1ZKMA

Structural analysis of escherichia coli thif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
244
structure length
244
Chain Sequence
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Escherichia Coli ThiF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylyltransferase thiF
total genus 70
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zkmA00
2VZ0A 1U3VA 3RAJA 3FNGA 4G81A 1HDCA 2EKLA 4PG4A 3A28A 2Q50A 1HDYA 3HSKA 1TT5B 1ZH8A 3RKRA 4HNHA 4FN4A 3GPDG 3STHA 4B7UA 4R5HA 4AL4A 1HLPA 1E3IA 1GD1O 1X13A 2XOXA 3UAGA 1J4AA 4MJLA 4A03A 2JD1A 5DBGA 1GQ2A 1VKNA 3DBRA 4UVGA 3VVBA 4CL3A 1JAXA 6ADHA 1YVEI 4RDHA 1B15A 4WPGA 3UH1A 1ISGA 4ZGWA 2X86A 1JVSA 1VC2A 1M67A 3UHAA 1GUZA 2Y67A 1C1DA 5DZSA 1O5IA 5F1KA 5T6BA 4CJXA 2E82A 1HE4A 1NP3A 1I10A 1UZNA 2EV9A 3AUTA 3L07A 4GWGA 1T2FA 1RM4A 3QSGA 4PZEA 3K92A 4PZDA 2NLOA 3GVPA 1PIWA 1MLDA 3O8QB 4JBHA 1D7OA 2OP1A 4I5EA 3V5NA 3L9XA 3GNTA 3R3SA 4PFJA 5IF3A 3IQDB 4Z0PA 3RI3A 2P4HX 3H9UA 5KKCA 4BGUA 4GLLA 1LDMA 2V6FA 1ONOA 3M2TA 5JYEA 1EVZA 3D4NA 3QV1A 3MJ4A 4CMEA 1ISIA 4CPDA 1DIGA 3V1UA 3T4XA 3GN1A 4O0LA 4YEDA 4AJLA 1T1RA 3RFXA 4PLWA 3D3EA 4OL9A 1LQUA 1PS0A 3VZPA 2VHVA 4IJVA 2JL1A 2NM0A 3VPGA 3VPXA 4A0SA 1ML3A 4PLFA 3AM5A 5DP1A 3ADOA 4HFJA 3GVCA 3C7DB 4OQYA 2GPTA 3SLKA 3W4KA 1EFKA 1OBFO 4LSWA 1XSEA 4LVUA 3F9IA 3QWFA 5J23A 3GNQA 1JKFA 3ON5A 3VH4A 2CUKA 2FN7A 5CDUA 3PIDA 1ONNA 1ZKMA 1YJ8A 1GCUA 1ZBQA 1ZSNA 4MP6A 2FZEA 3H8VA 3FR7A 3DL2A 2IZ1A 3E9NA 3JD3A 3QWAA 4TRRA 5K9ZA 1T2DA 1ULSA 1SOWA 3KSZO 4UVHA 4WCFA 1H0KA 1GUYA 1IULA 3F47A 3UUWA 2I3AA 1I33A 4CL8A 1SCUA 3W8DA 4MVJD 4JN6B 3D7LA 3C7AA 5I9MA 3GOHA 2RIRA 3Q2IA 2VUSA 5KCZA 3A9WA 3QVOA 2O3TA 4F6CA 3BMNB 1B26A 4IMPA 4BNLA 4BNKA 1C1XA 5I9LA 1GL3A 2EEZA 4MKXA 4PLZA 4U5QA 4WCDA 1AHIA 2X1HA 1HRDA 3PHHA 4RQUA 5G4KB 3JYQA 4QSMA 4B7CA 3HDQA 3ZGYA 2PWZA 3L6EA 2ZTLA 4AJJA 1MB4A 2GZ2A 4M87A 1Y1PA 1Z82A 5TJ9A 1SAYA 4HV4A 3PZRA 1X7HA 4OQZA 3ZN2A 1A9YA 1ENOA 2QRJA 4E21A 3MWEB 2C20A 2WYVA 3FBGA 4EDFA 4L4XA 3NGXA 2YHUA 4PG5A 2HUNA 3F46A 4Q3NA 1BSVA 4NJMB 5U9CA 3RUIA 1Z73A 4GX0A 3NTRA 2HJRA 3TZ6A 2YFHA 1HSOA 3BMNA 4XRRA 4ZQHA 4NBRA 1GADO 4XJSA 3H2ZA 1WZIA 1NWHA 1H6CA 2DTEA 1PJTA 3BTSA 3FF4A 4C7JA 2EERA 1LTHR 2Y1CA 4NH4A 3GVHA 4B4UA 1CYDA 1YL6A 4FOSA 2H1SA 1VM6A 4R69A 4TROA 5TX7A 3U4HA 1D4FA 1W8DA 4D42A 1P74A 5AOVA 5BT9A 4NJOA 3TDKA 1B0AA 2QYTA 1NQTA 1KETA 3QWIA 4DUPA 1CQJA 1I36A 2C2YA 2PTGA 3PTZA 4LMRA 4MVJI 5F5NA 1DC3A 1YB5A 4J43A 1XU7A 2UV8A 1TT5A 3QWBA 4E2ZA 4INAA 1IPEA 3C8MA 4DIBA 3HZZA 5AQ1A 2TMGA 3DMTA 4XR4A 4URFA 3L77A 3WXBA 1JKIA 4OXKA 5B1YA 4DTIA 1M76A 5T57A 3U0BA 4YACA 5CAEA 4L73A 4WE3A 3C7CB 3G49A 5EINA 4H15A 3RFTA 4OKIA 3A06A 2RBEA 4XDZA 5HA5A 2AEMA 2ZK7A 3D5QA 5ITWA 1HXHA 1G1AA 2IEBA 5I8ZA 3F6YA 2FPIA 2DLDA 4IXTA 3KYCA 2PH5A 4E5NA 5IDWA 3GRKA 2Q45A 2RH4A 2XXJA 1BXZA 3M2PA 3E5MA 1H6AA 5A4DA 2BFMA 3WSVA 1KOLA 5K6AA 3N74A 3ZU5A 4O1MA 3E18A 3MJSA 2J3HA 4JX8A 4C4OA 2XPCA 1UUFA 2OGUA 5ILOA 3BTOA 1W73A 4BKQA 3H3JA 4NBWA 4KP7A 1CJCA 1CERA 2OMEA 2P9EA 3GUYA 4WOKA 3PRJA 4BO3A 4XKJA 3QVXA 1HEUA 3WGZA 3VPHA 3K2BA 4I1IA 1EDZA 5DULA 1IZ0A 3NTQA 1VKOA 4L4RA 4D0SA 2UAGA 2DUUA 3PQEA 4GLOA 3CPSA 2GO1A 2OBNA 1YE3A 3GR6A 3I83A 1TA4A 3VPSA 2O4UX 4JBGA 5DCYA 4J3FA 3JQAD 1RPNA 4WCFC 5T8KC 4AVYA 1LRJA 2GDZA 1YH3A 4JNKA 3SBOA 1PL6A 1TLTA 4A7PA 4LVCA 4E3ZA 1YB1A 3ITKA 4XB2A 4AJIA 1N9GA 3VH1A 1B16A 4EZBA 1R4NB 2H63A 4MOWA 1UDBA 3F5QA 3DAPA 9LDTA 3TPCA 3BHJA 4K28A 1G6KA 4XR9A 4ZRMA 2ZJ1A 3RFVA 4J49A 4NK5A 1VL8A 3TWOA 1PTJA 1E6EA 2BMAA 5FEUA 2CVOA 2WM3A 3BMOA 4Q3AA 4DIFA 2AA3A 4E4YA 1Q0HA 1JKJA 3D1LA 3PGXA 2Z1NA 4L8VA 3ZW9A 4W99A 4WUVA 3AU9A 4TKMA 2FR0A 4KUHA 1QLJA 3JYPA 4J9UE 4XA8A 3WGGA 1RKXA 4GVXA 3WS7A 1NWCA 4CM1A 3NT2A 2CFCA 5ENVA 1KEUA 2DBQA 2FMUA 3I3OA 2G0TA 4CLOB 3QIVA 5I7SA 3PHLA 1EK5A 1AXEA 3OH8A 4TVOA 2X0IA 4BO2A 4GMFA 4OGWA 4YXFA 4DYVA 4IINA 1NNUA 1ZIDA 4FR5A 2HMTA 1R0KA 1ZXBA 2O50A 1QR6A 2AG8A 2DC1A 3I9JA 2RH8A 1ISFA 3K30A 3LT4A 4E6PA 2B5WA 3K5PA 3LC1O 5FYDA 3RVDA 1RJWA 1MC4A 1AXGA 2GASA 3D4OA 1QSGA 4IY1A 5F3RA 1IYZA 5JDIC 4IQ0A 1LU9A 3W6ZA 1NAHA 4GKVA 4UAGA 4PZCA 5JCXA 4RJTA 2B5VA 2HKIA 3DHYA 3BZUA 5CDSA 8LDHA 3DQPA 5IDXA 3U62A 4R68A 4O6VA 4OYRA 4CMHA 2PZKA 3BIOA 4IPTA 3BTUA 3EZLA 4D44A 4NK4A 5TNXA 5JDCA 1DIBA 3F4BA 1PQWA 5L7YA 3DOOA 4IZHA 4UUMA 1EVYA 4NQZA 1F14A 5FI3A 3DMTC 4B8ZA 4D7AA 6LDHA 1Z7EA 3HB4X 1U5CA 1DAPA 2E4AA 2GERA 2P4QA 3ABIA 4FC7A 4FCCA 4GL4A 4CMIA 5EL0A 1RM3A 3RUAA 2AQHA 2O7QA 3QA9A 2OORA 3L9WA 4QEDA 3NT4A 4B3JA 3LC7O 3GZ4A 2GNAA 4DQVA 4PIVA 1XQ1A 3VAZA 1HKUA 2DTDA 4NR0A 3NUGA 3AUSA 3RD5A 2NSDA 2CNBA 3P2YA 2BFAA 1VJ0A 1JA9A 2ZTVA 1P33A 5DN9A 5I7VA 4IIUA 3I1JA 2J5RA 3IJPA 4YDRA 4IBOA 3TZKA 1DC4A 2GSDA 3A1NA 1SBYA 4I9UA 3RROA 1VL0A 5K6AC 1XIVA 2C7VA 1JAYA 1LXCA 2X9VA 3D4PA 3DOCA 5G0TA 3ZHXA 1EQUA 1LC0A 1QXSA 1KBZA 3L4BC 2GN4A 3ADPA 1A4UA 5F21A 1E3JA 3WQRA 3ZU4A 2EW8A 3OP4A 4KMSA 2HMWA 2EKQA 4DLLA 4RV9A 3MJVA 5L4NA 3GNSA 3H65A 3EHEA 3RUDA 1BTOA 2FRDA 2W2KA 3GN2A 2F1KA 2D8AA 1EEHA 2NU6A 3C24A 1K6XA 3ZI0A 1YQGA 3OSUA 4AJHA 