1ZL8A

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
GSLNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
molecule keywords LIN-7
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8A00
1Y76B 1VF6C 1Y74B 1ZL8A 1Y76A 1ZL8B 1RSOB 3B40A 1Y74A 1VF6A
chains in the Genus database with same CATH superfamily
5LXTB 1COWG 4PI0A 2F1MA 3K58A 4JYAO 3OEHG 3P30A 4UCVA 4WBNA 3R66A 2VWKA 1R6KA 2YC0A 3OD4A 3HB3B 1OCRB 3A8TA 2FMLA 2KG7A 2W6JG 2EULA 4DUYB 4JYBA 3U0ZA 1FXVA 2QKCA 2OYQA 1AR1B 4DR4O 4ASUG 1K3EA 4AILC 3S3WA 3U11A 3LSQA 1KB9F 2IJKA 2WLKA 2VWJA 1FYJA 1YJNV 4UVBA 1K33A 5K1PA 4PELA 1K5QA 2G38A 1AILA 3UM7A 2QWRB 3FAVB 3JD0A 3ABUA 2YIBA 1PNKA 4I4TA 2F95B 4I7ZB 4DV3O 4KUMA 2E5LB 2WLIA 1FFTB 4O4HA 5CBHA 1Y4MA 4LF7O 2ODMA 1SQGA 3EVKA 4PDLA 5IT9N 1IBMO 1E1QG 3CCQV 1PP9H 4UCSA 4UUJC 5IJ0A 5L3CA 1IBKB 3G67A 3JARA 2ADQB 5IDJA 1WP7A 1YXBA 1XHZA 3CP1A 4Z2WA 2GHYA 2N74A 4AHCA 3ZMVA 2EX3A 5CA1A 1F23A 3F5WC 4NTWA 3AK3A 2Q73A 3JD4A 4ZOLB 4FK5C 4I50B 4DR7O 3E8HA 4LF5O 3RYIB 4E4EA 2ZD9A 1BCCH 3G80A 4O4JB 1K97A 4KP4A 3JYCA 4J9YB 5CA0B 1OCZB 2Q7HA 4IIJB 3CJHB 3ZMSA 2OWOA 1AVMA 2ZDIC 4I55B 5LHIA 3CCJV 2R9AA 4MTFA 3BVOA 4FM0A 1XDCA 5FNVB 4TV8A 1OCZC 1PPJH 2DW4A 2P4KA 2KSDA 4YHHB 2LO1A 2Z5UA 2QKSA 2X6AA 2E3CA 3KKYA 1Y66A 1M57C 2HKOA 1W0JG 5JJEB 3APOA 1HNZB 4EFEA 4W4KA 3TK1A 4ZHQB 4LFCO 1SQVH 2YICA 4CH5A 4TQFA 5JVDA 1XNRO 3ZHSA 1E79G 4HNAA 2ITDC 2YEVA 4QPJA 5J2TB 3E86A 3OM3B 2ZKOA 3R65A 4CH3A 1YITV 2Q68A 4N23A 4X1KB 4XDKA 3DC5A 4FZ0A 2Y69C 2QWOB 5KUMA 1EM1A 1M1KW 4LF9B 2WLLA 3JSLA 3ABMC 1R3LC 3RYCB 4JAAA 3IC7A 3A0BZ 1QHTA 3CRRA 1FXKA 4MVRA 4R50A 2PI5A 3KCXA 1AP5A 5CB4A 3TGUH 4NTXA 1QLEC 2XT9A 3W7TA 2X6CA 4R8CA 2D3OW 4NTYA 3OTOO 3CJHA 3WG7B 1R3KC 4X8AA 3ASNC 5EC2C 3CD6V 5KMGB 4TWKA 3ZRWA 4J41A 3QO5A 2RNBA 5L3FA 4CH6A 2UXBO 2DOSA 1UJWB 5B1AB 4GX2A 3ABLB 3K3WA 3OGCC 5CA1B 4WF9V 2PTMA 4NYKA 4GX0A 1RSOB 5KLVH 4G28B 4FM1A 2HP8A 2UUCO 5B1AC 2F23A 1UFIA 1AI5A 1CXZB 5HFMA 5IYDO 4H13B 4O2AB 3QF7A 3RYCA 1ZSPA 4FLTA 2BSKA 3APQA 3P32A 1TA8A 4J80A 4PA4A 5EBWC 4DV2B 3ZHUA 2CE4A 3K5LA 4QGPA 4X65B 4GKKO 2EJRA 3B8MA 3HKCA 4O4LA 5EZYB 1Q3EA 1XL4A 2L35A 4BIUA 1U96A 2A06H 3ETGA 4TSFG 2OT5A 3SJQC 1J5EB 2DJVA 1N33B 4WFAV 3TJTA 2H94A 3CCSV 4WFGA 3P3PA 1V55B 4O2AA 3WU2Z 4BW5A 3AK1A 4UCTA 2VQEO 3IJ4A 4FMTA 4JAVA 1HWYA 2EZOA 1H8HG 1N34O 1IURA 5LHHA 2WPDG 4LFAB 3D36A 3K03A 1N34B 4DR5O 1B6QA 3DSQA 3AG2B 4GCZA 2QTOA 3CCEV 3GWKC 2EILB 1VQMV 4UCUA 2QWNB 4MVSA 5H2FZ 4FLXA 1V54B 4DV0O 3BPZA 1JR9A 1BGYH 2PYJA 2UXNA 2KKWA 4F6RB 1ORQC 2EIJB 3CX5F 2HEPA 3IFXA 3X2QC 3AG3C 3WFVA 4DR7B 4OPHA 1XBLA 2K9PA 1WNSA 4GKJB 1R6TA 2ZM6B 2QWQB 2ZIMA 3K04A 1B04A 5J2UB 1THZA 2IJHA 1D2DA 4B7EA 5CMUA 1DLBA 3FKSG 1J95A 4YIOA 3VQYA 1ENVA 1SETA 3HKEB 2PF4E 4HBNA 2M6YA 4PDMA 3DXRA 4I5SA 3I56V 5D5PA 1IXMA 3LSUA 4DV7O 3B4SA 4I9QA 1H2SB 3C3SA 1Q82W 2CDYA 3RFRA 5IY5C 1IVSA 4YJ3B 1Q6HA 5JH7B 5B3SB 5L3DA 1SQBH 3VBBA 1HDJA 1WLEA 1TAEA 2JDIG 2EIKB 4RQEA 1VMGA 4DV4B 3VQWA 4FZ1A 3HKBA 1R1BA 2DN9A 1SQFA 1YJ9V 2LGWA 2PUSA 3HKBB 3EHBB 1Y74A 2JGDA 2KG7B 3SYPA 1XNQO 4CS2A 1GM9A 4WFEA 4FM2A 4UFZA 1AJNA 2YUAA 4QPKA 4LF6B 1S76D 5EBLC 2MK3A 2YDEA 4UV9A 4LFBO 4MVZA 1NTKH 4JI6O 4DR6B 1P7GA 3JD1A 3BABA 4B3RB 2Q4PA 4O4IB 1YDXA 1BHAA 4L87A 2UUBO 1JA8A 1UPGA 3SJAC 2IJIA 3WB0A 1P84F 4O2BB 3F5TA 3F7VC 4CZZA 3G6EV 4DR1B 1I5YA 1WN7A 3K5OA 3PJSK 3STLC 1PKXA 4GUNA 1EZJA 5A9GA 1N32O 1MOFA 2H3OA 3KZIZ 1W2BU 4PD4F 2ZNIA 4YY3O 4H33A 2RQ6A 3JAMN 2UXCO 4F6EA 4LWSA 4PI2A 2UUAO 2QE7G 2XTAA 1GN3A 3WB1A 3D36C 1JFFA 4PA3A 5EBMC 1VF6C 4AQYO 1W59A 2ZR2A 4EB6A 4JYYA 2YIAA 5LMUO 3L75H 3ZRVA 2V7QG 3K57A 3OTFA 2L6LA 1VF5B 3SPCA 3ZHTA 1VQ7V 4FLYA 5GTIZ 1L1FA 2GBOA 4LNUB 2PI4A 5L3BA 2UUAB 5EK0A 5EIBD 3T1YO 3LDEA 