1ZL8A

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
b'GSLNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN-7
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8A00
1ZL8A 1Y76A 1Y74B 1VF6C 1ZL8B 3B40A 1VF6A 1RSOB 1Y74A 1Y76B
chains in the Genus database with same CATH superfamily
1N34B 4PHZA 1TUBB 4DV5B 1AJNA 4I50B 4KFMA 2ADPA 3F7YC 1BE3H 3SPIA 5LA6A 3ZRVA 2EIJB 4X62B 4LNUB 1BHAA 1EN6A 5CA0A 4K8XA 3A2FA 2QWNB 4FFBB 5L3DA 3SYOA 3DTUB 3ASOB 2CE4A 2UUAO 1QLEB 1WNSA 1N33O 2KQXA 2ZIMA 4ZOLA 1NTKH 5J2TB 5IYCO 4Q20A 1ZL8B 3IC7A 1GM7A 4KUMA 1WAZA 3VQWA 1GM9A 4J9ZB 1OZ0A 2PI5A 3K0GA 1K4CC 5A2QN 2GV9A 4FPPA 4EFEA 4O4LB 5CBGA 3ICXA 1S77D 1M56B 3ZEDA 1KP3A 1VQ4V 5CB4A 3JALB 2Q9LA 2XUMA 1GN4A 2F93B 4FLXA 2GUZA 2LO1A 3ZRSA 1VF5B 5EIBC 3CWBH 3H1KH 2EULA 3KG2A 1G4YB 3CEIA 2NNUA 2GTAA 2XT9A 3FKSG 3RFRA 4GLXA 1K4DC 3LSSA 4O4HA 1KQSU 1Y76B 4TV8B 3VQXA 1HNXO 2UUAB 3ZIAG 3R66A 1AP5A 1JCHA 1O9GA 1N33B 4O4IA 5CBFA 1G8MA 4DXWA 4FMTA 3ZHTA 2ODMA 2OYQA 2A7WA 4K35A 4FLWA 4JGSA 3AK3A 2BTOA 3ZRXA 2YIBD 3AK2A 5EC2C 5HFLA 1EN4A 5JCOA 3K0DA 1OCOC 4OXSA 2E5LO 3SYPA 4JI6O 2Q7HA 3A0BZ 1Y74B 2UXNA 1AR1B 2AHZA 4DO2A 2IJJA 3I56V 2E75B 1QNMA 3JARA 3A8TA 5KAIZ 2LQTA 3MHHC 1S0VA 3G6EV 1AI4A 1YSCA 3F5WC 1URFA 1HNXB 2LFSA 4QIWF 2OTJV 5JJJB 1RSOA 3K08A 3RBZA 4Z1VA 5H5NA 4FM0A 2UXXA 3LDEA 1SQPH 1BT8A 5LL6Y 4XBFA 1TAEA 5EBLC 4DV6O 4FM2A 1M9NA 2E5LB 3T1HO 4JI6B 4WFAV 2QM7A 5LMUO 2WLIB 4X88A 3PN1A 5FPOA 3ZHUA 3BY6A 1PL0A 4WFGA 1VQOV 1SERA 1HDJA 2F4VO 4YJ2A 3LNMB 4TSFG 4LF5O 1IBLO 1Y66A 4I9QA 1XNRB 1TVKB 5KUMA 3H9VA 1R6KA 2EIKB 3E22B 3LSUA 3CC2V 3U0ZA 4DR6O 1VIBA 2HR3A 4L8JA 3SDLA 4EB6B 1N36O 1K92A 3ASNC 3AG2B 1GN2A 4BIZA 1VQ5V 2QKCA 5LA6B 2QSAA 2A3QA 3FX7A 5B1BB 1YI2V 2DW4A 4LWSA 3NXSA 2XAJA 5DEDA 1XI1A 4LP8A 3VBBA 4IT5A 4DV6B 4P9OA 4I7ZB 1LUVA 4FLYA 3SYQA 3T1HB 4ZOLB 4UXNA 4FVMA 2O57A 4O4JB 3FYEB 5LMUB 1P7GA 2VQEO 4E4EA 1WB7A 3KKYA 2ADQB 3L75H 1AB3A 3BEHA 1EM1A 3ETEA 5H6RA 4LF4O 3UO3A 2Q5ZA 2F4VB 3W7TA 2HJFC 4LF5B 1MSDA 2YXLA 1IBLB 2ARHA 2DJVA 3M8AA 1M90W 4DR6B 1PD3A 3SPJA 1H2MA 4JPRA 1N36B 5GW7A 4GKJO 2GUZB 2OIGA 4B3SO 3T4DA 3ZHSA 5C8YA 3ABMC 3C3SA 2B5UA 1VF6C 1VQ9V 3B40A 4I9WA 4LFCO 3BFRA 5FL7G 1KD1W 5JH7B 1OCZC 3AG4C 3F5TA 2Y48A 1SQGA 2ATKC 3MDSA 3CB2A 1GKFA 3JD2A 1M4UA 2UUCO 2VQEB 2JGUA 1OV9A 4KL1A 4L87A 3D36C 3GWOA 3TXQA 4LF4B 3JD4A 1R73A 4P9PA 2F23A 3J80N 4JYYA 1KMIZ 4LCUC 2P90A 4NR1A 1MMMA 2Q8VA 3TGUH 1GH6A 1R3JC 2QKAA 3A0RA 1NJIW 4GKJB 3APQA 4DK0A 4B3SB 1EZVH 2UU9O 2QJ1A 2BE3A 1VF6A 4GZRB 4J42A 3OGIB 4N23A 3JARB 3JASA 2R72A 4LFCB 5IYZB 3FFQA 3E35A 2PYJA 1SS3A 3JYCA 5KX5A 3OUSA 4NKGB 5LOVB 1BHBA 3AG7A 5L3GA 4ZI7A 3FB8C 3RYHA 5KMGB 4QE7A 1MA1A 4CH5A 1SKVA 5LXTA 4MVZA 3N2KA 4BR6A 1WPXA 2HEPA 1S76D 1WB8A 2Q67A 3APOA 1OCOB 3K5MA 3CP1A 2HHHO 4X20A 2FMLA 4H44B 1KU9A 4AI8A 3OE7G 1LUWA 2UU9B 5LYJB 1YHQV 3K5LA 5A9GA 3OW2U 2P5OA 3BAAA 5CA1B 4YJ2B 3ZMZA 3RYCB 4OX9O 5IDJA 4F4LA 2XAGA 1IXBA 3QNEA 4H0LB 3P3PA 4IHJB 1V55B 2R9AA 2PY5A 1HP8A 3K9AA 1KUQA 3P32A 3H1LH 3WG7C 4R6ZA 2BOCC 1SA0A 4RQEA 3RWRD 3HKEB 4KXRA 3TCUA 1SC5B 3CC7V 2PI4A 4DR5O 2HG5C 1KC8W 3RYFA 4K0KO 5K1PA 4XDJA 4K8ZA 5JQGB 3WU2Z 2HHHB 2H3OA 3L70H 1NQTA 3MHSC 3BPZA 4WFHA 2FYUH 4F6EA 4HNAB 3DC5A 1H8HG 4OX9B 2HP8A 1AI5A 1RPOA 3RYIA 5LGNA 2W6JG 4MVRA 3SJQC 2HVJC 2JS5A 3ASNB 4DW0A 4UCOA 2H94A 1ZWIC 5C8YB 5IJ9B 1XBLA 3L73H 5J9PC 4DR5B 3T1YO 4U3FH 3CRRA 2D2CB 2ILMA 4K0KB 2P4KA 4UFZA 1NVPB 1MNGA 2EBOA 1W59A 4LH6A 1KKDA 2EINB 1E1QG 3N2GA 2EIMC 3ZRWB 1GN3A 2P6JA 2YIAA 4DV4O 4O2BA 5E79Z 2QKSA 2GHYA 3JD0A 3STZC 4ZKIA 5BY1A 1S72V 3G80A 2JDIG 5KHIA 1E79G 1Q82W 3ZN0A 3CMEV 2W0XA 2QGNA 2WAMA 3T4ZA 3ABMB 1L0LH 1Q6HA 2PTMA 5KAFZ 4FLVA 2NN4A 2XAFA 2CGNA 5CBHA 3E8GA 5F2VO 