4BKRA 5A9RA 3H7AA 1NFRA 4RDIA 2C54A 4GWKA 1U28A 1V3UA 4YJFA 3GH3A 1PJSA 2PH3A 3SJUA 3W1VA 2Q1SA 1ZVMA 2EJWA 5TF4A 4BB5A 4LCEA 4FPXA 1D1TA 1QORA 2PGLA 4GSKA 2I99A 5ILGA 5HM8A 1GQQA 4WNIA 5A9TA 4CUJA 4GKBA 3CXRA 4GAEA 1D8AA 3AUUA 3RU9A 1B3RA 4WLOA 1UXGA 5L95A 4YAIA 3N7UA 3RUEA 3KETA 1F17A 3KYDA 1M2WA 5JW6A 3UW3A 1T25A 1X1EA 4R9RA 3JSAA 1UZMA 3PJFA 1MGOA 1XA0A 5G2OA 4XQEA 3PZBA 1DIHA 2CY0A 4DIOA 3WYEA 4WNCA 5ER6A 3TL3A 2CMDA 1Z6ZA 3G1UA 4BMVA 4CMKA 1J6UA 4J9VA 1K0UA 3OJLA 1PJ4A 5A9SB 4GVLA 3LDHA 3ROMA 4BO9A 3DAFA 2NV6A 2A4KA 1OMOA 3PWZA 4XZ3A 1KY4A 5IDYA 1UAGA 3RASA 1N1EA 3I9KA 5A1TA 1Y8RB 4MKRA 4KUEA 2G76A 3TOXA 4EJ0A 1D3AA 3SC4A 2YFQA 4WGGA 4J4BA 4HNGA 4Y6RA 5FF9A 1Y7TA 3VKVA 4TWRA 4HP8A 3WMXA 4DXHA 1WDKA 4O5OA 4ROSA 1LLUA 4HBGA 4XD2A 3WTCA 1Y81A 2OBYA 1E3WA 4FFNA 2VWPA 3PLRA 2D2IA 3ZHYA 4LGVA 3JYNA 4W6ZA 4IJKA 2X5JO 4BO4A 4WEQA 4M55A 2X22A 1E3LA 2JCVA 3FN4A 4YAKA 3H2SA 2ZB8A 4RF4A 2BELA 3RBZA 4E32A 4L74A 1NQ5A 1WDLA 4YRAA 2GUGA 4AJPA 2VYVD 3TNLA 5C7IO 4CM4A 1DJNA 4JROA 1BDBA 3AW9A 5CEJA 3Q3CA 4OM8A 2JD2A 4S3MA 1R66A 1MP0A 4RQTA 1QMGA 4PG8A 1K6IA 5A02A 3C1TA 3ZWNA 4YA6A 3JD1A 3ZU3A 3H5NA 4EEXA 3PVZA 3IMFA 1H93A 3I4CA 4DPMA 4BNGA 3AI3A 1YWGO 2I9PA 4HWKA 2DAPA 4XRGA 1UP6A 1OAAA 1HDZA 1PGQA 5F5LA 5JC1A 5FI5A 3SJ7A 2JCXA 5I8WA 2O48X 3INTA 4OXYA 4BNIA 1E0DA 1LRLA 4KQXA 3CZRA 3RQSA 1ZFNA 3D5TA 4YVFA 5TJHA 4JGBA 2NU9A 2WEKA 1VE9A 4Y6SA 3GPIA 3U09A 1K89A 2QQ5A 4FJ0A 1FDUA 1C0LA 3DZGA 3G17A 4YBZA 3GY0A 5JFOA 1GYRA 5TLSA 3T4EA 3HB5X 1MFPA 2C2XA 2RAFA 2YV1A 2OXIA 4OXNA 3LF1A 5A05A 5B37A 1NAIA 3ICPA 1ZNQO 1W0CA 3KZVA 4MO2A 4RO0A 5AYVA 4RLSA 1HSZA 1GCOA 3OJEA 1WWKA 2BF7A 3M1LA 4YJGA 3H3FA 1BXGB 1L7EA 2YDYA 4QQRA 3U3XA 3ASVA 4WLUA 4BGIA 4BKPA 2RHRA 4GI2A 3PK0A 2DU8A 3G0OA 2HAEA 5JYDA 5LCXA 3OA2A 2BGKA 3SVTA 3QRWA 3FNHA 3K6JA 4MIOA 3AY7A 5IAAA 1GTMA 5A3VA 1LUAA 1BDMA 3R6DA 2B37A 3PGJA 1KEVA 4J4TA 1J5PA 2AHRA 3I9NA 1E3SA 2I5PO 2H5LA 2W98A 3GEGA 1FDSA 3WNVA 2Q2WA 1PR9A 3KSUA 3WR5A 5TIIA 3DB2A 4N54A 1B7GO 2AQKA 3IS3A 2BFOA 3ETGA 3GC6A 3ZNOA 2D4AA 2Y1EA 1AN9A 4HFMA 4JJFA 4JK3A 2V6MA 3H6KA 3DBRB 1HE3A 4E0BA 1R4MA 1YBAA 1NVTA 1PL7A 2CF6A 1O6ZA 3O26A 3WJAA 4BGEA 4CR8A 3OJFA 2FR1A 3PI7A 3UCXA 5JE8A 1NFQA 3ASUA 2NWQA 3WIDA 1I0ZA 3DAGA 4ZU3A 2DPHA 2FR8A 3MOIA 3WBFA 3S2EA 4JBIA 3I9MA 4L75A 1I3MA 1KY5A 3EAGA 4RVSA 4LRSB 1Y8RA 3ETEA 4U7WA 1JU9A 4R9SA 3FRJA 1RYEA 4QTZA 4RVHA 4D43A 1VI2A 3PIIA 1C0IA 1Y6JA 4YT8A 2IZZA 2C0CA 1BMDA 2Q1TA 3BHMA 4BO1A 3ZWVA 3ENKA 1E3WB 1DIRA 1O95A 3OMLA 5B4UA 2C5EA 4PLGA 4XYMA 3NDIA 1EDOA 1PQUA 2POQX 3MJTA 1PJ2A 1R15A 2DBZA 1WVGA 2VHYA 4CV0A 3ENNA 3RBXA 4J2OA 4OSPA 4DBVO 4N18A 3WBBA 1DLJA 5JAIA 4G5HA 5JNLA 4HY3A 1G0OA 4PRLA 4KWHA 1ONPA 2WYUA 1KIFA 2DT5A 1NXQA 3B20A 4BV9A 4ZQFA 3VZQA 4FDAA 2X6TA 1GAEO 1DC5A 2Q49A 3D0OA 2D59A 2VZ8A 4BKOA 4W4TA 1VJTA 3LYLA 4EI2A 3I52A 1MXFA 3ROPA 4ALIA 1ZEMA 2IXAA 2YYYA 5B4VA 3GQVA 3E82A 3TZCA 2Q3EA 1Z7BA 4TRNA 3GDGA 4R01A 1NASA 5DT9A 2A94A 3KB6A 3MCVA 2EP7A 2I67A 1KVUA 2VN8A 3BMCB 4YTEA 1LQTA 3I4FA 3JQFA 3C1OA 4PRKA 4CLXA 4PG6A 1P44A 1Y9AA 1T2CA 4CLEA 3DZJA 4EUHA 3GFBA 5L3ZA 3DWFA 1QLHA 1WXDA 4TQGA 4R54A 4F46A 5CEFA 3WGTA 3QVTA 3OQ1A 4NMHA 2XF8A 1QYDA 4BNUA 1A72A 1HYEA 3S2IA 1X14A 2BD0A 4D46A 3IP1A 2WWRA 2JAPA 2VUUA 2Y99A 3WMWA 3UF0A 4MVJG 5IZCA 1HT0A 3LQFA 1ENYA 1N7HA 4YCAA 3MZ0A 4Z9XA 4BQPA 3JCZA 5DDIP 3E48A 1A7KA 4NFYA 5ENDA 2CF5A 1SB9A 1SNYA 4OIMA 2J8ZA 1CEQA 2ZIZA 1B8VA 1OOEA 1U7TA 3JTMA 3BHIA 1IPFA 3K2EA 2J3IA 2WD7A 4MDHA 4ESOA 3BMQA 3RSHA 5BNTA 2HK7A 1HZZA 3IIEA 1YDEA 2ZQZA 1I5RA 4RZHA 3GG2A 3BXXA 4KQWA 3ROQA 2YJZA 3WB9A 2NTJA 5C7LO 3MEQA 4J7XA 3NRCA 3W4JA 3DFZA 2PK3A 3DBHB 3WOHA 3O38A 3P2OA 1ZJYA 4RORA 3INGA 3A14A 3PEFA 3B6ZA 1PJBA 4UUOA 4P4GA 4B4WA 3OQ6A 2BLLA 3B70A 5L4SA 3E03A 4XIYA 3HN7A 4MVJP 4W82A 1VSVA 4CMEC 5H82A 1HYGA 1M6WA 2V6BA 4J7UA 4CM7A 4CM6A 3PPIA 4BNYA 4ZVVA 2Y68A 4JJIA 3BMQB 2PZLA 3HQ4O 1B3BA 1BHSA 3V1TC 1QYWA 2VUTA 3LLSA 4RVUA 3KV3O 5JCJA 4IQ8A 3COSA 4II3A 2YHIB 1G0NA 3JQGB 2FSSA 2CVQA 4JIGA 3JYLA 5A3JA 4LK3A 4F3YA 3JD4A 3BTVA 1I01A 2EGHA 4IDCA 3O9ZA 3K9QO 5DOZA 3UCFA 3N58A 3IKTA 1BVUA 1FDVA 1P0CA 2O2SA 3DHNA 1U1IA 2VZ9A 4UVIA 2IODA 3SEFA 1NFFA 1XQ6A 3GGOA 4RPHA 1OFGA 2NQTA 3PHGA 4LMPA 1HLDA 2ZJ0A 3P7MA 4P4LA 2VOEA 4OKNA 4FB5A 4RGBA 4QO8A 1ADFA 4Q3CA 1XU9A 3RKUA 5L4LA 1R4MB 2DM6A 4RF5A 1YBMA 2WE8A 3JQBA 2O3QA 3KEQA 4BVAA 1E7RA 3GMSA 3GVXA 4CLRA 2AXQA 3DR3A 3TZQA 5JDCC 2Z1MA 4RF2A 1LI4A 1E92A 5L45A 1HETA 3FWNA 2ZB7A 3GHHA 3HNPA 7ADHA 1PJLA 2YUTA 2G1UA 5I7FA 1JW9B 1V0JA 1TVEA 3WNQA 1K6JA 2E6UX 5HTOA 1YBVA 1O89A 2EP5A 3BA1A 3DZKA 1YQDA 1BXKA 3EY4A 3IJRA 1I2CA 3VZSA 4IDGA 4FQ8A 4RZIA 2GYYA 3RU7A 4BO7A 1EE2A 3ZW8A 1WMBA 4CODB 2VHXA 1CQIA 3AUAA 5I7EA 3JQFC 2B35A 3MJEA 4ZJUA 1O94A 4DVJA 1EUZA 4IGFA 4RPJA 4ND1A 4WLEA 4CQLB 3AM3A 5H83A 1E1NA 2R6JA 4ZRNA 3DBLA 2OL4A 2EHDA 3IAHA 1ISJA 5G4KA 4PVDA 1DBVO 4LN1A 3BMOB 4HKTA 3VTZA 4RPKA 1PGJA 4YAGA 2ZTMA 2GR9A 2FP4A 1IE3A 5LDHA 4EYEA 3U4IA 4IGEA 3K31A 4MIYA 3BMCA 1SB8A 3H9GA 2NACA 1K3TA 2BI8A 4DGSA 3HE3A 1BG6A 4W7IA 