1ZKHA

Solution structure of a human ubiquitin-like domain in sf3a1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
PVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a human ubiquitin-like domain in SF3A1
rcsb
molecule keywords Splicing factor 3 subunit 1
molecule tags Gene regulation
source organism Homo sapiens
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1zkhA00
3DVNV 2JZ3B 4B9KA 2KTFA 4FN2A 2M0XA 3HM6X 3SDLC 2L0FA 1NBFC 4GU2A 4MGZE 3L13A 4OVUA 4LJOB 5BO4B 1J0GA 2XK5B 3QJZA 1WGYA 5LXIB 1D3ZA 3EFUA 3CF6E 3H6NA 3QIJA 1Y8RC 2K8HA 2N4FA 5G55A 3KYCD 2IY1B 1EF5A 1RFAA 4X57B 1WM2A 4FULA 3QQ8B 5C1ZA 3ALBA 4G50A 4EEWA 4MELA 1YX6B 1HE8A 2XBBC 3M63B 5CX3A 1E8XA 2UYZB 1UBIA 1LFDA 2KJRA 2N9EB 1WGHA 3L10B 4NPNA 4IWPA 5L83A 5DPTA 3VH3B 1J8CA 2KC2A 2HE7A 3A33B 3N32A 4KDLB 3QK0A 4NQKE 2WWZA 3RD2A 1XT9B 3WAOA 2CHZA 1P0RA 4WWPA 5IAAC 4KIKA 1R4MI 2NR2A 3VH4B 2DYBA 1XD3B 1OQYA 3TJPA 3NY5A 3RUIB 1V81A 2MW5A 2J0KA 2HD5B 2N9PC 3VXWA 1LM8B 2L0TA 4URKA 4G11A 2FCSA 2K6QA 2KLGA 2G4SA 2EKEC 3WANA 3DOWA 3NHEB 3VFKA 2O2VB 1WIAA 2K25A 5E6OA 3N30A 2KQ7A 2JY6A 5LLIA 1E7UA 3RZWC 3ZLZA 3L08A 4W9IA 2KDIA 2JRHA 4IM0A 3VUYA 4NNJB 1UGMA 5D7GA 4FADA 3AI5A 3MTNB 5DCNA 4JGHB 2GBMA 4JL9A 4LCDE 4EZJA 1KM7A 1P9DU 3NZSA 3NZUA 2JXXA 2BYVE 2NVUI 3DVGX 1VCBA 4GB9A 4TQ1A 1A5RA 4HK2A 4J6IA 4W9LA 4I6LB 5D94A 1TGZB 1WXVA 2LGDA 3QC8B 3EHVA 2KMCA 3N3KB 2M8SA 3PLUA 2B3AA 3I3TB 2ZVOA 3QWZB 3QCAA 2FCNA 3APCA 2NBWB 3S2AA 4B95A 2R2QA 3B1LX 4ICVA 2KTRA 2I1JA 2KJ6A 2RSUA 1S3SG 4FJZA 4GSWA 1VD2A 4TV3A 4HDQA 1ZGUB 3QHTA 3W1YA 1V80A 2KFJA 2LASA 1TBEA 3U30A 3ZKJC 4NJ7A 3R3MA 4BVUC 2N9XA 4A20A 2FAZA 4M0WB 4DK5A 2IO2B 4BKSD 2K8CA 1M94A 1OEYJ 3T8MA 3RT3B 1EO6A 1WI0A 3KW5B 3M3JA 3PS6A 4GGQA 2IO0B 3RCZA 4DHZE 1V5OA 1GC6A 3UF8A 3VQIA 3PHWB 2MBEA 1WGRA 2CU1A 2LRWA 1GC7A 2YVCA 2KDEB 3BY4B 2MLBA 4ICUA 2D2QA 1E8YA 4W9FA 4MDKE 2C60A 4ZRIA 3A1QB 4PYUA 3APDA 4HPMB 3PRMB 3HK0A 3OJ3A 3L16A 4ANXA 4P7IA 2DENB 3APFA 3ML8A 1R4NI 1SE9A 4LDTB 1WXAA 2Z0DB 4FLHA 3SU8X 2PJHA 4YL8A 2BF8B 2NCNA 1WX7A 5AEKB 2KX3A 3OAWA 4AJYB 2V4LA 1TTNA 1WH3A 1WX8A 1WJ4A 2KWCA 1WE6A 2C7NB 2D11A 4DWFA 2Z59B 3PGEA 3QARA 2NBUA 2BWFA 1U4AA 2CHXA 3SHQA 1GG3A 2CS4A 4BKGA 4G0NB 5DPRA 2RR9A 2KTRB 3IFWB 2KDFB 4IG7B 2GBRA 1G6JA 1P3QU 2DAJA 5CHWA 1YQBA 2A5UA 2KMAA 2LGXA 3JSVA 1NDDA 1WMHA 1NI2A 1WXMA 3DCGA 3PRPB 1GNUA 4W9CA 5TR5A 4NQLB 1ISNA 1WGDA 2L3ZA 2PE6B 3T9LA 1V86A 1XQQA 2K39A 2KFKA 3M62B 3L17A 2JPHA 4WAAA 1L7YA 4MGIE 4N9F4 2BYFA 2K8BA 2KD0A 4EUTA 1V6EA 3AU5A 3KYDD 3RYTA 2O6VA 1T0YA 3CSFA 1SGHA 2LD9A 5CHVC 2QHOA 4KZCA 1UD7A 2IO1B 2M17A 2MP2A 5DPWA 2KDBA 2LGYA 3H9DA 1WJUA 2A4ZA 2CHWA 2G3QB 3R66C 2Y5BB 1RLFA 4FHJA 1WY8A 2D10A 4I6NB 1WE7A 2DAFA 3ZTDA 3A4SC 3Q3FA 2LXCA 3PVLA 2VRRB 4MGKE 3IVFA 2AEHA 5JH5C 5LXHA 2MBOA 1I35A 2J0JA 1YJ1A 3H1UA 1E90A 1JRUA 3KUZA 4XC2A 5EDSA 2PE9A 2JRIB 2KN5A 3VUWA 1V5TA 4IM2A 4MM3A 1EF1A 4MGYE 3ZNID 5KHQA 3QA8A 1YX5B 3PLVA 2LRUA 4DDGD 4ZDVA 3WALA 4HLEA 1X1MA 4WJQA 4TKNA 4F7ZA 3V62A 5L95C 3IHPC 1C1YB 4DHJB 3JSVB 2D3GA 1WMHB 3L54A 5GMVA 4GXBA 2LXAA 1WF9A 3NS8A 1ZKHA 3DBLI 1GUAB 2KFKB 3L0WB 5CHFA 2GBJA 2ZZPB 5E6NA 4DHJD 1WJNA 3K9OB 4KIKB 2DYOA 4W9JA 1Q0WB 2DHZA 2JT4B 2ZPYA 2J7QB 2O6VB 2EMTA 1F9JA 4PYZA 4II3B 5C23A 2M1MA 2RGFA 3GZNI 2UWQA 3Q3JA 2C7HA 3A9JA 3RZFA 1P98A 2CR5A 4KDIC 5IA7A 1E7VA 1OGWA 3DVNU 2MP2B 1UBQA 4IM3A 3DVGY 4AJWA 4EZLA 2L8JA 5CTRC 2EMSA 5AZHA 2NBVB 1WYWB 2R2OA 2KOXA 2BPSA 5JZEB 1FXTB 4CHKA 4EFOA 4W9DA 3OLMD 3SD5A 2GBKA 2LWPA 1TZ1A 3CSTA 3DDCB 4MSMB 3VAWA 1Z5SB 4EZKA 2FIDA 3WAMA 2KQSA 3PTFC 2MQJA 4DBGA 2ZPNA 3ZIMA 1H8CA 4K7UA 2KXJA 1OEYA 2BKFA 1AARA 2ZNVC 3R7RA 2J0MA 3V6CB 3VHTC 1J19A 3VVWB 1KOTA 1P1AA 2Z0EB 3TIXA 3DPDA 3MJWA 2MBQA 5KHOA 3C0RB 4GMVA 4PS8A 4AUQC 3ML9A 2RPQA 4BFRA 3AXCA 2WX1A 4JIOU 5AZGA 3PV1A 2OJRA 4FA6A 4LDTD 5E6PA 2K1FA 2FNJB 3JYUA 2MSED 4NY0A 2HJ8A 3DBRI 3PSEB 1WGGA 1Z2MA 4XZ4A 4GDLA 4F1SA 4HJKA 4IWQA 1QZEA 3UGBB 1E8ZA 1LXDA 3PZDA 1WX9A 3TCAA 1WZ0A 1Q5WB 2JWZA 3VTWA 2IZVB 3ZVVA 4BBNF 3VDZA 1YD8U 2KWUB 2N1WA 4FBJB 3A9JB 1WRDB 3KH0A 2NS5A 3DBHI 1IPGA 3ZRCA 1WJ6A 4KSLC 3WA0A 3ZDTA 4G3XB 3UIOB 2MWSB 4PS3A 2YLMA 1CMXB 2FCQA 3PHXB 2AL6A 4IUMB 4OVVA 4W9GA 4EOYA 2KHWB 2KX0A 3IG3A 2I1KA 4CYEA 4F8CB 5AZFA 1WR6E 2W9NA 4FJYA 3M95A 4IWOA 3V61A 1KLVA 2DZJA 2GOWA 4HXDA 2LVQA 3VTVA 1OTRB 1V2YA 2DZIA 5JHAA 3GOEA 4KSKC 4ZRKA 4NJ6A 4KV2A 3WIMA 3QX1A 1E5WA 4B6WA 3TMPB 2KO3A 4ZRJA 3TBLD 4ANWA 3ENEA 4KVGB 2N7EA 2L05A 3JVZX 1L2NA 2KKCA 4MSQB 3W1SC 1WZ3A 2LUEA 2DZKA 2ZCCA 4CO7A 2LZ6A 2WYQA 4WWNA 2WX0A 2MBHA 4RMAA 4ANUA 2C5LC 4M8NA 4W9HA 3ZNGC 4A3PA 3H7PA 1H4RA 3ZTCA 4AOFA 5J18A 3KUCB 2DYMA 1GJZA 1MG8A 3LJ3A 4GIVA 4BKSA 2FIFA 5D2MB 3ONSA 4TQ0A 2IY0B 3ZUNA 4HDOA 2LVPA 4GDLB 1K8RB 2CKHB 2DX5B 3U7DA 5JHBA 1KJTA 2ASQA 2JZZA 4W9EA 4JQWC 4RM9A 2LI5A 4LJPB 1RRBA 4E74A 2WDTB 4JLCA 2KK8A 2PEAA 4TUUA 2MCNB 4DXAB 1SIFA 4IW0A 4NAWA 3X23A 4HWIB 2GMIC 4DHZB 3JW0X 3UINB 2AL3A 4ZYNA 4BKTA 4BOSC 2L7RA 4WWOA 2PPHA 1S1QB 3AULA 2MBBB 2BYEA 4ASWC 2JUOA 3ECIA 3A1QA 4WJOA 4E3CA 2ZEQA 4E71A 3MHSD 3A4RA 4DDID 4GDKA 2BWES 2REXA 3DQVA 4IC7B 3EECA 3LDZE 2V1YA 1UZXB 4II2B 3OJ4B 2KWVB 2DZMA 3ZNHB 3PREA 3VTUA 2KLCA 3UIPB 3VUXA 3WAPA 1IP9A 1E8WA 2NPTA 4GN1A 2BGFA 1WR1A 2N7DA 2XEWA 3A9KA 4I6PA 2JF5A 1UELA 2KC1A 4MJSA 3BINA 4PS7A 4K1RB 2G45B 3IBEA 3HIZA 4WJPA 1YIWA 3HHMA 2KNBA 2O6VD 4XX5A 1WXSA 3O65B 2JVCA 2KZRA 3DBSA 1C3TA 2RD0A 1RAXA 2C9WB 1EUVB 3HM3A 2M4NA 2N1VA 2XK5A 2KJHB 1IYFA 2C7MB 3K9PB 2IYDB 3H7PB 5FR6A 3PT2B 2KVRA 4KZ0A 3QAQA 4EKUA 3ZNZB 4HCNB 3KVFB 3U8ZA 1V9JA 2FUHB 2AWTA 3KUDB 3B08A 2V3SA 4K7WA 2ZJDA 3NOBA 3V60A 1ZW7A 1UH6A 4AP4C 2KANA 5HKHA 1PQSA 1V49A 4M8MA 2D07B 3ZDMC 3D32A 1WM3A 2OOBB 5DPSA 3V6EB 3UQBA 3CMMB 4NAWB 3TL5A 1Q1OA 2IBIB 3ZRFA 4AWJA 2HTHA 3P2BA 4MEMA 1LQBA 5G2NA 4A3OA 3PPAA 4K7SA 4FHKA 3ZO5B 4FJVB 2ZNVB 4W9KA 2MA9B 4HVBA 4K81A 2AYOB 2L76A 4ANVA 5J17A 4GDKB 2MRPA 4MH0E 4WQOB 1WFYA 3X0WA 1I42A 2GBNA 3ZW3A 3W1SA 5D6JB 2MX2A 3PRZA 2ZCBA 2LVOA 4HCPB 3B0AA 3UQAA 1BT0A 4RM8A 4GOCA 4BBNC 2BKRB 2IO3B 2LJ5A 3AU4A 2L00B 2NPTB 4WJNA 2O2VA 5J2RA 3A9KB 2ZVNA 4HPLB 3R7QA 4MJSB 2FCMA 3H7SA 3EC8A 2G4DB 3RULA 4BOZB 2K6DB
chains in the Genus database with same CATH superfamily
