1ZL8A

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
GSLNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN-7
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8A00
1ZL8B 1VF6C 1Y76A 1Y74A 3B40A 1Y76B 1VF6A 1Y74B 1ZL8A 1RSOB
chains in the Genus database with same CATH superfamily
4GCZA 4LFBO 4NR1A 1HDJA 3SYOA 4MSWC 1FXVA 4JI3O 1RPRA 4JI6O 1R3KC 1M5IA 3K5OA 1JFFA 1SQQH 1N4CA 3OM3B 1S72V 4K0KB 2ZIMA 2UXBB 2ZDIC 4W4KA 1SF9A 4JYYA 1Q6HA 4A5UB 2GHYA 2HJFC 2OIEA 3JAMN 1KU9A 2LGQA 4Z2WA 4QE9A 4X66O 1XMOO 1UFIA 2FYUH 2L35A 3ZMZA 1ZAUA 2JIZG 4CS3A 2YIBD 5LOVB 5LYJB 4U3JB 4FZ0A 2ILMA 3H9VA 2PF4E 3CRRA 4B3RO 2WA3A 4I0XB 3HKCA 3HKBA 4BIUA 4CS4A 2WPDG 4X62O 1S77D 5EC1C 3AG3C 2NR5A 2XNDG 3HKDA 4YJ2B 5H6QA 4R7CA 3RYIB 2CTRA 1MZFA 2YXYA 5J2TA 1MOFA 1N34B 3D3IA 4UCOA 5KHKA 3EHBB 4EFBA 5KHJA 3CC7V 3Q4HB 2JRIA 1FFTB 1GAXA 1DK1A 1S5LZ 3T4ZA 4HZ3A 1U97A 1A32A 1KYOF 3MDSA 3K04A 1N34O 1N0JA 3NR7A 2Y69B 1PNLA 2RNBA 4J9YB 4L87A 4UCVA 2GUZB 1VQ6V 3OMIB 5EIBC 1GM8A 3QO5A 4MTOA 2PI5A 4X1KA 1VMGA 3ASNB 1SS3A 3ABTA 4WFHA 3ABMB 1Z5WA 1KC8W 1NTMH 4GUNA 4TT3G 4O4JB 2BOCC 2LW1A 1KKCA 2VQFB 3RBZA 1M56B 3JCUZ 1G4YB 1SA0B 4MVRA 1ZWIC 5LOVA 1R3JC 5LYJA 3HPLC 1WA8B 3P30A 3FD9A 3LDCA 1F51A 3WG7B 4JI8B 1OCOB 1XQ8A 3IC7A 4I0XA 3MAQA 2KSDA 3SDLA 2CH7B 2VQFO 2P06A 4G28B 1VQ7V 2V4DA 5LHHA 2JVDA 4YXWG 3FB5C 4YJ2A 3RYCB 5ITZA 5EYPB 1RM1B 2EILB 2CAZC 1B6QA 4DV7B 2RN9A 2UUBB 1K8AW 2BCCH 4MTFA 2A7WA 4DRXB 3Q4HA 4RO2A 5EBMC 2ETNA 2ITCC 4AQYB 2DYRC 3MHSC 1VQPV 2F23A 4LF4O 4UCTA 4AILC 1N33B 5DECA 3CMAV 1ZL8A 3TJTA 2Q7HA 5FLXN 3D36C 2DYSB 2QM8A 3OGIB 3CRCA 5JCOC 5CBFA 2EIKB 1AR4A 2BOBC 2UU9B 2UXCB 3JD3A 2JS5A 2W6JG 5E79Z 3QNEA 4NYKA 2FB5A 4PDMA 4DV4B 4JAUA 2QWNB 4JI0O 2DW4A 4F6RB 2NN4A 4ICGA 1YTFD 5AG2A 4NKGB 2HFEC 2O57A 4ZBMA 4JGSA 4O4JA 2X6AA 1MNGA 1KB9F 4MVZA 1NH2B 2UU9O 2UXCO 5LMNB 2YSUB 4WBNB 1XNQB 4FLTA 4DV4O 4DR7B 3ZMVA 2QKCA 4PHZA 3CSXA 4DR5B 1S0VA 1Q43A 1SKVA 1VQMV 4QPKA 2CH7A 4JPRA 1U96A 4C7UA 1S76D 3R66A 5CA1B 2CGNA 3FAVA 1AJQA 3CRMA 4JAAA 4ZIBA 3RYCA 1IBMB 5EYPA 3RGBA 3OE7G 4OPAA 2EIJC 2OCCB 3CCUV 2KB1A 5CMUA 3SYAA 2A0LA 4IYHA 1HNZB 3KG2A 4UV9A 2WLLA 3GWOA 1R3LC 2E75B 2VRZA 3D8CA 2F1MA 4ZOLA 4O4IB 1FFXB 1IBMO 3JASB 2YEVB 1OHHG 1M9NA 1BL8A 1NQTA 1NTKH 3ABLB 4JYBA 2HJDA 5K1PA 3AG4C 3JYCA 3W7WA 2LP7A 1WP7A 1K5SA 1I94B 3OGCC 4F6RA 2ZXWB 2DQ0A 4DR6O 2RDCA 2XOKG 1SQXH 4JI7B 3OTOB 2OYQA 2RQ6A 1VF6A 1R1BA 4O4LB 5KUMA 4TWKA 4WBNA 5LXTB 3BCCH 4QJFB 4OGQB 3ZRWB 4J9ZB 3QTCA 1I94O 4K8ZA 3STZC 1R3IC 1P7BA 4J7KA 1I08A 3SJQC 2VQEO 3JARB 4DR1B 1JMKC 3U0ZA 1KMIZ 3VQYA 5KX5B 5CA1A 4QE7A 2Q0OC 3STLC 1H8EG 3E8GA 3OMAB 4FJCC 3WB2A 1UJWB 1HP8A 1IBLB 3ZN1A 1Y76B 2JJ2G 5JWPA 1AI6A 4RQFA 1LUWA 1V54C 2Q8VA 3A8TA 2RCVA 3ASOB 2Y0PA 4BWAA 4DR1O 2GSMB 1MSWD 2CDYA 1NBMG 3B09A 4E2LA 4JYAO 2GTAA 3CCMV 2OCHA 4CH4A 1D5NA 1FFXA 3HR0A 3JASA 2YEVA 2N04A 3C3SA 2YIAA 2QWQB 4DV2B 2Z0AA 4IYIA 1IBLO 3JALB 1NH2D 2BSKB 1XEQA 1D2DA 3SJCC 4X9QA 4JASA 1L1FA 3JD4A 3ZMUA 4EB6B 2YI9A 4E4EA 5B1AB 1URFA 4FPPA 1IVSA 2ZQMA 4BW5A 5B1BB 2W6IG 5HFLA 4LFAO 3K57A 2ZM6B 2D2CB 1YSCA 3LSQA 4X65B 1AI4A 4BW9A 3LNMB 3N27A 2HVKC 2AZ0A 1L0LH 5EBWC 2BTQB 4O4LA 4F6EA 4FZ1A 2HHHO 1K33A 3FFQA 1NVPB 1NJIW 1KBHA 4DW0A 3ZRWA 3C3TA 5IY5B 4LWSA 4BR6A 2EZPA 1Q90D 3ICXA 2X0LA 2VWJA 3JARA 5BMVB 4WFEA 1WP8A 5KX5A 1XHXA 4XDJA 3H1IH 4HYOA 4JTAB 2JEUA 4JI5B 1FD9A 5KMGB 1WB8A 4LCUC 2EINB 4AHCA 4MTGA 1GM7A 2PYLA 1LNQA 1Y76A 5KAFZ 3ZJZA 2ZE6A 4R50A 3OD4A 3OUFA 3E2EA 1DF4A 1XI1A 5K1XA 1QVGU 3IGAC 1M93A 3JCZA 1FJGO 4UCRA 1Q7YW 2K9PA 1GN2A 3JALA 1JX9A 2R9RB 2BSKA 1OCZB 4U7OA 5F2VO 3SR2C 1HNXB 3CCJV 1XL6A 2V7QG 4EB6A 4MVMA 2PI4A 2NNUA 1OCCB 3X2QC 4JI1B 3O9OA 2NLJC 2Y48A 3CWBH 1S5HC 3JAWB 4FLYA 1M57C 