4ID9A 5EN4A 5IZCC 4GQAA 1HE2A 1VL6A 1E6UA 4ZQBA 4A73A 4PN3A 3E9MA 4YB8A 4U0KA 4CM8B 3FI9A 3WIEA 4CQLA 4PCVA 4FBGA 2P5UA 5BSGA 1YOVA 5HS4A 2X4GA 2NVUA 2BKAA 1XHLA 5DBFA 5KTKA 2IYOA 2E37A 3ZCXA 4CUKA 3WGOA 2C59A 3RUFA 4BOYA 2QG4A 2JFHA 4R1SA 1PX0A 5G0UA 1KERA 4FFRA 4H7PA 1P3DA 1AE1A 3QE3A 2EIHA 4B7XA 4MVJE 1YB4A 2AE1A 4D45A 5C5IA 1LRKA 1O8CA 1T2EA 3AK4A 4RVDA 1JDJA 3QHAA 1DO8A 1ZXLA 4ZHSA 2Q2QA 4XB1A 2QIOA 5LDGA 1UZLA 3E8XA 3TQHA 4BO0A 1DFHA 1BW9A 4R16A 5JO9A 4CQMB 5TSDA 5KOIA 4BB6A 2C82A 1ZK2A 4BNTA 4HX5A 5IXYA 4EJ6A 3WGHA 3ANLA 2X0NA 1PU2A 3PFFA 2GCGA 1F0YA 3KTDA 4ZQGA 5L53A 2CDCA 2O2YA 4RVGA 2JAHA 1CDOA 4J1QA 2QYSA 1KYQA 3WWYA 4IJUA 5EPOA 1PWZA 3QP9A 4EW6A 4XYGA 3H4VA 2P9GA 1M75A 1NVGA 1DRUA 2VNSA 3UN1A 3CUKA 4KUGA 3RIHA 3Q9NA 4Q3BA 2PGJA 8ADHA 1KC1A 4BNMA 5BNIA 1NYTA 2D0IA 4QFCA 1E5LA 2Z5LA 2ZB4A 4YJHB 1YO6A 2RHCA 3CMMA 1T4BA 4Z0TA 1JWAB 1V3VA 3VPFA 3K8ZA 3RBVA 2BI7A 3GK3A 1SO8A 5C7OO 2Q4EA 2VHWA 5IXSA 1N7GA 1CIVA 1UDCA 3D64A 5EJ2A 4BO5A 4CM5A 4I5DA 4OAQA 1YJQA 5I9NA 1HDXA 1ZUD1 1DPGA 2B4RO 2D5CA 2HMUA 2VWGA 3QLJA 1DDOA 3ULKA 3R1IA 1PSDA 2J6IA 3HDYA 4Z3DA 1AGNA 2VYVA 3U4CA 4BO8A 3QW2A 2VCYA 3UGKA 5DF1A 4UEOA 4FS3A 2A9FA 1NX6A 4JJGA 1ZEJA 4LRTB 3PFWO 4DMMA 4DRYA 3PJGA 4L9RA 4AJOA 3JQGA 4M86A 3RJ5A 3WTBA 3HADA 4B3IA 4NNJA 3I6QA 4I08A 3O03A 1HDRA 1EBUA 1R6DA 2UYYA 5U1PA 1L7DA 2VWHA 3HHPA 4IS2A 3NDJA 3OF2A 2CD9A 4KZPA 1XDWA 3PXXA 3PHIA 2DPGA 5A9SA 3KYCB 3DZBA 4E2YA 1PZFA 5EIOA 4UUNA 4OOEA 4P4NA 1ZZEA 1EE9A 5GZ1A 1IHYA 3JQ9C 1B8PA 3JQEA 1D1SA 4WECA 4WKGA 1PZHA 3HUDA 2EKPA 1AHHA 4ALJA 1Z75A 4DQXA 4CM3A 4GSLA 2F00A 4BGVA 4CMJA 2XXBA 4CLRB 5EQDA 4AICA 5CDGA 3AY3A 1T24A 3ZV6A 2JFFA 3IOYA 3VDQA 3FNFA 3LVFO 5LC1A 3IKVA 2GZ3A 3GVIA 2ZKLA 2ILTA 2Y0CA 1UXKA 1HTBA 1YQXA 2D1YA 2Y93A 3HJAA 4JQCA 5A04A 3TJRA 1R37A 4E5YA 1ZK3A 1GR0A 2IDZA 2O23A 1LSOA 3IDSA 3H9JA 2G17A 2JFGA 3IUSA 4CR6A 4XJTA 4ILKA 1B2LA 1XELA 2OFPA 2TMDA 3CKYA 2JKVA 5KWEA 1ARZA 4GH5A 4XX0A 2VOJA 4IJWA 2WYWA 2O7SA 1RM0A 5KKAA 4L76A 2P9CA 2WD7B 4DLAA 2VRCD 2FPGA 3DXFA 3I23A 3ZH2A 4J2HA 4BNZA 4I9HA 2CDBA 4B4VA 1DXYA 2ZTUA 1PR3A 4YJDA 1B14A 1ADBA 1I3KA 2C7GA 1FK8A 1M6HA 4BQRA 2Y0EA 3C1AA 4MP3A 3DBHA 4CQMA 1P9LA 4YQYA 3LT0A 3CIFA 4WOJA 2YQ4A 5IDQA 4WASA 2I76A 3BYZA 2PKQO 3ETDA 1I2ZA 2NVUB 1IB6A 5JPIA 4WCFB 2J3JA 3QY9A 5T8KA 1V35A 2P68A 3SXPA 1BRMA 3HFSA 4J91A 5KJ6A 4FGWA 5HRUA 4K26A 2X9GA 1ZSVA 2NADA 2PR2A 1QYXA 1OC2A 4JXKA 3PJDA 2X8LA 1HF3A 1NTOA 2LDXA 4J1TA 4Y67A 3ZWOA 4BNWA 1TB4A 3GA0A 3WQSB 5HBRA 5JC8A 3TF5A 1X1TA 4NI5A 1E1MA 1PJQA 1LC3A 1Q0QA 2PD3A 1ZCJA 2QZZA 4FFOA 4FSHA 3W8EA 1ADGA 1W6UA 2GZ1A 4Y98A 1ENZA 4DREA 1UR5A 2GN8A 2DKNA 3AOEC 1PWXA 3E5RA 3ZHZA 3UXYA 2O3UA 4KTVE 5A03A 5TT1A 4M1QA 1F8FA 4KDFA 5DP2A 4DLBA 3RUHA 4N7RA 1MG0A 3BAZA 3K73O 1QYVA 1ZK1A 1U5AA 2UDPA 3VTFA 3U9LA 1DAOA 1ZSYA 5EERA 4R5MA 1E7MA 3OECA 1QG6A 5AXDA 4IM7A 3KXDA 1YGYA 1MFZA 1BXGA 5EESA 1PQPA 1SZJG 3ANNA 1M66A 3FBTA 1E7YA 1P77A 3KHUA 2R00C 1YS4A 3FD8A 5IN4A 2Y1GA 4GBJA 2HMSA 4E2XA 1XKQA 5F1PA 2HK8A 4DBZA 1N2SA 2Y1DA 5CP8A 2P2SA 4E33A 5KJFA 3M1AA 3EC7A 4ALLA 3FSRA 3ZV4A 4EITA 4K9DA 2Q1UA 2ZYAA 1ZJZA 2WTBA 3NTOA 3W8FA 3WGQA 1T2AA 1DRWA 2YV2A 3QQPA 1GFSA 4G65A 4TMFA 2NVBA 1H6DA 2QZ9A 2ZYGA 5DCUA 1Y8QB 2O3SA 4RPLA 4JP2A 1R0LA 4TZTA 4IZIA 3U5TA 2PGDA 1PZGA 3B1JA 2AW5A 1NM5A 3OFSA 5KJ1A 1GUFA 1ZW1A 4RPGA 3OEYA 3HN2A 5JAZA 5TGDA 5CG1A 4PLHA 2Q1WA 4E5MA 3C3XA 3JQAA 1NR7A 1GU7A 3DZHA 1OZAA 4BV8A 3DMYA 5A5EA 1OI7A 2WDZA 4NPCA 3ROKA 2HJSA 3INRA 4RCVA 2QX7A 5BQFA 3WFJA 1P1IA 5COBA 5G0WA 3GT0A 3E6AA 1P31A 1U7HA 3HWRA 2CSUA 4H16A 5KJCA 4CQMD 2HRZA 3H5RA 4Z3KA 4DC1A 5JY1A 3SX2A 1IUKA 4RLHA 4D3SA 2DTXA 5COQA 1LX6A 1DSSG 1GY8A 4OOFA 2Q4BA 4GX5A 3P19A 3WGYA 4K1LA 1F12A 1RYDA 4CLHA 1FDTA 3JD0A 5KIAA 1T1SA 5COAA 2PFGA 2VYND 3ONFA 4P38A 1YL5A 4U6SA 2BGLA 3KYBA 3UCEA 2DVMA 4BNVA 3LT2A 4C7KA 1ZK4A 4XYEA 3VHRA 4CUZA 3ZZNA 2JCYA 2QHXA 5JCJD 2OHXA 5DCWA 2X0JA 1KVSA 1SEVA 1T26A 3H9EO 1GDHA 5T67A 4YPOA 3PDJA 3L6OO 4FFPA 1E7SA 2Z95A 4N5LA 1GPDG 3RC9A 2GN6A 2DBVO 2AMFA 4P8RA 3FCOA 1KVRA 3ZWMA 2ZB3A 1ULUA 1YKFA 3WFIA 5T64A 1NR1A 5IG2A 3RUCA 4K6FA 4J16A 4U6QA 4WLFA 5U4QA 4OJNA 4CM4B 1A7AA 3V8BA 3PQFA 2BRUA 3V1YA 1MG5A 3WGIA 1QV7A 1U3UA 2IXBA 2FPPA 1XGKA 2CZCA 2W90A 5CDTA 2NU7A 4M8SA 1HDOA 1JN0A 1PZEA 2HCTA 3AOEA 3KRTA 1FDWA 4KOAA 4IUYA 3V2UA 3E1KA 3GZNB 2HK9A 5CPFA 4AJNA 2FY8A 5ICMA 3JQBC 1GV1A 1WZEA 2EXXA 3MTJA 3WQQA 1YOVB 2LDBA 3G1TA 1VLLA 3FTPA 3KM0A 3LF2A 2OZPA 2FZWA 2NQ8A 4UEKA 2VRBA 3TFQA 3PDUA 3ST7A 1I30A 5C3MA 1OC4A 3VH2A 2GGSA 2HQ1A 3NJ4A 4WJZA 5JS6A 3DONA 3ICCA 3KOUA 3AU8A 5L7WA 4M89A 1V9LA 2HO5A 1E7QA 3JQ8A 3UFXA 3DFUA 2E49A 2X58A 2WMDA 4FJ2A 5JXWA 4P22A 3OIDA 1RWBA 3JQDA 3TZHA 1BW9B 3PWSA 3AI1A 1B8UA 3GMDA 1T4DA 2W4QA 3R0IA 1U4SA 2FSVA 2GRAA 3LU1A 3DO5A 3S2GA 3DC2A 3P5SA 4NU5A 2EJVA 1JQBA 3OJOA 1PJ3A 2EG9A 2OP0A 2OO5A 1HL3A 3KSDO 1A4IA 4RL6A 4A10A 4AG3A 4IS3A 1UP4A 3ONEA 4KWIA 3VH3A 5JDIA 4MIEA 3ZDFA 4Q9NA 1LLCA 3CMCO 4TZKA 1LSJA 4CMIB 1FJHA 3JQ8B 5CHEA 4NFHA 2I6TA 3AFNA 4A27A 3JQAB 4BIIA 1U2GA 5FFFA 