3T1YB 4Z2WA 5JJEB 3DXRA 3G4SV 5DECA 5FNVB 2ZXWC 2DQ3A 1OCZB 2IU3A 3AG4B 1TGOA 5L3CA 1VQ6V 3E8FA 4X1YA 1DK1A 4YIPA 4WCEV 3AG3C 1K33A 4DR7O 4ZI7B 1NS1A 4X1KB 3VOUA 5LXTB 2IH1C 2OCHA 2Y0IA 1L8DA 1K5QA 3N2KB 3D8CA 4DV0O 4DV4B 5LHHA 4JTCB 4X1IA 1RPRA 4BW9A 2R9IA 5JWPA 1D2DA 4J41A 1F23A 3FAVA 5GONB 3RVZA 4X20B 2HJDA 3M7MX 4DK1A 1I0HA 2JRIA 5LP6A 4I0XA 2Z0AA 1SF9A 2P06A 3L9DA 3EFFK 1TA8A 4GKKO 5TISZ 1FXKA 2MW2B 5JVDA 1EZJA 2WLMA 4FM1A 1PKXA 1VQPV 4IGGA 3ABLC 4DR7B 1MABG 3O9OA 4ZHQA 3ETGA 2ZE5A 2PUSA 4GT1A 3E2EA 4C7UA 4DV0B 1K5SA 3SJCC 3RYFB 2CTQA 1GO3F 5H6QA 1HW7A 4UVAA 4FLZA 1PNKA 5EZYA 4O2AB 1CXZB 1J5EO 5IYBO 5AG2A 3THOA 4MTOA 1BL8A 2BSKB 5J2UB 4U3JB 2R9RB 2GDSA 1Q6UA 1RP3B 3CS5A 4EEQA 2QWOB 4CS4A 2DMXA 2QR4A 1UJWB 4GKKB 1NTZH 4JYAO 2LGWA 4TQFA 3E89A 3GB7C 3P30A 3SR2C 2E76B 2JIZG 3SPGA 2V7QG 3WG7B 2PYLA 3U11A 5JCOC 3HKBB 2Q0AA 1JFFA 2KG7A 2ZDIA 3W7SA 4GCZA 1XOUA 3OTFA 4XDKA 1VF7A 2CTWA 3SGIA 1XL4A 2ZE8A 2YXYA 3T1CA 2R70A 3JAMN 2OT5A 4UB8Z 3CCVV 3JAKA 1J5EB 3FB5C 4DV1O 2QWRB 4LF6O 1YJNV 2HVKC 1F7YA 3N2GB 3VQVA 2F1MA 3W7XA 3G67A 1Y67A 4I4TA 4MVQA 4CS2A 4G27B 5KHGA 2WSSG 1SRYA 4JYAB 2EZPA 2JK5C 1V9PA 1F51A 4PA9A 1PV0A 4TQDA 2JS3A 4JI3B 4AQYO 1B06A 2QA4V 3X2QC 4X8AA 4LF8B 1FJGO 2PF4E 2XOKG 2WLKA 5IJ0A 1MZEA 4H33A 1QR8A 3CJHB 2E3CA 2OTLV 1R3KC 4X1YB 4IIJA 1XNRO 4DV1B 2Q7EA 1R3LC 1K9MW 4LF6B 2WLNA 1VQ8V 5KLVH 1FFXA 2EIMB 1NBMG 2CUGA 4GX5A 1SZTA 3EVKA 3JATB 4X1IB 2LJ2A 2ZCEA 4NVPA 2DWDC 3OGCC 4FIPC 2EZOA 1AVMA 1N0NA 4XDLA 3C3TA 3CRAA 4PV1B 4AQYB 1UPGA 2QDOA 2N05A 3ZN1A 3I5DA 1FJGB 3CCMV 2F66C 4X89A 3K57A 3AEIA 2ZKOA 4NTXA 1CP9A 5JVDB 2ZXWB 4HZ3A 2WLHA 1GM8A 3UT5A 3CPWU 1IBMO 3JAWA 4H13B 4MTFA 3AG3B 1EFRG 4CS3A 1M57C 2YEVB 3J81N 4ZHQB 1IDSA 3QO7A 1U96A 3U10A 3HKCB 1Q8IA 4HAMA 4F6RB 5HFMA 1YCIA 1BZKA 3K5NA 2VWKA 1V54C 2JEXA 4ZBMA 3N27A 2LW1A 3L71H 4GUNA 5CA0B 4ZIBA 4CZZA 4BIOA 1SQQH 2CDYA 1QLNA 1FD9A 3EHBB 1NKDA 1DTOA 4IYIA 4GYCB 5EC1C 1Q81W 2FTKA 1HWYA 1FS0G 1Z2GA 1KECA 4PI0A 4X66O 2A79B 2XHBA 3M99B 4DV7O 1KP2A 3B8NA 4DYLA 1IBMB 3ABLB 1Q5OA 2CH7A 3OR7C 3IJ4A 1BCCH 5CB4B 5FPRA 1WPBA 5L3EA 4R50A 4JYBA 4NXMO 1BSMA 4B3TO 1JR9A 4TT3G 2WWWA 4O4HB 1OCCC 4WFEA 1AR5A 3ABTA 1GK9A 1QCEA 2N04A 4RO2A 2M7WA 4O4IB 3QTCA 3LUTB 4H37A 3J7AU 4X66B 4YHHO 4DV7B 4R8CA 4JI2O 4DRXA 1W0KG 2G38A 2F43G 5BMVA 3GVMA 4DR4O 1M1KW 1AJPA 4IYHA 1I08A 3OEHG 4JV5B 5IJ0B 3DC6A 1AR4A 4NXMB 4TUYA 2YS8A 4B3TB 4FZ1A 2BTQA 4B08A 2MK3A 4I55A 3SYAA 1SQXH 3HKDA 4WBNA 1XDCA 3K04A 2ZM6O 3E8BA 2RCVA 3RT3C 2DN9A 2GBOA 1RSOB 4EKWA 3IAYA 4MW8A 4FFKA 5B3SC 1UFIA 1P7BA 3CSXA 4YHHB 2OCCC 2Q7GA 3L74H 1YXBA 1VQLV 4JI2B 1G6UA 1IZ3A 4DV3O 5EIBD 1VQ7V 3OR6C 3L72H 3ZMTA 4JTDB 2A0LA 1XREA 4DR4B 4TWKA 2EILC 5C93A 5E1AC 3X2QB 1RM1C 2RN9A 4DV2O 2RNBA 2DYSC 2JGDA 4JI8O 1VP7A 3UT5B 4MTXA 2VWJA 1JVMA 3CX5F 4NTWA 1DF5A 1NR7A 3FD9A 4OGQB 3ML0A 3K59A 3CXHF 2NLJC 1H2SB 3JSLA 2ZM6B 5KHKA 1PL4A 3K58A 3B09A 1OJHA 5CN0A 3WB0A 4RUEA 5EYPA 4CBCA 2LGQA 1A32A 4IL6Z 4I5SA 1YF2A 4LWSB 1JQ0A 4DV3B 4PA7A 2B9ZA 2JEUA 3VQYA 4D7TA 2KKWA 2VQFO 1AP6A 4K3AA 5BR8O 1IURA 4DV2B 4YJ3A 1I5XA 1RFYA 4UB6Z 4YY3O 4JI8B 1YTFB 1TUBA 4ICGA 4I50A 3D3QA 1PPJH 2XNDG 1P4RA 3BA8A 1MOFA 4LNUA 1M57B 2HFEC 2RDCA 2DWEC 2X6CA 1N32O 1JA8A 4FFBA 4BIUA 3C90A 1S3JA 1V54B 3H1HH 1OHHG 1X59A 3HB3B 4JI4O 3KZIZ 3QO8A 1YJ9V 1PNMA 2VRZA 1AROP 1ZL8A 3CCRV 4B3MB 1SZXA 2VQFB 4B7EA 2AHYA 2Q4PA 5BR8B 2IJHA 4DW1A 1T5EA 1NR1A 4LF9O 4O4LA 4RAIA 1FPOA 4J10A 3WB2A 4YY3B 4CH3A 2ZNIA 1Z5VA 1R3IC 4HYOA 5H9CA 5EK0A 4QNHB 2YIBA 2V1DA 3RVYA 1Z5WA 1ZAUA 3QO5A 3TETA 2D3OW 1N32B 3UQ8A 1NVPD 2Q73A 4BWAA 1Y76A 2F95B 2H8PC 1HR0B 1NI8A 4J9YB 3H01A 5LP6C 3ZX6A 4JI4B 5L3FA 4UVBA 1J95A 2L6LA 1H8EG 4I55B 3JASB 1H38A 2XTAA 2ZE6A 1FXKC 1OCCB 