1ZLJA

Crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
DPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Dormancy Survival Regulator
total genus 23
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zljA00
2FMYA 2F2EA 3BZ6A 5ICGA 4JQFA 1Z7UA 2MBFA 2HTSA 1O57A 1B9NA 2D45A 3P9CA 3HSRA 2C6YA 4E70A 4HLYA 3MZHA 5J6XA 4G6QA 5HLHA 1HKSA 3P9IA 2J5OA 4PGHA 1K79A 2ESNA 3HYIA 3GX4X 4OIRF 3CJNA 3J7AO 4CYDA 2AS5F 4IRIA 3MFKA 4EJTA 1XSVA 4M71A 2XAQA 1I6XA 3REOA 4ASNA 1RNLA 3CTAA 1WI9A 1PP7U 4P9UA 3F8CA 1YQAA 2PEXA 1LDJA 2V9VA 4KIFA 4BHBA 3LAJA 1P6RA 4OOIA 2DQRA 5JR3A 4HDUA 3F8MA 3QAHA 1F1ZA 5K5QA 4HYEA 3L00A 1PDNC 5A2QK 2M30A 2PG4A 5JI6A 1K78A 1I27A 2DU9A 2IT0A 2R3SA 3BP8A 2HFHA 2WC2A 1KYWA 3OOPA 1ZRCA 3TO7A 4HF0A 3O2PE 3COAC 4IXAA 2BE5F 5DUKA 5FD5A 2VOPA 5HLIA 2ZNZA 1WQ2A 3RPUA 4IHTA 1LEAA 4UVAA 4WK8F 3M8EA 1TTYA 1U6GA 1TQMA 4UHTA 1UHWA 5LHHA 4EJWA 2AXLA 2V1UA 2VXZA 1UCRA 4KNYA 1O3SA 3M1EA 2PMUA 1B1BA 2EFNA 1H9GA 1WKMA 5IT9Z 4L0YB 2Q2EA 1EV7A 2HKXA 1XGNA 1IXSB 1XD7A 2V1DA 2GAUA 4IJAA 5D5WB 3LA2A 1R58A 3VOEA 1BIBA 3L2CA 3KZYA 4AVPA 1IW7F 1BM9A 2BGCA 2ISZA 3DPLC 2XAHA 2P8TA 4KN7X 4WX9A 4PGGA 5HOOA 1TNSA 2DBBA 1V4RA 5H20A 1J2XA 4ESFA 1YO5C 5ILSA 2XUBA 1LDDA 3JW4A 2W57A 2GXGA 1U5TB 3MQ0A 2O61A 4UV8A 3LQRA 1ZREA 1T2KA 2HKOA 2Q0OA 5DD4A 3DEUA 2GIVA 4M9SA 3FXRA 3GFJA 3V7RA 2G7UA 3HIFA 1PP8F 3Q9VA 4U0VA 3DXJF 4WXDA 4Y17A 1BJAA 4MHGA 3B02A 1S6LA 3W6JB 1J9IA 3F8FA 3QP5A 5LHIA 1OR7A 3V7CA 2IJLA 1AOYA 2XIGA 3E6BA 5LLQA 1E17A 4M6YA 5D5XB 4A2UA 1D8KA 4RGSA 5LBQA 4HX7A 3I4PA 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 3GEZA 4MEXF 5BPDA 3F3XA 1UB9A 1SMYF 4YIFA 4HV5A 4S04A 2ZBKA 5E18F 3HSEA 4BYYA 1D5VA 4KT5C 4MNUA 5BOXA 4RGRA 4R79A 2HEOA 4A0YA 1H0MA 2HYFA 1P4AA 3RJPA 4Q47A 1SFEA 4Y15A 3WGGA 5ICFA 2QQAA 1J7KA 4IVNA 1FBUA 3KLOA 4G7HF 1Z6RA 1UHMA 2QUFA 1TW2A 4D0PA 3I0TA 1SAXA 2A3SA 4A6EA 1QGPA 4NHJA 3HOTA 2KJCA 3GYHX 3C7JA 1ODDA 3MZYA 1ULYA 1ZN2A 1USTA 1FSHA 2E1CA 1REPC 4HA8A 1MZBA 1KQ9A 1B6AA 2VODA 2OA4A 3U1DA 1MJAA 4M9ZA 2DW4A 2QLZA 2DI3A 3ML6A 1XDSA 4FX4A 5L3GA 3NEUA 2FEZA 1L3LA 2Y75A 2K7LA 1CGPA 2HOEA 5LGNA 2QBYB 1O3RA 2YSRA 4YFXF 5AONA 1JGSA 3I58A 4EQQA 5J8CA 1P4WA 5HVQC 4KMFA 4O6JA 4WF2A 1Z6TA 3IWFA 4EM2A 2W84A 2V1XA 2ZJ2A 4WWCA 1P92A 3JSOA 3CUOA 2E7XA 4IHSA 4I7HA 1W5SA 1F9NA 3HSFA 2D2WA 1ZAOA 5K1YA 5JVTA 2E1NA 2P5VA 2NNNA 1D3YA 3LWFA 3EETA 4LG0A 2LF8A 5KK1A 2P7CB 4DNCA 2STWA 2FXAA 1U2WA 1GHCA 2MC3A 3SXYA 2FA5A 1TW3A 2QENA 2MLKA 4M73A 3KCCA 3M9AA 4OIOF 1S7AA 2RC4A 3E6DA 2ZKZA 1HKTA 5E20A 1U78A 1FY7A 2EB7A 3E5QA 3RYRA 2IP2A 1SMTA 4LK1F 3RTRA 1Y0UA 4ZH4F 1R1UA 2PMHA 5AIPA 4JK1X 2P6TA 5LRRA 4ETSA 1TNTA 5DUIA 4EGYA 4L18B 1QPMA 1RIOH 1ZG3A 1E2XA 4CGZA 3TDZC 4KN4X 4FT8A 1ZYRF 5D5UB 4PZJA 2CFXA 5L3EA 1U5TA 3AAFA 1EH6A 4K2EA 3TGNA 2QBYA 4CZZA 1R1TA 3QOPA 2L01A 1XGSA 4GYIA 1YW7A 3J81K 4EV0A 3JSPA 2HS5A 2XAJA 1T6SA 2IA1A 2A6EF 4B8XA 4QWQA 4LB6B 1RUNA 3IKTA 3SQNA 2PN6A 2O0YA 5D8LB 2EV5A 4MTEA 4HF1A 1KGSA 1J59A 4G7OF 5CVIA 2HWVA 4G8XA 3TO6A 1KU9A 1HW5A 2TDXA 4M74A 4XLPF 3MCZA 3VEPA 4UNOA 5HS7A 3BJOA 3FX3A 3R4KA 1RUOA 2G7HA 4R1HA 2MH9A 1LJ9A 2DT5A 4LK0F 5FGMA 1ZARA 2LNBA 2F5FA 1Z05A 3T5XA 4KYWA 3F22A 1XN7A 5KVRA 1XB4A 4HW0A 2VT3A 2PFBA 5FLXK 4UVBA 2XRNA 1SD4A 1KYZA 4HF2A 4GGGA 4P9FA 1D8JA 2EFOA 3V4GA 1JE8A 3EYIA 3K2ZA 3KETA 1OMIA 1YFHA 3I64A 5HDGA 3LAPA 1SD7A 4ZZLA 3WTYC 2VT2A 1BI0A 2FF4A 3L09A 3K0LA 2MA3A 2PBIA 2FBIA 5D8KB 2FE3A 2RKHA 4EVIA 4P55A 1FBSA 4NQWA 3ZMVA 2E7WA 5LHGA 3LFKA 1EH7A 2RQPA 3SZPA 4WXHA 4BXUA 2PJPA 2VBYA 2XVCA 3J80K 1HQCA 3DPTA 2F5EA 3KP5A 1IXCA 1DDNA 1STZA 3NRVA 2P6SA 2FRHA 3RYPA 3G73A 2CO5A 2UWMA 2A61A 2KJBA 1YW8A 2HTJA 1EH8A 4EJOA 5L3FA 4RB0A 4CDGA 3RKXA 4YFKF 3ZN0A 2H27A 1IZ1A 3GLXA 1IXRC 4I01A 1W5TA 3WU0A 2DK8A 3F6OA 3PQKA 3GF2A 1HKQA 4A5NA 3GFIA 5HDNA 1GXPA 4N0BA 4FX0A 3ZQ7A 4CICA 5HLGA 3N4MA 2CGPA 2LDUA 1BI1A 1J5YA 2ZMEB 3J80Z 1JXSA 3FWEA 2CW0F 2KIFA 3EQLF 4M6XA 4G94A 1AWCA 3N97A 2O3FA 1YS6A 3DQVC 2K4BA 1XMAA 2M87A 3K1PA 3T0YA 2MD5A 5DCMB 5FO5A 2L54A 5E8IA 1G3WA 2CSOA 4XRFA 4Q4ZF 3GWZA 2EK5A 1WWXA 5ILUA 2FOKA 2LKPA 3ECHA 3QU3A 1FX7A 2MH2A 3TDUC 3ULQB 4DQ2A 2JPCA 2RNJA 3MEXA 4LMYA 2EV0A 4PDKA 2VBXA 5L3DA 1ZRDA 2OD5A 4U0WA 3HTSB 4AWXB 3CLOA 4ESJA 3IRRA 4OIQF 5ICEA 3O3KA 1Z9CA 3HRSA 4H0EA 4KIGA 1XGOA 2A6HF 1R23A 3TKYA 1R1VA 1G3YA 2FBKA 2NRAC 4Z2YA 4ZZDA 3GO5A 3T8TA 5FB2A 3R0JA 1O7LA 3DFGA 2D1HA 2OU2A 2RGVA 1ONVA 3F8NA 3H3UA 5DEQA 2ZMEA 1ZRFA 3KP7A 4HLXA 5CVRA 4ESBA 3DV8A 3M7GA 4B09A 4I98B 3WE3A 1SFXA 5FFXA 2EFPA 1HSJA 5D5VB 2A69F 2H6BA 2CYYA 5K5OA 3J81Z 2P5KA 2ZXJA 3EUHA 5HDKA 2B0LA 4IRGA 2Z5UA 4EGZA 3GFMA 3KP3A 5CVJA 2DPDA 1IN8A 1R36A 1MKMA 2L3DA 2W85A 2NNYA 1RI7A 2Z9OA 2VC1A 1V3FA 4HX8A 3PFIA 2KRFA 1T39A 1GXQA 3G3ZA 2ESHA 3DP7A 