1ZL8A

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
b'GSLNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN-7
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8A00
1VF6C 1Y76B 1Y74A 1VF6A 3B40A 1ZL8B 1ZL8A 1RSOB 1Y74B 1Y76A
chains in the Genus database with same CATH superfamily
1KP2A 3ZIAG 4NXNB 2P06A 2YI9A 3Q4HA 4I0XA 3CCVV 4DV0B 4LF4B 1BQ0A 2CTWA 3E22B 1Q6UA 4J9ZB 3RGBA 4RQEA 3ZRWA 2Q5ZA 2IH3C 3ZHVA 4ZHQA 4O4HA 3TXSA 3O9OA 2YXYA 1N0NA 2V7QG 1NTKH 1R1BA 4TSFG 5B5EZ 3CB2A 4JTDB 4MSWC 4JTCB 5LMNO 4L8JA 3OR7C 2X6BA 1OZ0A 2LFRA 3ASNB 4MS2A 4JI2O 2B5UA 1KQSU 3RBZA 4UCTA 5CMUA 2B1IA 3K03A 1VF5B 4X1IB 5IE9A 1VQMV 5GONB 2WA4A 4JI4B 3ZS8C 3AG3C 4D7TA 5LHIA 5LA6A 1HNZB 5GTHZ 1FFXB 3FB5C 4GKKO 4CZZA 2AHYA 4DXWA 4F4LA 5BY1A 1R3IC 5IYZA 2XAQA 2EINB 1DF4A 4JZ2A 1RFYA 2RJZA 3SYQA 1RP3B 1WP8A 1L8DA 1ROPA 3KG2A 4A5UB 4CH6A 1XMOB 3EXAA 2UXBO 4XDLA 4LFAB 4DR7O 4LWSA 1M9NA 3HKDA 1VQ8V 4DV3B 1YJWV 1SQVH 1DK1A 5IT9N 4YHHB 1U96A 3ZHSA 4AHCA 1O9HA 3DXRA 3SJBC 1VQPV 1VQ5V 4ZI7B 3CJHB 3HKEB 5L3EA 3K79A 1WB7A 4IIJB 3ETGA 5BXZA 2E3CA 4FFBB 5BR8B 4B7EA 1F4MA 3J7AU 3OEEG 4DV6B 2WPDG 1IDSA 2FKXA 4MVMA 1SQFA 3AG1B 4P9OA 4PA6A 2KQXA 3AG7A 2EJ7A 4TT3G 4DV7B 2P4KA 4KHPB 4ZBMA 4IGGA 1XHZA 3C3SA 4G2KA 2ZXWC 4FLYA 4PD4F 4X64O 1GN3A 2PF4E 4DO2A 3JYCA 2BTQA 4GX1A 1PD3A 3CXCU 3K3WA 5EC1C 1FJGB 3CRRA 3VOUA 5IY5B 4TV9B 2M6YA 2VWJA 3GVMA 3CSXA 1K73W 1JPXA 2M7WA 2HEPA 3AG3B 4O2AB 1YZBA 3J80N 1WAZA 5LHGA 1QBZA 1MZEA 4FZ0A 3OTOO 5JCOA 3CRMA 1NJIW 1BQZA 1JJ2U 2KB1A 3GWKC 4DV2O 2Y48A 3OFNG 3CX5F 3H1KH 4U3JA 2ZR3A 2IM9A 3H1HH 3IJ4A 4QGPA 3OUFA 2YXLA 3UQ8A 1QCEA 4WFGA 3RYIA 1WPBA 4DV5O 3JARB 3ABTA 5J9PC 3IGAC 2LP7A 2HJDA 2ZKOA 2OTLV 4FLWA 1TUBB 1MSDA 1EFRG 1IZ3A 1AI4A 4PDRA 1P84F 1G8MA 4X20B 3CMAV 4MVRA 1E1RG 3B2EE 1M4UA 4WBNB 5KX5A 5IJ0A 3E86A 1SKVA 2UU9O 4K8XA 4JI3B 2A06H 2WLHA 5B3SC 2GTAA 4I0XB 4UVCA 1BHBA 1FAFA 3APQA 3CPWU 1H2KA 2ZXWB 2WSSG 4DV4O 4H33A 2VQFO 3JD1A 2LQTA 4W4LA 5CN0A 2QWPB 3P3NA 1IXBA 1Q82W 1VQ9V 3HKBB 3H1JH 2Y4UA 2JS5A 1Q43A 1AB3A 5KUKA 2ZT9B 1JFFA 2ADPA 4NXMO 2V4DA 5EC2C 4HZ3A 4MVZA 2PYLA 3CE2A 5LMNB 4Z1MG 3AEIA 4IL6Z 3H1IH 2P90A 4PJ0Z 1YIJV 4JI2B 5LP6A 1Y76A 4X66O 2UUAO 1I7FA 1GN6A 3ZMVA 1PNMA 1HP8A 2EZOA 4YIPA 4JI0O 1IXMA 1ZUQA 1HW7A 1YJ9V 3MAQA 3AG4C 5JVDA 3JASA 4B3RO 1KKCA 3D36A 1HR0O 4GKKB 1P7GA 2HP8A 3C3TA 1VQNV 4LWSB 4LF4O 3HKDB 4YY3O 1XNQO 1NTMH 4JI8O 5FPRA 2JGDA 1K5SA 1ENVA 1HWYA 2UXBB 4PA4A 2VWKA 2DOSA 5B1NA 1WN7A 4DR7B 2ITCC 3CCSV 1SQPH 3EHBB 2ZNJA 4CH4A 1EBOA 1YITV 2HR3A 4JV5O 1K3EA 3EVKA 2AW9A 5B3SB 3E8BA 3ZJZA 4PA9A 2A79B 3MD0A 1X4TA 4R50A 2BSKB 2ZDIA 1K34A 2IJHA 2HLDG 3E35A 4YIOA 2A7WA 2IH1C 5CA1B 2XT9A 4PDVA 1YTFD 4AILC 3FFQA 1PNKA 3FYIB 1D2DA 5ITZA 5EIBC 3RYFA 4GLXA 4K35A 3NR7A 4DRXB 4X1IA 5GONA 1SQXH 1AJNA 3D3IA 5HFMA 1I94O 3B8NA 3T1YO 5CBHA 3JD3A 1SQGA 4O4LB 1XMOO 2BE3A 3WG7B 4ZIBA 4TOIA 1OCCC 4DV3O 2DYRC 3JSNA 1F4NA 3WB1A 4PHZA 4RAIA 3CCQV 1YEWA 4LF5O 3LDDA 4JYBA 4QNHB 4JF3A 2QDOA 1OCRC 1AR5A 5LP6C 2UUBO 2ZIOA 3ZMZA 3ZRVA 2JGUA 3ETQA 4UCUA 4B3SO 2QGNA 1QLEC 3ASOC 2YDEA 2N05A 1Q3EA 2NR5A 3OTOB 4MT8A 4K0KO 3W7WA 4DV6O 3A2FA 3RYIB 4ZI7A 3CJHA 1KKDA 3HKEA 1L0NH 4DV2B 2FMLA 5LGNA 1JOYA 1O9GA 4RUFA 4UB8Z 3D36C 2QWRB 3K58A 4FFBA 5FLXN 4FK5C 5GTIZ 1BZKA 1N0JA 3R65A 4Z1VA 3THOA 1XREA 4XDJA 1YVWA 3U10A 2XOKG 1I08A 4DV5B 4DK0A 3IFXA 3RT3C 1COWG 3FB8C 3QNEA 3K0GA 2MW2B 1QLNA 3VQWA 5A2QN 2NNUA 2Q68A 4LR3A 3APOA 1QR8A 2Q7EA 1M56C 1BS3A 2A3QA 1S3JA 1NI8A 4RQFA 2YEVB 4BIUA 1QR9A 5CBGA 3LNNA 4GZRB 2A0LA 2ZIMA 1SQQH 4TV9A 4ZOLB 4LH6A 2EZPA 2CGOA 3CP1A 3W7XA 1US6A 1EN5A 1W59A 3ASNC 1KYOF 3FX7A 2BOCC 1GM9A 1Z5VA 4O2AA 3PN1A 5EBLC 4ASUG 4DV4B 2VQFB 1SERA 2N04A 2KSDA 1K7DA 3OEHG 1OCCB 1JFFB 