1ZKHA

Solution structure of a human ubiquitin-like domain in sf3a1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
PVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a human ubiquitin-like domain in SF3A1
rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Splicing factor 3 subunit 1
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1zkhA00
4MGKE 1KJTA 1V5TA 1IYFA 3HK0A 4NNJB 2JUOA 3ONSA 2EKEC 1V81A 2JT4B 2RR9A 2CS4A 2WDTB 3VVWB 2MA9B 3LDZE 2K8CA 4KZ0A 4ICVA 2DZMA 2PE6B 4M8NA 4EEWA 4G0NB 2KXJA 2NBWB 3KUZA 1WMHA 2FCQA 5D94A 1A5RA 2HTHA 4MGZE 5DCNA 4PYUA 2NR2A 5AEKB 3V62A 4B6WA 1CMXB 3WA0A 1LXDA 1GC6A 5JHBA 2O2VA 3DVNV 4ZRJA 1H4RA 3AU5A 2KWUB 3RZWC 5AZGA 2MBBB 2L3ZA 2K39A 5G2NA 4ANUA 2ZJDA 1F9JA 2ZNVC 3VDZA 5C23A 2D2QA 4IWPA 3IFWB 2AYOB 2JXXA 2KWVB 3HM6X 3DBLI 3BY4B 2UYZB 4N9F4 4A3PA 2L0FA 3ZTDA 5JZEB 1IP9A 3QWZB 3DVNU 4I6LB 4NQLB 2ZCCA 2KTRB 1WF9A 3NZUA 4PYZA 2KX0A 2KTFA 4MDKE 3U30A 1WMHB 5DPSA 2K6DB 4GDKA 4FADA 2KLGA 3WALA 5EDSA 2M1MA 3GZNI 4W9DA 4MM3A 4FLHA 3VTUA 4GSWA 4CO7A 2KC1A 2N7DA 3A9JA 4AJWA 5IA7A 1WXAA 2ZVOA 4X57B 2BKRB 3U8ZA 4EUTA 2EMTA 3A9KB 1C1YB 4WWPA 1WM3A 2J0MA 4WQOB 2DYBA 2FUHB 5CTRC 2IO0B 1L2NA 1UELA 1TZ1A 4WJOA 4F8CB 4OVVA 3TL5A 3NHEB 4LCDE 2NBVB 3KYCD 3ML8A 3L0WB 1Q5WB 2MBOA 3TIXA 2FIDA 4HDQA 3VQIA 4CHKA 2ZCBA 2BPSA 4K1RB 2OOBB 3PRZA 4MEMA 4RM8A 2R2OA 1NI2A 1WM2A 1WX9A 1BT0A 3OJ4B 4II2B 1R4MI 4ZRIA 2ZZPB 2V4LA 4DDID 5CHFA 4W9JA 2J0KA 2DYMA 3ML9A 5L95C 2KLCA 2KWCA 3VH4B 2LGYA 1UBIA 2CHXA 2KMCA 2IO1B 1WX8A 2V1YA 4BFRA 2CHWA 5GMVA 1E8YA 4FHKA 4DHJD 3ZNGC 1E7VA 2WYQA 4FBJB 3APDA 1WY8A 2JZ3B 3OJ3A 2RGFA 5LXIB 4BBNC 2KNBA 1E8ZA 2N4FA 2N7EA 2REXA 3M63B 2L05A 1MG8A 3TJPA 1GJZA 5DPWA 1WE6A 3ZTCA 2MBHA 2BWES 2L7RA 2KVRA 2IY0B 4TQ1A 1EUVB 2V3SA 3PLUA 2LASA 1UBQA 1E8XA 3ZKJC 1M94A 2Z0DB 4FA6A 1C3TA 2AWTA 1XT9B 1WFYA 4JQWC 4FJVB 4LJOB 4BKSA 2O6VD 1PQSA 4GOCA 2JF5A 3ZRCA 2NPTB 3RZFA 2ZPYA 2ZPNA 2FAZA 2FCSA 3Q3JA 3N30A 3PZDA 1GNUA 3QHTA 3L13A 4WJQA 1UH6A 4DWFA 5AZFA 1WX7A 4TKNA 1GG3A 2KTRA 4MH0E 3UGBB 4K7WA 2B3AA 4B95A 1WR1A 2DHZA 1WGGA 1NBFC 3NZSA 1WE7A 2BF8B 2KQSA 2BYEA 2LGDA 2MSED 2YVCA 4EKUA 2L8JA 3KYDD 5L83A 1WZ3A 4E71A 2LVQA 4RMAA 4BKTA 3ZNID 4ZDVA 2K1FA 4KV2A 1EF1A 3ZUNA 4ANWA 1WXVA 4F7ZA 1GUAB 2YLMA 2K8BA 4IW0A 1OTRB 1V80A 3QAQA 3L54A 3CF6E 3SU8X 2PJHA 4WJPA 2KD0A 2O2VB 3OLMD 2ZEQA 4W9KA 3R66C 1VD2A 3QJZA 4GDLA 3M95A 2RSUA 4W9CA 5C1ZA 4URKA 1WZ0A 2LXCA 4KSKC 1KLVA 3MHSD 3HHMA 2N9XA 4G3XB 5JHAA 1J19A 3VXWA 1HE8A 3ZRFA 1ISNA 2LRWA 1LFDA 3ENEA 4IM0A 4NAWB 5LXHA 2NS5A 3DPDA 3PRMB 1V86A 3L08A 4M0WB 3KVFB 4PS3A 2ZVNA 2D3GA 2QHOA 2NBUA 3IG3A 1TGZB 3H7SA 1WIAA 4K81A 2WX0A 2A5UA 5KHOA 1WJ4A 2PEAA 2N1WA 2O6VB 2LD9A 3PHWB 2DAFA 5CHWA 4HPLB 4KVGB 4IG7B 1V2YA 4NPNA 3PGEA 1EO6A 2XK5B 2LGXA 2KANA 3I3TB 2D10A 5LLIA 2KK8A 3ZNHB 3EHVA 4GU2A 2M0XA 5AZHA 1WXMA 4J6IA 4LJPB 1E5WA 2CU1A 5IAAC 4FULA 2KDEB 1WR6E 1WRDB 5BO4B 4AJYB 4MGIE 5CX3A 2GBKA 1OGWA 2DENB 2A4ZA 5J2RA 2MLBA 2KHWB 2KJ6A 3ECIA 4DHJB 3WAPA 1E8WA 2GBNA 4HK2A 2GBJA 4IM2A 2R2QA 2RPQA 1WGYA 4FJYA 4P7IA 3VH3B 2G4DB 5J17A 2JRHA 4IWQA 4HLEA 2LRUA 3JSVB 1SE9A 3A1QA 2KJRA 1Z5SB 3K9OB 1EF5A 2IBIB 2J0JA 3PHXB 4IM3A 5E6OA 2MBQA 1ZGUB 3RD2A 4M8MA 2MQJA 3H9DA 2KO3A 4DDGD 4HDOA 2KMAA 1UD7A 2DAJA 1G6JA 1WH3A 1I35A 3B0AA 3V6CB 4IC7B 5J18A 4DHZB 2DZKA 2KN5A 4W9FA 3VFKA 2Y5BB 4BBNF 4IWOA 2M8SA 3TCAA 1U4AA 4KIKA 4WWOA 3SD5A 1J8CA 4DXAB 3VTVA 2KJHB 3JYUA 3R3MA 2OJRA 1WJ6A 4PS8A 3UIOB 3H1UA 4K7SA 1ZW7A 1WJNA 4A20A 4EZKA 2PPHA 4G11A 3IVFA 2IZVB 3CMMB 1L7YA 1KM7A 3DOWA 2MP2A 3TBLD 4GDKB 3ZLZA 2C7HA 1E90A 2JZZA 5CHVC 4AUQC 3X23A 2MW5A 4W9IA 3QCAA 2KDIA 4GDLB 1Q0WB 1YJ1A 3VTWA 2KDBA 4EZLA 1YQBA 4MSMB 3KUDB 1WXSA 4AWJA 2IO3B 4ANVA 2KQ7A 4EOYA 1WGRA 5G55A 1WI0A 1UGMA 2C60A 2JWZA 2KX3A 3M3JA 4NJ7A 2JRIB 4FJZA 3TMPB 4AOFA 4EZJA 5DPTA 2W9NA 1T0YA 1V9JA 2MP2B 1S1QB 3X0WA 2XK5A 3SHQA 2UWQA 3VUWA 2MBEA 2AL3A 2NCNA 5DPRA 1JRUA 3KW5B 3QA8A 1P0RA 2I1KA 2Z0EB 4WJNA 2GBRA 3GOEA 3QARA 2KFKB 1E7UA 1YX5B 3M62B 3LJ3A 2WWZA 4MJSA 3A9KA 3K9PB 4CYEA 3HIZA 3QIJA 2C7MB 4W9EA 3NS8A 4KIKB 3PV1A 4II3B 2K8HA 3RT3B 1FXTB 4KZCA 2CKHB 4G50A 2D07B 2CR5A 3DQVA 3PTFC 2G45B 3DVGX 2LJ5A 3V6EB 4DBGA 2HJ8A 3WIMA 1WJUA 1XD3B 2KC2A 4TQ0A 1OQYA 2RD0A 3VUYA 4BOZB 4NJ6A 4F1SA 3HM3A 3W1SA 4BKGA 1P1AA 3UQAA 3CSTA 4BVUC 3QX1A 4E3CA 3CSFA 1GC7A 2HE7A 3R7QA 4AP4C 3RUIB 2IO2B 4ZYNA 1VCBA 4EFOA 1P3QU 4W9GA 1R4NI 3V61A 4FHJA 1I42A 2DX5B 2NVUI 2ZNVB 4I6PA 2C5LC 4XZ4A 3L17A 3R7RA 1H8CA 2EMSA 2JPHA 3C0RB 2JY6A 2GBMA 2I1JA 1RAXA 4HCPB 1XQQA 4A3OA 3JW0X 2KFJA 3Q3FA 4KDLB 1OEYA 3EECA 5TR5A 2CHZA 3ZO5B 2KFKA 4BOSC 4NQKE 1NDDA 1YX6B 3IBEA 3WANA 1WGDA 2NPTA 2L76A 2PE9A 4NAWA 2IYDB 3ZDTA 4ZRKA 4HJKA 5FR6A 4ANXA 2FIFA 4GB9A 3U7DA 4LDTB 2K6QA 3QQ8B 1V49A 4W9HA 3UINB 5KHQA 2XBBC 3RULA 3ZW3A 2C9WB 3QC8B 1P98A 3MTNB 2O6VA 3WAMA 3PREA 3DBSA 5D7GA 4DHZE 3KH0A 2N9PC 2LXAA 2M17A 1SIFA 3A4RA 3QK0A 5D6JB 1AARA 3AU4A 2AL6A 1TTNA 3P2BA 4GXBA 3RYTA 4B9KA 2LWPA 3L16A 1IPGA 5JH5C 2MX2A 3WAOA 2GMIC 2G4SA 2D11A 3N32A 3A9JB 3NY5A 4K7UA 4JL9A 3B08A 4PS7A 3SDLC 2XEWA 2FCNA 3H6NA 3ZDMC 2C7NB 3PT2B 4HPMB 3VUXA 1Y8RC 2KKCA 3H7PB 4GMVA 4BKSD 1LM8B 2G3QB 3O65B 3NOBA 3T9LA 2BWFA 1QZEA 1V5OA 2L00B 5HKHA 3L10B 3PPAA 2MCNB 1Q1OA 2BKFA 2HD5B 4MJSB 4JGHB 5E6NA 2BYVE 4DK5A 1WYWB 1J0GA 2MWSB 3PVLA 4TUUA 2LVOA 3UQBA 4WAAA 1KOTA 4NY0A 3IHPC 2KDFB 2M4NA 4E74A 1V6EA 3APCA 4MSQB 3DBRI 4IUMB 3RCZA 3H7PA 1S3SG 1RLFA 3DVGY 3A4SC 4KDIC 3BINA 2DZJA 2ASQA 5E6PA 4KSLC 3AXCA 4WWNA 4LDTD 2N9EB 2JVCA 4HVBA 2KZRA 2DZIA 2LUEA 2WX1A 3PSEB 4MGYE 2VRRB 3PS6A 4FN2A 2MRPA 4XC2A 3ZIMA 4MELA 4OVUA 3ZVVA 2Z59B 3S2AA 2FCMA 1P9DU 1OEYJ 2LZ6A 3A1QB 3DCGA 4I6NB 1D3ZA 1RFAA 3B1LX 4W9LA 5D2MB 3JSVA 2LVPA 2BGFA 2K25A 3KUCB 3W1SC 1X1MA 3OAWA 3PRPB 2KOXA 1Z2MA 4HCNB 3AI5A 4ICUA 4JIOU 3V60A 2L0TA 1SGHA 1WGHA 4GGQA 3ALBA 4GIVA 4HXDA 3MJWA 1TBEA 1YD8U 3W1YA 3VAWA 1ZKHA 2J7QB 3DDCB 3APFA 3A33B 2AEHA 2FNJB 3UF8A 3VHTC 3JVZX 2N1VA 1UZXB 1YIWA 3UIPB 2DYOA 3EFUA 3PLVA 4ASWC 2BYFA 4TV3A 4GN1A 4HWIB 3T8MA 3D32A 1LQBA 2LI5A 4XX5A 1RRBA 3DBHI 3EC8A 3AULA 2IY1B 3ZNZB 4YL8A 1K8RB 4RM9A 4JLCA 3N3KB 2GOWA
chains in the Genus database with same CATH superfamily