1KQSU 2Q67A 4DW1A 4GKKO 3CP1A 4EEQA 2F4VB 4EKWA 3ABKC 5H2FZ 4DV5O 4YIPA 3OR6C 3CXCU 5BMVA 2IH1C 1WJZA 4ZI7B 2QJ1A 5JJJB 2WLIA 1ZSPA 2HKOA 4UVBA 4JTCB 1AILA 5CN0A 1YEWA 5B1OA 4I50B 4H13B 1BT8A 5KMGA 2F4VO 4X20B 3SJAC 1FKAO 1YF2A 5JVDB 2A9HA 1TAEA 4UB8Z 2HG5C 5H6RA 3DC6A 1VQLV 4PI2A 5B3SC 4YJ3A 1H2SB 4PD4F 1E1RG 3DXRB 4EFEA 2M6YA 4IHJB 3ZRSA 5LHGA 4X1YB 4I4TB 2M7WA 1BHAA 4BIZA 4TV9A 2MK3A 3G71V 1VQKV 2KQXA 3E22B 3SYCA 3AG2B 2JGUA 1IX9A 5HFMA 1GRJA 5BZBA 1PM9A 3K79A 4PELA 2B1GA 5TISZ 4K0KO 1KP2A 2UXBO 1FPOA 1ZUQA 2R9AA 4B7EA 4UFZA 3APQA 5L3EA 3G4SV 1DF5A 3JAWA 5LP6C 2WLMA 5FNVB 2XAGA 3E8BA 1J95A 2Y4UA 1B3QA 3ZIAG 3ZHQA 4FLUA 3QO8A 1CPYA 3E83A 2E74B 3LSUA 1FXKC 3AK2A 5IWAB 3ABMC 5IE9A 5IYZB 2EULA 4DV3B 3LNNA 4NTWA 2DJVA 4BIOA 4ZI7A 2Z5UA 1M56C 2ZE5A 3ZMTA 5FL7G 5DM6V 1BZKA 1QR8A 3SPJA 3CD6V 2WLJA 1RFYA 4X20A 3M7MX 5KA5A 3HB3B 1JA8A 3A0HZ 5IWAO 4CH5A 2EBOA 4PDLA 3L74H 1VF7A 1BSMA 2JEXA 3DXRA 1JQ0A 4IHJA 2QWRB 3G6BA 4X64B 5EK0A 4I4TA 2IM9A 4UXNA 4G27B 2UUAB 1L8DA 3AG3B 2P4VA 3E22A 1NI8A 3OFNG 1FXHA 5L3GA 2ZNJA 1V55C 3CC4V 3U10A 2UXXA 4FIPC 4K3AA 4P30A 1MZEA 4MS2A 1TVKB 4U3JA 3LUTB 1W2BU 2LO1A 3MD0A 1VEWA 4LF8B 2ITDC 1F4NA 3ZRVA 5E1AC 5FNVA 1Z2GA 4X89A 1E79G 4FLZA 4PI0A 4NVPA 2QWOB 4JZGA 1GN3A 3L72H 1YJWV 1IZ3A 2Q73A 1H2KA 1JPXA 2Y0IA 3C90A 4CC6A 2Q68A 3ETDA 5LGUA 3RYIA 4Z1MG 1JVMA 2XAFA 4X8AA 4J7JA 1X59A 1VF5B 5IYZA 3CEIA 2F93B 2K1EA 4JI8O 4LF8O 4DK0A 1PV0A 3JAKB 2QR4A 4KP4A 3WFVA 4X88A 2HLDG 3UO2A 2X6CA 2BTOA 4TQFA 4WFAV 2WLKA 4JAVA 2XHBA 1NR7A 3AG1C 1OCRB 3H1HH 4JZ2A 4PA7A 2E5LB 2ZINA 4B3MB 4DV7O 1XL4A 2UUBO 1N32B 1OV9A 2RJZA 4JI2B 4DYLA 4GX1A 2GUZA 3RFRA 4B3TB 2WLHA 4OX9B 4FFBB 4ASUG 4AQYO 4BAYA 4L8JA 2E5LO 4CS2A 1N33O 5LGTA 4PA4A 1SQBH 5EZYB 1M1KW 2QE7G 2X6BA 2Q0AA 1PL0A 1SA0A 2XAJA 2YICA 2JK5C 4JI2O 2QEXV 2FTKA 3F5TA 3A2FA 3ZCCA 3SPIA 3BFRA 1WA8A 1H2GA 4GT1A 3H1KH 5L3BA 4LFCB 1BHBA 4UCUA 5H9CA 1VQOV 2A79B 2QSAA 1HNWB 5KHHA 1RSOB 3W7XA 4Z1VA 5LMNO 2DYRB 3CE2A 1XNQO 2B1IA 3FB8C 3QVNA 4LF9B 2GTSA 1HWYA 4UV8A 2DWEC 4DR7O 1K9MW 4LNUB 1BQZA 4DR5O 2IJJA 4N23A 3JAKA 3DGEA 5KLVH 4FK5C 1XREA 4IIJB 1YDXA 4O2AB 2YUAA 4DRXA 1ZX3A 3OTFA 3B8MA 2ATKC 5J9PC 4GKJB 1JCHA 3JD2A 3TGUH 3GVMA 2MW2B 3ML0A 2QTOA 1F7YA 3U11A 1FAFA 4LH6A 2FKXA 4CH3A 1H2MA 1IDSA 3CC2V 2IBZH 1XBLA 1WLEA 5BXZA 4J10A 1YIJV 1H2NA 1HNZO 2ZIOA 3IC9A 4G2KA 3O65A 3EFFK 5KUKA 1QLEC 2AGAA 2YDEA 4FFBA 2HP8A 2IJKA 1RP3B 1K97A 4P9PA 4LF7B 1CP9A 5EZYA 1XMQB 5L3FA 2AZ2A 1Q81W 4PDVA 2XTAA 2EIJB 4I9QA 2GBOA 1K3EA 4H33A 4FM1A 5EIBD 1SETA 3VOUA 3SPGA 4JI7O 2X7RB 3TXSA 3K59A 3VQVA 3OTOO 1XHZA 1XMQO 1RSOA 3QO7A 3SYPA 1W0JG 4P2ZA 2WLNA 4FLXA 1YJ9V 3CX5F 3D36A 1VP7A 3ZX6A 3FKSG 4LNUA 4U7NA 2LJ2A 4DR2B 3DSQA 5IYCO 3AG4B 3J81N 2QWPB 4DV6B 4TUYB 5KA6A 4IIJA 5LHIA 3K5LA 4K8XA 3K08A 3RN4A 2W0FC 5GONB 3AK1A 3E89A 4O4IA 1KECA 3P32A 1SZTA 1JJ2U 2W0XA 2ODMA 1H2LA 2UXDB 5J2UB 1TUBB 4J11A 2FL4A 4ZHQB 1Y6XA 4TOIA 5C93A 1VQ4V 1WPXA 3UT5B 1R6NA 3ZHTA 3T1CA 2B9ZA 5FPOA 2OIGA 3SPHA 1Q8IA 5JQGB 2R9IA 2A06H 1VQNV 2EINC 5CB4B 2GDSA 2PGGA 4JI4B 3M99B 4DV1B 4DV2O 3BY6A 1EFRG 3G6EV 4R6ZA 2G38A 3CYOA 4FVMA 1L0NH 5L3CA 5A9GA 3BABA 2ZCEA 1EZVH 2D3OW 4GX0A 5LXTA 1GN6A 2XAHA 4J80A 3IFXA 5LA6B 3BEHA 1V9PA 2ZM6O 1Q3EA 1V54B 3PJSK 1MMMA 1YJNV 1SQPH 4X65O 2ZKOA 1WN7A 3M8AA 1AI5A 1YXBA 4YHHB 1Y66A 3CPWU 4TV8B 4H0LB 1I7FA 4RWUA 4MVSA 3KZIZ 1QLNA 2YC0A 3A0RA 3L73H 5CA0B 4LF6B 4TUYA 5B66Z 5KAIZ 3ABUA 5GONA 2UUCB 3K5NA 1B04A 5D5QA 2OWOA 1I5XA 4LH7A 4JI5O 1N36B 3DC5A 1SQGA 1AP6A 4YHHO 3N2KB 2EJ7A 3T4DA 3K06A 2Q7GA 5J2UA 4X1IB 3ZRXA 1AR5A 2HEPA 4ZHQA 4U3FH 3K0DA 3E35A 4LF6O 4WFGA 3UT5A 3SJBC 2DE0X 1NR1A 4KFMA 5IJ9B 1R6KA 2ADQB 5JQGA 4LR3A 4PA3A 4GZRB 2RMKB 2AXTZ 4WFBV 1SC5B 4NTYA 1Y74B 