1LDNA 2HDHA 3EW7A 1U4OA 3LC2O 4PGFA 5CG2A 4XYLA 3OICA 3WSWA 3W4IA 3HG7A 2GLXA 4NFSA 3GUCA 5GZ6A 1DEHA 2X23A 4AFNA 2ZQYA 3ANMA 4IDEA 4PVCA 1SMKA 1H94A 3EVNA 4B4OA 3DTTA 1L1FA 4BNNA 3F5SA 3OQBA 4IDDA 1WP4A 4KDEA 2VHZA 3X2EA 1C14A 1JVBA 4D41A 4YWJA 3Q0EA 1Y5RA 3GLQA 4J7CA 3D3WA 1H9AA 3WLFA 4NDNE 4I5GA 1H5QA 5CFZA 2YDXA 4R1UA 3OJ0A 1VPDA 4E13A 1NHWA 2QRLA 3GFGA 1HZJA 4J0FA 1EFLA 3RJ9A 3WG9A 1V8BA 2DFDA 2EW2A 2VQ3A 3RWBA 4XCVA 3O8QA 4Z0HO 3ONDA 1EZ4A 1FF9A 3Q9UA 4MKZA 1LNQA 4YAEA 1IL0A 1U8FO 1GYPA 4FFLA 3GRPA 1ISHA 4BNFA 2XAAA 4MP8A 3ZWCA 5G0SA 2A35A 1TXGA 3W6UA 2VTEA 1YXMA 2G5CA 2P91A 3G3EA 1ISMA 1UJMA 2FOIA 2C5AA 1DLIA 4N5MA 4J1SA 4XGKA 3ZV5A 1Q7GA 3M6IA 4ND3A 3DHEA 2W8ZA 4B8WA 4IDBA 3UICA 1YDWA 3MTGA 4MVJF 1E77A 1PGPA 1H6BA 4ITUA 5JMWA 2D3TA 5A06A 3UKOA 4PLCA 4HADA 4BMSA 3WX0A 5MGBA 4CR7A 3PYLA 1SOVA 1PS8A 3C85A 1C0KA 3GZNA 3L0DA 3WLEA 1K2WA 2YW9A 1C1XB 5ES3A 1Y5MA 1V3TA 5BSFA 3FR8A 4Y9DA 3PWKA 3PYMA 2O3RA 3SC6A 1DB3A 1WNTA 2FWMX 2YY7A 1A71A 4DPKA 4MVJH 1O0SA 4Z9FA 3LZ6A 2WJPA 4R3NA 4EJMA 1E7WA 4LW8A 5BSHA 3JQ6A 4D79A 1GYQA 4E30A 4HXYA 4ZD6A 3NV9A 1UXJA 2G82A 1P1KA 3B1KA 3MJCA 4H3VA 2V6GA 5TT0A 3FTNA 3H9QA 4IQGA 1CETA 1JWBB 5G4LA 3ZWPA 1I3LA 4CLOA 1WPQA 1X15A 5AVOA 1LLQA 3RC1A 4XYBA 4LISA 4A26A 1SC6A 4FD3A 4E31A 3AFMA 4QO7A 4UREA 4II2A 9LDBA 1BWSA 5BNFA 3AI2A 4CMBA 2R2GA 4AJKA 3AM4A 1QYCA 3V2HA 5JO0A 3SLGA 1CF2O 4B3HA 1PL8A 4K6CA 3ZWWA 5KNLA 2PZMA 4I8XA 2EWMA 5CPBA 3QVSA 4R4JA 4BHTA 1U3WA 1ZO8A 1U2DA 4D3FA 2O3JA 2HSDA 2WSBA 3CZMA 3HFGA 3IP3A 4QECA 1QV6A 2X9NA 4J4HA 3PJEA 4AJEA 4PLVA 4R41A 1HWYA 2AG5A 4KTTE 4QX6A 4NBVA 5L7TA 2IEDA 3OHSX 4CV3A 3RCBA 1UXIA 3OIFA 1UP7A 3NJ8A 1MV8A 2W2LA 2HMVA 1WAMA 3NKLA 1E1LA 1QRRA 3FHLA 3IC5A 1Z45A 3R3JA 2W2LD 1A5ZA 3V2GA 2VTDA 1TI7A 4XGIA 4WLNA 5KJEA 5IN5A 4OMUA 4YYZA 1DRVA 2B36A 1R12A 2B69A 1ZMTA 1LDEA 1GZ6A 1I24A 1N5DA 1N92A 2C07A 3HDHA 3QWHA 2DFVA 2Q99A 5L9AA 3I9LA 3D3WB 1X7DA 3AWDA 2NVWA 4MVJA 5G0VA 5JY6A 4Q3DA 3O4RA 4DYDA 1RM5A 4D3DA 4G2NA 3DOJA 1I8TA 4ZN6A 3GG9A 2V65A 4LCJA 4A2CA 4GPD1 3KYDB 3ZNNA 1U8XX 1Y8QA 1Y9EA 3MOGA 4CV1A 3S8MA 2VNAA 3GGGA 1C3VA 3JQ7A 1YRLA 2IYPA 4DL9A 5BR7A 4A5OA 4Z9YA 3DEYX 3EYWA 3VKUA 5AXAA 1EVIA 4WLVA 1BGVA 2Y1FA 2PV7A 4GMGA 5K0ZA 1LBEA 4IXWA 4E2WA 3AJRA 4LSMA 1P0FA 4YAJA 4FC6A 3NGLA 3IL2A 3MWDB 1NQAO 2O4CA 3GAZA 3OETA 1N1GA 4I5FA 5IJZA 1PGNA 2OUIA 3QVWA 2NU8A 4R51A 4YJHA 2QRKA 4EUEA 3I6IA 4MINA 4OSOA 3FWZA 2PA3A 4UULA 4BNHA 3NDRA 3EUWA 4RF3A 4BO6A 4CV2A 4E12A 3WICA 1E1KA 4NHEA 4YJFB 2HRBA 2ZYDA 4GGOA 1R16A 3GDOA 1DFGA 4CMGA 3ZWBA 1DOHA 1XWFA 3LK7A 1MA0A 2VWQA 2WD8A 3Q6IA 2IZ0A 1EMDA 1NPYA 2Y66A 1P45A 2PY6A 5L51A 1N9GB 2J5QA 4QT0A 4EBFA 3HDJA 1I3NA 1WMAA 1A27A 4HFNA 1EK6A 4QFDA 2X0RA 3PHJA 1H2BA 1QP8A 1HYHA 4YR9A 4S1VA 4I9NA 4DQUA 4FW8A 4F45A 5ITVA 4ZICA 1TT7A 2R00A 3QJ5A 4W9NC 1J49A 4FIZA 4BS9A 4MPDA 3KO8A 3GEMA 4IDAA 2B4QA 3PYXA 4DC0A 5L40A 5JAQA 4MVJM 1XCBA 3GAFA 1DHRA 1HE5A 5F1OA 4OH1A 2HU2A 4AJ2A 5A5FA 1K5HA 2ZATA 1X0VA 3TSCA 4BNXA 2BH9A 3OM9A 2ZCUA 5TS3A 1VRWA 4BUCA 1TEHA 3ORFA 2JJYA 7MDHA 1PJCA 1SPXA 4GGPA 3LSYA 3G79A 4HFRA 3TRIA 1X0XA 1IOLA 5C37A 2AEFA 4TVBA 1MXHA 1FMCA 4F6LA 3GDFA 4CLDA 3RC2A 4JCOA 3VC7A 4TRMA 4JP3A 4O63O 4EEZA 1SEPA 3Q11A 5KVSA 1CRWG 3TN7A 1NPTO 2NNLD 5HWSA 1C0PA 1O9BA 1IHXA 1DJQA 2Y1OA 4M49A 4YJGB 3H5AA 3ZWAA 4M54A 2SCUA 3S2FA 2J5KA 2YQ5A 3E9QA 4YT2A 1NQOA 2B4TO 5T5QA 1ADCA 2Q46A 5THQA 5B12A 3PLNA 2V7PA 5JLAA 1DC6A 1QKIA 4UVEA 3AOGA 1EVJA 3CTMA 2AEJA 5DOVA 2Y0DA 3RC7A 2IRWA 3NAQA 4DWVA 3GHYA 2X5OA 1KC3A 1R0SA 3U4DA 1YONA 1LDBA 4CM8A 1N8KA 1NPDA 2GD1O 3F3SA 2Y05A 3OBBA 3UVEA 4DMLA 1ENPA 1MUUA 4UVDA 3VVCA 2IE0A 4DA9A 2ET6A 2PKQP 1XYGA 3PQDA 2W2KB 5KVCA 1KVTA 1Z74A 5TQVA 1YL7A 4HUJA 1WW8A 2X7HA 4J0EA 3NT5A 2YV3A 1ZK0A 1U9JA 2AQIA 5HS6A 2C29D 5ICSA 3TL2A 4NIMA 2NTVA 2DBRA 2RCYA 3GGPA 3JV7A 4N5NA 4CMAA 1LA2A 3K96A 3EZYA 3WWZA 5THKA 2VYNA 4R3WA 4ZQEA 1GEEA 1W4ZA 3DZIA 3EVTA 1F8GA 3KUXA 3DTYA 3X2FA 4Q3EA 2AQ8A 2DQ4A 3PP8A 2UUPA 4W7HA 5ER9A 3WDSA 1UAYA 5AXBA 1Q0LA 5FWNA 1UXHA 3GEDA 4GX1A 3DZFA 4Y6PA 1KEWA 4E5KA 3CEAA 2I3GA 3T7EA 2ZCVA 2VRCA 5GMOA 2D5AA 5GY7A 3S1LA 5GZ3A 3DBVO 3F1LA 3LLVA 5JBIA 1LJ8A 2Q2VA 3ZU2A 1LEHA 4XDYA 4AJ1A 1MX3A 5B4TA 5KVVA 5EQFA 2E48A 3EK2A 3JD2A 3T7CA 4YT4A 1LDGA 1EQ2A 1F06A 2WE7A 1C1DB 2VT3A 2CDAA 1S6YA 5DNAA 1GEGA 3GF4A 2BFPA 4YRBA 1J0XO 1XG5A 3S55A 1U3TA 4ONEA 3WYCA 3NYWA 2PZJA 4RVFA 5DBIA 2PD6A 2HLPA 2EF1A 4ND5A 1Q2XA 3KEOA 4AJ4A 1JTVA 1V6AA 3EGOA 4U8GA 4XQCA 2NTNA 3L6DA 1DFIA 2UVDA 1LLDA 1XEAA 4XIJA 4Y8VA 4EUFA 5CDYA 3ZWXA 1AUPA 5IZ4A 1Q1NA 2H6EA 4IIVA 4J90A 2JHFA 4NZ9A 2X5KO 4Q39A 3VOSA 4J1NA 4TKLA 2PNFA 5CEEA 4W9NA 3ZNPA 3JQ7B 1GV0A 4D0RA 3A4VA 4FJ1A 4PLTA 1FXSA 4GX2A 5BSEA 1WLYA 4DPLA 1VJ1A 1I2BA 2DUWA 3DBLB 5IFLA 1Q7CA 2P5YA 3TFOA 1P1FA 2NUAA 1H2HA 3CE6A 4OHUA 1E6WA 3ITDA 4CM9A 4WK6A 2I65A 1NHGA 4TSKA 4TRJA 1KEPA 4FGSA 1PEDA 1GZ3A 1EUCA 4CM9D 2BGMA 3Q2KA 2YZ7A 4QXMA 4R1NA 4L4SA 3L4SO 4FOOA 2A92A 2I66A 3ZWYA 3F1KA 5JMPA 4ND4A 4BNJA 1P1HA 3F4LA 3AY6A 1R4NA 3OEWA 4YRDA 3EDMA 1DIAA 3CH6A 4PLPA 