3NS1A 2BS3B 1IBXA 1V81A 3C8YA 4HEA1 3LDZE 1N5XA 4ICVA 1I4RA 4US9A 3KUZA 5EE1A 1JWSD 3EFCA 4MGZE 5DCNA 1LXDA 1GC6A 5JHBA 4ZRJA 2VZKB 1YN5A 3HRDD 2DNFA 4WH4A 4HKZE 3CIRB 1MG4A 3TEWA 1SE2A 1D5XC 1L0XB 4A55A 5C23A 2D2QA 4N9F4 2L0FA 3ZTDA 1D5ZC 3QWZB 3HUIA 3N9YC 1WF9A 3VR9B 1FEHA 2KQ4X 3U30A 2WHIA 2V0GA 1QOAA 3Q3NC 3OG5A 1WXAA 2ZVOA 1HZ5A 1D6EC 1F2RC 2WXQA 4EE2A 2FUHB 2JX5A 2NBVB 2K9XA 3KYCD 3ML8A 3L0WB 3URYA 4HDQA 3RNEC 1T0RC 2LGIA 3Q2AC 3PRZA 1NI2A 4ZRIA 2J0KA 1STEA 3VH4B 2D3AA 5GMVA 4FBJB 2JZ3B 3TEZA 2RGFA 1UWMA 2MH7A 3FKYA 2N4FA 3TJPA 5EE9A 2MBHA 1FFUA 3PLUA 1ZOYB 1C3TA 1M94A 3AE4B 1HEZE 5IO9A 3L13A 3HVZA 1WX7A 3P4PB 3W5VB 2Y5CA 2BF8B 2BYEA 1E7PB 4EKUA 1N61A 1P7EA 4RMAA 1V1OA 1EM7A 2K8BA 1OTRB 1V80A 3L54A 1DOIA 2PJHA 3BWUD 3AECB 3OLMD 1JMLA 1WZ0A 1KLVA 1QF6A 3HHMA 5D3IB 1ET6A 3ZRFA 1UF0A 1QKZA 2K22A 1MHXA 4NAWB 5LXHA 3W9CB 2V3NA 4HPPA 1HZ6A 2MEKA 3IG3A 1IGDA 2Y3AA 2WX0A 2A5UA 2N1WA 3PHWB 2AQ3B 1V2YA 4NPNA 1F1HA 3U4EG 2D10A 5LLIA 3EHVA 2WXNA 5AZHA 1WXMA 2UU7A 4AJYB 2IJ0A 2LFIA 1RM6C 2W82A 3KQ4A 1JROA 2W3RA 2KJ6A 1E8WA 2GBNA 1FXAA 1HXYD 4IM2A 2R2QA 4FJYA 3VH3B 4ZOHC 2G4DB 3IT6B 1FCLA 1I4GA 2KJRA 1Z5SB 3K9OB 4IM3A 2IBIB 3Q8BA 3RD2A 5FK9C 2MBQA 1E10A 2DAJA 5C2TB 1WH3A 4L1BA 4DHZB 2KN5A 1XLNA 3Q6BA 4W9FA 4K3BA 2QMTA 1U4AA 4KIKA 2PLPA 3SD5A 3BYTB 2WXOA 3H1UA 1WJNA 4A20A 3MHZA 4G11A 5BYSA 1YMHE 3B9JA 2MJEA 1KM7A 3TBLD 4AUQC 3X23A 3QCAA 4GDLB 1MVKA 3VTWA 2KDBA 1FXIA 1WXSA 2I38A 2IO3B 1WGRA 1SE3A 4EZJA 2FE8A 3X0WA 1N63A 1KH0A 3SHQA 2UWQA 2N9LA 1JQ4A 2NCNA 5DPRA 1JRUA 3KW5B 4TSSA 4WJNA 2Q5WD 2JQRB 3M62B 1YX5B 2V9HA 1M4VA 4W9EA 1SJED 2G9HD 3NS8A 1R4NB 3PV1A 1TZOA 3Q8EA 2JYTA 4G50A 2D07B 3DQVA 3DVGX 2HJ8A 2KC2A 4BOZB 3HM3A 4S17A 4E3CA 3R7QA 4AP4C 3RUIB 4EFOA 1I42A 2NVUI 2ZNVB 1TKEA 1BUIC 1XQQA 1WGKA 1SIJA 1A70A 2PE9A 2NPTA 4XGAB 4ZRKA 1L4DB 2IPKD 5KHQA 2INPE 2O6VA 4LTUA 3KH0A 2WGSA 3QK0A 1VLBA 1TTNA 2W54A 1L6UA 2D11A 3NY5A 3A9JB 3Q69A 4K7UA 2D5GA 1HTQA 3ZDMC 2C7NB 3PT2B 3AE2B 1LM8B 3O65B 1SBBB 2BWFA 1MHHE 1NYQA 2L83A 3NG0A 4DK5A 1J0GA 5H92C 4ITKA 4TUUA 3UQBA 1LO5D 1KOTA 3CWIA 2KDFB 1V6EA 3APCA 4KKIA 4MSQB 4C7ZA 2BBCA 4IUMB 1MFWA 3DVGY 3FAHA 4LNIA 2N9EB 2JVCA 5IKCM 2KZRA 3PSEB 4MGYE 1KFYB 4MELA 4OVUA 3S2AA 2FCMA 4M01A 3B1LX 4W9LA 2BGFA 2K25A 4R3DA 3OAWA 1N60A 2WXRA 2M56B 4ICUA 3AI5A 4JIOU 3PO0A 3DWMA 1WRIA 1WGHA 3ALBA 1CK1A 3MJWA 3W5UB 1YD8U 4ZHOA 3DDCB 1VDVA 1YIWA 2PKOA 2ZW1A 4TV3A 4GN1A 1FNUA 1LQBA 4HROA 1RRBA 3N20C 4PT5A 1TS4A 3VFKA 2GOWA 4MGKE 1V5TA 2JUOA 3MJ5A 2LJIA 2EKEC 4J3OD 2CS4A 1I4QA 4P1BC 4PYUA 2KT7A 1YN4A 3Q8AA 5AEKB 1BXTA 1BMLC 2BT6A 5IN7A 1H4RA 2JYEA 4JWSC 4DQOC 3RZWC 3ZJTA 5G2NA 1KRHA 1JWUD 2ZJDA 2IGGA 1JRPA 3HM6X 3BYYB 3BY4B 3DBLI 4ACFA 2UYZB 2LUMA 4I6LB 2PIAA 3SEBA 1MPEA 3NZ3A 4MDKE 5DPSA 4GDKA 2KLGA 4CO7A 3VTUA 4MM3A 1T6BX 5IA7A 4X57B 4EUTA 3P63A 1ENFA 1WM3A 2J0MA 4WQOB 5FR3A 1L2NA 1T5XD 4F8CB 4OVVA 3TL5A 1WXQA 2MBOA 3TIXA 2FIDA 5C3JB 3VQIA 4K1RB 4MEMA 2R2OA 5FKAC 2M19A 3OJ4B 1WX9A 1BT0A 4II2B 4OZBA 1CJEA 3RNGC 2KWCA 3P4QB 2LGYA 5G5HA 2BTEA 1VZ7A 2IO1B 1WX8A 3R2TA 1E8YA 4FHKA 1E7VA 2V4IB 1QILA 1L0YB 3FC4A 5I4DA 1E8ZA 2KACA 2L05A 1MG8A 1YN3A 5DPWA 1WE6A 2IY0B 2L7RA 2KDMA 2V3SA 2LASA 4JX1C 2AWTA 1XT9B 2D3BA 4BKSA 1TS5A 3ZRCA 2NPTB 4A9AA 2ZPNA 4WURA 4RGOS 2FAZA 3NJTA 2FCSA 4LNOA 3QHTA 4DWFA 1UH6A 5AZFA 1DOYA 4TKNA 1GG3A 3UGBB 1P7FA 4K7WA 4JE3B 1WR1A 2YVCA 2MSED 3KYDD 4E71A 4BKTA 3PZ8A 3NRZA 2E6XA 3ZUNA 3ZXRA 4F7ZA 1ET9A 2N9KA 1GUAB 2YLMA 4IW0A 1QQRA 4P16A 3QAQA 2EELA 3RN9C 3SFEB 2NTSA 4GLSC 2J53A 3ZJVA 4WJPA 2WDQB 1YQ4B 1VD2A 2BS4B 4LNNA 2LXCA 1QOGA 3DHHC 3KWLA 2N9XA 5HI1A 5JHAA 1J19A 1ISNA 3C19A 2LRWA 3ENEA 4IM0A 2NS5A 1PGXA 3DPDA 1V86A 1XO3A 2WU2B 4M0WB 4Q2JA 4PS3A 2D3GA 1TGZB 3H7SA 4K81A 3U2SC 5KHOA 4P1CC 1SSNA 4IG7B 3PGEA 2LGXA 2QDFA 3I3TB 4BZAA 1RFKA 5AUKA 5IAAC 2CU1A 4IKGA 4M00A 2KDEB 1T0QC 1SEBD 1WR6E 2QSDA 5CX3A 4FXCA 3SR6A 3VRBB 5J2RA 1PGBA 4N58A 3I57A 1WGYA 2KVZA 5J17A 3ZQ4A 4IWQA 3NVVA 3JSVB 1L0VB 1WWTA 4DXGA 2J0JA 3PHXB 1ZGUB 3B2GA 4M8MA 4DDGD 2KMAA 2H88B 1G6JA 1I35A 3V6CB 4IC7B 3P42A 1RYJA 2DZKA 4BBNF 4IWOA 1MJDA 3RNCC 2SEBD 3IAS1 5BMIA 3JYUA 3R3MA 1WJ6A 4PS8A 3UIOB 2QC8A 1IUEA 3RNAC 1PGAA 1FIQA 2JZZA 2JZPA 1YJ1A 4IOIE 2JWUA 2NTTA 4YXDB 1FD6A 1N5WA 2KQ7A 1PUTA 5G55A 2C60A 3M3JA 3TMPB 3BIID 5DPTA 3HVDA 1S1QB 1SB3C 3VUWA 1D4BA 3QA8A 1P0RA 4K3CA 2Z0EB 3QARA 1AYFA 1E7UA 1PFDA 1LGRA 2WWZA 4MJSA 4CYEA 2DBYA 3U7ZA 1ZDVA 4HKQA 1FXTB 4KZCA 3E56A 2CR5A 2LJ5A 4TQ0A 1XD3B 4JWUC 3B2FA 3VUYA 3BK1A 1I7HA 3VRAB 1P1AA 4BVUC 2ZW0A 1GC7A 2DLBA 4WAFA 4W9GA 2C5LC 1EWCA 3L17A 3BZDB 4NJCA 2WNMA 3R7RA 4US8A 5HHDG 2I1JA 4HCPB 3ZGZA 2LEKA 5IP4D 1XCTL 3LYYA 1CQVA 4C80A 1TY0A 3EECA 2CHZA 3ZO5B 3AE9B 4BOSC 3SFDB 3IBEA 2D3CA 4NAWA 2L52A 1NEKB 5FR6A 3U7DA 3QQ8B 3UINB 2C9WB 5LNK1 3MTNB 5D7GA 3AEFB 2M0AA 2N9PC 4OZAA 2M17A 4HJGE 2NMQA 3A4RA 3AU4A 3DHGC 3RNBC 5JXVA 1IPGA 2EKIA 4TMAB 2GMIC 2G4SA 4MM3B 2FCNA 3H6NA 3H8HA 3H7PB 4GMVA 3AV8A 3AE3B 4YWGG 1RWSA 4PK1A 2QILA 2L00B 4LLGM 2KN4A 2HD5B 2BYVE 2JSVX 2MWSB 4WAAA 2M4NA 3MFGA 1GAQB 1YOVB 3H7PA 1ZE3D 3A4SC 3BINA 2ASQA 3EA6A 3IT4B 4YSZB 4AS1A 3W2DA 4A8XC 3MP9A 4HVBA 3AE7B 2DZIA 2LUEA 2LHEA 2MRPA 3ZVVA 3A1QB 4I6NB 1VZ8A 3AE5B 3KUCB 1QLBB 3PRPB 2BW2A 3V60A 3LXFA 3PZ7A 3GS2A 3AN1A 1ZKHA 3APFA 1C9FA 3A33B 2I2YA 3UF8A 2N1VA 1KF6B 3EFUA 5BYQA 1K52A 1NYRA 3D32A 3R8BA 2E3TA 4XX5A 1ZP0B 3EC8A 4OVZA 2IY1B 2RDHA 2CJOA 1K8RB 4RM9A 1J7BA 4JLCA 4D2KA 3N3KB 1YJIA 1IYFA 4NNJB 4MT5A 3ONSA 2IGDA 2MA9B 4CQNA 2K8CA 4KZ0A 1UWXA 2PE6B 4NZLB 4G0NB 2KXJA 2WS3B 2NBWB 2FCQA 2HTHA 2KAJA 2NR2A 1E0ZA 1UGJA 3V62A 3N1ZC 5HG2A 2O2VA 4ZYSA 3AU5A 2KWUB 4LK0M 5AZGA 2MBBB 2K39A 3VDZA 1F9JA 4XYCA 2AYOB 1E9MA 3AEBB 4A3PA 1IP9A 1HQRD 2HDEA 2RDBC 4USAA 2KX0A 2LHDA 2K6DB 4ARIA 4FADA 5EDSA 2M1MA 3GZNI 4GSWA 3A9JA 2WXHA 4AJWA 2BKRB 3U8ZA 2EMTA 4WWPA 2DYBA 5CTRC 2IO0B 2N7JA 4WJOA 2K0PA 1EU4A 3TSSA 1XLPA 1Q5WB 4CHKA 2FBWB 2BPSA 1FRDA 1R4MI 2ZZPB 4DXFA 5CHFA 2DYMA 3ML9A 3NVWA 1DGJA 1C79A 4YT0B 1UBIA 2CHXA 2TSSA 2KMCA 2QJLA 3ZXVA 1SJHD 4BFRA 2WYQA 3APDA 1WY8A 5G5GA 3OJ3A 2X38A 3DBHB 5LXIB 2KNBA 2N7EA 1TT5B 1SXTA 1TIFA 1GJZA 2GRIA 4L23A 4TQ1A 1EUVB 3GP7A 4FA6A 4C7YA 1WFYA 3NVZA 2ICIA 4JQWC 4LJOB 4GOCA 1I4PA 2JF5A 3TEXA 3RZFA 2ZPYA 1KTKA 4A90A 3N30A 1GNUA 2ONQA 3Q3MC 2QIEB 4H2AA 2RDGA 2KTRA 3E9SA 1K51A 1WGGA 1NBFC 3NZSA 2LGDA 2L8JA 2LVQA 3ZNID 2QEJC 4ZDVA 4KV2A 4ANWA 1HTOA 1FFVA 3DHIC 4C4VB 1KLGD 2BS2B 3SU8X 2K5PA 1K53A 3R66C 5C1ZA 2RSUA 4URKA 1ZDXA 4G3XB 1D5MC 3N1XC 1UNSA 1OFFA 2L1AA 5EE0A 1FRRA 3PRMB 1XXGA 3L08A 3KVFB 4RF0A 2ZVNA 2QHOA 3MC9A 2NBUA 3I63C 2O6VB 1HA5A 4HPLB 4KVGB 1EO6A 2XK5B 2B76B 2KANA 1AN8A 3TUOA 2KK8A 3ZNHB 4GU2A 2M0XA 4J6IA 2BYTA 4FULA 3T3OA 2GBKA 1FPYA 1OGWA 1FNVA 1AWDA 2MLBA 2K3UA 2KHWB 1CZPA 4DHJB 4HK2A 1YNTE 2GBJA 1C4PA 2RPQA 3I9V1 4L2YA 1GB1A 1VRAB 2AQ2B 2JRHA 4HLEA 2WDRB 2IDYA 3IXSA 3BK2A 2MQJA 2KO3A 4HDOA 2OJWA 1JCKB 1UD7A 2G1EA 5J18A 3DBLB 5D3DA 2Y5BB 2M8SA 1J8CA 3VTVA 4RCOA 2OJRA 4K7SA 2WDVB 1E6EB 1ZW7A 4O1NA 1YQ3B 2QCZA 2WXKA 3IVFA 2IZVB 3CMMB 3AM9A 4GDKB 3ZLZA 3AEGB 1E90A 5CHVC 3N1YC 2MW5A 2KDIA 1Q0WB 1ZPSA 1V97A 1TY2A 1YQBA 2WLBA 4ANVA 4EOYA 1UGMA 4AOFA 2JRIB 4FJZA 1C76A 1JWMD 2W9NA 1NENB 1SE4A 2J4XA 1C77A 2MBEA 2AL3A 1XEEA 2I1KA 4N59A 4KGSA 2KWDA 1C78A 4XE0A 5T8IA 3HIZA 4KIKB 1WYGA 3RT3B 2WU5B 5E6JA 3PTFC 1KLUD 3V6EB 4M02A 1WJUA 4XDDA 1OQYA 1FM0D 2RD0A 4NJ6A 4F1SA 4BKGA 3GZNB 2KMMA 4MH8A 3UQAA 3CSFA 4OZCA 3BVGA 2IO2B 1P3QU 3V61A 4FHJA 2DX5B 4I6PA 2EMSA 2INNE 1NVID 1J7CA 2GBMA 1RAXA 4A6QA 4ZRPA 4N6EB 2R61A 2WXGA 1DYQA 2PW9A 2KFKA 1YX6B 3WANA 4OHJA 1GOZA 2L76A 2IYDB 3ZDTA 2RPVA 4HJKA 4ANXA 2W3SA 3L4PA 4RGMA 4W9HA 2XBBC 3QC8B 3PREA 3DBSA 4DHZE 4WQMA 1SIFA 4GXBA 4C00A 2LWPA 4P6VF 1FO4A 2MX2A 3WAOA 3N32A 1F77A 3B08A 4BAXA 3SDLC 2XEWA 1ESFA 1Y8RC 2IGHA 2G3QB 1V5OA 5HKHA 1J7AA 1B1ZA 3L10B 1Q1OA 2BKFA 4MJSB 2MCNB 4JGHB 1WYWB 1C4CA 3PVLA 4NY0A 3DBRI 2WXFA 2DWQA 3MC8A 1S3SG 2DZJA 3ZJUA 4LDTD 2PVGC 3OWEB 4NAMA 2WX1A 2VRRB 3PS6A 4FN2A 4XC2A 1P9DU 1OEYJ 2VH1A 3DCGA 1RFAA 2LVPA 3ZYYX 3RMKC 3V05A 4GGQA 4GIVA 4HXDA 1TBEA 3W1YA 3VAWA 2J7QB 1R4MB 2WXMA 2BB5A 