4FLTA 2LP7A 4WBNB 1VARA 4A5UB 5KX5B 3B4SA 4DR3O 3LNNA 2W0FC 2Q6AA 1MG1A 4LF9B 1CEZA 1VQMV 1K8AW 3RYHB 3CMAV 3CCQV 3G71V 4PA6A 1H2KA 1WA8A 2QM8A 3ETDA 2P22C 4AHCA 5EBMC 1Y74A 3K03A 4DUZO 4RUFA 4TOIA 5GTIZ 5KUKA 1JJOA 2DQ0A 4UCUA 2X7RB 1Q3EA 1I94O 1W2BU 4JAUA 3S3XA 1S5HC 2ZE7A 4UCVA 2A9HA 5LHIA 3AG2C 5K1XA 4ASUG 3CCJV 1YEWA 2CK3G 1NH2B 4JZGA 5IWAO 2IJIA 5IT9N 4CC6A 1COWG 1F4MA 4MVOA 2WLLA 2AXTZ 3ETQA 1D5NA 3OAAG 1BMFG 4DR3B 1SA0B 2EX3A 2Y4UA 5B3SB 5EYPB 2AZ2A 1XMQO 4PDRA 3SPHA 1B04A 2ZDIC 2OCCB 1JJ2U 1MZFA 2DYRC 2WLIA 3JSNA 1S5JA 4DUZB 5B66Z 3K9SA 2FL4A 2LW7A 4BAYA 2ZNJA 2Y0PA 2EILB 3CC4V 1CPYA 1KYOF 2RMKB 1NH2D 1AJQA 2CGOA 4D7SA 1I94B 3PJSK 3KCYA 3OD4A 1GAXA 5B5EZ 1R1BA 1H2NA 3JD3A 4Q6GA 5IWAB 3ZHRA 3RYIB 1QVGU 2PGGA 4QGPA 4PA4A 4JI3O 2YXHA 1WP8A 1XMQB 1N0JA 2YIDA 4LF8O 3O65A 4R7CA 4O4JA 4MTGA 1NT2B 4U7OA 1AILA 1FFTB 2LFRA 3SPCA 3JD1A 1YVWA 1Q7YW 1NZ6A 1ZLZA 1XILA 1OCRC 1B6QA 4GX1A 4BW5A 1XUQA 2WPDG 1IXMA 4PDVA 1JPXA 3EXAA 4O2BB 3QVNA 3ZMVA 2Y4TA 2UXCO 3CCSV 4PD4F 2GSMB 1TUEB 3UO2A 2FB5A 3BA9A 3E86A 4PELA 1WN7A 2QE7G 2KB1A 5JH7A 5D5QA 3LDDA 3T2MA 4W4LA 2A06H 3ABUA 1BS3A 3AK1A 4MW3A 3TJTA 3H1JH 1FXHA 1L1FA 1XHZA 3DXRB 1XHXA 1MSWD 3E8HA 3TXSA 3SYCA 2YC0A 4QPKA 5B1NA 4MVUA 3BHPA 4TV9A 1US6A 1WA8B 2X6BA 3GWKC 1Q86W 1QVFU 4X64O 3BABA 3ABKC 2UXCB 1FXVA 4PDMA 4FJCC 1N4CA 2L35A 3FB6C 1ROPA 2P4VA 3FAVB 5B1AC 5IYZA 2CAZC 1SQBH 1KBHA 1V55C 3AG1C 3IC9A 5LOVA 5LP6B 2Z3YA 4I0XB 5LMNO 1THZA 3OT7A 5KMGA 2Q69A 3OMIB 1FXKB 4UCRA 2YI8A 1WLEA 2WLLB 2Y69C 3OMNB 3OEEG 3SJBC 1SESA 1K3EA 2ITCC 3OUFA 1IX9A 1BQZA 4AILC 3MD0A 1G1XB 1ZSPA 4UCSA 2QTSA 1GRJA 1PM9A 3QF7A 3UCSC 4J7JA 2GTSA 5BZBA 5EBWC 1R6TA 2IW5A 1PNLA 4X64B 5IY5C 3UKMA 5LYJA 4JTAB 2XASA 2WA4A 4JI7O 5CA1A 1I7FA 5EZYB 3RYCA 1YDXA 4UV8A 4P2ZA 4IHJA 2JJ2G 3ZS8C 5H2FZ 2XAHA 1IBKO 4EB6A 1X4TA 2K9PA 5LMNB 1VMGA 2UXDO 3HKEA 3G6BA 4MSWC 2C2AA 4P30A 4YXWG 2ZD9A 2IU0A 4D6TH 1NTMH 3ZMUA 3CRQA 1F4NA 4J11A 2IBZH 2K1EA 2NR5A 4JI1O 5JJNB 1XNQO 4W4KA 5JQGA 4PI2A 1ENVA 1JFFB 3CRMA 4CH6A 2KG7B 4UUJC 4JV5O 2EINC 2DYRB 3MAQA 2ZIOA 4WFBV 2P67A 2ZR3A 1GTOA 1YITV 2YUAA 1GMGA 2YDEA 4J80A 2WLJA 4JI7B 4HNAA 3JAKB 4WFFA 3S3WA 1QHTA 5LGUA 2PZSA 2CTPA 2OWOA 4GX0A 3ZHQA 1IBKB 2M6YA 1DLBA 2V4DA 4I4TB 3STLC 4JF3A 1K97A 1M5IA 2UXDB 3B8MA 2AW9A 5IJ9A 1EBOA 3KCXA 3JCZA 1Q43A 3BRCA 4PJ0Z 2RJZA 5DM6V 2QTOA 4CH4A 1PP9H 2JVDA 3K79A 4JI1B 1XNQB 4LBEC 3ZMSA 3K06A 3NR7A 2CTRA 3RN4A 3IFXA 4JZ2A 3CCUV 1B3QA 3W7UA 1W0JG 4YIOA 4J7ZA 2YI9A 4NYKA 3ZRWA 3JCUZ 3CCLV 1XMOO 4X65O 1D5AA 4U7NA 4IIJB 1IVSA 4QPJA 4MVMA 1OCRB 4JYCA 3CCEV 3OFNG 2OIEA 4LR3A 5LBQA 1FFXB 4TV9B 2W6IG 1WJZA 4G28B 3SJAC 3CRCA 1KB9F 5ITZA 3FYIB 4UCTA 1R6NA 5IE9A 1DGSA 4G2KA 5FNVA 3H1IH 1XQ8A 2ITDC 5LHGA 2YICA 1H2LA 2QWPB 1EN5A 3OMAB 4MT8A 4DR1O 3WFVA 2ZINA 1K73W 3W7WA 3CYOA 1JOYA 1N8RW 4X1KA 5BXZA 2UUCB 1VEWA 3RGBA 4JI5O 2X0LA 3D36A 2HLDG 3JAWB 4Z1MG 1XMOB 4X65B 4LFBO 4DR2O 2EIJC 1YJWV 1S5LZ 3B77A 2BOBC 1U97A 2HKOA 1JMKC 1AI7A 5GONA 1M93A 1Y4MA 2YSUB 1O9HA 3ABKB 3RW0A 2E74B 5GTHZ 3ASOC 3Q4HA 1QLEC 4FZ0A 4PDLA 5KHJA 1LNQA 2Q0OC 1FYJA 3HR0A 5B1AB 1FAFA 3LDCA 3IGAC 4LH7A 1ZUQA 2RQ6A 4B3MO 2IJKA 4GX2A 3AG1B 2VS0A 1XL6A 4NB5A 2FKXA 2QWQB 4DR1B 1Y6XA 1ZTEA 4DUYO 1M56C 4N21A 4JI5B 3ZBHA 1ORQC 2Y69B 4X9QA 2ZT9B 1HNWO 3BVOA 3BCCH 1VQNV 2JJ1G 4LFBB 4DR2B 4MS2A 3ZHVA 2CH7B 1E1RG 4O2AA 3QG5A 4KP4A 2P7TC 1HR0O 5IY5B 2BSKA 5J2UA 4U3JA 4JAVA 1BGYH 2QM4A 1K7DA 1QQCA 3OM3B 4UV9A 4FK5C 2AZ0A 1YIJV 4LF7O 3FB7C 5J2TA 3LSQA 1ZX3A 3OTOO 1YTFD 5LGTA 1XEQA 3P3NA 3DGEA 5CA3A 3B2EE 3K5OA 3HKBA 2EJ7A 4DUYB 2ZR2A 3JALA 4DRXB 3R65A 1HNWB 4OPHA 4NXNO 2DE0X 1P49A 5IYDO 2Q68A 5BMVB 4LFAO 2WA3A 2N74A 3UM7A 4EFBA 4PA3A 2B1IA 2B1GA 4MVSA 5KHHA 4JI0O 4J7KA 5B1OA 2EJRA 