1ZL8A

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
GSLNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
molecule keywords LIN-7
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8A00
1VF6A 1RSOB 1Y76B 1Y74A 1ZL8A 1VF6C 3B40A 1Y76A 1Y74B 1ZL8B
chains in the Genus database with same CATH superfamily
4TUYB 2A7WA 3LSUA 4JI3O 1EFRG 3EHBB 2XAFA 3CJHA 3H1HH 4DR2O 2FTKA 4JI4B 5LYJA 3JCUZ 1NTZH 1R3IC 5BR8O 1TAEA 3JSNA 3OAAG 1VMGA 3CC4V 4DR7O 4KUMA 1HW7A 2DYRC 3RT3C 2Z3YA 3JD2A 4LF5O 5LP6C 1WPXA 1K33A 5B1BB 2KQXA 4MTXA 2E76B 4PA7A 5LMNB 3K04A 3FKSG 4JAVA 3FAVA 5EBMC 4J7ZA 4QE7A 3VQXA 2ATKC 2M7WA 1JA8A 2E75B 4WFBV 2PUSA 2OTLV 1E79G 2YIBD 3RFRA 1Z5VA 2ADPA 2EIJC 1FPOA 4F6RB 5IYZB 3UM7A 3W7TA 1EM1A 1LNQA 5B66Z 3AG1C 3BRCA 2ZDIC 1BGYH 2JVDA 2EIMC 4GKKO 4NXNB 3AEIA 3WB2A 3Q4HA 4IGGA 2YIDA 3CCUV 2MK3A 2R9AA 1AI4A 4AI8A 4FK5C 1Q5OA 4R7CA 3VBBA 1EN4A 5HFLA 1YDXA 4LH7A 2F23A 2R70A 1QCEA 4JI7B 4JZGA 1SQBH 3K5MA 4QJFB 2X6CA 4NR1A 3LSQA 3SJCC 1SZXA 2VQFO 1FAFA 3ZX6A 1JJOA 4H37A 3SPIA 2ZE8A 3BHPA 5B3SB 2QDOA 1R73A 2UXBO 3RYHB 1XNQO 4BIOA 1OCZC 2NN4A 3PJSK 5LHGA 3X2QC 3DGEA 3RW0A 2Z0AA 4WCEV 3DC6A 3ASNC 3ZHUA 1PNMA 1WLEA 2IJHA 2A3QA 5J9PC 5KHIA 4MSWC 2N04A 2N74A 2LW1A 5JJNB 2P22C 3WB1A 3EXAA 3JALA 3CWBH 1EN6A 1CEZA 1QBZA 3BY6A 2D3OW 3E22A 4FM2A 1NQTA 2HFEC 2ARHA 3IC7A 2KKWA 2CE4A 2EULA 4LF4B 3QO5A 5C8YB 3HKDB 5K1XA 3B40A 1JPXA 2RDCA 4EB6A 1GRJA 1FKAO 3KZIZ 3F5WC 4F4LA 5EC2C 1O9GA 1YJWV 3P32A 3SYPA 2LO1A 3OTFA 2F4VO 2NLJC 4JI8B 1K4DC 4BW5A 2E5LO 4DR6O 4PELA 4GKJB 1Z5WA 4PD4F 3E2EA 5FLXN 4PI0A 3TK1A 3E89A 3RYCA 1XL6A 1YSCA 1B3QA 2ZM6O 2XAHA 2Q6AA 4GLXA 4DV5B 1YJNV 1NT2B 2ZR3A 3ZMZA 3CXHF 4X1IA 2PTMA 2EJRA 4GYCB 1OCCC 3AG3C 3K79A 4NVPA 5LGTA 1VQKV 4DV7B 1K73W 2PI4A 1MSWD 5KAFZ 4X1YA 4U3JA 4IL6Z 1XMOO 3CC7V 4K3AA 4TUYA 2V7QG 1M90W 2CGNA 4DR3B 1J5EB 2X6BA 1VQLV 1KB9F 3OEHG 2QWOB 3OR7C 3CCRV 3CX5F 1JVMA 4YY3B 2KB1A 4Z1MG 4NTYA 1Y74B 4O4LB 4ZI7B 1M56B 1RPRA 3SR2C 1S5HC 4JI3B 2PZSA 2HR3A 2IBZH 1QHTA 3ABKC 1N36O 2RN9A 1MZEA 4ZHQA 2PYLA 4HBNA 1MSDA 2OIEA 3WG7B 3ZCCA 4LR3A 1ZL8B 2HVKC 3D3QA 1WAZA 5BR8B 5IY5B 1GMGA 3FAVB 2GHYA 2F1MA 4JI1B 3CCEV 2V4DA 2ADQB 4KFMA 1G4YB 4BAYA 4BR6A 1QR9A 3HKEB 4YJ2A 2GUZB 3MHSC 3AG4C 1YZBA 1MMMA 5L3EA 1S3JA 2M6YA 3KG2A 1HDJA 2OYQA 2LQTA 1PKXA 3ZRXA 3W7SA 1JFFB 3TETA 4IT5A 5FPRA 2Q73A 2ZR2A 2XASA 3JCZA 1OCOC 4O4JA 4UV8A 3ZRSA 1PP9H 4X66B 3J7AU 1WP8A 4GX5A 2YEVB 2ITDC 5C8YA 3SPJA 1QQCA 2IU0A 5KHHA 3E8GA 3JAKB 3T4ZA 4GX1A 2RQ6A 2YI8A 4UVCA 3MD0A 2HHHO 4GCZA 2QR4A 2CTRA 1GN3A 2K9PA 2XNDG 1F7YA 3OW2U 3JAWA 3LNMB 4I4TB 2Y48A 1CPYA 2DW4A 4J9YB 3FB8C 1BL8A 4DV1B 4NXMO 3ZMSA 2QSAA 5J2UB 4B3MO 2XT9A 4OX9B 1VQPV 1YI2V 2HJDA 1NKDA 5CA0B 1ZL8A 2YICA 2UXNA 5CA3A 4I0XA 2X0LA 1HWYA 1R6NA 2ZDIA 3FB7C 3RN4A 4RO2A 4UUJC 1NS1A 2NNUA 3JARA 5EYPB 3CRAA 3F5TA 3SJQC 2OCCC 4X1KB 1T5EA 5IYCO 2BTOA 3CSXA 3I55V 2UXCB 2Y69B 4DV3O 1IXBA 1EBOA 3D3IA 3QG5A 2DWEC 1JX9A 1JCHA 1VF6A 1FXKC 2VQEO 1VQ8V 1AI7A 4UB8Z 4MVSA 3D8CA 4CS4A 4IIJA 4UVAA 5CA1B 3SPCA 1US6A 4K0KO 4TOIA 1E1RG 3WU2Z 5LMUB 2ZCEA 4DUZO 1YJ9V 1Y6XA 2XAQA 4DUYO 1KD1W 4IHJA 1MZFA 5EK0A 1FJGO 1IVSA 2YEVA 3FX7A 1HR0O 2HG5C 1SQFA 1YTFB 4AILC 2Y4TA 4UCVA 2JIZG 1FD9A 3OR6C 1XHXA 4MTFA 3FFQA 2JRIA 3C90A 4MVQA 2DWDC 1IURA 3OD4A 4AQYO 5B5EZ 2QWNB 4TSFG 1YHQV 2JJ2G 2R72A 4ASUG 1ZUQA 1L0NH 4XDJA 1LUWA 5H6RA 1R1BA 3BA8A 4BW9A 2WA3A 2N05A 4FLVA 5JQGB 3GWKC 1H2NA 4LNUB 1N32B 5C93A 4PDRA 4LF8O 1JJ2U 3U0ZA 1N33O 4X88A 1NI8A 4DK0A 3G67A 4UCSA 4JV5B 1XILA 2EZOA 4ZHQB 4XDLA 1AI5A 3DXRB 1ZLZA 2GBOA 3AG1B 3BAAA 1BS3A 5JH7A 1TUBB 1YIJV 4CH3A 3B8MA 4NTXA 5LHIA 1PD3A 4DR3O 1QVGU 2JJ1G 1G6UA 3ICXA 4JI5O 2YUAA 4W4LA 1Y67A 4R6ZA 1VQNV 5BZBA 2X7RB 3W7XA 1KECA 4JAAA 4B3TO 