4LF4B 3IAYA 3ASNB 1FJGO 2E75B 4U3JA 1QNMA 2IU3A 2GSMB 4X66O 4MW8A 1Q90D 3K5MA 4CH4A 2QM8A 2A3QA 3ZJZA 4IGGA 1SQXH 1VQ4V 4UV8A 2WA4A 2Q5ZA 2HJDA 3N2KA 5IJ9B 1MG1A 3CRQA 3AG1B 3K59A 1FXKC 4Q20A 2ZXWB 1H2KA 1D5NA 4P2ZA 1XMQB 4FFKA 1M56C 1QU7A 1PNMA 3OFNG 2CTRA 3BA8A 4DR6O 1EN4A 3SYQA 3OMIB 4DV5B 2B1IA 4LF7B 3B8NA 3JCUZ 5EYPA 4DV1B 1R6NA 3A0RA 3CCLV 2N04A 5TISZ 3UT5B 3HPLC 2IH3C 5C8YB 5KHKA 3VQXA 5KHJA 5JQGA 5CB4B 4KXRA 4RUFA 5KX5A 1FD9A 1GO3F 5GW7A 5LYJA 4JI2O 1KUQA 4D6TH 4DR4B 1X4TA 2Q9LA 5DM6V 4RWUA 1I94O 1OCOB 2JGDB 2JIZG 3W7UA 2P22C 1TGOA 1OV9A 2Y48A 2LJ2A 4HZ3A 3L9DA 5JVDB 1NQTA 2RCVA 4E2LA 5DECA 3H1LH 4RAIA 4WFHA 2W6IG 4WCEV 2ZE7A 5EC1C 4B3TO 3A2FA 3K0DA 3B40A 4DV1O 1G6UA 4R6ZA 2Z0AA 1QR8A 4X64O 4X66B 2PY5A 1HR0O 3C3TA 3IGAC 3O9OA 4NXNB 1VP7A 1OZ0A 1BSMA 1URFA 1XL6A 3TETA 1QCEA 1JPXA 2FB5A 2QJ1A 4JTCB 5LXTA 3ZRXA 4LH7A 4X1KA 5H6RA 2Q0AA 4N21A 3QG5A 3SPHA 5DEDA 1SQPH 1NZ6A 2F43G 3E8BA 4MVMA 3QO8A 3JAWA 4DR5B 3MHHC 3OW2U 5B1NA 1JMKC 1K34A 1LUVA 4F4LA 3JAKA 3UQ8A 2ZE5A 2CTQA 1H8EG 3IC9A 5FPRA 2AZ2A 5LP6B 5B1BB 2JEUA 2OCCB 2FKXA 3Q4HA 3CRMA 4TV8B 4C7UA 1PL4A 1KP3A 1KBHA 3ICXA 2H8PC 1FFXA 4J10A 3ABMB 3AG3B 5BMVB 2PYLA 1OCCB 1LR1A 1ZL8B 1VQOV 4O4JA 1BQ0A 4YJ2A 2CTPA 4PDVA 2EIMC 5FPOA 4J7ZA 1SC5B 2JGUA 2UXXA 3SJCC 4MW3A 3N27A 4HNAB 1Q8IA 1K73W 5LGTA 3K0GA 3CS5A 5J9PC 3K08A 3S3XA 1Q6IA 4BAYA 3OMNB 4B3RO 1M5IA 3AK2A 3CEIA 4JAUA 4D7SA 2OIGA 3K79A 3N2GB 1BZKA 3ZMZA 2LFRA 3BRCA 5E79Z 2P7TC 3ASOC 5LYJB 4CC5A 2AXTZ 1NTZH 1VQNV 1ZUQA 4X20A 2UXBB 1Y6XA 4DW0A 4O2BA 5LOVA 1FPOA 1RSOA 4OGQB 3HKCB 3ASOB 2PGGA 4A5UB 1YZBA 2EZPA 3ZX6A 2Y0IA 3OTOB 4GZRB 4R7CA 3CE2A 1GN4A 4U3FH 3U10A 1AJQA 3LDDA 4DRXB 2P06A 2ZQMA 5LA6A 2YI9A 1Q5OA 1BS3A 2CAZC 4TUYA 2VS0A 3CRAA 1NTMH 3FYIB 4DUZB 1YHQV 4BIOA 2LW1A 4QE9A 4DV5O 3FB7C 2HHHB 1QLNA 3CXCU 1M57B 5A2QN 2B5UA 1WPXA 2AZ0A 4X20B 1M9NA 1I7FA 4PA7A 1I5XA 4HAMA 4Z1VA 1DTOA 1OCCC 2WLMA 2BCCH 2BTQB 4NR1A 4YJ3A 2OIEA 2XAJA 4LFCB 5IY5B 5LP6A 2ZM6O 3AG1C 4BWAA 4LH6A 4AI8A 2Y69B 1S5JA 1H38A 5BR8B 2ZDIA 5EYPB 3ZHQA 1SA0A 2ILMA 4LFAO 4JZGA 3B77A 2W0XA 4KL1A 3ZCCA 4UB6Z 1JJOA 3CSXA 3T1YB 4LF4O 1IXBA 2Y4TA 1HNXB 2GUZB 4X1IA 3B09A 2XUMA 4NXMB 1QVFU 1AROP 2YI8A 2P67A 4QE7A 5LL6Y 1M56B 2WSSG 2DQ0A 2E76B 5JJNB 3CHXA 3JARB 4DV0B 1J5EO 1N33O 1GM7A 3RBZA 1W0KG 3DGEA 3JALB 3SPIA 4JV5O 1K4DC 3HKDB 1K7DA 5KAFZ 1XHXA 1WAZA 3ABKC 2UXCB 4IL6Z 3UT5A 4LCUC 1M90W 3QO7A 4LF5B 4DR3B 1YF2A 5ITZA 3OT7A 5HFLA 4WFBV 1ZX3A 4O4IA 1KC8W 3M7MX 2OCHA 5IYCO 1AP6A 2X0LA 1A32A 3ML0A 3RYFB 3H01A 2A9HA 2YIDA 3ZRWB 4DO2A 1VQLV 3LSSA 1JVMA 4LC1A 1B06A 2QR4A 3L71H 4JI6B 2QEXV 1HNWO 3T4ZA 2QM4A 1AI7A 1GH6A 1XQ8A 3E2EA 1FFXB 2HHHO 4LF6O 1QBZA 2D2CB 4DUZO 5IYZB 1PV0A 3CWBH 3E35A 2F93B 2CGOA 1V55C 1XNQB 1SF9A 3TXSA 3LDCA 4U3JB 3H9VA 1BHBA 3JAKB 5B1OA 1AR5A 2UUCB 1DF4A 4MTOA 4K0KB 3E83A 3I5DA 4NB5A 4JI1B 3CXHF 3ZS8C 1RFYA 3WB2A 2BSKB 1Q86W 3G71V 4TOIA 3HKEA 4DV7B 2P6JA 1NJIW 4QJFB 1SS3A 1R3IC 3JD3A 1KKCA 3ABKB 4QIWF 5KA6A 4B7KA 4TV9A 1EN5A 3NXSA 3SPJA 2PZSA 4K8ZA 4X9QA 1D5AA 1Q7YW 2HG5C 5C8YA 2NN4A 2XOKG 3D3QA 5LP6C 1K5SA 4H37A 1IZ3A 2JK5C 3J81N 2ARHA 1TVKB 3M99B 3UCSC 5BZBA 3M8AA 4JF3A 4IHJB 2DMXA 4EB6B 4JV5B 3NR7A 3SYOA 2QWPB 4DR2B 2ADPA 1Y74B 1SERA 3CCMV 5IWAO 1OCOC 4JI3B 3FX7A 1KD1W 2QTSA 5KHGA 1K4CC 3Q4HB 2IBZH 1XEQA 2DYRC 1VQ9V 4ZI7A 4JI8O 1VQKV 1NKDA 3W7WA 2WLNA 4YHHO 1VEWA 1H2NA 2V1DA 5B3SC 2V4DA 1GM8A 4O4HB 3JATA 1KKDA 1Y67A 2AHZA 4FPPA 2Y4UA 1H2MA 5KHHA 5H6QA 2ZE8A 3FFQA 2LP7A 2BOCC 1IBKO 3TXQA 1Z5WA 2GTAA 2XAFA 2C2AA 4P30A 4GT1A 2EINC 5CN0A 2EIMB 5KMGA 2LQTA 4JGSA 3HR0A 4MS2A 2Q6AA 1HR0B 1XUQA 4G2KA 4LWSB 4I55A 2K1EA 3K9AA 4P9PA 2Q7GA 3JCZA 4ZKIA 4PJ0Z 3UKMA 5F2VO 4B3TB 3SYCA 1VF6A 2UU9O 1VF7A 2CH7B 4IHJA 