2X6AA 1QR9A 2Z5UA 4CC5A 4TV8A 3TK1A 4QJFB 5KA6A 4TUYB 4KHPO 1DF4A 1SQVH 1YZBA 1AI6A 2UXBO 4B3RO 3ZCCA 2BTQB 2KSDA 4LF7B 1JX9A 3ZJZA 3CHXA 1SQFA 4ABMA 3CD6V 2QEXV 2ZQMA 3HKDB 3OTOB 1NU1H 4E2LA 5DN6G 1P84F 3K3WA 1VQKV 1K34A 2UUBO 1GN6A 3DSQA 1L0NH 4JASA 4OPAA 1Q90D 5ITZB 1FKAO 2XAQA 4HBNA 4NXNB 5FLXN 3CXCU 4LFAB 3CJHA 4LC1A 1HNZO 4JI0B 2IM9A 5D5PA 2EIKC 1I5YA 2JGDB 1H2GA 4KHPB 1BQ0A 1N34O 4B7KA 2UXBB 1Q6IA 3JATA 4DV5O 4B3RB 1KKCA 4X62O 5L3BA 5CMUA 3A0HZ 3D3IA 5B1BC 4UVCA 3HPLC 3F7VC 2UUBB 4RWUA 2BCCH 3Q4HB 3CE2A 1QU7A 4WF9V 2AGAA 3I55V 1LR1A 4JAAA 1WP7A 2DOSA 3WB1A 1SETA 1RM1B 1HNZB 4FLUA 2IH3C 1TVKA 4NTYA 5KA5A 1QBZA 2DYSB 2YEVA 3E22A 4YJ3B 4RQFA 3E83A 3HKCA 2ETNA 4QE9A 4F6RA
chains in the Genus database with same CATH topology
1ZL8A 1Y76A 1Y74B 1VF6C 1ZL8B 3B40A 1VF6A 1RSOB 1Y74A 1Y76B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 A;  1Y76 A;  1Y74 B;  1VF6 C;  1ZL8 B;  3B40 A;  1VF6 A;  1RSO B;  1Y74 A;  1Y76 B; 
#chains in the Genus database with same CATH topology
 1N34 B;  4PHZ A;  1TUB B;  4DV5 B;  1AJN A;  4I50 B;  4KFM A;  2ADP A;  3F7Y C;  1BE3 H;  3SPI A;  5LA6 A;  3ZRV A;  2EIJ B;  4X62 B;  4LNU B;  1BHA A;  1EN6 A;  5CA0 A;  4K8X A;  3A2F A;  2QWN B;  4FFB B;  5L3D A;  3SYO A;  3DTU B;  3ASO B;  2CE4 A;  2UUA O;  1QLE B;  1WNS A;  1N33 O;  2KQX A;  2ZIM A;  4ZOL A;  1NTK H;  5J2T B;  5IYC O;  4Q20 A;  1ZL8 B;  3IC7 A;  1GM7 A;  4KUM A;  1WAZ A;  3VQW A;  1GM9 A;  4J9Z B;  1OZ0 A;  2PI5 A;  3K0G A;  1K4C C;  5A2Q N;  2GV9 A;  4FPP A;  4EFE A;  4O4L B;  5CBG A;  3ICX A;  1S77 D;  1M56 B;  3ZED A;  1KP3 A;  1VQ4 V;  5CB4 A;  3JAL B;  2Q9L A;  2XUM A;  1GN4 A;  2F93 B;  4FLX A;  2GUZ A;  2LO1 A;  3ZRS A;  1VF5 B;  5EIB C;  3CWB H;  3H1K H;  2EUL A;  3KG2 A;  1G4Y B;  3CEI A;  2NNU A;  2GTA A;  2XT9 A;  3FKS G;  3RFR A;  4GLX A;  1K4D C;  3LSS A;  4O4H A;  1KQS U;  1Y76 B;  4TV8 B;  3VQX A;  1HNX O;  2UUA B;  3ZIA G;  3R66 A;  1AP5 A;  1JCH A;  1O9G A;  1N33 B;  4O4I A;  5CBF A;  1G8M A;  4DXW A;  4FMT A;  3ZHT A;  2ODM A;  2OYQ A;  2A7W A;  4K35 A;  4FLW A;  4JGS A;  3AK3 A;  2BTO A;  3ZRX A;  2YIB D;  3AK2 A;  5EC2 C;  5HFL A;  1EN4 A;  5JCO A;  3K0D A;  1OCO C;  4OXS A;  2E5L O;  3SYP A;  4JI6 O;  2Q7H A;  3A0B Z;  1Y74 B;  2UXN A;  1AR1 B;  2AHZ A;  4DO2 A;  2IJJ A;  3I56 V;  2E75 B;  1QNM A;  3JAR A;  3A8T A;  5KAI Z;  2LQT A;  3MHH C;  1S0V A;  3G6E V;  1AI4 A;  1YSC A;  3F5W C;  1URF A;  1HNX B;  2LFS A;  4QIW F;  2OTJ V;  5JJJ B;  1RSO A;  3K08 A;  3RBZ A;  4Z1V A;  5H5N A;  4FM0 A;  2UXX A;  3LDE A;  1SQP H;  1BT8 A;  5LL6 Y;  4XBF A;  1TAE A;  5EBL C;  4DV6 O;  4FM2 A;  1M9N A;  2E5L B;  3T1H O;  4JI6 B;  4WFA V;  2QM7 A;  5LMU O;  2WLI B;  4X88 A;  3PN1 A;  5FPO A;  3ZHU A;  3BY6 A;  1PL0 A;  4WFG A;  1VQO V;  1SER A;  1HDJ A;  2F4V O;  4YJ2 A;  3LNM B;  4TSF G;  4LF5 O;  1IBL O;  1Y66 A;  4I9Q A;  1XNR B;  1TVK B;  5KUM A;  3H9V A;  1R6K A;  2EIK B;  3E22 B;  3LSU A;  3CC2 V;  3U0Z A;  4DR6 O;  1VIB A;  2HR3 A;  4L8J A;  3SDL A;  4EB6 B;  1N36 O;  1K92 A;  3ASN C;  3AG2 B;  1GN2 A;  4BIZ A;  1VQ5 V;  2QKC A;  5LA6 B;  2QSA A;  2A3Q A;  3FX7 A;  5B1B B;  1YI2 V;  2DW4 A;  4LWS A;  3NXS A;  2XAJ A;  5DED A;  1XI1 A;  4LP8 A;  3VBB A;  4IT5 A;  4DV6 B;  4P9O A;  4I7Z B;  1LUV A;  4FLY A;  3SYQ A;  3T1H B;  4ZOL B;  4UXN A;  4FVM A;  2O57 A;  4O4J B;  3FYE B;  5LMU B;  1P7G A;  2VQE O;  4E4E A;  1WB7 A;  3KKY A;  2ADQ B;  3L75 H;  1AB3 A;  3BEH A;  1EM1 A;  3ETE A;  5H6R A;  4LF4 O;  3UO3 A;  2Q5Z A;  2F4V B;  3W7T A;  2HJF C;  4LF5 B;  1MSD A;  2YXL A;  1IBL B;  2ARH A;  2DJV A;  3M8A A;  1M90 W;  4DR6 B;  1PD3 A;  3SPJ A;  1H2M A;  4JPR A;  1N36 B;  5GW7 