4RGUA 2BV6A 2DAOA 5EEHA 4IRHA 4YG2F 4EM0B 4G7ZF 4M9XA 1SFUA 1ON2A 2L4MA 4LG0B 4L5JA 2QQBA 2IW5A 1YIOA 5E17F 2YPRA 3GZ5A 2DK5A 4ON0A 2CQKA 4Q48A 1X3UA 4P5OA 2YX4A 3P7NA 3VB2A 2XAGA 5E1WA 4Y13A 4U88A 2RDPA 4OMYA 4IPAA 1WRJA 4RAZA 6PAXA 4ENNA 4RB3C 1WSUA 3E3VA 2K86A 1FP2A 4EJVA 3WU1B 1R5GA 3HHGA 3F72A 1OYWA 4I09A 4BHPA 2BYVE 3ZMTA 4MQ9F 3GUDA 2IA2A 4JBAA 3CDHA 2XGXA 1FZPB 1FNNA 2FSWA 1G6NA 1RZ4A 3V8KA 1XCBA 4L9NA 5ED4A 2ISYA 1U5TC 1T0FA 4HQEA 4CXFA 3K9TA 5CLSA 1IN4A 3FF5A 3I71A 3F6VA 2JZYA 2FQ3A 4GYGA 3K1NA 1JHHA 3FHZA 5LEJA 5FFZA 2H09A 4RAYA 3RI4A 4N9HA 2EWNA 5HS8A 5EEGA 4G9YA 4ZYEA 1S29A 3SZTA 2PLYA 1IF1A 1W4MA 3I59A 5FLXZ 3FXQA 2M8EA 3SFZA 1KQ8A 1SD5A 1R7JA 3JTGA 4P96A 3WTUC 3R61A 1R22A 4ENMA 1FT9A 1K6OA 1FPQA 5DV5A 1W7PB 2CWEA 2X0LA 2XHKA 3KP2A 2KKOA 1MGTA 2VBZA 4MQVA 4YFNF 4MGRA 2UXXA 3GXOA 1TLHB 3LSTA 5F6FA 3BROA 2UZKA 2J5PA 1FYMA 2OZ6A 4U0YA 3HRUA 3SHFA 5E1ZB 3QP6A 1Z91A 1QO0D 4A0XA 3E6MA 3BJ6A 4FHTA 3E97A 1QBJA 2STTA 1G3SA 4EMSA 2PI0A 3IL2A 3KLNA 2GA2A 1CF7A 3DF8A 5BS6A 3ZMSA 1IUYA 4XLNF 3ZMUA 2ZCWA 2F5DA 2VONA 1DP7P 3KE2A 5JFRA 1HBXG 1P2FA 2A07F 3BJAA 4KUMA 2NS0A 4A6DA 3I53A 5LRSA 3QPHA 3EDPA 5F64A 2OQRA 3I5UA 2DO7A 1YTYA 2Z3YA 5TRDA 2NAZA 5D6FA 3ABTA 2KIUA 2HGCA 2OAZA 3DKWA 1S3JA 4O3MA 3L7WA 4ZYDA 2DPUA 2K27A 4GCVA 4KMUX 3BDDA 1R5HA 2ADUA 4U7BA 1LVAA 1ZGAA 2RVCA 2JPBA 4O5VA 2XAFA 4GXOA 5ERIA 3GW2A 5BQTA 3KFWX 1QNTA 3M8FA 4G6DA 4MTDA 3H3ZA 3FZVA 5H6RA 4AIKA 2M5WA 4CHUA 1YS7A 3P9KA 1QZYA 1HXDA 2YR2A 3E5UA 1ZH5A 4OINF 2O8XA 1C0WA 4S05A 1BC8C 3R60A 1BI2A 5LGUA 2EJRA 3Q9SA 4HX4A 4CO8A 2GA1A 2JRTA 2K02A 3IRQA 4ENJA 4L5IA 2Y48A 5D4SA 4R8HA 2HQNA 1KU2A 1S7OA 1IAWA 2O6GE 1FP1D 4YIIA 1J75A 3T1BA 3K69A 4L9TA 4OU0A 4HOBA 1USSA 1ZLKA 3IKVA 3R0AA 2JTVA 5JHUA 1JHFA 4I0AA 1OPCA 1YYVA 2W24A 5CVVA 5HS9A 4KA4A 1DPRA 2DFIA 3F21A 2NYXA 2YX7A 3F8BA 5D4RA 2P5LC 1ZLJA 3FM3A 5A2QZ 3V8LA 3C1DA 1KU3A 2RV8A 1ZHFA 3WG9A 3WODF 1HW1A 1QQIA 2BBYA 4L9JA 2X4HA 4RB1A 4XSZF 1O3QA 3D5LA 3WTSC 4HQMA 5CJ9A 3FXUA 1I5ZA 1UFMA 2QWWA 1XCVA 3CUQB 5DD8A 1W7PD 4RGXA 5J8FA 3ROUA 1W7PA 2L02A 4KDPA 1MJBA 3C3WA 4Q5SF 1B59A 2HR3A 3TQNA 2QZ8A 4BH9A 2ZFWA 3ZP5A 2FBHA 3QU6A 4HBLA 3I59B 2O03A 1K7AA 4LLNA 3NQOA 3MWMA 1FBQA 2EFQA 1XSDA 2FMLA 3CO7C 4TV7A 5DYMA 2LSOA 2XKOA 5ICCA 1FWZA 3GFLA 1TQPA 1MDMB 2ELHA 4A5MA 3CO6C 2OBPA 2Z33A 1FYLA 1FOKA 4WCGA 3Q5FA 2VE9A 5D6EA 3WTXC 2V79A 3E5XA 3HRTA 4RS8A 3BY6A 1KU7A 2ZO4A 3RDIA 3OV8A 1P4XA 1KA8A 3WGIA 1Z1DA 2EFWA 3WGHA 2H6CA 3L9FA 2F5CA 2IVMA 3S2WA 4XSXF 3TO9A 3T8RA 2D1VA 3ZMZA 3KP6A 1LQ1A 4BHCA 1MDMA 2WV0A 4WXCA 5H6QA 4I2OA 3WE2A 4QLCU 3EYYA 1MJ9A 3E6CC 3V8JA 5AIQA 4LLLA 3LA3A 5E8GA 4GO1A 2K4JA 1IN6A 3ERED 2G9WA 3ELKA 2GXBA 2LF7A 3HOSA 5K5RA 3K1MA 2M45A 3JTHA 3O6BB 1U8RA 2A5YB 4XBFA 4A0ZA 2UXNA 2HZTA 1F5TA 5L3BA 2Z99A 4KICA 3HHHA 4N9IA 1J0RA 3TOBA 5LEKA 1SD6A 4EM1A 5DCMA 1FYKA 2DQLA 2QVOA 5TJJA 2ZNYA 3WTWC 1IRFA 1BC7C 2A68F 2RN7A 3BPXA 3ABUA 3ZN1A 2DLLA 2Y0MA 2EA2A 1ON1A 2OZUA 2JSCA 1Q1HA 2GWRA 1IN5A 3WTTC 2YU3A 1YG2A 4M72A 3LA7A 1H9TA 3V7SA 2M1BA 3U2RA 4BNCA 4BAYA 3H92A 2QQ9A 1T98A 1HSTA 2WWYA 2VE8A 1A04A 3IHUA 4HV6A 3WTZA 3GZ6A 2COMA 1CF7B 3JAMZ 5CYVA 1OKRA 1BIAA 3FMQA 1FSEA 2FU4A 2P4WA 4UUVA 4EJUA 2P7VB 2CG4A 4LGWA 4RB2C 1O7FA 3RIRA 3F23A 3W6KB 2VN2A 2JT1A 2EA4A 1XSXA 3BPVA 3BOQA 1FC3A 1FLIA 2HDCA 3FM5A 4ZYHA 1QZZA 1XMKA 2WTEA 5E1XA 4HDVA 3C18A 2BEOA 1BI3A 2QM3A 5FD6A 5CVUA 1ZG1A 2HQRA 3JAMK 1LB2A 1IRGA 1I1GA 3IWZA 3ZMDA 2XV4S 4U7DA 3FMRA 3ISPA 3FMSA 1S8NA 4L9VA 4BQAA 1IN7A 1U3EM 3HRMA 4LD5A 2H94A 2XROA 4LB5A 1NHAA 1B9MA 2L4AA 3RPQA 1HW2A 5BMZA 4I02A 5F1RA 5IT3A 3HTUA 5L3CA 1ZGJA 2VOOA 3HUGA 4HAMA 1YLFA 5DCFA 3I54A 1OYYA 4A12A 1MD0A 3QRFF 2ACJA 3VFZA 2IPQX 3U9GA 1DPUA 3WTVC 4AIJA 1YW9A 4OIPF 4LLGF 4ENKA 2R7FA 2IRFG 2VC0A 3CUQC 3PQJA 2V6CA 3QPTA 4LJZF 1F4KA 1TBXA 2GQQA 4HZFA 2OQGA 1ZG5A 2FNPA 4ZYGA 2W25A 3IC7A 1XDUA 1DUXC 3GVAA 4OMZA 2Q8KA 3TOAA 3KP4A 2R7DA 4AIHA 1KQ0A 2PQ8A 2XASA 1B4AA 1G4DA 3D0SA 4IF4A 3RKWA 5BPIA 1LEBA 1LDKB 4F7ZA 5LGTA 1BN5A 1O3TA 4AD9A 3KZZA 1GVJA 2EV6A 3RKYA 1K78B 3B73A 1I1SA 2XKPA 5ILVA 1PUEE 2VBWA 3ZPLA 1L0OC 3BWGA 3CUQA 2IA0A 1XGMA 1BBYA 1R00A 4UV9A 4KFCA 5IT9K 3ECOA 3LQQA 1T38A 4NB5A 2ETHA 2HYGD 3R6SA 4I0BA 2MLGA 4UXNA 3KEQA 1OYIA 5DDGA 2GZWA 1BOAA 3VODA 4LFUA 2FNAA 2QYOA 1VTNC 2KIMA 4MEYF 4PCQA 1LNWA 4KIBA 4UVCA
chains in the Genus database with same CATH superfamily