2JYEA 3HM6X 4YWGG 3L13A 1WGYA 3EFUA 3H6NA 1LGRA 3IAS1 2K8HA 1WM2A 4FULA 3QQ8B 4L1BA 1AWDA 1TY0A 4B0MA 2N9EB 1E9MA 1WGHA 1PGBA 2BS4B 5DPTA 3VH3B 1J8CA 3N32A 3A33B 4WWMA 3WAOA 1NYRA 1EWCA 1TY2A 4WWPA 1DOXA 4XWWA 1F77A 1OQYA 3TJPA 3T3OA 3U52E 2KT7A 1JWUD 2FCSA 2G4SA 2WXQA 5FKAC 3Q6BA 3EUB2 3RPFC 1J7CA 2O2VB 2K25A 3N30A 3L08A 1V97A 2WXJA 4NNJB 1SIJA 1UGMA 4RCOA 4MACA 4LCDE 4EZJA 1PDXA 3NZUA 2JXXA 3AEEB 2NVUI 1VCBA 4GB9A 4HK2A 3U4EG 3QC8B 2KMCA 2BB6A 2M8SA 1NYQA 3BVGA 1RM6C 2MJ3A 3QCAA 3AE7B 3LYYA 4UDUC 3B1LX 1SE3A 2I1JA 4B0EA 1S3SG 3NVYA 4GSWA 4TV3A 3BWUD 5AUKA 3W1YA 1V80A 2LASA 4P16A 3ZKJC 2N9XA 2IO2B 4BKSD 2K8CA 2LGIA 3RT3B 1FD6A 3RCZA 4DHZE 3BYTB 1V5OA 3VQIA 3PHWB 2LEKA 1GC7A 3BY4B 4ICUA 2C60A 3APDA 3HK0A 3OJ3A 4ANXA 2SAKA 4XDDA 2Z0DB 3SU8X 2PJHA 4YL8A 3OAWA 2YEPB 1KRHA 1TTNA 1VJKA 5T8IA 4HJGE 1WJ4A 1L6VA 2ON8A 2VZKD 2JWUA 2BWFA 1U4AA 2RDHA 2N7JA 5DPRA 2RR9A 4DXFA 3IFWB 2QEJC 1D5MC 3U2SC 5FK9C 1EM7A 1G6JA 1P3QU 2PVOD 3JSVA 3R8BA 1WMHA 5TR5A 1ISNA 3T9LA 5BYSA 2PW9A 1L7YA 4MGIE 1IGDA 2K8BA 4XYCA 1V6EA 1PYWD 1AYFA 2QDFA 3KYDD 3RYTA 1OFFA 4ZHPA 2WNMA 1FO4A 3CSFA 3AE9B 2DNFA 4KZCA 1UD7A 2KDBA 3MC9A 1WJUA 3MHZA 2R61A 3R66C 1UNSA 1YN5A 4I6NB 3ZTDA 3NVVA 3IVFA 2AEHA 5LXHA 1FIQA 1E90A 1JRUA 1P7EA 2KN5A 3UQAA 4MM3A 1WGKA 1VR9A 2LRUA 4DDGD 3WALA 4HLEA 1X1MA 2IGHA 4WJQA 4TKNA 3V62A 4N6EB 1GB4A 2LXAA 1WF9A 2W54A 1ZKHA 2GBJA 1JWSD 4DHJD 1WJNA 2TSSA 3KWVA 4W9JA 2DHZA 2ZPYA 3GZNB 2O6VB 2OJWA 2M1MA 2C7HA 4A8XC 2DWQA 1OGWA 2L8JA 5AZHA 2KOXA 4CHKA 3AEBB 3KLSX 4S17A 2LWPA 3DDCB 2AQ1B 3CSTA 3VAWA 4EZKA 2KQSA 3VR8B 2MHJA 4K7UA 2KXJA 1OEYA 3VHTC 1AARA 3R7RA 1KOTA 1KFYB 4FXCA 3C0RB 4GMVA 3ML9A 2N9LA 5EE9A 3AXCA 2WX1A 5AZGA 4BFRA 1HA5A 3JYUA 4NY0A 2HJ8A 1ZOYB 1C4CA 1FFUA 5TSSA 4IWQA 1QZEA 3PZDA 3TCAA 1SBBB 2G9HD 1YD8U 3A9JB 1YN3A 2NS5A 3DBHI 3ZRCA 3ZDTA 3UIOB 1IGCA 2INCC 4PS3A 2I1KA 4IWOA 3V61A 1KLVA 1B9RA 3WIMA 5H92C 2KO3A 4ANWA 2L05A 2AQ3B 2W82A 2Y3AA 1L2NA 4MSQB 3W1SC 2LUEA 3AM9A 1GPXA 4WWNA 1JCKB 4ANUA 2MBHA 4RMAA 2C5LC 3H7PA 4AOFA 2DYMA 1MG8A 5AUIA 2WXKA 4WAFA 2OEDA 3ONSA 2DX5B 2CKHB 4A55A 4JQWC 4E74A 4JPSA 1F52A 1PUTA 1ESFA 4BOSC 2PTLA 4WWOA 4C4VA 1S1QB 3AULA 2Y5PA 3ECIA 1UF0A 2QJLA 2NTSA 4GDKA 2REXA 4XE0A 1KF6B 4IC7B 2V1YA 1D6EC 2V4IB 3VTUA 3PO0A 1IP9A 1FCLA 3A9KA 2KC1A 1SB3C 3BINA 4DQOC 4K1RB 2G45B 3IBEA 3NG0A 1YIWA 3AN1A 3O65B 1C3TA 2KZRA 3DBSA 3B2GA 1RAXA 2PLPA 2N1VA 1EU4A 1IYFA 3K9PB 2BT6A 1CQVA 3ZNZB 3KVFB 3U8ZA 1HXYD 4R3DA 2JXTA 2AWTA 3Q3MC 3W9CB 1T0QC 3ETRA 2WDRB 3ZDMC 3D32A 5DPSA 1Q1OA 1SF0A 3P2BA 4LTUA 1LQBA 3ZGZA 1JQ4A 4K81A 3P4SB 5D3DA 4ANVA 3AB5A 3X0WA 1WFYA 1PGAA 3ZW3A 2LVOA 1BT0A 4ZRQA 2WU5B 1F0ZA 4GOCA 2ZVNA 4MJSB 4HPPA 2WU2B 1J0GA 1FEHA 2GLSA 3FKYA 3DVNV 2JZ3B 4B9KA 2KTFA 1HEZE 2BTEA 4GU2A 1VRAB 4MGZE 4AS1A 3GB1A 2XK5B 1D3ZA 3CF6E 3HUIA 2J4XA 3NUHB 1JWAD 2OHFA 1SJHD 1EF5A 3AECB 4X57B 3ZJUA 3ALBA 4G50A 1YX6B 3M63B 4KKIA 1UBIA 1KLUD 2KJRA 4IWPA 3AE4B 4RGOS 2KC2A 2HE7A 2RPVA 4NQKE 3RD2A 2CHZA 1T5XD 1P0RA 1ZXHA 4A90A 1QF6A 3AE2B 2K9XA 2QSDA 3VRAB 4CQNA 2DYBA 2INDC 1XD3B 1V81A 2MW5A 3VXWA 1MFWA 2L0TA 4IKGA 2K6QA 3DOWA 4RGNA 2KQ7A 1EWYC 3ZLZA 3RZWC 4J3OD 4YSXB 2KDIA 4IM0A 3OWEB 5D7GA 3AI5A 1YNTE 1KM7A 3N9YC 2KYWA 3NZSA 4YSYB 1VZ8A 3GS2A 1A5RA 1TGZB 4US8A 2N9KA 3I3TB 3Q3NC 1L4ZB 2KTRA 2KJ6A 2WXGA 1XF5L 4HDQA 3LB8C 3PZ7A 4O1NA 5HI1A 4NJ7A 3R3MA 3C8YA 4A20A 2FAZA 4M0WB 3KWLA 3URYA 1OEYJ 1WI0A 3J9CA 4YSZB 3UF8A 2BW2A 2WXLA 2PVGC 4RH6A 2YVCA 2JZPA 2KMMA 1R4NB 4P7IA 3MP9A 2DENB 3APFA 4LDTB 2L83A 5BYRA 1WX7A 3CIRB 4AJYB 1JROA 1WX8A 1CZPA 2WXNA 1FRRA 2H89B 3SHQA 1GG3A 4KGRA 2KDFB 4IG7B 1N62A 5CHWA 4WH4A 1A70A 3R2IA 4W9CA 1WXMA 3DCGA 3HVDA 1WGDA 2L3ZA 1V86A 1XQQA 1TJEA 2Y5CA 2KFKA 3M62B 3L17A 1HZ6A 4N9F4 3AU5A 1Q10A 1T0YA 2I38A 4KGTA 4H2AA 1IBXA 2QHOA 2CJNA 5DPWA 2IO1B 1MG4A 1YN4A 2A4ZA 2KN4A 2G3QB 1T0SC 1XLQA 1WE7A 2DAFA 3Q3FA 2BBCA 2LXCA 2VRRB 2EELA 1I35A 2J0JA 2PE9A 3VUWA 1V5TA 5KHQA 1EF1A 2NTTA 1YOVB 3AE1B 5L95C 4NAMA 1NENB 3NRZA 3DBLB 3NS8A 1B1ZA 2LGSA 3NZ3A 1GUAB 5CHFA 1SE2A 3K9OB 4KIKB 4OZBA 2BYTA 2EMTA 4NZLB 2RGFA 1QOAA 3GZNI 2HDEA 3UI3A 3PZ8A 3RZFA 3P42A 4GLSC 3TUOA 5IP4D 1E7VA 3DVNU 2MP2B 4LNNA 5CTRC 2R2OA 5JZEB 4LNIA 4IDIA 1XXGA 3KQ4A 3SD5A 2GBKA 4WIPA 1TZ1A 4KGSA 1C4PA 1QT9A 5HHDG 2MQJA 2SEBD 2ZPNA 3AV8A 2KACA 1PGXA 1NEKB 4A9AA 2J53A 2X8XX 3TIXA 1N6ZA 3FILA 4FA6A 1UWMA 3AMZA 3RNBC 1RYJA 3DHGC 3PSEB 1WGGA 1V1PB 4XZ4A 4GDLA 3W2DA 1E8ZA 1UGJA 2JYTA 4C56C 3TEWA 4C7ZA 1WX9A 2PMVA 3VTWA 2JWZA 2N1WA 3KH0A 2GB1A 1WJ6A 4KSLC 4G3XB 1CMXB 3IXSA 1N5WA 2KHWB 2KX0A 3IG3A 4CYEA 1PFDA 5AZFA 1N63A 3N1YC 2LVQA 1K51A 5JHAA 3GOEA 4KSKC 3EGRA 1F2RC 1JW9D 3TMPB 4ZRJA 2WP9B 3ENEA 3RNEC 3JVZX 1WZ3A 1MPEA 2ACZB 2LZ6A 1F1HA 4M8NA 1UUPA 1QQRA 3ZNGC 3ZQ4A 3ZTCA 3LJ3A 2M19A 2FIFA 4HDOA 2LVPA 1K8RB 1YMHE 2WXHA 5JHBA 2JZZA 1T0RC 3BVMA 4M0WA 4K3CA 2PEAA 1STEA 4DXAB 1WXQA 4IW0A 4NAWA 3X23A 3JW0X 3UINB 1XEEA 1AW7A 2L7RA 2MJEA 2PPHA 2JUOA 4WJOA 4E3CA 2ZEQA 2BWES 1C4AA 1TS2A 3OJ4B 2DZMA 4YTNB 3PREA 4S0RA 1JRPA 2FBWB 3WAPA 1E8WA 2NPTA 4GN1A 3AH7A 2BGFA 2XEWA 2N7DA 1UELA 4WJPA 4KKJA 5EE3A 1YJIA 2RD0A 1ZXIA 1KTKA 1TZOA 2IYDB 4YTMB 2LUMA 2KVRA 1OQQA 4L23A 4DXGA 5HFYA 5D3IB 2CJOA 2FUHB 3NVZA 3B08A 2I2YA 2ZJDA 3NOBA 3V60A 1DOYA 3UQBA 2LHDA 3BK2A 3CMMB 2IBIB 5BYQA 1K52A 5G2NA 3O13A 4MT5A 2JX5A 4FHKA 1LO5D 4FJVB 5J17A 1I42A 2BS3B 3W1SA 3PRZA 4AQ7A 2KDMA 1D4BA 4RM8A 4MH8A 2IO3B 2VZKB 5J2RA 4WJNA 2O2VA 3R7QA 1FM0D 2FCMA 3EC8A 1SJED 4BOZB 1XLOA 4FN2A 4D2KA 1QOBA 2L0FA 5BO4B 5FR3A 2EKIA 3QIJA 2K5PA 1Y8RC 3KYCD 1RFAA 1WSPA 4JWSC 4EEWA 5LNK1 3HVZA 1L4DB 1HE8A 3Q8CA 1E8XA 1I4GA 1LFDA 5L83A 3DWMA 1VZ6A 4PT5A 1R4MB 3QK0A 2WWZA 2E3TA 4KIKA 3RNFC 2NR2A 1F2RI 4OHJA 3RUIB 4OW0A 1TKEA 2J0KA 1C77A 2N9PC 1LM8B 4URKA 3SFDB 3WANA 4HKZE 1WIAA 4NJCA 1JWMD 3SFEB 5LLIA 1E7UA 2JRHA 3AE8B 4FADA 1XO3A 3MTNB 5DCNA 4JGHB 3CWIA 2GBMA 3R2TA 2BYVE 2AX5A 4HEA1 3DVGX 4TQ1A 4TSSA 2J52A 4J6IA 4W9LA 5IKCM 5D94A 1WXVA 2LGDA 3EHVA 2KWDA 2B3AA 3QWZB 5HG2A 1DYQA 1YQ3B 1FRDA 4B95A 2NBWB 3S2AA 2ZW0A 1N61A 4HRSA 2N0SB 4ICVA 1MJDA 1TT5B 3E56A 1L0YB 4M02A 4OZCA 2L32A 5I4DA 4FJZA 1VD2A 4N58A 1ZGUB 1VZ7A 3QHTA 1TBEA 3U30A 5E6JA 2W55A 2ZW1A 3Q8FA 3KW5B 4GGQA 3M3JA 1ROEA 2AQ2B 2IO0B 1GC6A 4M01A 2K3UA 2CU1A 3ABVB 2D2QA 1E8YA 4PYUA 5IN7A 3ML8A 1R4NI 1AN8A 1WXAA 2BF8B 1ZUD2 2NCNA 5AEKB 1D5XC 2V4LA 1WH3A 3RNCC 2C7NB 2Z59B 3BK1A 2YEPF 4N59A 2JSVX 2CS4A 4BKGA 2DBYA 2XN9C 4G0NB 1BUIC 4LLGM 4K3BA 1M4VA 1FFVA 1NDDA 3L4PA 1QOGA 1E7PB 1JALA 2LHEA 4P6VF 4C80A 2PE6B 2K39A 2RMMA 4WAAA 5BMGA 4EUTA 2O6VA 2LD9A 5CHVC 3Q8EA 1HTQA 4ZYSA 3Q3OC 2M17A 2LGYA 3H9DA 3AE3B 1GOZA 1RLFA 2BQQA 3PVLA 4A6QA 1TKYA 3BVZA 3C19A 3KUZA 3V05A 2FE8A 5EDSA 2GI9A 2JRIB 2V3PA 3QA8A 2ICIA 3PLVA 2H88B 3TSSA 4F7ZA 3NS1A 1C1YB 3JSVB 3N1XC 1WMHB 1HTOA 3DBLI 1XLPA 3E9SA 2ZZPB 3GE8C 2DYOA 2J7QB 2QMTA 3W5VB 4PYZA 5C23A 2IGGA 2UWQA 2BS2B 3A9JA 1P98A 2CR5A 4KDIC 5IA7A 4IM3A 1UBQA 3DVGY 2WXOA 2KVZA 1WYWB 1IUEA 2BPSA 4TMAB 4MSMB 3Q8BA 2W3SA 3SR6A 3RNAC 2PKOA 3DHIC 3BZDB 2J0MA 1C9FA 2RDBC 1C79A 2B76B 2Z0EB 2MBQA 3DPDA 3MJWA 5KHOA 4AUQC 3RI7C 2RPQA 1XCTL 1KH0A 2OJRA 1YJJA 2K1FA 2FNJB 3DBRB 1FXIA 2GRIA 3Q2AC 4F1SA 4HJKA 1LXDA 2L1AA 4XWTA 1SE4A 1Q5WB 1WZ0A 3P4RB 2IZVB 3ZVVA 4BBNF 3BYYB 4FBJB 1WRDB 1IPGA 1QLBB 3WA0A 1I7HA 2AL6A 2ONQA 4ITKA 4JE3B 2W9NA 3M95A 2GOWA 5C3JB 3VTVA 1JWBD 2INPE 2DZIA 4ZRKA 4NJ6A 4KV2A 4KVGB 4RGMA 3Q14C 2KKCA 1Y56A 3RNGC 2DZKA 2ZCCA 2QCZA 3I5JC 4P1BC 4A3PA 1MHHE 2Q5WD 1H4RA 1ZDXA 5J18A 1GJZA 1E0ZA 5JXVA 4TQ0A 2IY0B 3ZUNA 2HJ1A 1XLNA 3OG5A 1KJTA 2ASQA 1GAQB 4W9EA 3B2FA 4RM9A 4WURA 4JLCA 2KK8A 4TUUA 2MCNB 4HWIB 2GMIC 4DHZB 3MC8A 2AL3A 4ZYNA 4BKTA 2MBBB 2BYEA 5C2TB 4ASWC 3T3NA 4E71A 4EE2A 4DDID 1MI0A 4RGTA 1J7AA 3EECA 3LDZE 1UZXB 2KWVB 1NVID 3ZNHB 3FAHA 1WR1A 1ACCA 2WXPA 4MJSA 2O6VD 3SEBA 2D3CA 2M4NA 2XK5A 2WXFA 2IJ0A 2C7MB 3H7PB 5FR6A 3PT2B 4KZ0A 2KAJA 1DOIA 5IOIA 4HKQA 3QAQA 4EKUA 2D3BA 3FC4A 4ZRPA 1HQRD 3WCQA 2V3SA 4K7WA 3V3XA 2QC8A 4OZAA 4AP4C 1UH6A 2KANA 5HKHA 2LJIA 2IDYA 4M8MA 1WM3A 2OOBB 2BVCA 3TL5A 3ZRFA 4AWJA 2PIAA 2HTHA 4MEMA 4A3OA 4C4VB 3ZO5B 2ZNVB 