4DO2A 1SRYA 3T1YB 3CJHB 3WU2Z 2F43G 1HNXO 4Q6GA 3RW0A 1BE3H 2BTQA 1VQ8V 2QM7A 3K58A 1PNKA 1KKDA 3RVZA 3ETGA 5LA6A 1TGOA 4JI1O 4JV5B 1THZA 3VQWA 2HR3A 1YCIA 3OEEG 4O4HB 4DR4B 1YVWA 1K34A 1K4DC 4AI8A 3ETQA 1WNSA 3HKDB 1K4CC 5BR8B 1F23A 2XT9A 1Q6IA 3FYEB 4J42A 1M90W 4NTXA 3THOA 1G8MA 1I0HA 4TV8A 4RAIA 3KCYA 4LFBB 3K03A 1AJPA 2CTQA 4JI3B 4JI6B 4WFFA 3CXHF 1H38A 5CA0A 1ZTEA 2ZE7A 3S3XA 2IU3A 4DR4O 3OMNB 5CA3A 3BPZA 3UQ8A 3X2QB 1NTZH 4B3SB 2R70A 2CTPA 2EJRA 1H8HG 2Y4TA 2YI8A 1QBZA 3N2KA 1KUQA 2QA4V 1KP3A 1WPBA 1XMOB 1EZJA 2DN9A 1M57B 3WB0A 4X1IA 4LC1A 2CE4A 1NVPD 4R8CA 5LL6Y 4J41A 2IJHA 5IJ9A 2XUMA 1M4UA 4X1KB 3ABKB 4CC5A 4JYCA 1SQVH 4B3SO 4B3RB 1VIBA 2WWWA 3T2MA 1NU1H 4X62B 1Y74A 2IJIA 3CHXA 2Y69C 2YIDA 4DXWA 3CJHA 2JS3A 4JF3A 4N21A 3I56V 1EN4A 3UKMA 1LR1A 4XBFA 5IT9N 1MABG 4PJ0Z 3ASNC 2EIMB 5FPRA 3KKYA 4ABMA 2C2AA 1QU7A 3D3QA 3WB1A 1YTFB 4O4HA 1XNRB 3JD1A 4PA6A 5B3SB 1EBOA 5L3DA 5ITZB 4I50A 4GLXA 2QGNA 1YI2V 1EM1A 3OUSA 5JVDA 3ZHRA 3J80N 3WG7C 4MT8A 1OCOC 4I7ZB 1Y67A 3OR7C 2DMXA 3OT7A 1VQ5V 1R6TA 4UVCA 1BCCH 1T5EA 4DV3O 4FLVA 1ENVA 4QGPA 1GH6A 3BVOA 1XNRO 1K5QA 1GO3F 4CH6A 5GTIZ 4I9WA 2DWDC 5IYDO 2P7TC 4X1YA 4IGGA 2XAQA 1ZL8B 3L71H 1N0NA 2EILC 3JD0A 1RM1C 5LP6B 1JJOA 3B40A 3R65A 1O9GA 3PN1A 1S5JA 2LFRA 5EBLC 1B06A 1GTOA 1XUQA 3S3WA 2JDIG 4NXNB 4UB6Z 2KG7B 4QPJA 1DGSA 1FXKB 5EC2C 3K5MA 1BS3A 1OCRC 2AHYA 2IU0A 1NS1A 4X64O 3ZBHA 2DYSC 3ZS8C 2UUAO 3UO3A 3KCXA 2EIKC 2Q69A 5LMUB 2LGWA 4NXNO 3SGIA 3UCSC 3QF7A 2OTLV 2F66C 1BGYH 3AG7A 1IXMA 4XDLA 2LFSA 1Q82W 2QM4A 1BMFG 4O2BB 5DN6G 3CCVV 2CTWA 3MHHC 3APOA 3W7TA 4Q20A 1QNMA 5IJ0B 1NKDA 3VQXA 3RVYA 5B1NA 2GV9A 4UCSA 5LMUO 1MSDA 1VF6C 3FAVB 4I5SA 3LDDA 3UM7A 2H3OA 4LF4B 2ZDIA 4MVOA 2PZSA 4I55B 1FS0G 1OZ0A 3BA9A 4D7SA 4GX5A 1VARA 4GX2A 2P90A 3OW2U 1QVFU 4PV1B 1V55B 4DV0B 2WLLB 5DEDA 5GW7A 4JI0B 4ZOLB 1SQFA 2Q6AA 1HR0B 4OXSA 2Q9LA 1EN5A 1OJHA 2OCCC 5LP6A 5LGNA 4TQDA 1AP5A 3F7VC 5JJEB 4B3MO 2BE3A 5LBQA 4KL1A 2CGOA 2N74A 1QCEA 1N32O 1CEZA 3IJ4A 2CUGA 2KG7A 4MTXA 3W7UA 4RUEA 4DV0O 1PNMA 3ZMSA 1FXKA 4B3TO 4HAMA 2A3QA 1TVKA 4OX9O 2XASA 1CXZB 4MW8A 1HR0O 1PD3A 4QNHB 1US6A 3OAAG 3T1HB 1P4RA 1AROP 1AR1B 5JH7B 3ABLC 2P5OA 3TK1A 4FLWA 4PA9A 1WAZA 2YXLA 3AG1B 4GYCB 5H5NA 2ZE8A 4LBEC 4YY3B 2F95B 2ZXWC 2DOSA 3FYIB 3E86A 4O2BA 3CMEV 2P4KA 3L9DA 3A0BZ 3T1HO 2PY5A 1XOUA 5IJ0A 1AJNA 5CBGA 2WSSG 4LFCO 2P6JA 3NXSA 5IDJA 3AK3A 1HNWO 3G80A 3TXQA 3JSLA 4DUYB 3B8NA 4DR3B 3H01A 4KUMA 3BRCA 4I55A 4JTDB 4YY3O 3ZEDA 4MVUA 2L6LA 4LF9O 1IURA 5JJNB 3DTUB 1GKFA 2WAMA 2YXHA 4CZZA 3L70H 1NT2B 3RWRD 2VWKA 4B7KA 4DUZB 2P22C 1KD1W 5GTHZ 1D5AA 2CK3G 4DR6B 2QTSA 2QKAA 1G6UA 4DUYO 4DR3O 4GKJO 3CCSV 2ADPA 2H8PC 3FB7C 1IXBA 4FFKA 1SERA 3ASOC 5A2QN 1XDCA 1K92A 1COWG 1TA8A 3OEHG 4DUZO 2PTMA 2UXNA 2ZR2A 4RUFA 1BQ0A 4P9OA 3JATB 4HNAB 1MG1A 2VQEB 2H94A 3TETA 4D6TH 3CRAA 1NZ6A 2ARHA 4ZKIA 3N2GB 4LP8A 1PP9H 5JH7A 4LF7O 4LF5B 3K9SA 4FMTA 3RYHB 1AVMA 3GWKC 2OT5A 2DQ3A 2JJ1G 5B1AC 3VBBA 4KHPB 2EZOA 4LWSB 5B1BC 1JR9A 4CBCA 3L75H 5JCOA 1JOYA 2ZT9B 2Q5ZA 3RT3C 1E1QG 2Z3YA 3BHPA 4LF5O 4JYAB 1VQ9V 3CCRV 4O2AA 1QR9A 2PYJA 1QLEB 1SZXA 2R72A 4KHPO 1GMGA 5IY5C 3SPCA 3EXAA 2VS0A 1K73W 3QG5A 1R73A 1Q5OA 2AW9A 3B77A 3H1LH 3IAYA 4DR2O 4IL6Z 4J7ZA 4K35A 4DV6O 4YIOA 4NXMB 2KKWA 5BY1A 3RYFB 4LFAB 1YITV 1QQCA 3AEIA 4UUJC 3H1JH 3CCLV 3J7AU 3ZHSA 2UXDO 1DLBA 2E3CA 2P67A 1O9HA 5B5EZ 2JGDB 3ZHVA 2HHHB 4NXMO 4IT5A 1TUEB 4TSFG 3ZN0A 1MA1A 1PL4A 5CBHA 1ORQC 3BA8A 3HKEB 1X4TA 3JATA 1AI7A 4HNAA 1GM9A 1I5YA 2ZD9A 2HVJC 2B5UA 3N2GA 4JI4O 1OCZC 4DV1O 1XILA 3FB6C 3RYHA 3FX7A 1Z5VA 3E8HA 2OTJV 3P3NA 1IBKB 3W7SA 1P7GA 1SESA 3K9AA 3EVKA 1OCCC 1AB3A 3SYQA 2E76B 1Q6UA 4NB5A 3ETEA 4WCEV 5KHGA 3P3PA 4UVAA 2FMLA 4MVQA 4H44B 4QIWF 