4IL6C 2FMYA 3CCYA 2F2EA 2IXSA 3BZ6A 2GXAA 2HNHA 5ICGA 4JQFA 3C2BA 1Z7UA 4FQGA 4BEHA 2MBFA 4G12A 3E7LA 3HG9A 2HTSA 4A3MJ 4I76A 1O57A 3PNVA 1B9NA 3KYCB 2XRLA 1T0FC 2D45A 1IUFA 3HSRA 3P9CA 1YIJI 2C6YA 1PVEA 1LVKA 1B8IB 3K4KA 4E70A 1R5ID 3HBLA 4HLYA 3MZHA 4PJ0C 5J6XA 4G6QA 5HLHA 3I9V2 4AU7A 1HKSA 1YITI 2Y9ZA 3L1PA 2L0KA 1Z3YA 3BT9A 3P9IA 4PSWA 5K7ZA 1JGGA 2YU9J 4Y7NJ 4V2GA 2J5OA 4EATA 4PGHA 1K79A 2ESNA 3QYBA 3HYIA 3S3OA 2R7TA 3GX4X 1VQ5I 1V55H 4OIRF 3JRBA 4XL9A 3GMEA 1E3OC 3CJNA 3D5RC 1QPIA 3J7AO 4CYDA 3BG7A 4J00A 1JT0A 2AS5F 4IRIA 2QKLB 3MFKA 4EJTA 2DFFA 1XSVA 3G1OA 4ZC3A 4M71A 2XAQA 1I6XA 2GBYA 3REOA 4ASNA 4MFDA 5F08A 4BY7J 1RNLA 3CTAA 1WI9A 4B3XA 1PP7U 4P9UA 3VYUB 1WH7A 2LMDA 3F8CA 1YQAA 2PEXA 1LDJA 2V9VA 2W00A 3BTJA 4KIFA 4BHBA 1VI0A 1P6RA 2BW3B 4C9YA 3LAJA 4OOIA 2DQRA 5JR3A 2E19A 2BHZA 3CF5F 4HDUA 4A3IJ 4JP0A 3F8MA 3FBIB 3QAHA 1F1ZA 4M3FA 5K5QA 2DDBA 1E3PA 4A69C 1BA5A 1K6YA 4HYEA 3L00A 4IHWA 1PDNC 5A2QK 2M30A 2PG4A 5JI6A 1K78A 3W3CA 2PJRB 2MABA 1R49A 1I27A 3BC8A 2DU9A 1K61A 2V6EA 5F0FA 2IT0A 2R3SA 3BP8A 1T33A 2COBA 2HFHA 1TWHJ 1VQOI 2LRDA 1KYWA 2WC2A 2FOWA 3OOPA 2ZJQF 3ZR8X 1ZRCA 3TO7A 4HF0A 3O2PE 1B72B 1MBJA 3COAC 4IXAA 1E3HA 2BE5F 5DUKA 3IAS2 5FD5A 5HLIA 3OYNA 2VOPA 5C44J 2ZNZA 1WQ2A 4OAZA 2R7XA 3RPUA 3QYEA 3HGGA 4IHTA 1LEAA 2Y69H 2R7VA 4UVAA 4WK8F 3SDGA 3M8EA 5IYBJ 1TTYA 5B5EC 2R5ZB 1U6GA 1JUPA 3OYMA 1TQMA 2KLOA 3AG1H 4UHTA 2NVXJ 1UHWA 3EUAA 5LHHA 1T08B 3S1MJ 4EJWA 2AXLA 2V1UA 4MIMA 2VXZA 3QQAA 1UCRA 1QU3A 1X3ZB 4KNYA 3AG2H 4F3QA 3M1EA 2PMUA 1O3SA 4CCKA 1B1BA 2EFNA 2K5CA 1BW5A 1H9GA 2KFDA 1WKMA 5IT9Z 1IJWC 1WJEA 3PNTA 2WB1A 4L0YB 2Q2EA 3ZQQA 1MH3A 4NBQA 1EV7A 2HKXA 1G2HA 2EIJH 1XGNA 2IAIA 1IXSB 1I3QJ 3GTJJ 1XD7A 2V1DA 3QOEA 2EILH 1TZLA 2GAUA 4IJAA 3K7AJ 5D5WB 3ONQA 3LA2A 1R58A 3VOEA 1BIBA 3KX2A 3L2CA 2WY7Q 3KZYA 4AVPA 1IW7F 2KL4A 1BM9A 9ANTA 2BGCA 2DA4A 1RR7A 2ISZA 3DPLC 2ICWG 1YRNB 4FE7A 2XAHA 2P8TA 4KN7X 4WX9A 4HNVA 1LE8A 4JX5A 4PGGA 2CFOA 2Q1ZB 2XF5A 3RZOJ 5HOOA 3K4NA 1TNSA 2DBBA 1V4RA 2LREA 5H20A 3CC7I 3HJEA 1J2XA 2TCTA 1UJ8A 4ESFA 2VL8A 1YO5C 3C2HA 4XR6A 2KIQA 3H0DA 4I99C 4QPOA 4IQJA 1X1DA 3HC7A 5ILSA 2XUBA 4BY1J 1LDDA 3JW4A 2W57A 3EUKL 2GXGA 1U5TB 2NS7A 4V2FA 3MQ0A 3MKYB 3M07A 4RBOA 2O61A 4FTHA 4UV8A 3LQRA 1ZREA 4KISA 2ZXHA 1T2KA 1DQUA 2HKOA 2Q0OA 5DD4A 1SANA 3DEUA 4C3HJ 3CCQI 1RPWA 2GIVA 4M9SA 4PUSA 3FXRA 3GFJA 3V7RA 2G7UA 3HIFA 2JVGA 1PP8F 1EF4A 1GUUA 2V9PA 3S2HJ 1BR4A 3Q9VA 3KIOA 3DXJF 4U0VA 4WXDA 4Y17A 3MKZA 4F93B 2L9VA 1VQ6I 3L2QA 1BJAA 1D0XA 3TEDA 4MHGA 3ZOBA 3OIQA 3BQYA 3B02A 2MYSA 1S6LA 3W6JB 1J9IA 1FEXA 3F8FA 3QP5A 4B43A 5LHIA 1JJ6C 1OR7A 2XDVA 2RREA 3V7CA 5LFAA 3NWSA 2IJLA 1AOYA 2PX9A 2XIGA 3E6BA 4RA2A 3TP3A 5LLQA 1E17A 4M6YA 5D5XB 2K9QA 1D8KA 4A2UA 4D7NA 4RGSA 2R7SA 5LBQA 4HX7A 3I4PA 4RM3A 4B1RA 1OCTC 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 5B3SH 3GEZA 1X3WB 3M8JA 2TRTA 3F9KA 3D5SC 4MEXF 2K85A 5BPDA 2HVRA 1OQYA 3F3XA 1UB9A 1IGNA 1SMYF 1JKOC 4YIFA 3ZCOA 4HV5A 4S04A 4BE0A 4OWRB 2ZBKA 5E18F 3HSEA 1SVMA 4BYYA 3WHBA 1D5VA 4KT5C 4ZDLA 2XC7A 3BTLA 1Y1VJ 1N77A 4MNUA 5BOXA 1AHDP 4RGRA 3N05A 4R79A 1MBKA 2HEOA 2HOSA 4A0YA 1MBEA 1H0MA 3K4MA 2HYFA 1P4AA 2VKDA 2DT6A 3RJPA 1XTAA 4Q47A 1SFEA 4Y15A 1X1BA 1AKHA 3WGGA 5H2FC 2JSPA 5ICFA 4F92B 2QQAA 1SFKA 1J7KA 1D1AA 2BVMA 4IVNA 1FBUA 2BY3A 1Y8QB 3KLOA 5E3OA 4G7HF 1Z6RA 3OYIA 4E7IA 1UHMA 2R7QA 4HRIA 1W36D 1WGXA 2QUFA 2KP6A 1TW2A 2L7MP 1V5FA 4D0PA 5GAEJ 3VSLA 2LY9A 4PJJA 2L7KA 3I0TA 1SAXA 2A3SA 2XGEA 1QGPA 4A6EA 3C2GA 1Z21A 4BBRJ 3AL0C 4NHJA 4CYCA 1POGA 3IV5A 3HOTA 2KJCA 3S1RJ 2ECCA 3X2QH 4Z6YA 5EJCA 1MH4A 2HXOA 3GYHX 1V54H 3C7JA 1ODDA 3MZYA 2HZDA 1ULYA 1ZN2A 2KPMA 5EYRA 1USTA 1FSHA 2E1CA 3CDLA 3A0HC 5CPRB 1REPC 4HA8A 2VJ4A 1MZBA 1MNEA 1KQ9A 1B6AA 3TMOA 4HNUA 2VODA 2OA4A 3U1DA 4H4KC 4AIDA 1AKHB 1MJAA 4M9ZA 4BUPA 5J4VA 3MVPA 1U0JA 2DW4A 2QLZA 1VQKI 2DI3A 4A3GJ 3ML6A 1XDSA 3LMMA 4AUXA 4FX4A 5L3GA 3NEUA 2FEZA 1L3LA 5EZGA 2Y75A 2K7LA 1CGPA 1X58A 2HOEA 3I55I 5LGNA 2QBYB 1O3RA 1Z77A 1MBFA 1FOXA 3HOWJ 3RZDJ 2YSRA 4YFXF 5AONA 1KONA 1LPQA 1WJ5A 1JGSA 1OCZH 5M5YJ 3ZQFA 3I58A 4E7LA 4D9JA 5IOYA 5DTDA 4EQQA 3CJTB 5J8CA 1E0EA 1P4WA 1V5GA 1Z0XA 5HVQC 4D5FA 2OV7A 4KMFA 4O6JA 4WF2A 1Z6TA 3IWFA 2B9SA 5FRMA 4EM2A 2W84A 3BR2A 3FIWA 2V1XA 4IOAF 2ZJ2A 1BOBA 3G6EI 4AYBN 4HG2A 2GLOA 4WWCA 1P92A 3JSOA 2OTLI 3CUOA 3Q3SA 2E7XA 5KCMA 3LSMA 2BXZA 1A36A 4IHSA 4I7HA 1W5SA 3P5JA 1F9NA 2IS4A 2LC2A 3HOUJ 1YOVB 3HSFA 2D2WA 1ZAOA 5K1YA 4BJ6C 5JVTA 1NH3A 2E1NA 2P5VA 3DTIA 2UV1A 2EINH 5FLMJ 2NNNA 1D3YA 5M5WJ 1JTYA 1YI2I 3HOZJ 3OSGA 3LWFA 2A05A 3EETA 2LF8A 4LG0A 2VB6A 5KK1A 2BY0A 3LSJA 4DNCA 5IP9J 3DBRB 2FXAA 3IH4A 2P7CB 3SYTA 2STWA 4X6AJ 2R93J 1EKEA 3S16J 1U2WA 1GHCA 2MC3A 2VJIA 3RSNA 3SXYA 2FA5A 4V19K 1D1CA 1TW3A 2QENA 4FE4A 2MLKA 4M3DA 4M73A 1OFCX 3KCCA 1H8AC 3M9AA 1YX5A 4OIOF 1N25A 1S7AA 3HB9A 4OAYA 2RC4A 3E6DA 2ZKZA 2L9SA 1GV5A 1MBGA 2Y31A 1IG7A 2RQQA 1HKTA 2GOXB 2Y0SN 5FJ8J 1HF0A 5E20A 2L2OA 2ID3A 5K7FA 3FKIJ 1U78A 2M34A 1FY7A 2EB7A 4QIWN 3JRCA 3MMYB 3E5QA 1P7IA 3RYRA 2IP2A 1SMTA 1D5YA 1BR1A 4LK1F 3RTRA 1Y0UA 3M3YJ 4ZH4F 1R1UA 2PMHA 1T8IA 1P7JA 4BXXJ 5AIPA 