1AP6A 1MNGA 2DYRB 4K8ZA 4DR4O 1B6QA 3LDCA 2V1DA 4X62O 4NTYA 4JI7B 4X88A 1PKXA 1OCRB 4YXWG 3A0RA 2PY5A 2UXXA 4LFCO 1L1FA 5LP6B 5CA0B 4I4TB 5L3BA 4NXMB 3L73H 2EILC 3JARA 1GM7A 1XNRO 1PNLA 1QLEB 3ASOB 1YXBA 3JAWA 1K8AW 4OXSA 1M90W 1N33B 3OGCC 1TUBA 1B3QA 2GBOA 4X66B 3P30A 4N23A 5JVDB 1TAEA 5FNVB 5B1BB 2UUAB 3ML0A 4LH7A 3AK1A 3BRCA 4H0LB 4U3FH 4EFBA 4JI0B 4X20A 3C90A 3K0DA 2PTMA 3JCUZ 4WBNA 1R3LC 1JCHA 5LL6Y 2QWQB 4B3RB 2Q7HA 1Y67A 5KLVH 1Q5OA 1HR0B 1A32A 2B1GA 3AK2A 1H8EG 4TUYA 1Y6XA 2X6CA 4YY3B 1XNQB 3RVZA 2AHZA 3AG2B 4JI8B 1M56B 1AVMA 1TVKB 3AG1C 1I5XA 3FAVA 5JJEB 5F2VO 4JYAO 3L70H 4DR5O 1PPJH 4KUMA 2O57A 1KD1W 3CYOA 3SJAC 1B04A 3HKBA 2HKOA 2QJ1A 2ZE6A 4JV5B 2IW5A 3E8HA 1CXZB 4LF6B 4HBNA 3JD0A 2CDYA 3ZRXA 2LGQA 4X8AA 2N74A 1F51A 5H2FZ 1GK9A 5ITZB 1R6TA 3RYFB 5IY5C 1BMFG 3A0BZ 4RO2A 1EM1A 5KA6A 4J7KA 3GWOA 3JSLA 5BZBA 2WLKA 3ZHRA 2KG7B 3CRQA 2R72A 4KL1A 4X9QA 4NYKA 3UCSC 3CC7V 2EILB 1I94B 4NKGB 3T1YB 4Q6GA 5H6QA 2E5LO 4EFEA 1WA8B 1NH2B 2QWOB 1YI2V 2VS0A 1DLBA 4PI2A 4I9QA 4FLVA 3I5DA 2P7TC 1Q81W 2QTOA 4BR6A 2IU0A 1CEZA 4LF5B 4MVSA 1F23A 1VQ7V 4DV1O 1N32O 1PM9A 2YS8A 2CH7B 5LHHA 4FM1A 2ETNA 2UUBB 4X1KB 2DW4A 2IJKA 1SF9A 4P2ZA 3BVOA 3U0ZA 1S5HC 3LDEA 4QPJA 1M1KW 4B3SB 2NLJC 1KC8W 1NTZH 2BSKA 4K0KB 3WU2Z 5LMUB 5CA1A 1KU9A 4DR6O 3B09A 4HNAB 1XILA 2VRZA 4YJ3B 2ZD9A 2K1EA 1XMQO 3MHSC 1MA1A 3OW2U 2PGGA 2YI8A 2D3OW 3TETA 4B7KA 3DC5A 1S5LZ 1NVPB 1NKDA 2ZE7A 4BIZA 3IAYA 3FYEB 4OGQB 2HG5C 2P4VA 5D5QA 4DRXA 3LSSA 3R66A 1GN4A 3O65A 4O4LA 2DMXA 5J2TB 3TXQA 1IBKO 5EZYB 1XL4A 1UPGA 1AI5A 1NR1A 1R6NA 4MVOA 3F7YC 4NR1A 1WLEA 4J42A 4B3TO 1WB8A 5C93A 2XAFA 1NT2B 2Y4TA 3FB7C 2E75B 4Z2WA 1KBHA 2LJ2A 1CPYA 3MHHC 2XUMA 1WPXA 2LFSA 5KA5A 1MOFA 3QO5A 3UM7A 4B08A 1BCCH 4JI6O 4UCVA 3JD4A 3HKCB 3ICXA 1ZAUA 4J10A 2AZ0A 3T1HO 4DR2O 1MSWD 4DR4B 1CP9A 2WLJA 3E83A 4X62B 2XNDG 1N4CA 3JAWB 5HFLA 3G4SV 2YIAA 4LFCB 4CH3A 1JA8A 2RN9A 2QEXV 2OCHA 3DC6A 3M8AA 4JAUA 1G4YB 2F95B 1XNRB 5DM6V 4CC6A 2OWOA 1SS3A 3B77A 3OR6C 2UUCO 2DQ3A 2DJVA 4GX2A 3K5MA 2C2AA 2UXDO 1VP7A 2LW1A 3OMNB 4TUYB 2YEVA 3JATB 1I0HA 5A9GA 3BABA 1LNQA 4ZOLA 1S5JA 3WFVA 4I55B 3FAVB 3ZHTA 3OUSA 1H2NA 1H2SB 2W0FC 3B4SA 1AR1B 1K97A 1FFTB 4J9YB 1KMIZ 3K59A 1PP9H 3UO2A 4P30A 2NN4A 3L75H 4JI7O 4KXRA 1AI6A 2HHHO 4JYAB 1Q7YW 2Q69A 4DR5B 2WWWA 5CB4B 2QWNB 1KB9F 2RDCA 4B3MO 2G38A 5KUMA 4I50B 3J81N 3T4DA 1UFIA 1RPRA 3BPZA 3WG7C 1S76D 2XAJA 1N33O 1IURA 4O4IB 5CA0A 4I4TA 2FL4A 1MMMA 3K06A 2F66C 1MG1A 3K57A 2ITDC 1BHAA 5LYJB 5BMVA 2JJ2G 1EN4A 2EIMB 5FNVA 5JJJB 4MTGA 5J2UB 1URFA 1DTOA 4MVUA 3CC2V 4GKJO 1NZ6A 5IDJA 1SQBH 2E5LB 3K04A 4GYCB 1RPOA 4WFEA 1TVKA 4JAVA 2VQEO 4LF6O 3CCMV 4FPPA 1R3KC 1FD9A 2WAMA 4H44B 4DV1B 3M7MX 1GM8A 2GTSA 1N32B 3K9AA 1V54C 1GTOA 1VQLV 1SA0B 2HVKC 4IYIA 2RNBA 1WP7A 3ZX6A 1QVFU 1SETA 1JVMA 4K3AA 2PZSA 3G67A 2UXCB 1ZX3A 1N36O 1Q6IA 2X0LA 2R9AA 2YIBD 4DR6B 4PI0A 5C8YB 1X59A 1XMQB 5LGTA 4UV9A 2P22C 3ABMC 4QE9A 4ICGA 3SJCC 2GHYA 3JALB 1NR7A 4XBFA 2KG7A 3RN4A 4N21A 1OJHA 2OCCC 2EBOA 2JDIG 1OCZB 2FB5A 4R7CA 4RWUA 4H13B 2ZNIA 1GKFA 1WA8A 2WLMA 3OT7A 1R6KA 1S77D 2Y69B 4GX0A 4JTAB 1IBKB 3TJTA 3A0HZ 3UT5B 4GUNA 1LUVA 4B3TB 1ZL8B 3UO3A 3D3QA 5L3GA 4J80A 3L9DA 1IX9A 2IU3A 3K5LA 2JEXA 1PV0A 5KHHA 2W6IG 5L3DA 2CH7A 1OCOC 4LP8A 4W4KA 5LMUO 4X1KA 2Q73A 5B1BC 3K9SA 1YSCA 4JI6B 1G6UA 3OGIB 1K9MW 4CH5A 5IYBO 3ABUA 3T1HB 4DR2B 5KHIA 1U97A 4F6RB 2BTOA 3AK3A 2Q4PA 3E2EA 1Z2GA 3G80A 4HNAA 4YJ3A 2WLNA 3JAKB 5TISZ 4CS3A 1V54B 4RUEA 1QU7A 5KAIZ 4KFMA 4JI5O 3AG2C 2WLLB 4UXNA 1NS1A 2RQ6A 4BIOA 1KUQA 3ETDA 1W0JG 3CC4V 2UUCB 2PYJA 2UXDB 4PA7A 2X7RB 1Y74B 2EJRA 4I9WA 5J2TA 2R70A 5EZYA 4E2LA 1D5AA 3GB7C 5KHJA 3ZN1A 5LOVA 4QPKA 3OM3B 3VQXA 3ETEA 2CK3G 4U7NA 5B1AC 2DN9A 3EFFK 3BA9A 