4W9KA 4HVBA 2AYOB 2L76A 1BXTA 4GDKB 4WQOB 2JU6X 2GBNA 5D6JB 2MX2A 2ZCBA 2WXMA 4ARIA 4LNOA 3AU4A 1BMLC 3A9KB 2K6DB 3BIID 2WLBA 1SSNA 1T6BX 2LFIA 2M0AA 2M0XA 1NBFC 2NMQA 3SDLC 4ZOHC 4OVUA 4LJOB 3ZJTA 1ZP0B 5LXIB 3QJZA 1L5PA 1XCQL 4Q2JA 2N4FA 5G55A 2IY1B 1N5XA 5C1ZA 1WYGA 1E10A 4MELA 2XBBC 3I9V1 5CX3A 2UYZB 4NPNA 3L10B 4KDLB 1XT9B 5IAAC 4LNFA 2G1EA 1R4MI 3VH4B 3EFCA 3NY5A 4US9A 3EA6A 2HD5B 3RMKC 1P7FA 2D5GA 1TKGA 4G11A 2KLGA 2EKEC 3NHEB 1UWXA 3VFKA 2D3AA 1RWSA 3RULA 5E6OA 2JY6A 1ZPSA 3DHHC 1WWTA 4W9IA 3VUYA 3RN9C 5G5HA 3I63C 4JL9A 1P9DU 2MJDA 2RDGA 2E6XA 4I6LB 3W5UB 3Q69A 2LMCA 3N3KB 2WXRA 3PLUA 2ZVOA 1I4HA 2FCNA 4LNKA 4ACFA 3APCA 2R2QA 3P4PB 3GP7A 1MVKA 1FXAA 3VR9B 3VRBB 2L52A 2RSUA 4YT0B 2Z8LA 1K53A 2KFJA 2K22A 4BVUC 4DK5A 1M94A 3T8MA 1EO6A 2VH1A 3PS6A 2WXIA 2MH7A 2MBEA 1WGRA 2LRWA 2KDEB 1DGJA 2MLBA 4W9FA 4MDKE 4ZRIA 3A1QB 4HPMB 3PRMB 3L16A 3IT6B 3MFGA 2WS3B 1SE9A 4ARCA 4FLHA 3AE6B 2KX3A 1ENFA 1SEBD 1QOFA 2KWCA 1WE6A 2V9HA 2D11A 4DWFA 3PGEA 3QARA 2QIEB 2KQ4X 2NBUA 1J7BA 3IAM1 3ZXVA 2CHXA 5BMHA 2KTRB 4C7YA 2GBRA 2DAJA 1YQBA 1I4RA 2A5UA 2KMAA 2LGXA 4RNAA 2M56B 1NI2A 1YQ4B 3PRPB 1GNUA 4NQLB 1TS4A 2FUG1 2W3RA 2JPHA 2BYFA 1TS3A 1FNVA 2KD0A 4REZA 3TEXA 4C00A 3AEDB 1V8CA 1HZ5A 1SGHA 1SXTA 4RF1A 2WDVB 1C76A 1L6UA 2MP2A 1V1OA 2CHWA 1MHXA 5GXGB 4YXDB 2Y5BB 1OQRA 4FHJA 3AEGB 1WY8A 2D10A 3A4SC 4MGKE 5JH5C 1K50A 2MBOA 1YJ1A 3H1UA 4XC2A 1EU3A 3MC0B 1T3QA 2IGDA 4IM2A 4MGYE 3ZNID 1N60A 1YX5B 4ZDVA 1D5ZC 3ZYYX 1FNWA 4P1CC 3IHPC 4DHJB 2D3GA 1WRIA 3L54A 5GMVA 4GXBA 3AEFB 3N20C 2KFKB 3L0WB 4YTPB 1I4QA 4ZHOA 5E6NA 1V1PA 4XDCA 1Q0WB 2JT4B 1F9JA 4II3B 4JWUC 3Q3JA 1IBXB 4EZLA 4AJWA 3TEZA 2EMSA 5EE0A 2NBVB 1FXTB 4EFOA 4W9DA 3OLMD 2VH2A 4QAYA 1Z5SB 2FIDA 3WAMA 1QILA 3PTFC 4DBGA 3ZIMA 1H8CA 5EE1A 2BKFA 2ZNVC 3LXFA 3VVWB 3V6CB 1J19A 1P1AA 3GE3C 1C78A 4PS8A 2K0PA 4JIOU 3PV1A 4LDTD 5E6PA 2BB5A 1VDVA 4PK1A 2MSED 3RFZB 3NVWA 3DBRI 3P63A 1Z2MA 4KX6B 3UGBB 3VDZA 1L0VB 2KWUB 3DBHB 2X38A 1L0XB 1GB1A 2MWSB 2YLMA 3PHXB 2FCQA 4IUMB 4W9GA 4OVVA 5H8YE 4EOYA 4WQMA 4F8CB 1WR6E 4FJYA 4M00A 1TIFA 2DZJA 4HXDA 5G5GA 2IPKD 1OTRB 1V2YA 4USAA 3U7ZA 1ZDVA 1VLBA 3QX1A 1E5WA 1R7SA 4B6WA 3TBLD 1TS5A 4JX1C 2N7EA 3P1MA 2HTME 4CO7A 1KLGD 3FILB 2WYQA 2WX0A 1E6EB 5MPOA 4W9HA 1I4XA 1NI3A 2WDQB 4L2YA 3KUCB 1FPYA 4GIVA 4BKSA 5D2MB 1CK1A 3U7DA 4GDLB 2WQYB 1I4PA 3IT4B 2LI5A 4LJPB 1RRBA 3B9JA 3AE5B 2WDTB 1SIFA 1ZE3D 3TEYA 3A1QA 3MHSD 3A4RA 2WGSA 3DQVA 5IO9A 3H8HA 3P4QB 3N1ZC 4II2B 3DWGC 2KLCA 3UIPB 3VUXA 1FCCC 4I6PA 3AEAB 2JF5A 4PS7A 4RF0A 3HIZA 1FNUA 3HHMA 2KNBA 4XX5A 1WXSA 2JVCA 2INNE 2UU7A 4RFBA 2C9WB 1EUVB 3HM3A 4BAXA 2KJHB 1FMAD 3HRDD 4LK0M 4IOIE 4HCNB 1V9JA 5BMIA 3Q8AA 3KUDB 4BZAA 4MM3B 2QILA 1ZW7A 1JMLA 1TYGB 1PQSA 1V49A 2D07B 3V6EB 4XGAB 4NAWB 2DLBA 1RFKA 2XNAC 3NJTA 3PPAA 4K7SA 1ET9A 2CU3A 1CJEA 3ZJVA 3MJ5A 2MA9B 3I57A 2MRPA 2J42A 4MH0E 4OVZA 3ZXRA 4HCPB 3B0AA 2V3NA 4HROA 1QKZA 1ET6A 4BBNC 2BKRB 2LJ5A 2V0GA 2L00B 2NPTB 2MEKA 2JQRB 4HPLB 3H7SA 2G4DB 2WHIA
chains in the Genus database with same CATH topology
3DVNV 2JZ3B 4B9KA 2KTFA 4FN2A 2M0XA 3HM6X 3SDLC 2L0FA 1NBFC 4GU2A 4MGZE 3L13A 4OVUA 4LJOB 5BO4B 1J0GA 2XK5B 3QJZA 1WGYA 5LXIB 1D3ZA 3EFUA 3CF6E 3H6NA 3QIJA 1Y8RC 2K8HA 2N4FA 5G55A 3KYCD 2IY1B 1EF5A 1RFAA 4X57B 1WM2A 4FULA 3QQ8B 5C1ZA 3ALBA 4G50A 4EEWA 4MELA 1YX6B 1HE8A 2XBBC 3M63B 5CX3A 1E8XA 2UYZB 1UBIA 1LFDA 2KJRA 2N9EB 1WGHA 3L10B 4NPNA 4IWPA 5L83A 5DPTA 3VH3B 1J8CA 2KC2A 2HE7A 3A33B 3N32A 4KDLB 3QK0A 4NQKE 2WWZA 3RD2A 1XT9B 3WAOA 2CHZA 1P0RA 4WWPA 5IAAC 4KIKA 1R4MI 2NR2A 3VH4B 2DYBA 1XD3B 1OQYA 3TJPA 3NY5A 3RUIB 1V81A 2MW5A 2J0KA 2HD5B 2N9PC 3VXWA 1LM8B 2L0TA 4URKA 4G11A 2FCSA 2K6QA 2KLGA 2G4SA 2EKEC 3WANA 3DOWA 3NHEB 3VFKA 2O2VB 1WIAA 2K25A 5E6OA 3N30A 2KQ7A 2JY6A 5LLIA 1E7UA 3RZWC 3ZLZA 3L08A 4W9IA 2KDIA 2JRHA 4IM0A 3VUYA 4NNJB 1UGMA 5D7GA 4FADA 3AI5A 3MTNB 5DCNA 4JGHB 2GBMA 4JL9A 4LCDE 4EZJA 1KM7A 1P9DU 3NZSA 3NZUA 2JXXA 2BYVE 2NVUI 3DVGX 1VCBA 4GB9A 4TQ1A 1A5RA 4HK2A 4J6IA 4W9LA 4I6LB 5D94A 1TGZB 1WXVA 2LGDA 3QC8B 3EHVA 2KMCA 3N3KB 2M8SA 3PLUA 2B3AA 3I3TB 2ZVOA 3QWZB 3QCAA 2FCNA 3APCA 2NBWB 3S2AA 4B95A 2R2QA 3B1LX 4ICVA 2KTRA 2I1JA 2KJ6A 2RSUA 1S3SG 4FJZA 4GSWA 1VD2A 4TV3A 4HDQA 1ZGUB 3QHTA 3W1YA 1V80A 2KFJA 2LASA 1TBEA 3U30A 3ZKJC 4NJ7A 3R3MA 4BVUC 2N9XA 4A20A 2FAZA 4M0WB 4DK5A 2IO2B 4BKSD 2K8CA 1M94A 1OEYJ 3T8MA 3RT3B 1EO6A 1WI0A 3KW5B 3M3JA 3PS6A 4GGQA 2IO0B 3RCZA 4DHZE 1V5OA 1GC6A 3UF8A 3VQIA 3PHWB 2MBEA 1WGRA 2CU1A 2LRWA 1GC7A 2YVCA 2KDEB 3BY4B 2MLBA 4ICUA 2D2QA 1E8YA 4W9FA 4MDKE 2C60A 4ZRIA 3A1QB 4PYUA 3APDA 4HPMB 3PRMB 3HK0A 3OJ3A 3L16A 4ANXA 4P7IA 2DENB 3APFA 3ML8A 1R4NI 1SE9A 4LDTB 1WXAA 2Z0DB 4FLHA 3SU8X 2PJHA 4YL8A 2BF8B 2NCNA 1WX7A 5AEKB 2KX3A 3OAWA 4AJYB 2V4LA 1TTNA 1WH3A 1WX8A 1WJ4A 2KWCA 1WE6A 2C7NB 2D11A 4DWFA 2Z59B 3PGEA 3QARA 2NBUA 2BWFA 1U4AA 2CHXA 3SHQA 1GG3A 2CS4A 4BKGA 4G0NB 5DPRA 2RR9A 2KTRB 3IFWB 2KDFB 4IG7B 2GBRA 1G6JA 1P3QU 2DAJA 5CHWA 1YQBA 2A5UA 2KMAA 2LGXA 3JSVA 1NDDA 1WMHA 1NI2A 1WXMA 3DCGA 3PRPB 1GNUA 4W9CA 5TR5A 4NQLB 1ISNA 1WGDA 2L3ZA 2PE6B 3T9LA 1V86A 1XQQA 2K39A 2KFKA 3M62B 3L17A 2JPHA 4WAAA 1L7YA 4MGIE 4N9F4 2BYFA 2K8BA 2KD0A 4EUTA 1V6EA 3AU5A 3KYDD 3RYTA 2O6VA 1T0YA 3CSFA 1SGHA 2LD9A 5CHVC 2QHOA 4KZCA 1UD7A 2IO1B 2M17A 2MP2A 5DPWA 2KDBA 2LGYA 3H9DA 1WJUA 2A4ZA 2CHWA 2G3QB 3R66C 2Y5BB 1RLFA 4FHJA 1WY8A 2D10A 4I6NB 1WE7A 2DAFA 3ZTDA 3A4SC 3Q3FA 2LXCA 3PVLA 2VRRB 4MGKE 3IVFA 2AEHA 5JH5C 5LXHA 2MBOA 1I35A 2J0JA 1YJ1A 3H1UA 1E90A 1JRUA 3KUZA 4XC2A 5EDSA 2PE9A 2JRIB 2KN5A 3VUWA 1V5TA 4IM2A 4MM3A 1EF1A 4MGYE 3ZNID 5KHQA 3QA8A 1YX5B 3PLVA 2LRUA 4DDGD 4ZDVA 3WALA 4HLEA 1X1MA 4WJQA 4TKNA 4F7ZA 3V62A 5L95C 3IHPC 1C1YB 4DHJB 3JSVB 2D3GA 1WMHB 3L54A 5GMVA 4GXBA 2LXAA 1WF9A 3NS8A 1ZKHA 3DBLI 1GUAB 2KFKB 3L0WB 5CHFA 2GBJA 2ZZPB 5E6NA 4DHJD 1WJNA 3K9OB 4KIKB 2DYOA 4W9JA 1Q0WB 2DHZA 2JT4B 2ZPYA 2J7QB 2O6VB 2EMTA 1F9JA 4PYZA 4II3B 5C23A 2M1MA 2RGFA 3GZNI 2UWQA 3Q3JA 2C7HA 3A9JA 3RZFA 1P98A 2CR5A 4KDIC 5IA7A 1E7VA 1OGWA 3DVNU 2MP2B 1UBQA 4IM3A 3DVGY 4AJWA 4EZLA 2L8JA 5CTRC 2EMSA 5AZHA 2NBVB 1WYWB 2R2OA 2KOXA 2BPSA 5JZEB 1FXTB 4CHKA 4EFOA 4W9DA 3OLMD 3SD5A 2GBKA 2LWPA 1TZ1A 3CSTA 3DDCB 4MSMB 3VAWA 1Z5SB 4EZKA 2FIDA 3WAMA 2KQSA 3PTFC 2MQJA 4DBGA 2ZPNA 3ZIMA 1H8CA 4K7UA 2KXJA 1OEYA 2BKFA 1AARA 2ZNVC 3R7RA 2J0MA 3V6CB 3VHTC 1J19A 3VVWB 1KOTA 1P1AA 2Z0EB 3TIXA 3DPDA 3MJWA 2MBQA 5KHOA 3C0RB 4GMVA 4PS8A 4AUQC 3ML9A 2RPQA 4BFRA 3AXCA 2WX1A 4JIOU 5AZGA 3PV1A 2OJRA 4FA6A 4LDTD 5E6PA 2K1FA 2FNJB 3JYUA 2MSED 4NY0A 2HJ8A 3DBRI 3PSEB 1WGGA 1Z2MA 4XZ4A 4GDLA 4F1SA 4HJKA 4IWQA 1QZEA 3UGBB 1E8ZA 1LXDA 3PZDA 1WX9A 3TCAA 1WZ0A 1Q5WB 2JWZA 3VTWA 2IZVB 3ZVVA 4BBNF 3VDZA 1YD8U 2KWUB 2N1WA 4FBJB 3A9JB 1WRDB 3KH0A 2NS5A 3DBHI 1IPGA 3ZRCA 1WJ6A 4KSLC 3WA0A 3ZDTA 4G3XB 3UIOB 2MWSB 4PS3A 2YLMA 1CMXB 2FCQA 3PHXB 2AL6A 4IUMB 4OVVA 4W9GA 4EOYA 2KHWB 2KX0A 3IG3A 2I1KA 4CYEA 4F8CB 5AZFA 1WR6E 2W9NA 4FJYA 3M95A 4IWOA 3V61A 1KLVA 2DZJA 2GOWA 4HXDA 2LVQA 3VTVA 1OTRB 1V2YA 2DZIA 5JHAA 3GOEA 4KSKC 4ZRKA 4NJ6A 4KV2A 3WIMA 3QX1A 1E5WA 4B6WA 3TMPB 2KO3A 4ZRJA 3TBLD 4ANWA 3ENEA 4KVGB 2N7EA 2L05A 3JVZX 1L2NA 2KKCA 4MSQB 3W1SC 1WZ3A 