2X7RB 1JOYA 3E8GA 4F6RA 2R70A 1GN2A 4LNUA 3RVZA 3X2QB 2ZNJA 1K9MW 2IJJA 3FB5C 2QDOA 4YIPA 3GVMA 1AB3A 1XILA 3MHSC 3CPWU 1WB8A 3E22A 2F4VO 1JCHA 4LF8B 1H2LA 4DV3B 4JYAB 2WAMA 4BR6A 1B3QA 4TQDA 4JPRA 3OE7G 2JJ2G 3RWRD 2GTSA 4U7OA 3CYOA 3H1KH 1MZEA 4H44B 5JCOA 1SRYA 2BTOA 2LW7A 1Y76B 3GB7C 2HLDG 4FFBB 4BW9A 3VQVA 1NS1A 3A0HZ 1KECA 4JI3O 4G27B 4CS3A 4I9WA 4DR2O 3AG4B 1MSWD 4FJCC 1AI6A 3OAAG 1WA8A 2AW9A 4JTDB 1WA8B 5GONA 3RYIA 4XDJA 1NH2D 3RYHB 4MVOA 1XMQO 1DGSA 3LUTB 3THOA 2HR3A 4RO2A 4JI5B 1JX9A 4OXSA 2CH7A 1XNRB 3C90A 3UO2A 1MABG 1Z2GA 4B08A 1XREA 5LOVB 1P4RA 3RN4A 5B66Z 3J80N 1JFFB 4KHPO 1Y76A 2QKAA 5B1BC 4B3SO 4X88A 2E74B 3CC2V 4TV9B 2LGQA 2EILC 3CCVV 1V9PA 1BE3H 2W0FC 1DK1A 1I0HA 5IE9A 2A79B 3VOUA 1SZTA 4DV6B 3BHPA 1FJGB 1T5EA 3ZHVA 5JJJB 1VQ5V 1S0VA 1Q43A 1U97A 2RDCA 1IBLB 3L70H 4D7TA 1BT8A 3O65A 4XBFA 1SKVA 1YSCA 4LF8O 2OTLV 2JRIA 2EIJC 3TCUA 2NLJC 2A7WA 1G8MA 4PDRA 5D5QA 3QNEA 3QTCA 2RN9A 4I4TB 4ZHQA 4I0XA 2UXDO 4JASA 2F66C 2EBOA 4LR3A 1N0NA 1XMOO 1PNLA 3HKDA 4EKWA 1WB7A 5E1AC 1R73A 1L0NH 1N36B 5IJ0B 3ZHRA 2OCCC 1H2GA 1S5LZ 4NVPA 2HFEC 1DF5A 5JQGB 2YIBD 1N0JA 1WJZA 1M4UA 3E22B 1S5HC 1ZLZA 5KA5A 2FTKA 2UUBB 2NR5A 4FLZA 1FS0G 3OUSA 1QR9A 1K8AW 1HNWB 1VQ6V 4JI0B 1SA0B 3RYHA 1R3JC 1F51A 2VQFO 2M7WA 2Q67A 1F7YA 4GYCB 1IBMB 3L72H 1BL8A 3SPGA 1Q81W 5LGUA 5KUKA 4MTXA 1BQZA 2IH1C 3BEHA 3GWOA 2RJZA 2BTQA 3BY6A 4HYOA 1VQ8V 3ETDA 1IX9A 4FFBA 2RMKB 3N2KB 5IJ9A 3CC4V 4J9ZB 4MVUA 4DR3O 4WBNB 4UCOA 2P5OA 1CP9A 4DV4O 1LNQA 1US6A 2XAQA 1SESA 2P90A 5L3GA 4K35A 2EJ7A 4OX9O 4FLVA 4UVCA 4FLUA 4I0XB 5IWAB 2WLLB 2CUGA 4JTAB 3STZC 3CMAV 3KCYA 3JATB 2DWDC 2CK3G 3BA9A 3OEEG 3ZN0A 4NXMO 4KFMA 3DXRB 5J2TA 3OUFA 1S72V 4PV1B 4Z1MG 3BCCH 1RM1C 1YVWA 5IYBO 1S77D 4UVAA 2N05A 5ITZB 1GKFA 4DK0A 3OMAB 2XNDG 5J2UA 5JWPA 1RPRA 1EFRG 3EFFK 3I55V 2JEXA 3B2EE 4K8XA 2DYSC 2XHBA 4PA6A 2QM7A 2GDSA 5CBFA 4UXNA 2WA3A 2B1GA 3CRCA 4ZBMA 1TVKA 1O9GA 5LMNB 1KQSU 1EZVH 5B5EZ 3G4SV 3T1HO 2DYSB 1O9HA 2IW5A 5LMUB 5JH7A 4JI4O 3CCRV 4FIPC 4JZ2A 3H1HH 4DK1A 3AG7A 3FB8C 3DTUB 2FL4A 1VQPV 3ZN1A 4MTGA 3MDSA 1GMGA 4JI1O 3JD2A 4O4LB 5EZYA 4DYLA 2YXYA 1TUBB 4K0KO 3JASB 4ZOLA 2YXHA 5H9CA 1QQCA 3ETQA 4YY3B 1JQ0A 2JJ1G 3T4DA 2QSAA 3OR6C 1LUWA 1VIBA 1FXKB 2VQEB 1AR4A 3QVNA 4X62B 5DN6G 2HVKC 4OPAA 1S3JA 3G6BA 3LNMB 3RVYA 5CA3A 1GAXA 3E89A 5FNVA 1WP8A 3L73H 4JI7B 1IDSA 1NVPD 2XAGA 2R72A 3ETEA 3LNNA 2DWEC 4X65O 4GKKB 1YIJV 3JASA 4IYHA 4LFBB 1VARA 4ICGA 2WLIB 4Q6GA 2QGNA 4DV2O 3RYFA 4RUEA 2WLHA 1FAFA 4L8JA 4B3MB 4YJ2B 4MSWC 3OR7C 5GTHZ 2HVJC 4ZI7B 1L0LH 1E1RG 1MNGA 1KU9A 2Q0OC 2Y0PA 1N36O 4J7JA 1JJ2U 3SDLA 2IM9A 2Q69A 5AG2A 1XI1A 2O57A 3MAQA 2CTWA 3FYEB 4JI7O 5FLXN 2YXLA 3OGIB 1CEZA 1FKAO 2NNUA 2CGNA 4IIJA 1P49A 1HW7A 5LA6B 2ATKC 2ITCC 4X62O 5LMNO 2GUZA 4X1IB 1PM9A 2ZIOA 1HNXO 4UCRA 1GRJA 1IBLO 3RW0A 3WG7C 4UB8Z 3CC7V 1NVPB 3MD0A 1NH2B 2ZR3A 3CB2A 2ZCEA 5BR8O 3PN1A 4DXWA 1NBMG 2DQ3A 2GV9A 1BMFG 1F4MA 4GKJO 2ZT9B 3K06A 4YXWG 2YS8A 4JI4B 4NKGB 4JI5O 3AG2C 5KX5B 1YCIA 5LHGA 4LF9O 1G4YB 3N2GA 2AHYA 2LFSA 1Q6UA 4W4LA 3CMEV 4MT8A 4GX1A 2JS5A 1EBOA 1Z5VA 2BE3A 1ZWIC 4J42A 2DYRB 3SJBC 1WPBA 4RQFA 4PHZA 4IT5A 4X64B 4H0LB 5GONB 3W7XA 3D3IA 4ABMA 3FAVA 4MVQA 5CA0A 4GX5A 1HNZO 3F7YC 1GTOA 4U7NA 4EFBA 1L8DA 2QA4V 1G1XB 2ZINA 5LBQA 3ZIAG 1HP8A 2KQXA 4CC6A 3AEIA 2AGAA 4IYIA 3J7AU 1KMIZ 1QLEB 4CS4A 1YEWA 3P3NA 5IYZA 2JVDA 4J7KA 2MW2B 3FB6C 3KG2A 3SYAA 4FVMA 3JALA 2F4VB 4ZIBA 1OJHA 2Q7EA 4X89A 1GN6A 1I94B 5KAIZ 3T1CA 4J11A 4OX9B 5EIBC 1CPYA 2IU0A 2FYUH 2Q8VA 2HJFC 1YTFB 1ZAUA 4XDLA 5BY1A 1SZXA 3W7SA 2VQFB 1RPOA 4DRXA 4X1YB 1NI8A 4JI2B 2VRZA 2P4VA 1YJWV 4TT3G 1GK9A 1ROPA 1FXHA 1P7BA 2DE0X 2XAHA 2ETNA 4I50A 3L74H 5KHIA 1TUBA 4FLWA 3ZBHA 2ZXWC 1F4NA 1N4CA 2B9ZA 1PL0A 