A;  4GKJ O;  2GUZ B;  2OIG A;  4B3S O;  3T4D A;  3ZHS A;  5C8Y A;  3ABM C;  3C3S A;  2B5U A;  1VF6 C;  1VQ9 V;  3B40 A;  4I9W A;  4LFC O;  3BFR A;  5FL7 G;  1KD1 W;  5JH7 B;  1OCZ C;  3AG4 C;  3F5T A;  2Y48 A;  1SQG A;  2ATK C;  3MDS A;  3CB2 A;  1GKF A;  3JD2 A;  1M4U A;  2UUC O;  2VQE B;  2JGU A;  1OV9 A;  4KL1 A;  4L87 A;  3D36 C;  3GWO A;  3TXQ A;  4LF4 B;  3JD4 A;  1R73 A;  4P9P A;  2F23 A;  3J80 N;  4JYY A;  1KMI Z;  4LCU C;  2P90 A;  4NR1 A;  1MMM A;  2Q8V A;  3TGU H;  1GH6 A;  1R3J C;  2QKA A;  3A0R A;  1NJI W;  4GKJ B;  3APQ A;  4DK0 A;  4B3S B;  1EZV H;  2UU9 O;  2QJ1 A;  2BE3 A;  1VF6 A;  4GZR B;  4J42 A;  3OGI B;  4N23 A;  3JAR B;  3JAS A;  2R72 A;  4LFC B;  5IYZ B;  3FFQ A;  3E35 A;  2PYJ A;  1SS3 A;  3JYC A;  5KX5 A;  3OUS A;  4NKG B;  5LOV B;  1BHB A;  3AG7 A;  5L3G A;  4ZI7 A;  3FB8 C;  3RYH A;  5KMG B;  4QE7 A;  1MA1 A;  4CH5 A;  1SKV A;  5LXT A;  4MVZ A;  3N2K A;  4BR6 A;  1WPX A;  2HEP A;  1S76 D;  1WB8 A;  2Q67 A;  3APO A;  1OCO B;  3K5M A;  3CP1 A;  2HHH O;  4X20 A;  2FML A;  4H44 B;  1KU9 A;  4AI8 A;  3OE7 G;  1LUW A;  2UU9 B;  5LYJ B;  1YHQ V;  3K5L A;  5A9G A;  3OW2 U;  2P5O A;  3BAA A;  5CA1 B;  4YJ2 B;  3ZMZ A;  3RYC B;  4OX9 O;  5IDJ A;  4F4L A;  2XAG A;  1IXB A;  3QNE A;  4H0L B;  3P3P A;  4IHJ B;  1V55 B;  2R9A A;  2PY5 A;  1HP8 A;  3K9A A;  1KUQ A;  3P32 A;  3H1L H;  3WG7 C;  4R6Z A;  2BOC C;  1SA0 A;  4RQE A;  3RWR D;  3HKE B;  4KXR A;  3TCU A;  1SC5 B;  3CC7 V;  2PI4 A;  4DR5 O;  2HG5 C;  1KC8 W;  3RYF A;  4K0K O;  5K1P A;  4XDJ A;  4K8Z A;  5JQG B;  3WU2 Z;  2HHH B;  2H3O A;  3L70 H;  1NQT A;  3MHS C;  3BPZ A;  4WFH A;  2FYU H;  4F6E A;  4HNA B;  3DC5 A;  1H8H G;  4OX9 B;  2HP8 A;  1AI5 A;  1RPO A;  3RYI A;  5LGN A;  2W6J G;  4MVR A;  3SJQ C;  2HVJ C;  2JS5 A;  3ASN B;  4DW0 A;  4UCO A;  2H94 A;  1ZWI C;  5C8Y B;  5IJ9 B;  1XBL A;  3L73 H;  5J9P C;  4DR5 B;  3T1Y O;  4U3F H;  3CRR A;  2D2C B;  2ILM A;  4K0K B;  2P4K A;  4UFZ A;  1NVP B;  1MNG A;  2EBO A;  1W59 A;  4LH6 A;  1KKD A;  2EIN B;  1E1Q G;  3N2G A;  2EIM C;  3ZRW B;  1GN3 A;  2P6J A;  2YIA A;  4DV4 O;  4O2B A;  5E79 Z;  2QKS A;  2GHY A;  3JD0 A;  3STZ C;  4ZKI A;  5BY1 A;  1S72 V;  3G80 A;  2JDI G;  5KHI A;  1E79 G;  1Q82 W;  3ZN0 A;  3CME V;  2W0X A;  2QGN A;  2WAM A;  3T4Z A;  3ABM B;  1L0L H;  1Q6H A;  2PTM A;  5KAF Z;  4FLV A;  2NN4 A;  2XAF A;  2CGN A;  5CBH A;  3E8G A;  5F2V O;  3T1Y B;  4Z2W A;  5JJE B;  3DXR A;  3G4S V;  5DEC A;  5FNV B;  2ZXW C;  2DQ3 A;  1OCZ B;  2IU3 A;  3AG4 B;  1TGO A;  5L3C A;  1VQ6 V;  3E8F A;  4X1Y A;  1DK1 A;  4YIP A;  4WCE V;  3AG3 C;  1K33 A;  4DR7 O;  4ZI7 B;  1NS1 A;  4X1K B;  3VOU A;  5LXT B;  2IH1 C;  2OCH A;  2Y0I A;  1L8D A;  1K5Q A;  3N2K B;  3D8C A;  4DV0 O;  4DV4 B;  5LHH A;  4JTC B;  4X1I A;  1RPR A;  4BW9 A;  2R9I A;  5JWP A;  1D2D A;  4J41 A;  1F23 A;  3FAV A;  5GON B;  3RVZ A;  4X20 B;  2HJD A;  3M7M X;  4DK1 A;  1I0H A;  2JRI A;  5LP6 A;  4I0X A;  2Z0A A;  1SF9 A;  2P06 A;  3L9D A;  3EFF K;  1TA8 A;  4GKK O;  5TIS Z;  1FXK A;  2MW2 B;  5JVD A;  1EZJ A;  2WLM A;  4FM1 A;  1PKX A;  1VQP V;  4IGG A;  3ABL C;  4DR7 B;  1MAB G;  3O9O A;  4ZHQ A;  3ETG A;  2ZE5 A;  2PUS A;  4GT1 A;  3E2E A;  4C7U A;  4DV0 B;  1K5S A;  3SJC C;  3RYF B;  2CTQ A;  1GO3 F;  5H6Q A;  1HW7 A;  4UVA A;  4FLZ A;  1PNK A;  5EZY A;  4O2A B;  1CXZ B;  1J5E O;  5IYB O;  5AG2 A;  3THO A;  4MTO A;  1BL8 A;  2BSK B;  5J2U B;  4U3J B;  2R9R B;  2GDS A;  1Q6U A;  1RP3 B;  3CS5 A;  4EEQ A;  2QWO B;  4CS4 A;  2DMX A;  2QR4 A;  1UJW B;  4GKK B;  1NTZ H;  4JYA O;  2LGW A;  4TQF A;  3E89 A;  3GB7 C;  3P30 A;  3SR2 C;  2E76 B;  2JIZ G;  3SPG A;  2V7Q G;  3WG7 B;  2PYL A;  3U11 A;  5JCO