2LUEA 2DZKA 2ZCCA 4CO7A 2LZ6A 2WYQA 4WWNA 2WX0A 2MBHA 4RMAA 4ANUA 2C5LC 4M8NA 4W9HA 3ZNGC 4A3PA 3H7PA 1H4RA 3ZTCA 4AOFA 5J18A 3KUCB 2DYMA 1GJZA 1MG8A 3LJ3A 4GIVA 4BKSA 2FIFA 5D2MB 3ONSA 4TQ0A 2IY0B 3ZUNA 4HDOA 2LVPA 4GDLB 1K8RB 2CKHB 2DX5B 3U7DA 5JHBA 1KJTA 2ASQA 2JZZA 4W9EA 4JQWC 4RM9A 2LI5A 4LJPB 1RRBA 4E74A 2WDTB 4JLCA 2KK8A 2PEAA 4TUUA 2MCNB 4DXAB 1SIFA 4IW0A 4NAWA 3X23A 4HWIB 2GMIC 4DHZB 3JW0X 3UINB 2AL3A 4ZYNA 4BKTA 4BOSC 2L7RA 4WWOA 2PPHA 1S1QB 3AULA 2MBBB 2BYEA 4ASWC 2JUOA 3ECIA 3A1QA 4WJOA 4E3CA 2ZEQA 4E71A 3MHSD 3A4RA 4DDID 4GDKA 2BWES 2REXA 3DQVA 4IC7B 3EECA 3LDZE 2V1YA 1UZXB 4II2B 3OJ4B 2KWVB 2DZMA 3ZNHB 3PREA 3VTUA 2KLCA 3UIPB 3VUXA 3WAPA 1IP9A 1E8WA 2NPTA 4GN1A 2BGFA 1WR1A 2N7DA 2XEWA 3A9KA 4I6PA 2JF5A 1UELA 2KC1A 4MJSA 3BINA 4PS7A 4K1RB 2G45B 3IBEA 3HIZA 4WJPA 1YIWA 3HHMA 2KNBA 2O6VD 4XX5A 1WXSA 3O65B 2JVCA 2KZRA 3DBSA 1C3TA 2RD0A 1RAXA 2C9WB 1EUVB 3HM3A 2M4NA 2N1VA 2XK5A 2KJHB 1IYFA 2C7MB 3K9PB 2IYDB 3H7PB 5FR6A 3PT2B 2KVRA 4KZ0A 3QAQA 4EKUA 3ZNZB 4HCNB 3KVFB 3U8ZA 1V9JA 2FUHB 2AWTA 3KUDB 3B08A 2V3SA 4K7WA 2ZJDA 3NOBA 3V60A 1ZW7A 1UH6A 4AP4C 2KANA 5HKHA 1PQSA 1V49A 4M8MA 2D07B 3ZDMC 3D32A 1WM3A 2OOBB 5DPSA 3V6EB 3UQBA 3CMMB 4NAWB 3TL5A 1Q1OA 2IBIB 3ZRFA 4AWJA 2HTHA 3P2BA 4MEMA 1LQBA 5G2NA 4A3OA 3PPAA 4K7SA 4FHKA 3ZO5B 4FJVB 2ZNVB 4W9KA 2MA9B 4HVBA 4K81A 2AYOB 2L76A 4ANVA 5J17A 4GDKB 2MRPA 4MH0E 4WQOB 1WFYA 3X0WA 1I42A 2GBNA 3ZW3A 3W1SA 5D6JB 2MX2A 3PRZA 2ZCBA 2LVOA 4HCPB 3B0AA 3UQAA 1BT0A 4RM8A 4GOCA 4BBNC 2BKRB 2IO3B 2LJ5A 3AU4A 2L00B 2NPTB 4WJNA 2O2VA 5J2RA 3A9KB 2ZVNA 4HPLB 3R7QA 4MJSB 2FCMA 3H7SA 3EC8A 2G4DB 3RULA 4BOZB 2K6DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVN V;  2JZ3 B;  4B9K A;  2KTF A;  4FN2 A;  2M0X A;  3HM6 X;  3SDL C;  2L0F A;  1NBF C;  4GU2 A;  4MGZ E;  3L13 A;  4OVU A;  4LJO B;  5BO4 B;  1J0G A;  2XK5 B;  3QJZ A;  1WGY A;  5LXI B;  1D3Z A;  3EFU A;  3CF6 E;  3H6N A;  3QIJ A;  1Y8R C;  2K8H A;  2N4F A;  5G55 A;  3KYC D;  2IY1 B;  1EF5 A;  1RFA A;  4X57 B;  1WM2 A;  4FUL A;  3QQ8 B;  5C1Z A;  3ALB A;  4G50 A;  4EEW A;  4MEL A;  1YX6 B;  1HE8 A;  2XBB C;  3M63 B;  5CX3 A;  1E8X A;  2UYZ B;  1UBI A;  1LFD A;  2KJR A;  2N9E B;  1WGH A;  3L10 B;  4NPN A;  4IWP A;  5L83 A;  5DPT A;  3VH3 B;  1J8C A;  2KC2 A;  2HE7 A;  3A33 B;  3N32 A;  4KDL B;  3QK0 A;  4NQK E;  2WWZ A;  3RD2 A;  1XT9 B;  3WAO A;  2CHZ A;  1P0R A;  4WWP A;  5IAA C;  4KIK A;  1R4M I;  2NR2 A;  3VH4 B;  2DYB A;  1XD3 B;  1OQY A;  3TJP A;  3NY5 A;  3RUI B;  1V81 A;  2MW5 A;  2J0K A;  2HD5 B;  2N9P C;  3VXW A;  1LM8 B;  2L0T A;  4URK A;  4G11 A;  2FCS A;  2K6Q A;  2KLG A;  2G4S A;  2EKE C;  3WAN A;  3DOW A;  3NHE B;  3VFK A;  2O2V B;  1WIA A;  2K25 A;  5E6O A;  3N30 A;  2KQ7 A;  2JY6 A;  5LLI A;  1E7U A;  3RZW C;  3ZLZ A;  3L08 A;  4W9I A;  2KDI A;  2JRH A;  4IM0 A;  3VUY A;  4NNJ B;  1UGM A;  5D7G A;  4FAD A;  3AI5 A;  3MTN B;  5DCN A;  4JGH B;  2GBM A;  4JL9 A;  4LCD E;  4EZJ A;  1KM7 A;  1P9D U;  3NZS A;  3NZU A;  2JXX A;  2BYV E;  2NVU I;  3DVG X;  1VCB A;  4GB9 A;  4TQ1 A;  1A5R A;  4HK2 A;  4J6I A;  4W9L A;  4I6L B;  5D94 A;  1TGZ B;  1WXV A;  2LGD A;  3QC8 B;  3EHV A;  2KMC A;  3N3K B;  2M8S A;  3PLU A;  2B3A A;  3I3T B;  2ZVO A;  3QWZ B;  3QCA A;  2FCN A;  3APC A;  2NBW B;  3S2A A;  4B95 A;  2R2Q A;  3B1L X;  4ICV A;  2KTR A;  2I1J A;  2KJ6 A;  2RSU A;  1S3S G;  4FJZ A;  4GSW A;  1VD2 A;  4TV3 A;  4HDQ A;  1ZGU B;  3QHT A;  3W1Y A;  1V80 A;  2KFJ A;  2LAS A;  1TBE A;  3U30 A;  3ZKJ C;  4NJ7 A;  3R3M A;  4BVU C;  2N9X A;  4A20 A;  2FAZ A;  4M0W B;  4DK5 A;  2IO2 B;  4BKS D;  2K8C A;  1M94 A;  1OEY J;  3T8M A;  3RT3 B;  1EO6 A;  1WI0 A;  3KW5 B;  3M3J A;  3PS6 A;  4GGQ A;  2IO0 B;  3RCZ A;  4DHZ E;  1V5O A;  1GC6 A;  3UF8 A;  3VQI A;  3PHW B;  2MBE A;  1WGR A;  2CU1 A;  2LRW A;  1GC7 A;  2YVC A;  2KDE B;  3BY4 B;  2MLB A;  4ICU A;  2D2Q A;  1E8Y A;  4W9F A;  4MDK E;  2C60 A;  4ZRI A;  3A1Q B;  4PYU A;  3APD A;  4HPM B;  3PRM B;  3HK0 A;  3OJ3 A;  3L16 A;  4ANX A;  4P7I A;  2DEN B;  3APF A;  3ML8 A;  1R4N I;  1SE9 A;  4LDT B;  1WXA A;  2Z0D B;  4FLH A;  3SU8 X;  2PJH A;  4YL8 A;  2BF8 B;  2NCN A;  1WX7 A;  5AEK B;  2KX3 A;  3OAW A;  4AJY B;  2V4L A;  1TTN A;  1WH3 A;  1WX8 A;  1WJ4 A;  2KWC A;  1WE6 A;  2C7N B;  2D11 A;  4DWF A;  2Z59 B;  3PGE A;  3QAR A;  2NBU A;  2BWF A;  1U4A A;  2CHX A;  3SHQ A;  1GG3 A;  2CS4 A;  4BKG A;  4G0N B;  5DPR A;  2RR9 A;  2KTR B;  3IFW B;  2KDF B;  4IG7 B;  2GBR A;  1G6J A;  1P3Q U;  2DAJ A;  5CHW A;  1YQB A;  2A5U A;  2KMA A;  2LGX A;  3JSV A;  1NDD A;  1WMH A;  1NI2 A;  1WXM A;  3DCG A;  3PRP B;  1GNU A;  4W9C A;  5TR5 A;  4NQL B;  1ISN A;  1WGD A;  2L3Z A;  2PE6 B;  3T9L A;  1V86 A;  1XQQ A;  2K39 A;  2KFK A;  3M62 B;  3L17 A;  2JPH A;  4WAA A;  1L7Y A;  4MGI E;  4N9F 4;  2BYF A;  2K8B A;  2KD0 A;  4EUT A;  1V6E A;  3AU5 A;  3KYD D;  3RYT A;  2O6V A;  1T0Y A;  3CSF A;  1SGH A;  2LD9 A;  5CHV C;  2QHO A;  4KZC A;  1UD7 A;  2IO1 B;  2M17 A;  2MP2 A;  5DPW A;  2KDB A;  2LGY A;  3H9D A;  1WJU A;  2A4Z A;  2CHW A;  2G3Q B;  3R66 C;  2Y5B B;  1RLF A;  4FHJ A;  1WY8 A;  2D10 A;  4I6N B;  1WE7 A;  2DAF A;  3ZTD A;  3A4S C;  3Q3F A;  2LXC A;  3PVL A;  2VRR B;  4MGK E;  3IVF A;  2AEH A;  5JH5 C;  5LXH A;  2MBO A;  1I35 A;  2J0J A;  1YJ1 A;  3H1U A;  1E90 A;  1JRU A;  3KUZ A;  4XC2 A;  5EDS A;  2PE9 A;  2JRI B;  2KN5 A;  3VUW A;  1V5T A;  4IM2 A;  4MM3 A;  1EF1 A;  4MGY E;  3ZNI D;  5KHQ A;  3QA8 A;  1YX5 B;  3PLV A;  2LRU A;  4DDG D;  4ZDV A;  3WAL A;  4HLE A;  1X1M A;  4WJQ A;  4TKN A;  4F7Z A;  3V62 A;  5L95 C;  3IHP C;  1C1Y B;  4DHJ B;  3JSV B;  2D3G A;  1WMH B;  3L54 A;  5GMV A;  4GXB A;  2LXA A;  1WF9 A;  3NS8 A;  1ZKH A;  3DBL I;  1GUA B;  2KFK B;  3L0W B;  5CHF A;  2GBJ A;  2ZZP B;  5E6N A;  4DHJ D;  1WJN A;  3K9O B;  4KIK B;  2DYO A;  4W9J A;  1Q0W B;  2DHZ A;  2JT4 B;  2ZPY A;  2J7Q B;  2O6V B;  2EMT A;  1F9J A;  4PYZ A;  4II3 B;  5C23 A;  2M1M A;  2RGF A;  3GZN I;  2UWQ A;  3Q3J A;  2C7H A;  3A9J A;  3RZF A;  1P98 A;  2CR5 A;  4KDI C;  5IA7 A;  1E7V A;  1OGW A;  3DVN U;  2MP2 B;  1UBQ A;  4IM3 A;  3DVG Y;  4AJW A;  4EZL A;  2L8J A;  5CTR C;  2EMS A;  5AZH A;  2NBV B;  1WYW B;  2R2O A;  2KOX A;  2BPS A;  5JZE B;  1FXT B;  4CHK A;  4EFO A;  4W9D A;  3OLM D;  3SD5 A;  2GBK A;  2LWP A;  1TZ1 A;  3CST A;  3DDC B;  4MSM B;  3VAW A;  1Z5S B;  4EZK A;  2FID A;  3WAM A;  2KQS A;  3PTF C;  2MQJ A;  4DBG A;  2ZPN A;  3ZIM A;  1H8C A;  4K7U A;  2KXJ A;  1OEY A;  2BKF A;  1AAR A;  2ZNV C;  3R7R A;  2J0M A;  3V6C B;  3VHT C;  1J19 A;  3VVW B;  1KOT A;  1P1A A;  2Z0E B;  3TIX A;  3DPD A;  3MJW A;  2MBQ A;  5KHO A;  3C0R B;  4GMV A;  4PS8 A;  4AUQ C;  3ML9 A;  2RPQ A;  4BFR A;  3AXC A;  2WX1 A;  4JIO U;  5AZG A;  3PV1 A;  2OJR A;  4FA6 A;  4LDT D;  5E6P A;  2K1F A;  2FNJ B;  3JYU A;  2MSE D;  4NY0 A;  2HJ8 A;  3DBR I;  3PSE B;  1WGG A;  1Z2M A;  4XZ4 A;  4GDL A;  4F1S A;  4HJK A;  4IWQ A;  1QZE A;  3UGB B;  1E8Z A;  1LXD A;  3PZD A;  1WX9 A;  3TCA A;  1WZ0 A;  1Q5W B;  2JWZ A;  3VTW A;  2IZV B;  3ZVV A;  4BBN F;  3VDZ A;  1YD8 U;  2KWU