2IW5A 4D7TA 5KHIA 3E8FA 4MW3A 2WLIB 1FJGB 2YS8A 5C8YB 1N8RW 1IBKO 4B08A 3K0GA 4OPHA 1EN6A 2LQTA 1YZBA 1W59A 1TUBA 3B2EE 3F7YC 4H37A 1RPOA 3LDEA 2N05A 3K3WA 3CRQA 1JFFB 4YJ3B 3RYFA 4F4LA 1F4MA 4RQEA 2UUCO 3LSSA 1LUVA 4HBNA 1N36O 5CB4A 3ZHUA 2ZNIA 3GB7C 1QHTA 1WB7A 4TV9B 3CCEV 2Q7EA 3JSNA 1PKXA 4GKKB 1S3JA 4PDRA 4WF9V 2JGDA 2EX3A 1G1XB 1FYJA 1PPJH 4FM0A 4XDKA 3TCUA 3HKEA 4DV5B 1GN4A 4DK1A 5D5PA 1K7DA 3HKCB 3HKBB 1P49A 1ROPA 1YHQV 3AG2C 4KXRA 3T1YO 2WA4A 1J5EB 3F5WC 3CB2A 2IH3C 2PUSA 1Q86W 3I5DA 3CCQV 2YIBA 5J2TB 1ZLZA 1UPGA 3CS5A 3G67A 2ZR3A 3BAAA 3B4SA 1HW7A 4JV5O 1DTOA 2AHZA 2Q4PA 2QDOA 2V1DA 1Y4MA 1GK9A 1P84F 4W4LA 4FM2A 5C8YA 5BR8O 1J5EO 3I55V 5IYBO 2LW7A 2EIMC 2QKSA 4X66B 1W0KG
chains in the Genus database with same CATH topology
1ZL8B 1VF6C 1Y76A 1Y74A 3B40A 1Y76B 1VF6A 1Y74B 1ZL8A 1RSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 B;  1VF6 C;  1Y76 A;  1Y74 A;  3B40 A;  1Y76 B;  1VF6 A;  1Y74 B;  1ZL8 A;  1RSO B; 
#chains in the Genus database with same CATH topology
 4GCZ A;  4LFB O;  4NR1 A;  1HDJ A;  3SYO A;  4MSW C;  1FXV A;  4JI3 O;  1RPR A;  4JI6 O;  1R3K C;  1M5I A;  3K5O A;  1JFF A;  1SQQ H;  1N4C A;  3OM3 B;  1S72 V;  4K0K B;  2ZIM A;  2UXB B;  2ZDI C;  4W4K A;  1SF9 A;  4JYY A;  1Q6H A;  4A5U B;  2GHY A;  2HJF C;  2OIE A;  3JAM N;  1KU9 A;  2LGQ A;  4Z2W A;  4QE9 A;  4X66 O;  1XMO O;  1UFI A;  2FYU H;  2L35 A;  3ZMZ A;  1ZAU A;  2JIZ G;  4CS3 A;  2YIB D;  5LOV B;  5LYJ B;  4U3J B;  4FZ0 A;  2ILM A;  3H9V A;  2PF4 E;  3CRR A;  4B3R O;  2WA3 A;  4I0X B;  3HKC A;  3HKB A;  4BIU A;  4CS4 A;  2WPD G;  4X62 O;  1S77 D;  5EC1 C;  3AG3 C;  2NR5 A;  2XND G;  3HKD A;  4YJ2 B;  5H6Q A;  4R7C A;  3RYI B;  2CTR A;  1MZF A;  2YXY A;  5J2T A;  1MOF A;  1N34 B;  3D3I A;  4UCO A;  5KHK A;  3EHB B;  4EFB A;  5KHJ A;  3CC7 V;  3Q4H B;  2JRI A;  1FFT B;  1GAX A;  1DK1 A;  1S5L Z;  3T4Z A;  4HZ3 A;  1U97 A;  1A32 A;  1KYO F;  3MDS A;  3K04 A;  1N34 O;  1N0J A;  3NR7 A;  2Y69 B;  1PNL A;  2RNB A;  4J9Y B;  4L87 A;  4UCV A;  2GUZ B;  1VQ6 V;  3OMI B;  5EIB C;  1GM8 A;  3QO5 A;  4MTO A;  2PI5 A;  4X1K A;  1VMG A;  3ASN B;  1SS3 A;  3ABT A;  4WFH A;  3ABM B;  1Z5W A;  1KC8 W;  1NTM H;  4GUN A;  4TT3 G;  4O4J B;  2BOC C;  2LW1 A;  1KKC A;  2VQF B;  3RBZ A;  1M56 B;  3JCU Z;  1G4Y B;  1SA0 B;  4MVR A;  1ZWI C;  5LOV A;  1R3J C;  5LYJ A;  3HPL C;  1WA8 B;  3P30 A;  3FD9 A;  3LDC A;  1F51 A;  3WG7 B;  4JI8 B;  1OCO B;  1XQ8 A;  3IC7 A;  4I0X A;  3MAQ A;  2KSD A;  3SDL A;  2CH7 B;  2VQF O;  2P06 A;  4G28 B;  1VQ7 V;  2V4D A;  5LHH A;  2JVD A;  4YXW G;  3FB5 C;  4YJ2 A;  3RYC B;  5ITZ A;  5EYP B;  1RM1 B;  2EIL B;  2CAZ C;  1B6Q A;  4DV7 B;  2RN9 A;  2UUB B;  1K8A W;  2BCC H;  4MTF A;  2A7W A;  4DRX B;  3Q4H A;  4RO2 A;  5EBM C;  2ETN A;  2ITC C;  4AQY B;  2DYR C;  3MHS C;  1VQP V;  2F23 A;  4LF4 O;  4UCT A;  4AIL C;  1N33 B;  5DEC A;  3CMA V;  1ZL8 A;  3TJT A;  2Q7H A;  5FLX N;  3D36 C;  2DYS B;  2QM8 A;  3OGI B;  3CRC A;  5JCO C;  5CBF A;  2EIK B;  1AR4 A;  2BOB C;  2UU9 B;  2UXC B;  3JD3 A;  2JS5 A;  2W6J G;  5E79 Z;  3QNE A;  4NYK A;  2FB5 A;  4PDM A;  4DV4 B;  4JAU A;  2QWN B;  4JI0 O;  2DW4 A;  4F6R B;  2NN4 A;  4ICG A;  1YTF D;  5AG2 A;  4NKG B;  2HFE C;  2O57 A;  4ZBM A;  4JGS A;  4O4J A;  2X6A A;  1MNG A;  1KB9 F;  4MVZ A;  1NH2 B;  2UU9 O;  2UXC O;  5LMN B;  2YSU B;  4WBN B;  1XNQ B;  4FLT A;  4DV4 O;  4DR7 B;  3ZMV A;  2QKC A;  4PHZ A;  3CSX A;  4DR5 B;  1S0V A;  1Q43 A;  1SKV A;  1VQM V;  4QPK A;  2CH7 A;  4JPR A;  1U96 A;  4C7U A;  1S76 D;  3R66 A;  5CA1 B;  2CGN A;  3FAV A;  1AJQ A;  3CRM A;  4JAA A;  4ZIB A;  3RYC A;  1IBM B;  5EYP A;  3RGB A;  3OE7 G;  4OPA A;  2EIJ C;  2OCC B;  3CCU V;  2KB1 A;  5CMU A;  3SYA A;  2A0L A;  4IYH A;  1HNZ B;  3KG2 A;  4UV9 A;  2WLL A;  3GWO A;  1R3L C;  2E75 B;  2VRZ A;  3D8C A;  2F1M A;  4ZOL A;  4O4I B;  1FFX B;  1IBM O;  3JAS B;  2YEV B;  1OHH G;  1M9N A;  1BL8 A;  1NQT A;  1NTK H;  3ABL B;  4JYB A;  2HJD A;  5K1P A;  3AG4 C;  3JYC A;  3W7W A;  2LP7 A;  1WP7 A;  1K5S A;  1I94 B;  3OGC C;  4F6R A;  2ZXW B;  2DQ0 A;  4DR6 O;  2RDC A;  2XOK G;  1SQX H;  4JI7 B;  3OTO B;  2OYQ A;  2RQ6 A;  1VF6 A;  1R1B A;  4O4L B;  5KUM A;  4TWK A;  4WBN A;  5LXT B;  3BCC H;  4QJF B;  4OGQ B;  3ZRW B;  4J9Z B;  3QTC A;  1I94 O;  4K8Z A;  3STZ C;  1R3I C;  1P7B A;  4J7K A;  1I08 A;  3SJQ C;  2VQE O;  3JAR B;  4DR1 B;  1JMK C;  3U0Z A;  1KMI Z;  3VQY A;  5KX5 B;  5CA1 A;  4QE7 A;  2Q0O C;  3STL C;  1H8E G;  3E8G A;  3OMA B;  4FJC C;  3WB2 A;  1UJW B;  1HP8 A;  1IBL B;  3ZN1 A;  1Y76 B;  2JJ2 G;  5JWP A;  1AI6 A;  4RQF A;  1LUW A;  1V54 C;  2Q8V A;  3A8T A;  2RCV A;  3ASO B;  2Y0P A;  4BWA A;  4DR1 O;  2GSM B;  1MSW D;  2CDY A;  1NBM G;  3B09 A;  4E2L A;  4JYA O;  2GTA A;  3CCM V;  2OCH A;  4CH4 A;  1D5N A;  1FFX A;  3HR0 A;  3JAS A;  2YEV A;  2N04 A;  3C3S A;  2YIA A;  2QWQ B;  4DV2 B;  2Z0A A;  4IYI A;  1IBL O;  3JAL B;  1NH2 D;  2BSK B;  1XEQ A;  1D2D A;  3SJC C;  4X9Q A;  4JAS A;  1L1F A;  3JD4 A;  3ZMU A;  4EB6 B;  2YI9 A;  4E4E A;  5B1A B;  1URF A;  4FPP A;  1IVS A;  2ZQM A;  4BW5 A;  5B1B B;  2W6I G;  5HFL A;  4LFA O;  3K57 A;  2ZM6 B;  2D2C B;  1YSC A;  3LSQ A;  4X65 B;  1AI4 A;  4BW9 A;  3LNM B;  3N27 A;  2HVK C;  2AZ0 A;  1L0L H;  5EBW C;  2BTQ B;  4O4L A;  4F6E A;  4FZ1 A;  2HHH O;  1K33 A;  3FFQ A;  1NVP B;  1NJI W;  1KBH A;  4DW0 A;  3ZRW A;  3C3T A;  5IY5 B;  4LWS A;  4BR6 A;  2EZP A;  1Q90 D;  3ICX A;  2X0L A;  2VWJ A;  3JAR A;  5BMV B;  4WFE A;  1WP8 A;  5KX5 A;  1XHX A;  4XDJ A;  3H1I H;  4HYO A;  4JTA B;  2JEU A;  4JI5 B;  1FD9 A;  5KMG B;  1WB8 A;  4LCU C;  2EIN B;  4AHC A;  4MTG A;  1GM7 A;  2PYL A;  1LNQ A;  1Y76 A;  5KAF Z;  3ZJZ A;  2ZE6 A;  4R50 A;  3OD4 A;  3OUF A;  3E2E A;  1DF4 A;  1XI1 A;  5K1X A;  1QVG U;  3IGA C;  1M93 A;  3JCZ A;  1FJG O;  4UCR A;  1Q7Y W;  2K9P A;  1GN2 A;  3JAL A;  1JX9 A;  2R9R B;  2BSK A;  1OCZ B;  4U7O A;  5F2V O;  3SR2 C;  1HNX B;  3CCJ V;  1XL6 A;  2V7Q G;  4EB6 A;  4MVM A;  2PI4 A;  2NNU A;  1OCC B;  3X2Q C;  4JI1 B;  3O9O A;  2NLJ C;  2Y48 A;  3CWB H;  1S5H C;  3JAW B;  4FLY A;  1M57 C;  1KQS U;  2Q67 A;  4DW1 A;  4GKK O;  3CP1 A;  4EEQ A;  2F4V B;  4EKW A;  3ABK C;  5H2F Z;  4DV5 O;  4YIP A;  3OR6 C;  3CXC U;  5BMV A;  2IH1 C;  1WJZ A;  4ZI7 B;  2QJ1 A;  5JJJ B;  2WLI A;  1ZSP A;  2HKO A;  4UVB A;  4JTC B;  1AIL A;  5CN0 A;  1YEW A;  5B1O A;  4I50 B;  4H13 B;  1BT8 A;  5KMG A;  2F4V O;  4X20 B;  3SJA C;  1FKA O;  1YF2 A;  5JVD B;  2A9H A;  1TAE A;  4UB8 Z;  2HG5 C;  5H6R A;  3DC6 A;  1VQL V;  4PI2 A;  5B3S C;  4YJ3 A;  1H2S B;  4PD4 F;  1E1R G;  3DXR B;  4EFE A;  2M6Y A;  4IHJ B;  3ZRS A;  5LHG A;  4X1Y B;  4I4T B;  2M7W A;  1BHA A;  4BIZ A;  4TV9 A;  2MK3 A;  3G71 V;  1VQK V;  2KQX A;  3E22 B;  3SYC A;  3AG2 B;  2JGU A;  1IX9 A;  5HFM A;  1GRJ A;  5BZB A;  1PM9 A;  3K79 A;  4PEL A;  2B1G A;  5TIS Z;  4K0K O;  1KP2 A;  2UXB O;  1FPO A;  1ZUQ A;  2R9A A;  4B7E A;  4UFZ A;  3APQ A;  5L3E A;  3G4S V;  1DF5 A;  3JAW A;  5LP6 C;  2WLM A;  5FNV B;  2XAG A;  3E8B A;  1J95 A;  2Y4U A;  1B3Q A;  3ZIA G;  3ZHQ A;  4FLU A;  3QO8 A;  1CPY A;  3E83 A;  2E74 B;  3LSU A;  1FXK C;  3AK2 A;  5IWA B;  3ABM C;  5IE9 A;  5IYZ B;  2EUL A;  4DV3 B;  3LNN A;  4NTW A;  2DJV A;  4BIO A;  4ZI7 A;  2Z5U A;  1M56 C;  2ZE5 A;  3ZMT A;  5FL7 G;  5DM6 V;  1BZK A;  1QR8 A;  3SPJ A;  3CD6 V;  2WLJ A;  1RFY A;  4X20 A;  