2UU9B 4B3MO 2X6BA 2KB1A 5BXZA 1NR7A 1V54C 3DC6A 4JYCA 5H5NA 3K9SA 3CCUV 1SQQH 1K92A 2BOBC 4GLXA 4PA9A 3K5NA 2WWWA 1NT2B 2UXDB 4JI0O 3D8CA 3JSNA 1KP2A 3RGBA 4DW1A 1KYOF 1OCRC 3UO3A 2JS3A 2E5LO 3ZMUA 1NU1H 4K3AA 3SR2C 5C93A 2XASA 1NR1A 3BFRA 1ZTEA 1ZL8A 1XOUA 1YTFD 4LBEC 1I08A 1AI4A 1RP3B 3AG4C 5LGNA 1XMOB 4JI8B 4LP8A 1AJPA 2YSUB 4WFFA 4B3SB 3ZMTA 2ZE6A 1M93A 2WLJA 2OTJV 4P9OA 3T2MA 5BMVA 4DUYO 1YI2V 3ZRSA 5L3EA 3H1IH 5FL7G 4AQYB 3T1HB 3E8FA 1MA1A 1MSDA 1OHHG 4QNHB 1RM1B 1MMMA 3FD9A 1N8RW 3EXAA 2EINB 3ABTA 5CBGA 5JCOC 2EIKC 4NXNO 3BAAA 1PD3A 4DV6O 1TUEB 4TUYB 4BIZA 3ZEDA 3JAWB 2R9IA 3H1JH 1N32B 3RT3C 5K1XA 1MZFA 2YEVB 1QVGU 2R9RB 4DR1O 2A0LA 4KHPB 3ABLC 3SGIA 2Z3YA 1EN6A 1X59A 4EEQA 4CBCA 4X1YA
chains in the Genus database with same CATH topology
1Y76B 1VF6C 1Y74B 1ZL8A 1Y76A 1ZL8B 1RSOB 3B40A 1Y74A 1VF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 B;  1VF6 C;  1Y74 B;  1ZL8 A;  1Y76 A;  1ZL8 B;  1RSO B;  3B40 A;  1Y74 A;  1VF6 A; 
#chains in the Genus database with same CATH topology
 5LXT B;  1COW G;  4PI0 A;  2F1M A;  3K58 A;  4JYA O;  3OEH G;  3P30 A;  4UCV A;  4WBN A;  3R66 A;  2VWK A;  1R6K A;  2YC0 A;  3OD4 A;  3HB3 B;  1OCR B;  3A8T A;  2FML A;  2KG7 A;  2W6J G;  2EUL A;  4DUY B;  4JYB A;  3U0Z A;  1FXV A;  2QKC A;  2OYQ A;  1AR1 B;  4DR4 O;  4ASU G;  1K3E A;  4AIL C;  3S3W A;  3U11 A;  3LSQ A;  1KB9 F;  2IJK A;  2WLK A;  2VWJ A;  1FYJ A;  1YJN V;  4UVB A;  1K33 A;  5K1P A;  4PEL A;  1K5Q A;  2G38 A;  1AIL A;  3UM7 A;  2QWR B;  3FAV B;  3JD0 A;  3ABU A;  2YIB A;  1PNK A;  4I4T A;  2F95 B;  4I7Z B;  4DV3 O;  4KUM A;  2E5L B;  2WLI A;  1FFT B;  4O4H A;  5CBH A;  1Y4M A;  4LF7 O;  2ODM A;  1SQG A;  3EVK A;  4PDL A;  5IT9 N;  1IBM O;  1E1Q G;  3CCQ V;  1PP9 H;  4UCS A;  4UUJ C;  5IJ0 A;  5L3C A;  1IBK B;  3G67 A;  3JAR A;  2ADQ B;  5IDJ A;  1WP7 A;  1YXB A;  1XHZ A;  3CP1 A;  4Z2W A;  2GHY A;  2N74 A;  4AHC A;  3ZMV A;  2EX3 A;  5CA1 A;  1F23 A;  3F5W C;  4NTW A;  3AK3 A;  2Q73 A;  3JD4 A;  4ZOL B;  4FK5 C;  4I50 B;  4DR7 O;  3E8H A;  4LF5 O;  3RYI B;  4E4E A;  2ZD9 A;  1BCC H;  3G80 A;  4O4J B;  1K97 A;  4KP4 A;  3JYC A;  4J9Y B;  5CA0 B;  1OCZ B;  2Q7H A;  4IIJ B;  3CJH B;  3ZMS A;  2OWO A;  1AVM A;  2ZDI C;  4I55 B;  5LHI A;  3CCJ V;  2R9A A;  4MTF A;  3BVO A;  4FM0 A;  1XDC A;  5FNV B;  4TV8 A;  1OCZ C;  1PPJ H;  2DW4 A;  2P4K A;  2KSD A;  4YHH B;  2LO1 A;  2Z5U A;  2QKS A;  2X6A A;  2E3C A;  3KKY A;  1Y66 A;  1M57 C;  2HKO A;  1W0J G;  5JJE B;  3APO A;  1HNZ B;  4EFE A;  4W4K A;  3TK1 A;  4ZHQ B;  4LFC O;  1SQV H;  2YIC A;  4CH5 A;  4TQF A;  5JVD A;  1XNR O;  3ZHS A;  1E79 G;  4HNA A;  2ITD C;  2YEV A;  4QPJ A;  5J2T B;  3E86 A;  3OM3 B;  2ZKO A;  3R65 A;  4CH3 A;  1YIT V;  2Q68 A;  4N23 A;  4X1K B;  4XDK A;  3DC5 A;  4FZ0 A;  2Y69 C;  2QWO B;  5KUM A;  1EM1 A;  1M1K W;  4LF9 B;  2WLL A;  3JSL A;  3ABM C;  1R3L C;  3RYC B;  4JAA A;  3IC7 A;  3A0B Z;  1QHT A;  3CRR A;  1FXK A;  4MVR A;  4R50 A;  2PI5 A;  3KCX A;  1AP5 A;  5CB4 A;  3TGU H;  4NTX A;  1QLE C;  2XT9 A;  3W7T A;  2X6C A;  4R8C A;  2D3O W;  4NTY A;  3OTO O;  3CJH A;  3WG7 B;  1R3K C;  4X8A A;  3ASN C;  5EC2 C;  3CD6 V;  5KMG B;  4TWK A;  3ZRW A;  4J41 A;  3QO5 A;  2RNB A;  5L3F A;  4CH6 A;  2UXB O;  2DOS A;  1UJW B;  5B1A B;  4GX2 A;  3ABL B;  3K3W A;  3OGC C;  5CA1 B;  4WF9 V;  2PTM A;  4NYK A;  4GX0 A;  1RSO B;  5KLV H;  4G28 B;  4FM1 A;  2HP8 A;  2UUC O;  5B1A C;  2F23 A;  1UFI A;  1AI5 A;  1CXZ B;  5HFM A;  5IYD O;  4H13 B;  4O2A B;  3QF7 A;  3RYC A;  1ZSP A;  4FLT A;  2BSK A;  3APQ A;  3P32 A;  1TA8 A;  4J80 A;  4PA4 A;  5EBW C;  4DV2 B;  3ZHU A;  2CE4 A;  3K5L A;  4QGP A;  4X65 B;  4GKK O;  2EJR A;  3B8M