B;  2N1W A;  4FBJ B;  3A9J B;  1WRD B;  3KH0 A;  2NS5 A;  3DBH I;  1IPG A;  3ZRC A;  1WJ6 A;  4KSL C;  3WA0 A;  3ZDT A;  4G3X B;  3UIO B;  2MWS B;  4PS3 A;  2YLM A;  1CMX B;  2FCQ A;  3PHX B;  2AL6 A;  4IUM B;  4OVV A;  4W9G A;  4EOY A;  2KHW B;  2KX0 A;  3IG3 A;  2I1K A;  4CYE A;  4F8C B;  5AZF A;  1WR6 E;  2W9N A;  4FJY A;  3M95 A;  4IWO A;  3V61 A;  1KLV A;  2DZJ A;  2GOW A;  4HXD A;  2LVQ A;  3VTV A;  1OTR B;  1V2Y A;  2DZI A;  5JHA A;  3GOE A;  4KSK C;  4ZRK A;  4NJ6 A;  4KV2 A;  3WIM A;  3QX1 A;  1E5W A;  4B6W A;  3TMP B;  2KO3 A;  4ZRJ A;  3TBL D;  4ANW A;  3ENE A;  4KVG B;  2N7E A;  2L05 A;  3JVZ X;  1L2N A;  2KKC A;  4MSQ B;  3W1S C;  1WZ3 A;  2LUE A;  2DZK A;  2ZCC A;  4CO7 A;  2LZ6 A;  2WYQ A;  4WWN A;  2WX0 A;  2MBH A;  4RMA A;  4ANU A;  2C5L C;  4M8N A;  4W9H A;  3ZNG C;  4A3P A;  3H7P A;  1H4R A;  3ZTC A;  4AOF A;  5J18 A;  3KUC B;  2DYM A;  1GJZ A;  1MG8 A;  3LJ3 A;  4GIV A;  4BKS A;  2FIF A;  5D2M B;  3ONS A;  4TQ0 A;  2IY0 B;  3ZUN A;  4HDO A;  2LVP A;  4GDL B;  1K8R B;  2CKH B;  2DX5 B;  3U7D A;  5JHB A;  1KJT A;  2ASQ A;  2JZZ A;  4W9E A;  4JQW C;  4RM9 A;  2LI5 A;  4LJP B;  1RRB A;  4E74 A;  2WDT B;  4JLC A;  2KK8 A;  2PEA A;  4TUU A;  2MCN B;  4DXA B;  1SIF A;  4IW0 A;  4NAW A;  3X23 A;  4HWI B;  2GMI C;  4DHZ B;  3JW0 X;  3UIN B;  2AL3 A;  4ZYN A;  4BKT A;  4BOS C;  2L7R A;  4WWO A;  2PPH A;  1S1Q B;  3AUL A;  2MBB B;  2BYE A;  4ASW C;  2JUO A;  3ECI A;  3A1Q A;  4WJO A;  4E3C A;  2ZEQ A;  4E71 A;  3MHS D;  3A4R A;  4DDI D;  4GDK A;  2BWE S;  2REX A;  3DQV A;  4IC7 B;  3EEC A;  3LDZ E;  2V1Y A;  1UZX B;  4II2 B;  3OJ4 B;  2KWV B;  2DZM A;  3ZNH B;  3PRE A;  3VTU A;  2KLC A;  3UIP B;  3VUX A;  3WAP A;  1IP9 A;  1E8W A;  2NPT A;  4GN1 A;  2BGF A;  1WR1 A;  2N7D A;  2XEW A;  3A9K A;  4I6P A;  2JF5 A;  1UEL A;  2KC1 A;  4MJS A;  3BIN A;  4PS7 A;  4K1R B;  2G45 B;  3IBE A;  3HIZ A;  4WJP A;  1YIW A;  3HHM A;  2KNB A;  2O6V D;  4XX5 A;  1WXS A;  3O65 B;  2JVC A;  2KZR A;  3DBS A;  1C3T A;  2RD0 A;  1RAX A;  2C9W B;  1EUV B;  3HM3 A;  2M4N A;  2N1V A;  2XK5 A;  2KJH B;  1IYF A;  2C7M B;  3K9P B;  2IYD B;  3H7P B;  5FR6 A;  3PT2 B;  2KVR A;  4KZ0 A;  3QAQ A;  4EKU A;  3ZNZ B;  4HCN B;  3KVF B;  3U8Z A;  1V9J A;  2FUH B;  2AWT A;  3KUD B;  3B08 A;  2V3S A;  4K7W A;  2ZJD A;  3NOB A;  3V60 A;  1ZW7 A;  1UH6 A;  4AP4 C;  2KAN A;  5HKH A;  1PQS A;  1V49 A;  4M8M A;  2D07 B;  3ZDM C;  3D32 A;  1WM3 A;  2OOB B;  5DPS A;  3V6E B;  3UQB A;  3CMM B;  4NAW B;  3TL5 A;  1Q1O A;  2IBI B;  3ZRF A;  4AWJ A;  2HTH A;  3P2B A;  4MEM A;  1LQB A;  5G2N A;  4A3O A;  3PPA A;  4K7S A;  4FHK A;  3ZO5 B;  4FJV B;  2ZNV B;  4W9K A;  2MA9 B;  4HVB A;  4K81 A;  2AYO B;  2L76 A;  4ANV A;  5J17 A;  4GDK B;  2MRP A;  4MH0 E;  4WQO B;  1WFY A;  3X0W A;  1I42 A;  2GBN A;  3ZW3 A;  3W1S A;  5D6J B;  2MX2 A;  3PRZ A;  2ZCB A;  2LVO A;  4HCP B;  3B0A A;  3UQA A;  1BT0 A;  4RM8 A;  4GOC A;  4BBN C;  2BKR B;  2IO3 B;  2LJ5 A;  3AU4 A;  2L00 B;  2NPT B;  4WJN A;  2O2V A;  5J2R A;  3A9K B;  2ZVN A;  4HPL B;  3R7Q A;  4MJS B;  2FCM A;  3H7S A;  3EC8 A;  2G4D B;  3RUL A;  4BOZ B;  2K6D B; 
#chains in the Genus database with same CATH topology
 2JYE A;  3HM6 X;  4YWG G;  3L13 A;  1WGY A;  3EFU A;  3H6N A;  1LGR A;  3IAS 1;  2K8H A;  1WM2 A;  4FUL A;  3QQ8 B;  4L1B A;  1AWD A;  1TY0 A;  4B0M A;  2N9E B;  1E9M A;  1WGH A;  1PGB A;  2BS4 B;  5DPT A;  3VH3 B;  1J8C A;  3N32 A;  3A33 B;  4WWM A;  3WAO A;  1NYR A;  1EWC A;  1TY2 A;  4WWP A;  1DOX A;  4XWW A;  1F77 A;  1OQY A;  3TJP A;  3T3O A;  3U52 E;  2KT7 A;  1JWU D;  2FCS A;  2G4S A;  2WXQ A;  5FKA C;  3Q6B A;  3EUB 2;  3RPF C;  1J7C A;  2O2V B;  2K25 A;  3N30 A;  3L08 A;  1V97 A;  2WXJ A;  4NNJ B;  1SIJ A;  1UGM A;  4RCO A;  4MAC A;  4LCD E;  4EZJ A;  1PDX A;  3NZU A;  2JXX A;  3AEE B;  2NVU I;  1VCB A;  4GB9 A;  4HK2 A;  3U4E G;  3QC8 B;  2KMC A;  2BB6 A;  2M8S A;  1NYQ A;  3BVG A;  1RM6 C;  2MJ3 A;  3QCA A;  3AE7 B;  3LYY A;  4UDU C;  3B1L X;  1SE3 A;  2I1J A;  4B0E A;  1S3S G;  3NVY A;  4GSW A;  4TV3 A;  3BWU D;  5AUK A;  3W1Y A;  1V80 A;  2LAS A;  4P16 A;  3ZKJ C;  2N9X A;  2IO2 B;  4BKS D;  2K8C A;  2LGI A;  3RT3 B;  1FD6 A;  3RCZ A;  4DHZ E;  3BYT B;  1V5O A;  3VQI A;  3PHW B;  2LEK A;  1GC7 A;  3BY4 B;  4ICU A;  2C60 A;  3APD A;  3HK0 A;  3OJ3 A;  4ANX A;  2SAK A;  4XDD A;  2Z0D B;  3SU8 X;  2PJH A;  4YL8 A;  3OAW A;  2YEP B;  1KRH A;  1TTN A;  1VJK A;  5T8I A;  4HJG E;  1WJ4 A;  1L6V A;  2ON8 A;  2VZK D;  2JWU A;  2BWF A;  1U4A A;  2RDH A;  2N7J A;  5DPR A;  2RR9 A;  4DXF A;  3IFW B;  2QEJ C;  1D5M C;  3U2S C;  5FK9 C;  1EM7 A;  1G6J A;  1P3Q U;  2PVO D;  3JSV A;  3R8B A;  1WMH A;  5TR5 A;  1ISN A;  3T9L A;  5BYS A;  2PW9 A;  1L7Y A;  4MGI E;  1IGD A;  2K8B A;  4XYC A;  1V6E A;  1PYW D;  1AYF A;  2QDF A;  3KYD D;  3RYT A;  1OFF A;  4ZHP A;  2WNM A;  1FO4 A;  3CSF A;  3AE9 B;  2DNF A;  4KZC A;  1UD7 A;  2KDB A;  3MC9 A;  1WJU A;  3MHZ A;  2R61 A;  3R66 C;  1UNS A;  1YN5 A;  4I6N B;  3ZTD A;  3NVV A;  3IVF A;  2AEH A;  5LXH A;  1FIQ A;  1E90 A;  1JRU A;  1P7E A;  2KN5 A;  3UQA A;  4MM3 A;  1WGK A;  1VR9 A;  2LRU A;  4DDG D;  3WAL A;  4HLE A;  1X1M A;  2IGH A;  4WJQ A;  4TKN A;  3V62 A;  4N6E B;  1GB4 A;  2LXA A;  1WF9 A;  2W54 A;  1ZKH A;  2GBJ A;  1JWS D;  4DHJ D;  1WJN A;  2TSS A;  3KWV A;  4W9J A;  2DHZ A;  2ZPY A;  3GZN B;  2O6V B;  2OJW A;  2M1M A;  2C7H A;  4A8X C;  2DWQ A;  1OGW A;  2L8J A;  5AZH A;  2KOX A;  4CHK A;  3AEB B;  3KLS X;  4S17 A;  2LWP A;  3DDC B;  2AQ1 B;  3CST A;  3VAW A;  4EZK A;  2KQS A;  3VR8 B;  2MHJ A;  4K7U A;  2KXJ A;  1OEY A;  3VHT C;  1AAR A;  3R7R A;  1KOT A;  1KFY B;  4FXC A;  3C0R B;  4GMV A;  3ML9 A;  2N9L A;  5EE9 A;  3AXC A;  2WX1 A;  5AZG A;  4BFR A;  1HA5 A;  3JYU A;  4NY0 A;  2HJ8 A;  1ZOY B;  1C4C A;  1FFU A;  5TSS A;  4IWQ A;  1QZE A;  3PZD A;  3TCA A;  1SBB B;  2G9H D;  1YD8 U;  3A9J B;  1YN3 A;  2NS5 A;  3DBH I;  3ZRC A;  3ZDT A;  3UIO B;  1IGC A;  2INC C;  4PS3 A;  2I1K A;  4IWO A;  3V61 A;  1KLV A;  1B9R A;  3WIM A;  5H92 C;  2KO3 A;  4ANW A;  2L05 A;  2AQ3 B;  2W82 A;  2Y3A A;  1L2N A;  4MSQ B;  3W1S C;  2LUE A;  3AM9 A;  1GPX A;  4WWN A;  1JCK B;  4ANU A;  2MBH A;  4RMA A;  2C5L C;  3H7P A;  4AOF A;  2DYM A;  1MG8 A;  5AUI A;  2WXK A;  4WAF A;  2OED A;  3ONS A;  2DX5 B;  2CKH B;  4A55 A;  4JQW C;  4E74 A;  4JPS A;  1F52 A;  1PUT A;  1ESF A;  4BOS C;  2PTL A;  4WWO A;  4C4V A;  1S1Q B;  3AUL A;  2Y5P A;  3ECI A;  1UF0 A;  2QJL A;  2NTS A;  4GDK A;  2REX A;  4XE0 A;  1KF6 B;  4IC7 B;  2V1Y A;  1D6E C;  2V4I B;  3VTU A;  3PO0 A;  1IP9 A;  1FCL A;  3A9K A;  2KC1 A;  1SB3 C;  3BIN A;  4DQO C;  4K1R B;  2G45 B;  3IBE A;  3NG0 A;  1YIW A;  3AN1 A;  3O65 B;  1C3T A;  2KZR A;  3DBS A;  3B2G A;  1RAX A;  2PLP A;  2N1V A;  1EU4 A;  1IYF A;  3K9P B;  2BT6 A;  1CQV A;  3ZNZ B;  3KVF B;  3U8Z A;  1HXY D;  4R3D A;  2JXT A;  2AWT A;  3Q3M C;  3W9C B;  1T0Q C;  3ETR A;  2WDR B;  3ZDM C;  3D32 A;  5DPS A;  1Q1O A;  1SF0 A;  3P2B A;  4LTU A;  1LQB A;  3ZGZ A;  1JQ4 A;  4K81 A;  3P4S B;  5D3D A;  4ANV