2HEPA 2GUZA 4JYBA 4G2KA 3ZJZA 2CAZC 2YSUB 2UUBB 5L3FA 1P49A 3WG7C 4N23A 3JATB 3ABKB 4MW8A 1WB8A 1XI1A 3K03A 1VF6C 1ZX3A 1HNXB 4TV9B 4Z2WA 3UQ8A 1IBLO 5TISZ 4D6TH 1L1FA 3HKCB 1VQ7V 5IYBO 3DC5A 2QA4V 1RP3B 4EFBA 4FZ0A 1QLEC 1S5JA 3ZHVA 3L71H 1WB7A 2LGQA 3IAYA 1W0KG 2ZNIA 1H2GA 4DK1A 2JDIG 4CH4A 4FLYA 3H9VA 1NH2B 4DW0A 3QO7A 4QNHB 4ZBMA 4X65B 4FLXA 4J9ZB 2Y69C 3F7VC 3JD4A 4WFAV 2WLLA 3THOA 1VP7A 1TUEB 5LBQA 5IYDO 2OCHA 5H9CA 3ABTA 4DR1O 1R6TA 3ZBHA 1KU9A 4X66O 1KUQA 3CMAV 2R9RB 5LOVA 3E22B 4GUNA 4CS3A 2A0LA 2BE3A 3T1CA 3CE2A 4FJCC 2KG7A 4QIWF 2CUGA 2F93B 1GM7A 4O4HB 3K59A 1GN4A 2OTJV 3W7UA 2DYSB 3UCSC 3JARB 2LP7A 3ETQA 3BPZA 4JI7O 1N4CA 2IW5A 1GAXA 4Q6GA 3UKMA 1WPBA 3EFFK 4MT8A 1THZA 1M1KW 4JPRA 4PA3A 1PV0A 1V54C 2YDEA 4FMTA 3O9OA 5LYJB 3QTCA 4LNUA 3CCLV 2HVJC 3JATA 4B08A 2UUCB 3OE7G 1H8HG 1CXZB 1BQ0A 3QVNA 3ZN0A 1YTFD 1W59A 4DV2B 4O4IB 4F6EA 4LF6O 2PF4E 2OCCB 4GX0A 2UXCO 3TCUA 3ZN1A 1Y76B 3RVZA 4UCUA 3N2GB 3B09A 4MVZA 4JTDB 5FPOA 4B7KA 4LFBB 3CRCA 2ODMA 3BA9A 1Q6HA 4NTWA 2HKOA 1AI6A 5EZYA 2Y4UA 2LW7A 3RYIB 2ILMA 3CMEV 1Y4MA 3ZRWB 5JVDA 4LFAB 2IJJA 2B9ZA 2EINC 4YIOA 1I0HA 3F7YC 4IIJB 1ORQC 2WLHA 2PGGA 4X8AA 3D36A 3BABA 2XTAA 2ZIOA 1XBLA 4FFBB 2P7TC 4UFZA 4RUEA 1BSMA 1YF2A 2F4VB 5JCOA 2C2AA 1Q3EA 4GX2A 4P9PA 4DR6B 3PN1A 1QNMA 2LFRA 2RJZA 3CCJV 3DTUB 5F2VO 1WJZA 1HP8A 1MA1A 3J81N 1FXKA 1PNKA 4WFHA 1SS3A 2UXXA 2BCCH 3LDEA 2Q7GA 3ZMTA 4DW1A 4DV5O 1MG1A 5GONA 1Q81W 1WA8B 4DV0B 1DK1A 4O2AB 4O4JB 1UPGA 2QWRB 2DOSA 3TGUH 1K34A 2H94A 2UU9B 2QKAA 4X62O 4DRXA 3K9AA 3BEHA 1K5SA 2GDSA 2ITCC 2WLJA 4FPPA 5LA6A 2YC0A 1AVMA 4O2BB 2O57A 3FB5C 3C3SA 1XHZA 1J5EO 1Y76A 2ZQMA 3O65A 5JJJB 1YEWA 2P4KA 5CA1A 2HJFC 4YY3O 3FB6C 5GTIZ 4AHCA 3H01A 1N0JA 5LXTA 3JSLA 1VARA 4J42A 4DR4O 3T1HO 3JD0A 2E3CA 1URFA 2UUBO 4PDLA 1SZTA 2UUAO 2UXDB 3CXCU 2UXBB 1BQZA 2CK3G 3TXQA 5CA0A 2ZE5A 4PI2A 1L8DA 1VF7A 1S0VA 4I0XB 5B1AB 5AG2A 3D36C 5EC1C 1N0NA 4UCTA 2F66C 3LSSA 1Y74A 5LGNA 1BCCH 1RPOA 4Q20A 2EJ7A 3CEIA 4FIPC 4QPJA 4KL1A 4BWAA 3OUFA 2PI5A 3A0HZ 4X64B 1IDSA 4EFEA 1QLNA 1GM9A 4B3SO 3SYOA 3JASB 4OGQB 5LOVB 1IBKB 4UCRA 5CBGA 2PYJA 1Y66A 3H1JH 3UT5A 1PPJH 2QKSA 2JGDA 3OMNB 5KX5A 4E2LA 5E79Z 3ZHTA 1AB3A 5L3BA 3S3WA 3ASOC 1NZ6A 2Q9LA 2VRZA 4WBNB 1VQ9V 2P06A 2F95B 4JI0B 4BIUA 4G28B 5JVDB 4LF4O 2VQFB 1TUBA 4W4KA 3RGBA 1WP7A 1R3KC 1YCIA 1JR9A 1M93A 5KMGA 1Q82W 1D2DA 1VQ5V 2JS5A 2B5UA 1G1XB 3IJ4A 2QKCA 1K9MW 3ABLC 4RUFA 2W0FC 1NVPB 3OMIB 2WLLB 1V55B 4DR5O 4DV1O 1KYOF 1NBMG 5EIBC 4CH6A 4NXMB 5DECA 2LJ2A 5IJ0B 1QLEB 2A06H 1F51A 1V9PA 2YS8A 5JJEB 4LF9O 1VQ4V 1AJQA 2ZE7A 2NR5A 1LUVA 1KP3A 2WA4A 1BHBA 4J7KA 4TV9A 3OTOO 5GTHZ 2EILC 3LUTB 3N2GA 5KA5A 3FYEB 3K5LA 1AJPA 1KP2A 3A8TA 3HKBA 4PHZA 1NJIW 3IFXA 4DYLA 4TWKA 1AR4A 2RNBA 2JEUA 1K5QA 4IYIA 1NR7A 2P4VA 3KCXA 4K8ZA 5LA6B 1P4RA 2WLIB 3ASOB 1SQVH 3E8HA 5KX5B 3HKEA 1GTOA 4JI6O 3JASA 3HB3B 3JYCA 3OGCC 1KKDA 2VQEB 2QEXV 5IYZA 4YJ3A 4B3RB 1AR5A 1K97A 5BY1A 3NXSA 4JI8O 2QWPB 3MDSA 4J11A 4H33A 1IBMB 3HR0A 1VEWA 4MW3A 2DN9A 1N36B 1FFXB 4X9QA 4HNAA 2JK5C 2P5OA 1K92A 2JS3A 4LWSA 2L6LA 1FXKB 4PDMA 3LDDA 1P84F 1TVKA 3R65A 4JI2B 4JI1O 4DV7O 3CP1A 3AG3B 1N8RW 5IWAO 3ZEDA 5B1OA 5LL6Y 3SJAC 4N21A 5DM6V 5D5PA 2YIBA 3I5DA 3QNEA 1AR1B 4U7NA 5J2TB 1ENVA 1N33B 4D7SA 5KHJA 4GT1A 1RFYA 4DV0O 4DV4O 5KA6A 3N2KA 1Q43A 1AJNA 1NU1H 3K5OA 5CB4B 3L9DA 4YHHO 2W6JG 5B3SC 3VQYA 1FS0G 3UO2A 4DR2B 2HP8A 5KUMA 3H1KH 1HNZB 5LXTB 5GONB 1ZTEA 4GKKB 4X1KA 2BSKA 4NXNO 1VIBA 4R8CA 1I5XA 5JWPA 3CRRA 2VWJA 1XNRB 4HAMA 2OIGA 1M5IA 1M9NA 4OPAA 1I94B 2Q0AA 3WFVA 1B04A 3AK3A 4FLWA 3CPWU 1N34O 4J41A 2RCVA 1XREA 2DQ3A 2BTQA 2Q5ZA 5GW7A 4CC5A 2QJ1A 4X20A 4XDKA 4DR4B 1WN7A 1E1QG 3AG7A 1I7FA 3T1HB 4MVOA 5EBWC 2UXDO 1XNQB 4I7ZB 2IJKA 2QM4A 