2AEHA 1UZXB 1ROEA 2BYFA 4HWIB 3Q3OC 3U52E 1N6ZA 3T8MA 4KX6B 2LI5A 1T0SC 3DBHI 1PDXA 1TS3A 1F52A 3ZNZB 3FILA 4XWTA 2HTME 3CF6E 1KJTA 4RF1A 3GE8C 3HK0A 2JU6X 4RNAA 2JT4B 2RR9A 2WDTB 3VVWB 2DZMA 1QOFA 4M8NA 4EEWA 5D94A 1WMHA 1A5RA 1K50A 4MACA 4B6WA 1CMXB 3LB8C 3WA0A 3AMZA 3DVNV 1TYGB 3EGRA 2FUG1 2L3ZA 4ANUA 1ACCA 1MI0A 2ZNVC 4IWPA 3IFWB 2JXXA 2KWVB 4REZA 5JZEB 3DVNU 4NQLB 2ZCCA 2KTRB 1WSPA 3J9CA 3NZUA 4PYZA 2KTFA 3P4RB 4ZRQA 1WMHB 2PMVA 2INDC 3P1MA 2Y5PA 3WALA 4W9DA 4FLHA 2KC1A 2N7DA 2ACZB 1JALA 4UDUC 3A9KB 1FMAD 1C1YB 4AQ7A 2RMMA 2BQQA 3T3NA 1UELA 1TZ1A 3BVZA 1NI3A 3VR8B 3NHEB 4RGNA 4LCDE 1TKGA 1TKYA 3R2IA 4WWMA 3AEAB 2ZCBA 2BB6A 5H8YE 4QAYA 2OOBB 1I4HA 4RM8A 1WM2A 2V4LA 3IAM1 4DDID 4W9JA 5L95C 4HRSA 2LGSA 2KLCA 2V1YA 2CHWA 4DHJD 3ZNGC 1L6VA 4BBNC 1F0ZA 2REXA 2WP9B 3M63B 4C56C 3ZTCA 2BWES 3Q8FA 2KVRA 1UBQA 1E8XA 5BMGA 3ZKJC 2Z0DB 2BVCA 4FJVB 2W55A 2O6VD 1PQSA 3BVMA 2N0SB 2WXPA 1AW7A 2WQYB 4YTMB 3Q3JA 1GB4A 3NUHB 3PZDA 4ZHPA 4WJQA 5MPOA 3O13A 1GPXA 4MH0E 1C4AA 4C4VA 2B3AA 4B95A 2DHZA 1WE7A 2KQSA 1EU3A 5L83A 1JWBD 1WZ3A 1V1PB 2K1FA 5EE3A 1EF1A 1WXVA 2INCC 2KD0A 2O2VB 3AE6B 2ZEQA 4W9KA 3QJZA 4GDLA 3M95A 4W9CA 4KSKC 4RH6A 3MHSD 3P4SB 4WIPA 1SF0A 3VXWA 1HE8A 2GLSA 3NVYA 2XNAC 4B0MA 1LFDA 1JWAD 1L5PA 3WCQA 3V3XA 4RGTA 2AX5A 1WIAA 3GE3C 2PTLA 1WJ4A 5AUIA 2PEAA 1OQQA 2LD9A 2DAFA 5CHWA 4OW0A 1TJEA 1VR9A 2JXTA 3DBRB 4LJPB 1E5WA 1B9RA 1WRDB 5BO4B 1N62A 4MGIE 1L4ZB 4KKJA 2DENB 2A4ZA 4M0WA 3ECIA 3WAPA 1OQRA 3Q14C 3MC0B 4P7IA 2YEPB 2ON8A 4B0EA 2LRUA 1SE9A 2H89B 3A1QA 1EF5A 2CJNA 5E6OA 2GB1A 1V8CA 4XDCA 3AH7A 1I4XA 3H9DA 3Q8CA 1VZ6A 1PYWD 3B0AA 5GXGB 2PVOD 3ABVB 3TCAA 4WWOA 4LNFA 1F2RI 1Q10A 4DXAB 2KJHB 1TS2A 2PPHA 4EZKA 2CU3A 1L7YA 2V3PA 3DOWA 2MP2A 2C7HA 3RFZB 4W9IA 2WXIA 3RPFC 4EZLA 4MSMB 3KUDB 3RNFC 4AWJA 4RFBA 1WI0A 2JWZA 4NJ7A 2KX3A 2VZKD 1T0YA 1V9JA 2MP2B 2WXLA 2XK5A 1V1PA 3TEYA 3UI3A 3AE1B 1JW9D 2GBRA 3GOEA 5BYRA 2XN9C 2KFKB 3RI7C 1ZXIA 3LJ3A 2WXJA 2MHJA 3A9KA 3K9PB 3QIJA 2C7MB 4II3B 1XLOA 2K8HA 3AE8B 2CKHB 1UUPA 2G45B 4DBGA 3KWVA 3WIMA 1T3QA 3W1SA 1FNWA 3CSTA 4IDIA 3QX1A 1FCCC 4YSXB 2HE7A 5TSSA 3ETRA 4ZYNA 1VCBA 5BMHA 1R4NI 4XZ4A 2VH2A 1H8CA 2JPHA 3C0RB 1XLQA 2JY6A 1EWYC 4A3OA 3JW0X 3EUB2 2KFJA 3Q3FA 4KDLB 1OEYA 1ZXHA 5TR5A 4NQKE 1NDDA 1YJJA 3I5JC 1WGDA 2FIFA 4GB9A 4LDTB 2K6QA 1XCQL 1V49A 2J42A 3RULA 2X8XX 3ZW3A 1P98A 4JPSA 3WAMA 4LNKA 4ARCA 3KLSX 2LXAA 1ZUD2 2MJ3A 1AARA 3FILB 5D6JB 2AL6A 3P2BA 3RYTA 4B9KA 3L16A 5JH5C 1XF5L 4PS7A 4JL9A 2MJDA 1R7SA 2J52A 4HPMB 3VUXA 2KKCA 4KGRA 4BKSD 4S0RA 1VJKA 3NOBA 3T9LA 1QZEA 1DOXA 3PPAA 5E6NA 2LVOA 2YEPF 3IHPC 1QT9A 4E74A 5HFYA 3RCZA 1RLFA 2KYWA 2AQ1B 5E6PA 4KSLC 3DWGC 4XWWA 3AXCA 4WWNA 3AB5A 3ZIMA 2Z59B 2LZ6A 2OHFA 1D3ZA 5D2MB 2SAKA 3JSVA 2Z8LA 3W1SC 1X1MA 4YSYB 2KOXA 2OEDA 1Z2MA 4HCNB 2L0TA 1SGHA 2LMCA 3AEDB 1IBXB 5IOIA 4YTNB 4YTPB 3GB1A 2FNJB 3VHTC 3JVZX 3UIPB 2DYOA 2GI9A 3PLVA 4ASWC 3AEEB 1IGCA 2L32A 3AULA 4KGTA 1QOBA 4YL8A 1Y56A 2HJ1A 4KDIC
chains in the Genus database with same CATH topology
4MGKE 1KJTA 1V5TA 1IYFA 3HK0A 4NNJB 2JUOA 3ONSA 2EKEC 1V81A 2JT4B 2RR9A 2CS4A 2WDTB 3VVWB 2MA9B 3LDZE 2K8CA 4KZ0A 4ICVA 2DZMA 2PE6B 4M8NA 4EEWA 4G0NB 2KXJA 2NBWB 3KUZA 1WMHA 2FCQA 5D94A 1A5RA 2HTHA 4MGZE 5DCNA 4PYUA 2NR2A 5AEKB 3V62A 4B6WA 1CMXB 3WA0A 1LXDA 1GC6A 5JHBA 2O2VA 3DVNV 4ZRJA 1H4RA 3AU5A 2KWUB 3RZWC 5AZGA 2MBBB 2L3ZA 2K39A 5G2NA 4ANUA 2ZJDA 1F9JA 2ZNVC 3VDZA 5C23A 2D2QA 4IWPA 3IFWB 2AYOB 2JXXA 2KWVB 3HM6X 3DBLI 3BY4B 2UYZB 4N9F4 4A3PA 2L0FA 3ZTDA 5JZEB 1IP9A 3QWZB 3DVNU 4I6LB 4NQLB 2ZCCA 2KTRB 1WF9A 3NZUA 4PYZA 2KX0A 2KTFA 4MDKE 3U30A 1WMHB 5DPSA 2K6DB 4GDKA 4FADA 2KLGA 3WALA 5EDSA 2M1MA 3GZNI 4W9DA 4MM3A 4FLHA 3VTUA 4GSWA 4CO7A 2KC1A 2N7DA 3A9JA 4AJWA 5IA7A 1WXAA 2ZVOA 4X57B 2BKRB 3U8ZA 4EUTA 2EMTA 3A9KB 1C1YB 4WWPA 1WM3A 2J0MA 4WQOB 2DYBA 2FUHB 5CTRC 2IO0B 1L2NA 1UELA 1TZ1A 4WJOA 4F8CB 4OVVA 3TL5A 3NHEB 4LCDE 2NBVB 3KYCD 3ML8A 3L0WB 1Q5WB 2MBOA 3TIXA 2FIDA 4HDQA 3VQIA 4CHKA 2ZCBA 2BPSA 4K1RB 2OOBB 3PRZA 4MEMA 4RM8A 2R2OA 1NI2A 1WM2A 1WX9A 1BT0A 3OJ4B 4II2B 1R4MI 4ZRIA 2ZZPB 2V4LA 4DDID 5CHFA 4W9JA 2J0KA 2DYMA 3ML9A 5L95C 2KLCA 2KWCA 3VH4B 2LGYA 1UBIA 2CHXA 2KMCA 2IO1B 1WX8A 2V1YA 4BFRA 2CHWA 5GMVA 1E8YA 4FHKA 4DHJD 3ZNGC 1E7VA 2WYQA 4FBJB 3APDA 1WY8A 2JZ3B 3OJ3A 2RGFA 5LXIB 4BBNC 2KNBA 1E8ZA 2N4FA 2N7EA 2REXA 3M63B 2L05A 1MG8A 3TJPA 1GJZA 5DPWA 1WE6A 3ZTCA 2MBHA 2BWES 2L7RA 2KVRA 2IY0B 4TQ1A 1EUVB 2V3SA 3PLUA 2LASA 1UBQA 1E8XA 3ZKJC 1M94A 2Z0DB 4FA6A 1C3TA 2AWTA 1XT9B 1WFYA 4JQWC 4FJVB 4LJOB 4BKSA 2O6VD 1PQSA 4GOCA 2JF5A 3ZRCA 2NPTB 3RZFA 2ZPYA 2ZPNA 2FAZA 2FCSA 3Q3JA 3N30A 3PZDA 1GNUA 3QHTA 3L13A 4WJQA 1UH6A 4DWFA 5AZFA 1WX7A 4TKNA 1GG3A 2KTRA 4MH0E 3UGBB 4K7WA 2B3AA 4B95A 1WR1A 2DHZA 1WGGA 1NBFC 3NZSA 1WE7A 2BF8B 2KQSA 2BYEA 2LGDA 2MSED 2YVCA 4EKUA 2L8JA 3KYDD 5L83A 1WZ3A 4E71A 2LVQA 4RMAA 4BKTA 3ZNID 4ZDVA 2K1FA 4KV2A 1EF1A 3ZUNA 4ANWA 1WXVA 4F7ZA 1GUAB 2YLMA 2K8BA 4IW0A 1OTRB 1V80A 3QAQA 3L54A 3CF6E 3SU8X 2PJHA 4WJPA 2KD0A 2O2VB 3OLMD 2ZEQA 4W9KA 3R66C 1VD2A 3QJZA 4GDLA 3M95A 2RSUA 4W9CA 5C1ZA 4URKA 1WZ0A 2LXCA 4KSKC 1KLVA 3MHSD 3HHMA 2N9XA 4G3XB 5JHAA 1J19A 3VXWA 1HE8A 3ZRFA 1ISNA 2LRWA 1LFDA 3ENEA 4IM0A 4NAWB 5LXHA 2NS5A 3DPDA 3PRMB 1V86A 3L08A 4M0WB 3KVFB 4PS3A 2ZVNA 2D3GA 2QHOA 2NBUA 3IG3A 1TGZB 3H7SA 1WIAA 4K81A 2WX0A 2A5UA 5KHOA 1WJ4A 2PEAA 2N1WA 2O6VB 2LD9A 3PHWB 2DAFA 5CHWA 4HPLB 4KVGB 4IG7B 1V2YA 4NPNA 3PGEA 1EO6A 2XK5B 2LGXA 2KANA 3I3TB 2D10A 5LLIA 2KK8A 3ZNHB 3EHVA 4GU2A 2M0XA 5AZHA 1WXMA 4J6IA 4LJPB 1E5WA 2CU1A 5IAAC 4FULA 2KDEB 1WR6E 1WRDB 5BO4B 4AJYB 4MGIE 5CX3A 2GBKA 1OGWA 2DENB 2A4ZA 5J2RA 2MLBA 2KHWB 2KJ6A 3ECIA 4DHJB 3WAPA 1E8WA 2GBNA 4HK2A 2GBJA 4IM2A 2R2QA 2RPQA 1WGYA 4FJYA 4P7IA 3VH3B 2G4DB 5J17A 2JRHA 4IWQA 4HLEA 2LRUA 3JSVB 1SE9A 3A1QA 2KJRA 1Z5SB 3K9OB 1EF5A 2IBIB 2J0JA 3PHXB 4IM3A 5E6OA 2MBQA 1ZGUB 3RD2A 4M8MA 2MQJA 3H9DA 2KO3A 4DDGD 4HDOA 2KMAA 1UD7A 2DAJA 1G6JA 1WH3A 1I35A 3B0AA 3V6CB 4IC7B 5J18A 4DHZB 2DZKA 2KN5A 4W9FA 3VFKA 2Y5BB 4BBNF 4IWOA 2M8SA 3TCAA 1U4AA 4KIKA 4WWOA 3SD5A 1J8CA 4DXAB 3VTVA 2KJHB 3JYUA 3R3MA 2OJRA 1WJ6A 4PS8A 3UIOB 3H1UA 4K7SA 1ZW7A 1WJNA 4A20A 4EZKA 2PPHA 4G11A 3IVFA 2IZVB 3CMMB 1L7YA 1KM7A 3DOWA 2MP2A 3TBLD 4GDKB 3ZLZA 2C7HA 1E90A 2JZZA 5CHVC 4AUQC 3X23A 2MW5A 4W9IA 3QCAA 2KDIA 4GDLB 1Q0WB 1YJ1A 3VTWA 2KDBA 4EZLA 1YQBA 4MSMB 3KUDB 1WXSA 4AWJA 2IO3B 4ANVA 2KQ7A 4EOYA 1WGRA 5G55A 1WI0A 1UGMA 2C60A 2JWZA 2KX3A 3M3JA 4NJ7A 2JRIB 4FJZA 3TMPB 4AOFA 4EZJA 5DPTA 2W9NA 1T0YA 1V9JA 2MP2B 1S1QB 3X0WA 2XK5A 3SHQA 2UWQA 3VUWA 2MBEA 2AL3A 2NCNA 5DPRA 1JRUA 3KW5B 3QA8A 1P0RA 2I1KA 2Z0EB 4WJNA 2GBRA 3GOEA 3QARA 2KFKB 1E7UA 1YX5B 3M62B 3LJ3A 2WWZA 4MJSA 3A9KA 3K9PB 4CYEA 3HIZA 3QIJA 2C7MB 4W9EA 3NS8A 4KIKB 3PV1A 4II3B 2K8HA 3RT3B 1FXTB 4KZCA 2CKHB 4G50A 2D07B 2CR5A 3DQVA 3PTFC 2G45B 3DVGX 2LJ5A 3V6EB 4DBGA 2HJ8A 3WIMA 1WJUA 1XD3B 2KC2A 4TQ0A 1OQYA 2RD0A 3VUYA 4BOZB 4NJ6A 4F1SA 3HM3A 3W1SA 4BKGA 1P1AA 3UQAA 3CSTA 4BVUC 3QX1A 4E3CA 3CSFA 1GC7A 2HE7A 3R7QA 4AP4C 3RUIB 2IO2B 4ZYNA 1VCBA 4EFOA 1P3QU 4W9GA 1R4NI 3V61A 4FHJA 1I42A 2DX5B 2NVUI 2ZNVB 4I6PA 2C5LC 4XZ4A 3L17A 3R7RA 1H8CA 2EMSA 