A;  3AB5 A;  3X0W A;  1WFY A;  1PGA A;  3ZW3 A;  2LVO A;  1BT0 A;  4ZRQ A;  2WU5 B;  1F0Z A;  4GOC A;  2ZVN A;  4MJS B;  4HPP A;  2WU2 B;  1J0G A;  1FEH A;  2GLS A;  3FKY A;  3DVN V;  2JZ3 B;  4B9K A;  2KTF A;  1HEZ E;  2BTE A;  4GU2 A;  1VRA B;  4MGZ E;  4AS1 A;  3GB1 A;  2XK5 B;  1D3Z A;  3CF6 E;  3HUI A;  2J4X A;  3NUH B;  1JWA D;  2OHF A;  1SJH D;  1EF5 A;  3AEC B;  4X57 B;  3ZJU A;  3ALB A;  4G50 A;  1YX6 B;  3M63 B;  4KKI A;  1UBI A;  1KLU D;  2KJR A;  4IWP A;  3AE4 B;  4RGO S;  2KC2 A;  2HE7 A;  2RPV A;  4NQK E;  3RD2 A;  2CHZ A;  1T5X D;  1P0R A;  1ZXH A;  4A90 A;  1QF6 A;  3AE2 B;  2K9X A;  2QSD A;  3VRA B;  4CQN A;  2DYB A;  2IND C;  1XD3 B;  1V81 A;  2MW5 A;  3VXW A;  1MFW A;  2L0T A;  4IKG A;  2K6Q A;  3DOW A;  4RGN A;  2KQ7 A;  1EWY C;  3ZLZ A;  3RZW C;  4J3O D;  4YSX B;  2KDI A;  4IM0 A;  3OWE B;  5D7G A;  3AI5 A;  1YNT E;  1KM7 A;  3N9Y C;  2KYW A;  3NZS A;  4YSY B;  1VZ8 A;  3GS2 A;  1A5R A;  1TGZ B;  4US8 A;  2N9K A;  3I3T B;  3Q3N C;  1L4Z B;  2KTR A;  2KJ6 A;  2WXG A;  1XF5 L;  4HDQ A;  3LB8 C;  3PZ7 A;  4O1N A;  5HI1 A;  4NJ7 A;  3R3M A;  3C8Y A;  4A20 A;  2FAZ A;  4M0W B;  3KWL A;  3URY A;  1OEY J;  1WI0 A;  3J9C A;  4YSZ B;  3UF8 A;  2BW2 A;  2WXL A;  2PVG C;  4RH6 A;  2YVC A;  2JZP A;  2KMM A;  1R4N B;  4P7I A;  3MP9 A;  2DEN B;  3APF A;  4LDT B;  2L83 A;  5BYR A;  1WX7 A;  3CIR B;  4AJY B;  1JRO A;  1WX8 A;  1CZP A;  2WXN A;  1FRR A;  2H89 B;  3SHQ A;  1GG3 A;  4KGR A;  2KDF B;  4IG7 B;  1N62 A;  5CHW A;  4WH4 A;  1A70 A;  3R2I A;  4W9C A;  1WXM A;  3DCG A;  3HVD A;  1WGD A;  2L3Z A;  1V86 A;  1XQQ A;  1TJE A;  2Y5C A;  2KFK A;  3M62 B;  3L17 A;  1HZ6 A;  4N9F 4;  3AU5 A;  1Q10 A;  1T0Y A;  2I38 A;  4KGT A;  4H2A A;  1IBX A;  2QHO A;  2CJN A;  5DPW A;  2IO1 B;  1MG4 A;  1YN4 A;  2A4Z A;  2KN4 A;  2G3Q B;  1T0S C;  1XLQ A;  1WE7 A;  2DAF A;  3Q3F A;  2BBC A;  2LXC A;  2VRR B;  2EEL A;  1I35 A;  2J0J A;  2PE9 A;  3VUW A;  1V5T A;  5KHQ A;  1EF1 A;  2NTT A;  1YOV B;  3AE1 B;  5L95 C;  4NAM A;  1NEN B;  3NRZ A;  3DBL B;  3NS8 A;  1B1Z A;  2LGS A;  3NZ3 A;  1GUA B;  5CHF A;  1SE2 A;  3K9O B;  4KIK B;  4OZB A;  2BYT A;  2EMT A;  4NZL B;  2RGF A;  1QOA A;  3GZN I;  2HDE A;  3UI3 A;  3PZ8 A;  3RZF A;  3P42 A;  4GLS C;  3TUO A;  5IP4 D;  1E7V A;  3DVN U;  2MP2 B;  4LNN A;  5CTR C;  2R2O A;  5JZE B;  4LNI A;  4IDI A;  1XXG A;  3KQ4 A;  3SD5 A;  2GBK A;  4WIP A;  1TZ1 A;  4KGS A;  1C4P A;  1QT9 A;  5HHD G;  2MQJ A;  2SEB D;  2ZPN A;  3AV8 A;  2KAC A;  1PGX A;  1NEK B;  4A9A A;  2J53 A;  2X8X X;  3TIX A;  1N6Z A;  3FIL A;  4FA6 A;  1UWM A;  3AMZ A;  3RNB C;  1RYJ A;  3DHG C;  3PSE B;  1WGG A;  1V1P B;  4XZ4 A;  4GDL A;  3W2D A;  1E8Z A;  1UGJ A;  2JYT A;  4C56 C;  3TEW A;  4C7Z A;  1WX9 A;  2PMV A;  3VTW A;  2JWZ A;  2N1W A;  3KH0 A;  2GB1 A;  1WJ6 A;  4KSL C;  4G3X B;  1CMX B;  3IXS A;  1N5W A;  2KHW B;  2KX0 A;  3IG3 A;  4CYE A;  1PFD A;  5AZF A;  1N63 A;  3N1Y C;  2LVQ A;  1K51 A;  5JHA A;  3GOE A;  4KSK C;  3EGR A;  1F2R C;  1JW9 D;  3TMP B;  4ZRJ A;  2WP9 B;  3ENE A;  3RNE C;  3JVZ X;  1WZ3 A;  1MPE A;  2ACZ B;  2LZ6 A;  1F1H A;  4M8N A;  1UUP A;  1QQR A;  3ZNG C;  3ZQ4 A;  3ZTC A;  3LJ3 A;  2M19 A;  2FIF A;  4HDO A;  2LVP A;  1K8R B;  1YMH E;  2WXH A;  5JHB A;  2JZZ A;  1T0R C;  3BVM A;  4M0W A;  4K3C A;  2PEA A;  1STE A;  4DXA B;  1WXQ A;  4IW0 A;  4NAW A;  3X23 A;  3JW0 X;  3UIN B;  1XEE A;  1AW7 A;  2L7R A;  2MJE A;  2PPH A;  2JUO A;  4WJO A;  4E3C A;  2ZEQ A;  2BWE S;  1C4A A;  1TS2 A;  3OJ4 B;  2DZM A;  4YTN B;  3PRE A;  4S0R A;  1JRP A;  2FBW B;  3WAP A;  1E8W A;  2NPT A;  4GN1 A;  3AH7 A;  2BGF A;  2XEW A;  2N7D A;  1UEL A;  4WJP A;  4KKJ A;  5EE3 A;  1YJI A;  2RD0 A;  1ZXI A;  1KTK A;  1TZO A;  2IYD B;  4YTM B;  2LUM A;  2KVR A;  1OQQ A;  4L23 A;  4DXG A;  5HFY A;  5D3I B;  2CJO A;  2FUH B;  3NVZ A;  3B08 A;  2I2Y A;  2ZJD A;  3NOB A;  3V60 A;  1DOY A;  3UQB A;  2LHD A;  3BK2 A;  3CMM B;  2IBI B;  5BYQ A;  1K52 A;  5G2N A;  3O13 A;  4MT5 A;  2JX5 A;  4FHK A;  1LO5 D;  4FJV B;  5J17 A;  1I42 A;  2BS3 B;  3W1S A;  3PRZ A;  4AQ7 A;  2KDM A;  1D4B A;  4RM8 A;  4MH8 A;  2IO3 B;  2VZK B;  5J2R A;  4WJN A;  2O2V A;  3R7Q A;  1FM0 D;  2FCM A;  3EC8 A;  1SJE D;  4BOZ B;  1XLO A;  4FN2 A;  4D2K A;  1QOB A;  2L0F A;  5BO4 B;  5FR3 A;  2EKI A;  3QIJ A;  2K5P A;  1Y8R C;  3KYC D;  1RFA A;  1WSP A;  4JWS C;  4EEW A;  5LNK 1;  3HVZ A;  1L4D B;  1HE8 A;  3Q8C A;  1E8X A;  1I4G A;  1LFD A;  5L83 A;  3DWM A;  1VZ6 A;  4PT5 A;  1R4M B;  3QK0 A;  2WWZ A;  2E3T A;  4KIK A;  3RNF C;  2NR2 A;  1F2R I;  4OHJ A;  3RUI B;  4OW0 A;  1TKE A;  2J0K A;  1C77 A;  2N9P C;  1LM8 B;  4URK A;  3SFD B;  3WAN A;  4HKZ E;  1WIA A;  4NJC A;  1JWM D;  3SFE B;  5LLI A;  1E7U A;  2JRH A;  3AE8 B;  4FAD A;  1XO3 A;  3MTN B;  5DCN A;  4JGH B;  3CWI A;  2GBM A;  3R2T A;  2BYV E;  2AX5 A;  4HEA 1;  3DVG X;  4TQ1 A;  4TSS A;  2J52 A;  4J6I A;  4W9L A;  5IKC M;  5D94 A;  1WXV A;  2LGD A;  3EHV A;  2KWD A;  2B3A A;  3QWZ B;  5HG2 A;  1DYQ A;  1YQ3 B;  1FRD A;  4B95 A;  2NBW B;  3S2A A;  2ZW0 A;  1N61 A;  4HRS A;  2N0S B;  4ICV A;  1MJD A;  1TT5 B;  3E56 A;  1L0Y B;  4M02 A;  4OZC A;  2L32 A;  5I4D A;  4FJZ A;  1VD2 A;  4N58 A;  1ZGU B;  1VZ7 A;  3QHT A;  1TBE A;  3U30 A;  5E6J A;  2W55 A;  2ZW1 A;  3Q8F A;  3KW5 B;  4GGQ A;  3M3J A;  1ROE A;  2AQ2 B;  2IO0 B;  1GC6 A;  4M01 A;  2K3U A;  2CU1 A;  3ABV B;  2D2Q A;  1E8Y A;  4PYU A;  5IN7 A;  3ML8 A;  1R4N I;  1AN8 A;  1WXA A;  2BF8 B;  1ZUD 2;  2NCN A;  5AEK B;  1D5X C;  2V4L A;  1WH3 A;  3RNC C;  2C7N B;  2Z59 B;  3BK1 A;  2YEP F;  4N59 A;  2JSV X;  2CS4 A;  4BKG A;  2DBY A;  2XN9 C;  4G0N B;  1BUI C;  4LLG M;  4K3B A;  1M4V A;  1FFV A;  1NDD A;  3L4P A;  1QOG A;  1E7P B;  1JAL A;  2LHE A;  4P6V F;  4C80 A;  2PE6 B;  2K39 A;  2RMM A;  4WAA A;  5BMG A;  4EUT A;  2O6V A;  2LD9 A;  5CHV C;  3Q8E A;  1HTQ A;  4ZYS A;  3Q3O C;  2M17 A;  2LGY A;  3H9D A;  3AE3 B;  1GOZ A;  1RLF A;  2BQQ A;  3PVL A;  4A6Q A;  1TKY A;  3BVZ A;  3C19 A;  3KUZ A;  3V05 A;  2FE8 A;  5EDS A;  2GI9 A;  2JRI B;  2V3P A;  3QA8 A;  2ICI A;  3PLV A;  2H88 B;  3TSS A;  4F7Z A;  3NS1 A;  1C1Y B;  3JSV B;  3N1X C;  1WMH B;  1HTO A;  3DBL I;  1XLP A;  3E9S A;  2ZZP B;  3GE8 C;  2DYO A;  2J7Q B;  2QMT A;  3W5V B;  4PYZ A;  5C23 A;  2IGG A;  2UWQ A;  2BS2 B;  3A9J A;  1P98 A;  2CR5 A;  4KDI C;  5IA7 A;  4IM3 A;  1UBQ A;  3DVG Y;  2WXO A;  2KVZ A;  1WYW B;  1IUE A;  2BPS A;  4TMA B;  4MSM B;  3Q8B A;  2W3S A;  3SR6 A;  3RNA C;  2PKO A;  3DHI C;  3BZD B;  2J0M A;  1C9F A;  2RDB C;  1C79 A;  2B76 B;  2Z0E B;  2MBQ A;  3DPD A;  3MJW A;  5KHO A;  4AUQ C;  3RI7 C;  2RPQ A;  1XCT L;  1KH0 A;  2OJR A;  1YJJ A;  2K1F A;  2FNJ B;  3DBR B;  1FXI A;  2GRI A;  3Q2A C;  4F1S A;  4HJK A;  1LXD A;  2L1A A;  4XWT A;  1SE4 A;  1Q5W B;  1WZ0 A;  3P4R B;  2IZV B;  3ZVV A;  4BBN F;  3BYY B;  4FBJ B;  1WRD B;  1IPG A;  1QLB B;  3WA0 A;  1I7H A;  2AL6 A;  2ONQ A;  4ITK A;  4JE3 B;  2W9N A;  3M95 A;  2GOW A;  5C3J B;  3VTV A;  1JWB D;  2INP E;  2DZI A;  4ZRK A;  4NJ6 A;  4KV2 A;  4KVG B;  4RGM A;  