A;  3HKC A;  4O4L A;  5EZY B;  1Q3E A;  1XL4 A;  2L35 A;  4BIU A;  1U96 A;  2A06 H;  3ETG A;  4TSF G;  2OT5 A;  3SJQ C;  1J5E B;  2DJV A;  1N33 B;  4WFA V;  3TJT A;  2H94 A;  3CCS V;  4WFG A;  3P3P A;  1V55 B;  4O2A A;  3WU2 Z;  4BW5 A;  3AK1 A;  4UCT A;  2VQE O;  3IJ4 A;  4FMT A;  4JAV A;  1HWY A;  2EZO A;  1H8H G;  1N34 O;  1IUR A;  5LHH A;  2WPD G;  4LFA B;  3D36 A;  3K03 A;  1N34 B;  4DR5 O;  1B6Q A;  3DSQ A;  3AG2 B;  4GCZ A;  2QTO A;  3CCE V;  3GWK C;  2EIL B;  1VQM V;  4UCU A;  2QWN B;  4MVS A;  5H2F Z;  4FLX A;  1V54 B;  4DV0 O;  3BPZ A;  1JR9 A;  1BGY H;  2PYJ A;  2UXN A;  2KKW A;  4F6R B;  1ORQ C;  2EIJ B;  3CX5 F;  2HEP A;  3IFX A;  3X2Q C;  3AG3 C;  3WFV A;  4DR7 B;  4OPH A;  1XBL A;  2K9P A;  1WNS A;  4GKJ B;  1R6T A;  2ZM6 B;  2QWQ B;  2ZIM A;  3K04 A;  1B04 A;  5J2U B;  1THZ A;  2IJH A;  1D2D A;  4B7E A;  5CMU A;  1DLB A;  3FKS G;  1J95 A;  4YIO A;  3VQY A;  1ENV A;  1SET A;  3HKE B;  2PF4 E;  4HBN A;  2M6Y A;  4PDM A;  3DXR A;  4I5S A;  3I56 V;  5D5P A;  1IXM A;  3LSU A;  4DV7 O;  3B4S A;  4I9Q A;  1H2S B;  3C3S A;  1Q82 W;  2CDY A;  3RFR A;  5IY5 C;  1IVS A;  4YJ3 B;  1Q6H A;  5JH7 B;  5B3S B;  5L3D A;  1SQB H;  3VBB A;  1HDJ A;  1WLE A;  1TAE A;  2JDI G;  2EIK B;  4RQE A;  1VMG A;  4DV4 B;  3VQW A;  4FZ1 A;  3HKB A;  1R1B A;  2DN9 A;  1SQF A;  1YJ9 V;  2LGW A;  2PUS A;  3HKB B;  3EHB B;  1Y74 A;  2JGD A;  2KG7 B;  3SYP A;  1XNQ O;  4CS2 A;  1GM9 A;  4WFE A;  4FM2 A;  4UFZ A;  1AJN A;  2YUA A;  4QPK A;  4LF6 B;  1S76 D;  5EBL C;  2MK3 A;  2YDE A;  4UV9 A;  4LFB O;  4MVZ A;  1NTK H;  4JI6 O;  4DR6 B;  1P7G A;  3JD1 A;  3BAB A;  4B3R B;  2Q4P A;  4O4I B;  1YDX A;  1BHA A;  4L87 A;  2UUB O;  1JA8 A;  1UPG A;  3SJA C;  2IJI A;  3WB0 A;  1P84 F;  4O2B B;  3F5T A;  3F7V C;  4CZZ A;  3G6E V;  4DR1 B;  1I5Y A;  1WN7 A;  3K5O A;  3PJS K;  3STL C;  1PKX A;  4GUN A;  1EZJ A;  5A9G A;  1N32 O;  1MOF A;  2H3O A;  3KZI Z;  1W2B U;  4PD4 F;  2ZNI A;  4YY3 O;  4H33 A;  2RQ6 A;  3JAM N;  2UXC O;  4F6E A;  4LWS A;  4PI2 A;  2UUA O;  2QE7 G;  2XTA A;  1GN3 A;  3WB1 A;  3D36 C;  1JFF A;  4PA3 A;  5EBM C;  1VF6 C;  4AQY O;  1W59 A;  2ZR2 A;  4EB6 A;  4JYY A;  2YIA A;  5LMU O;  3L75 H;  3ZRV A;  2V7Q G;  3K57 A;  3OTF A;  2L6L A;  1VF5 B;  3SPC A;  3ZHT A;  1VQ7 V;  4FLY A;  5GTI Z;  1L1F A;  2GBO A;  4LNU B;  2PI4 A;  5L3B A;  2UUA B;  5EK0 A;  5EIB D;  3T1Y O;  3LDE A;  4LF4 B;  3IAY A;  3ASN B;  1FJG O;  2E75 B;  4U3J A;  1QNM A;  2IU3 A;  2GSM B;  4X66 O;  4MW8 A;  1Q90 D;  3K5M A;  4CH4 A;  2QM8 A;  2A3Q A;  3ZJZ A;  4IGG A;  1SQX H;  1VQ4 V;  4UV8 A;  2WA4 A;  2Q5Z A;  2HJD A;  3N2K A;  5IJ9 B;  1MG1 A;  3CRQ A;  3AG1 B;  3K59 A;  1FXK C;  4Q20 A;  2ZXW B;  1H2K A;  1D5N A;  4P2Z A;  1XMQ B;  4FFK A;  1M56 C;  1QU7 A;  1PNM A;  3OFN G;  2CTR A;  3BA8 A;  4DR6 O;  1EN4 A;  3SYQ A;  3OMI B;  4DV5 B;  2B1I A;  4LF7 B;  3B8N A;  3JCU Z;  5EYP A;  4DV1 B;  1R6N A;  3A0R A;  3CCL V;  2N04 A;  5TIS Z;  3UT5 B;  3HPL C;  2IH3 C;  5C8Y B;  5KHK A;  3VQX A;  5KHJ A;  5JQG A;  5CB4 B;  4KXR A;  4RUF A;  5KX5 A;  1FD9 A;  1GO3 F;  5GW7 A;  5LYJ A;  4JI2 O;  1KUQ A;  4D6T H;  4DR4 B;  1X4T A;  2Q9L A;  5DM6 V;  4RWU A;  1I94 O;  1OCO B;  2JGD B;  2JIZ G;  3W7U A;  2P22 C;  1TGO A;  1OV9 A;  2Y48 A;  2LJ2 A;  4HZ3 A;  3L9D A;  5JVD B;  1NQT A;  2RCV A;  4E2L A;  5DEC A;  3H1L H;  4RAI A;  4WFH A;  2W6I G;  4WCE V;  2ZE7 A;  5EC1 C;  4B3T O;  3A2F A;  3K0D A;  3B40 A;  4DV1 O;  1G6U A;  4R6Z A;  2Z0A A;  1QR8 A;  4X64 O;  4X66 B;  2PY5 A;  1HR0 O;  3C3T A;  3IGA C;  3O9O A;  4NXN B;  1VP7 A;  1OZ0 A;  1BSM A;  1URF A;  1XL6 A;  3TET A;  1QCE A;  1JPX A;  2FB5 A;  2QJ1 A;  4JTC B;  5LXT A;  3ZRX A;  