4Z1VA 1Q90D 1HNXO 4TV8A 1G8MA 1XMQB 4EKWA 4KHPB 3ZHRA 4B7EA 2DJVA 3CB2A 3KCYA 1EZJA 2IH3C 4PA4A 3SJBC 3CJHB 2EINB 4LF7B 1KQSU 4E4EA 1GH6A 5A9GA 1VF5B 3X2QB 4X64O 2EIKB 5B1NA 5CN0A 2W6IG 3RBZA 5CB4A 1DTOA 4PDVA 4DV3B 1SQPH 3A2FA 1OCRB 1OCRC 1XL4A 1D5NA 3K58A 2AZ0A 2EZPA 1M57B 2HHHB 2JEXA 3CC2V 2Q4PA 3JALB 3L72H 3HKDA 4DR1B 1AP5A 2ZIMA 1UFIA 5B1BC 1X59A 5ITZA 3CRMA 2QM8A 2YIAA 4X1IB 2DYRB 4DV6O 4O2BA 4NYKA 1FJGB 5IE9A 4B3MB 1HR0B 3NR7A 5LP6A 1S77D 2FB5A 2GSMB 4P30A 1GN6A 1EZVH 4IYHA 4JASA 4FLZA 3SYQA 4J10A 2Y0PA 1VQMV 2H8PC 4CBCA 1OJHA 1F4MA 5DN6G 2QWQB 3SDLA 1Q6UA 5IJ9B 2BTQB 4ZKIA 4P2ZA 1DF4A 2YI9A 5KUKA 4LF9B 5BMVB 3STLC 2LGWA 3E35A 3JAWB 3JAKA 3OMAB 2KG7B 4LF8B 5KMGB 4K35A 4CZZA 3B8NA 5J2TA 4MVRA 3CHXA 3B77A 1PL0A 2OWOA 2F43G 4J7JA 5LMUO 1SA0B 4JV5O 4BIZA 4DV2O 4DUYB 2GV9A 5CBFA 5HFMA 2AXTZ 1B6QA 4JI4O 3MHHC 3K3WA 3JD3A 1Q7YW 3G80A 2VWKA 2VS0A 1BT8A 5CMUA 1VQOV 3ABMB 3CRQA 2Q0OC 2OT5A 2R9IA 4O4LA 1B06A 3MAQA 4KXRA 3P3NA 2W0XA 5IT9N 1M56C 1ROPA 2E5LB 4LF5B 4F6RA 3SPHA 3WB0A 3ZIAG 4GKJO 4PJ0Z 3U11A 1XDCA 1IBMO 4FLTA 2DQ0A 4H44B 2HLDG 3STZC 4YJ3B 1NTKH 5IJ9A 2WWWA 3G6BA 2V1DA 1V54B 3OEEG 1P7GA 1HNWB 4WFEA 1COWG 2P67A 4JI2O 1K8AW 4KP4A 3EVKA 2AHZA 2BSKB 4LBEC 4ZOLA 3AK1A 5IWAB 3CS5A 4UCOA 4P9OA 4JAUA 5IDJA 3RYFA 2P6JA 4IHJB 3ZMVA 2FYUH 1M57C 1YXBA 1JFFA 1RM1C 3N27A 2B1IA 4OXSA 1KMIZ 2WPDG 1OZ0A 4OPHA 4LWSB 2EBOA 2Q68A 4FZ1A 3G4SV 1R3LC 1OCZB 2YXLA 3ZHQA 5BXZA 4YXWG 2Y0IA 4WFGA 5EBLC 4YHHB 4LH6A 2GTAA 1IXMA 1BHAA 1MNGA 3E86A 1TGOA 3ABUA 2AW9A 2A79B 2QGNA 4ICGA 4LFCO 1GO3F 3UT5B 1HNZO 3T1YO 2B1GA 2EILB 3ZHSA 5H2FZ 3G71V 1XNRO 2P90A 3L73H 3W7WA 2L35A 1UJWB 1TA8A 1N34B 5D5QA 5JH7B 3LNNA 2ZNJA 3VQWA 1IX9A 4J80A 5IJ0A 2BOCC 4EEQA 4A5UB 5J2UA 3CCSV 4RAIA 3U10A 2IU3A 3HPLC 4MVUA 3ZRWA 1NTMH 5L3GA 3ABMC 3H1LH 4I4TA 5LHHA 3OM3B 1I5YA 3R66A 4TQFA 2QTOA 2RMKB 4QGPA 4YIPA 1OCCB 3K0GA 1M4UA 5ITZB 1MABG 1AROP 2XUMA 5E1AC 1JMKC 2WSSG 1SESA 4FFBA 4JYAO 3ABLB 2BOBC 3ETDA 4D7TA 1SF9A 3Q4HB 3G6EV 4ZOLB 4X20B 4H13B 2IH1C 1ZWIC 3T2MA 4O4HA 3T4DA 3HKBB 1K3EA 2ZE6A 1NVPD 4X89A 3RYFB 3APQA 3SYAA 2Q7HA 3N2KB 2K1EA 4MVMA 3BCCH 1SQXH 2WLIA 3FD9A 1ZAUA 5DEDA 3KKYA 3ZRVA 3HKCA 2DMXA 1GN2A 1PNLA 3DXRA 2WLNA 1H2KA 1XUQA 2IM9A 2EIJB 1XOUA 3M7MX 4DV6B 4YJ2B 1QR8A 2AHYA 1MOFA 4OX9O 1GM8A 1X4TA 3OGIB 2EIMB 4FM0A 3RYHA 1TVKB 5BMVA 4JGSA 3OUSA 4I55A 1PM9A 4WFFA 3K0DA 4I5SA 1J95A 4LCUC 1AILA 2QTSA 2ZXWC 3APOA 4DO2A 4I50A 3OT7A 4MS2A 4LP8A 3E8FA 4RQFA 2XHBA 2H3OA 5JQGA 1SETA 1GKFA 3RVYA 1DF5A 4LF6B 2FL4A 3C3TA 1Z2GA 4NB5A 1N32O 1AP6A 3OTOB 2DYSC 5KHGA 3RYIA 5LP6B 4JYYA 1A32A 1R6KA 3ETGA 1H2LA 1R3JC 5IY5C 2UU9O 3SGIA 4DUZB 1L0LH 3P3PA 4HYOA 1EN5A 4RWUA 2G38A 1YITV 4TQDA 3BFRA 3GVMA 3B2EE 3AG2C 3AG2B 1H2MA 2JGUA 1F23A 1PL4A 2Q69A 1IZ3A 4PV1B 2YXYA 4MTGA 5FNVA 3CD6V 5KAIZ 4O4IA 4DR7B 3K57A 4B3RO 1BMFG 2CDYA 4B3TB 2A9HA 1GK9A 4JTAB 5EYPA 1Q8IA 1V55C 2XOKG 5LMNO 2IJIA 2GTSA 2Q67A 2UUAB 3GB7C 4LC1A 3CCMV 3K5NA 5EIBD 3IC9A 2CGOA 3QO8A 4ABMA 1K7DA 3K08A 1HNWO 3CYOA 4I55B 1CP9A 1KBHA 5LGUA 4CH5A 1DGSA 3J80N 2ZT9B 5KHKA 1DLBA 1SRYA 1XEQA 4JZ2A 1U96A 1FFXA 5H5NA 5JCOC 4X65O 3GWOA 4EB6B 2Q8VA 4JI5B 4ZI7A 2CH7B 1IBKO 1P7BA 1FXHA 1D5AA 4QPKA 4DV4B 4PA6A 1FFTB 2ZINA 4CC6A 1SA0A 1F4NA 3L74H 1I08A 2X6AA 4JI0O 2FKXA 4G27B 2CTQA 4GZRB 4LFCB 1KC8W 4TT3G 1WA8A 3T1YB 2PY5A 3JD1A 4UXNA 1BZKA 3RYCB 3ZS8C 1Q86W 1S76D 4UB6Z 4DRXB 4I9WA 1I94O 1IBLB 1BE3H 4RQEA 2LFSA 2XAGA 3FYIB 3SPGA 3M99B 3CCVV 4JTCB 2ZD9A 1XQ8A 3IGAC 3L70H 3DSQA 1SKVA 3B4SA 5L3CA 3A0RA 1LR1A 4QE9A 3AK2A 3P30A 2EX3A 4B3SB 1OV9A 1SC5B 4HNAB 2E74B 4ZIBA 4L8JA 1RSOB 2ZXWB 1OHHG 2UUCO 3E83A 1XMQO 1QU7A 2WAMA 5CBHA 1SQGA 4KHPO 4JYAB 4XBFA 2CTWA 4FM1A 2YXHA 4K0KB 4CS2A 1H8EG 3LDCA 1VQ6V 