C;  3HKB B;  2Q0A A;  1JFF A;  2KG7 A;  2ZDI A;  3W7S A;  4GCZ A;  1XOU A;  3OTF A;  4XDK A;  1VF7 A;  2CTW A;  3SGI A;  1XL4 A;  2ZE8 A;  2YXY A;  3T1C A;  2R70 A;  3JAM N;  2OT5 A;  4UB8 Z;  3CCV V;  3JAK A;  1J5E B;  3FB5 C;  4DV1 O;  2QWR B;  4LF6 O;  1YJN V;  2HVK C;  1F7Y A;  3N2G B;  3VQV A;  2F1M A;  3W7X A;  3G67 A;  1Y67 A;  4I4T A;  4MVQ A;  4CS2 A;  4G27 B;  5KHG A;  2WSS G;  1SRY A;  4JYA B;  2EZP A;  2JK5 C;  1V9P A;  1F51 A;  4PA9 A;  1PV0 A;  4TQD A;  2JS3 A;  4JI3 B;  4AQY O;  1B06 A;  2QA4 V;  3X2Q C;  4X8A A;  4LF8 B;  1FJG O;  2PF4 E;  2XOK G;  2WLK A;  5IJ0 A;  1MZE A;  4H33 A;  1QR8 A;  3CJH B;  2E3C A;  2OTL V;  1R3K C;  4X1Y B;  4IIJ A;  1XNR O;  4DV1 B;  2Q7E A;  1R3L C;  1K9M W;  4LF6 B;  2WLN A;  1VQ8 V;  5KLV H;  1FFX A;  2EIM B;  1NBM G;  2CUG A;  4GX5 A;  1SZT A;  3EVK A;  3JAT B;  4X1I B;  2LJ2 A;  2ZCE A;  4NVP A;  2DWD C;  3OGC C;  4FIP C;  2EZO A;  1AVM A;  1N0N A;  4XDL A;  3C3T A;  3CRA A;  4PV1 B;  4AQY B;  1UPG A;  2QDO A;  2N05 A;  3ZN1 A;  3I5D A;  1FJG B;  3CCM V;  2F66 C;  4X89 A;  3K57 A;  3AEI A;  2ZKO A;  4NTX A;  1CP9 A;  5JVD B;  2ZXW B;  4HZ3 A;  2WLH A;  1GM8 A;  3UT5 A;  3CPW U;  1IBM O;  3JAW A;  4H13 B;  4MTF A;  3AG3 B;  1EFR G;  4CS3 A;  1M57 C;  2YEV B;  3J81 N;  4ZHQ B;  1IDS A;  3QO7 A;  1U96 A;  3U10 A;  3HKC B;  1Q8I A;  4HAM A;  4F6R B;  5HFM A;  1YCI A;  1BZK A;  3K5N A;  2VWK A;  1V54 C;  2JEX A;  4ZBM A;  3N27 A;  2LW1 A;  3L71 H;  4GUN A;  5CA0 B;  4ZIB A;  4CZZ A;  4BIO A;  1SQQ H;  2CDY A;  1QLN A;  1FD9 A;  3EHB B;  1NKD A;  1DTO A;  4IYI A;  4GYC B;  5EC1 C;  1Q81 W;  2FTK A;  1HWY A;  1FS0 G;  1Z2G A;  1KEC A;  4PI0 A;  4X66 O;  2A79 B;  2XHB A;  3M99 B;  4DV7 O;  1KP2 A;  3B8N A;  4DYL A;  1IBM B;  3ABL B;  1Q5O A;  2CH7 A;  3OR7 C;  3IJ4 A;  1BCC H;  5CB4 B;  5FPR A;  1WPB A;  5L3E A;  4R50 A;  4JYB A;  4NXM O;  1BSM A;  4B3T O;  1JR9 A;  4TT3 G;  2WWW A;  4O4H B;  1OCC C;  4WFE A;  1AR5 A;  3ABT A;  1GK9 A;  1QCE A;  2N04 A;  4RO2 A;  2M7W A;  4O4I B;  3QTC A;  3LUT B;  4H37 A;  3J7A U;  4X66 B;  4YHH O;  4DV7 B;  4R8C A;  4JI2 O;  4DRX A;  1W0K G;  2G38 A;  2F43 G;  5BMV A;  3GVM A;  4DR4 O;  1M1K W;  1AJP A;  4IYH A;  1I08 A;  3OEH G;  4JV5 B;  5IJ0 B;  3DC6 A;  1AR4 A;  4NXM B;  4TUY A;  2YS8 A;  4B3T B;  4FZ1 A;  2BTQ A;  4B08 A;  2MK3 A;  4I55 A;  3SYA A;  1SQX H;  3HKD A;  4WBN A;  1XDC A;  3K04 A;  2ZM6 O;  3E8B A;  2RCV A;  3RT3 C;  2DN9 A;  2GBO A;  1RSO B;  4EKW A;  3IAY A;  4MW8 A;  4FFK A;  5B3S C;  1UFI A;  1P7B A;  3CSX A;  4YHH B;  2OCC C;  2Q7G A;  3L74 H;  1YXB A;  1VQL V;  4JI2 B;  1G6U A;  1IZ3 A;  4DV3 O;  5EIB D;  1VQ7 V;  3OR6 C;  3L72 H;  3ZMT A;  4JTD B;  2A0L A;  1XRE A;  4DR4 B;  4TWK A;  2EIL C;  5C93 A;  5E1A C;  3X2Q B;  1RM1 C;  2RN9 A;  4DV2 O;  2RNB A;  2DYS C;  2JGD A;  4JI8 O;  1VP7 A;  3UT5 B;  4MTX A;  2VWJ A;  1JVM A;  3CX5 F;  4NTW A;  1DF5 A;  1NR7 A;  3FD9 A;  4OGQ B;  3ML0 A;  3K59 A;  3CXH F;  2NLJ C;  1H2S B;  3JSL A;  2ZM6 B;  5KHK A;  1PL4 A;  3K58 A;  3B09 A;  1OJH A;  5CN0 A;  3WB0 A;  4RUE A;  5EYP A;  4CBC A;  2LGQ A;  1A32 A;  4IL6 Z;  4I5S A;  1YF2 A;  4LWS B;  1JQ0 A;  4DV3 B;  4PA7 A;  2B9Z A;  2JEU A;  3VQY A;  4D7T A;  2KKW A;  2VQF O;  1AP6 A;  4K3A A;  5BR8 O;  1IUR A;  4DV2 B;  4YJ3 A;  1I5X A;  1RFY A;  4UB6 Z;  4YY3 O;  4JI8 B;  1YTF B;  1TUB A;  4ICG A;  4I50 A;  3D3Q A;  1PPJ H;  2XND G;  1P4R A;  3BA8 A;  1MOF A;  4LNU A;  1M57 B;  2HFE C;  2RDC A;  2DWE C;  2X6C A;  1N32 O;  1JA8 A;  4FFB A;  4BIU A;  3C90 A;  1S3J A;  1V54 B;  3H1H H;  1OHH G;  1X59 A;  3HB3 B;  4JI4 O;  3KZI Z;  3QO8 A;  1YJ9 V;  1PNM A;  2VRZ A;  1ARO P;  1ZL8 A;  3CCR V;  4B3M B;  