4LH7 A;  4X1K A;  5H6R A;  2Q0A A;  4N21 A;  3QG5 A;  3SPH A;  5DED A;  1SQP H;  1NZ6 A;  2F43 G;  3E8B A;  4MVM A;  3QO8 A;  3JAW A;  4DR5 B;  3MHH C;  3OW2 U;  5B1N A;  1JMK C;  1K34 A;  1LUV A;  4F4L A;  3JAK A;  3UQ8 A;  2ZE5 A;  2CTQ A;  1H8E G;  3IC9 A;  5FPR A;  2AZ2 A;  5LP6 B;  5B1B B;  2JEU A;  2OCC B;  2FKX A;  3Q4H A;  3CRM A;  4TV8 B;  4C7U A;  1PL4 A;  1KP3 A;  1KBH A;  3ICX A;  2H8P C;  1FFX A;  4J10 A;  3ABM B;  3AG3 B;  5BMV B;  2PYL A;  1OCC B;  1LR1 A;  1ZL8 B;  1VQO V;  4O4J A;  1BQ0 A;  4YJ2 A;  2CTP A;  4PDV A;  2EIM C;  5FPO A;  4J7Z A;  1SC5 B;  2JGU A;  2UXX A;  3SJC C;  4MW3 A;  3N27 A;  4HNA B;  1Q8I A;  1K73 W;  5LGT A;  3K0G A;  3CS5 A;  5J9P C;  3K08 A;  3S3X A;  1Q6I A;  4BAY A;  3OMN B;  4B3R O;  1M5I A;  3AK2 A;  3CEI A;  4JAU A;  4D7S A;  2OIG A;  3K79 A;  3N2G B;  1BZK A;  3ZMZ A;  2LFR A;  3BRC A;  5E79 Z;  2P7T C;  3ASO C;  5LYJ B;  4CC5 A;  2AXT Z;  1NTZ H;  1VQN V;  1ZUQ A;  4X20 A;  2UXB B;  1Y6X A;  4DW0 A;  4O2B A;  5LOV A;  1FPO A;  1RSO A;  4OGQ B;  3HKC B;  3ASO B;  2PGG A;  4A5U B;  1YZB A;  2EZP A;  3ZX6 A;  2Y0I A;  3OTO B;  4GZR B;  4R7C A;  3CE2 A;  1GN4 A;  4U3F H;  3U10 A;  1AJQ A;  3LDD A;  4DRX B;  2P06 A;  2ZQM A;  5LA6 A;  2YI9 A;  1Q5O A;  1BS3 A;  2CAZ C;  4TUY A;  2VS0 A;  3CRA A;  1NTM H;  3FYI B;  4DUZ B;  1YHQ V;  4BIO A;  2LW1 A;  4QE9 A;  4DV5 O;  3FB7 C;  2HHH B;  1QLN A;  3CXC U;  1M57 B;  5A2Q N;  2B5U A;  1WPX A;  2AZ0 A;  4X20 B;  1M9N A;  1I7F A;  4PA7 A;  1I5X A;  4HAM A;  4Z1V A;  1DTO A;  1OCC C;  2WLM A;  2BCC H;  2BTQ B;  4NR1 A;  4YJ3 A;  2OIE A;  2XAJ A;  4LFC B;  5IY5 B;  5LP6 A;  2ZM6 O;  3AG1 C;  4BWA A;  4LH6 A;  4AI8 A;  2Y69 B;  1S5J A;  1H38 A;  5BR8 B;  2ZDI A;  5EYP B;  3ZHQ A;  1SA0 A;  2ILM A;  4LFA O;  4JZG A;  3B77 A;  2W0X A;  4KL1 A;  3ZCC A;  4UB6 Z;  1JJO A;  3CSX A;  3T1Y B;  4LF4 O;  1IXB A;  2Y4T A;  1HNX B;  2GUZ B;  4X1I A;  3B09 A;  2XUM A;  4NXM B;  1QVF U;  1ARO P;  2YI8 A;  2P67 A;  4QE7 A;  5LL6 Y;  1M56 B;  2WSS G;  2DQ0 A;  2E76 B;  5JJN B;  3CHX A;  3JAR B;  4DV0 B;  1J5E O;  1N33 O;  1GM7 A;  3RBZ A;  1W0K G;  3DGE A;  3JAL B;  3SPI A;  4JV5 O;  1K4D C;  3HKD B;  1K7D A;  5KAF Z;  1XHX A;  1WAZ A;  3ABK C;  2UXC B;  4IL6 Z;  3UT5 A;  4LCU C;  1M90 W;  3QO7 A;  4LF5 B;  4DR3 B;  1YF2 A;  5ITZ A;  3OT7 A;  5HFL A;  4WFB V;  1ZX3 A;  4O4I A;  1KC8 W;  3M7M X;  2OCH A;  5IYC O;  1AP6 A;  2X0L A;  1A32 A;  3ML0 A;  3RYF B;  3H01 A;  2A9H A;  2YID A;  3ZRW B;  4DO2 A;  1VQL V;  3LSS A;  1JVM A;  4LC1 A;  1B06 A;  2QR4 A;  3L71 H;  4JI6 B;  2QEX V;  1HNW O;  3T4Z A;  2QM4 A;  1AI7 A;  1GH6 A;  1XQ8 A;  3E2E A;  1FFX B;  2HHH O;  4LF6 O;  1QBZ A;  2D2C B;  4DUZ O;  5IYZ B;  1PV0 A;  3CWB H;  3E35 A;  2F93 B;  2CGO A;  1V55 C;  1XNQ B;  1SF9 A;  3TXS A;  3LDC A;  4U3J B;  3H9V A;  1BHB A;  3JAK B;  5B1O A;  1AR5 A;  2UUC B;  1DF4 A;  4MTO A;  4K0K B;  3E83 A;  3I5D A;  4NB5 A;  4JI1 B;  3CXH F;  3ZS8 C;  1RFY A;  3WB2 A;  2BSK B;  1Q86 W;  3G71 V;  4TOI A;  3HKE A;  4DV7 B;  2P6J A;  1NJI W;  4QJF B;  1SS3 A;  1R3I C;  3JD3 A;  1KKC A;  3ABK B;  4QIW F;  5KA6 A;  4B7K A;  4TV9 A;  1EN5 A;  3NXS A;  3SPJ A;  2PZS A;  4K8Z A;  4X9Q A;  1D5A A;  1Q7Y W;  2HG5 C;  5C8Y A;  2NN4 A;  2XOK G;  3D3Q A;  5LP6 C;  1K5S A;  4H37 A;  1IZ3 A;  2JK5 C;  3J81 N;  2ARH A;  1TVK B;  3M99 B;  3UCS C;  5BZB A;  3M8A A;  4JF3 A;  4IHJ B;  2DMX A;  4EB6 B;  4JV5 B;  3NR7 A;  3SYO A;  2QWP B;  4DR2 B;  2ADP A;  1Y74 B;  1SER A;  3CCM V;  5IWA O;  1OCO C;  4JI3 B;  3FX7 A;  1KD1 W;  2QTS A;  5KHG A;  1K4C C;  3Q4H B;  2IBZ H;  1XEQ A;  2DYR C;  1VQ9 V;  4ZI7 A;  4JI8 O;  1VQK V;  1NKD A;  3W7W A;  2WLN A;  