3OFNG 4LF7O 1FYJA 4FFKA 2JGDB 1WNSA 3I56V 2AGAA 2D2CB 4WF9V 2AZ2A 3VQVA 3S3XA 1K4CC 1O9HA 4NKGB 5EZYB 1QVFU 2CTPA 5K1PA 3VOUA 4LFBO 3BVOA 4O2AA 3AG4B 4TV8B 5FL7G 1W0JG 4K8XA 3E8BA 3TJTA 4X1YB 4U7OA 1W2BU 2ETNA 1H38A 2QE7G 1Q6IA 3L75H 4AQYB 4DXWA 1JOYA 4DR5B 3ML0A 1YVWA 2ZKOA 3K06A 4MTOA 5A2QN 1H2SB 3H1IH 4LFAO 4JF3A 1JQ0A 2QM7A 4UV9A 4L87A 4I50B 1RM1B 2FMLA 1SERA 5KLVH 2XAJA 2Q7EA 2ZM6B 4U3JB 3A0BZ 3RWRD 3ZMUA 3QF7A 2Z5UA 3ETEA 3ASNB 1ZSPA 4UVBA 5H6QA 2MW2B 1S5LZ 1S72V 1NR1A 4JYCA 3JAMN 1U97A 4R50A 1KKCA 4HZ3A 5L3DA 2EIKC 4WBNA 1XMOB 4U3FH 1FXVA 3UO3A 2DE0X 4PA9A 5FNVB 2WLKA 3K9SA 4JI6B 4FLUA 4C7UA 3M8AA 1NH2D 4FVMA 2KSDA 2CH7A 3SYCA 1OCOB 1RSOA 3TXSA 4H0LB 1SQQH 5B1AC 3CCQV 2WLMA 4I9QA 4X62B
chains in the Genus database with same CATH topology
1VF6A 1RSOB 1Y76B 1Y74A 1ZL8A 1VF6C 3B40A 1Y76A 1Y74B 1ZL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF6 A;  1RSO B;  1Y76 B;  1Y74 A;  1ZL8 A;  1VF6 C;  3B40 A;  1Y76 A;  1Y74 B;  1ZL8 B; 
#chains in the Genus database with same CATH topology
 4TUY B;  2A7W A;  3LSU A;  4JI3 O;  1EFR G;  3EHB B;  2XAF A;  3CJH A;  3H1H H;  4DR2 O;  2FTK A;  4JI4 B;  5LYJ A;  3JCU Z;  1NTZ H;  1R3I C;  5BR8 O;  1TAE A;  3JSN A;  3OAA G;  1VMG A;  3CC4 V;  4DR7 O;  4KUM A;  1HW7 A;  2DYR C;  3RT3 C;  2Z3Y A;  3JD2 A;  4LF5 O;  5LP6 C;  1WPX A;  1K33 A;  5B1B B;  2KQX A;  4MTX A;  2E76 B;  4PA7 A;  5LMN B;  3K04 A;  3FKS G;  4JAV A;  3FAV A;  5EBM C;  4J7Z A;  4QE7 A;  3VQX A;  2ATK C;  2M7W A;  1JA8 A;  2E75 B;  4WFB V;  2PUS A;  2OTL V;  1E79 G;  2YIB D;  3RFR A;  1Z5V A;  2ADP A;  2EIJ C;  1FPO A;  4F6R B;  5IYZ B;  3UM7 A;  3W7T A;  1EM1 A;  1LNQ A;  5B66 Z;  3AG1 C;  3BRC A;  2ZDI C;  1BGY H;  2JVD A;  2EIM C;  4GKK O;  4NXN B;  3AEI A;  3WB2 A;  3Q4H A;  4IGG A;  2YID A;  3CCU V;  2MK3 A;  2R9A A;  1AI4 A;  4AI8 A;  4FK5 C;  1Q5O A;  4R7C A;  3VBB A;  1EN4 A;  5HFL A;  1YDX A;  4LH7 A;  2F23 A;  2R70 A;  1QCE A;  4JI7 B;  4JZG A;  1SQB H;  3K5M A;  4QJF B;  2X6C A;  4NR1 A;  3LSQ A;  3SJC C;  1SZX A;  2VQF O;  1FAF A;  3ZX6 A;  1JJO A;  4H37 A;  3SPI A;  2ZE8 A;  3BHP A;  5B3S B;  2QDO A;  1R73 A;  2UXB O;  3RYH B;  1XNQ O;  4BIO A;  1OCZ C;  2NN4 A;  3PJS K;  5LHG A;  3X2Q C;  3DGE A;  3RW0 A;  2Z0A A;  4WCE V;  3DC6 A;  3ASN C;  3ZHU A;  1PNM A;  1WLE A;  2IJH A;  2A3Q A;  5J9P C;  5KHI A;  4MSW C;  2N04 A;  2N74 A;  2LW1 A;  5JJN B;  2P22 C;  3WB1 A;  3EXA A;  3JAL A;  3CWB H;  1EN6 A;  1CEZ A;  1QBZ A;  3BY6 A;  2D3O W;  3E22 A;  4FM2 A;  1NQT A;  2HFE C;  2ARH A;  3IC7 A;  2KKW A;  2CE4 A;  2EUL A;  4LF4 B;  3QO5 A;  5C8Y B;  3HKD B;  5K1X A;  3B40 A;  1JPX A;  2RDC A;  4EB6 A;  1GRJ A;  1FKA O;  3KZI Z;  3F5W C;  4F4L A;  5EC2 C;  1O9G A;  1YJW V;  3P32 A;  3SYP A;  2LO1 A;  3OTF A;  2F4V O;  2NLJ C;  4JI8 B;  1K4D C;  4BW5 A;  2E5L O;  4DR6 O;  4PEL A;  4GKJ B;  1Z5W A;  4PD4 F;  3E2E A;  5FLX N;  4PI0 A;  3TK1 A;  3E89 A;  3RYC A;  1XL6 A;  1YSC A;  1B3Q A;  2ZM6 O;  2XAH A;  2Q6A A;  4GLX A;  4DV5 B;  1YJN V;  1NT2 B;  2ZR3 A;  3ZMZ A;  3CXH F;  4X1I A;  2PTM A;  2EJR A;  4GYC B;  1OCC C;  3AG3 C;  3K79 A;  4NVP A;  5LGT A;  1VQK V;  4DV7 B;  1K73 W;  2PI4 A;  1MSW D;  5KAF Z;  4X1Y A;  4U3J A;  4IL6 Z;  1XMO O;  3CC7 V;  4K3A A;  4TUY A;  2V7Q G;  1M90 W;  2CGN A;  4DR3 B;  1J5E B;  2X6B A;  1VQL V;  1KB9 F;  3OEH G;  2QWO B;  3OR7 C;  3CCR V;  3CX5 F;  1JVM A;  4YY3 B;  2KB1 A;  4Z1M G;  4NTY A;  1Y74 B;  4O4L B;  4ZI7 B;  1M56 B;  1RPR A;  3SR2 C;  1S5H C;  4JI3 B;  2PZS A;  2HR3 A;  2IBZ H;  1QHT A;  3ABK C;  1N36 O;  2RN9 A;  1MZE A;  4ZHQ A;  2PYL A;  4HBN A;  1MSD A;  2OIE A;  3WG7 B;  3ZCC A;  4LR3 A;  1ZL8 B;  2HVK C;  3D3Q A;  1WAZ A;  5BR8 B;  5IY5 B;  1GMG A;  3FAV B;  2GHY A;  2F1M A;  4JI1 B;  3CCE V;  2V4D A;  2ADQ B;  4KFM A;  1G4Y B;  4BAY A;  4BR6 A;  1QR9 A;  3HKE B;  4YJ2 A;  2GUZ B;  3MHS C;  3AG4 C;  1YZB A;  1MMM A;  5L3E A;  1S3J A;  2M6Y A;  3KG2 A;  1HDJ A;  2OYQ A;  2LQT A;  1PKX A;  3ZRX A;  3W7S A;  1JFF B;  3TET A;  4IT5 A;  5FPR A;  2Q73 A;  2ZR2 A;  2XAS A;  3JCZ A;  1OCO C;  4O4J A;  4UV8 A;  3ZRS A;  1PP9 H;  4X66 B;  3J7A U;  1WP8 A;  4GX5 A;  2YEV B;  2ITD C;  5C8Y A;  3SPJ A;  1QQC A;  2IU0 A;  5KHH A;  3E8G A;  3JAK B;  3T4Z A;  4GX1 A;  2RQ6 A;  2YI8 A;  4UVC A;  3MD0 A;  2HHH O;  4GCZ A;  2QR4 A;  2CTR A;  1GN3 A;  2K9P A;  2XND G;  1F7Y A;  3OW2 U;  3JAW A;  3LNM B;  4I4T B;  2Y48 A;  1CPY A;  2DW4 A;  4J9Y B;  3FB8 C;  1BL8 A;  4DV1 B;  4NXM O;  3ZMS A;  2QSA A;  5J2U B;  4B3M O;  2XT9 A;  4OX9 B;  1VQP V;  1YI2 V;  2HJD A;  1NKD A;  5CA0 B;  1ZL8 A;  2YIC A;  2UXN A;  5CA3 A;  4I0X A;  2X0L A;  1HWY A;  1R6N A;  2ZDI A;  3FB7 C;  3RN4 A;  4RO2 A;  4UUJ C;  1NS1 A;  2NNU A;  3JAR A;  5EYP B;  3CRA A;  3F5T A;  3SJQ C;  2OCC C;  4X1K B;  1T5E A;  5IYC O;  2BTO A;  3CSX A;  3I55 V;  2UXC B;  2Y69 B;  4DV3 O;  1IXB A;  1EBO A;  3D3I A;  3QG5 A;  2DWE C;  1JX9 A;  1JCH A;  1VF6 A;  1FXK C;  2VQE O;  1VQ8 V;  1AI7 A;  4UB8 Z;  4MVS A;  3D8C A;  4CS4 A;  4IIJ A;  4UVA A;  5CA1 B;  3SPC A;  1US6 A;  4K0K O;  4TOI A;  1E1R G;  3WU2 Z;  5LMU B;  2ZCE A;  4DUZ O;  1YJ9 V;  1Y6X A;  2XAQ A;  4DUY O;  1KD1 W;  4IHJ A;  1MZF A;  5EK0 A;  1FJG O;  1IVS A;  2YEV A;  3FX7 A;  1HR0 O;  2HG5 C;  1SQF A;  1YTF B;  4AIL C;  2Y4T A;  4UCV A;  2JIZ G;  1FD9 A;  3OR6 C;  1XHX A;  4MTF A;  3FFQ A;  2JRI A;  3C90 A;  4MVQ A;  2DWD C;  1IUR A;  3OD4 A;  4AQY O;  5B5E Z;  2QWN B;  4TSF G;  1YHQ V;  2JJ2 G;  2R72 A;  4ASU G;  1ZUQ A;  1L0N H;  4XDJ A;  1LUW A;  5H6R A;  1R1B A;  3BA8 A;  4BW9 A;  2WA3 A;  2N05 A;  4FLV A;  5JQG B;  3GWK C;  1H2N A;  4LNU B;  1N32 B;  5C93 A;  4PDR A;  4LF8 O;  1JJ2 U;  3U0Z A;  1N33 O;  4X88 A;  1NI8 A;  4DK0 A;  3G67 A;  4UCS A;  4JV5 B;  1XIL A;  2EZO A;  4ZHQ B;  4XDL A;  1AI5 A;  3DXR B;  1ZLZ A;  2GBO A;  3AG1 B;  3BAA A;  1BS3 A;  5JH7 A;  1TUB B;  1YIJ V;  4CH3 A;  3B8M A;  4NTX A;  5LHI A;  1PD3 A;  4DR3 O;  1QVG U;  2JJ1 G;  1G6U A;  3ICX A;  4JI5 O;  2YUA A;  4W4L A;  1Y67 A;  4R6Z A;  1VQN V;  5BZB A;  2X7R B;  3W7X A;  1KEC A;  4JAA A;  4B3T O;  2HEP A;  2GUZ A;  4JYB A;  4G2K A;  3ZJZ A;  2CAZ C;  2YSU B;  2UUB B;  5L3F A;  1P49 A;  3WG7 C;  4N23 A;  3JAT B;  3ABK B;  4MW8 A;  1WB8 A;  1XI1 A;  3K03 A;  1VF6 C;  1ZX3 A;  1HNX B;  4TV9 B;  4Z2W A;  3UQ8 A;  1IBL O;  5TIS Z;  4D6T H;  1L1F A;  3HKC B;  1VQ7 V;  5IYB O;  3DC5 A;  2QA4 V;  1RP3 B;  4EFB A;  4FZ0 A;  1QLE C;  1S5J A;  3ZHV A;  3L71 H;  1WB7 A;  2LGQ A;  3IAY A;  1W0K G;  2ZNI A;  1H2G A;  4DK1 A;  2JDI G;  4CH4 A;  4FLY A;  3H9V A;  1NH2 B;  4DW0 A;  3QO7 A;  4QNH B;  4ZBM A;  4X65 B;  4FLX A;  4J9Z B;  2Y69 C;  3F7V C;  3JD4 A;  4WFA V;  2WLL A;  3THO A;  1VP7 A;  1TUE B;  5LBQ A;  5IYD O;  2OCH A;  5H9C A;  3ABT A;  4DR1 O;  1R6T A;  3ZBH A;  1KU9 A;  4X66 O;  1KUQ A;  3CMA V;  2R9R B;  5LOV A;  3E22 B;  4GUN A;  4CS3 A;  2A0L A;  2BE3 A;  3T1C A;  3CE2 A;  4FJC C;  2KG7 A;  4QIW F;  2CUG A;  2F93 B;  1GM7 A;  4O4H B;  3K59 A;  1GN4 A;  2OTJ V;  3W7U A;  2DYS B;  3UCS C;  3JAR B;  2LP7 A;  3ETQ A;  3BPZ A;  4JI7 O;  1N4C A;  2IW5 A;  1GAX A;  4Q6G A;  3UKM A;  1WPB A;  3EFF K;  4MT8 A;  1THZ A;  1M1K W;  4JPR A;  4PA3 A;  1PV0 A;  1V54 C;  2YDE A;  4FMT A;  3O9O A;  5LYJ B;  3QTC A;  4LNU A;  3CCL V;  2HVJ C;  3JAT A;  4B08 A;  2UUC B;  3OE7 G;  1H8H G;  1CXZ B;  1BQ0 A;  3QVN A;  3ZN0 A;  1YTF D;  