2JPHA 3C0RB 2JY6A 2GBMA 2I1JA 1RAXA 4HCPB 1XQQA 4A3OA 3JW0X 2KFJA 3Q3FA 4KDLB 1OEYA 3EECA 5TR5A 2CHZA 3ZO5B 2KFKA 4BOSC 4NQKE 1NDDA 1YX6B 3IBEA 3WANA 1WGDA 2NPTA 2L76A 2PE9A 4NAWA 2IYDB 3ZDTA 4ZRKA 4HJKA 5FR6A 4ANXA 2FIFA 4GB9A 3U7DA 4LDTB 2K6QA 3QQ8B 1V49A 4W9HA 3UINB 5KHQA 2XBBC 3RULA 3ZW3A 2C9WB 3QC8B 1P98A 3MTNB 2O6VA 3WAMA 3PREA 3DBSA 5D7GA 4DHZE 3KH0A 2N9PC 2LXAA 2M17A 1SIFA 3A4RA 3QK0A 5D6JB 1AARA 3AU4A 2AL6A 1TTNA 3P2BA 4GXBA 3RYTA 4B9KA 2LWPA 3L16A 1IPGA 5JH5C 2MX2A 3WAOA 2GMIC 2G4SA 2D11A 3N32A 3A9JB 3NY5A 4K7UA 4JL9A 3B08A 4PS7A 3SDLC 2XEWA 2FCNA 3H6NA 3ZDMC 2C7NB 3PT2B 4HPMB 3VUXA 1Y8RC 2KKCA 3H7PB 4GMVA 4BKSD 1LM8B 2G3QB 3O65B 3NOBA 3T9LA 2BWFA 1QZEA 1V5OA 2L00B 5HKHA 3L10B 3PPAA 2MCNB 1Q1OA 2BKFA 2HD5B 4MJSB 4JGHB 5E6NA 2BYVE 4DK5A 1WYWB 1J0GA 2MWSB 3PVLA 4TUUA 2LVOA 3UQBA 4WAAA 1KOTA 4NY0A 3IHPC 2KDFB 2M4NA 4E74A 1V6EA 3APCA 4MSQB 3DBRI 4IUMB 3RCZA 3H7PA 1S3SG 1RLFA 3DVGY 3A4SC 4KDIC 3BINA 2DZJA 2ASQA 5E6PA 4KSLC 3AXCA 4WWNA 4LDTD 2N9EB 2JVCA 4HVBA 2KZRA 2DZIA 2LUEA 2WX1A 3PSEB 4MGYE 2VRRB 3PS6A 4FN2A 2MRPA 4XC2A 3ZIMA 4MELA 4OVUA 3ZVVA 2Z59B 3S2AA 2FCMA 1P9DU 1OEYJ 2LZ6A 3A1QB 3DCGA 4I6NB 1D3ZA 1RFAA 3B1LX 4W9LA 5D2MB 3JSVA 2LVPA 2BGFA 2K25A 3KUCB 3W1SC 1X1MA 3OAWA 3PRPB 2KOXA 1Z2MA 4HCNB 3AI5A 4ICUA 4JIOU 3V60A 2L0TA 1SGHA 1WGHA 4GGQA 3ALBA 4GIVA 4HXDA 3MJWA 1TBEA 1YD8U 3W1YA 3VAWA 1ZKHA 2J7QB 3DDCB 3APFA 3A33B 2AEHA 2FNJB 3UF8A 3VHTC 3JVZX 2N1VA 1UZXB 1YIWA 3UIPB 2DYOA 3EFUA 3PLVA 4ASWC 2BYFA 4TV3A 4GN1A 4HWIB 3T8MA 3D32A 1LQBA 2LI5A 4XX5A 1RRBA 3DBHI 3EC8A 3AULA 2IY1B 3ZNZB 4YL8A 1K8RB 4RM9A 4JLCA 3N3KB 2GOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGK E;  1KJT A;  1V5T A;  1IYF A;  3HK0 A;  4NNJ B;  2JUO A;  3ONS A;  2EKE C;  1V81 A;  2JT4 B;  2RR9 A;  2CS4 A;  2WDT B;  3VVW B;  2MA9 B;  3LDZ E;  2K8C A;  4KZ0 A;  4ICV A;  2DZM A;  2PE6 B;  4M8N A;  4EEW A;  4G0N B;  2KXJ A;  2NBW B;  3KUZ A;  1WMH A;  2FCQ A;  5D94 A;  1A5R A;  2HTH A;  4MGZ E;  5DCN A;  4PYU A;  2NR2 A;  5AEK B;  3V62 A;  4B6W A;  1CMX B;  3WA0 A;  1LXD A;  1GC6 A;  5JHB A;  2O2V A;  3DVN V;  4ZRJ A;  1H4R A;  3AU5 A;  2KWU B;  3RZW C;  5AZG A;  2MBB B;  2L3Z A;  2K39 A;  5G2N A;  4ANU A;  2ZJD A;  1F9J A;  2ZNV C;  3VDZ A;  5C23 A;  2D2Q A;  4IWP A;  3IFW B;  2AYO B;  2JXX A;  2KWV B;  3HM6 X;  3DBL I;  3BY4 B;  2UYZ B;  4N9F 4;  4A3P A;  2L0F A;  3ZTD A;  5JZE B;  1IP9 A;  3QWZ B;  3DVN U;  4I6L B;  4NQL B;  2ZCC A;  2KTR B;  1WF9 A;  3NZU A;  4PYZ A;  2KX0 A;  2KTF A;  4MDK E;  3U30 A;  1WMH B;  5DPS A;  2K6D B;  4GDK A;  4FAD A;  2KLG A;  3WAL A;  5EDS A;  2M1M A;  3GZN I;  4W9D A;  4MM3 A;  4FLH A;  3VTU A;  4GSW A;  4CO7 A;  2KC1 A;  2N7D A;  3A9J A;  4AJW A;  5IA7 A;  1WXA A;  2ZVO A;  4X57 B;  2BKR B;  3U8Z A;  4EUT A;  2EMT A;  3A9K B;  1C1Y B;  4WWP A;  1WM3 A;  2J0M A;  4WQO B;  2DYB A;  2FUH B;  5CTR C;  2IO0 B;  1L2N A;  1UEL A;  1TZ1 A;  4WJO A;  4F8C B;  4OVV A;  3TL5 A;  3NHE B;  4LCD E;  2NBV B;  3KYC D;  3ML8 A;  3L0W B;  1Q5W B;  2MBO A;  3TIX A;  2FID A;  4HDQ A;  3VQI A;  4CHK A;  2ZCB A;  2BPS A;  4K1R B;  2OOB B;  3PRZ A;  4MEM A;  4RM8 A;  2R2O A;  1NI2 A;  1WM2 A;  1WX9 A;  1BT0 A;  3OJ4 B;  4II2 B;  1R4M I;  4ZRI A;  2ZZP B;  2V4L A;  4DDI D;  5CHF A;  4W9J A;  2J0K A;  2DYM A;  3ML9 A;  5L95 C;  2KLC A;  2KWC A;  3VH4 B;  2LGY A;  1UBI A;  2CHX A;  2KMC A;  2IO1 B;  1WX8 A;  2V1Y A;  4BFR A;  2CHW A;  5GMV A;  1E8Y A;  4FHK A;  4DHJ D;  3ZNG C;  1E7V A;  2WYQ A;  4FBJ B;  3APD A;  1WY8 A;  2JZ3 B;  3OJ3 A;  2RGF A;  5LXI B;  4BBN C;  2KNB A;  1E8Z A;  2N4F A;  2N7E A;  2REX A;  3M63 B;  2L05 A;  1MG8 A;  3TJP A;  1GJZ A;  5DPW A;  1WE6 A;  3ZTC A;  2MBH A;  2BWE S;  2L7R A;  2KVR A;  2IY0 B;  4TQ1 A;  1EUV B;  2V3S A;  3PLU A;  2LAS A;  1UBQ A;  1E8X A;  3ZKJ C;  1M94 A;  2Z0D B;  4FA6 A;  1C3T A;  2AWT A;  1XT9 B;  1WFY A;  4JQW C;  4FJV B;  4LJO B;  4BKS A;  2O6V D;  1PQS A;  4GOC A;  2JF5 A;  3ZRC A;  2NPT B;  3RZF A;  2ZPY A;  2ZPN A;  2FAZ A;  2FCS A;  3Q3J A;  3N30 A;  3PZD A;  1GNU A;  3QHT A;  3L13 A;  4WJQ A;  1UH6 A;  4DWF A;  5AZF A;  1WX7 A;  4TKN A;  1GG3 A;  2KTR A;  4MH0 E;  3UGB B;  4K7W A;  2B3A A;  4B95 A;  1WR1 A;  2DHZ A;  1WGG A;  1NBF C;  3NZS A;  1WE7 A;  2BF8 B;  2KQS A;  2BYE A;  2LGD A;  2MSE D;  2YVC A;  4EKU A;  2L8J A;  3KYD D;  5L83 A;  1WZ3 A;  4E71 A;  2LVQ A;  4RMA A;  4BKT A;  3ZNI D;  4ZDV A;  2K1F A;  4KV2 A;  1EF1 A;  3ZUN A;  4ANW A;  1WXV A;  4F7Z A;  1GUA B;  2YLM A;  2K8B A;  4IW0 A;  1OTR B;  1V80 A;  3QAQ A;  3L54 A;  3CF6 E;  3SU8 X;  2PJH A;  4WJP A;  2KD0 A;  2O2V B;  3OLM D;  2ZEQ A;  4W9K A;  3R66 C;  1VD2 A;  3QJZ A;  4GDL A;  3M95 A;  2RSU A;  4W9C A;  5C1Z A;  4URK A;  1WZ0 A;  2LXC A;  4KSK C;  1KLV A;  3MHS D;  3HHM A;  2N9X A;  4G3X B;  5JHA A;  1J19 A;  3VXW A;  1HE8 A;  3ZRF A;  1ISN A;  2LRW A;  1LFD A;  3ENE A;  4IM0 A;  4NAW B;  5LXH A;  2NS5 A;  3DPD A;  3PRM B;  1V86 A;  3L08 A;  4M0W B;  3KVF B;  4PS3 A;  2ZVN A;  2D3G A;  2QHO A;  2NBU A;  3IG3 A;  1TGZ B;  3H7S A;  1WIA A;  4K81 A;  2WX0 A;  2A5U A;  5KHO A;  1WJ4 A;  2PEA A;  2N1W A;  2O6V B;  2LD9 A;  3PHW B;  2DAF A;  5CHW A;  4HPL B;  4KVG B;  4IG7 B;  1V2Y A;  4NPN A;  3PGE A;  1EO6 A;  2XK5 B;  2LGX A;  2KAN A;  3I3T B;  2D10 A;  5LLI A;  2KK8 A;  3ZNH B;  3EHV A;  4GU2 A;  2M0X A;  5AZH A;  1WXM A;  4J6I A;  4LJP B;  1E5W A;  2CU1 A;  5IAA C;  4FUL A;  2KDE B;  1WR6 E;  1WRD B;  5BO4 B;  4AJY B;  4MGI E;  5CX3 A;  2GBK A;  1OGW A;  2DEN B;  2A4Z A;  5J2R A;  2MLB A;  2KHW B;  2KJ6 A;  3ECI A;  4DHJ B;  3WAP A;  1E8W A;  2GBN A;  4HK2 A;  2GBJ A;  4IM2 A;  2R2Q A;  2RPQ A;  1WGY A;  4FJY A;  4P7I A;  3VH3 B;  2G4D B;  5J17 A;  2JRH A;  4IWQ A;  4HLE A;  2LRU A;  3JSV B;  1SE9 A;  3A1Q A;  2KJR A;  1Z5S B;  3K9O B;  1EF5 A;  2IBI B;  2J0J A;  3PHX B;  4IM3 A;  5E6O A;  2MBQ A;  1ZGU B;  3RD2 A;  4M8M A;  2MQJ A;  3H9D A;  2KO3 A;  4DDG D;  4HDO A;  2KMA A;  1UD7 A;  2DAJ A;  1G6J A;  1WH3 A;  1I35 A;  3B0A A;  3V6C B;  4IC7 B;  5J18 A;  4DHZ B;  2DZK A;  2KN5 A;  4W9F A;  3VFK A;  2Y5B B;  4BBN F;  4IWO A;  2M8S A;  3TCA A;  1U4A A;  4KIK A;  4WWO A;  3SD5 A;  1J8C A;  4DXA B;  3VTV A;  2KJH B;  3JYU A;  3R3M A;  2OJR A;  1WJ6 A;  4PS8 A;  3UIO B;  3H1U A;  4K7S A;  1ZW7 A;  1WJN A;  4A20 A;  4EZK A;  2PPH A;  4G11 A;  3IVF A;  2IZV B;  3CMM B;  1L7Y A;  1KM7 A;  3DOW A;  2MP2 A;  3TBL D;  4GDK B;  3ZLZ A;  2C7H A;  1E90 A;  2JZZ A;  5CHV C;  4AUQ C;  3X23 A;  2MW5 A;  4W9I A;  3QCA A;  2KDI A;  4GDL B;  1Q0W B;  1YJ1 A;  3VTW A;  2KDB A;  4EZL A;  1YQB A;  4MSM B;  3KUD B;  1WXS A;  4AWJ A;  2IO3 B;  4ANV A;  2KQ7 A;  4EOY A;  1WGR A;  5G55 A;  1WI0 A;  1UGM A;  2C60 A;  2JWZ A;  2KX3 A;  3M3J A;  4NJ7 A;  2JRI B;  4FJZ A;  3TMP B;  4AOF A;  4EZJ A;  5DPT A;  2W9N A;  1T0Y A;  1V9J A;  2MP2 B;  1S1Q B;  3X0W A;  2XK5 A;  3SHQ A;  2UWQ A;  3VUW A;  2MBE A;  2AL3 A;  2NCN A;  5DPR A;  1JRU A;  3KW5 B;  3QA8 A;  1P0R A;  2I1K A;  2Z0E B;  4WJN A;  2GBR A;  3GOE A;  3QAR A;  2KFK B;  1E7U A;  1YX5 B;  3M62 B;  3LJ3 A;  