4YHH O;  1VEW A;  1H2N A;  2V1D A;  5B3S C;  2V4D A;  1GM8 A;  4O4H B;  3JAT A;  1KKD A;  1Y67 A;  2AHZ A;  4FPP A;  2Y4U A;  1H2M A;  5KHH A;  5H6Q A;  2ZE8 A;  3FFQ A;  2LP7 A;  2BOC C;  1IBK O;  3TXQ A;  1Z5W A;  2GTA A;  2XAF A;  2C2A A;  4P30 A;  4GT1 A;  2EIN C;  5CN0 A;  2EIM B;  5KMG A;  2LQT A;  4JGS A;  3HR0 A;  4MS2 A;  2Q6A A;  1HR0 B;  1XUQ A;  4G2K A;  4LWS B;  4I55 A;  2K1E A;  3K9A A;  4P9P A;  2Q7G A;  3JCZ A;  4ZKI A;  4PJ0 Z;  3UKM A;  5F2V O;  4B3T B;  3SYC A;  1VF6 A;  2UU9 O;  1VF7 A;  2CH7 B;  4IHJ A;  2X7R B;  1JOY A;  3E8G A;  4F6R A;  2R70 A;  1GN2 A;  4LNU A;  3RVZ A;  3X2Q B;  2ZNJ A;  1K9M W;  2IJJ A;  3FB5 C;  2QDO A;  4YIP A;  3GVM A;  1AB3 A;  1XIL A;  3MHS C;  3CPW U;  1WB8 A;  3E22 A;  2F4V O;  1JCH A;  4LF8 B;  1H2L A;  4DV3 B;  4JYA B;  2WAM A;  4BR6 A;  1B3Q A;  4TQD A;  4JPR A;  3OE7 G;  2JJ2 G;  3RWR D;  2GTS A;  4U7O A;  3CYO A;  3H1K H;  1MZE A;  4H44 B;  5JCO A;  1SRY A;  2BTO A;  2LW7 A;  1Y76 B;  3GB7 C;  2HLD G;  4FFB B;  4BW9 A;  3VQV A;  1NS1 A;  3A0H Z;  1KEC A;  4JI3 O;  4G27 B;  4CS3 A;  4I9W A;  4DR2 O;  3AG4 B;  1MSW D;  4FJC C;  1AI6 A;  3OAA G;  1WA8 A;  2AW9 A;  4JTD B;  1WA8 B;  5GON A;  3RYI A;  4XDJ A;  1NH2 D;  3RYH B;  4MVO A;  1XMQ O;  1DGS A;  3LUT B;  3THO A;  2HR3 A;  4RO2 A;  4JI5 B;  1JX9 A;  4OXS A;  2CH7 A;  1XNR B;  3C90 A;  3UO2 A;  1MAB G;  1Z2G A;  4B08 A;  1XRE A;  5LOV B;  1P4R A;  3RN4 A;  5B66 Z;  3J80 N;  1JFF B;  4KHP O;  1Y76 A;  2QKA A;  5B1B C;  4B3S O;  4X88 A;  2E74 B;  3CC2 V;  4TV9 B;  2LGQ A;  2EIL C;  3CCV V;  1V9P A;  1BE3 H;  2W0F C;  1DK1 A;  1I0H A;  5IE9 A;  2A79 B;  3VOU A;  1SZT A;  4DV6 B;  3BHP A;  1FJG B;  1T5E A;  3ZHV A;  5JJJ B;  1VQ5 V;  1S0V A;  1Q43 A;  1U97 A;  2RDC A;  1IBL B;  3L70 H;  4D7T A;  1BT8 A;  3O65 A;  4XBF A;  1SKV A;  1YSC A;  4LF8 O;  2OTL V;  2JRI A;  2EIJ C;  3TCU A;  2NLJ C;  2A7W A;  1G8M A;  4PDR A;  5D5Q A;  3QNE A;  3QTC A;  2RN9 A;  4I4T B;  4ZHQ A;  4I0X A;  2UXD O;  4JAS A;  2F66 C;  2EBO A;  4LR3 A;  1N0N A;  1XMO O;  1PNL A;  3HKD A;  4EKW A;  1WB7 A;  5E1A C;  1R73 A;  1L0N H;  1N36 B;  5IJ0 B;  3ZHR A;  2OCC C;  1H2G A;  1S5L Z;  4NVP A;  2HFE C;  1DF5 A;  5JQG B;  2YIB D;  1N0J A;  1WJZ A;  1M4U A;  3E22 B;  1S5H C;  1ZLZ A;  5KA5 A;  2FTK A;  2UUB B;  2NR5 A;  4FLZ A;  1FS0 G;  3OUS A;  1QR9 A;  1K8A W;  1HNW B;  1VQ6 V;  4JI0 B;  1SA0 B;  3RYH A;  1R3J C;  1F51 A;  2VQF O;  2M7W A;  2Q67 A;  1F7Y A;  4GYC B;  1IBM B;  3L72 H;  1BL8 A;  3SPG A;  1Q81 W;  5LGU A;  5KUK A;  4MTX A;  1BQZ A;  2IH1 C;  3BEH A;  3GWO A;  2RJZ A;  2BTQ A;  3BY6 A;  4HYO A;  1VQ8 V;  3ETD A;  1IX9 A;  4FFB A;  2RMK B;  3N2K B;  5IJ9 A;  3CC4 V;  4J9Z B;  4MVU A;  4DR3 O;  4WBN B;  4UCO A;  2P5O A;  1CP9 A;  4DV4 O;  1LNQ A;  1US6 A;  2XAQ A;  1SES A;  2P90 A;  5L3G A;  4K35 A;  2EJ7 A;  4OX9 O;  4FLV A;  4UVC A;  4FLU A;  4I0X B;  5IWA B;  2WLL B;  2CUG A;  4JTA B;  3STZ C;  3CMA V;  3KCY A;  3JAT B;  2DWD C;  2CK3 G;  3BA9 A;  3OEE G;  3ZN0 A;  4NXM O;  4KFM A;  3DXR B;  5J2T A;  3OUF A;  1S72 V;  4PV1 B;  4Z1M G;  3BCC H;  1RM1 C;  1YVW A;  5IYB O;  1S77 D;  4UVA A;  2N05 A;  5ITZ B;  1GKF A;  4DK0 A;  3OMA B;  2XND G;  5J2U A;  5JWP A;  1RPR A;  1EFR G;  3EFF K;  3I55 V;  2JEX A;  3B2E E;  4K8X A;  2DYS C;  2XHB A;  4PA6 A;  2QM7 A;  2GDS A;  5CBF A;  4UXN A;  2WA3 A;  2B1G A;  3CRC A;  4ZBM A;  1TVK A;  1O9G A;  5LMN B;  1KQS U;  1EZV H;  5B5E Z;  3G4S V;  3T1H O;  2DYS B;  1O9H A;  2IW5 A;  5LMU B;  5JH7 A;  4JI4 O;  3CCR V;  4FIP C;  4JZ2 A;  3H1H H;  4DK1 A;  3AG7 A;  3FB8 C;  3DTU B;  2FL4 A;  1VQP V;  3ZN1 A;  4MTG A;  3MDS A;  1GMG A;  4JI1 O;  3JD2 A;  4O4L B;  5EZY