4JK1X 2DN0A 2E2HJ 2QGUA 2P6TA 5HLTA 5LRRA 4ETSA 2GOMA 2VJ5A 2M9HA 5TISC 3S2DJ 1WJFA 4XONA 1TNTA 5DUIA 2GIZA 4EGYA 4RLFA 4L18B 1QPMA 3BQZA 3QYFA 4ANJA 1RIOH 3CC2I 1ZG3A 2DCEA 1U9OA 3Q0WA 1E2XA 2IGKA 4CGZA 1VFCA 3TDZC 4LIVA 3BLYA 2KDOA 3I4MJ 4BACA 4KN4X 4FT8A 2OC6A 3TW6A 4UUSB 2P81A 2QEXI 1ZYRF 2E1OA 5D5UB 5EEAA 2WBMA 4PZJA 2CFXA 5L3EA 4II3A 1U5TA 3CESA 3AAFA 1TP4A 2V26A 3ABLH 1X19A 4UB8C 2R5YA 1EH6A 4K2EA 3TGNA 2QBYA 4CZZA 1R1TA 2X1DA 3QOPA 2L01A 1XGSA 4GYIA 2I10A 3K70D 3HKZA 1YW7A 1DP3A 4A3KJ 3J81K 4LIUA 1MBHA 4EV0A 3JSPA 2HS5A 4YRVA 2XAJA 3IH2A 4E6KG 2R0QC 1QHHD 1T6SA 2YUSA 3HEFA 1FOWA 1NTCA 2HYJA 2IA1A 2A6EF 4B8XA 5FKMA 4BE2A 4QWQA 1ZR4A 4LB6B 1RUNA 4BQNA 3IKTA 3SQNA 2PN6A 2O0YA 3MKLA 2KRHA 3DEWA 5D8LB 2A5WA 2EV5A 4MTEA 4HF1A 2HI3A 1KGSA 3SJMA 1J59A 3SEQA 4B44A 4G7OF 3A4CA 5CVIA 2HWVA 3OR2C 3JRIA 2MFZA 4G8XA 3TO6A 1QZEA 2CMPA 1KU9A 4BKXA 1HW5A 1I50J 2TDXA 2E71A 1BW6A 4M74A 1VQLI 1DU0A 2DMUA 4XLPF 3MCZA 3VEPA 1RC9A 4UNOA 5HS7A 3DKYA 3BJOA 3IAM2 2CW7A 3RKQA 3FX3A 3R4KA 1I39A 1RUOA 2G7HA 2ZC2A 4R1HA 2MH9A 1LJ9A 2IS6A 2QSGX 2DT5A 5EZHA 2F4IA 3CQZJ 5GP9A 1WJBA 3FDYA 3L2RA 4W1UA 4LK0F 2F4OB 3J7ZI 2DJNA 5FGMA 4XQFA 1ZARA 4Y33A 2LNBA 2F5FA 3S8PA 1Z05A 2LR8A 3T5XA 4KYWA 2E35A 3IH3A 1TWCJ 1H89C 3F22A 1XN7A 5KVRA 2M0MA 2FJ1A 2W1OA 1R9TJ 1XB4A 4HW0A 5LD2C 2VT3A 3DPUA 5EF6A 2ELJA 2PFBA 5TGTA 3GTMJ 5FLXK 4UVBA 2XRNA 1SD4A 1KYZA 3VDXA 4HF2A 4GGGA 4P9FA 1D8JA 4XRSA 5FLVA 2EFOA 3V4GA 4J01A 2M4KA 2F5VA 1JE8A 4UUSA 3EYIA 3K2ZA 3KETA 1OMIA 1YFHA 3I64A 1KZHA 5HDGA 3LAPA 1SD7A 4ZZLA 3WTYC 2XPVA 1J09A 2VT2A 1BI0A 2X85A 3H5NA 2FF4A 2L5QA 2R7ZJ 3L09A 1HDDC 2LK2A 3H9GA 3CD6I 3K0LA 5B66C 3FXJA 2MA3A 5GAHJ 2PBIA 2FBIA 5F04A 2EZLA 5D8KB 2FE3A 2HQAA 1K83J 2RKHA 4Y4RA 4P55A 4EVIA 1FBSA 4NQWA 2XF7A 4XMYA 3ZMVA 1YX3A 2E7WA 5LHGA 1GVDA 3Q0VA 3ASNH 5F1JA 3LFKA 5EG0B 4ZJZA 1EH7A 2RQPA 3SZPA 2LG4A 4WXHA 4BXUA 5IPAA 2PJPA 4A3EJ 2VBYA 2XVCA 3AG4H 2EZHA 3J80K 4IEJA 1HQCA 3PNYA 3DPTA 3JRAA 2F5EA 3KP5A 2X1EA 1IXCA 1DDNA 1STZA 3DTKA 3NRVA 3WG7H 2BZTA 1FTTA 2P6SA 2FRHA 3RYPA 3G73A 2CO5A 2UWMA 2A61A 2KJBA 1YW8A 2HTJA 3OYLA 2JA8J 1EH8A 1QVUA 2CUZA 4EJOA 5L3FA 5EGOB 1A31A 1ETWA 4RB0A 4CDGA 5IP6A 3RKXA 2KZVA 4NC8A 2EQRA 5F0CA 4GDFA 3S1QJ 1GT0C 3A01B 4YFKF 3ZN0A 2H27A 3AFHA 1IZ1A 2X6XA 4IQ4A 2CQXA 1X2NA 3GLXA 1TWFJ 1IXRC 4I01A 3MZ8A 3CCLI 4N4NB 2DYRH 1DU6A 4RMNA 1W5TA 3BCBA 3WU0A 2DK8A 3F6OA 3L2UA 3A02A 2CUEA 1ZR2A 4NUBA 3PQKA 3GF2A 1HKQA 4A5NA 4F55A 3GFIA 5HDNA 1JUMA 1V5EA 4A3LJ 1HCRA 1GXPA 4N0BA 4FX0A 4J19A 3ZQ7A 1D0YA 4CYCB 3H9QA 4CICA 1FIPA 5HLGA 3N4MA 2LDUA 1BI1A 3OYHA 1J5YA 2CGPA 3GTLJ 2ZMEB 3J80Z 1JXSA 3FWEA 3KYLA 4M3GA 2CW0F 3BG9A 1OCCH 3OL3A 2KIFA 3EQLF 1FJLA 1EJ9A 4HPQA 4M6XA 4G94A 1AWCA 3N97A 2O3FA 1YS6A 2AHQA 1MNMC 4XK4A 3DQVC 2K4BA 3PO3J 4IOCF 1XMAA 2VPRA 2M87A 3K1PA 3T0YA 2IGNA 4E4HA 2VQCA 2BY1A 2MD5A 5DCMB 5FO5A 3FBNB 2L54A 3GTKJ 3DTEA 2CH0A 5E8IA 4XLEA 1G3WA 2QF7A 2CSOA 4XRFA 1S7EA 2Z1DA 3UKGA 2L7ZA 2NVYJ 2VQGA 4Q4ZF 3GWZA 2BHYA 2EK5A 4X1EA 1WWXA 5ILUA 4DGWB 2FOKA 2LKPA 3BR0A 2O5RA 3ECHA 3QU3A 3S15J 1FX7A 1TT5B 4XICA 2MH2A 3TDUC 3ULQB 3S14J 2KZGA 3CCEI 1HDPA 4DQ2A 5HODA 2JPCA 2RNJA 3MEXA 2ZMEC 4LMYA 1GDTA 4CZCA 1XC5A 2EV0A 4PDKA 2VBXA 3Q0UA 5L3DA 1ZRDA 2OD5A 1MMSA 4U0WA 3HTSB 4AWXB 5J1YA 3CLOA 3BG5A 2YS9A 3CLQA 4ESJA 3IRRA 4OIQF 4A3DJ 1Y56A 5ICEA 1X1CA 3PIPF 3O3KA 4YIRX 1OISA 1Z9CA 3HRSA 4H0EA 4KIGA 1PUFB 2HQ5A 5C3EJ 3PL8A 2FUG2 4BJTA 3K10A 1XGOA 2A6HF 1R23A 3TKYA 1R1VA 2VKVA 3PM1A 4XOTA 2VASA 2I5UA 2UUZA 3CP2A 1G3YA 3KPHA 2FBKA 1UZCA 4YEJA 2V7FA 5K7HA 2NRAC 4A93J 5E79C 3PFYA 2W7NA 1A6QA 2JA7J 4G6TB 1DGWY 4Z2YA 4ZZDA 1S9HA 3GO5A 3T8TA 4DYRA 2IGMA 5FB2A 3R0JA 1O7LA 3DFGA 2D1HA 5C4JJ 2OU2A 4B4CA 3DLAA 2RGVA 3OYCA 3RCOA 1ONVA 4KT6A 4EEFG 3CP8A 3F8NA 3H3UA 3G1LA 3UNGC 2JN6A 5DEQA 1QHGA 3LSKA 1X1AA 3OMYA 5FKKA 2ZMEA 1ZRFA 3FK7A 3KP7A 4HLXA 1IC8A 5CVRA 2F48A 4ESBA 3DV8A 2HVQA 2LD5A 3BTCA 2CV1A 3M7GA 4B09A 2Y2ZA 3CF2A 4I98B 3WE3A 2Y30A 2G0EA 1G8XA 1SFXA 5FFXA 2EFPA 2DYSH 2VKEA 2IS1A 3GTOJ 2Z16A 1HSJA 4BE1A 5D5VB 2A69F 2H6BA 2CYYA 5K5OA 2X1CA 2R92J 4XN0A 2P5KA 2ZXJA 3EUHA 3J81Z 3BZCA 2B0LA 5HDKA 3QPLA 4IRGA 3HOYJ 2BXYA 3JR9A 3DU5A 1A35A 2Z5UA 4EGZA 3GFMA 3KP3A 4C30A 5CVJA 1IN8A 1R36A 2DPDA 1MKMA 2L3DA 1VZ0A 2W85A 1UMQA 2QQ8A 2ZXWH 2NNYA 1RI7A 5F27A 2Z9OA 2VC1A 1V3FA 4HX8A 3PFIA 3ZQIA 2VIXA 2KRFA 1T39A 1GXQA 4E7KA 3G3ZA 2ESHA 4A3CJ 2Y9YA 3DP7A 2BV6A 3JCUC 4RGUA 2DAOA 3O8GA 5IYDJ 1ETOA 5EEHA 4IRHA 5E3MA 4YG2F 4E7ZA 4EM0B 1JI8A 4G7ZF 4M9XA 2KHMA 1SFUA 4JX4A 4N4OB 1MNDA 1ON2A 2L4MA 4LG0B 4L5JA 2QQBA 2IW5A 2E5ZA 2LBFA 1YIOA 4DYCA 5E17F 2R5ZA 2YPRA 4NQWB 3FKJA 4Y3OA 3GZ5A 2DK5A 3OIPA 4ON0A 2CQKA 4FCYA 4Q48A 4AVZA 4HNTA 1JKQC 3CCSI 1X3UA 1Y0NA 2WAQN 3H9JA 4D5CA 1F43A 4P5OA 2YX4A 2XF6A 