2WWZ A;  4MJS A;  3A9K A;  3K9P B;  4CYE A;  3HIZ A;  3QIJ A;  2C7M B;  4W9E A;  3NS8 A;  4KIK B;  3PV1 A;  4II3 B;  2K8H A;  3RT3 B;  1FXT B;  4KZC A;  2CKH B;  4G50 A;  2D07 B;  2CR5 A;  3DQV A;  3PTF C;  2G45 B;  3DVG X;  2LJ5 A;  3V6E B;  4DBG A;  2HJ8 A;  3WIM A;  1WJU A;  1XD3 B;  2KC2 A;  4TQ0 A;  1OQY A;  2RD0 A;  3VUY A;  4BOZ B;  4NJ6 A;  4F1S A;  3HM3 A;  3W1S A;  4BKG A;  1P1A A;  3UQA A;  3CST A;  4BVU C;  3QX1 A;  4E3C A;  3CSF A;  1GC7 A;  2HE7 A;  3R7Q A;  4AP4 C;  3RUI B;  2IO2 B;  4ZYN A;  1VCB A;  4EFO A;  1P3Q U;  4W9G A;  1R4N I;  3V61 A;  4FHJ A;  1I42 A;  2DX5 B;  2NVU I;  2ZNV B;  4I6P A;  2C5L C;  4XZ4 A;  3L17 A;  3R7R A;  1H8C A;  2EMS A;  2JPH A;  3C0R B;  2JY6 A;  2GBM A;  2I1J A;  1RAX A;  4HCP B;  1XQQ A;  4A3O A;  3JW0 X;  2KFJ A;  3Q3F A;  4KDL B;  1OEY A;  3EEC A;  5TR5 A;  2CHZ A;  3ZO5 B;  2KFK A;  4BOS C;  4NQK E;  1NDD A;  1YX6 B;  3IBE A;  3WAN A;  1WGD A;  2NPT A;  2L76 A;  2PE9 A;  4NAW A;  2IYD B;  3ZDT A;  4ZRK A;  4HJK A;  5FR6 A;  4ANX A;  2FIF A;  4GB9 A;  3U7D A;  4LDT B;  2K6Q A;  3QQ8 B;  1V49 A;  4W9H A;  3UIN B;  5KHQ A;  2XBB C;  3RUL A;  3ZW3 A;  2C9W B;  3QC8 B;  1P98 A;  3MTN B;  2O6V A;  3WAM A;  3PRE A;  3DBS A;  5D7G A;  4DHZ E;  3KH0 A;  2N9P C;  2LXA A;  2M17 A;  1SIF A;  3A4R A;  3QK0 A;  5D6J B;  1AAR A;  3AU4 A;  2AL6 A;  1TTN A;  3P2B A;  4GXB A;  3RYT A;  4B9K A;  2LWP A;  3L16 A;  1IPG A;  5JH5 C;  2MX2 A;  3WAO A;  2GMI C;  2G4S A;  2D11 A;  3N32 A;  3A9J B;  3NY5 A;  4K7U A;  4JL9 A;  3B08 A;  4PS7 A;  3SDL C;  2XEW A;  2FCN A;  3H6N A;  3ZDM C;  2C7N B;  3PT2 B;  4HPM B;  3VUX A;  1Y8R C;  2KKC A;  3H7P B;  4GMV A;  4BKS D;  1LM8 B;  2G3Q B;  3O65 B;  3NOB A;  3T9L A;  2BWF A;  1QZE A;  1V5O A;  2L00 B;  5HKH A;  3L10 B;  3PPA A;  2MCN B;  1Q1O A;  2BKF A;  2HD5 B;  4MJS B;  4JGH B;  5E6N A;  2BYV E;  4DK5 A;  1WYW B;  1J0G A;  2MWS B;  3PVL A;  4TUU A;  2LVO A;  3UQB A;  4WAA A;  1KOT A;  4NY0 A;  3IHP C;  2KDF B;  2M4N A;  4E74 A;  1V6E A;  3APC A;  4MSQ B;  3DBR I;  4IUM B;  3RCZ A;  3H7P A;  1S3S G;  1RLF A;  3DVG Y;  3A4S C;  4KDI C;  3BIN A;  2DZJ A;  2ASQ A;  5E6P A;  4KSL C;  3AXC A;  4WWN A;  4LDT D;  2N9E B;  2JVC A;  4HVB A;  2KZR A;  2DZI A;  2LUE A;  2WX1 A;  3PSE B;  4MGY E;  2VRR B;  3PS6 A;  4FN2 A;  2MRP A;  4XC2 A;  3ZIM A;  4MEL A;  4OVU A;  3ZVV A;  2Z59 B;  3S2A A;  2FCM A;  1P9D U;  1OEY J;  2LZ6 A;  3A1Q B;  3DCG A;  4I6N B;  1D3Z A;  1RFA A;  3B1L X;  4W9L A;  5D2M B;  3JSV A;  2LVP A;  2BGF A;  2K25 A;  3KUC B;  3W1S C;  1X1M A;  3OAW A;  3PRP B;  2KOX A;  1Z2M A;  4HCN B;  3AI5 A;  4ICU A;  4JIO U;  3V60 A;  2L0T A;  1SGH A;  1WGH A;  4GGQ A;  3ALB A;  4GIV A;  4HXD A;  3MJW A;  1TBE A;  1YD8 U;  3W1Y A;  3VAW A;  1ZKH A;  2J7Q B;  3DDC B;  3APF A;  3A33 B;  2AEH A;  2FNJ B;  3UF8 A;  3VHT C;  3JVZ X;  2N1V A;  1UZX B;  1YIW A;  3UIP B;  2DYO A;  3EFU A;  3PLV A;  4ASW C;  2BYF A;  4TV3 A;  4GN1 A;  4HWI B;  3T8M A;  3D32 A;  1LQB A;  2LI5 A;  4XX5 A;  1RRB A;  3DBH I;  3EC8 A;  3AUL A;  2IY1 B;  3ZNZ B;  4YL8 A;  1K8R B;  4RM9 A;  4JLC A;  3N3K B;  2GOW A; 
#chains in the Genus database with same CATH topology
 3NS1 A;  2BS3 B;  1IBX A;  1V81 A;  3C8Y A;  4HEA 1;  3LDZ E;  1N5X A;  4ICV A;  1I4R A;  4US9 A;  3KUZ A;  5EE1 A;  1JWS D;  3EFC A;  4MGZ E;  5DCN A;  1LXD A;  1GC6 A;  5JHB A;  4ZRJ A;  2VZK B;  1YN5 A;  3HRD D;  2DNF A;  4WH4 A;  4HKZ E;  3CIR B;  1MG4 A;  3TEW A;  1SE2 A;  1D5X C;  1L0X B;  4A55 A;  5C23 A;  2D2Q A;  4N9F 4;  2L0F A;  3ZTD A;  1D5Z C;  3QWZ B;  3HUI A;  3N9Y C;  1WF9 A;  3VR9 B;  1FEH A;  2KQ4 X;  3U30 A;  2WHI A;  2V0G A;  1QOA A;  3Q3N C;  3OG5 A;  1WXA A;  2ZVO A;  1HZ5 A;  1D6E C;  1F2R C;  2WXQ A;  4EE2 A;  2FUH B;  2JX5 A;  2NBV B;  2K9X A;  3KYC D;  3ML8 A;  3L0W B;  3URY A;  4HDQ A;  3RNE C;  1T0R C;  2LGI A;  3Q2A C;  3PRZ A;  1NI2 A;  4ZRI A;  2J0K A;  1STE A;  3VH4 B;  2D3A A;  5GMV A;  4FBJ B;  2JZ3 B;  3TEZ A;  2RGF A;  1UWM A;  2MH7 A;  3FKY A;  2N4F A;  3TJP A;  5EE9 A;  2MBH A;  1FFU A;  3PLU A;  1ZOY B;  1C3T A;  1M94 A;  3AE4 B;  1HEZ E;  5IO9 A;  3L13 A;  3HVZ A;  1WX7 A;  3P4P B;  3W5V B;  2Y5C A;  2BF8 B;  2BYE A;  1E7P B;  4EKU A;  1N61 A;  1P7E A;  4RMA A;  1V1O A;  1EM7 A;  2K8B A;  1OTR B;  1V80 A;  3L54 A;  1DOI A;  2PJH A;  3BWU D;  3AEC B;  3OLM D;  1JML A;  1WZ0 A;  1KLV A;  1QF6 A;  3HHM A;  5D3I B;  1ET6 A;  3ZRF A;  1UF0 A;  1QKZ A;  2K22 A;  1MHX A;  4NAW B;  5LXH A;  3W9C B;  2V3N A;  4HPP A;  1HZ6 A;  2MEK A;  3IG3 A;  1IGD A;  2Y3A A;  2WX0 A;  2A5U A;  2N1W A;  3PHW B;  2AQ3 B;  1V2Y A;  4NPN A;  1F1H A;  3U4E G;  2D10 A;  5LLI A;  3EHV A;  2WXN A;  5AZH A;  1WXM A;  2UU7 A;  4AJY B;  2IJ0 A;  2LFI A;  1RM6 C;  2W82 A;  3KQ4 A;  1JRO A;  2W3R A;  2KJ6 A;  1E8W A;  2GBN A;  1FXA A;  1HXY D;  4IM2 A;  2R2Q A;  4FJY A;  3VH3 B;  4ZOH C;  2G4D B;  3IT6 B;  1FCL A;  1I4G A;  2KJR A;  1Z5S B;  3K9O B;  4IM3 A;  2IBI B;  3Q8B A;  3RD2 A;  5FK9 C;  2MBQ A;  1E10 A;  2DAJ A;  5C2T B;  1WH3 A;  4L1B A;  4DHZ B;  2KN5 A;  1XLN A;  3Q6B A;  4W9F A;  4K3B A;  2QMT A;  1U4A A;  4KIK A;  2PLP A;  3SD5 A;  3BYT B;  2WXO A;  3H1U A;  1WJN A;  4A20 A;  3MHZ A;  4G11 A;  5BYS A;  1YMH E;  3B9J A;  2MJE A;  1KM7 A;  3TBL D;  4AUQ C;  3X23 A;  3QCA A;  4GDL B;  1MVK A;  3VTW A;  2KDB A;  1FXI A;  1WXS A;  2I38 A;  2IO3 B;  1WGR A;  1SE3 A;  4EZJ A;  2FE8 A;  3X0W A;  1N63 A;  1KH0 A;  3SHQ A;  2UWQ A;  2N9L A;  1JQ4 A;  2NCN A;  5DPR A;  1JRU A;  3KW5 B;  4TSS A;  4WJN A;  2Q5W D;  2JQR B;  3M62 B;  1YX5 B;  2V9H A;  1M4V A;  4W9E A;  1SJE D;  2G9H D;  3NS8 A;  1R4N B;  3PV1 A;  1TZO A;  3Q8E A;  2JYT A;  4G50 A;  2D07 B;  3DQV A;  3DVG X;  2HJ8 A;  2KC2 A;  4BOZ B;  3HM3 A;  4S17 A;  4E3C A;  3R7Q A;  4AP4 C;  3RUI B;  4EFO A;  1I42 A;  2NVU I;  2ZNV B;  1TKE A;  1BUI C;  1XQQ A;  1WGK A;  1SIJ A;  1A70 A;  2PE9 A;  2NPT A;  4XGA B;  4ZRK A;  1L4D B;  2IPK D;  5KHQ A;  2INP E;  2O6V A;  4LTU A;  3KH0 A;  2WGS A;  3QK0 A;  1VLB A;  1TTN A;  2W54 A;  1L6U A;  2D11 A;  3NY5 A;  3A9J B;  3Q69 A;  4K7U A;  2D5G A;  1HTQ A;  3ZDM C;  2C7N B;  3PT2 B;  3AE2 B;  1LM8 B;  3O65 B;  1SBB B;  2BWF A;  1MHH E;  1NYQ A;  2L83 A;  3NG0 A;  4DK5 A;  1J0G A;  5H92 C;  4ITK A;  4TUU A;  3UQB A;  1LO5 D;  1KOT A;  3CWI A;  2KDF B;  1V6E A;  3APC A;  4KKI A;  4MSQ B;  4C7Z A;  2BBC A;  4IUM B;  1MFW A;  3DVG Y;  3FAH A;  4LNI A;  2N9E B;  2JVC A;  5IKC M;  2KZR A;  3PSE B;  4MGY E;  1KFY B;  4MEL A;  4OVU A;  3S2A A;  2FCM A;  4M01 A;  3B1L X;  4W9L A;  2BGF A;  2K25 A;  4R3D A;  3OAW A;  1N60 A;  2WXR A;  2M56 B;  4ICU A;  3AI5 A;  4JIO U;  3PO0 A;  3DWM A;  1WRI A;  1WGH A;  3ALB A;  1CK1 A;  3MJW A;  3W5U B;  1YD8 U;  4ZHO A;  3DDC B;  1VDV A;  1YIW A;  2PKO A;  2ZW1 A;  4TV3 A;  4GN1 A;  1FNU A;  1LQB A;  4HRO A;  1RRB A;  3N20 C;  4PT5 A;  1TS4 A;  3VFK A;  2GOW A;  4MGK E;  1V5T A;  2JUO A;  3MJ5 A;  2LJI A;  2EKE C;  4J3O D;  2CS4 A;  1I4Q A;  4P1B C;  4PYU A;  2KT7 A;  1YN4 A;  3Q8A A;  5AEK B;  1BXT A;  1BML C;  2BT6 A;  5IN7 A;  