3ABMB 2CTPA 3ZN0A 3N27A 4OPHA 2DE0X 3CWBH 2BCCH 1VF6A 2OCCB 4MTFA 3N2KB 1XBLA 3OTFA 3QO8A 1VQ6V 1AILA 2P6JA 2OIEA 5LGUA 4D6TH 1GMGA 3SPCA 1XQ8A 2GV9A 3HKCA 2HHHB 4UFZA 3FB6C 5IYDO 3F5WC 4O2BB 4B3MB 4HYOA 4X89A 4EB6A 1BE3H 3H9VA 2XASA 1OCOB 5BMVB 1JX9A 3E89A 2F1MA 2Z3YA 1K33A 2DYSB 4OX9O 4LF8O 5JH7B 3I56V 4LFBO 3G6EV 3ZHQA 2F93B 4CS2A 2PI5A 3IC9A 5DEDA 2EIJB 2MK3A 1ZTEA 3FKSG 5AG2A 1GAXA 2P5OA 3CRCA 1R3JC 4FFKA 1L0LH 1V9PA 2BOBC 1GRJA 3SJQC 1QHTA 2F23A 2QA4V 2CGNA 3JATA 3DSQA 4WFAV 3RFRA 1THZA 3QVNA 4GKJB 2QTSA 5EK0A 2DQ0A 1H8HG 4MVQA 4MW3A 4I55A 4DW0A 4G27B 1EN6A 3CCLV 2B9ZA 5H6RA 3S3XA 2AXTZ 3G71V 5IJ9B 5L3FA 5EBWC 3VBBA 1JQ0A 4YJ2A 3BA8A 4R8CA 4LF7O 2VQEB 1OHHG 1ZLZA 2P67A 3LNMB 5B1AB 5KHGA 3L74H 2CE4A 1P49A 2ZINA 5E1AC 5CB4A 2LW7A 5CA3A 2H3OA 1KP3A 4I50A 1BGYH 2YUAA 2GUZB 2H8PC 1YTFB 4JASA 4FLTA 4O4IA 4P9PA 4NVPA 5JQGB 1SZXA 5LXTB 3JCZA 1N36B 4Q20A 4JI1B 1SC5B 1M57B 5B66Z 1VF6C 1YCIA 3BFRA 5LYJA 1KECA 1VQKV 2OYQA 1VQ4V 4LC1A 2JK5C 1R73A 2WA3A 2ZE8A 5J2UA 3CCEV 4JZGA 5B1OA 4GT1A 3KKYA 3RYCB 2IJIA 3ZMUA 2ZCEA 3VQYA 2ADQB 2ZM6O 1IVSA 3ZBHA 3RVYA 1B06A 3STZC 3ABLB 2Y0IA 1AP5A 4TQFA 1JR9A 1SZTA 3K5OA 1BT8A 1Y66A 2ILMA 5EYPB 4G28B 1BSMA 4DR3O 3STLC 4BWAA 1IBMO 4LF9O 2UXCO 3WB0A 2QM8A 4WCEV 1SA0A 3K08A 4CC5A 1ZSPA 2F4VO 4NTXA 2L6LA 4TV8B 4LBEC 3VQVA 2X6AA 4PDMA 1DF5A 1YDXA 1N34O 2KKWA 1K4DC 3T4ZA 4O4JA 5L3CA 4DYLA 1S72V 2JS3A 1P4RA 1HNWO 4QE7A 1N8RW 5C8YA 2YXHA 3BEHA 4DW1A 3JALA 1TA8A 5CBFA 4JI5B 4FVMA 5IYCO 2R9RB 1RSOB 5LOVB 3CHXA 1P7BA 2EULA 1MZFA 4FZ1A 3SPIA 4LCUC 1AI7A 4WFFA 2ODMA 3W7TA 3OE7G 1VEWA 4X65O 5FL7G 1E79G 1HDJA 4GX5A 4C7UA 1NU1H 1XOUA 4QIWF 4D7SA 5GW7A 3UT5A 1YF2A 4UVAA 1UJWB 4DUYO 3DTUB 1ZL8A 5H5NA 4AI8A 3ZMSA 4UCOA 3KCXA 1WJZA 4NTWA 5H9CA 3UKMA 3OMIB 3ZCCA 1K4CC 3W7UA 1M93A 1EZJA 1XHXA 4MTXA 4GCZA 2JIZG 3E8FA 3CCJV 3BHPA 2EIMC 1ORQC 3SYCA 3L71H 4PV1B 1NQTA 4PDLA 4EB6B 3SDLA 4DR1O 4J7JA 2D2CB 2L35A 1J5EB 3CEIA 3ZRSA 3JAMN 4F6RA 2EIKC 2IJJA 3CCRV 2F43G 3RYHB 3JAKA 3QF7A 2W0XA 1AJPA 3LUTB 3OD4A 4IHJB 4OX9B 4F6EA 4LF8B 2WLLA 3DGEA 3A8TA 4LFBB 4CS4A 3BCCH 5KMGB 2JRIA 1ZWIC 3TCUA 2QKAA 2K9PA 4XDKA 4X1YB 3ZMTA 1Y74A 1VF7A 2JJ1G 4FLUA 3BY6A 2WLIB 2FTKA 3H1LH 3SYPA 1TUEB 5EIBD 4AQYO 2QM4A 3LSUA 3E8GA 4EEQA 2ZE5A 2FYUH 2W6JG 3Q4HB 1Q90D 4YJ2B 4TWKA 3ZRWB 4ZHQB 4O4HB 3N2KA 1FXKA 3LSQA 4FM0A 4KP4A 5D5PA 3U11A 4JGSA 4UUJC 3CCUV 4E4EA 2GDSA 4J41A 3RWRD 4LF7B 4MW8A 4LNUA 1W0KG 4BAYA 1OCZC 1K92A 1XI1A 4O2BA 5K1PA 2HVJC 4I5SA 2Y69C 5IWAO 2Q6AA 5K1XA 4DUZO 5JH7A 2Q0AA 1I5YA 3OAAG 2QR4A 4UCRA 1H2MA 5E79Z 5LA6B 1SESA 3N2GA 2A9HA 3QG5A 1D5NA 3CXHF 4FJCC 2CUGA 2LO1A 5DN6G 4PA3A 2EIKB 1GN2A 2Q67A 5IYZB 3HPLC 5JCOC 1IBLO 3CRAA 2YIDA 4H37A 1Y4MA 2RMKB 1HNXO 4NXNO 2GSMB 4DV0O 2ZM6B 1MABG 3SGIA 1VMGA 4FLXA 4ABMA 1AJQA 2QKCA 4L87A 3BAAA 3WB2A 5IJ9A 3DXRB 5JWPA 1XEQA 2IBZH 2CTRA 2DWEC 3E22A 3KCYA 1BL8A 4FLZA 2ZQMA 3F5TA 2XAGA 4QJFB 2QM7A 4DR3B 2YSUB 1IBMB 4FMTA 3S3WA 4LF9B 4O4JB 1FKAO 3TGUH 3X2QC 4JI1O 2F4VB 2GUZA 3PJSK 2QSAA 4JPRA 3HR0A 5KAFZ 1K5QA 2E76B 1N34B 5JQGA 2YIBA 4WF9V 5LXTA 1QNMA 3W7SA 3ZEDA 4JI4O 1S0VA 4PELA 1V55C 1E1QG 1HNZO 2ZR2A 2AZ2A 1HNWB 1FXKC 1JMKC 3L72H 2BTQB 4JYYA 1YJNV 4J7ZA 1PL4A 3NXSA 4I7ZB 2Q8VA 2ARHA 1FFXA 2Y0PA 3RYCA 3H01A 2H94A 3B8MA 4X64B 3SYAA 4LFAO 1NH2D 3CD6V 3I55V 3SPHA 4X65B 4EKWA 2YICA 4YHHO 3T1CA 1VARA 3P3PA 2YC0A 2CAZC 2XHBA 4DUYB 2DYSC 1QVGU 3K5NA 4HAMA 1VIBA 5FPOA 3AG4B 1FXVA 4R6ZA 4UV8A 5EYPA 3ABKC 3OMAB 1F7YA 4U3JB 2EIJC 1W2BU 5BR8O 1DGSA 4TV8A 5EBMC 1SRYA 4BW5A 2OIGA 4IIJA 3KZIZ 4DR1B 4DV7O 4KHPO 2JEUA 1VQOV 4NB5A 3TK1A 1WNSA 1XUQA 4WFHA 4UCSA 1OV9A 3CMEV 1NVPD 1RM1C 2ATKC 3X2QB 2OT5A 3G6BA 3F7VC 3QO7A 1FJGO 3D8CA 1H38A 5KX5B 3MDSA 2LGWA 1RSOA 5IJ0B 1Z5WA 4DK1A 