1W59 A;  4DV2 B;  4O4I B;  4F6E A;  4LF6 O;  2PF4 E;  2OCC B;  4GX0 A;  2UXC O;  3TCU A;  3ZN1 A;  1Y76 B;  3RVZ A;  4UCU A;  3N2G B;  3B09 A;  4MVZ A;  4JTD B;  5FPO A;  4B7K A;  4LFB B;  3CRC A;  2ODM A;  3BA9 A;  1Q6H A;  4NTW A;  2HKO A;  1AI6 A;  5EZY A;  2Y4U A;  2LW7 A;  3RYI B;  2ILM A;  3CME V;  1Y4M A;  3ZRW B;  5JVD A;  4LFA B;  2IJJ A;  2B9Z A;  2EIN C;  4YIO A;  1I0H A;  3F7Y C;  4IIJ B;  1ORQ C;  2WLH A;  2PGG A;  4X8A A;  3D36 A;  3BAB A;  2XTA A;  2ZIO A;  1XBL A;  4FFB B;  2P7T C;  4UFZ A;  4RUE A;  1BSM A;  1YF2 A;  2F4V B;  5JCO A;  2C2A A;  1Q3E A;  4GX2 A;  4P9P A;  4DR6 B;  3PN1 A;  1QNM A;  2LFR A;  2RJZ A;  3CCJ V;  3DTU B;  5F2V O;  1WJZ A;  1HP8 A;  1MA1 A;  3J81 N;  1FXK A;  1PNK A;  4WFH A;  1SS3 A;  2UXX A;  2BCC H;  3LDE A;  2Q7G A;  3ZMT A;  4DW1 A;  4DV5 O;  1MG1 A;  5GON A;  1Q81 W;  1WA8 B;  4DV0 B;  1DK1 A;  4O2A B;  4O4J B;  1UPG A;  2QWR B;  2DOS A;  3TGU H;  1K34 A;  2H94 A;  2UU9 B;  2QKA A;  4X62 O;  4DRX A;  3K9A A;  3BEH A;  1K5S A;  2GDS A;  2ITC C;  2WLJ A;  4FPP A;  5LA6 A;  2YC0 A;  1AVM A;  4O2B B;  2O57 A;  3FB5 C;  3C3S A;  1XHZ A;  1J5E O;  1Y76 A;  2ZQM A;  3O65 A;  5JJJ B;  1YEW A;  2P4K A;  5CA1 A;  2HJF C;  4YY3 O;  3FB6 C;  5GTI Z;  4AHC A;  3H01 A;  1N0J A;  5LXT A;  3JSL A;  1VAR A;  4J42 A;  4DR4 O;  3T1H O;  3JD0 A;  2E3C A;  1URF A;  2UUB O;  4PDL A;  1SZT A;  2UUA O;  2UXD B;  3CXC U;  2UXB B;  1BQZ A;  2CK3 G;  3TXQ A;  5CA0 A;  2ZE5 A;  4PI2 A;  1L8D A;  1VF7 A;  1S0V A;  4I0X B;  5B1A B;  5AG2 A;  3D36 C;  5EC1 C;  1N0N A;  4UCT A;  2F66 C;  3LSS A;  1Y74 A;  5LGN A;  1BCC H;  1RPO A;  4Q20 A;  2EJ7 A;  3CEI A;  4FIP C;  4QPJ A;  4KL1 A;  4BWA A;  3OUF A;  2PI5 A;  3A0H Z;  4X64 B;  1IDS A;  4EFE A;  1QLN A;  1GM9 A;  4B3S O;  3SYO A;  3JAS B;  4OGQ B;  5LOV B;  1IBK B;  4UCR A;  5CBG A;  2PYJ A;  1Y66 A;  3H1J H;  3UT5 A;  1PPJ H;  2QKS A;  2JGD A;  3OMN B;  5KX5 A;  4E2L A;  5E79 Z;  3ZHT A;  1AB3 A;  5L3B A;  3S3W A;  3ASO C;  1NZ6 A;  2Q9L A;  2VRZ A;  4WBN B;  1VQ9 V;  2P06 A;  2F95 B;  4JI0 B;  4BIU A;  4G28 B;  5JVD B;  4LF4 O;  2VQF B;  1TUB A;  4W4K A;  3RGB A;  1WP7 A;  1R3K C;  1YCI A;  1JR9 A;  1M93 A;  5KMG A;  1Q82 W;  1D2D A;  1VQ5 V;  2JS5 A;  2B5U A;  1G1X B;  3IJ4 A;  2QKC A;  1K9M W;  3ABL C;  4RUF A;  2W0F C;  1NVP B;  3OMI B;  2WLL B;  1V55 B;  4DR5 O;  4DV1 O;  1KYO F;  1NBM G;  5EIB C;  4CH6 A;  4NXM B;  5DEC A;  2LJ2 A;  5IJ0 B;  1QLE B;  2A06 H;  1F51 A;  1V9P A;  2YS8 A;  5JJE B;  4LF9 O;  1VQ4 V;  1AJQ A;  2ZE7 A;  2NR5 A;  1LUV A;  1KP3 A;  2WA4 A;  1BHB A;  4J7K A;  4TV9 A;  3OTO O;  5GTH Z;  2EIL C;  3LUT B;  3N2G A;  5KA5 A;  3FYE B;  3K5L A;  1AJP A;  1KP2 A;  3A8T A;  3HKB A;  4PHZ A;  1NJI W;  3IFX A;  4DYL A;  4TWK A;  1AR4 A;  2RNB A;  2JEU A;  1K5Q A;  4IYI A;  1NR7 A;  2P4V A;  3KCX A;  4K8Z A;  5LA6 B;  1P4R A;  2WLI B;  3ASO B;  1SQV H;  3E8H A;  5KX5 B;  3HKE A;  1GTO A;  4JI6 O;  3JAS A;  3HB3 B;  3JYC A;  3OGC C;  1KKD A;  2VQE B;  2QEX V;  5IYZ A;  4YJ3 A;  4B3R B;  1AR5 A;  1K97 A;  5BY1 A;  3NXS A;  4JI8 O;  2QWP B;  3MDS A;  4J11 A;  4H33 A;  1IBM B;  3HR0 A;  1VEW A;  4MW3 A;  2DN9 A;  1N36 B;  1FFX B;  4X9Q A;  4HNA A;  2JK5 C;  2P5O A;  1K92 A;  2JS3 A;  4LWS A;  2L6L A;  1FXK B;  4PDM A;  3LDD A;  1P84 F;  1TVK A;  3R65 A;  4JI2 B;  4JI1 O;  4DV7 O;  3CP1 A;  3AG3 B;  1N8R W;  5IWA O;  3ZED A;  5B1O A;  5LL6 Y;  3SJA C;  4N21 A;  5DM6 V;  5D5P A;  2YIB A;  3I5D A;  3QNE A;  1AR1 B;  4U7N A;  5J2T B;  1ENV A;  1N33 B;  4D7S A;  5KHJ A;  4GT1 A;  1RFY A;  4DV0 O;  4DV4 O;  5KA6 A;  3N2K A;  1Q43 A;  1AJN A;  1NU1 H;  3K5O A;  5CB4 B;  3L9D A;  4YHH O;  2W6J G;  5B3S C;  