1SZX A;  2VQF B;  4B7E A;  2AHY A;  2Q4P A;  5BR8 B;  2IJH A;  4DW1 A;  1T5E A;  1NR1 A;  4LF9 O;  4O4L A;  4RAI A;  1FPO A;  4J10 A;  3WB2 A;  4YY3 B;  4CH3 A;  2ZNI A;  1Z5V A;  1R3I C;  4HYO A;  5H9C A;  5EK0 A;  4QNH B;  2YIB A;  2V1D A;  3RVY A;  1Z5W A;  1ZAU A;  3QO5 A;  3TET A;  2D3O W;  1N32 B;  3UQ8 A;  1NVP D;  2Q73 A;  4BWA A;  1Y76 A;  2F95 B;  2H8P C;  1HR0 B;  1NI8 A;  4J9Y B;  3H01 A;  5LP6 C;  3ZX6 A;  4JI4 B;  5L3F A;  4UVB A;  1J95 A;  2L6L A;  1H8E G;  4I55 B;  3JAS B;  1H38 A;  2XTA A;  2ZE6 A;  1FXK C;  1OCC B;  4FLT A;  2LP7 A;  4WBN B;  1VAR A;  4A5U B;  5KX5 B;  3B4S A;  4DR3 O;  3LNN A;  2W0F C;  2Q6A A;  1MG1 A;  4LF9 B;  1CEZ A;  1VQM V;  1K8A W;  3RYH B;  3CMA V;  3CCQ V;  3G71 V;  4PA6 A;  1H2K A;  1WA8 A;  2QM8 A;  3ETD A;  2P22 C;  4AHC A;  5EBM C;  1Y74 A;  3K03 A;  4DUZ O;  4RUF A;  4TOI A;  5GTI Z;  5KUK A;  1JJO A;  2DQ0 A;  4UCU A;  2X7R B;  1Q3E A;  1I94 O;  1W2B U;  4JAU A;  3S3X A;  1S5H C;  2ZE7 A;  4UCV A;  2A9H A;  5LHI A;  3AG2 C;  5K1X A;  4ASU G;  3CCJ V;  1YEW A;  2CK3 G;  1NH2 B;  4JZG A;  5IWA O;  2IJI A;  5IT9 N;  4CC6 A;  1COW G;  1F4M A;  4MVO A;  2WLL A;  2AXT Z;  3ETQ A;  1D5N A;  3OAA G;  1BMF G;  4DR3 B;  1SA0 B;  2EX3 A;  2Y4U A;  5B3S B;  5EYP B;  2AZ2 A;  1XMQ O;  4PDR A;  3SPH A;  1B04 A;  2ZDI C;  2OCC B;  1JJ2 U;  1MZF A;  2DYR C;  2WLI A;  3JSN A;  1S5J A;  4DUZ B;  5B66 Z;  3K9S A;  2FL4 A;  2LW7 A;  4BAY A;  2ZNJ A;  2Y0P A;  2EIL B;  3CC4 V;  1CPY A;  1KYO F;  2RMK B;  1NH2 D;  1AJQ A;  2CGO A;  4D7S A;  1I94 B;  3PJS K;  3KCY A;  3OD4 A;  1GAX A;  5B5E Z;  1R1B A;  1H2N A;  3JD3 A;  4Q6G A;  5IWA B;  3ZHR A;  3RYI B;  1QVG U;  2PGG A;  4QGP A;  4PA4 A;  4JI3 O;  2YXH A;  1WP8 A;  1XMQ B;  1N0J A;  2YID A;  4LF8 O;  3O65 A;  4R7C A;  4O4J A;  4MTG A;  1NT2 B;  4U7O A;  1AIL A;  1FFT B;  2LFR A;  3SPC A;  3JD1 A;  1YVW A;  1Q7Y W;  1NZ6 A;  1ZLZ A;  1XIL A;  1OCR C;  1B6Q A;  4GX1 A;  4BW5 A;  1XUQ A;  2WPD G;  1IXM A;  4PDV A;  1JPX A;  3EXA A;  4O2B B;  3QVN A;  3ZMV A;  2Y4T A;  2UXC O;  3CCS V;  4PD4 F;  2GSM B;  1TUE B;  3UO2 A;  2FB5 A;  3BA9 A;  3E86 A;  4PEL A;  1WN7 A;  2QE7 G;  2KB1 A;  5JH7 A;  5D5Q A;  3LDD A;  3T2M A;  4W4L A;  2A06 H;  3ABU A;  1BS3 A;  3AK1 A;  4MW3 A;  3TJT A;  3H1J H;  1FXH A;  1L1F A;  1XHZ A;  3DXR B;  1XHX A;  1MSW D;  3E8H A;  3TXS A;  3SYC A;  2YC0 A;  4QPK A;  5B1N A;  4MVU A;  3BHP A;  4TV9 A;  1US6 A;  1WA8 B;  2X6B A;  3GWK C;  1Q86 W;  1QVF U;  4X64 O;  3BAB A;  3ABK C;  2UXC B;  1FXV A;  4PDM A;  4FJC C;  1N4C A;  2L35 A;  3FB6 C;  1ROP A;  2P4V A;  3FAV B;  5B1A C;  5IYZ A;  2CAZ C;  1SQB H;  1KBH A;  1V55 C;  3AG1 C;  3IC9 A;  5LOV A;  5LP6 B;  2Z3Y A;  4I0X B;  5LMN O;  1THZ A;  3OT7 A;  5KMG A;  2Q69 A;  3OMI B;  1FXK B;  4UCR A;  2YI8 A;  1WLE A;  2WLL B;  2Y69 C;  3OMN B;  3OEE G;  3SJB C;  1SES A;  1K3E A;  2ITC C;  3OUF A;  1IX9 A;  1BQZ A;  4AIL C;  3MD0 A;  1G1X B;  1ZSP A;  4UCS A;  2QTS A;  1GRJ A;  1PM9 A;  3QF7 A;  3UCS C;  4J7J A;  2GTS A;  5BZB A;  5EBW C;  1R6T A;  2IW5 A;  1PNL A;  4X64 B;  5IY5 C;  3UKM A;  5LYJ A;  4JTA B;  2XAS A;  2WA4 A;  4JI7 O;  5CA1 A;  1I7F A;  5EZY B;  3RYC A;  1YDX A;  4UV8 A;  4P2Z A;  4IHJ A;  2JJ2 G;  3ZS8 C;  5H2F Z;  2XAH A;  1IBK O;  4EB6 A;  1X4T A;  2K9P A;  5LMN B;  1VMG A;  2UXD O;  3HKE A;  3G6B A;  4MSW C;  2C2A A;  4P30 A;  4YXW G;  2ZD9 A;  2IU0 A;  4D6T H;  1NTM H;  3ZMU A;  3CRQ A;  1F4N A;  4J11 A;  2IBZ H;  2K1E A;  2NR5 A;  4JI1 O;  5JJN B;  1XNQ O;  4W4K A;  5JQG A;  4PI2 A;  1ENV A;  1JFF B;  3CRM A;  4CH6 A;  2KG7 B;  4UUJ C;  4JV5 O;  2EIN C;  2DYR B;  3MAQ A;  2ZIO A;  4WFB V;  2P67 A;  2ZR3 A;  1GTO A;  