1H4R A;  2JYE A;  4JWS C;  4DQO C;  3RZW C;  3ZJT A;  5G2N A;  1KRH A;  1JWU D;  2ZJD A;  2IGG A;  1JRP A;  3HM6 X;  3BYY B;  3BY4 B;  3DBL I;  4ACF A;  2UYZ B;  2LUM A;  4I6L B;  2PIA A;  3SEB A;  1MPE A;  3NZ3 A;  4MDK E;  5DPS A;  4GDK A;  2KLG A;  4CO7 A;  3VTU A;  4MM3 A;  1T6B X;  5IA7 A;  4X57 B;  4EUT A;  3P63 A;  1ENF A;  1WM3 A;  2J0M A;  4WQO B;  5FR3 A;  1L2N A;  1T5X D;  4F8C B;  4OVV A;  3TL5 A;  1WXQ A;  2MBO A;  3TIX A;  2FID A;  5C3J B;  3VQI A;  4K1R B;  4MEM A;  2R2O A;  5FKA C;  2M19 A;  3OJ4 B;  1WX9 A;  1BT0 A;  4II2 B;  4OZB A;  1CJE A;  3RNG C;  2KWC A;  3P4Q B;  2LGY A;  5G5H A;  2BTE A;  1VZ7 A;  2IO1 B;  1WX8 A;  3R2T A;  1E8Y A;  4FHK A;  1E7V A;  2V4I B;  1QIL A;  1L0Y B;  3FC4 A;  5I4D A;  1E8Z A;  2KAC A;  2L05 A;  1MG8 A;  1YN3 A;  5DPW A;  1WE6 A;  2IY0 B;  2L7R A;  2KDM A;  2V3S A;  2LAS A;  4JX1 C;  2AWT A;  1XT9 B;  2D3B A;  4BKS A;  1TS5 A;  3ZRC A;  2NPT B;  4A9A A;  2ZPN A;  4WUR A;  4RGO S;  2FAZ A;  3NJT A;  2FCS A;  4LNO A;  3QHT A;  4DWF A;  1UH6 A;  5AZF A;  1DOY A;  4TKN A;  1GG3 A;  3UGB B;  1P7F A;  4K7W A;  4JE3 B;  1WR1 A;  2YVC A;  2MSE D;  3KYD D;  4E71 A;  4BKT A;  3PZ8 A;  3NRZ A;  2E6X A;  3ZUN A;  3ZXR A;  4F7Z A;  1ET9 A;  2N9K A;  1GUA B;  2YLM A;  4IW0 A;  1QQR A;  4P16 A;  3QAQ A;  2EEL A;  3RN9 C;  3SFE B;  2NTS A;  4GLS C;  2J53 A;  3ZJV A;  4WJP A;  2WDQ B;  1YQ4 B;  1VD2 A;  2BS4 B;  4LNN A;  2LXC A;  1QOG A;  3DHH C;  3KWL A;  2N9X A;  5HI1 A;  5JHA A;  1J19 A;  1ISN A;  3C19 A;  2LRW A;  3ENE A;  4IM0 A;  2NS5 A;  1PGX A;  3DPD A;  1V86 A;  1XO3 A;  2WU2 B;  4M0W B;  4Q2J A;  4PS3 A;  2D3G A;  1TGZ B;  3H7S A;  4K81 A;  3U2S C;  5KHO A;  4P1C C;  1SSN A;  4IG7 B;  3PGE A;  2LGX A;  2QDF A;  3I3T B;  4BZA A;  1RFK A;  5AUK A;  5IAA C;  2CU1 A;  4IKG A;  4M00 A;  2KDE B;  1T0Q C;  1SEB D;  1WR6 E;  2QSD A;  5CX3 A;  4FXC A;  3SR6 A;  3VRB B;  5J2R A;  1PGB A;  4N58 A;  3I57 A;  1WGY A;  2KVZ A;  5J17 A;  3ZQ4 A;  4IWQ A;  3NVV A;  3JSV B;  1L0V B;  1WWT A;  4DXG A;  2J0J A;  3PHX B;  1ZGU B;  3B2G A;  4M8M A;  4DDG D;  2KMA A;  2H88 B;  1G6J A;  1I35 A;  3V6C B;  4IC7 B;  3P42 A;  1RYJ A;  2DZK A;  4BBN F;  4IWO A;  1MJD A;  3RNC C;  2SEB D;  3IAS 1;  5BMI A;  3JYU A;  3R3M A;  1WJ6 A;  4PS8 A;  3UIO B;  2QC8 A;  1IUE A;  3RNA C;  1PGA A;  1FIQ A;  2JZZ A;  2JZP A;  1YJ1 A;  4IOI E;  2JWU A;  2NTT A;  4YXD B;  1FD6 A;  1N5W A;  2KQ7 A;  1PUT A;  5G55 A;  2C60 A;  3M3J A;  3TMP B;  3BII D;  5DPT A;  3HVD A;  1S1Q B;  1SB3 C;  3VUW A;  1D4B A;  3QA8 A;  1P0R A;  4K3C A;  2Z0E B;  3QAR A;  1AYF A;  1E7U A;  1PFD A;  1LGR A;  2WWZ A;  4MJS A;  4CYE A;  2DBY A;  3U7Z A;  1ZDV A;  4HKQ A;  1FXT B;  4KZC A;  3E56 A;  2CR5 A;  2LJ5 A;  4TQ0 A;  1XD3 B;  4JWU C;  3B2F A;  3VUY A;  3BK1 A;  1I7H A;  3VRA B;  1P1A A;  4BVU C;  2ZW0 A;  1GC7 A;  2DLB A;  4WAF A;  4W9G A;  2C5L C;  1EWC A;  3L17 A;  3BZD B;  4NJC A;  2WNM A;  3R7R A;  4US8 A;  5HHD G;  2I1J A;  4HCP B;  3ZGZ A;  2LEK A;  5IP4 D;  1XCT L;  3LYY A;  1CQV A;  4C80 A;  1TY0 A;  3EEC A;  2CHZ A;  3ZO5 B;  3AE9 B;  4BOS C;  3SFD B;  3IBE A;  2D3C A;  4NAW A;  2L52 A;  1NEK B;  5FR6 A;  3U7D A;  3QQ8 B;  3UIN B;  2C9W B;  5LNK 1;  3MTN B;  5D7G A;  3AEF B;  2M0A A;  2N9P C;  4OZA A;  2M17 A;  4HJG E;  2NMQ A;  3A4R A;  3AU4 A;  3DHG C;  3RNB C;  5JXV A;  1IPG A;  2EKI A;  4TMA B;  2GMI C;  2G4S A;  4MM3 B;  2FCN A;  3H6N A;  3H8H A;  3H7P B;  4GMV A;  3AV8 A;  3AE3 B;  4YWG G;  1RWS A;  4PK1 A;  2QIL A;  2L00 B;  4LLG M;  2KN4 A;  2HD5 B;  2BYV E;  2JSV X;  2MWS B;  4WAA A;  2M4N A;  3MFG A;  1GAQ B;  1YOV B;  3H7P A;  1ZE3 D;  3A4S C;  3BIN A;  2ASQ A;  3EA6 A;  3IT4 B;  4YSZ B;  4AS1 A;  3W2D A;  4A8X C;  3MP9 A;  4HVB A;  3AE7 B;  2DZI A;  2LUE A;  2LHE A;  2MRP A;  3ZVV A;  3A1Q B;  4I6N B;  1VZ8 A;  3AE5 B;  3KUC B;  1QLB B;  3PRP B;  2BW2 A;  3V60 A;  3LXF A;  3PZ7 A;  3GS2 A;  3AN1 A;  1ZKH A;  3APF A;  1C9F A;  3A33 B;  2I2Y A;  3UF8 A;  2N1V A;  1KF6 B;  3EFU A;  5BYQ A;  1K52 A;  1NYR A;  3D32 A;  3R8B A;  2E3T A;  4XX5 A;  1ZP0 B;  3EC8 A;  4OVZ A;  2IY1 B;  2RDH A;  2CJO A;  1K8R B;  4RM9 A;  1J7B A;  4JLC A;  4D2K A;  3N3K B;  1YJI A;  1IYF A;  4NNJ B;  4MT5 A;  3ONS A;  2IGD A;  2MA9 B;  4CQN A;  2K8C A;  4KZ0 A;  1UWX A;  2PE6 B;  4NZL B;  4G0N B;  2KXJ A;  2WS3 B;  2NBW B;  2FCQ A;  2HTH A;  2KAJ A;  2NR2 A;  1E0Z A;  1UGJ A;  3V62 A;  3N1Z C;  5HG2 A;  2O2V A;  4ZYS A;  3AU5 A;  2KWU B;  4LK0 M;  5AZG A;  2MBB B;  2K39 A;  3VDZ A;  1F9J A;  4XYC A;  2AYO B;  1E9M A;  3AEB B;  4A3P A;  1IP9 A;  1HQR D;  2HDE A;  2RDB C;  4USA A;  2KX0 A;  2LHD A;  2K6D B;  4ARI A;  4FAD A;  5EDS A;  2M1M A;  3GZN I;  4GSW A;  3A9J A;  2WXH A;  4AJW A;  2BKR B;  3U8Z A;  2EMT A;  4WWP A;  2DYB A;  5CTR C;  2IO0 B;  2N7J A;  4WJO A;  2K0P A;  1EU4 A;  3TSS A;  1XLP A;  1Q5W B;  4CHK A;  2FBW B;  2BPS A;  1FRD A;  1R4M I;  2ZZP B;  4DXF A;  5CHF A;  2DYM A;  3ML9 A;  3NVW A;  1DGJ A;  1C79 A;  4YT0 B;  1UBI A;  2CHX A;  2TSS A;  2KMC A;  2QJL A;  3ZXV A;  1SJH D;  4BFR A;  2WYQ A;  3APD A;  1WY8 A;  5G5G A;  3OJ3 A;  2X38 A;  3DBH B;  5LXI B;  2KNB A;  2N7E A;  1TT5 B;  1SXT A;  1TIF A;  1GJZ A;  2GRI A;  4L23 A;  4TQ1 A;  1EUV B;  3GP7 A;  4FA6 A;  4C7Y A;  1WFY A;  3NVZ A;  2ICI A;  4JQW C;  4LJO B;  4GOC A;  1I4P A;  2JF5 A;  3TEX A;  3RZF A;  2ZPY A;  1KTK A;  4A90 A;  3N30 A;  1GNU A;  2ONQ A;  3Q3M C;  2QIE B;  4H2A A;  2RDG A;  2KTR A;  3E9S A;  1K51 A;  1WGG A;  1NBF C;  3NZS A;  2LGD A;  2L8J A;  2LVQ A;  3ZNI D;  2QEJ C;  4ZDV A;  4KV2 A;  4ANW A;  1HTO A;  1FFV A;  3DHI C;  4C4V B;  1KLG D;  2BS2 B;  3SU8 X;  2K5P A;  1K53 A;  3R66 C;  5C1Z A;  2RSU A;  4URK A;  1ZDX A;  4G3X B;  1D5M C;  3N1X C;  1UNS A;  1OFF A;  2L1A A;  5EE0 A;  1FRR A;  3PRM B;  1XXG A;  3L08 A;  3KVF B;  4RF0 A;  2ZVN A;  2QHO A;  3MC9 A;  2NBU A;  3I63 C;  2O6V B;  1HA5 A;  4HPL B;  4KVG B;  1EO6 A;  2XK5 B;  2B76 B;  2KAN A;  1AN8 A;  3TUO A;  2KK8 A;  3ZNH B;  4GU2 A;  2M0X A;  4J6I A;  2BYT A;  4FUL A;  3T3O A;  2GBK A;  1FPY A;  1OGW A;  1FNV A;  1AWD A;  2MLB A;  2K3U A;  2KHW B;  1CZP A;  4DHJ B;  4HK2 A;  1YNT E;  2GBJ A;  1C4P A;  2RPQ A;  3I9V 1;  4L2Y A;  1GB1 A;  1VRA B;  2AQ2 B;  2JRH A;  4HLE A;  2WDR B;  2IDY A;  3IXS A;  3BK2 A;  2MQJ A;  2KO3 A;  4HDO A;  2OJW A;  1JCK B;  1UD7 A;  2G1E A;  5J18 A;  3DBL B;  5D3D A;  2Y5B B;  2M8S A;  1J8C A;  3VTV A;  4RCO A;  2OJR A;  4K7S A;  2WDV B;  1E6E B;  1ZW7 A;  4O1N A;  1YQ3 B;  2QCZ A;  2WXK A;  3IVF A;  2IZV B;  3CMM B;  3AM9 A;  4GDK B;  3ZLZ A;  3AEG B;  1E90 A;  5CHV C;  3N1Y C;  2MW5 A;  2KDI A;  1Q0W B;  1ZPS A;  1V97 A;  1TY2 A;  1YQB A;  2WLB A;  4ANV A;  4EOY A;  1UGM A;  4AOF A;  2JRI B;  4FJZ A;  1C76 A;  1JWM D;  2W9N A;  1NEN B;  1SE4 A;  2J4X A;  1C77 A;  2MBE A;  2AL3 A;  1XEE A;  2I1K A;  4N59 A;  4KGS A;  2KWD A;  1C78 A;  4XE0 A;  5T8I A;  3HIZ A;  4KIK B;  1WYG A;  3RT3 B;  2WU5 B;  5E6J A;  3PTF C;  1KLU D;  3V6E B;  4M02 A;  1WJU A;  4XDD A;  1OQY A;  1FM0 D;  2RD0 A;  4NJ6 A;  4F1S