3P7NA 1R4NB 3VB2A 2ZSHB 2XAGA 5E1WA 4Y13A 4U88A 2RDPA 3DBLB 4OMYA 4IPAA 2LBFB 1WRJA 2CUJA 4XOPA 2IBDA 3SEZA 3OYDA 2DOAA 1JT6A 2XPUA 4RAZA 6PAXA 3CCRI 4ENNA 4RB3C 1WSUA 2WADA 3E3VA 3OYEA 1LFUP 2K86A 4E7JA 1FP2A 4EJVA 3JRGA 1MIJA 2FX0A 2NVQJ 1WCMJ 3A1YA 3F0CA 3U1KA 2VI6A 3WU2C 3WU1B 4D1QA 4ZTFA 4CCLA 4CCMA 2VQLA 1ERDA 1R5GA 3JREA 3HHGA 2KDZA 5FKOA 3F72A 3DWLE 1OYWA 4ITVA 4I09A 1FTZA 5FKLA 2X9DA 2VXDA 3PIOF 2JK3A 4BHPA 2BYVE 3ZMTA 4MQ9F 3GUDA 2IA2A 4JBAA 1PJRA 3CDHA 1HLVA 1CQTA 2XGXA 1FZPB 1FNNA 2FSWA 1G6NA 1RZ4A 3V8KA 1XCBA 1I3AA 3LFUA 4L9NA 5ED4A 2ISYA 1U5TC 3M1CA 1T0FA 4HSTA 2JA2A 4HQEA 4CXFA 4C3JJ 2PMZN 1JJ8C 3K9TA 1ZKGA 5CLSA 1IN4A 4F52A 3OY9A 3FF5A 3CCJI 3I71A 1GV2A 3F6VA 4NNJA 2JZYA 2FQ3A 2NOJB 4GYGA 4BDYA 4C2UA 1AA7A 3K1NA 3VSKA 1JHHA 3FHZA 1LFBA 2DTZA 2LY2A 5LEJA 5FFZA 3FHNA 2H09A 3G1MA 1A5JA 4B48A 2LVSA 4RAYA 5JVGF 2IGOA 3RI4A 4N9HA 2EWNA 5HS8A 4HSRA 1BR2A 2OJED 2I8DA 3K6GA 3HOXJ 5EEGA 4G9YA 1JKPC 3V42A 4ZYEA 1S29A 3SZTA 2PLYA 1OCOH 4I6ZA 1IF1A 1W4MA 2XAUA 3I59A 5FLXZ 3QWLA 3FXQA 2CJJA 4JOMA 3S32A 3S93A 1VQ7I 2V9KA 4XLFA 2M8EA 3SFZA 1KQ8A 1MW7A 1SD5A 1R7JA 2L7FP 3JTGA 3RQ4A 4RM2A 4P96A 3WTUC 3BR3A 3R61A 2QSHX 4DZJA 2ZXIA 1R22A 1X1PA 2CQ7A 4ENMA 2M4GA 1FT9A 3FISA 1K6OA 4CCNA 3ZRGA 1FPQA 3OSFA 3A01A 5DV5A 4II2A 3H3VK 5J1UA 1W7PB 2CWEA 2DXIA 2X0LA 2XHKA 3KP2A 2KKOA 2VUMJ 3I3LA 2XSJC 5JLXA 1MGTA 4QSHA 2VBZA 2E60A 3KZIC 3S3MA 3A03A 3HKZN 4MQVA 4YFNF 4MGRA 1P9QC 2HU9A 2UXXA 3GXOA 3S17J 2LFBA 1TLHB 2WY8Q 1TC3C 1T95A 1WVRA 3LSTA 3BR6A 3BROA 4XKBA 5F6FA 4XKWA 2UZKA 5DM6F 2J5PA 2F4MB 2NXNB 1FYMA 3DKXA 2OZ6A 4U0YA 1F36A 3HRUA 1W0UA 3SHFA 2NVTJ 5E1ZB 3OS1A 1VQMI 5M3FJ 3QP6A 2MW8A 2XPWA 1Z91A 2F6CA 1QO0D 2VLAA 4A0XA 1VQ8I 4QPQA 3BCAA 3E6MA 3BJ6A 4FHTA 3E97A 5CQGA 3SDBA 1QBJA 2STTA 3ESWB 1G3SA 4EMSA 2PI0A 3IL2A 2HPMA 4DJAA 5HNHA 3KLNA 3M4OJ 2X6WA 2CRGA 3AL0B 2GA2A 3CCUI 1CF7A 3CDIA 5FRNA 3DF8A 3HM5A 3TBIA 1QRYA 3GZNB 5BS6A 3ZMSA 1IUYA 4XLNF 3ZMUA 2ZCWA 2F5DA 2VONA 1DP7P 4M6VA 2LLKA 4BQOA 3KE2A 5JFRA 4ABZA 1P2FA 1HBXG 4AYBA 1B8IA 5IYCJ 3LSIA 2A07F 3OS0A 4NC7A 1XG1A 2DODA 3BJAA 4KUMA 2NS0A 4UUTA 3LSGA 5EGOA 4A6DA 3I53A 3ZQHA 4DBQA 5LRSA 3QPHA 2O8KA 3EDPA 5F64A 1SC7A 2OQRA 1U8BA 2DFHA 1YJNI 3I5UA 1W5CC 5C4XJ 2DO7A 2A6TA 4PFPA 1YTYA 2Z3YA 5TRDA 2NAZA 5D6FA 3ABTA 2KIUA 2HGCA 2OAZA 2M7BA 1ETKA 2L9NA 3DKWA 1S3JA 4ZYDA 3L7WA 4O3MA 4XRSG 2DPUA 2K27A 1VQ9I 4GCVA 1BJZA 4KMUX 3BDDA 4RAFA 1OLTA 1YRNA 1R5HA 2GM4A 2ADUA 4U7BA 1LVAA 1ZGAA 2RVCA 2JPBA 4O5VA 2XAFA 2DA3A 4UY8I 2DA5A 5GPCA 4GXOA 5ERIA 2AO9A 3CMMA 3GW2A 5BQTA 3KFWX 5BNGA 2HOAA 3CCVI 1ITYA 1B72A 3VPRA 2K3FA 3VWBA 1QNTA 3M8FA 4G6DA 4DIQA 3ERMA 4MTDA 3H3ZA 3FZVA 5H6RA 1D1BA 4AIKA 3IUOA 4BDZA 2XGCA 3IP4B 4MO7A 2H8RA 3W2AA 2M5WA 1YE9A 1YS7A 4CHUA 3P9KA 4W97A 1QZYA 1YJWI 4CA0A 1MMDA 1HXDA 3K4CA 2YR2A 1WHUA 3E5UA 1ZH5A 4OINF 2KMUA 2O8XA 1VQNI 1C0WA 3K4LA 4S05A 2LKSA 1VQ4I 2W48A 4A3FJ 1BC8C 3RPUD 3JRHA 1WH5A 3R60A 1BI2A 2EJRA 5LGUA 3Q9SA 4HX4A 3HPGA 1APLC 4CO8A 2GA1A 2JRTA 1Z7LA 3I56I 3LSHA 2E1MB 2K02A 3IRQA 3PUBA 5JLWA 3E1SA 2VQHA 2M3AA 4ENJA 4L5IA 2Y48A 1MMNA 1UHSA 5D4SA 2PJRA 2DA6A 4CCJA 5GADJ 4ZTJA 4R8HA 3LNQA 1SVLA 3JRFA 4C3IJ 2HQNA 1KU2A 1S7OA 1IAWA 2O6GE 2O9LA 1FP1D 4YIIA 3PUFA 1MMAA 2Y0SA 1J75A 3T1BA 3I4NJ 2N8GA 2EPFA 3K69A 3NAUA 4HOBA 4L9TA 4OU0A 1USSA 3OL4A 1ZLKA 2CUFA 3IKVA 5GPAA 2QKMB 2JTVA 3R0AA 2B7EA 5JHUA 1JHFA 3QPSA 3RQIA 4I0AA 3FXLA 1OPCA 2HOTA 1YYVA 3H35A 2AQFA 2W24A 5CVVA 5HS9A 2OTJI 4KA4A 2KQRA 2E2IJ 1DPRA 2LY1A 3ABMH 2WA0A 2DFIA 3GLLA 3F21A 2NYXA 2YX7A 3F8BA 5D4RA 2P5LC 5J47A 1ZLJA 4DYQA 2LKXA 1D0ZA 1IV8A 4GFBA 1SEUA 3TP0A 3FM3A 5A2QZ 3H5RA 3V8LA 3C1DA 5DS9A 3J7AY 1KU3A 2OPTA 4LITA 1N75A 3GTPJ 2RV8A 4CSWA 1ZHFA 2R5YB 3WG9A 3WODF 1HW1A 1ACIA 1QQIA 2BBYA 2WV1A 1X4PA 1BL0A 2O7OA 4L9JA 2X4HA 5E3LA 2FQ4A 2JUCA 5CKTA 1LUJB 3BR1A 4XLAA 4RB1A 3SFIA 2E5NA 4XSZF 1O3QA 3D5LA 3WTSC 4HQMA 5CJ9A 2K9LA 3UR3C 4BL0B 1Q1VA 3FXUA 1I5ZA 1UFMA 2K40A 2QWWA 5FROA 1XCVA 3MD2A 3FXMA 3W6VA 1RRJA 3ASOH 2JRMA 3CUQB 1G59A 5DD8A 2X6YA 1W7PD 4RGXA 5J8FA 4IX7A 3ROUA 1W7PA 2DA2A 2L02A 3H0GJ 3LSPA 2CV0A 3HL2A 4KDPA 2IS2A 3QODA 3PO2J 1MJBA 3C3WA 4CUGA 4Q5SF 4YELA 1B59A 3H36A 3HOVJ 3CJQB 2ID6A 2HR3A 4PJLA 3TQNA 2QZ8A 4BH9A 2ZJPF 2HXIA 2ZFWA 3ZP5A 3ZXSA 2JQ7A 5KAFC 2FBHA 2CU7A 3QU6A 4HBLA 3I59B 1W0TA 3K4JA 4PK4A 2O03A 3TL4X 1OCRH 1K7AA 4LLNA 4PSXA 3NQOA 1FMWA 4M3BA 3MWMA 2R7WA 2RAEA 1ETYA 1FOYA 1FBQA 2FD5A 2EFQA 3MN2A 2KT0A 2LP0A 1XSDA 1FIAA 2FMLA 1WPKA 3CO7C 4TV7A 2K9MA 2X6OA 2LSOA 2XKOA 5DYMA 5ICCA 2EIMH 1FWZA 4IHXA 2R4GA 2WAEA 3H1CA 3JRDA 2E2JJ 2WB1N 3GFLA 1TQPA 1IDYA 3DU6A 2ELHA 5GTIC 3OYFA 1TWAJ 1MDMB 4A5MA 3CO6C 5IOZA 3B6AA 5J40A 2JA6J 4CH7A 3PSFA 3OYAA 3A2KA 1WZ2A 3S1NJ 2OBPA 4ZYAA 2Z33A 1FYLA 2JUGA 1FOKA 4WCGA 3Q5FA 