3IC7A 1G1XB 2Q0OC 4IT5A 3SYOA 1M5IA 1QQCA 2RCVA 3CS5A 1V55B 4FM2A 2ZDIC 4WFBV 1FXKB 3HB3B 2XAHA 4UB6Z 1T5EA 1H2LA 2UU9B 4AQYB 1EZVH 1FS0G 4CBCA 1J95A 1FXHA 1M57C 1XL6A 3M99B 2Q9LA 1AROP 2CTQA 2PUSA 3B40A 5KHKA 1J5EO 2R9IA 2XTAA 4LNUB 2HJFC 4JYCA 1FYJA 2HFEC 5DECA 2QKSA 3SPGA 1YHQV 3RW0A 2E74B 4BW9A 2UXNA 2Z0AA 4UVBA 3ZHUA 1AR4A 1H2GA 2EINC 4J11A 1Y76B 3QTCA 3ABKB 3SR2C 3N2GB 1NBMG 3RYHA 5IWAB 1Q8IA 1JJOA 3P32A 1LR1A 2DWDC 4JAAA 4IYHA 4IHJA 3ABLC 4ZKIA 2AGAA 4DUZB 1XDCA 3FD9A 2PI4A 2OTJV 3SPJA 2JVDA 3JASB 2EX3A 1Q6HA 5KMGA 4JI3O 1FPOA 4TQDA 5JJNB 4X1YA 2QE7G 4MTOA 4FIPC 1LUWA 1GO3F 4U7OA 4OPAA 1TGOA 1IBLB 2JGDB 1GH6A 2Z5UA 2WLIA 3T2MA 2Q7GA 3JD2A 5LBQA 1Q86W 1PL0A 1HNXB 1RM1B
chains in the Genus database with same CATH topology
1VF6C 1Y76B 1Y74A 1VF6A 3B40A 1ZL8B 1ZL8A 1RSOB 1Y74B 1Y76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF6 C;  1Y76 B;  1Y74 A;  1VF6 A;  3B40 A;  1ZL8 B;  1ZL8 A;  1RSO B;  1Y74 B;  1Y76 A; 
#chains in the Genus database with same CATH topology
 1KP2 A;  3ZIA G;  4NXN B;  2P06 A;  2YI9 A;  3Q4H A;  4I0X A;  3CCV V;  4DV0 B;  4LF4 B;  1BQ0 A;  2CTW A;  3E22 B;  1Q6U A;  4J9Z B;  3RGB A;  4RQE A;  3ZRW A;  2Q5Z A;  2IH3 C;  3ZHV A;  4ZHQ A;  4O4H A;  3TXS A;  3O9O A;  2YXY A;  1N0N A;  2V7Q G;  1NTK H;  1R1B A;  4TSF G;  5B5E Z;  3CB2 A;  4JTD B;  4MSW C;  4JTC B;  5LMN O;  4L8J A;  3OR7 C;  2X6B A;  1OZ0 A;  2LFR A;  3ASN B;  4MS2 A;  4JI2 O;  2B5U A;  1KQS U;  3RBZ A;  4UCT A;  5CMU A;  2B1I A;  3K03 A;  1VF5 B;  4X1I B;  5IE9 A;  1VQM V;  5GON B;  2WA4 A;  4JI4 B;  3ZS8 C;  3AG3 C;  4D7T A;  5LHI A;  5LA6 A;  1HNZ B;  5GTH Z;  1FFX B;  3FB5 C;  4GKK O;  4CZZ A;  2AHY A;  4DXW A;  4F4L A;  5BY1 A;  1R3I C;  5IYZ A;  2XAQ A;  2EIN B;  1DF4 A;  4JZ2 A;  1RFY A;  2RJZ A;  3SYQ A;  1RP3 B;  1WP8 A;  1L8D A;  1ROP A;  3KG2 A;  4A5U B;  4CH6 A;  1XMO B;  3EXA A;  2UXB O;  4XDL A;  4LFA B;  4DR7 O;  4LWS A;  1M9N A;  3HKD A;  1VQ8 V;  4DV3 B;  1YJW V;  1SQV H;  1DK1 A;  5IT9 N;  4YHH B;  1U96 A;  3ZHS A;  4AHC A;  1O9H A;  3DXR A;  3SJB C;  1VQP V;  1VQ5 V;  4ZI7 B;  3CJH B;  3HKE B;  5L3E A;  3K79 A;  1WB7 A;  4IIJ B;  3ETG A;  5BXZ A;  2E3C A;  4FFB B;  5BR8 B;  4B7E A;  1F4M A;  3J7A U;  3OEE G;  4DV6 B;  2WPD G;  1IDS A;  2FKX A;  4MVM A;  1SQF A;  3AG1 B;  4P9O A;  4PA6 A;  2KQX A;  3AG7 A;  2EJ7 A;  4TT3 G;  4DV7 B;  2P4K A;  4KHP B;  4ZBM A;  4IGG A;  1XHZ A;  3C3S A;  4G2K A;  2ZXW C;  4FLY A;  4PD4 F;  4X64 O;  1GN3 A;  2PF4 E;  4DO2 A;  3JYC A;  2BTQ A;  4GX1 A;  1PD3 A;  3CXC U;  3K3W A;  5EC1 C;  1FJG B;  3CRR A;  3VOU A;  5IY5 B;  4TV9 B;  2M6Y A;  2VWJ A;  3GVM A;  3CSX A;  1K73 W;  1JPX A;  2M7W A;  2HEP A;  3AG3 B;  4O2A B;  1YZB A;  3J80 N;  1WAZ A;  5LHG A;  1QBZ A;  1MZE A;  4FZ0 A;  3OTO O;  5JCO A;  3CRM A;  1NJI W;  1BQZ A;  1JJ2 U;  2KB1 A;  3GWK C;  4DV2 O;  2Y48 A;  3OFN G;  3CX5 F;  3H1K H;  4U3J A;  2ZR3 A;  2IM9 A;  3H1H H;  3IJ4 A;  4QGP A;  3OUF A;  2YXL A;  3UQ8 A;  1QCE A;  4WFG A;  3RYI A;  1WPB A;  4DV5 O;  3JAR B;  3ABT A;  5J9P C;  3IGA C;  2LP7 A;  2HJD A;  2ZKO A;  2OTL V;  4FLW A;  1TUB B;  1MSD A;  1EFR G;  1IZ3 A;  1AI4 A;  4PDR A;  1P84 F;  1G8M A;  4X20 B;  3CMA V;  4MVR A;  1E1R G;  3B2E E;  1M4U A;  4WBN B;  5KX5 A;  5IJ0 A;  3E86 A;  1SKV A;  2UU9 O;  4K8X A;  4JI3 B;  2A06 H;  2WLH A;  5B3S C;  2GTA A;  4I0X B;  4UVC A;  1BHB A;  1FAF A;  3APQ A;  3CPW U;  1H2K A;  2ZXW B;  2WSS G;  4DV4 O;  4H33 A;  2VQF O;  3JD1 A;  2LQT A;  4W4L A;  5CN0 A;  2QWP B;  3P3N A;  1IXB A;  1Q82 W;  1VQ9 V;  3HKB B;  3H1J H;  2Y4U A;  2JS5 A;  1Q43 A;  1AB3 A;  5KUK A;  2ZT9 B;  1JFF A;  2ADP A;  4NXM O;  2V4D A;  5EC2 C;  4HZ3 