3ZNQA 4BMNA 4ALMA 3TOZA 4IDFA 5MDHA 1IY8A 1S7CA 4U0JA 1X7GA 1XR3A 3WJ7A 2GN9A 4OO3A 5ADHA 2OOSA 2VT2A 4E5PA 1Q7BA 4O59O 4ZA2A 1WDMA 3LT1A 1BVRA 1PGOA 3KBOA 1LSUA 1KVQA 2EGGA 4WEOA 3OA0A 3FNEA 1EUDA 1MC5A 4UUPA 4XGNA 1XLTA 1JLLA 1ID1A 1ZMOA 4XEHA 3VDRA 1VSUA 4NG5A 2JHGA 3L4BA 3KVOA 4L0QA 5AXCA 4X54A 4YQZA 3JQCA 3U49A 4YT5A 3Q1LA 4NU6A 3KLPX 3I5MA 1LSSA 4R1TA 5KVQA 4QUKA 2GF2A 2JD0A 4NJMA 2H9IA 4CMCA 3FPCA 3FPLA 4Z6KA 2B83A 3JYOA 2B0JA 4EGFA 3IUPA 4FFMA 2FHSA 2PD4A 2QW8A 3B1FA 4XQGA 1A9ZA 1GPJA 4NBUA 4XWYA 1UDAA 1CWUA 4UEJA 2PKRA 1H9BA 1NVMB 4J6FA 4B79A 1GZ4A 5TC4A 4BKUA 5H81A 4IMRA 3JQ9A 4ALNA 2AE2A 3UOGA 4BL5A 1DHTA 3ZV3A 3NEPX 3OIGA 1UH5A 3CSDA 4XQ9A 3NX4A 3VZRA 1E5QA 1E3EA 1GQYA 4ALKA 4ND2A 5EMHA 1P1RA 5TRTA 3KLMX 3WYBA 3EMKA 2J3KA 4JLWA 4NBTA 3ZHBA 1HDGO 1I32A 2UUOA 5JSFA 2YHIA 1ORRA 1NBOA 4PG7A 4PLYA 3CINA 1IZ9A 3I9OA 1LDYA 1P1JA 1KS9A 2BHLA 1EBFA 3DDNA 5JAMA 2CVZA 2PLAA 1PS9A
chains in the Genus database with same CATH superfamily
3G0BA 1M2GA 1U3VA 4RUKA 1TK9A 3OZVA 5CD1A 2EKLA 4K88A 1C9YA 2MSKA 3ZZMA 3QNWA 4C0KA 2YXPX 2ZT5A 4NYJQ 4MAFA 5I5GA 1VCOA 2Z56A 4G1MB 1E64A 1LWOA 1TT5B 1VDZA 2ORYA 3AVQA 4L8GA 4D5EA 3E2MA 3STHA 4AS3A 3QOWA 1KRHA 2D7JA 4JYZA 2F9MA 3GGCA 4TMZA 1Q6ZA 4LY6A 3MA0A 3FTQA 3FDXA 5E9JA 1FC0A 2HEIA 5EXEA 4QDUA 5GOZA 2BGIA 2OGSA 3EWNA 3E9EA 3KEMA 2PX4A 3FGOA 2PJZA 3C70A 4A03A 3JAMA 3M5DA 4IFBA 4ESHA 3VVBA 5LOVA 1R2QA 4HN4B 2ZUWA 3L1VA 3GJTA 1JAXA 3PVSA 4MIKA 3UK2A 1YVEI 4WPGA 1B15A 1FRNA 4C87A 1RJ9B 1U0BB 1E62A 3EASA 4EKEA 3P97A 3VHQA 1JVSA 1VC2A 2F9FA 3C43A 3UHAA 1RI4A 4DSOA 1GUZA 2QDKA 4LJSA 4PSCA 3Q0TA 3WL6A 8ATCA 1KYXA 2HSZA 2BT4A 3RT9A 3S3TA 2Q27A 2ZWOA 3WDKA 1O5IA 1WW2A 1ZC3A 3ENZA 5D86A 1QFYA 2WJHA 4CJXA 2E82A 1NP3A 2EJUA 1Z34A 1KMHB 2FTKE 4KHZA 3THYB 1IIBA 4ZANA 5FBRB 1SUBA 1EZ1A 1OXVA 1WPXA 1RM4A 1XZAA 4GU5A 3IAS6 4PZEA 2XUDA 4CKWB 1XWWA 4QDTA 4WFJA 1S3GA 2BFNA 2Q29A 2WRZA 4RE6A 4M0CA 5ELLA 1IN1A 3RYFB 4U2EA 3TAUA 5FR1A 3O8QB 4DDVA 4JBHA 3TB4A 4QULA 2ASVA 3V5NA 3E61A 1E2IA 3CONA 1GQOA 4PFJA 3HSSA 4Z4IA 3G9XA 1RI3A 2YH2A 4HRYA 3ZDAA 5CJJA 5ALXA 3FGPA 3RS5A 1OW3B 3HCAA 4XSHA 4GLLA 1ONOA 2XSZD 2HA6A 3VMMA 4AF6A 5JYEA 3AKEA 5CLIA 3D4NA 2M9MA 4AQYB 2NZJA 2X2FA 2PLFA 2VLIA 5CIWA 1E0KA 1BYIA 4P7GA 1A96A 1JX6A 1W2WB 4RZUA 3TQSA 4PBSA 2ACVA 4KDRA 3VTKA 1ZHOA 1W85B 4O0LA 1T2VA 3F9CA 3KKQA 1YQQA 4AJLA 4BWYA 2ALJA 3RWMB 1LQUA 1VE1A 4XWTA 3VZPA 4A0QA 2P9BA 4AXXA 1ID8A 2JL1A 4JGGA 1C3LA 1W35A 4ND8A 4A0SA 4NVRA 4PLFA 5DP1A 3DHWC 4C7OB 3V7WA 1OHHA 2LXNA 3F6PA 3GVCA 3C7DB 4JT4A 4LOIA 4JJKA 2BEVA 1P2UA 4OQYA 4OI0A 1OBFO 5A0FA 5IJWA 2HF2A 2OSVA 3IEXA 5BSUA 1WXWA 1JHVA 3A2MA 3KK0A 4Q7LA 3RGGA 4NZPA 1HYBA 3FH0A 5J23A 4AY5A 1T8RA 1JKFA 2BAGA 2NNWB 3D43A 3ON5A 2Q6TA 4E03A 3VU8A 4H7KA 1TZ2A 3IPAA 1L8AA 2F8LA 3PIDA 1ONNA 1A2KC 3S2YA 4BVFA 1YJ8A 5ALHA 2MSDB 5ESWA 1ZSNA 4R0MA 3E9NA 3EG9B 3JD3A 3H1FA 4K05A 1T2DA 1CRPA 4G63A 2GA9A 2ZJZA 3SYMA 3RSGA 1N33B 3F47A 4IFEA 4ZC8A 2NU7B 1I33A 3IQIX 3OMWA 3HDTA 3VSAA 3GOHA 2XHZA 1OGJA 1MX9A 2SBTA 4D4IA 2RIRA 2A88A 3Q2IA 3UPDA 5KCZA 4AIIA 3FCCA 3A9WA 3WY9A 1CUGA 1JDZA 4AUMA 1L4NA 1P29A 1T1EA 3K1AB 3ZLVA 1J0EA 1CRLA 1P4RA 2HF7A 2MINB 4U5QA 3EDYA 4NYIR 2VAXA 4R2MA 5FUQA 1FP1D 5ALZA 4K9KA 5JVDB 4WI1A 1ABBA 1N3BA 1NUSA 3FWPA 1S9HA 3C3MA 3HCDA 3PPYA 4LNUA 4QSMA 2ZIVB 3HDQA 4HB4A 5AQEA 3I45A 3MFQA 4HQ0A 3UA4A 4CKZA 3THOA 2FP4B 5DHUA 4AJJA 3K4HA 3JY6A 1MTOA 1KZ7B 1Z82A 3W5JA 2H2IA 3GGJA 1SAYA 1YRBA 3GARA 2A84A 1FW8A 3AB8A 3PPWA 1KMMA 3PZRA 4HDNA 4IH4A 2ZT6A 1YIAA 4PHGA 1U6KA 4E21A 5C1DA 2IX3A 3BILA 2JGRA 3NGXA 3LVQE 3CVOA 2IEZA 2YOHA 2PPVA 1ESZA 1Q7RA 4O4HA 1G6OA 4URVR 4ZCRA 1YFKA 4ARVA 2LCIA 4FZ3A 3GFTA 1UPCA 5AOCA 3KJQA 1HORA 1HSOA 3KPVA 4AURA 3K2QA 2C57A 2BKXA 2C31A 4IILA 3PQ2A 4ZVNA 3ND6A 2FGKA 3GFQA 4GXTA 3MB5A 3S81A 2EZTA 4X1KB 4NE9A 3F97A 3K9CA 3LO5A 3HKBB 1I0IA 5JVDA 3AJEA 4UBNA 3G2LA 3VC1A 4ARUA 4PIPA 4F2GA 3DAHA 1GPUA 3K8QA 2A6PA 6GPBA 2NTYC 3X1ZA 3TLJA 4WD3A 1NI4B 4R69A 3HVUA 3SC2A 4D42A 1U8UA 4TSFD 3LRXA 1OBOA 5EJ8A 3HZRA 2ZXUA 1VSQA 2PX0A 3TDKA 4Y7CA 1OUMA 1NQTA 1SCQA 2A5FA 3LIPA 2YS6A 3WV4A 3D8RA 4BBPA 2FE4A 1U1EA 4D4MA 1N77A 1NJ2A 2PTGA 1LI7A 4LMRA 4MVJI 1QHEA 4YDHB 3VDMA 2XVMA 5EQJB 1XU7A 3AUYA 1VSTA 3RE1A 2PKXA 3L1HA 2X1VA 3ZY5A 4DM3A 3KT3A 4DIBA 3W2HA 1TO1E 1JAHA 4EO7A 4KQMA 1H8HA 1Q77A 3C5HA 5KX5B 1L4EA 1JKIA 3VI4B 2N47A 2GTHA 2P1RA 5T57A 3STWA 2ZVJA 1M1XB 3KZ1E 3U0BA 1CVLA 2GK4A 4MS4B 4LFCB 2P2NA 4I3FA 3TIIA 5CAEA 2YMLA 3GFSA 3B7WA 4WE3A 3BZBA 5TE9A 2BJVA 3G49A 4V1CB 3A2NA 3EIOA 1E1DA 4H15A 1RYMA 2XY4A 1THMA 3KPUA 3VX4A 1RXCA 4O2LA 4EK9A 1GGKA 2OWEA 3BXOA 4X6XA 2ZK7A 5HA5A 2IEBA 3Q5DA 4F9TA 3CRW1 3SPXA 2DX7A 2DLDA 4ARBA 1XAJA 4IXTA 3KYCA 2PH5A 5IDWA 2KBEA 1XXHB 2RH4A 3DF7A 2WB2A 2P75A 3LP5A 2JAWA 1N6KA 5A4DA 1KOLA 4LYYA 1KTVA 1VPWA 2FX3A 5FWXA 1C9KA 3ZU5A 3E18A 4OA8A 4PO8A 5DBEX 3MJSA 2J3HA 4BJ1A 1U8CB 3K09A 4QRIA 1CZKA 1IPHA 4PNPA 4TUYA 2C03A 1UUFA 5K8VA 3HYSA 3BTOA 4B6QA 4BKQA 3H3JA 4LTNA 2WWFA 5HCUA 3W2TA 2P2GA 4JLSA 2FWBA 4C20A 1QP0A 2OMEA 2I54A 1JG7A 