3VQY A;  1FS0 G;  3UO2 A;  4DR2 B;  2HP8 A;  5KUM A;  3H1K H;  1HNZ B;  5LXT B;  5GON B;  1ZTE A;  4GKK B;  4X1K A;  2BSK A;  4NXN O;  1VIB A;  4R8C A;  1I5X A;  5JWP A;  3CRR A;  2VWJ A;  1XNR B;  4HAM A;  2OIG A;  1M5I A;  1M9N A;  4OPA A;  1I94 B;  2Q0A A;  3WFV A;  1B04 A;  3AK3 A;  4FLW A;  3CPW U;  1N34 O;  4J41 A;  2RCV A;  1XRE A;  2DQ3 A;  2BTQ A;  2Q5Z A;  5GW7 A;  4CC5 A;  2QJ1 A;  4X20 A;  4XDK A;  4DR4 B;  1WN7 A;  1E1Q G;  3AG7 A;  1I7F A;  3T1H B;  4MVO A;  5EBW C;  2UXD O;  1XNQ B;  4I7Z B;  2IJK A;  2QM4 A;  4Z1V A;  1Q90 D;  1HNX O;  4TV8 A;  1G8M A;  1XMQ B;  4EKW A;  4KHP B;  3ZHR A;  4B7E A;  2DJV A;  3CB2 A;  3KCY A;  1EZJ A;  2IH3 C;  4PA4 A;  3SJB C;  3CJH B;  2EIN B;  4LF7 B;  1KQS U;  4E4E A;  1GH6 A;  5A9G A;  1VF5 B;  3X2Q B;  4X64 O;  2EIK B;  5B1N A;  5CN0 A;  2W6I G;  3RBZ A;  5CB4 A;  1DTO A;  4PDV A;  4DV3 B;  1SQP H;  3A2F A;  1OCR B;  1OCR C;  1XL4 A;  1D5N A;  3K58 A;  2AZ0 A;  2EZP A;  1M57 B;  2HHH B;  2JEX A;  3CC2 V;  2Q4P A;  3JAL B;  3L72 H;  3HKD A;  4DR1 B;  1AP5 A;  2ZIM A;  1UFI A;  5B1B C;  1X59 A;  5ITZ A;  3CRM A;  2QM8 A;  2YIA A;  4X1I B;  2DYR B;  4DV6 O;  4O2B A;  4NYK A;  1FJG B;  5IE9 A;  4B3M B;  1HR0 B;  3NR7 A;  5LP6 A;  1S77 D;  2FB5 A;  2GSM B;  4P30 A;  1GN6 A;  1EZV H;  4IYH A;  4JAS A;  4FLZ A;  3SYQ A;  4J10 A;  2Y0P A;  1VQM V;  2H8P C;  4CBC A;  1OJH A;  1F4M A;  5DN6 G;  2QWQ B;  3SDL A;  1Q6U A;  5IJ9 B;  2BTQ B;  4ZKI A;  4P2Z A;  1DF4 A;  2YI9 A;  5KUK A;  4LF9 B;  5BMV B;  3STL C;  2LGW A;  3E35 A;  3JAW B;  3JAK A;  3OMA B;  2KG7 B;  4LF8 B;  5KMG B;  4K35 A;  4CZZ A;  3B8N A;  5J2T A;  4MVR A;  3CHX A;  3B77 A;  1PL0 A;  2OWO A;  2F43 G;  4J7J A;  5LMU O;  1SA0 B;  4JV5 O;  4BIZ A;  4DV2 O;  4DUY B;  2GV9 A;  5CBF A;  5HFM A;  2AXT Z;  1B6Q A;  4JI4 O;  3MHH C;  3K3W A;  3JD3 A;  1Q7Y W;  3G80 A;  2VWK A;  2VS0 A;  1BT8 A;  5CMU A;  1VQO V;  3ABM B;  3CRQ A;  2Q0O C;  2OT5 A;  2R9I A;  4O4L A;  1B06 A;  3MAQ A;  4KXR A;  3P3N A;  2W0X A;  5IT9 N;  1M56 C;  1ROP A;  2E5L B;  4LF5 B;  4F6R A;  3SPH A;  3WB0 A;  3ZIA G;  4GKJ O;  4PJ0 Z;  3U11 A;  1XDC A;  1IBM O;  4FLT A;  2DQ0 A;  4H44 B;  2HLD G;  3STZ C;  4YJ3 B;  1NTK H;  5IJ9 A;  2WWW A;  3G6B A;  2V1D A;  1V54 B;  3OEE G;  1P7G A;  1HNW B;  4WFE A;  1COW G;  2P67 A;  4JI2 O;  1K8A W;  4KP4 A;  3EVK A;  2AHZ A;  2BSK B;  4LBE C;  4ZOL A;  3AK1 A;  5IWA B;  3CS5 A;  4UCO A;  4P9O A;  4JAU A;  5IDJ A;  3RYF A;  2P6J A;  4IHJ B;  3ZMV A;  2FYU H;  1M57 C;  1YXB A;  1JFF A;  1RM1 C;  3N27 A;  2B1I A;  4OXS A;  1KMI Z;  2WPD G;  1OZ0 A;  4OPH A;  4LWS B;  2EBO A;  2Q68 A;  4FZ1 A;  3G4S V;  1R3L C;  1OCZ B;  2YXL A;  3ZHQ A;  5BXZ A;  4YXW G;  2Y0I A;  4WFG A;  5EBL C;  4YHH B;  4LH6 A;  2GTA A;  1IXM A;  1BHA A;  1MNG A;  3E86 A;  1TGO A;  3ABU A;  2AW9 A;  2A79 B;  2QGN A;  4ICG A;  4LFC O;  1GO3 F;  3UT5 B;  1HNZ O;  3T1Y O;  2B1G A;  2EIL B;  3ZHS A;  5H2F Z;  3G71 V;  1XNR O;  2P90 A;  3L73 H;  3W7W A;  2L35 A;  1UJW B;  1TA8 A;  1N34 B;  5D5Q A;  5JH7 B;  3LNN A;  2ZNJ A;  3VQW A;  1IX9 A;  4J80 A;  5IJ0 A;  2BOC C;  4EEQ A;  4A5U B;  5J2U A;  3CCS V;  4RAI A;  3U10 A;  2IU3 A;  3HPL C;  4MVU A;  3ZRW A;  1NTM H;  5L3G A;  3ABM C;  3H1L H;  4I4T A;  5LHH A;  3OM3 B;  1I5Y A;  3R66 A;  4TQF A;  2QTO A;  2RMK B;  4QGP A;  4YIP A;  1OCC B;  3K0G A;  1M4U A;  5ITZ B;  1MAB G;  1ARO P;  2XUM A;  5E1A C;  1JMK C;  2WSS G;  1SES A;  4FFB A;  4JYA O;  3ABL B;  2BOB C;  3ETD A;  4D7T A;  1SF9 A;  3Q4H B;  3G6E V;  4ZOL B;  4X20 B;  4H13 B;  2IH1 C;  1ZWI C;  3T2M A;  4O4H A;  3T4D A;  3HKB B;  1K3E A;  2ZE6 A;  1NVP D;  4X89 A;  3RYF B;  3APQ A;  3SYA A;  2Q7H A;  3N2K