A;  4MVZ A;  2PYL A;  3CE2 A;  5LMN B;  4Z1M G;  3AEI A;  4IL6 Z;  3H1I H;  2P90 A;  4PJ0 Z;  1YIJ V;  4JI2 B;  5LP6 A;  1Y76 A;  4X66 O;  2UUA O;  1I7F A;  1GN6 A;  3ZMV A;  1PNM A;  1HP8 A;  2EZO A;  4YIP A;  4JI0 O;  1IXM A;  1ZUQ A;  1HW7 A;  1YJ9 V;  3MAQ A;  3AG4 C;  5JVD A;  3JAS A;  4B3R O;  1KKC A;  3D36 A;  1HR0 O;  4GKK B;  1P7G A;  2HP8 A;  3C3T A;  1VQN V;  4LWS B;  4LF4 O;  3HKD B;  4YY3 O;  1XNQ O;  1NTM H;  4JI8 O;  5FPR A;  2JGD A;  1K5S A;  1ENV A;  1HWY A;  2UXB B;  4PA4 A;  2VWK A;  2DOS A;  5B1N A;  1WN7 A;  4DR7 B;  2ITC C;  3CCS V;  1SQP H;  3EHB B;  2ZNJ A;  4CH4 A;  1EBO A;  1YIT V;  2HR3 A;  4JV5 O;  1K3E A;  3EVK A;  2AW9 A;  5B3S B;  3E8B A;  3ZJZ A;  4PA9 A;  2A79 B;  3MD0 A;  1X4T A;  4R50 A;  2BSK B;  2ZDI A;  1K34 A;  2IJH A;  2HLD G;  3E35 A;  4YIO A;  2A7W A;  2IH1 C;  5CA1 B;  2XT9 A;  4PDV A;  1YTF D;  4AIL C;  3FFQ A;  1PNK A;  3FYI B;  1D2D A;  5ITZ A;  5EIB C;  3RYF A;  4GLX A;  4K35 A;  3NR7 A;  4DRX B;  4X1I A;  5GON A;  1SQX H;  1AJN A;  3D3I A;  5HFM A;  1I94 O;  3B8N A;  3T1Y O;  5CBH A;  3JD3 A;  1SQG A;  4O4L B;  1XMO O;  2BE3 A;  3WG7 B;  4ZIB A;  4TOI A;  1OCC C;  4DV3 O;  2DYR C;  3JSN A;  1F4N A;  3WB1 A;  4PHZ A;  4RAI A;  3CCQ V;  1YEW A;  4LF5 O;  3LDD A;  4JYB A;  4QNH B;  4JF3 A;  2QDO A;  1OCR C;  1AR5 A;  5LP6 C;  2UUB O;  2ZIO A;  3ZMZ A;  3ZRV A;  2JGU A;  3ETQ A;  4UCU A;  4B3S O;  2QGN A;  1QLE C;  3ASO C;  2YDE A;  2N05 A;  1Q3E A;  2NR5 A;  3OTO B;  4MT8 A;  4K0K O;  3W7W A;  4DV6 O;  3A2F A;  3RYI B;  4ZI7 A;  3CJH A;  1KKD A;  3HKE A;  1L0N H;  4DV2 B;  2FML A;  5LGN A;  1JOY A;  1O9G A;  4RUF A;  4UB8 Z;  3D36 C;  2QWR B;  3K58 A;  4FFB A;  5FLX N;  4FK5 C;  5GTI Z;  1BZK A;  1N0J A;  3R65 A;  4Z1V A;  3THO A;  1XRE A;  4XDJ A;  1YVW A;  3U10 A;  2XOK G;  1I08 A;  4DV5 B;  4DK0 A;  3IFX A;  3RT3 C;  1COW G;  3FB8 C;  3QNE A;  3K0G A;  2MW2 B;  1QLN A;  3VQW A;  5A2Q N;  2NNU A;  2Q68 A;  4LR3 A;  3APO A;  1QR8 A;  2Q7E A;  1M56 C;  1BS3 A;  2A3Q A;  1S3J A;  1NI8 A;  4RQF A;  2YEV B;  4BIU A;  1QR9 A;  5CBG A;  3LNN A;  4GZR B;  2A0L A;  2ZIM A;  1SQQ H;  4TV9 A;  4ZOL B;  4LH6 A;  2EZP A;  2CGO A;  3CP1 A;  3W7X A;  1US6 A;  1EN5 A;  1W59 A;  3ASN C;  1KYO F;  3FX7 A;  2BOC C;  1GM9 A;  1Z5V A;  4O2A A;  3PN1 A;  5EBL C;  4ASU G;  4DV4 B;  2VQF B;  1SER A;  2N04 A;  2KSD A;  1K7D A;  3OEH G;  1OCC B;  1JFF B;  1AP6 A;  1MNG A;  2DYR B;  4K8Z A;  4DR4 O;  1B6Q A;  3LDC A;  2V1D A;  4X62 O;  4NTY A;  4JI7 B;  4X88 A;  1PKX A;  1OCR B;  4YXW G;  3A0R A;  2PY5 A;  2UXX A;  4LFC O;  1L1F A;  5LP6 B;  5CA0 B;  4I4T B;  5L3B A;  4NXM B;  3L73 H;  2EIL C;  3JAR A;  1GM7 A;  1XNR O;  1PNL A;  1QLE B;  3ASO B;  1YXB A;  3JAW A;  1K8A W;  4OXS A;  1M90 W;  1N33 B;  3OGC C;  1TUB A;  1B3Q A;  2GBO A;  4X66 B;  3P30 A;  4N23 A;  5JVD B;  1TAE A;  5FNV B;  5B1B B;  2UUA B;  3ML0 A;  4LH7 A;  3AK1 A;  3BRC A;  4H0L B;  4U3F H;  4EFB A;  4JI0 B;  4X20 A;  3C90 A;  3K0D A;  2PTM A;  3JCU Z;  4WBN A;  1R3L C;  1JCH A;  5LL6 Y;  2QWQ B;  4B3R B;  2Q7H A;  1Y67 A;  5KLV H;  1Q5O A;  1HR0 B;  1A32 A;  2B1G A;  3AK2 A;  1H8E G;  4TUY A;  1Y6X A;  2X6C A;  4YY3 B;  1XNQ B;  3RVZ A;  2AHZ A;  3AG2 B;  4JI8 B;  1M56 B;  1AVM A;  1TVK B;  3AG1 C;  1I5X A;  3FAV A;  5JJE B;  5F2V O;  4JYA O;  3L70 H;  4DR5 O;  1PPJ H;  4KUM A;  2O57 A;  1KD1 W;  3CYO A;  3SJA C;  1B04 A;  3HKB A;  2HKO A;  2QJ1 A;  2ZE6 A;  4JV5 B;  2IW5 A;  3E8H A;  1CXZ B;  4LF6 B;  4HBN A;  3JD0 A;  2CDY A;  3ZRX A;  2LGQ A;  4X8A A;  2N74 A;  1F51 A;  5H2F Z;  1GK9 A;  5ITZ B;  1R6T A;  3RYF B;  5IY5 C;  1BMF G;  3A0B Z;  4RO2 A;  1EM1 A;  5KA6 A;  4J7K A;  3GWO A;  3JSL