3Q14 C;  2KKC A;  1Y56 A;  3RNG C;  2DZK A;  2ZCC A;  2QCZ A;  3I5J C;  4P1B C;  4A3P A;  1MHH E;  2Q5W D;  1H4R A;  1ZDX A;  5J18 A;  1GJZ A;  1E0Z A;  5JXV A;  4TQ0 A;  2IY0 B;  3ZUN A;  2HJ1 A;  1XLN A;  3OG5 A;  1KJT A;  2ASQ A;  1GAQ B;  4W9E A;  3B2F A;  4RM9 A;  4WUR A;  4JLC A;  2KK8 A;  4TUU A;  2MCN B;  4HWI B;  2GMI C;  4DHZ B;  3MC8 A;  2AL3 A;  4ZYN A;  4BKT A;  2MBB B;  2BYE A;  5C2T B;  4ASW C;  3T3N A;  4E71 A;  4EE2 A;  4DDI D;  1MI0 A;  4RGT A;  1J7A A;  3EEC A;  3LDZ E;  1UZX B;  2KWV B;  1NVI D;  3ZNH B;  3FAH A;  1WR1 A;  1ACC A;  2WXP A;  4MJS A;  2O6V D;  3SEB A;  2D3C A;  2M4N A;  2XK5 A;  2WXF A;  2IJ0 A;  2C7M B;  3H7P B;  5FR6 A;  3PT2 B;  4KZ0 A;  2KAJ A;  1DOI A;  5IOI A;  4HKQ A;  3QAQ A;  4EKU A;  2D3B A;  3FC4 A;  4ZRP A;  1HQR D;  3WCQ A;  2V3S A;  4K7W A;  3V3X A;  2QC8 A;  4OZA A;  4AP4 C;  1UH6 A;  2KAN A;  5HKH A;  2LJI A;  2IDY A;  4M8M A;  1WM3 A;  2OOB B;  2BVC A;  3TL5 A;  3ZRF A;  4AWJ A;  2PIA A;  2HTH A;  4MEM A;  4A3O A;  4C4V B;  3ZO5 B;  2ZNV B;  4W9K A;  4HVB A;  2AYO B;  2L76 A;  1BXT A;  4GDK B;  4WQO B;  2JU6 X;  2GBN A;  5D6J B;  2MX2 A;  2ZCB A;  2WXM A;  4ARI A;  4LNO A;  3AU4 A;  1BML C;  3A9K B;  2K6D B;  3BII D;  2WLB A;  1SSN A;  1T6B X;  2LFI A;  2M0A A;  2M0X A;  1NBF C;  2NMQ A;  3SDL C;  4ZOH C;  4OVU A;  4LJO B;  3ZJT A;  1ZP0 B;  5LXI B;  3QJZ A;  1L5P A;  1XCQ L;  4Q2J A;  2N4F A;  5G55 A;  2IY1 B;  1N5X A;  5C1Z A;  1WYG A;  1E10 A;  4MEL A;  2XBB C;  3I9V 1;  5CX3 A;  2UYZ B;  4NPN A;  3L10 B;  4KDL B;  1XT9 B;  5IAA C;  4LNF A;  2G1E A;  1R4M I;  3VH4 B;  3EFC A;  3NY5 A;  4US9 A;  3EA6 A;  2HD5 B;  3RMK C;  1P7F A;  2D5G A;  1TKG A;  4G11 A;  2KLG A;  2EKE C;  3NHE B;  1UWX A;  3VFK A;  2D3A A;  1RWS A;  3RUL A;  5E6O A;  2JY6 A;  1ZPS A;  3DHH C;  1WWT A;  4W9I A;  3VUY A;  3RN9 C;  5G5H A;  3I63 C;  4JL9 A;  1P9D U;  2MJD A;  2RDG A;  2E6X A;  4I6L B;  3W5U B;  3Q69 A;  2LMC A;  3N3K B;  2WXR A;  3PLU A;  2ZVO A;  1I4H A;  2FCN A;  4LNK A;  4ACF A;  3APC A;  2R2Q A;  3P4P B;  3GP7 A;  1MVK A;  1FXA A;  3VR9 B;  3VRB B;  2L52 A;  2RSU A;  4YT0 B;  2Z8L A;  1K53 A;  2KFJ A;  2K22 A;  4BVU C;  4DK5 A;  1M94 A;  3T8M A;  1EO6 A;  2VH1 A;  3PS6 A;  2WXI A;  2MH7 A;  2MBE A;  1WGR A;  2LRW A;  2KDE B;  1DGJ A;  2MLB A;  4W9F A;  4MDK E;  4ZRI A;  3A1Q B;  4HPM B;  3PRM B;  3L16 A;  3IT6 B;  3MFG A;  2WS3 B;  1SE9 A;  4ARC A;  4FLH A;  3AE6 B;  2KX3 A;  1ENF A;  1SEB D;  1QOF A;  2KWC A;  1WE6 A;  2V9H A;  2D11 A;  4DWF A;  3PGE A;  3QAR A;  2QIE B;  2KQ4 X;  2NBU A;  1J7B A;  3IAM 1;  3ZXV A;  2CHX A;  5BMH A;  2KTR B;  4C7Y A;  2GBR A;  2DAJ A;  1YQB A;  1I4R A;  2A5U A;  2KMA A;  2LGX A;  4RNA A;  2M56 B;  1NI2 A;  1YQ4 B;  3PRP B;  1GNU A;  4NQL B;  1TS4 A;  2FUG 1;  2W3R A;  2JPH A;  2BYF A;  1TS3 A;  1FNV A;  2KD0 A;  4REZ A;  3TEX A;  4C00 A;  3AED B;  1V8C A;  1HZ5 A;  1SGH A;  1SXT A;  4RF1 A;  2WDV B;  1C76 A;  1L6U A;  2MP2 A;  1V1O A;  2CHW A;  1MHX A;  5GXG B;  4YXD B;  2Y5B B;  1OQR A;  4FHJ A;  3AEG B;  1WY8 A;  2D10 A;  3A4S C;  4MGK E;  5JH5 C;  1K50 A;  2MBO A;  1YJ1 A;  3H1U A;  4XC2 A;  1EU3 A;  3MC0 B;  1T3Q A;  2IGD A;  4IM2 A;  4MGY E;  3ZNI D;  1N60 A;  1YX5 B;  4ZDV A;  1D5Z C;  3ZYY X;  1FNW A;  4P1C C;  3IHP C;  4DHJ B;  2D3G A;  1WRI A;  3L54 A;  5GMV A;  4GXB A;  3AEF B;  3N20 C;  2KFK B;  3L0W B;  4YTP B;  1I4Q A;  4ZHO A;  5E6N A;  1V1P A;  4XDC A;  1Q0W B;  2JT4 B;  1F9J A;  4II3 B;  4JWU C;  3Q3J A;  1IBX B;  4EZL A;  4AJW A;  3TEZ A;  2EMS A;  5EE0 A;  2NBV B;  1FXT B;  4EFO A;  4W9D A;  3OLM D;  2VH2 A;  4QAY A;  1Z5S B;  2FID A;  3WAM A;  1QIL A;  3PTF C;  4DBG A;  3ZIM A;  1H8C A;  5EE1 A;  2BKF A;  2ZNV C;  3LXF A;  3VVW B;  3V6C B;  1J19 A;  1P1A A;  3GE3 C;  1C78 A;  4PS8 A;  2K0P A;  4JIO U;  3PV1 A;  4LDT D;  5E6P A;  2BB5 A;  1VDV A;  4PK1 A;  2MSE D;  3RFZ B;  3NVW A;  3DBR I;  3P63 A;  1Z2M A;  4KX6 B;  3UGB B;  3VDZ A;  1L0V B;  2KWU B;  3DBH B;  2X38 A;  1L0X B;  1GB1 A;  2MWS B;  2YLM A;  3PHX B;  2FCQ A;  4IUM B;  4W9G A;  4OVV A;  5H8Y E;  4EOY A;  4WQM A;  4F8C B;  1WR6 E;  4FJY A;  4M00 A;  1TIF A;  2DZJ A;  4HXD A;  5G5G A;  2IPK D;  1OTR B;  1V2Y A;  4USA A;  3U7Z A;  1ZDV A;  1VLB A;  3QX1 A;  1E5W A;  1R7S A;  4B6W A;  3TBL D;  1TS5 A;  4JX1 C;  2N7E A;  3P1M A;  2HTM E;  4CO7 A;  1KLG D;  3FIL B;  2WYQ A;  2WX0 A;  1E6E B;  5MPO A;  4W9H A;  1I4X A;  1NI3 A;  2WDQ B;  4L2Y A;  3KUC B;  1FPY A;  4GIV A;  4BKS A;  5D2M B;  1CK1 A;  3U7D A;  4GDL B;  2WQY B;  1I4P A;  3IT4 B;  2LI5 A;  4LJP B;  1RRB A;  3B9J A;  3AE5 B;  2WDT B;  1SIF A;  1ZE3 D;  3TEY A;  3A1Q A;  3MHS D;  3A4R A;  2WGS A;  3DQV A;  5IO9 A;  3H8H A;  3P4Q B;  3N1Z C;  4II2 B;  3DWG C;  2KLC A;  3UIP B;  3VUX A;  1FCC C;  4I6P A;  3AEA B;  2JF5 A;  4PS7 A;  4RF0 A;  3HIZ A;  1FNU A;  3HHM A;  2KNB A;  4XX5 A;  1WXS A;  2JVC A;  2INN E;  2UU7 A;  4RFB A;  2C9W B;  1EUV B;  3HM3 A;  4BAX A;  2KJH B;  1FMA D;  3HRD D;  4LK0 M;  4IOI E;  4HCN B;  1V9J A;  5BMI A;  3Q8A A;  3KUD B;  4BZA A;  4MM3 B;  2QIL A;  1ZW7 A;  1JML A;  1TYG B;  1PQS A;  1V49 A;  2D07 B;  3V6E B;  4XGA B;  4NAW B;  2DLB A;  1RFK A;  2XNA C;  3NJT A;  3PPA A;  4K7S A;  1ET9 A;  2CU3 A;  1CJE A;  3ZJV A;  3MJ5 A;  2MA9 B;  3I57 A;  2MRP A;  2J42 A;  4MH0 E;  4OVZ A;  3ZXR A;  4HCP B;  3B0A A;  2V3N A;  4HRO A;  1QKZ A;  1ET6 A;  4BBN C;  2BKR B;  2LJ5 A;  2V0G A;  2L00 B;  2NPT B;  2MEK A;  2JQR B;  4HPL B;  3H7S A;  2G4D B;  2WHI A; 
#chains in the Genus database with same CATH homology
 3DVN V;  2JZ3 B;  4B9K A;  2KTF A;  4FN2 A;  2M0X A;  3HM6 X;  3SDL C;  2L0F A;  1NBF C;  4GU2 A;  4MGZ E;  3L13 A;  4OVU A;  4LJO B;  5BO4 B;  1J0G A;  2XK5 B;  3QJZ A;  1WGY A;  5LXI B;  1D3Z A;  3EFU A;  3CF6 E;  3H6N A;  3QIJ A;  1Y8R C;  2K8H A;  2N4F A;  5G55 A;  3KYC D;  2IY1 B;  1EF5 A;  1RFA A;  4X57 B;  1WM2 A;  4FUL A;  3QQ8 B;  5C1Z A;  3ALB A;  4G50 A;  4EEW A;  4MEL A;  1YX6 B;  1HE8 A;  2XBB C;  3M63 B;  5CX3 A;  1E8X A;  2UYZ B;  1UBI A;  1LFD A;  2KJR A;  2N9E B;  1WGH A;  3L10 B;  4NPN A;  4IWP A;  5L83 A;  5DPT A;  3VH3 B;  1J8C A;  2KC2 A;  2HE7 A;  3A33 B;  3N32 A;  4KDL B;  3QK0 A;  4NQK E;  2WWZ A;  3RD2 A;  1XT9 B;  3WAO A;  2CHZ A;  1P0R A;  4WWP A;  5IAA C;  4KIK A;  1R4M I;  2NR2 A;  3VH4 B;  2DYB A;  1XD3 B;  1OQY A;  3TJP A;  3NY5 A;  3RUI B;  1V81 A;  2MW5 A;  2J0K A;  2HD5 B;  2N9P C;  3VXW A;  1LM8 B;  2L0T A;  4URK A;  4G11 A;  2FCS A;  2K6Q A;  2KLG A;  2G4S A;  2EKE C;  3WAN A;  3DOW A;  3NHE B;  3VFK A;  2O2V B;  1WIA A;  2K25 A;  5E6O A;  3N30 A;  2KQ7 A;  2JY6 A;  5LLI A;  1E7U A;  3RZW C;  3ZLZ A;  3L08 A;  4W9I A;  2KDI A;  2JRH A;  4IM0 A;  3VUY A;  4NNJ B;  1UGM A;  5D7G A;  4FAD A;  3AI5 A;  3MTN B;  5DCN A;  4JGH B;  2GBM A;  4JL9 A;  4LCD E;  4EZJ A;  1KM7 A;  1P9D U;  3NZS A;  3NZU A;  2JXX A;  2BYV E;  2NVU I;  3DVG X;  1VCB A;  4GB9 A;  4TQ1 A;  1A5R A;  4HK2 A;  4J6I A;  4W9L A;  4I6L B;  5D94 A;  1TGZ B;  1WXV A;  2LGD A;  3QC8 B;  3EHV A;  2KMC A;  3N3K B;  2M8S A;  3PLU A;  2B3A