1PT9A 4ER3A 1SXGA 1HEUA 4G24A 5K09A 4S1OA 3UUGA 3P4YA 1QG0A 5D84A 1ZM4A 1IZ0A 2H3HA 3ND5A 3NWOA 4GE3A 1EA5A 1VKOA 3GRUA 3NYIA 5C1PA 3SLRA 2BUBA 2H1RA 1O9GA 1FTQA 4KPGA 1D2MA 4GLOA 4GUAA 2OBNA 1ZS9A 5F7OA 1M34E 1RKVA 1RPNA 1T36B 2VJYA 4AVYA 4JNKA 3E9ZA 4GEKA 1C2YA 2VPXA 4LVCA 4ME6A 4U39A 2XADA 3HJCA 1P8JA 1XDDA 4WJKB 4AJIA 4DSTA 1QCYA 3CLSC 2ODBA 3NM5A 2I8AA 2O1SA 3KUUA 2EDAA 4KAXA 3RVJA 3RRYA 3RRJA 1OX6A 4N47A 4YYEA 5DLPA 4K28A 4Q4AA 3D6MA 1AK2A 4KLZA 4XWWA 4AZ3B 1A2BA 3RFVA 1VL8A 4EY8A 5K8CA 4M8IA 1IQ0A 1MNAA 1M73E 2QTZA 3AUKA 3G5LA 3KKOA 4NNPA 1RQPA 1KQNA 2ECQA 4CT4B 1UBHS 2Y1LA 1ZI9A 3CE9A 1YC2A 5EJEA 5IC5A 5IK2A 3BMOA 4E1BA 2I4LA 3MMSA 3I6BA 3BF7A 3PPVA 2OLKA 3K72B 3DMGA 4KJZA 4DIFA 1DTWB 4E4YA 2OILA 4FFSA 4K81B 4UZEA 1JKJA 2CWWA 3PGXA 1NRIA 3ERCA 1W4RA 4W99A 4WUVA 3W2IA 2COKA 1P4AA 5CA1B 3CR7A 2BHSA 1G8YA 3PNQA 5JZMA 3WGGA 2XUPA 1RKXA 1T6NA 1V5EA 3KJZA 1FRZA 3PPXA 3WYNA 5C80A 5JRDS 1OWLA 3GLHE 2R44A 3NT2A 2DBQA 1W29A 2G0TA 3OZEA 1OI3A 3C98A 4MYSA 5I7SA 3S29A 1L7XA 2QE7A 2PUGA 1XZQA 3TTVA 1RHKA 1G5TA 4BO2A 3F49S 3QKIA 4OB7A 2ZRDA 4OGWA 5E38A 1CUIA 1M6YA 4DYVA 5A1JA 1FFXA 1KP3A 2Y4OA 4ARCA 4UTOA 2RGDA 3VSCA 3K0CC 4JYCA 4U02A 3FY4A 2HMTA 1JYEA 5LA6B 3RG8A 5A3QA 1QR6A 2AG8A 2DC1A 2P0EA 4RFSB 3K30A 1ISFA 3I9V1 4E6PA 3U4QB 5DKFA 4ARIA 1RJWA 1MC4A 4TWJA 3ZE2B 1DQZA 2BI4A 2H51A 1GL9B 1HT2E 1CUEA 2F3UA 2ZAOA 3P0JA 4UJ3A 1OQAA 4IY1A 4Y0AA 5F3RA 1IYZA 3T3DA 4DCTA 2HPHA 2NO6A 2VAVA 2CCJA 4IQ0A 1O8BA 1T3TA 4LHVA 2NXCA 1ZG3A 3DHYA 3HK2A 2FEOA 3U4MA 1Y8CA 3LUDA 4U00A 1DT5A 3U62A 4R68A 2G5GX 4XTRA 4P34A 1KOJA 2P9TA 3BTUA 3FVRA 3HJFA 3KOXA 4ETIA 2GEKA 2JLVA 2Z6UA 2W6OA 1DIBA 3GRRA 4I55B 5JDCA 5L7YA 3DL0A 4ERXA 4GR5A 4MA5A 3RRNA 5A7GA 1V1MB 1XTBA 4MEAA 2F59A 3WYDA 3ABIA 2XUJA 1ZISA 5EMNA 5L4NA 3MILA 1QZZA 1GFIA 1YE5A 1ZHFA 1SULA 2CYAA 3G23A 2VJDA 3QFHA 4K1XA 4NJEA 4RFLA 3E35A 3I5YA 2O7QA 2ZR0A 1VCNA 5JZSA 3F3YA 2CEKA 3GROA 3NT4A 1UIMA 4G56A 4L5AA 3IVRA 4ZDWA 4AMYA 5B55A 3K6SB 2P40A 4ZV9A 3V32A 2W6MA 3X1MA 1QQ7A 2E0IA 4H3SA 2HDOA 4TS1A 1HKUA 2DTDA 1C3EA 3NUGA 3LCMA 1DX9A 4G36A 1T10A 4R0NA 4CRWB 1DQSA 3OO1A 3P2YA 1CJKC 7AT1A 3ZXSA 3FPHA 2GHRA 2QL7A 3KEFA 3T1QA 4NCAA 2IP4A 1PT6A 4IIUA 5F2OA 2XCSB 3OOWA 1G21B 1P6XA 4EI7A 4HNUA 4IBOA 4RPCA 2A1TS 4MKFA 3TZKA 1ZGJA 5IAGA 4Q4HA 5K6AC 2QX8A 2YWRA 1XIVA 2C7VA 1JAYA 3D4PA 3BFPA 4G5RA 5G0TA 5B3LA 1N0IA 4FMDB 4LKOA 4A15A 2JGMA 2Z2IA 3ADPA 4GZ3A 3TUZC 1RAAA 5F21A 1HTWA 1UDXA 3OP4A 1W59A 3T5PA 5DNWA 1LF0A 1NXSA 3PE4A 4MRSA 4PGAA 3ME5A 2IF0A 1CUUA 4AN0A 4FGKA 2QX4A 3PKIA 5I4IA 1BTOA 1A5BB 2G3YA 2JEZA 3A2LA 1DQYA 4K3VA 3GN2A 4G1FA 1L9KA 2W2XA 1TMKA 3QU4A 3T61A 5ICEA 4G0VA 3C24A 5D51S 1K6XA 4RM3A 1YAJA 4U7FA 4LNHA 1CIJA 4YALA 1ZN9A 1PF7E 3FPSA 1CYEA 2C4KA 3GH3A 5JISA 1R5BA 3QYPA 3SJUA 3W1VA 4D8TA 5TF4A 4DLWA 4RV4A 4JYBA 4LCEA 1GTG1 1BC5A 4FPXA 4D6XA 1D1TA 1MB2A 1ODKA 3R4CA 1I1OA 2PGLA 4X9XA 1YC5A 5CCDA 4BAUA 1W52X 3QVGA 2IDKA 1VIVA 5HM8A 4WNIA 2UZ4A 3AG5A 4C0SA 4CUJA 3TMKA 1BD3A 4OLAA 5F3WB 3FPFA 4DCVA 5M29A 3AUUA 1FXWF 1OLXB 4WLOA 3WI7A 4YAIA 5L95A 1FFHA 1W1UA 2PFSA 3JAKB 1F17A 4QU9A 5DTEA 4PAQA 3W5DA 4Y6QA 1WCV1 1G18A 2FSVC 3OM0A 1MGOA 4R8MA 3VGJA 4XQEA 5E6RA 2CY0A 1QAMA 3TH5A 1VFPA 1VZ3A 3FLBA 1KPHA 4WNCA 5FI1B 5CA0F 4BRZA 1Z6ZA 3BBPA 8OHMA 2V45A 3D54D 4ZZ2A 3IAM1 1J1ZA 1EHYA 3HWWA 1XRMA 3T5MA 5A9SB 3L1KA 4GVLA 2DFKB 2DLNA 2G5PA 2Q6VA 2R5NA 5BMVB 3VC2A 1OMOA 1TZJA 3DDUA 2QENA 4XZ3A 1LW7A 4IWNA 1NLYA 3RASA 3I9KA 5A1TA 4AY2A 1Y8RB 4MKRA 4HLNA 1AK9A 4P3NA 3SHFA 3TOXA 5IF9A 2DPXA 2ETXA 1P2GA 4J4BA 3A0RB 1QLWA 5ESXA 3OFVA 4R1LA 4YGXB 3TTUA 4HP8A 3VKVA 5ELXA 2C2GA 1NM5C 3PNMA 1Z0UA 4QM7A 3OQHA 4DXHA 2MSWA 1WDKA 1LLUA 5DW3A 5CRIA 3BGVA 3C4QA 3WTCA 2AZMA 1Y81A 3TLCA 2OBYA 2CL7X 1QBGA 3OTGA 4FFNA 3PLRA 1Q3KA 1DCMA 2D2IA 4IUBS 5B6PA 1GUBA 5AW0A 1G38A 3GLIE 2XJ9A 4BO4A 1KE1A 3A1EA 2HNBA 2AXEA 2PJRA 3AJ8A 2OV2A 3IULA 4MAMA 4PWZA 5DMHA 4GR4A 3WLMA 3PUZA 2W71A 4J0HA 5JS2A 3EFBA 3H2SA 4MUJA 4P4SB 1WBDA 2PE5A 3C8DA 5DHAA 3TSOA 1E3TA 4YRAA 4F93B 2GBFA 3GJ5A 1Z2CA 2PRZA 5C7IO 1K7YA 5JNWA 2JGEA 2Q5JA 1DJNA 2GILA 4FMBB 4OFXA 2PV0A 4WSOA 4MJ3A 3X1XA 1BDBA 1GRVA 1MAUA 3AW9A 2HWYA 4GP9A 3EZNA 4OM8A 5D3QA 4A8HA 3GL9A 3SHTA 4RQTA 5B53A 1RPTA 4PG8A 1K6IA 3FM9A 2IFTA 4GLFA 1YIDA 5A02A 3N0TA 1UBKS 3QE4A 1HURA 3ZQUA 1HX7A 1ATIA 2NUPB 3H5NA 4RJJA 1RSZA 3IFSA 2P6UA 3IMFA 1TPZA 3PVZA 3A6DA 3TLXA 3LZCA 4EEXA 2VA8A 1L4KA 5K51A 4AN4A 4Q4CA 3KU4A 1UP6A 1M6NA 5E8RA 5FR2A 1PGQA 1X9GA 2P30A 4PC6A 1RIFA 1H0RA 1ZZGA 1EM8A 5FI5A 3SKXA 1AS0A 1CY0A 3EPHA 1N8SA 3SDSA 4NYMQ 3INTA 2ZAGA 1MGPA 1TJ5A 4UXHA 3RREA 3CZRA 3IBGA 1QHYA 1ZFNA 5TJHA 4JGBA 2HGSA 4AMVA 1X1RA 2OCKA 5C51B 5EE0A 2RHHA 1GNSA 1ISPA 2V3VA 4ZAXA 3N7TA 3PEWA 5AJWA 5IVHA 2Y4NA 1QFXA 1A1VA 4GICA 3HB5X 4ECAA 1MFPA 2RARA 2YV1A 3GFOA 3HC7A 1QO7A 1RCUA 3C16C 5DI9A 2CVHA 1M8PA 1DI0A 1FB5A 1GDDA 4B2YA 5TF0A 2MMGA 2AOXA 1KWGA 1WKVA 2FOXA 4CWAA 4RO0A 1O96A 1YZTA 3IQWA 2PO5A 4RLSA 1D6JA 1HSZA 1PFWA 1UC8A 4TTVA 2JDID 3UJBA 1J1UA 5AKGA 4DIMA 1WWKA 2BF7A 4I1OA 2SHKA 3USCS 1XL0A 