4XNFA 2VE9A 5D6EA 3WTXC 3NARA 2P0WA 1RR8C 2KISA 2V79A 3E5XA 3HRTA 4RS8A 1Y1WJ 4D7MA 3BY6A 1XPXA 1KU7A 2ZO4A 4QTRA 3RDIA 1WJCA 2DOFA 4E7HA 3OV8A 2DFEA 1SVOA 2CQQA 3A0BC 1P4XA 1KA8A 2JMWA 3WGIA 1LFPA 1Z1DA 4F91B 2CS3A 2EFWA 3OOUA 4BGDA 1O4XA 4NC6A 4RLQA 5J1RA 3GCMA 3WGHA 2H6CA 3L9FA 2MD0A 2F5CA 2IVMA 4ZDPA 2K9NA 3S2WA 4XSXF 1Y6IA 3TO9A 3T8RA 2ECBA 3O8HA 2D1VA 1K4SA 3ZMZA 4A3JJ 1TL8A 3KP6A 4FASD 4FETA 1LQ1A 4XKVA 2X48A 4BHCA 1MDMA 2WV0A 1SFOJ 4WXCA 5H6QA 2M2EA 1RESA 4S0HB 4I2OA 1R6RA 3WE2A 2MC4A 4PFOA 2DMNA 3HDDA 4QLCU 3EYYA 3K4BA 1MJ9A 3E6CC 3V8JA 2NVUB 4DW6A 5AIQA 4LLLA 2LOOA 2JA5J 3LA3A 1UELB 5E8GA 1Z67A 4GO1A 4JX6A 2K4JA 1IN6A 1TT0A 3ERED 2G9WA 3ELKA 4LG3A 2GXBA 4JYKA 2HVSA 2X51A 2LF7A 3HOSA 2DMTA 4RDUA 2D5VA 4XORA 1IO2A 3K1MA 5K5RA 2M45A 2MGQA 3HUGB 3ZQLA 3BTIA 1NK2P 3JTHA 3O6BB 1U8RA 4U87A 3K70C 2JJ7A 2A5YB 2H1KA 4XBFA 5EDNA 4A0ZA 2UXNA 2ZSIB 4BBSJ 2HZTA 4NDLA 2VJJA 4IO9F 1F5TA 1MSFC 5L3BA 5E3NA 2Z99A 4UB6C 2IEKA 4DOZA 1IRXA 4BXFA 1ZQ3P 4KICA 3HGYA 3HHHA 4N9IA 1J0RA 3TOBA 1ORKA 5LEKA 4XRMA 1YHQI 1SD6A 3CMYA 4EM1A 5DCMA 1FYKA 2DQLA 4X0GA 1MSEC 2M7AA 3VYSB 2QVOA 5TJJA 2ZNYA 3OYBA 3WTWC 1IRFA 3GTQJ 1BC7C 4C2MJ 3KYDB 1IV6A 5KNLA 2A68F 2RN7A 3BG6A 2W4SA 3BPXA 1HA8A 3ABUA 3ZN1A 4XLCA 2DLLA 2Y0MA 3G2BA 1XMXA 2ME6A 2EA2A 1ON1A 2OZUA 3DBHB 2JSCA 4ZDOA 2EZIA 2MSYA 1ETXA 1Q1HA 1EA3A 2GWRA 1IN5A 2LH9A 3WTTC 4AM3A 3SZGA 2YU3A 2LTPA 1YG2A 1YJ9I 3H5AA 4M72A 4BEHB 4DBRA 1X2MA 3LA7A 1H9TA 3V7SA 2M1BA 3U2RA 4BAYA 2PMZA 3MKWB 3L2WA 4BNCA 1A6IA 2R7RA 1NK3P 1LKXA 2DDAA 3H92A 2QQ9A 4Y52J 3PSIA 1T98A 1VF9A 1HSTA 1WJDA 2WWYA 3W2WA 1T56A 3EUHC 2VE8A 1A04A 2LYCA 2V4JC 3IHUA 1LE8B 2DA1A 4HV6A 3WTZA 3GZ6A 3VYTB 2KRCA 3U21A 3FXOA 1UG2A 5KAIC 2COMA 2OUMA 3OIOA 1CF7B 3JAMZ 5CYVA 1OKRA 2ME0A 4GRIA 1K4TA 1BIAA 3KEYA 3FMQA 1FSEA 2FU4A 2P4WA 3OWTA 3TW7A 4UUVA 4KJZA 1SAUA 1IRZA 5M5XJ 4EJUA 3AKZA 1W36C 2P7VB 2L9RA 2CG4A 4LGWA 4MLOA 4PJNA 2DJIA 4XN3A 4RB2C 1RKTA 1O7FA 1ZGWA 3RIRA 3OS2A 3F23A 3CMEI 2DMPA 4E7SA 3W6KB 5KHDA 3BZKA 3BG3A 2VN2A 2JT1A 2EA4A 5B1BH 1XSXA 3BPVA 3BOQA 1FC3A 1FLIA 2HDCA 1R4MB 1RETA 2R7OA 3FM5A 2R7UA 4ZYHA 4BQQA 1QZZA 4IKFA 1W1WE 3OR1C 1ETVA 1XMKA 1PUFA 2WTEA 5E1XA 4HDVA 3C18A 2M0CA 2JWTA 2BEOA 2WAFA 3OYKA 1BI3A 3FXKA 3B6CA 2QM3A 3DEEA 5FD6A 3GTGJ 3D1NI 5CVUA 1ZG1A 2HQRA 1ZELA 4XIDA 4FISA 1S72I 2XB5A 3EPZA 3JAMK 1MMGA 1LB2A 1ZK8A 5J4YA 1IRGA 1ZTRA 3CC4I 1I1GA 3IWZA 3ZMDA 2XV4S 3VYRB 4U7DA 2HDDA 3FMRA 3ISPA 3G71I 3FMSA 3S3NA 1S8NA 4L9VA 3BR5A 5GAGJ 2VPLA 4BQAA 1IN7A 5JHFA 1U3EM 2AQEA 1R71A 3HRMA 4LD5A 2H94A 2XROA 4LB5A 1NHAA 1B9MA 2V1NA 1FMVA 2L4AA 3RPQA 1HW2A 2XB0X 3DCFA 5BMZA 4I02A 3G4SI 2DMQA 1HOMA 5F1RA 5IT3A 3HTUA 4B47A 5L3CA 1ZGJA 2VOOA 2W82A 1XX5A 3CMAI 1WFXA 3HUGA 3ZGKA 4HAMA 1YLFA 2E1MC 2OF7A 3I54A 5DCFA 3E0JB 2AXTC 1OYYA 2RNGA 4A12A 2H8WA 2Q2EB 2EBIA 1MD0A 3QRFF 4C2TA 2ACJA 3VFZA 2IPQX 2M8GX 1TWGJ 5IY5H 2EH3A 3U9GA 1DPUA 3ZQGA 1U9NA 1PYVA 3CZ6A 2CQNA 3WTVC 1UAAA 4AIJA 2MG4A 1YW9A 4BS9A 1VQPI 3W2VA 2ZJRF 4OIPF 4LLGF 2XSDC 2HDWA 4ENKA 1N78A 4M3EA 3CJRB 4L5EA 1AU7A 2Z2SB 3DLLF 4IHYA 2R7FA 1Y39A 2IRFG 4HEA2 2VC0A 3CUQC 3NWTA 3PQJA 2EZKA 2V6CA 2B63J 1ETQA 3QPTA 4LJZF 4LOCA 5M3MJ 1F4KA 1TBXA 3HPHA 1ENHA 1M1EB 1JTXA 2GQQA 4XM3A 4XLHA 4IZZA 1OR7C 4HZFA 4XKCA 2OQGA 1ZG5A 5J3LA 2DOEA 2DT7B 2FNPA 4MFEA 1X4OA 2BOLA 4ZYGA 2K9SA 2W25A 4BJ5C 2EIKH 1NG6A 2OCCH 3WHCA 3IC7A 1XDUA 1DUXC 3ZQCA 3GVAA 2BVLA 4OMZA 2Q8KA 3TOAA 3KP4A 1VNDA 2R7DA 4AIHA 5B1AH 3FK6A 1OCPA 1KQ0A 2NS8A 2H1LA 2PQ8A 2XASA 3OYGA 2BW3A 2WAQA 1HC8A 3LL7A 1Y8RB 2QSFX 2XGDA 1QA6A 1Z3XA 1WJAA 1B4AA 1RKWA 1G4DA 1XS9A 5IP7J 3D0SA 4IF4A 3RKWA 3AG3H 5BPIA 1LEBA 4BU2A 1LDKB 4F7ZA 3LOCA 2HPIA 5LGTA 1BN5A 3CCMI 1O3TA 2BY2A 4AD9A 3KZZA 5EG0A 1GVJA 2ZFUA 2EV6A 2QA4I 5HNFA 3RKYA 1IDZA 3LSRA 1K78B 2QCOA 3B73A 1I1SA 2NOGA 4AC0A 2XKPA 5ILVA 1PUEE 2VBWA 4IHVA 2ELKA 3ZPLA 1I6HJ 1L0OC 4PJMA 2E34A 3BWGA 3CUQA 4B3AA 3GBGA 1H88C 2JVHA 2IA0A 5DM7F 1XGMA 4CCOA 1QVTA 1BBYA 1R00A 4UV9A 4KITB 3K2AA 4KFCA 2OCEA 5IT9K 1NG7A 3ECOA 3L2VA 3HXLA 3ABKH 3LQQA 4RAGA 1T38A 4P1WA 3PJRA 1JKRC 4NB5A 2ETHA 2HYGD 3R6SA 1DGRM 1OJLA 2K3PA 4I0BA 2MLGA 4UXNA 3KEQA 1OYIA 2ZB9A 1WI3A 3HZJA 1S5LC 5DDGA 4DZPA 1JUSA 5F0HA 2GZWA 5GTHC 1BOAA 2E36A 3VODA 2CV2A 3J7YJ 4LFUA 5CQEA 2FNAA 2QYOA 1VTNC 1UG0A 2KIMA 4MEYF 4PCQA 1LNWA 2DA7A 2VKHA 3OYJA 4KIBA 5FKNA 4A3BJ 2CW8A 4UVCA 1GLNA
chains in the Genus database with same CATH topology