B;  2K1E A;  4MVM A;  3BCC H;  1SQX H;  2WLI A;  3FD9 A;  1ZAU A;  5DED A;  3KKY A;  3ZRV A;  3HKC A;  2DMX A;  1GN2 A;  1PNL A;  3DXR A;  2WLN A;  1H2K A;  1XUQ A;  2IM9 A;  2EIJ B;  1XOU A;  3M7M X;  4DV6 B;  4YJ2 B;  1QR8 A;  2AHY A;  1MOF A;  4OX9 O;  1GM8 A;  1X4T A;  3OGI B;  2EIM B;  4FM0 A;  3RYH A;  1TVK B;  5BMV A;  4JGS A;  3OUS A;  4I55 A;  1PM9 A;  4WFF A;  3K0D A;  4I5S A;  1J95 A;  4LCU C;  1AIL A;  2QTS A;  2ZXW C;  3APO A;  4DO2 A;  4I50 A;  3OT7 A;  4MS2 A;  4LP8 A;  3E8F A;  4RQF A;  2XHB A;  2H3O A;  5JQG A;  1SET A;  1GKF A;  3RVY A;  1DF5 A;  4LF6 B;  2FL4 A;  3C3T A;  1Z2G A;  4NB5 A;  1N32 O;  1AP6 A;  3OTO B;  2DYS C;  5KHG A;  3RYI A;  5LP6 B;  4JYY A;  1A32 A;  1R6K A;  3ETG A;  1H2L A;  1R3J C;  5IY5 C;  2UU9 O;  3SGI A;  4DUZ B;  1L0L H;  3P3P A;  4HYO A;  1EN5 A;  4RWU A;  2G38 A;  1YIT V;  4TQD A;  3BFR A;  3GVM A;  3B2E E;  3AG2 C;  3AG2 B;  1H2M A;  2JGU A;  1F23 A;  1PL4 A;  2Q69 A;  1IZ3 A;  4PV1 B;  2YXY A;  4MTG A;  5FNV A;  3CD6 V;  5KAI Z;  4O4I A;  4DR7 B;  3K57 A;  4B3R O;  1BMF G;  2CDY A;  4B3T B;  2A9H A;  1GK9 A;  4JTA B;  5EYP A;  1Q8I A;  1V55 C;  2XOK G;  5LMN O;  2IJI A;  2GTS A;  2Q67 A;  2UUA B;  3GB7 C;  4LC1 A;  3CCM V;  3K5N A;  5EIB D;  3IC9 A;  2CGO A;  3QO8 A;  4ABM A;  1K7D A;  3K08 A;  1HNW O;  3CYO A;  4I55 B;  1CP9 A;  1KBH A;  5LGU A;  4CH5 A;  1DGS A;  3J80 N;  2ZT9 B;  5KHK A;  1DLB A;  1SRY A;  1XEQ A;  4JZ2 A;  1U96 A;  1FFX A;  5H5N A;  5JCO C;  4X65 O;  3GWO A;  4EB6 B;  2Q8V A;  4JI5 B;  4ZI7 A;  2CH7 B;  1IBK O;  1P7B A;  1FXH A;  1D5A A;  4QPK A;  4DV4 B;  4PA6 A;  1FFT B;  2ZIN A;  4CC6 A;  1SA0 A;  1F4N A;  3L74 H;  1I08 A;  2X6A A;  4JI0 O;  2FKX A;  4G27 B;  2CTQ A;  4GZR B;  4LFC B;  1KC8 W;  4TT3 G;  1WA8 A;  3T1Y B;  2PY5 A;  3JD1 A;  4UXN A;  1BZK A;  3RYC B;  3ZS8 C;  1Q86 W;  1S76 D;  4UB6 Z;  4DRX B;  4I9W A;  1I94 O;  1IBL B;  1BE3 H;  4RQE A;  2LFS A;  2XAG A;  3FYI B;  3SPG A;  3M99 B;  3CCV V;  4JTC B;  2ZD9 A;  1XQ8 A;  3IGA C;  3L70 H;  3DSQ A;  1SKV A;  3B4S A;  5L3C A;  3A0R A;  1LR1 A;  4QE9 A;  3AK2 A;  3P30 A;  2EX3 A;  4B3S B;  1OV9 A;  1SC5 B;  4HNA B;  2E74 B;  4ZIB A;  4L8J A;  1RSO B;  2ZXW B;  1OHH G;  2UUC O;  3E83 A;  1XMQ O;  1QU7 A;  2WAM A;  5CBH A;  1SQG A;  4KHP O;  4JYA B;  4XBF A;  2CTW A;  4FM1 A;  2YXH A;  4K0K B;  4CS2 A;  1H8E G;  3LDC A;  1VQ6 V;  3OFN G;  4LF7 O;  1FYJ A;  4FFK A;  2JGD B;  1WNS A;  3I56 V;  2AGA A;  2D2C B;  4WF9 V;  2AZ2 A;  3VQV A;  3S3X A;  1K4C C;  1O9H A;  4NKG B;  5EZY B;  1QVF U;  2CTP A;  5K1P A;  3VOU A;  4LFB O;  3BVO A;  4O2A A;  3AG4 B;  4TV8 B;  5FL7 G;  1W0J G;  4K8X A;  3E8B A;  3TJT A;  4X1Y B;  4U7O A;  1W2B U;  2ETN A;  1H38 A;  2QE7 G;  1Q6I A;  3L75 H;  4AQY B;  4DXW A;  1JOY A;  4DR5 B;  3ML0 A;  1YVW A;  2ZKO A;  3K06 A;  4MTO A;  5A2Q N;  1H2S B;  3H1I H;  4LFA O;  4JF3 A;  1JQ0 A;  2QM7 A;  4UV9 A;  4L87 A;  4I50 B;  1RM1 B;  2FML A;  1SER A;  5KLV H;  2XAJ A;  2Q7E A;  2ZM6 B;  4U3J B;  3A0B Z;  3RWR D;  3ZMU A;  3QF7 A;  2Z5U A;  3ETE A;  3ASN B;  1ZSP A;  4UVB A;  5H6Q A;  2MW2 B;  1S5L Z;  1S72 V;  1NR1 A;  4JYC A;  3JAM N;  1U97 A;  4R50 A;  1KKC A;  4HZ3 A;  5L3D A;  2EIK C;  4WBN A;  1XMO B;  4U3F H;  1FXV A;  3UO3 A;  2DE0 X;  4PA9 A;  5FNV B;  2WLK A;  3K9S A;  4JI6 B;  4FLU A;  4C7U A;  3M8A A;  1NH2 D;  4FVM A;  2KSD A;  2CH7 A;  3SYC A;  1OCO B;  1RSO A;  3TXS A;  4H0L B;  1SQQ H;  5B1A C;  3CCQ V;  2WLM A;  4I9Q A;  4X62 B; 
#chains in the Genus database with same CATH homology
 1VF6 A;  1RSO B;  1Y76 B;  1Y74 A;  1ZL8 A;  1VF6 C;  3B40 A;  1Y76 A;  1Y74 B;  1ZL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...