3F3MA 3U3XA 5JNVA 3DUFB 5JWHA 4H60A 1TCAA 3UEOA 1MA3A 4DJDC 2Q5QA 2DFTA 5IAOA 2JCBA 1UIRA 2HAEA 3G0OA 2Z3ZA 3V4ZA 3WAJA 4UTPA 3EIWA 3H5TA 2R65A 3QRWA 4HB0A 3K6JA 1JLSA 1TPYA 3AY7A 2RGXA 2LUOA 3GA5A 4KXFB 4RLQA 4FBMA 4RH0A 5K3EA 4YHHB 1GTMA 2J4FA 4RYLA 2ODPA 4RMGA 2NZXA 1BDMA 4JLMA 1TEVA 1Y5LA 3C3WA 1KEVA 3BD6A 3OPYA 4J4TA 2AHRA 3BDAA 2I3DA 1DRKA 1VLMA 2IOQA 1ZD8A 3A3KA 4PRZA 4X91A 1AT1A 2R11A 4BN5A 4MHTA 3KXPA 2Q2WA 1PR9A 2PZBA 3WR5A 3IALA 1WF6A 2RB5A 3DB2A 4NCJA 1SH7A 2WQ6A 1EB8A 3PHCA 2Q3HA 2AQKA 4Q9IA 2HY7A 1RD4A 2EFJA 4YC7A 1YQTA 2P65A 3QUCA 5C8YA 2ZE6A 2Y1EA 4ERNA 4JK3A 5LMZA 1ACLA 4E0BA 2XZOA 1R4MA 1H5UA 3JZFA 3PC2A 3SDBA 1MW8X 1NVTA 1PL7A 1X9HA 2J46A 1O6ZA 2MSNA 4E5VA 3RTGA 4CR8A 3E0QA 4OG2A 1NFQA 2J1LA 3ASUA 3LPMA 5FIUA 2NWQA 3G6KA 5HNKA 4X66B 3B1XA 5GV7A 2DR2A 4RHTA 2DPHA 3DYBA 3P4UA 4Z7QB 4WAUA 5DHQA 3ONVA 5J4VA 1XA4A 1SRRA 2GKOA 4L75A 1IM8A 1AS3A 2E6KA 3PNSA 3T41A 4D8UA 3EAGA 3CH4B 4JR1A 1Y8RA 1TLLA 2QR5A 1QR2A 3ETEA 4MI9A 4U7WA 3FHTA 1XCOA 3FRJA 4MQBA 2ZVDA 4QTZA 4RK6A 4RTJA 2P2LA 4LOHA 3OZXA 1N4DA 1XDUA 3MM4A 2QX6A 2VP9A 2DEUA 1C0IA 4DCNA 4RCYA 1EIZA 4YT8A 2C0CA 4FFBA 4S1PA 5AKKA 2YHSA 4YP6A 4AZVA 4EJ6A 5BN1A 4YI3A 2DHRA 1C7QA 2JFZA 4JSTA 4YIKA 5LYYA 1ZYUA 4ZDIA 3ENKA 4EUSA 1XMQB 3AYZB 1EFHA 4MH0R 4RDXA 5B4UA 1O95A 2AZDA 3LCRA 3RK1A 3N2ZB 3QFSA 3UK7A 4OGKA 1FP4A 1EDOA 3ITEA 3PCXA 1KS2A 2ZFUA 5DV9A 1IWOA 3C97A 3EFOB 4GWLA 2DBZA 4N3GA 5FV4A 1NVFA 4Z4EA 2V96A 3U7EB 3RBXA 3O6VA 4ZEMA 4J2OA 5BV2P 4OSPA 3UHPA 1J99A 2QPLA 4LGMA 1WD5A 1DKPA 3N6VA 1LW6E 2IDMA 5LYJA 1RE1A 1HNZB 3FUVA 4G5HA 3IT0A 4JI4B 1NBWB 4HY3A 1G0OA 3R24A 3LCVB 4F1WA 1ONPA 3PC6A 1G8FA 3OF5A 3DOEA 1VI5A 5DEOA 5BSVA 4FYKA 2E9SA 5E6RB 3CG4A 3TNJA 4IDHA 1KY3A 2X6TA 3IX7A 4PXAA 4KXUA 1DC5A 1KXJA 5E9AA 1E4EA 1PK8A 1UOEA 1XLVA 2J67A 5FULA 4QJ3A 3SOZA 2V7QA 2CXSA 1PN3A 1Z22A 2NO4A 4Q02A 4W4TA 3LYLA 4ALIA 1ECGA 3ROPA 1H8HD 3WWCA 4OQMA 1WY5A 2BBSA 3T3PB 3KKPA 3TZCA 2Q3EA 3CH5A 3I1YA 3U4GA 5DT9A 4KNYA 1QVVA 2A94A 4GC9A 4G9BA 4ZDJA 4H1VA 3PDIA 5J4LA 1YRAA 1MIOA 4J2TA 2WV7A 2NYUA 1SXJA 4RMHA 1KMQA 2RJOA 2WYOA 5FPYA 5HG0A 1LK5A 1B6TA 3C1OA 3T15A 2JEOA 1RACA 1Y9AA 4CLEA 3CO0S 3EXIB 1E60A 1EJBA 3B5JA 3K9NA 4CEHB 5C8YF 4IGAA 4O25A 1YAHA 1VJ5A 2QLMA 2XTAA 5CEFA 2AFIB 2IU3A 4EFDA 3HSYA 1GPWB 2ZP1A 3QVTA 2NXEA 2XF8A 3ZCPA 3OPQA 3D2CA 3R3VA 1A72A 1HYEA 2AR7A 1ZVKA 2VF2A 3W5HA 1GNTA 1IMJA 1FQOA 1SKYE 1SR8A 1Y9DA 1ZY2A 4P6VF 4QDJA 4CG1A 3J7TA 4D4HA 2W11A 3HHEA 1AV7A 3HJBA 5CLQA 2OECA 5IZCA 1JF8A 5J4YA 2R6FA 3C5CA 2VNKA 2YINC 4UMDA 4BQPA 1Q1ZA 3JCZA 3AV0B 3C6ZA 4HNRA 4EMTA 1CW2B 4A0FA 1XPRA 2FFRA 1A7KA 2P3QA 4HN2A 4R9UC 4AJ9A 3FNQA 2JJ1A 3D9QX 2PN1A 5I4KA 1F5NA 1SNYA 2HSGA 5LZ4A 1NUUA 4LWQA 1F6WA 3B51X 4C4ZA 2IU6A 1Z37A 4C07A 2OO7A 3LYHA 2ZXEA 2C2OA 2ZIZA 3SYNA 3TRJA 4HLUA 1KJ9A 3WWDA 1E0JA 4KBGA 1RLMA 1KI2A 2K7ZA 4H4EA 3T5CA 3UENA 3D3QA 1EFAA 1HZZA 1Q19A 3MTBA 3LUCA 4W9MC 4LJ8A 5CBPA 2QW0X 1S5PA 2QF7A 3LD9A 4JITA 3AQ4A 4K0RA 1P2BA 3ROQA 1LVGA 2DSNA 2YJZA 3WB9A 4ZOAA 1R0RE 3FG9A 4EABA 2C97A 5TPZA 2UXDB 4DW8A 3RS2A 5KSWB 3FA2A 3COWA 5HSGA 1HPLA 3TOCA 1QP7A 4R1MA 2DXIA 1PV1A 4RORA 3SF8B 1P60A 3A14A 3NAMA 3PEFA 3UYKA 4HT3B 1XI2A 3ODPA 5T4BA 1X7WA 4CTOA 3WBJA 1UMDA 4IOLA 3TX2A 2J3EA 2H18A 4D97A 2BLLA 1PO7A 3E03A 4XIYA 1JLHA 3VOAA 4KV7A 3HN7A 2CJYA 3IO5A 4CMEC 3CY6A 3U1TA 1QWOA 3WRWA 3T7IA 2ZIWB 1CUAA 1WXHA 5DM0A 3PPIA 3KWMA 5BWBA 3RS0A 1G19A 4QFBA 2ORVA 4ZXPA 3BMQB 3FDJA 4HDMB 3EEFA 4Z3OA 3V1TC 3OLCX 4JA2A 2WZBA 3N28A 3M49A 4II3A 4OLFA 3JQGB 4ZI7A 4N0QA 2VIIA 3JYLA 5HF8A 1RXWA 5A3JA 2ZM6B 3QLVA 2ORIA 3W77A 5C2JB 5TEVA 4IDCA 521PA 4JODA 4ATNA 4JLDA 3DV2A 3IHLA 3UJDA 2OQVA 4XUGB 1UPXA 3L93A 5HBGA 1BVUA 2WHQA 4M0DA 1QPGA 3VR3D 4B82A 4F9EA 3IKTA 2UXCB 1ODTC 1P0CA 1OIWA 1VHJA 4UNRA 2WZQA 4HCJA 3DULA 3KVYA 1ZINA 1SU8A 2BZ1A 3BIFA 5CYPA 4C08A 2HLDD 3EPLA 5LLSA 4DF3A 3LFUA 2DP4E 4X7RA 4BMZA 3PHGA 4AO7A 5AW1A 2CXTA 2ZJ0A 3MCTA 3L49A 2VOEA 2FPOA 3D0QA 3D4BA 3L7BA 4XX1A 5FQNA 4B3BA 4UQLA 4JUBA 2X0FA 5IW8A 1PT7A 3MYRA 3HRHA 1GARA 4K9MA 5FA5A 1KO5A 1Q0RA 1UANA 4RF5A 5JIBA 3KEQA 3GMSA 5WRFA 4PZYA 4AO6A 2OGWA 2I2AA 4UD2A 2AXQA 2G09A 1QF7A 1AGPA 5AI8A 2QR3A 4V3CA 1LI4A 3A1SA 4HB2A 1NNEA 3UT6A 3TJMA 1AO3A 4EKGA 2ZWVA 4F4FA 3QKSA 5TGZA 5JLJA 3UO8B 5I7FA 2WLTA 4B4KA 1FLNA 2GBGA 4I99A 5DLQC 4UU8A 4E11A 3KXIA 2E6UX 3P9KA 1YBVA 1PTKA 4TVSA 5DGHA 3LUHA 1CJSA 2IVZA 3AF2A 3DG9A 4D92A 4N41A 1O89A 2VP2A 4O2BA 3DZKA 5AK5A 1BXKA 1Q57A 2YYSA 2HJGA 4JL6A 1I2CA 5HGJA 2VBFA 4FQ8A 4F11A 2A9KA 3DOIA 1RLIA 1CQWA 3UQZA 1P6UA 4CCYA 5AVJA 4I1UA 2II6A 3SX0A 4GZMA 2GCIA 4POAA 5KUTA 3AUAA 5EUCA 5H7XA 3F6BX 4TLDA 4DT1A 3MJEA 3KUKA 4TS9A 3EBPA 4GZ6A 3TR0A 1O94A 1DC7A 3WKAA 1EUZA 2Y2UA 1ULZA 3KQLA 4LTDA 1MHTA 1Z0DA 2F4NA 2RIPA 1X8LA 1C0EA 3L82B 2OBBA 4KNWA 5H83A 4A0GA 1UAAA 2NZYA 2OD7A 3L7KA 3ZCTA 5CIYA 2VQEB 2CV0A 4DLXA 4X3OA 5KZMB 1E8NA 3CLKA 1QV9A 2OAQ1 3BMOB 4P08A 4RY2A 1I7DA 4K8OA 4RPKA 1PGJA 4B2LA 4QBHA 3RAGA 1N5JA 4YAGA 2ZTMA 2FP4A 5CW2A 4EYEA 4TMYA 2DLCX 5LLTA 4QOIA 4JOQA 1CS0B 2AS0A 3UJCA 1RZUA 