1YIT V;  2YUA A;  1GMG A;  2YDE A;  4J80 A;  2WLJ A;  4JI7 B;  4HNA A;  3JAK B;  4WFF A;  3S3W A;  1QHT A;  5LGU A;  2PZS A;  2CTP A;  2OWO A;  4GX0 A;  3ZHQ A;  1IBK B;  2M6Y A;  1DLB A;  2V4D A;  4I4T B;  3STL C;  4JF3 A;  1K97 A;  1M5I A;  2UXD B;  3B8M A;  2AW9 A;  5IJ9 A;  1EBO A;  3KCX A;  3JCZ A;  1Q43 A;  3BRC A;  4PJ0 Z;  2RJZ A;  5DM6 V;  2QTO A;  4CH4 A;  1PP9 H;  2JVD A;  3K79 A;  4JI1 B;  1XNQ B;  4LBE C;  3ZMS A;  3K06 A;  3NR7 A;  2CTR A;  3RN4 A;  3IFX A;  4JZ2 A;  3CCU V;  1B3Q A;  3W7U A;  1W0J G;  4YIO A;  4J7Z A;  2YI9 A;  4NYK A;  3ZRW A;  3JCU Z;  3CCL V;  1XMO O;  4X65 O;  1D5A A;  4U7N A;  4IIJ B;  1IVS A;  4QPJ A;  4MVM A;  1OCR B;  4JYC A;  3CCE V;  3OFN G;  2OIE A;  4LR3 A;  5LBQ A;  1FFX B;  4TV9 B;  2W6I G;  1WJZ A;  4G28 B;  3SJA C;  3CRC A;  1KB9 F;  5ITZ A;  3FYI B;  4UCT A;  1R6N A;  5IE9 A;  1DGS A;  4G2K A;  5FNV A;  3H1I H;  1XQ8 A;  2ITD C;  5LHG A;  2YIC A;  1H2L A;  2QWP B;  1EN5 A;  3OMA B;  4MT8 A;  4DR1 O;  3WFV A;  2ZIN A;  1K73 W;  3W7W A;  3CYO A;  1JOY A;  1N8R W;  4X1K A;  5BXZ A;  2UUC B;  1VEW A;  3RGB A;  4JI5 O;  2X0L A;  3D36 A;  2HLD G;  3JAW B;  4Z1M G;  1XMO B;  4X65 B;  4LFB O;  4DR2 O;  2EIJ C;  1YJW V;  1S5L Z;  3B77 A;  2BOB C;  1U97 A;  2HKO A;  1JMK C;  1AI7 A;  5GON A;  1M93 A;  1Y4M A;  2YSU B;  1O9H A;  3ABK B;  3RW0 A;  2E74 B;  5GTH Z;  3ASO C;  3Q4H A;  1QLE C;  4FZ0 A;  4PDL A;  5KHJ A;  1LNQ A;  2Q0O C;  1FYJ A;  3HR0 A;  5B1A B;  1FAF A;  3LDC A;  3IGA C;  4LH7 A;  1ZUQ A;  2RQ6 A;  4B3M O;  2IJK A;  4GX2 A;  3AG1 B;  2VS0 A;  1XL6 A;  4NB5 A;  2FKX A;  2QWQ B;  4DR1 B;  1Y6X A;  1ZTE A;  4DUY O;  1M56 C;  4N21 A;  4JI5 B;  3ZBH A;  1ORQ C;  2Y69 B;  4X9Q A;  2ZT9 B;  1HNW O;  3BVO A;  3BCC H;  1VQN V;  2JJ1 G;  4LFB B;  4DR2 B;  4MS2 A;  3ZHV A;  2CH7 B;  1E1R G;  4O2A A;  3QG5 A;  4KP4 A;  2P7T C;  1HR0 O;  5IY5 B;  2BSK A;  5J2U A;  4U3J A;  4JAV A;  1BGY H;  2QM4 A;  1K7D A;  1QQC A;  3OM3 B;  4UV9 A;  4FK5 C;  2AZ0 A;  1YIJ V;  4LF7 O;  3FB7 C;  5J2T A;  3LSQ A;  1ZX3 A;  3OTO O;  1YTF D;  5LGT A;  1XEQ A;  3P3N A;  3DGE A;  5CA3 A;  3B2E E;  3K5O A;  3HKB A;  2EJ7 A;  4DUY B;  2ZR2 A;  3JAL A;  4DRX B;  3R65 A;  1HNW B;  4OPH A;  4NXN O;  2DE0 X;  1P49 A;  5IYD O;  2Q68 A;  5BMV B;  4LFA O;  2WA3 A;  2N74 A;  3UM7 A;  4EFB A;  4PA3 A;  2B1I A;  2B1G A;  4MVS A;  5KHH A;  4JI0 O;  4J7K A;  5B1O A;  2EJR A;  2X6A A;  1QR9 A;  2Z5U A;  4CC5 A;  4TV8 A;  3TK1 A;  4QJF B;  5KA6 A;  4TUY B;  4KHP O;  1DF4 A;  1SQV H;  1YZB A;  1AI6 A;  2UXB O;  4B3R O;  3ZCC A;  2BTQ B;  2KSD A;  4LF7 B;  1JX9 A;  3ZJZ A;  3CHX A;  1SQF A;  4ABM A;  3CD6 V;  2QEX V;  2ZQM A;  3HKD B;  3OTO B;  1NU1 H;  4E2L A;  5DN6 G;  1P84 F;  3K3W A;  1VQK V;  1K34 A;  2UUB O;  1GN6 A;  3DSQ A;  1L0N H;  4JAS A;  4OPA A;  1Q90 D;  5ITZ B;  1FKA O;  2XAQ A;  4HBN A;  4NXN B;  5FLX N;  3CXC U;  4LFA B;  3CJH A;  4LC1 A;  1HNZ O;  4JI0 B;  2IM9 A;  5D5P A;  2EIK C;  1I5Y A;  2JGD B;  1H2G A;  4KHP B;  1BQ0 A;  1N34 O;  4B7K A;  2UXB B;  1Q6I A;  3JAT A;  4DV5 O;  4B3R B;  1KKC A;  4X62 O;  5L3B A;  5CMU A;  3A0H Z;  3D3I A;  5B1B C;  4UVC A;  3HPL C;  3F7V C;  2UUB B;  4RWU A;  2BCC H;  3Q4H B;  3CE2 A;  1QU7 A;  4WF9 V;  2AGA A;  3I55 V;  1LR1 A;  4JAA A;  1WP7 A;  2DOS A;  3WB1 A;  1SET A;  1RM1 B;  1HNZ B;  4FLU A;  2IH3 C;  1TVK A;  4NTY A;  5KA5 A;  1QBZ A;  2DYS B;  2YEV A;  3E22 A;  4YJ3 B;  4RQF A;  3E83 A;  3HKC A;  2ETN A;  4QE9 A;  4F6R A; 
#chains in the Genus database with same CATH homology
 1ZL8 A;  1Y76 A;  1Y74 B;  1VF6 C;  1ZL8 B;  3B40 A;  1VF6 A;  1RSO B;  1Y74 A;  1Y76 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...