A;  4DYL A;  2YXY A;  1TUB B;  4K0K O;  3JAS B;  4ZOL A;  2YXH A;  5H9C A;  1QQC A;  3ETQ A;  4YY3 B;  1JQ0 A;  2JJ1 G;  3T4D A;  2QSA A;  3OR6 C;  1LUW A;  1VIB A;  1FXK B;  2VQE B;  1AR4 A;  3QVN A;  4X62 B;  5DN6 G;  2HVK C;  4OPA A;  1S3J A;  3G6B A;  3LNM B;  3RVY A;  5CA3 A;  1GAX A;  3E89 A;  5FNV A;  1WP8 A;  3L73 H;  4JI7 B;  1IDS A;  1NVP D;  2XAG A;  2R72 A;  3ETE A;  3LNN A;  2DWE C;  4X65 O;  4GKK B;  1YIJ V;  3JAS A;  4IYH A;  4LFB B;  1VAR A;  4ICG A;  2WLI B;  4Q6G A;  2QGN A;  4DV2 O;  3RYF A;  4RUE A;  2WLH A;  1FAF A;  4L8J A;  4B3M B;  4YJ2 B;  4MSW C;  3OR7 C;  5GTH Z;  2HVJ C;  4ZI7 B;  1L0L H;  1E1R G;  1MNG A;  1KU9 A;  2Q0O C;  2Y0P A;  1N36 O;  4J7J A;  1JJ2 U;  3SDL A;  2IM9 A;  2Q69 A;  5AG2 A;  1XI1 A;  2O57 A;  3MAQ A;  2CTW A;  3FYE B;  4JI7 O;  5FLX N;  2YXL A;  3OGI B;  1CEZ A;  1FKA O;  2NNU A;  2CGN A;  4IIJ A;  1P49 A;  1HW7 A;  5LA6 B;  2ATK C;  2ITC C;  4X62 O;  5LMN O;  2GUZ A;  4X1I B;  1PM9 A;  2ZIO A;  1HNX O;  4UCR A;  1GRJ A;  1IBL O;  3RW0 A;  3WG7 C;  4UB8 Z;  3CC7 V;  1NVP B;  3MD0 A;  1NH2 B;  2ZR3 A;  3CB2 A;  2ZCE A;  5BR8 O;  3PN1 A;  4DXW A;  1NBM G;  2DQ3 A;  2GV9 A;  1BMF G;  1F4M A;  4GKJ O;  2ZT9 B;  3K06 A;  4YXW G;  2YS8 A;  4JI4 B;  4NKG B;  4JI5 O;  3AG2 C;  5KX5 B;  1YCI A;  5LHG A;  4LF9 O;  1G4Y B;  3N2G A;  2AHY A;  2LFS A;  1Q6U A;  4W4L A;  3CME V;  4MT8 A;  4GX1 A;  2JS5 A;  1EBO A;  1Z5V A;  2BE3 A;  1ZWI C;  4J42 A;  2DYR B;  3SJB C;  1WPB A;  4RQF A;  4PHZ A;  4IT5 A;  4X64 B;  4H0L B;  5GON B;  3W7X A;  3D3I A;  4ABM A;  3FAV A;  4MVQ A;  5CA0 A;  4GX5 A;  1HNZ O;  3F7Y C;  1GTO A;  4U7N A;  4EFB A;  1L8D A;  2QA4 V;  1G1X B;  2ZIN A;  5LBQ A;  3ZIA G;  1HP8 A;  2KQX A;  4CC6 A;  3AEI A;  2AGA A;  4IYI A;  3J7A U;  1KMI Z;  1QLE B;  4CS4 A;  1YEW A;  3P3N A;  5IYZ A;  2JVD A;  4J7K A;  2MW2 B;  3FB6 C;  3KG2 A;  3SYA A;  4FVM A;  3JAL A;  2F4V B;  4ZIB A;  1OJH A;  2Q7E A;  4X89 A;  1GN6 A;  1I94 B;  5KAI Z;  3T1C A;  4J11 A;  4OX9 B;  5EIB C;  1CPY A;  2IU0 A;  2FYU H;  2Q8V A;  2HJF C;  1YTF B;  1ZAU A;  4XDL A;  5BY1 A;  1SZX A;  3W7S A;  2VQF B;  1RPO A;  4DRX A;  4X1Y B;  1NI8 A;  4JI2 B;  2VRZ A;  2P4V A;  1YJW V;  4TT3 G;  1GK9 A;  1ROP A;  1FXH A;  1P7B A;  2DE0 X;  2XAH A;  2ETN A;  4I50 A;  3L74 H;  5KHI A;  1TUB A;  4FLW A;  3ZBH A;  2ZXW C;  1F4N A;  1N4C A;  2B9Z A;  1PL0 A;  2UU9 B;  4B3M O;  2X6B A;  2KB1 A;  5BXZ A;  1NR7 A;  1V54 C;  3DC6 A;  4JYC A;  5H5N A;  3K9S A;  3CCU V;  1SQQ H;  1K92 A;  2BOB C;  4GLX A;  4PA9 A;  3K5N A;  2WWW A;  1NT2 B;  2UXD B;  4JI0 O;  3D8C A;  3JSN A;  1KP2 A;  3RGB A;  4DW1 A;  1KYO F;  1OCR C;  3UO3 A;  2JS3 A;  2E5L O;  3ZMU A;  1NU1 H;  4K3A A;  3SR2 C;  5C93 A;  2XAS A;  1NR1 A;  3BFR A;  1ZTE A;  1ZL8 A;  1XOU A;  1YTF D;  4LBE C;  1I08 A;  1AI4 A;  1RP3 B;  3AG4 C;  5LGN A;  1XMO B;  4JI8 B;  4LP8 A;  1AJP A;  2YSU B;  4WFF A;  4B3S B;  3ZMT A;  2ZE6 A;  1M93 A;  2WLJ A;  2OTJ V;  4P9O A;  3T2M A;  5BMV A;  4DUY O;  1YI2 V;  3ZRS A;  5L3E A;  3H1I H;  5FL7 G;  4AQY B;  3T1H B;  3E8F A;  1MA1 A;  1MSD A;  1OHH G;  4QNH B;  1RM1 B;  1MMM A;  3FD9 A;  1N8R W;  3EXA A;  2EIN B;  3ABT A;  5CBG A;  5JCO C;  2EIK C;  4NXN O;  3BAA A;  1PD3 A;  4DV6 O;  1TUE B;  4TUY B;  4BIZ A;  3ZED A;  3JAW B;  2R9I A;  3H1J H;  1N32 B;  3RT3 C;  5K1X A;  1MZF A;  2YEV B;  1QVG U;  2R9R B;  4DR1 O;  2A0L A;  4KHP B;  3ABL C;  3SGI A;  2Z3Y A;  1EN6 A;  1X59 A;  4EEQ A;  4CBC A;  4X1Y A; 
#chains in the Genus database with same CATH homology
 1Y76 B;  1VF6 C;  1Y74 B;  1ZL8 A;  1Y76 A;  1ZL8 B;  1RSO B;  3B40 A;  1Y74 A;  1VF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...