3ED1A 3FB1A 3H9GA 4QPDA 4TWBA 5HF5A 1K3TA 1IZYA 2J85A 4UDNA 3TUIC 3ZQJA 2VQDA 5GJVC 3PDHA 4PC2A 2DQSA 5EN4A 5IZCC 2JCGA 3DCYA 2ZB2A 4Y2PA 4QOHA 4OCZA 3UWKA 4A73A 2EQBA 3LWNA 2PWPA 4YMLA 3QA3E 2NPOA 3G7SA 3WYFA 3SGLA 4X7BA 3U3OA 3AR2A 1J7JA 2YN4A 3A27A 1KFEB 2P5UA 3OZWA 1PR0A 2J0SA 3DXXA 1TK2A 4QA9A 1L5NA 1OCEA 1DG3A 2BKAA 4I46A 5KTKA 2WOOA 2JF0A 5DE3A 1TKCA 1E4VA 2E37A 3VHXB 3WGOA 2C59A 1IUPA 5SZHB 2BHNA 2QG4A 4KACA 3VVLA 4EHNA 4ESEA 4EKYA 2QN7A 4GMDA 4UUAA 4J75A 4B7XA 1NP6A 1X39A 2V97A 1SVMA 5JH7B 2QUJA 1I4OA 2AE1A 3GO4A 4W8GA 3P9RA 5EJ7A 3JZIA 1JDJA 1XRRA 3BK1A 1EM6A 1ZXLA 1WCYA 3DL4A 4ZHSA 2EEPA 4ZEOA 4EB6B 1FFCA 4BQFA 3OWHA 1ZQ9A 3PTLA 3R6GA 4R16A 5AIAA 1Z6GA 1KI8A 1PFGA 5TSDA 5KOIA 1N32B 3IOBA 3AX6A 3LTEA 4KSYA 4GPAA 1NY5A 3COVA 3ZDZB 2CDCA 3K0BA 3BKWA 2OESA 4J0KA 1CVRA 4LHYA 1H9CA 3EFHA 4KEAA 2Z6QA 1U63A 5HYVA 3OBIA 2PIDA 5IK2D 1IJEA 4KH1A 1KYQA 3KHKA 5J5VA 3KJNA 3ZDDA 1SXIA 3EDQA 1JHUA 4EW6A 3TGLA 2W6IA 4UHBA 1Y4UA 2ENUA 2Z3WA 4RHXA 3UY4A 2W6PA 2P7IA 3RR2A 3QUBA 2AN3A 4Q3BA 4WMLA 1KC1A 3LJKA 4BNMA 4M9ZA 1N6IA 2RHOA 1GAXA 3GEBA 1KFCB 3CX4A 2Z5LA 4FYYA 5M2QA 1BKDR 5HUJA 3T7SA 3CMMA 1MX5A 4LZNA 1JWAB 4Z0TA 1OI2A 3I64A 1V3VA 3VPFA 4Z4HA 3UBTA 1IONA 1A9QA 5C7OO 1ZX1A 4GZ5A 4D0GA 1GZ5A 1QHGA 2XMSA 2GM3A 1E9BA 3B13B 4G85A 4KCGA 3T35A 4BU1A 4PC1A 3RQIA 4Z9AA 1AGXA 1N7GA 1UDCA 3FCSB 3NTUA 4YUYA 1GWNA 4JL8A 5FH9A 4FGUA 1PFYA 1YZNA 3NPMA 2IH2A 2PKEA 3LL4A 4K0KB 3GBPA 4WA8A 2NVOA 5ALUA 3ZK9A 1SXJD 4P5EA 2DUJA 4RENA 1VYHA 1NA5A 4BO8A 3LBIA 2O59A 1ZXXA 2VCYA 4B3FX 4OJKA 2OQIA 4GL2A 2A9FA 1U0EA 4JJGA 2J9YB 4REQB 4Z1MD 2R5WA 5GONB 3I2JA 1ISSA 4DRYA 5JNRA 2F62A 1BGWA 2C88A 2ZG6A 3JQGA 4MW4A 4ZI7B 4OQFA 3UZUA 2XKKA 1AD2A 3EVEA 4P0TA 4MS1A 3RJ5A 3KLNA 3KJHA 3HADA 2BSAA 3U44A 3I6QA 3N5CA 1ND6A 1Z2NX 2XE7A 5K5EA 1R6DA 1EBUA 4KBFA 1XEXA 5U1PA 1V7CA 1L7DA 4H9GA 3JARA 3K2IA 1YULA 3OF2A 4TKZA 4OJQA 1KAQA 1NBHA 4KZPA 3SHOA 3FMOB 3UT0A 2WM8A 2P2DA 3PHIA 3UG6A 2FZ5A 2RAUA 2WV9A 3RSFA 1JG3A 3NXKA 3OCJA 4B80A 2WJ3A 4E2YA 5EIOA 4EI9A 4EHHA 2Q8NA 4UUNA 5J2UA 4A16A 4P4NA 1EE9A 4OI4A 5GZ1A 1IHYA 1OAOC 3R0QA 2FQXA 1E5DA 2CHFA 1DARA 1AK1A 2YXBA 4BZXA 3OZBA 3KNZA 5IJ9B 4FFDA 4YJ3F 4XOIA 2WHYA 2QD5A 5I7RA 1BKYA 1KAEA 2AXPA 1RQRA 3O0TA 4HDSB 4OJYA 2Q21A 4ALJA 4AQ7A 1Z75A 4DQXA 1AHNA 3P9PA 2AOTA 2R68A 1MJGM 1M1NA 3PENA 2OQ2A 1CUZA 2WVHA 4P7JA 2F00A 3MT8A 4KFSA 4DDWA 3K71B 3H2GA 3FAZA 2PR7A 4CMJA 2FAXA 3SI7A 4L8YA 3GLIA 5LZ2A 1KRXA 4CLRB 5KNBD 2Z6VA 3ZZTA 1TIPA 1T24A 4X00A 5CDGA 2H00A 2PNJA 5LNK6 1AH2A 2PFKA 2YYZA 1RI2A 5HK9A 2C9YA 3VR4D 4PC7A 4F56A 3NKVA 2RONA 3GVIA 3T7DA 4Q7MB 4PE5B 5KQRA 1QH1B 2Y0CA 1OYVA 3QX3A 1HTBA 1YQXA 4BWFB 1H0HA 1DVRA 2Y93A 2DKFA 2ROQA 3EIUA 2H29A 3FCEA 2XT0A 3HJAA 3G85A 3HA5A 3NHJA 1PYGA 1EPUA 3OG9A 3SJZA 4YFVA 3TJRA 1R37A 4KXNA 4FM9A 1J8QA 2ZJ6A 2JFGA 2VJQA 3ABRB 5JWOA 1FFWA 4HGYA 4MRAA 1KR5A 2PSDA 3O7WA 4RGYA 5KWEA 1U2SA 4IJWA 2WYWA 2ZR7A 3NLLA 5KKAA 4L76A 1C9DB 1OLUB 2GJ8A 2WD7B 1QRUA 3TSYA 5HZMA 3DXFA 2FPGA 4K7JA 3QPWA 4M22A 2XA1A 1Z68A 2BEWB 3FVWA 4J2HA 3ZH2A 4B4VA 2BISA 2I6QA 4BNZA 2QSYA 1PR3A 3ELWA 1EKXA 1B14A 2CDRA 1ADBA 4TLEA 3V8PA 1QC5B 3HO1A 2O5EA 5AKEA 2C1EA 4HLUC 1JDPA 1RCFA 4UBMA 4BQRA 1BCSB 3EZ7A 4NARA 3P8ZA 4JVMA 5HDBB 3CIFA 1P8AA 3T3EA 4C2BA 5EKUA 3EN0A 1QYIA 5IDQA 5CK4A 5FWYA 2BGGA 4GI5A 3ETDA 1WV1A 3CUSA 4REMA 3Q7QA 1AB5A 1IM2A 3T34A 3VZCA 1WQ4A 1MDFA 1OBCA 3O3OB 1IB6A 1WM1A 2CJFA 3A6HA 5JPIA 1XVLA 2ZRHA 1IN8A 3IV9A 4LHEA 4E51A 5A4IS 3KQVA 4WCFB 1OZHA 1RBYA 2KE5A 5LQUA 2R0QC 2ZJAA 1G5RA 5T8KA 2QTBA 1GPNA 4B71A 4F2DA 5DHTA 3HFSA 2FI1A 1W36D 4Y6GB 1NJ5A 4FGWA 1ZNZA 1YDHA 3C5WP 3HCPA 3IP8A 4J16C 4DFDA 2HPVA 4F2WA 2PR2A 1ZUNB 1NW4A 1QYXA 3GJYA 1TFRA 3PCRB 2DYKA 1U7ZA 3PJDA 4G25A 4BFXA 2LDXA 3A9CA 4Y67A 4XARA 4QKQA 2F1HA 3A70A 3WLOA 2XECA 3ZWOA 1TB4A 3GA0A 5JC8A 1OKKD 3TCKA 3PD0A 3U40A 1FZTA 1LC3A 1Q0QA 3W8EA 1ZCJA 4B74A 3ILXA 1U0GA 3LHIA 3VR0A 2ZU0C 5F1YA 2O0LA 1TX4B 1WSDA 4Z2YA 2GN8A 3QH4A 2C7QA 3BB4A 3E5RA 5A5VA 2ONKA 3UXYA 2JLAA 2O3UA 2R1VA 3KVRA 4I4TB 5E1BA 4HYTA 4KQFA 2Z9DA 3KR9A 1WUTA 4M1QA 1F8FA 3QOFA 4IIYA 3CBQA 4TMWA 4DLBA 3GLFB 2XOKA 1XN4A 3CM0A 3OPYI 3T5BA 4EX7A 3C5EA 5CLGA 1K4YA 2IEAA 2WJVA 1U2ZA 3HJGA 2R7KA 3LDGA 1J8DA 1RNLA 2ZLBA 3HL0A 1ZSYA 3MSCA 4MQFB 5EERA 2ONCA 4JQZA 1HQDA 1OD6A 2WY2D 1JBQA 5J2TA 4QPZA 2WVGA 4REQA 1ZN7A 1G64A 1YGYA 3Q7EA 1MFZA 1DMRA 1MT0A 2H2AA 3JR7A 1QHIA 1PQPA 4FYHA 5EESA 4DIDA 1OILA 1P77A 3GCWA 3FPGA 1MQ8B 2ZSKA 3I2KA 3LPNA 2Y1GA 4OK5A 4C22A 2JBWA 3N2GB 5F1PA 2LCFA 3F96A 4NCHA 4D4KA 4CT5A 1AVTA 1G6HA 2YJGA 3AIKA 3LY8A 3LCJA 2V5AA 3NO4A 4L8WB 1X7ZA 3SQWA 4E2FA 2ZIXB 3M1AA 4FZVA 4TX1A 3EEIA 1A98A 3FSRA 3ZV4A 4GBGA 1E9SA 2XMRA 3AHGA 3FKQA 3OU2A 3WJ2A 3WGQA 1M0WA 1RCTE 1DRWA 3AHDA 1P7PA 1SJ9A 5DPMA 5EZYB 3O1JC 5AVKA 1JH9A 4KQHA 1IG3A 3W2FA 1T5IA 4DJFC 2FF5A 4AMUA 5J2TB 2NVBA 2O8DB 1UBUS 2QRHA 3RDPA 1EK2A 2QZ9A 1LFAA 4IDOA 1S8OA 2Q3MA 1U2QA 3P94A 1TJPB 2B9VA 2IUTA 4RPLA 3RLIA 4RAQA 2BUAA 4IZIA 4OHKA 3A4NA 4HH4A 2WICA 2ZOSA 3IT1A 4EHJA 2CYBA 4KE8A 3VYSB 2SKCA 1ZW1A