A;  5BZB A;  2WLK A;  3ZHR A;  2KG7 B;  3CRQ A;  2R72 A;  4KL1 A;  4X9Q A;  4NYK A;  3UCS C;  3CC7 V;  2EIL B;  1I94 B;  4NKG B;  3T1Y B;  4Q6G A;  5H6Q A;  2E5L O;  4EFE A;  1WA8 B;  1NH2 B;  2QWO B;  1YI2 V;  2VS0 A;  1DLB A;  4PI2 A;  4I9Q A;  4FLV A;  3I5D A;  2P7T C;  1Q81 W;  2QTO A;  4BR6 A;  2IU0 A;  1CEZ A;  4LF5 B;  4MVS A;  1F23 A;  1VQ7 V;  4DV1 O;  1N32 O;  1PM9 A;  2YS8 A;  2CH7 B;  5LHH A;  4FM1 A;  2ETN A;  2UUB B;  4X1K B;  2DW4 A;  2IJK A;  1SF9 A;  4P2Z A;  3BVO A;  3U0Z A;  1S5H C;  3LDE A;  4QPJ A;  1M1K W;  4B3S B;  2NLJ C;  1KC8 W;  1NTZ H;  2BSK A;  4K0K B;  3WU2 Z;  5LMU B;  5CA1 A;  1KU9 A;  4DR6 O;  3B09 A;  4HNA B;  1XIL A;  2VRZ A;  4YJ3 B;  2ZD9 A;  2K1E A;  1XMQ O;  3MHS C;  1MA1 A;  3OW2 U;  2PGG A;  2YI8 A;  2D3O W;  3TET A;  4B7K A;  3DC5 A;  1S5L Z;  1NVP B;  1NKD A;  2ZE7 A;  4BIZ A;  3IAY A;  3FYE B;  4OGQ B;  2HG5 C;  2P4V A;  5D5Q A;  4DRX A;  3LSS A;  3R66 A;  1GN4 A;  3O65 A;  4O4L A;  2DMX A;  5J2T B;  3TXQ A;  1IBK O;  5EZY B;  1XL4 A;  1UPG A;  1AI5 A;  1NR1 A;  1R6N A;  4MVO A;  3F7Y C;  4NR1 A;  1WLE A;  4J42 A;  4B3T O;  1WB8 A;  5C93 A;  2XAF A;  1NT2 B;  2Y4T A;  3FB7 C;  2E75 B;  4Z2W A;  1KBH A;  2LJ2 A;  1CPY A;  3MHH C;  2XUM A;  1WPX A;  2LFS A;  5KA5 A;  1MOF A;  3QO5 A;  3UM7 A;  4B08 A;  1BCC H;  4JI6 O;  4UCV A;  3JD4 A;  3HKC B;  3ICX A;  1ZAU A;  4J10 A;  2AZ0 A;  3T1H O;  4DR2 O;  1MSW D;  4DR4 B;  1CP9 A;  2WLJ A;  3E83 A;  4X62 B;  2XND G;  1N4C A;  3JAW B;  5HFL A;  3G4S V;  2YIA A;  4LFC B;  4CH3 A;  1JA8 A;  2RN9 A;  2QEX V;  2OCH A;  3DC6 A;  3M8A A;  4JAU A;  1G4Y B;  2F95 B;  1XNR B;  5DM6 V;  4CC6 A;  2OWO A;  1SS3 A;  3B77 A;  3OR6 C;  2UUC O;  2DQ3 A;  2DJV A;  4GX2 A;  3K5M A;  2C2A A;  2UXD O;  1VP7 A;  2LW1 A;  3OMN B;  4TUY B;  2YEV A;  3JAT B;  1I0H A;  5A9G A;  3BAB A;  1LNQ A;  4ZOL A;  1S5J A;  3WFV A;  4I55 B;  3FAV B;  3ZHT A;  3OUS A;  1H2N A;  1H2S B;  2W0F C;  3B4S A;  1AR1 B;  1K97 A;  1FFT B;  4J9Y B;  1KMI Z;  3K59 A;  1PP9 H;  3UO2 A;  4P30 A;  2NN4 A;  3L75 H;  4JI7 O;  4KXR A;  1AI6 A;  2HHH O;  4JYA B;  1Q7Y W;  2Q69 A;  4DR5 B;  2WWW A;  5CB4 B;  2QWN B;  1KB9 F;  2RDC A;  4B3M O;  2G38 A;  5KUM A;  4I50 B;  3J81 N;  3T4D A;  1UFI A;  1RPR A;  3BPZ A;  3WG7 C;  1S76 D;  2XAJ A;  1N33 O;  1IUR A;  4O4I B;  5CA0 A;  4I4T A;  2FL4 A;  1MMM A;  3K06 A;  2F66 C;  1MG1 A;  3K57 A;  2ITD C;  1BHA A;  5LYJ B;  5BMV A;  2JJ2 G;  1EN4 A;  2EIM B;  5FNV A;  5JJJ B;  4MTG A;  5J2U B;  1URF A;  1DTO A;  4MVU A;  3CC2 V;  4GKJ O;  1NZ6 A;  5IDJ A;  1SQB H;  2E5L B;  3K04 A;  4GYC B;  1RPO A;  4WFE A;  1TVK A;  4JAV A;  2VQE O;  4LF6 O;  3CCM V;  4FPP A;  1R3K C;  1FD9 A;  2WAM A;  4H44 B;  4DV1 B;  3M7M X;  1GM8 A;  2GTS A;  1N32 B;  3K9A A;  1V54 C;  1GTO A;  1VQL V;  1SA0 B;  2HVK C;  4IYI A;  2RNB A;  1WP7 A;  3ZX6 A;  1QVF U;  1SET A;  1JVM A;  4K3A A;  2PZS A;  3G67 A;  2UXC B;  1ZX3 A;  1N36 O;  1Q6I A;  2X0L A;  2R9A A;  2YIB D;  4DR6 B;  4PI0 A;  5C8Y B;  1X59 A;  1XMQ B;  5LGT A;  4UV9 A;  2P22 C;  3ABM C;  4QE9 A;  4ICG A;  3SJC C;  2GHY A;  3JAL B;  1NR7 A;  4XBF A;  2KG7 A;  3RN4 A;  4N21 A;  1OJH A;  2OCC C;  2EBO A;  2JDI G;  1OCZ B;  2FB5 A;  4R7C A;  4RWU A;  4H13 B;  2ZNI A;  1GKF A;  1WA8 A;  2WLM A;  3OT7 A;  1R6K A;  1S77 D;  2Y69 B;  4GX0 A;  4JTA B;  1IBK B;  3TJT A;  3A0H Z;  3UT5 B;  4GUN A;  1LUV A;  4B3T B;  1ZL8 B;  3UO3 A;  3D3Q A;  5L3G A;  4J80 A;  3L9D A;  1IX9 A;  2IU3 A;  3K5L A;  2JEX A;  1PV0 A;  5KHH A;  2W6I G;  5L3D A;  2CH7 A;  1OCO C;  4LP8 A;  4W4K A;  5LMU O;  4X1K A;  2Q73 A;  5B1B C;  3K9S A;  1YSC A;  4JI6 B;  1G6U A;  3OGI B;  1K9M W;  4CH5 A;  5IYB O;  3ABU