3M7M X;  5KA5 A;  3HB3 B;  1JA8 A;  3A0H Z;  5IWA O;  4CH5 A;  2EBO A;  4PDL A;  3L74 H;  1VF7 A;  1BSM A;  2JEX A;  3DXR A;  1JQ0 A;  4IHJ A;  2QWR B;  3G6B A;  4X64 B;  5EK0 A;  4I4T A;  2IM9 A;  4UXN A;  4G27 B;  2UUA B;  1L8D A;  3AG3 B;  2P4V A;  3E22 A;  1NI8 A;  3OFN G;  1FXH A;  5L3G A;  2ZNJ A;  1V55 C;  3CC4 V;  3U10 A;  2UXX A;  4FIP C;  4K3A A;  4P30 A;  1MZE A;  4MS2 A;  1TVK B;  4U3J A;  3LUT B;  1W2B U;  2LO1 A;  3MD0 A;  1VEW A;  4LF8 B;  2ITD C;  1F4N A;  3ZRV A;  5E1A C;  5FNV A;  1Z2G A;  4X89 A;  1E79 G;  4FLZ A;  4PI0 A;  4NVP A;  2QWO B;  4JZG A;  1GN3 A;  3L72 H;  1YJW V;  1IZ3 A;  2Q73 A;  1H2K A;  1JPX A;  2Y0I A;  3C90 A;  4CC6 A;  2Q68 A;  3ETD A;  5LGU A;  3RYI A;  4Z1M G;  1JVM A;  2XAF A;  4X8A A;  4J7J A;  1X59 A;  1VF5 B;  5IYZ A;  3CEI A;  2F93 B;  2K1E A;  4JI8 O;  4LF8 O;  4DK0 A;  1PV0 A;  3JAK B;  2QR4 A;  4KP4 A;  3WFV A;  4X88 A;  2HLD G;  3UO2 A;  2X6C A;  2BTO A;  4TQF A;  4WFA V;  2WLK A;  4JAV A;  2XHB A;  1NR7 A;  3AG1 C;  1OCR B;  3H1H H;  4JZ2 A;  4PA7 A;  2E5L B;  2ZIN A;  4B3M B;  4DV7 O;  1XL4 A;  2UUB O;  1N32 B;  1OV9 A;  2RJZ A;  4JI2 B;  4DYL A;  4GX1 A;  2GUZ A;  3RFR A;  4B3T B;  2WLH A;  4OX9 B;  4FFB B;  4ASU G;  4AQY O;  4BAY A;  4L8J A;  2E5L O;  4CS2 A;  1N33 O;  5LGT A;  4PA4 A;  1SQB H;  5EZY B;  1M1K W;  2QE7 G;  2X6B A;  2Q0A A;  1PL0 A;  1SA0 A;  2XAJ A;  2YIC A;  2JK5 C;  4JI2 O;  2QEX V;  2FTK A;  3F5T A;  3A2F A;  3ZCC A;  3SPI A;  3BFR A;  1WA8 A;  1H2G A;  4GT1 A;  3H1K H;  5L3B A;  4LFC B;  1BHB A;  4UCU A;  5H9C A;  1VQO V;  2A79 B;  2QSA A;  1HNW B;  5KHH A;  1RSO B;  3W7X A;  4Z1V A;  5LMN O;  2DYR B;  3CE2 A;  1XNQ O;  2B1I A;  3FB8 C;  3QVN A;  4LF9 B;  2GTS A;  1HWY A;  4UV8 A;  2DWE C;  4DR7 O;  1K9M W;  4LNU B;  1BQZ A;  4DR5 O;  2IJJ A;  4N23 A;  3JAK A;  3DGE A;  5KLV H;  4FK5 C;  1XRE A;  4IIJ B;  1YDX A;  4O2A B;  2YUA A;  4DRX A;  1ZX3 A;  3OTF A;  3B8M A;  2ATK C;  5J9P C;  4GKJ B;  1JCH A;  3JD2 A;  3TGU H;  3GVM A;  2MW2 B;  3ML0 A;  2QTO A;  1F7Y A;  3U11 A;  1FAF A;  4LH6 A;  2FKX A;  4CH3 A;  1H2M A;  1IDS A;  3CC2 V;  2IBZ H;  1XBL A;  1WLE A;  5BXZ A;  4J10 A;  1YIJ V;  1H2N A;  1HNZ O;  2ZIO A;  3IC9 A;  4G2K A;  3O65 A;  3EFF K;  5KUK A;  1QLE C;  2AGA A;  2YDE A;  4FFB A;  2HP8 A;  2IJK A;  1RP3 B;  1K97 A;  4P9P A;  4LF7 B;  1CP9 A;  5EZY A;  1XMQ B;  5L3F A;  2AZ2 A;  1Q81 W;  4PDV A;  2XTA A;  2EIJ B;  4I9Q A;  2GBO A;  1K3E A;  4H33 A;  4FM1 A;  5EIB D;  1SET A;  3VOU A;  3SPG A;  4JI7 O;  2X7R B;  3TXS A;  3K59 A;  3VQV A;  3OTO O;  1XHZ A;  1XMQ O;  1RSO A;  3QO7 A;  3SYP A;  1W0J G;  4P2Z A;  2WLN A;  4FLX A;  1YJ9 V;  3CX5 F;  3D36 A;  1VP7 A;  3ZX6 A;  3FKS G;  4LNU A;  4U7N A;  2LJ2 A;  4DR2 B;  3DSQ A;  5IYC O;  3AG4 B;  3J81 N;  2QWP B;  4DV6 B;  4TUY B;  5KA6 A;  4IIJ A;  5LHI A;  3K5L A;  4K8X A;  3K08 A;  3RN4 A;  2W0F C;  5GON B;  3AK1 A;  3E89 A;  4O4I A;  1KEC A;  3P32 A;  1SZT A;  1JJ2 U;  2W0X A;  2ODM A;  1H2L A;  2UXD B;  5J2U B;  1TUB B;  4J11 A;  2FL4 A;  4ZHQ B;  1Y6X A;  4TOI A;  5C93 A;  1VQ4 V;  1WPX A;  3UT5 B;  1R6N A;  3ZHT A;  3T1C A;  2B9Z A;  5FPO A;  2OIG A;  3SPH A;  1Q8I A;  5JQG B;  2R9I A;  2A06 H;  1VQN V;  2EIN C;  5CB4 B;  2GDS A;  2PGG A;  4JI4 B;  3M99 B;  4DV1 B;  4DV2 O;  3BY6 A;  1EFR G;  3G6E V;  4R6Z A;  2G38 A;  3CYO A;  4FVM A;  1L0N H;  5L3C A;  5A9G A;  3BAB A;  2ZCE A;  1EZV H;  2D3O W;  4GX0 A;  5LXT A;  1GN6 A;  2XAH A;  4J80 A;  3IFX A;  5LA6 B;  3BEH A;  1V9P A;  2ZM6 O;  1Q3E A;  1V54 B;  3PJS K;  1MMM A;  1YJN V;  1SQP H;  4X65 O;  2ZKO A;  1WN7 A;  3M8A A;  1AI5 A;  1YXB A;  4YHH B;  1Y66 A;  3CPW U;  4TV8 B;  4H0L B;  1I7F