A;  3I3T B;  2ZVO A;  3QWZ B;  3QCA A;  2FCN A;  3APC A;  2NBW B;  3S2A A;  4B95 A;  2R2Q A;  3B1L X;  4ICV A;  2KTR A;  2I1J A;  2KJ6 A;  2RSU A;  1S3S G;  4FJZ A;  4GSW A;  1VD2 A;  4TV3 A;  4HDQ A;  1ZGU B;  3QHT A;  3W1Y A;  1V80 A;  2KFJ A;  2LAS A;  1TBE A;  3U30 A;  3ZKJ C;  4NJ7 A;  3R3M A;  4BVU C;  2N9X A;  4A20 A;  2FAZ A;  4M0W B;  4DK5 A;  2IO2 B;  4BKS D;  2K8C A;  1M94 A;  1OEY J;  3T8M A;  3RT3 B;  1EO6 A;  1WI0 A;  3KW5 B;  3M3J A;  3PS6 A;  4GGQ A;  2IO0 B;  3RCZ A;  4DHZ E;  1V5O A;  1GC6 A;  3UF8 A;  3VQI A;  3PHW B;  2MBE A;  1WGR A;  2CU1 A;  2LRW A;  1GC7 A;  2YVC A;  2KDE B;  3BY4 B;  2MLB A;  4ICU A;  2D2Q A;  1E8Y A;  4W9F A;  4MDK E;  2C60 A;  4ZRI A;  3A1Q B;  4PYU A;  3APD A;  4HPM B;  3PRM B;  3HK0 A;  3OJ3 A;  3L16 A;  4ANX A;  4P7I A;  2DEN B;  3APF A;  3ML8 A;  1R4N I;  1SE9 A;  4LDT B;  1WXA A;  2Z0D B;  4FLH A;  3SU8 X;  2PJH A;  4YL8 A;  2BF8 B;  2NCN A;  1WX7 A;  5AEK B;  2KX3 A;  3OAW A;  4AJY B;  2V4L A;  1TTN A;  1WH3 A;  1WX8 A;  1WJ4 A;  2KWC A;  1WE6 A;  2C7N B;  2D11 A;  4DWF A;  2Z59 B;  3PGE A;  3QAR A;  2NBU A;  2BWF A;  1U4A A;  2CHX A;  3SHQ A;  1GG3 A;  2CS4 A;  4BKG A;  4G0N B;  5DPR A;  2RR9 A;  2KTR B;  3IFW B;  2KDF B;  4IG7 B;  2GBR A;  1G6J A;  1P3Q U;  2DAJ A;  5CHW A;  1YQB A;  2A5U A;  2KMA A;  2LGX A;  3JSV A;  1NDD A;  1WMH A;  1NI2 A;  1WXM A;  3DCG A;  3PRP B;  1GNU A;  4W9C A;  5TR5 A;  4NQL B;  1ISN A;  1WGD A;  2L3Z A;  2PE6 B;  3T9L A;  1V86 A;  1XQQ A;  2K39 A;  2KFK A;  3M62 B;  3L17 A;  2JPH A;  4WAA A;  1L7Y A;  4MGI E;  4N9F 4;  2BYF A;  2K8B A;  2KD0 A;  4EUT A;  1V6E A;  3AU5 A;  3KYD D;  3RYT A;  2O6V A;  1T0Y A;  3CSF A;  1SGH A;  2LD9 A;  5CHV C;  2QHO A;  4KZC A;  1UD7 A;  2IO1 B;  2M17 A;  2MP2 A;  5DPW A;  2KDB A;  2LGY A;  3H9D A;  1WJU A;  2A4Z A;  2CHW A;  2G3Q B;  3R66 C;  2Y5B B;  1RLF A;  4FHJ A;  1WY8 A;  2D10 A;  4I6N B;  1WE7 A;  2DAF A;  3ZTD A;  3A4S C;  3Q3F A;  2LXC A;  3PVL A;  2VRR B;  4MGK E;  3IVF A;  2AEH A;  5JH5 C;  5LXH A;  2MBO A;  1I35 A;  2J0J A;  1YJ1 A;  3H1U A;  1E90 A;  1JRU A;  3KUZ A;  4XC2 A;  5EDS A;  2PE9 A;  2JRI B;  2KN5 A;  3VUW A;  1V5T A;  4IM2 A;  4MM3 A;  1EF1 A;  4MGY E;  3ZNI D;  5KHQ A;  3QA8 A;  1YX5 B;  3PLV A;  2LRU A;  4DDG D;  4ZDV A;  3WAL A;  4HLE A;  1X1M A;  4WJQ A;  4TKN A;  4F7Z A;  3V62 A;  5L95 C;  3IHP C;  1C1Y B;  4DHJ B;  3JSV B;  2D3G A;  1WMH B;  3L54 A;  5GMV A;  4GXB A;  2LXA A;  1WF9 A;  3NS8 A;  1ZKH A;  3DBL I;  1GUA B;  2KFK B;  3L0W B;  5CHF A;  2GBJ A;  2ZZP B;  5E6N A;  4DHJ D;  1WJN A;  3K9O B;  4KIK B;  2DYO A;  4W9J A;  1Q0W B;  2DHZ A;  2JT4 B;  2ZPY A;  2J7Q B;  2O6V B;  2EMT A;  1F9J A;  4PYZ A;  4II3 B;  5C23 A;  2M1M A;  2RGF A;  3GZN I;  2UWQ A;  3Q3J A;  2C7H A;  3A9J A;  3RZF A;  1P98 A;  2CR5 A;  4KDI C;  5IA7 A;  1E7V A;  1OGW A;  3DVN U;  2MP2 B;  1UBQ A;  4IM3 A;  3DVG Y;  4AJW A;  4EZL A;  2L8J A;  5CTR C;  2EMS A;  5AZH A;  2NBV B;  1WYW B;  2R2O A;  2KOX A;  2BPS A;  5JZE B;  1FXT B;  4CHK A;  4EFO A;  4W9D A;  3OLM D;  3SD5 A;  2GBK A;  2LWP A;  1TZ1 A;  3CST A;  3DDC B;  4MSM B;  3VAW A;  1Z5S B;  4EZK A;  2FID A;  3WAM A;  2KQS A;  3PTF C;  2MQJ A;  4DBG A;  2ZPN A;  3ZIM A;  1H8C A;  4K7U A;  2KXJ A;  1OEY A;  2BKF A;  1AAR A;  2ZNV C;  3R7R A;  2J0M A;  3V6C B;  3VHT C;  1J19 A;  3VVW B;  1KOT A;  1P1A A;  2Z0E B;  3TIX A;  3DPD A;  3MJW A;  2MBQ A;  5KHO A;  3C0R B;  4GMV A;  4PS8 A;  4AUQ C;  3ML9 A;  2RPQ A;  4BFR A;  3AXC A;  2WX1 A;  4JIO U;  5AZG A;  3PV1 A;  2OJR A;  4FA6 A;  4LDT D;  5E6P A;  2K1F A;  2FNJ B;  3JYU A;  2MSE D;  4NY0 A;  2HJ8 A;  3DBR I;  3PSE B;  1WGG A;  1Z2M A;  4XZ4 A;  4GDL A;  4F1S A;  4HJK A;  4IWQ A;  1QZE A;  3UGB B;  1E8Z A;  1LXD A;  3PZD A;  1WX9 A;  3TCA A;  1WZ0 A;  1Q5W B;  2JWZ A;  3VTW A;  2IZV B;  3ZVV A;  4BBN F;  3VDZ A;  1YD8 U;  2KWU B;  2N1W A;  4FBJ B;  3A9J B;  1WRD B;  3KH0 A;  2NS5 A;  3DBH I;  1IPG A;  3ZRC A;  1WJ6 A;  4KSL C;  3WA0 A;  3ZDT A;  4G3X B;  3UIO B;  2MWS B;  4PS3 A;  2YLM A;  1CMX B;  2FCQ A;  3PHX B;  2AL6 A;  4IUM B;  4OVV A;  4W9G A;  4EOY A;  2KHW B;  2KX0 A;  3IG3 A;  2I1K A;  4CYE A;  4F8C B;  5AZF A;  1WR6 E;  2W9N A;  4FJY A;  3M95 A;  4IWO A;  3V61 A;  1KLV A;  2DZJ A;  2GOW A;  4HXD A;  2LVQ A;  3VTV A;  1OTR B;  1V2Y A;  2DZI A;  5JHA A;  3GOE A;  4KSK C;  4ZRK A;  4NJ6 A;  4KV2 A;  3WIM A;  3QX1 A;  1E5W A;  4B6W A;  3TMP B;  2KO3 A;  4ZRJ A;  3TBL D;  4ANW A;  3ENE A;  4KVG B;  2N7E A;  2L05 A;  3JVZ X;  1L2N A;  2KKC A;  4MSQ B;  3W1S C;  1WZ3 A;  2LUE A;  2DZK A;  2ZCC A;  4CO7 A;  2LZ6 A;  2WYQ A;  4WWN A;  2WX0 A;  2MBH A;  4RMA A;  4ANU A;  2C5L C;  4M8N A;  4W9H A;  3ZNG C;  4A3P A;  3H7P A;  1H4R A;  3ZTC A;  4AOF A;  5J18 A;  3KUC B;  2DYM A;  1GJZ A;  1MG8 A;  3LJ3 A;  4GIV A;  4BKS A;  2FIF A;  5D2M B;  3ONS A;  4TQ0 A;  2IY0 B;  3ZUN A;  4HDO A;  2LVP A;  4GDL B;  1K8R B;  2CKH B;  2DX5 B;  3U7D A;  5JHB A;  1KJT A;  2ASQ A;  2JZZ A;  4W9E A;  4JQW C;  4RM9 A;  2LI5 A;  4LJP B;  1RRB A;  4E74 A;  2WDT B;  4JLC A;  2KK8 A;  2PEA A;  4TUU A;  2MCN B;  4DXA B;  1SIF A;  4IW0 A;  4NAW A;  3X23 A;  4HWI B;  2GMI C;  4DHZ B;  3JW0 X;  3UIN B;  2AL3 A;  4ZYN A;  4BKT A;  4BOS C;  2L7R A;  4WWO A;  2PPH A;  1S1Q B;  3AUL A;  2MBB B;  2BYE A;  4ASW C;  2JUO A;  3ECI A;  3A1Q A;  4WJO A;  4E3C A;  2ZEQ A;  4E71 A;  3MHS D;  3A4R A;  4DDI D;  4GDK A;  2BWE S;  2REX A;  3DQV A;  4IC7 B;  3EEC A;  3LDZ E;  2V1Y A;  1UZX B;  4II2 B;  3OJ4 B;  2KWV B;  2DZM A;  3ZNH B;  3PRE A;  3VTU A;  2KLC A;  3UIP B;  3VUX A;  3WAP A;  1IP9 A;  1E8W A;  2NPT A;  4GN1 A;  2BGF A;  1WR1 A;  2N7D A;  2XEW A;  3A9K A;  4I6P A;  2JF5 A;  1UEL A;  2KC1 A;  4MJS A;  3BIN A;  4PS7 A;  4K1R B;  2G45 B;  3IBE A;  3HIZ A;  4WJP A;  1YIW A;  3HHM A;  2KNB A;  2O6V D;  4XX5 A;  1WXS A;  3O65 B;  2JVC A;  2KZR A;  3DBS A;  1C3T A;  2RD0 A;  1RAX A;  2C9W B;  1EUV B;  3HM3 A;  2M4N A;  2N1V A;  2XK5 A;  2KJH B;  1IYF A;  2C7M B;  3K9P B;  2IYD B;  3H7P B;  5FR6 A;  3PT2 B;  2KVR A;  4KZ0 A;  3QAQ A;  4EKU A;  3ZNZ B;  4HCN B;  3KVF B;  3U8Z A;  1V9J A;  2FUH B;  2AWT A;  3KUD B;  3B08 A;  2V3S A;  4K7W A;  2ZJD A;  3NOB A;  3V60 A;  1ZW7 A;  1UH6 A;  4AP4 C;  2KAN A;  5HKH A;  1PQS A;  1V49 A;  4M8M A;  2D07 B;  3ZDM C;  3D32 A;  1WM3 A;  2OOB B;  5DPS A;  3V6E B;  3UQB A;  3CMM B;  4NAW B;  3TL5 A;  1Q1O A;  2IBI B;  3ZRF A;  4AWJ A;  2HTH A;  3P2B A;  4MEM A;  1LQB A;  5G2N A;  4A3O A;  3PPA A;  4K7S A;  4FHK A;  3ZO5 B;  4FJV B;  2ZNV B;  4W9K A;  2MA9 B;  4HVB A;  4K81 A;  2AYO B;  2L76 A;  4ANV A;  5J17 A;  4GDK B;  2MRP A;  4MH0 E;  4WQO B;  1WFY A;  3X0W A;  1I42 A;  2GBN A;  3ZW3 A;  3W1S A;  5D6J B;  2MX2 A;  3PRZ A;  2ZCB A;  2LVO A;  4HCP B;  3B0A A;  3UQA A;  1BT0 A;  4RM8 A;  4GOC A;  4BBN C;  2BKR B;  2IO3 B;  2LJ5 A;  3AU4 A;  2L00 B;  2NPT B;  4WJN A;  2O2V A;  5J2R A;  3A9K B;  2ZVN A;  4HPL B;  3R7Q A;  4MJS B;  2FCM A;  3H7S A;  3EC8 A;  2G4D B;  3RUL A;  4BOZ B;  2K6D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...