A;  3T1H B;  4DR2 B;  5KHI A;  1U97 A;  4F6R B;  2BTO A;  3AK3 A;  2Q4P A;  3E2E A;  1Z2G A;  3G80 A;  4HNA A;  4YJ3 A;  2WLN A;  3JAK B;  5TIS Z;  4CS3 A;  1V54 B;  4RUE A;  1QU7 A;  5KAI Z;  4KFM A;  4JI5 O;  3AG2 C;  2WLL B;  4UXN A;  1NS1 A;  2RQ6 A;  4BIO A;  1KUQ A;  3ETD A;  1W0J G;  3CC4 V;  2UUC B;  2PYJ A;  2UXD B;  4PA7 A;  2X7R B;  1Y74 B;  2EJR A;  4I9W A;  5J2T A;  2R70 A;  5EZY A;  4E2L A;  1D5A A;  3GB7 C;  5KHJ A;  3ZN1 A;  5LOV A;  4QPK A;  3OM3 B;  3VQX A;  3ETE A;  2CK3 G;  4U7N A;  5B1A C;  2DN9 A;  3EFF K;  3BA9 A;  3ABM B;  2CTP A;  3ZN0 A;  3N27 A;  4OPH A;  2DE0 X;  3CWB H;  2BCC H;  1VF6 A;  2OCC B;  4MTF A;  3N2K B;  1XBL A;  3OTF A;  3QO8 A;  1VQ6 V;  1AIL A;  2P6J A;  2OIE A;  5LGU A;  4D6T H;  1GMG A;  3SPC A;  1XQ8 A;  2GV9 A;  3HKC A;  2HHH B;  4UFZ A;  3FB6 C;  5IYD O;  3F5W C;  4O2B B;  4B3M B;  4HYO A;  4X89 A;  4EB6 A;  1BE3 H;  3H9V A;  2XAS A;  1OCO B;  5BMV B;  1JX9 A;  3E89 A;  2F1M A;  2Z3Y A;  1K33 A;  2DYS B;  4OX9 O;  4LF8 O;  5JH7 B;  3I56 V;  4LFB O;  3G6E V;  3ZHQ A;  2F93 B;  4CS2 A;  2PI5 A;  3IC9 A;  5DED A;  2EIJ B;  2MK3 A;  1ZTE A;  3FKS G;  5AG2 A;  1GAX A;  2P5O A;  3CRC A;  1R3J C;  4FFK A;  1L0L H;  1V9P A;  2BOB C;  1GRJ A;  3SJQ C;  1QHT A;  2F23 A;  2QA4 V;  2CGN A;  3JAT A;  3DSQ A;  4WFA V;  3RFR A;  1THZ A;  3QVN A;  4GKJ B;  2QTS A;  5EK0 A;  2DQ0 A;  1H8H G;  4MVQ A;  4MW3 A;  4I55 A;  4DW0 A;  4G27 B;  1EN6 A;  3CCL V;  2B9Z A;  5H6R A;  3S3X A;  2AXT Z;  3G71 V;  5IJ9 B;  5L3F A;  5EBW C;  3VBB A;  1JQ0 A;  4YJ2 A;  3BA8 A;  4R8C A;  4LF7 O;  2VQE B;  1OHH G;  1ZLZ A;  2P67 A;  3LNM B;  5B1A B;  5KHG A;  3L74 H;  2CE4 A;  1P49 A;  2ZIN A;  5E1A C;  5CB4 A;  2LW7 A;  5CA3 A;  2H3O A;  1KP3 A;  4I50 A;  1BGY H;  2YUA A;  2GUZ B;  2H8P C;  1YTF B;  4JAS A;  4FLT A;  4O4I A;  4P9P A;  4NVP A;  5JQG B;  1SZX A;  5LXT B;  3JCZ A;  1N36 B;  4Q20 A;  4JI1 B;  1SC5 B;  1M57 B;  5B66 Z;  1VF6 C;  1YCI A;  3BFR A;  5LYJ A;  1KEC A;  1VQK V;  2OYQ A;  1VQ4 V;  4LC1 A;  2JK5 C;  1R73 A;  2WA3 A;  2ZE8 A;  5J2U A;  3CCE V;  4JZG A;  5B1O A;  4GT1 A;  3KKY A;  3RYC B;  2IJI A;  3ZMU A;  2ZCE A;  3VQY A;  2ADQ B;  2ZM6 O;  1IVS A;  3ZBH A;  3RVY A;  1B06 A;  3STZ C;  3ABL B;  2Y0I A;  1AP5 A;  4TQF A;  1JR9 A;  1SZT A;  3K5O A;  1BT8 A;  1Y66 A;  2ILM A;  5EYP B;  4G28 B;  1BSM A;  4DR3 O;  3STL C;  4BWA A;  1IBM O;  4LF9 O;  2UXC O;  3WB0 A;  2QM8 A;  4WCE V;  1SA0 A;  3K08 A;  4CC5 A;  1ZSP A;  2F4V O;  4NTX A;  2L6L A;  4TV8 B;  4LBE C;  3VQV A;  2X6A A;  4PDM A;  1DF5 A;  1YDX A;  1N34 O;  2KKW A;  1K4D C;  3T4Z A;  4O4J A;  5L3C A;  4DYL A;  1S72 V;  2JS3 A;  1P4R A;  1HNW O;  4QE7 A;  1N8R W;  5C8Y A;  2YXH A;  3BEH A;  4DW1 A;  3JAL A;  1TA8 A;  5CBF A;  4JI5 B;  4FVM A;  5IYC O;  2R9R B;  1RSO B;  5LOV B;  3CHX A;  1P7B A;  2EUL A;  1MZF A;  4FZ1 A;  3SPI A;  4LCU C;  1AI7 A;  4WFF A;  2ODM A;  3W7T A;  3OE7 G;  1VEW A;  4X65 O;  5FL7 G;  1E79 G;  1HDJ A;  4GX5 A;  4C7U A;  1NU1 H;  1XOU A;  4QIW F;  4D7S A;  5GW7 A;  3UT5 A;  1YF2 A;  4UVA A;  1UJW B;  4DUY O;  3DTU B;  1ZL8 A;  5H5N A;  4AI8 A;  3ZMS A;  4UCO A;  3KCX A;  1WJZ A;  4NTW A;  5H9C A;  3UKM A;  3OMI B;  3ZCC A;  1K4C C;  3W7U A;  1M93 A;  1EZJ A;  1XHX A;  4MTX A;  4GCZ A;  2JIZ G;  3E8F A;  3CCJ V;  3BHP A;  2EIM C;  1ORQ C;  3SYC A;  3L71 H;  4PV1 B;  1NQT A;  4PDL A;  4EB6 B;  3SDL A;  4DR1 O;  4J7J A;  2D2C B;  2L35 A;  1J5E B;  3CEI A;  3ZRS A;  3JAM N;  4F6R A;  2EIK C;  2IJJ A;  3CCR V;  2F43 G;  3RYH B;  3JAK A;  3QF7 A;  2W0X A;  1AJP A;  3LUT B;  3OD4 A;  4IHJ B;  4OX9 B;  4F6E A;  4LF8 B;  2WLL A;  3DGE A;  3A8T A;  4LFB B;  4CS4 A;  3BCC H;  5KMG