A;  4BKG A;  3GZN B;  2KMM A;  4MH8 A;  3UQA A;  3CSF A;  4OZC A;  3BVG A;  2IO2 B;  1P3Q U;  3V61 A;  4FHJ A;  2DX5 B;  4I6P A;  2EMS A;  2INN E;  1NVI D;  1J7C A;  2GBM A;  1RAX A;  4A6Q A;  4ZRP A;  4N6E B;  2R61 A;  2WXG A;  1DYQ A;  2PW9 A;  2KFK A;  1YX6 B;  3WAN A;  4OHJ A;  1GOZ A;  2L76 A;  2IYD B;  3ZDT A;  2RPV A;  4HJK A;  4ANX A;  2W3S A;  3L4P A;  4RGM A;  4W9H A;  2XBB C;  3QC8 B;  3PRE A;  3DBS A;  4DHZ E;  4WQM A;  1SIF A;  4GXB A;  4C00 A;  2LWP A;  4P6V F;  1FO4 A;  2MX2 A;  3WAO A;  3N32 A;  1F77 A;  3B08 A;  4BAX A;  3SDL C;  2XEW A;  1ESF A;  1Y8R C;  2IGH A;  2G3Q B;  1V5O A;  5HKH A;  1J7A A;  1B1Z A;  3L10 B;  1Q1O A;  2BKF A;  4MJS B;  2MCN B;  4JGH B;  1WYW B;  1C4C A;  3PVL A;  4NY0 A;  3DBR I;  2WXF A;  2DWQ A;  3MC8 A;  1S3S G;  2DZJ A;  3ZJU A;  4LDT D;  2PVG C;  3OWE B;  4NAM A;  2WX1 A;  2VRR B;  3PS6 A;  4FN2 A;  4XC2 A;  1P9D U;  1OEY J;  2VH1 A;  3DCG A;  1RFA A;  2LVP A;  3ZYY X;  3RMK C;  3V05 A;  4GGQ A;  4GIV A;  4HXD A;  1TBE A;  3W1Y A;  3VAW A;  2J7Q B;  1R4M B;  2WXM A;  2BB5 A;  2AEH A;  1UZX B;  1ROE A;  2BYF A;  4HWI B;  3Q3O C;  3U52 E;  1N6Z A;  3T8M A;  4KX6 B;  2LI5 A;  1T0S C;  3DBH I;  1PDX A;  1TS3 A;  1F52 A;  3ZNZ B;  3FIL A;  4XWT A;  2HTM E;  3CF6 E;  1KJT A;  4RF1 A;  3GE8 C;  3HK0 A;  2JU6 X;  4RNA A;  2JT4 B;  2RR9 A;  2WDT B;  3VVW B;  2DZM A;  1QOF A;  4M8N A;  4EEW A;  5D94 A;  1WMH A;  1A5R A;  1K50 A;  4MAC A;  4B6W A;  1CMX B;  3LB8 C;  3WA0 A;  3AMZ A;  3DVN V;  1TYG B;  3EGR A;  2FUG 1;  2L3Z A;  4ANU A;  1ACC A;  1MI0 A;  2ZNV C;  4IWP A;  3IFW B;  2JXX A;  2KWV B;  4REZ A;  5JZE B;  3DVN U;  4NQL B;  2ZCC A;  2KTR B;  1WSP A;  3J9C A;  3NZU A;  4PYZ A;  2KTF A;  3P4R B;  4ZRQ A;  1WMH B;  2PMV A;  2IND C;  3P1M A;  2Y5P A;  3WAL A;  4W9D A;  4FLH A;  2KC1 A;  2N7D A;  2ACZ B;  1JAL A;  4UDU C;  3A9K B;  1FMA D;  1C1Y B;  4AQ7 A;  2RMM A;  2BQQ A;  3T3N A;  1UEL A;  1TZ1 A;  3BVZ A;  1NI3 A;  3VR8 B;  3NHE B;  4RGN A;  4LCD E;  1TKG A;  1TKY A;  3R2I A;  4WWM A;  3AEA B;  2ZCB A;  2BB6 A;  5H8Y E;  4QAY A;  2OOB B;  1I4H A;  4RM8 A;  1WM2 A;  2V4L A;  3IAM 1;  4DDI D;  4W9J A;  5L95 C;  4HRS A;  2LGS A;  2KLC A;  2V1Y A;  2CHW A;  4DHJ D;  3ZNG C;  1L6V A;  4BBN C;  1F0Z A;  2REX A;  2WP9 B;  3M63 B;  4C56 C;  3ZTC A;  2BWE S;  3Q8F A;  2KVR A;  1UBQ A;  1E8X A;  5BMG A;  3ZKJ C;  2Z0D B;  2BVC A;  4FJV B;  2W55 A;  2O6V D;  1PQS A;  3BVM A;  2N0S B;  2WXP A;  1AW7 A;  2WQY B;  4YTM B;  3Q3J A;  1GB4 A;  3NUH B;  3PZD A;  4ZHP A;  4WJQ A;  5MPO A;  3O13 A;  1GPX A;  4MH0 E;  1C4A A;  4C4V A;  2B3A A;  4B95 A;  2DHZ A;  1WE7 A;  2KQS A;  1EU3 A;  5L83 A;  1JWB D;  1WZ3 A;  1V1P B;  2K1F A;  5EE3 A;  1EF1 A;  1WXV A;  2INC C;  2KD0 A;  2O2V B;  3AE6 B;  2ZEQ A;  4W9K A;  3QJZ A;  4GDL A;  3M95 A;  4W9C A;  4KSK C;  4RH6 A;  3MHS D;  3P4S B;  4WIP A;  1SF0 A;  3VXW A;  1HE8 A;  2GLS A;  3NVY A;  2XNA C;  4B0M A;  1LFD A;  1JWA D;  1L5P A;  3WCQ A;  3V3X A;  4RGT A;  2AX5 A;  1WIA A;  3GE3 C;  2PTL A;  1WJ4 A;  5AUI A;  2PEA A;  1OQQ A;  2LD9 A;  2DAF A;  5CHW A;  4OW0 A;  1TJE A;  1VR9 A;  2JXT A;  3DBR B;  4LJP B;  1E5W A;  1B9R A;  1WRD B;  5BO4 B;  1N62 A;  4MGI E;  1L4Z B;  4KKJ A;  2DEN B;  2A4Z A;  4M0W A;  3ECI A;  3WAP A;  1OQR A;  3Q14 C;  3MC0 B;  4P7I A;  2YEP B;  2ON8 A;  4B0E A;  2LRU A;  1SE9 A;  2H89 B;  3A1Q A;  1EF5 A;  2CJN A;  5E6O A;  2GB1 A;  1V8C A;  4XDC A;  3AH7 A;  1I4X A;  3H9D A;  3Q8C A;  1VZ6 A;  1PYW D;  3B0A A;  5GXG B;  2PVO D;  3ABV B;  3TCA A;  4WWO A;  4LNF A;  1F2R I;  1Q10 A;  4DXA B;  2KJH B;  1TS2 A;  2PPH A;  4EZK A;  2CU3 A;  1L7Y A;  2V3P A;  3DOW A;  2MP2 A;  2C7H A;  3RFZ B;  4W9I A;  2WXI A;  3RPF C;  4EZL A;  4MSM B;  3KUD B;  3RNF C;  4AWJ A;  4RFB A;  1WI0 A;  2JWZ A;  4NJ7 A;  2KX3 A;  2VZK D;  1T0Y A;  1V9J A;  2MP2 B;  2WXL A;  2XK5 A;  1V1P A;  3TEY A;  3UI3 A;  3AE1 B;  1JW9 D;  2GBR A;  3GOE A;  5BYR A;  2XN9 C;  2KFK B;  3RI7 C;  1ZXI A;  3LJ3 A;  2WXJ A;  2MHJ A;  3A9K A;  3K9P B;  3QIJ A;  2C7M B;  4II3 B;  1XLO A;  2K8H A;  3AE8 B;  2CKH B;  1UUP A;  2G45 B;  4DBG A;  3KWV A;  3WIM A;  1T3Q A;  3W1S A;  1FNW A;  3CST A;  4IDI A;  3QX1 A;  1FCC C;  4YSX B;  2HE7 A;  5TSS A;  3ETR A;  4ZYN A;  1VCB A;  5BMH A;  1R4N I;  4XZ4 A;  2VH2 A;  1H8C A;  2JPH A;  3C0R B;  1XLQ A;  2JY6 A;  1EWY C;  4A3O A;  3JW0 X;  3EUB 2;  2KFJ A;  3Q3F A;  4KDL B;  1OEY A;  1ZXH A;  5TR5 A;  4NQK E;  1NDD A;  1YJJ A;  3I5J C;  1WGD A;  2FIF A;  4GB9 A;  4LDT B;  2K6Q A;  1XCQ L;  1V49 A;  2J42 A;  3RUL A;  2X8X X;  3ZW3 A;  1P98 A;  4JPS A;  3WAM A;  4LNK A;  4ARC A;  3KLS X;  2LXA A;  1ZUD 2;  2MJ3 A;  1AAR A;  3FIL B;  5D6J B;  2AL6 A;  3P2B A;  3RYT A;  4B9K A;  3L16 A;  5JH5 C;  1XF5 L;  4PS7 A;  4JL9 A;  2MJD A;  1R7S A;  2J52 A;  4HPM B;  3VUX A;  2KKC A;  4KGR A;  4BKS D;  4S0R A;  1VJK A;  3NOB A;  3T9L A;  1QZE A;  1DOX A;  3PPA A;  5E6N A;  2LVO A;  2YEP F;  3IHP C;  1QT9 A;  4E74 A;  5HFY A;  3RCZ A;  1RLF A;  2KYW A;  2AQ1 B;  5E6P A;  4KSL C;  3DWG C;  4XWW A;  3AXC A;  4WWN A;  3AB5 A;  3ZIM A;  2Z59 B;  2LZ6 A;  2OHF A;  1D3Z A;  5D2M B;  2SAK A;  3JSV A;  2Z8L A;  3W1S C;  1X1M A;  4YSY B;  2KOX A;  2OED A;  1Z2M A;  4HCN B;  2L0T A;  1SGH A;  2LMC A;  3AED B;  1IBX B;  5IOI A;  4YTN B;  4YTP B;  3GB1 A;  2FNJ B;  3VHT C;  3JVZ X;  3UIP B;  2DYO A;  2GI9 A;  3PLV A;  4ASW C;  3AEE B;  1IGC A;  2L32 A;  3AUL A;  4KGT A;  1QOB A;  4YL8 A;  1Y56 A;  2HJ1 A;  4KDI C; 
#chains in the Genus database with same CATH homology
 4MGK E;  1KJT A;  1V5T A;  1IYF A;  3HK0 A;  4NNJ B;  2JUO A;  3ONS A;  2EKE C;  1V81 A;  2JT4 B;  2RR9 A;  2CS4 A;  2WDT B;  3VVW B;  2MA9 B;  3LDZ E;  2K8C A;  4KZ0 A;  4ICV A;  2DZM A;  2PE6 B;  4M8N A;  4EEW A;  4G0N B;  2KXJ A;  2NBW B;  3KUZ A;  1WMH A;  2FCQ A;  5D94 A;  1A5R A;  2HTH A;  4MGZ E;  5DCN A;  4PYU A;  2NR2 A;  5AEK B;  3V62 A;  4B6W A;  1CMX B;  3WA0 A;  1LXD A;  1GC6 A;  5JHB A;  2O2V A;  3DVN V;  4ZRJ A;  1H4R A;  3AU5 A;  2KWU B;  3RZW C;  5AZG A;  2MBB B;  2L3Z A;  2K39 A;  5G2N A;  4ANU A;  2ZJD A;  1F9J A;  2ZNV C;  3VDZ A;  5C23 A;  2D2Q A;  4IWP A;  3IFW B;  2AYO B;  2JXX A;  2KWV B;  3HM6 X;  3DBL I;  3BY4 B;  2UYZ B;  4N9F 4;  4A3P A;  2L0F A;  3ZTD A;  5JZE B;  1IP9 A;  3QWZ B;  3DVN U;  4I6L B;  4NQL B;  2ZCC A;  2KTR B;  1WF9 A;  3NZU A;  4PYZ A;  2KX0 A;  2KTF A;  4MDK E;  3U30 A;  1WMH B;  5DPS A;  2K6D B;  4GDK A;  4FAD A;  2KLG A;  3WAL A;  5EDS A;  2M1M A;  3GZN I;  4W9D A;  4MM3 A;  4FLH A;  3VTU A;  4GSW A;  4CO7 A;  2KC1 A;  2N7D A;  3A9J A;  4AJW A;  5IA7 A;  1WXA A;  2ZVO A;  4X57 B;  2BKR B;  3U8Z A;  4EUT A;  2EMT A;  3A9K B;  1C1Y B;  4WWP A;  1WM3 A;  2J0M A;  4WQO B;  2DYB A;  2FUH B;  5CTR C;  2IO0 B;  1L2N A;  1UEL A;  1TZ1 A;  4WJO A;  4F8C B;  4OVV A;  3TL5 A;  3NHE B;  4LCD E;  2NBV B;  3KYC D;  3ML8 A;  3L0W B;  1Q5W B;  2MBO A;  3TIX A;  2FID A;  4HDQ A;  3VQI A;  4CHK A;  2ZCB A;  2BPS A;  4K1R B;  2OOB B;  3PRZ A;  4MEM A;  4RM8 A;  2R2O A;  1NI2 A;  1WM2 A;  1WX9 A;  1BT0 