A;  4RWU A;  4MVS A;  3KZI Z;  1QLN A;  2YC0 A;  3A0R A;  3L73 H;  5CA0 B;  4LF6 B;  4TUY A;  5B66 Z;  5KAI Z;  3ABU A;  5GON A;  2UUC B;  3K5N A;  1B04 A;  5D5Q A;  2OWO A;  1I5X A;  4LH7 A;  4JI5 O;  1N36 B;  3DC5 A;  1SQG A;  1AP6 A;  4YHH O;  3N2K B;  2EJ7 A;  3T4D A;  3K06 A;  2Q7G A;  5J2U A;  4X1I B;  3ZRX A;  1AR5 A;  2HEP A;  4ZHQ A;  4U3F H;  3K0D A;  3E35 A;  4LF6 O;  4WFG A;  3UT5 A;  3SJB C;  2DE0 X;  1NR1 A;  4KFM A;  5IJ9 B;  1R6K A;  2ADQ B;  5JQG A;  4LR3 A;  4PA3 A;  4GZR B;  2RMK B;  2AXT Z;  4WFB V;  1SC5 B;  4NTY A;  1Y74 B;  4DO2 A;  1SRY A;  3T1Y B;  3CJH B;  3WU2 Z;  2F43 G;  1HNX O;  4Q6G A;  3RW0 A;  1BE3 H;  2BTQ A;  1VQ8 V;  2QM7 A;  3K58 A;  1PNK A;  1KKD A;  3RVZ A;  3ETG A;  5LA6 A;  1TGO A;  4JI1 O;  4JV5 B;  1THZ A;  3VQW A;  2HR3 A;  1YCI A;  3OEE G;  4O4H B;  4DR4 B;  1YVW A;  1K34 A;  1K4D C;  4AI8 A;  3ETQ A;  1WNS A;  3HKD B;  1K4C C;  5BR8 B;  1F23 A;  2XT9 A;  1Q6I A;  3FYE B;  4J42 A;  1M90 W;  4NTX A;  3THO A;  1G8M A;  1I0H A;  4TV8 A;  4RAI A;  3KCY A;  4LFB B;  3K03 A;  1AJP A;  2CTQ A;  4JI3 B;  4JI6 B;  4WFF A;  3CXH F;  1H38 A;  5CA0 A;  1ZTE A;  2ZE7 A;  3S3X A;  2IU3 A;  4DR4 O;  3OMN B;  5CA3 A;  3BPZ A;  3UQ8 A;  3X2Q B;  1NTZ H;  4B3S B;  2R70 A;  2CTP A;  2EJR A;  1H8H G;  2Y4T A;  2YI8 A;  1QBZ A;  3N2K A;  1KUQ A;  2QA4 V;  1KP3 A;  1WPB A;  1XMO B;  1EZJ A;  2DN9 A;  1M57 B;  3WB0 A;  4X1I A;  4LC1 A;  2CE4 A;  1NVP D;  4R8C A;  5LL6 Y;  4J41 A;  2IJH A;  5IJ9 A;  2XUM A;  1M4U A;  4X1K B;  3ABK B;  4CC5 A;  4JYC A;  1SQV H;  4B3S O;  4B3R B;  1VIB A;  2WWW A;  3T2M A;  1NU1 H;  4X62 B;  1Y74 A;  2IJI A;  3CHX A;  2Y69 C;  2YID A;  4DXW A;  3CJH A;  2JS3 A;  4JF3 A;  4N21 A;  3I56 V;  1EN4 A;  3UKM A;  1LR1 A;  4XBF A;  5IT9 N;  1MAB G;  4PJ0 Z;  3ASN C;  2EIM B;  5FPR A;  3KKY A;  4ABM A;  2C2A A;  1QU7 A;  3D3Q A;  3WB1 A;  1YTF B;  4O4H A;  1XNR B;  3JD1 A;  4PA6 A;  5B3S B;  1EBO A;  5L3D A;  5ITZ B;  4I50 A;  4GLX A;  2QGN A;  1YI2 V;  1EM1 A;  3OUS A;  5JVD A;  3ZHR A;  3J80 N;  3WG7 C;  4MT8 A;  1OCO C;  4I7Z B;  1Y67 A;  3OR7 C;  2DMX A;  3OT7 A;  1VQ5 V;  1R6T A;  4UVC A;  1BCC H;  1T5E A;  4DV3 O;  4FLV A;  1ENV A;  4QGP A;  1GH6 A;  3BVO A;  1XNR O;  1K5Q A;  1GO3 F;  4CH6 A;  5GTI Z;  4I9W A;  2DWD C;  5IYD O;  2P7T C;  4X1Y A;  4IGG A;  2XAQ A;  1ZL8 B;  3L71 H;  1N0N A;  2EIL C;  3JD0 A;  1RM1 C;  5LP6 B;  1JJO A;  3B40 A;  3R65 A;  1O9G A;  3PN1 A;  1S5J A;  2LFR A;  5EBL C;  1B06 A;  1GTO A;  1XUQ A;  3S3W A;  2JDI G;  4NXN B;  4UB6 Z;  2KG7 B;  4QPJ A;  1DGS A;  1FXK B;  5EC2 C;  3K5M A;  1BS3 A;  1OCR C;  2AHY A;  2IU0 A;  1NS1 A;  4X64 O;  3ZBH A;  2DYS C;  3ZS8 C;  2UUA O;  3UO3 A;  3KCX A;  2EIK C;  2Q69 A;  5LMU B;  2LGW A;  4NXN O;  3SGI A;  3UCS C;  3QF7 A;  2OTL V;  2F66 C;  1BGY H;  3AG7 A;  1IXM A;  4XDL A;  2LFS A;  1Q82 W;  2QM4 A;  1BMF G;  4O2B B;  5DN6 G;  3CCV V;  2CTW A;  3MHH C;  3APO A;  3W7T A;  4Q20 A;  1QNM A;  5IJ0 B;  1NKD A;  3VQX A;  3RVY A;  5B1N A;  2GV9 A;  4UCS A;  5LMU O;  1MSD A;  1VF6 C;  3FAV B;  4I5S A;  3LDD A;  3UM7 A;  2H3O A;  4LF4 B;  2ZDI A;  4MVO A;  2PZS A;  4I55 B;  1FS0 G;  1OZ0 A;  3BA9 A;  4D7S A;  4GX5 A;  1VAR A;  4GX2 A;  2P90 A;  3OW2 U;  1QVF U;  4PV1 B;  1V55 B;  4DV0 B;  2WLL B;  5DED A;  5GW7 A;  4JI0 B;  4ZOL B;  1SQF A;  2Q6A A;  1HR0 B;  4OXS A;  2Q9L A;  1EN5 A;  1OJH A;  2OCC C;  5LP6 A;  5LGN A;  4TQD A;  1AP5 A;  3F7V C;  5JJE B;  4B3M O;  2BE3 A;  5LBQ A;  4KL1 A;  2CGO A;  2N74 A;  1QCE A;  1N32 O;  1CEZ A;  3IJ4 A;  2CUG A;  2KG7 A;  4MTX A;  3W7U A;  4RUE A;  4DV0 O;  1PNM A;  3ZMS A;  1FXK A;  4B3T O;  4HAM A;  2A3Q A;  1TVK A;  4OX9 O;  2XAS