2FMYA 2F2EA 3BZ6A 5ICGA 4JQFA 1Z7UA 2MBFA 2HTSA 1O57A 1B9NA 2D45A 3P9CA 3HSRA 2C6YA 4E70A 4HLYA 3MZHA 5J6XA 4G6QA 5HLHA 1HKSA 3P9IA 2J5OA 4PGHA 1K79A 2ESNA 3HYIA 3GX4X 4OIRF 3CJNA 3J7AO 4CYDA 2AS5F 4IRIA 3MFKA 4EJTA 1XSVA 4M71A 2XAQA 1I6XA 3REOA 4ASNA 1RNLA 3CTAA 1WI9A 1PP7U 4P9UA 3F8CA 1YQAA 2PEXA 1LDJA 2V9VA 4KIFA 4BHBA 3LAJA 1P6RA 4OOIA 2DQRA 5JR3A 4HDUA 3F8MA 3QAHA 1F1ZA 5K5QA 4HYEA 3L00A 1PDNC 5A2QK 2M30A 2PG4A 5JI6A 1K78A 1I27A 2DU9A 2IT0A 2R3SA 3BP8A 2HFHA 2WC2A 1KYWA 3OOPA 1ZRCA 3TO7A 4HF0A 3O2PE 3COAC 4IXAA 2BE5F 5DUKA 5FD5A 2VOPA 5HLIA 2ZNZA 1WQ2A 3RPUA 4IHTA 1LEAA 4UVAA 4WK8F 3M8EA 1TTYA 1U6GA 1TQMA 4UHTA 1UHWA 5LHHA 4EJWA 2AXLA 2V1UA 2VXZA 1UCRA 4KNYA 1O3SA 3M1EA 2PMUA 1B1BA 2EFNA 1H9GA 1WKMA 5IT9Z 4L0YB 2Q2EA 1EV7A 2HKXA 1XGNA 1IXSB 1XD7A 2V1DA 2GAUA 4IJAA 5D5WB 3LA2A 1R58A 3VOEA 1BIBA 3L2CA 3KZYA 4AVPA 1IW7F 1BM9A 2BGCA 2ISZA 3DPLC 2XAHA 2P8TA 4KN7X 4WX9A 4PGGA 5HOOA 1TNSA 2DBBA 1V4RA 5H20A 1J2XA 4ESFA 1YO5C 5ILSA 2XUBA 1LDDA 3JW4A 2W57A 2GXGA 1U5TB 3MQ0A 2O61A 4UV8A 3LQRA 1ZREA 1T2KA 2HKOA 2Q0OA 5DD4A 3DEUA 2GIVA 4M9SA 3FXRA 3GFJA 3V7RA 2G7UA 3HIFA 1PP8F 3Q9VA 4U0VA 3DXJF 4WXDA 4Y17A 1BJAA 4MHGA 3B02A 1S6LA 3W6JB 1J9IA 3F8FA 3QP5A 5LHIA 1OR7A 3V7CA 2IJLA 1AOYA 2XIGA 3E6BA 5LLQA 1E17A 4M6YA 5D5XB 4A2UA 1D8KA 4RGSA 5LBQA 4HX7A 3I4PA 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 3GEZA 4MEXF 5BPDA 3F3XA 1UB9A 1SMYF 4YIFA 4HV5A 4S04A 2ZBKA 5E18F 3HSEA 4BYYA 1D5VA 4KT5C 4MNUA 5BOXA 4RGRA 4R79A 2HEOA 4A0YA 1H0MA 2HYFA 1P4AA 3RJPA 4Q47A 1SFEA 4Y15A 3WGGA 5ICFA 2QQAA 1J7KA 4IVNA 1FBUA 3KLOA 4G7HF 1Z6RA 1UHMA 2QUFA 1TW2A 4D0PA 3I0TA 1SAXA 2A3SA 4A6EA 1QGPA 4NHJA 3HOTA 2KJCA 3GYHX 3C7JA 1ODDA 3MZYA 1ULYA 1ZN2A 1USTA 1FSHA 2E1CA 1REPC 4HA8A 1MZBA 1KQ9A 1B6AA 2VODA 2OA4A 3U1DA 1MJAA 4M9ZA 2DW4A 2QLZA 2DI3A 3ML6A 1XDSA 4FX4A 5L3GA 3NEUA 2FEZA 1L3LA 2Y75A 2K7LA 1CGPA 2HOEA 5LGNA 2QBYB 1O3RA 2YSRA 4YFXF 5AONA 1JGSA 3I58A 4EQQA 5J8CA 1P4WA 5HVQC 4KMFA 4O6JA 4WF2A 1Z6TA 3IWFA 4EM2A 2W84A 2V1XA 2ZJ2A 4WWCA 1P92A 3JSOA 3CUOA 2E7XA 4IHSA 4I7HA 1W5SA 1F9NA 3HSFA 2D2WA 1ZAOA 5K1YA 5JVTA 2E1NA 2P5VA 2NNNA 1D3YA 3LWFA 3EETA 4LG0A 2LF8A 5KK1A 2P7CB 4DNCA 2STWA 2FXAA 1U2WA 1GHCA 2MC3A 3SXYA 2FA5A 1TW3A 2QENA 2MLKA 4M73A 3KCCA 3M9AA 4OIOF 1S7AA 2RC4A 3E6DA 2ZKZA 1HKTA 5E20A 1U78A 1FY7A 2EB7A 3E5QA 3RYRA 2IP2A 1SMTA 4LK1F 3RTRA 1Y0UA 4ZH4F 1R1UA 2PMHA 5AIPA 4JK1X 2P6TA 5LRRA 4ETSA 1TNTA 5DUIA 4EGYA 4L18B 1QPMA 1RIOH 1ZG3A 1E2XA 4CGZA 3TDZC 4KN4X 4FT8A 1ZYRF 5D5UB 4PZJA 2CFXA 5L3EA 1U5TA 3AAFA 1EH6A 4K2EA 3TGNA 2QBYA 4CZZA 1R1TA 3QOPA 2L01A 1XGSA 4GYIA 1YW7A 3J81K 4EV0A 3JSPA 2HS5A 2XAJA 1T6SA 2IA1A 2A6EF 4B8XA 4QWQA 4LB6B 1RUNA 3IKTA 3SQNA 2PN6A 2O0YA 5D8LB 2EV5A 4MTEA 4HF1A 1KGSA 1J59A 4G7OF 5CVIA 2HWVA 4G8XA 3TO6A 1KU9A 1HW5A 2TDXA 4M74A 4XLPF 3MCZA 3VEPA 4UNOA 5HS7A 3BJOA 3FX3A 3R4KA 1RUOA 2G7HA 4R1HA 2MH9A 1LJ9A 2DT5A 4LK0F 5FGMA 1ZARA 2LNBA 2F5FA 1Z05A 3T5XA 4KYWA 3F22A 1XN7A 5KVRA 1XB4A 4HW0A 2VT3A 2PFBA 5FLXK 4UVBA 2XRNA 1SD4A 1KYZA 4HF2A 4GGGA 4P9FA 1D8JA 2EFOA 3V4GA 1JE8A 3EYIA 3K2ZA 3KETA 1OMIA 1YFHA 3I64A 5HDGA 3LAPA 1SD7A 4ZZLA 3WTYC 2VT2A 1BI0A 2FF4A 3L09A 3K0LA 2MA3A 2PBIA 2FBIA 5D8KB 2FE3A 2RKHA 4EVIA 4P55A 1FBSA 4NQWA 3ZMVA 2E7WA 5LHGA 3LFKA 1EH7A 2RQPA 3SZPA 4WXHA 4BXUA 2PJPA 2VBYA 2XVCA 3J80K 1HQCA 3DPTA 2F5EA 3KP5A 1IXCA 1DDNA 1STZA 3NRVA 2P6SA 2FRHA 3RYPA 3G73A 2CO5A 2UWMA 2A61A 2KJBA 1YW8A 2HTJA 1EH8A 4EJOA 5L3FA 4RB0A 4CDGA 3RKXA 4YFKF 3ZN0A 2H27A 1IZ1A 3GLXA 1IXRC 4I01A 1W5TA 3WU0A 2DK8A 3F6OA 3PQKA 3GF2A 1HKQA 4A5NA 3GFIA 5HDNA 1GXPA 4N0BA 4FX0A 3ZQ7A 4CICA 5HLGA 3N4MA 2CGPA 2LDUA 1BI1A 1J5YA 2ZMEB 3J80Z 1JXSA 3FWEA 2CW0F 2KIFA 3EQLF 4M6XA 4G94A 1AWCA 3N97A 2O3FA 1YS6A 3DQVC 2K4BA 1XMAA 2M87A 3K1PA 3T0YA 2MD5A 5DCMB 5FO5A 2L54A 5E8IA 1G3WA 2CSOA 4XRFA 4Q4ZF 3GWZA 2EK5A 1WWXA 5ILUA 2FOKA 2LKPA 3ECHA 3QU3A 1FX7A 2MH2A 3TDUC 3ULQB 4DQ2A 2JPCA 2RNJA 3MEXA 4LMYA 2EV0A 4PDKA 2VBXA 5L3DA 1ZRDA 2OD5A 4U0WA 3HTSB 4AWXB 3CLOA 4ESJA 3IRRA 4OIQF 5ICEA 3O3KA 1Z9CA 3HRSA 4H0EA 4KIGA 1XGOA 2A6HF 1R23A 3TKYA 1R1VA 1G3YA 2FBKA 2NRAC 4Z2YA 4ZZDA 3GO5A 3T8TA 5FB2A 3R0JA 1O7LA 3DFGA 2D1HA 2OU2A 2RGVA 1ONVA 3F8NA 3H3UA 5DEQA 2ZMEA 1ZRFA 3KP7A 4HLXA 5CVRA 4ESBA 3DV8A 3M7GA 4B09A 4I98B 3WE3A 1SFXA 5FFXA 2EFPA 1HSJA 5D5VB 2A69F 2H6BA 2CYYA 5K5OA 3J81Z 2P5KA 2ZXJA 3EUHA 5HDKA 2B0LA 4IRGA 2Z5UA 4EGZA 3GFMA 3KP3A 5CVJA 2DPDA 1IN8A 1R36A 1MKMA 2L3DA 2W85A 2NNYA 1RI7A 2Z9OA 2VC1A 1V3FA 4HX8A 3PFIA 2KRFA 1T39A 1GXQA 3G3ZA 2ESHA 3DP7A 4RGUA 2BV6A 2DAOA 5EEHA 4IRHA 4YG2F 4EM0B 4G7ZF 4M9XA 1SFUA 1ON2A 2L4MA 4LG0B 4L5JA 2QQBA 2IW5A 1YIOA 5E17F 2YPRA 3GZ5A 2DK5A 4ON0A 2CQKA 4Q48A 1X3UA 4P5OA 2YX4A 3P7NA 3VB2A 2XAGA 5E1WA 4Y13A 4U88A 2RDPA 4OMYA 4IPAA 1WRJA 4RAZA 6PAXA 4ENNA 4RB3C 1WSUA 3E3VA 2K86A 1FP2A 4EJVA 3WU1B 1R5GA 3HHGA 3F72A 1OYWA 4I09A 4BHPA 2BYVE 3ZMTA 4MQ9F 3GUDA 2IA2A 4JBAA 3CDHA 2XGXA 1FZPB 1FNNA 2FSWA 1G6NA 1RZ4A 3V8KA 1XCBA 4L9NA 5ED4A 2ISYA 1U5TC 1T0FA 4HQEA 4CXFA 3K9TA 5CLSA 1IN4A 3FF5A 3I71A 3F6VA 2JZYA 2FQ3A 4GYGA 3K1NA 1JHHA 3FHZA 5LEJA 5FFZA 2H09A 4RAYA 