A;  3OJ4 B;  4II2 B;  1R4M I;  4ZRI A;  2ZZP B;  2V4L A;  4DDI D;  5CHF A;  4W9J A;  2J0K A;  2DYM A;  3ML9 A;  5L95 C;  2KLC A;  2KWC A;  3VH4 B;  2LGY A;  1UBI A;  2CHX A;  2KMC A;  2IO1 B;  1WX8 A;  2V1Y A;  4BFR A;  2CHW A;  5GMV A;  1E8Y A;  4FHK A;  4DHJ D;  3ZNG C;  1E7V A;  2WYQ A;  4FBJ B;  3APD A;  1WY8 A;  2JZ3 B;  3OJ3 A;  2RGF A;  5LXI B;  4BBN C;  2KNB A;  1E8Z A;  2N4F A;  2N7E A;  2REX A;  3M63 B;  2L05 A;  1MG8 A;  3TJP A;  1GJZ A;  5DPW A;  1WE6 A;  3ZTC A;  2MBH A;  2BWE S;  2L7R A;  2KVR A;  2IY0 B;  4TQ1 A;  1EUV B;  2V3S A;  3PLU A;  2LAS A;  1UBQ A;  1E8X A;  3ZKJ C;  1M94 A;  2Z0D B;  4FA6 A;  1C3T A;  2AWT A;  1XT9 B;  1WFY A;  4JQW C;  4FJV B;  4LJO B;  4BKS A;  2O6V D;  1PQS A;  4GOC A;  2JF5 A;  3ZRC A;  2NPT B;  3RZF A;  2ZPY A;  2ZPN A;  2FAZ A;  2FCS A;  3Q3J A;  3N30 A;  3PZD A;  1GNU A;  3QHT A;  3L13 A;  4WJQ A;  1UH6 A;  4DWF A;  5AZF A;  1WX7 A;  4TKN A;  1GG3 A;  2KTR A;  4MH0 E;  3UGB B;  4K7W A;  2B3A A;  4B95 A;  1WR1 A;  2DHZ A;  1WGG A;  1NBF C;  3NZS A;  1WE7 A;  2BF8 B;  2KQS A;  2BYE A;  2LGD A;  2MSE D;  2YVC A;  4EKU A;  2L8J A;  3KYD D;  5L83 A;  1WZ3 A;  4E71 A;  2LVQ A;  4RMA A;  4BKT A;  3ZNI D;  4ZDV A;  2K1F A;  4KV2 A;  1EF1 A;  3ZUN A;  4ANW A;  1WXV A;  4F7Z A;  1GUA B;  2YLM A;  2K8B A;  4IW0 A;  1OTR B;  1V80 A;  3QAQ A;  3L54 A;  3CF6 E;  3SU8 X;  2PJH A;  4WJP A;  2KD0 A;  2O2V B;  3OLM D;  2ZEQ A;  4W9K A;  3R66 C;  1VD2 A;  3QJZ A;  4GDL A;  3M95 A;  2RSU A;  4W9C A;  5C1Z A;  4URK A;  1WZ0 A;  2LXC A;  4KSK C;  1KLV A;  3MHS D;  3HHM A;  2N9X A;  4G3X B;  5JHA A;  1J19 A;  3VXW A;  1HE8 A;  3ZRF A;  1ISN A;  2LRW A;  1LFD A;  3ENE A;  4IM0 A;  4NAW B;  5LXH A;  2NS5 A;  3DPD A;  3PRM B;  1V86 A;  3L08 A;  4M0W B;  3KVF B;  4PS3 A;  2ZVN A;  2D3G A;  2QHO A;  2NBU A;  3IG3 A;  1TGZ B;  3H7S A;  1WIA A;  4K81 A;  2WX0 A;  2A5U A;  5KHO A;  1WJ4 A;  2PEA A;  2N1W A;  2O6V B;  2LD9 A;  3PHW B;  2DAF A;  5CHW A;  4HPL B;  4KVG B;  4IG7 B;  1V2Y A;  4NPN A;  3PGE A;  1EO6 A;  2XK5 B;  2LGX A;  2KAN A;  3I3T B;  2D10 A;  5LLI A;  2KK8 A;  3ZNH B;  3EHV A;  4GU2 A;  2M0X A;  5AZH A;  1WXM A;  4J6I A;  4LJP B;  1E5W A;  2CU1 A;  5IAA C;  4FUL A;  2KDE B;  1WR6 E;  1WRD B;  5BO4 B;  4AJY B;  4MGI E;  5CX3 A;  2GBK A;  1OGW A;  2DEN B;  2A4Z A;  5J2R A;  2MLB A;  2KHW B;  2KJ6 A;  3ECI A;  4DHJ B;  3WAP A;  1E8W A;  2GBN A;  4HK2 A;  2GBJ A;  4IM2 A;  2R2Q A;  2RPQ A;  1WGY A;  4FJY A;  4P7I A;  3VH3 B;  2G4D B;  5J17 A;  2JRH A;  4IWQ A;  4HLE A;  2LRU A;  3JSV B;  1SE9 A;  3A1Q A;  2KJR A;  1Z5S B;  3K9O B;  1EF5 A;  2IBI B;  2J0J A;  3PHX B;  4IM3 A;  5E6O A;  2MBQ A;  1ZGU B;  3RD2 A;  4M8M A;  2MQJ A;  3H9D A;  2KO3 A;  4DDG D;  4HDO A;  2KMA A;  1UD7 A;  2DAJ A;  1G6J A;  1WH3 A;  1I35 A;  3B0A A;  3V6C B;  4IC7 B;  5J18 A;  4DHZ B;  2DZK A;  2KN5 A;  4W9F A;  3VFK A;  2Y5B B;  4BBN F;  4IWO A;  2M8S A;  3TCA A;  1U4A A;  4KIK A;  4WWO A;  3SD5 A;  1J8C A;  4DXA B;  3VTV A;  2KJH B;  3JYU A;  3R3M A;  2OJR A;  1WJ6 A;  4PS8 A;  3UIO B;  3H1U A;  4K7S A;  1ZW7 A;  1WJN A;  4A20 A;  4EZK A;  2PPH A;  4G11 A;  3IVF A;  2IZV B;  3CMM B;  1L7Y A;  1KM7 A;  3DOW A;  2MP2 A;  3TBL D;  4GDK B;  3ZLZ A;  2C7H A;  1E90 A;  2JZZ A;  5CHV C;  4AUQ C;  3X23 A;  2MW5 A;  4W9I A;  3QCA A;  2KDI A;  4GDL B;  1Q0W B;  1YJ1 A;  3VTW A;  2KDB A;  4EZL A;  1YQB A;  4MSM B;  3KUD B;  1WXS A;  4AWJ A;  2IO3 B;  4ANV A;  2KQ7 A;  4EOY A;  1WGR A;  5G55 A;  1WI0 A;  1UGM A;  2C60 A;  2JWZ A;  2KX3 A;  3M3J A;  4NJ7 A;  2JRI B;  4FJZ A;  3TMP B;  4AOF A;  4EZJ A;  5DPT A;  2W9N A;  1T0Y A;  1V9J A;  2MP2 B;  1S1Q B;  3X0W A;  2XK5 A;  3SHQ A;  2UWQ A;  3VUW A;  2MBE A;  2AL3 A;  2NCN A;  5DPR A;  1JRU A;  3KW5 B;  3QA8 A;  1P0R A;  2I1K A;  2Z0E B;  4WJN A;  2GBR A;  3GOE A;  3QAR A;  2KFK B;  1E7U A;  1YX5 B;  3M62 B;  3LJ3 A;  2WWZ A;  4MJS A;  3A9K A;  3K9P B;  4CYE A;  3HIZ A;  3QIJ A;  2C7M B;  4W9E A;  3NS8 A;  4KIK B;  3PV1 A;  4II3 B;  2K8H A;  3RT3 B;  1FXT B;  4KZC A;  2CKH B;  4G50 A;  2D07 B;  2CR5 A;  3DQV A;  3PTF C;  2G45 B;  3DVG X;  2LJ5 A;  3V6E B;  4DBG A;  2HJ8 A;  3WIM A;  1WJU A;  1XD3 B;  2KC2 A;  4TQ0 A;  1OQY A;  2RD0 A;  3VUY A;  4BOZ B;  4NJ6 A;  4F1S A;  3HM3 A;  3W1S A;  4BKG A;  1P1A A;  3UQA A;  3CST A;  4BVU C;  3QX1 A;  4E3C A;  3CSF A;  1GC7 A;  2HE7 A;  3R7Q A;  4AP4 C;  3RUI B;  2IO2 B;  4ZYN A;  1VCB A;  4EFO A;  1P3Q U;  4W9G A;  1R4N I;  3V61 A;  4FHJ A;  1I42 A;  2DX5 B;  2NVU I;  2ZNV B;  4I6P A;  2C5L C;  4XZ4 A;  3L17 A;  3R7R A;  1H8C A;  2EMS A;  2JPH A;  3C0R B;  2JY6 A;  2GBM A;  2I1J A;  1RAX A;  4HCP B;  1XQQ A;  4A3O A;  3JW0 X;  2KFJ A;  3Q3F A;  4KDL B;  1OEY A;  3EEC A;  5TR5 A;  2CHZ A;  3ZO5 B;  2KFK A;  4BOS C;  4NQK E;  1NDD A;  1YX6 B;  3IBE A;  3WAN A;  1WGD A;  2NPT A;  2L76 A;  2PE9 A;  4NAW A;  2IYD B;  3ZDT A;  4ZRK A;  4HJK A;  5FR6 A;  4ANX A;  2FIF A;  4GB9 A;  3U7D A;  4LDT B;  2K6Q A;  3QQ8 B;  1V49 A;  4W9H A;  3UIN B;  5KHQ A;  2XBB C;  3RUL A;  3ZW3 A;  2C9W B;  3QC8 B;  1P98 A;  3MTN B;  2O6V A;  3WAM A;  3PRE A;  3DBS A;  5D7G A;  4DHZ E;  3KH0 A;  2N9P C;  2LXA A;  2M17 A;  1SIF A;  3A4R A;  3QK0 A;  5D6J B;  1AAR A;  3AU4 A;  2AL6 A;  1TTN A;  3P2B A;  4GXB A;  3RYT A;  4B9K A;  2LWP A;  3L16 A;  1IPG A;  5JH5 C;  2MX2 A;  3WAO A;  2GMI C;  2G4S A;  2D11 A;  3N32 A;  3A9J B;  3NY5 A;  4K7U A;  4JL9 A;  3B08 A;  4PS7 A;  3SDL C;  2XEW A;  2FCN A;  3H6N A;  3ZDM C;  2C7N B;  3PT2 B;  4HPM B;  3VUX A;  1Y8R C;  2KKC A;  3H7P B;  4GMV A;  4BKS D;  1LM8 B;  2G3Q B;  3O65 B;  3NOB A;  3T9L A;  2BWF A;  1QZE A;  1V5O A;  2L00 B;  5HKH A;  3L10 B;  3PPA A;  2MCN B;  1Q1O A;  2BKF A;  2HD5 B;  4MJS B;  4JGH B;  5E6N A;  2BYV E;  4DK5 A;  1WYW B;  1J0G A;  2MWS B;  3PVL A;  4TUU A;  2LVO A;  3UQB A;  4WAA A;  1KOT A;  4NY0 A;  3IHP C;  2KDF B;  2M4N A;  4E74 A;  1V6E A;  3APC A;  4MSQ B;  3DBR I;  4IUM B;  3RCZ A;  3H7P A;  1S3S G;  1RLF A;  3DVG Y;  3A4S C;  4KDI C;  3BIN A;  2DZJ A;  2ASQ A;  5E6P A;  4KSL C;  3AXC A;  4WWN A;  4LDT D;  2N9E B;  2JVC A;  4HVB A;  2KZR A;  2DZI A;  2LUE A;  2WX1 A;  3PSE B;  4MGY E;  2VRR B;  3PS6 A;  4FN2 A;  2MRP A;  4XC2 A;  3ZIM A;  4MEL A;  4OVU A;  3ZVV A;  2Z59 B;  3S2A A;  2FCM A;  1P9D U;  1OEY J;  2LZ6 A;  3A1Q B;  3DCG A;  4I6N B;  1D3Z A;  1RFA A;  3B1L X;  4W9L A;  5D2M B;  3JSV A;  2LVP A;  2BGF A;  2K25 A;  3KUC B;  3W1S C;  1X1M A;  3OAW A;  3PRP B;  2KOX A;  1Z2M A;  4HCN B;  3AI5 A;  4ICU A;  4JIO U;  3V60 A;  2L0T A;  1SGH A;  1WGH A;  4GGQ A;  3ALB A;  4GIV A;  4HXD A;  3MJW A;  1TBE A;  1YD8 U;  3W1Y A;  3VAW A;  1ZKH A;  2J7Q B;  3DDC B;  3APF A;  3A33 B;  2AEH A;  2FNJ B;  3UF8 A;  3VHT C;  3JVZ X;  2N1V A;  1UZX B;  1YIW A;  3UIP B;  2DYO A;  3EFU A;  3PLV A;  4ASW C;  2BYF A;  4TV3 A;  4GN1 A;  4HWI B;  3T8M A;  3D32 A;  1LQB A;  2LI5 A;  4XX5 A;  1RRB A;  3DBH I;  3EC8 A;  3AUL A;  2IY1 B;  3ZNZ B;  4YL8 A;  1K8R B;  4RM9 A;  4JLC A;  3N3K B;  2GOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...