A;  1CXZ B;  4MW8 A;  1HR0 O;  1PD3 A;  4QNH B;  1US6 A;  3OAA G;  3T1H B;  1P4R A;  1ARO P;  1AR1 B;  5JH7 B;  3ABL C;  2P5O A;  3TK1 A;  4FLW A;  4PA9 A;  1WAZ A;  2YXL A;  3AG1 B;  4GYC B;  5H5N A;  2ZE8 A;  4LBE C;  4YY3 B;  2F95 B;  2ZXW C;  2DOS A;  3FYI B;  3E86 A;  4O2B A;  3CME V;  2P4K A;  3L9D A;  3A0B Z;  3T1H O;  2PY5 A;  1XOU A;  5IJ0 A;  1AJN A;  5CBG A;  2WSS G;  4LFC O;  2P6J A;  3NXS A;  5IDJ A;  3AK3 A;  1HNW O;  3G80 A;  3TXQ A;  3JSL A;  4DUY B;  3B8N A;  4DR3 B;  3H01 A;  4KUM A;  3BRC A;  4I55 A;  4JTD B;  4YY3 O;  3ZED A;  4MVU A;  2L6L A;  4LF9 O;  1IUR A;  5JJN B;  3DTU B;  1GKF A;  2WAM A;  2YXH A;  4CZZ A;  3L70 H;  1NT2 B;  3RWR D;  2VWK A;  4B7K A;  4DUZ B;  2P22 C;  1KD1 W;  5GTH Z;  1D5A A;  2CK3 G;  4DR6 B;  2QTS A;  2QKA A;  1G6U A;  4DUY O;  4DR3 O;  4GKJ O;  3CCS V;  2ADP A;  2H8P C;  3FB7 C;  1IXB A;  4FFK A;  1SER A;  3ASO C;  5A2Q N;  1XDC A;  1K92 A;  1COW G;  1TA8 A;  3OEH G;  4DUZ O;  2PTM A;  2UXN A;  2ZR2 A;  4RUF A;  1BQ0 A;  4P9O A;  3JAT B;  4HNA B;  1MG1 A;  2VQE B;  2H94 A;  3TET A;  4D6T H;  3CRA A;  1NZ6 A;  2ARH A;  4ZKI A;  3N2G B;  4LP8 A;  1PP9 H;  5JH7 A;  4LF7 O;  4LF5 B;  3K9S A;  4FMT A;  3RYH B;  1AVM A;  3GWK C;  2OT5 A;  2DQ3 A;  2JJ1 G;  5B1A C;  3VBB A;  4KHP B;  2EZO A;  4LWS B;  5B1B C;  1JR9 A;  4CBC A;  3L75 H;  5JCO A;  1JOY A;  2ZT9 B;  2Q5Z A;  3RT3 C;  1E1Q G;  2Z3Y A;  3BHP A;  4LF5 O;  4JYA B;  1VQ9 V;  3CCR V;  4O2A A;  1QR9 A;  2PYJ A;  1QLE B;  1SZX A;  2R72 A;  4KHP O;  1GMG A;  5IY5 C;  3SPC A;  3EXA A;  2VS0 A;  1K73 W;  3QG5 A;  1R73 A;  1Q5O A;  2AW9 A;  3B77 A;  3H1L H;  3IAY A;  4DR2 O;  4IL6 Z;  4J7Z A;  4K35 A;  4DV6 O;  4YIO A;  4NXM B;  2KKW A;  5BY1 A;  3RYF B;  4LFA B;  1YIT V;  1QQC A;  3AEI A;  4UUJ C;  3H1J H;  3CCL V;  3J7A U;  3ZHS A;  2UXD O;  1DLB A;  2E3C A;  2P67 A;  1O9H A;  5B5E Z;  2JGD B;  3ZHV A;  2HHH B;  4NXM O;  4IT5 A;  1TUE B;  4TSF G;  3ZN0 A;  1MA1 A;  1PL4 A;  5CBH A;  1ORQ C;  3BA8 A;  3HKE B;  1X4T A;  3JAT A;  1AI7 A;  4HNA A;  1GM9 A;  1I5Y A;  2ZD9 A;  2HVJ C;  2B5U A;  3N2G A;  4JI4 O;  1OCZ C;  4DV1 O;  1XIL A;  3FB6 C;  3RYH A;  3FX7 A;  1Z5V A;  3E8H A;  2OTJ V;  3P3N A;  1IBK B;  3W7S A;  1P7G A;  1SES A;  3K9A A;  3EVK A;  1OCC C;  1AB3 A;  3SYQ A;  2E76 B;  1Q6U A;  4NB5 A;  3ETE A;  4WCE V;  5KHG A;  3P3P A;  4UVA A;  2FML A;  4MVQ A;  4H44 B;  4QIW F;  2IW5 A;  4D7T A;  5KHI A;  3E8F A;  4MW3 A;  2WLI B;  1FJG B;  2YS8 A;  5C8Y B;  1N8R W;  1IBK O;  4B08 A;  3K0G A;  4OPH A;  1EN6 A;  2LQT A;  1YZB A;  1W59 A;  1TUB A;  3B2E E;  3F7Y C;  4H37 A;  1RPO A;  3LDE A;  2N05 A;  3K3W A;  3CRQ A;  1JFF B;  4YJ3 B;  3RYF A;  4F4L A;  1F4M A;  4RQE A;  2UUC O;  3LSS A;  1LUV A;  4HBN A;  1N36 O;  5CB4 A;  3ZHU A;  2ZNI A;  3GB7 C;  1QHT A;  1WB7 A;  4TV9 B;  3CCE V;  2Q7E A;  3JSN A;  1PKX A;  4GKK B;  1S3J A;  4PDR A;  4WF9 V;  2JGD A;  2EX3 A;  1G1X B;  1FYJ A;  1PPJ H;  4FM0 A;  4XDK A;  3TCU A;  3HKE A;  4DV5 B;  1GN4 A;  4DK1 A;  5D5P A;  1K7D A;  3HKC B;  3HKB B;  1P49 A;  1ROP A;  1YHQ V;  3AG2 C;  4KXR A;  3T1Y O;  2WA4 A;  1J5E B;  3F5W C;  3CB2 A;  2IH3 C;  2PUS A;  1Q86 W;  3I5D A;  3CCQ V;  2YIB A;  5J2T B;  1ZLZ A;  1UPG A;  3CS5 A;  3G67 A;  2ZR3 A;  3BAA A;  3B4S A;  1HW7 A;  4JV5 O;  1DTO A;  2AHZ A;  2Q4P A;  2QDO A;  2V1D A;  1Y4M A;  1GK9 A;  1P84 F;  4W4L A;  4FM2 A;  5C8Y A;  5BR8 O;  1J5E O;  3I55 V;  5IYB O;  2LW7 A;  2EIM C;  2QKS A;  4X66 B;  1W0K G; 
#chains in the Genus database with same CATH homology
 1ZL8 B;  1VF6 C;  1Y76 A;  1Y74 A;  3B40 A;  1Y76 B;  1VF6 A;  1Y74 B;  1ZL8 A;  1RSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...