B;  2JRI A;  1ZWI C;  3TCU A;  2QKA A;  2K9P A;  4XDK A;  4X1Y B;  3ZMT A;  1Y74 A;  1VF7 A;  2JJ1 G;  4FLU A;  3BY6 A;  2WLI B;  2FTK A;  3H1L H;  3SYP A;  1TUE B;  5EIB D;  4AQY O;  2QM4 A;  3LSU A;  3E8G A;  4EEQ A;  2ZE5 A;  2FYU H;  2W6J G;  3Q4H B;  1Q90 D;  4YJ2 B;  4TWK A;  3ZRW B;  4ZHQ B;  4O4H B;  3N2K A;  1FXK A;  3LSQ A;  4FM0 A;  4KP4 A;  5D5P A;  3U11 A;  4JGS A;  4UUJ C;  3CCU V;  4E4E A;  2GDS A;  4J41 A;  3RWR D;  4LF7 B;  4MW8 A;  4LNU A;  1W0K G;  4BAY A;  1OCZ C;  1K92 A;  1XI1 A;  4O2B A;  5K1P A;  2HVJ C;  4I5S A;  2Y69 C;  5IWA O;  2Q6A A;  5K1X A;  4DUZ O;  5JH7 A;  2Q0A A;  1I5Y A;  3OAA G;  2QR4 A;  4UCR A;  1H2M A;  5E79 Z;  5LA6 B;  1SES A;  3N2G A;  2A9H A;  3QG5 A;  1D5N A;  3CXH F;  4FJC C;  2CUG A;  2LO1 A;  5DN6 G;  4PA3 A;  2EIK B;  1GN2 A;  2Q67 A;  5IYZ B;  3HPL C;  5JCO C;  1IBL O;  3CRA A;  2YID A;  4H37 A;  1Y4M A;  2RMK B;  1HNX O;  4NXN O;  2GSM B;  4DV0 O;  2ZM6 B;  1MAB G;  3SGI A;  1VMG A;  4FLX A;  4ABM A;  1AJQ A;  2QKC A;  4L87 A;  3BAA A;  3WB2 A;  5IJ9 A;  3DXR B;  5JWP A;  1XEQ A;  2IBZ H;  2CTR A;  2DWE C;  3E22 A;  3KCY A;  1BL8 A;  4FLZ A;  2ZQM A;  3F5T A;  2XAG A;  4QJF B;  2QM7 A;  4DR3 B;  2YSU B;  1IBM B;  4FMT A;  3S3W A;  4LF9 B;  4O4J B;  1FKA O;  3TGU H;  3X2Q C;  4JI1 O;  2F4V B;  2GUZ A;  3PJS K;  2QSA A;  4JPR A;  3HR0 A;  5KAF Z;  1K5Q A;  2E76 B;  1N34 B;  5JQG A;  2YIB A;  4WF9 V;  5LXT A;  1QNM A;  3W7S A;  3ZED A;  4JI4 O;  1S0V A;  4PEL A;  1V55 C;  1E1Q G;  1HNZ O;  2ZR2 A;  2AZ2 A;  1HNW B;  1FXK C;  1JMK C;  3L72 H;  2BTQ B;  4JYY A;  1YJN V;  4J7Z A;  1PL4 A;  3NXS A;  4I7Z B;  2Q8V A;  2ARH A;  1FFX A;  2Y0P A;  3RYC A;  3H01 A;  2H94 A;  3B8M A;  4X64 B;  3SYA A;  4LFA O;  1NH2 D;  3CD6 V;  3I55 V;  3SPH A;  4X65 B;  4EKW A;  2YIC A;  4YHH O;  3T1C A;  1VAR A;  3P3P A;  2YC0 A;  2CAZ C;  2XHB A;  4DUY B;  2DYS C;  1QVG U;  3K5N A;  4HAM A;  1VIB A;  5FPO A;  3AG4 B;  1FXV A;  4R6Z A;  4UV8 A;  5EYP A;  3ABK C;  3OMA B;  1F7Y A;  4U3J B;  2EIJ C;  1W2B U;  5BR8 O;  1DGS A;  4TV8 A;  5EBM C;  1SRY A;  4BW5 A;  2OIG A;  4IIJ A;  3KZI Z;  4DR1 B;  4DV7 O;  4KHP O;  2JEU A;  1VQO V;  4NB5 A;  3TK1 A;  1WNS A;  1XUQ A;  4WFH A;  4UCS A;  1OV9 A;  3CME V;  1NVP D;  1RM1 C;  2ATK C;  3X2Q B;  2OT5 A;  3G6B A;  3F7V C;  3QO7 A;  1FJG O;  3D8C A;  1H38 A;  5KX5 B;  3MDS A;  2LGW A;  1RSO A;  5IJ0 B;  1Z5W A;  4DK1 A;  3IC7 A;  1G1X B;  2Q0O C;  4IT5 A;  3SYO A;  1M5I A;  1QQC A;  2RCV A;  3CS5 A;  1V55 B;  4FM2 A;  2ZDI C;  4WFB V;  1FXK B;  3HB3 B;  2XAH A;  4UB6 Z;  1T5E A;  1H2L A;  2UU9 B;  4AQY B;  1EZV H;  1FS0 G;  4CBC A;  1J95 A;  1FXH A;  1M57 C;  1XL6 A;  3M99 B;  2Q9L A;  1ARO P;  2CTQ A;  2PUS A;  3B40 A;  5KHK A;  1J5E O;  2R9I A;  2XTA A;  4LNU B;  2HJF C;  4JYC A;  1FYJ A;  2HFE C;  5DEC A;  2QKS A;  3SPG A;  1YHQ V;  3RW0 A;  2E74 B;  4BW9 A;  2UXN A;  2Z0A A;  4UVB A;  3ZHU A;  1AR4 A;  1H2G A;  2EIN C;  4J11 A;  1Y76 B;  3QTC A;  3ABK B;  3SR2 C;  3N2G B;  1NBM G;  3RYH A;  5IWA B;  1Q8I A;  1JJO A;  3P32 A;  1LR1 A;  2DWD C;  4JAA A;  4IYH A;  4IHJ A;  3ABL C;  4ZKI A;  2AGA A;  4DUZ B;  1XDC A;  3FD9 A;  2PI4 A;  2OTJ V;  3SPJ A;  2JVD A;  3JAS B;  2EX3 A;  1Q6H A;  5KMG A;  4JI3 O;  1FPO A;  4TQD A;  5JJN B;  4X1Y A;  2QE7 G;  4MTO A;  4FIP C;  1LUW A;  1GO3 F;  4U7O A;  4OPA A;  1TGO A;  1IBL B;  2JGD B;  1GH6 A;  2Z5U A;  2WLI A;  3T2M A;  2Q7G A;  3JD2 A;  5LBQ A;  1Q86 W;  1PL0 A;  1HNX B;  1RM1 B; 
#chains in the Genus database with same CATH homology
 1VF6 C;  1Y76 B;  1Y74 A;  1VF6 A;  3B40 A;  1ZL8 B;  1ZL8 A;  1RSO B;  1Y74 B;  1Y76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...