3RI4A 4N9HA 2EWNA 5HS8A 5EEGA 4G9YA 4ZYEA 1S29A 3SZTA 2PLYA 1IF1A 1W4MA 3I59A 5FLXZ 3FXQA 2M8EA 3SFZA 1KQ8A 1SD5A 1R7JA 3JTGA 4P96A 3WTUC 3R61A 1R22A 4ENMA 1FT9A 1K6OA 1FPQA 5DV5A 1W7PB 2CWEA 2X0LA 2XHKA 3KP2A 2KKOA 1MGTA 2VBZA 4MQVA 4YFNF 4MGRA 2UXXA 3GXOA 1TLHB 3LSTA 5F6FA 3BROA 2UZKA 2J5PA 1FYMA 2OZ6A 4U0YA 3HRUA 3SHFA 5E1ZB 3QP6A 1Z91A 1QO0D 4A0XA 3E6MA 3BJ6A 4FHTA 3E97A 1QBJA 2STTA 1G3SA 4EMSA 2PI0A 3IL2A 3KLNA 2GA2A 1CF7A 3DF8A 5BS6A 3ZMSA 1IUYA 4XLNF 3ZMUA 2ZCWA 2F5DA 2VONA 1DP7P 3KE2A 5JFRA 1HBXG 1P2FA 2A07F 3BJAA 4KUMA 2NS0A 4A6DA 3I53A 5LRSA 3QPHA 3EDPA 5F64A 2OQRA 3I5UA 2DO7A 1YTYA 2Z3YA 5TRDA 2NAZA 5D6FA 3ABTA 2KIUA 2HGCA 2OAZA 3DKWA 1S3JA 4O3MA 3L7WA 4ZYDA 2DPUA 2K27A 4GCVA 4KMUX 3BDDA 1R5HA 2ADUA 4U7BA 1LVAA 1ZGAA 2RVCA 2JPBA 4O5VA 2XAFA 4GXOA 5ERIA 3GW2A 5BQTA 3KFWX 1QNTA 3M8FA 4G6DA 4MTDA 3H3ZA 3FZVA 5H6RA 4AIKA 2M5WA 4CHUA 1YS7A 3P9KA 1QZYA 1HXDA 2YR2A 3E5UA 1ZH5A 4OINF 2O8XA 1C0WA 4S05A 1BC8C 3R60A 1BI2A 5LGUA 2EJRA 3Q9SA 4HX4A 4CO8A 2GA1A 2JRTA 2K02A 3IRQA 4ENJA 4L5IA 2Y48A 5D4SA 4R8HA 2HQNA 1KU2A 1S7OA 1IAWA 2O6GE 1FP1D 4YIIA 1J75A 3T1BA 3K69A 4L9TA 4OU0A 4HOBA 1USSA 1ZLKA 3IKVA 3R0AA 2JTVA 5JHUA 1JHFA 4I0AA 1OPCA 1YYVA 2W24A 5CVVA 5HS9A 4KA4A 1DPRA 2DFIA 3F21A 2NYXA 2YX7A 3F8BA 5D4RA 2P5LC 1ZLJA 3FM3A 5A2QZ 3V8LA 3C1DA 1KU3A 2RV8A 1ZHFA 3WG9A 3WODF 1HW1A 1QQIA 2BBYA 4L9JA 2X4HA 4RB1A 4XSZF 1O3QA 3D5LA 3WTSC 4HQMA 5CJ9A 3FXUA 1I5ZA 1UFMA 2QWWA 1XCVA 3CUQB 5DD8A 1W7PD 4RGXA 5J8FA 3ROUA 1W7PA 2L02A 4KDPA 1MJBA 3C3WA 4Q5SF 1B59A 2HR3A 3TQNA 2QZ8A 4BH9A 2ZFWA 3ZP5A 2FBHA 3QU6A 4HBLA 3I59B 2O03A 1K7AA 4LLNA 3NQOA 3MWMA 1FBQA 2EFQA 1XSDA 2FMLA 3CO7C 4TV7A 5DYMA 2LSOA 2XKOA 5ICCA 1FWZA 3GFLA 1TQPA 1MDMB 2ELHA 4A5MA 3CO6C 2OBPA 2Z33A 1FYLA 1FOKA 4WCGA 3Q5FA 2VE9A 5D6EA 3WTXC 2V79A 3E5XA 3HRTA 4RS8A 3BY6A 1KU7A 2ZO4A 3RDIA 3OV8A 1P4XA 1KA8A 3WGIA 1Z1DA 2EFWA 3WGHA 2H6CA 3L9FA 2F5CA 2IVMA 3S2WA 4XSXF 3TO9A 3T8RA 2D1VA 3ZMZA 3KP6A 1LQ1A 4BHCA 1MDMA 2WV0A 4WXCA 5H6QA 4I2OA 3WE2A 4QLCU 3EYYA 1MJ9A 3E6CC 3V8JA 5AIQA 4LLLA 3LA3A 5E8GA 4GO1A 2K4JA 1IN6A 3ERED 2G9WA 3ELKA 2GXBA 2LF7A 3HOSA 5K5RA 3K1MA 2M45A 3JTHA 3O6BB 1U8RA 2A5YB 4XBFA 4A0ZA 2UXNA 2HZTA 1F5TA 5L3BA 2Z99A 4KICA 3HHHA 4N9IA 1J0RA 3TOBA 5LEKA 1SD6A 4EM1A 5DCMA 1FYKA 2DQLA 2QVOA 5TJJA 2ZNYA 3WTWC 1IRFA 1BC7C 2A68F 2RN7A 3BPXA 3ABUA 3ZN1A 2DLLA 2Y0MA 2EA2A 1ON1A 2OZUA 2JSCA 1Q1HA 2GWRA 1IN5A 3WTTC 2YU3A 1YG2A 4M72A 3LA7A 1H9TA 3V7SA 2M1BA 3U2RA 4BNCA 4BAYA 3H92A 2QQ9A 1T98A 1HSTA 2WWYA 2VE8A 1A04A 3IHUA 4HV6A 3WTZA 3GZ6A 2COMA 1CF7B 3JAMZ 5CYVA 1OKRA 1BIAA 3FMQA 1FSEA 2FU4A 2P4WA 4UUVA 4EJUA 2P7VB 2CG4A 4LGWA 4RB2C 1O7FA 3RIRA 3F23A 3W6KB 2VN2A 2JT1A 2EA4A 1XSXA 3BPVA 3BOQA 1FC3A 1FLIA 2HDCA 3FM5A 4ZYHA 1QZZA 1XMKA 2WTEA 5E1XA 4HDVA 3C18A 2BEOA 1BI3A 2QM3A 5FD6A 5CVUA 1ZG1A 2HQRA 3JAMK 1LB2A 1IRGA 1I1GA 3IWZA 3ZMDA 2XV4S 4U7DA 3FMRA 3ISPA 3FMSA 1S8NA 4L9VA 4BQAA 1IN7A 1U3EM 3HRMA 4LD5A 2H94A 2XROA 4LB5A 1NHAA 1B9MA 2L4AA 3RPQA 1HW2A 5BMZA 4I02A 5F1RA 5IT3A 3HTUA 5L3CA 1ZGJA 2VOOA 3HUGA 4HAMA 1YLFA 5DCFA 3I54A 1OYYA 4A12A 1MD0A 3QRFF 2ACJA 3VFZA 2IPQX 3U9GA 1DPUA 3WTVC 4AIJA 1YW9A 4OIPF 4LLGF 4ENKA 2R7FA 2IRFG 2VC0A 3CUQC 3PQJA 2V6CA 3QPTA 4LJZF 1F4KA 1TBXA 2GQQA 4HZFA 2OQGA 1ZG5A 2FNPA 4ZYGA 2W25A 3IC7A 1XDUA 1DUXC 3GVAA 4OMZA 2Q8KA 3TOAA 3KP4A 2R7DA 4AIHA 1KQ0A 2PQ8A 2XASA 1B4AA 1G4DA 3D0SA 4IF4A 3RKWA 5BPIA 1LEBA 1LDKB 4F7ZA 5LGTA 1BN5A 1O3TA 4AD9A 3KZZA 1GVJA 2EV6A 3RKYA 1K78B 3B73A 1I1SA 2XKPA 5ILVA 1PUEE 2VBWA 3ZPLA 1L0OC 3BWGA 3CUQA 2IA0A 1XGMA 1BBYA 1R00A 4UV9A 4KFCA 5IT9K 3ECOA 3LQQA 1T38A 4NB5A 2ETHA 2HYGD 3R6SA 4I0BA 2MLGA 4UXNA 3KEQA 1OYIA 5DDGA 2GZWA 1BOAA 3VODA 4LFUA 2FNAA 2QYOA 1VTNC 2KIMA 4MEYF 4PCQA 1LNWA 4KIBA 4UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMY A;  2F2E A;  3BZ6 A;  5ICG A;  4JQF A;  1Z7U A;  2MBF A;  2HTS A;  1O57 A;  1B9N A;  2D45 A;  3P9C A;  3HSR A;  2C6Y A;  4E70 A;  4HLY A;  3MZH A;  5J6X A;  4G6Q A;  5HLH A;  1HKS A;  3P9I A;  2J5O A;  4PGH A;  1K79 A;  2ESN A;  3HYI A;  3GX4 X;  4OIR F;  3CJN A;  3J7A O;  4CYD A;  2AS5 F;  4IRI A;  3MFK A;  4EJT A;  1XSV A;  4M71 A;  2XAQ A;  1I6X A;  3REO A;  4ASN A;  1RNL A;  3CTA A;  1WI9 A;  1PP7 U;  4P9U A;  3F8C A;  1YQA A;  2PEX A;  1LDJ A;  2V9V A;  4KIF A;  4BHB A;  3LAJ A;  1P6R A;  4OOI A;  2DQR A;  5JR3 A;  4HDU A;  3F8M A;  3QAH A;  1F1Z A;  5K5Q A;  4HYE A;  3L00 A;  1PDN C;  5A2Q K;  2M30 A;  2PG4 A;  5JI6 A;  1K78 A;  1I27 A;  2DU9 A;  2IT0 A;  2R3S A;  3BP8 A;  2HFH A;  2WC2 A;  1KYW A;  3OOP A;  1ZRC A;  3TO7 A;  4HF0 A;  3O2P E;  3COA C;  4IXA A;  2BE5 F;  5DUK A;  5FD5 A;  2VOP A;  5HLI A;  2ZNZ A;  1WQ2 A;  3RPU A;  4IHT A;  1LEA A;  4UVA A;  4WK8 F;  3M8E A;  1TTY A;  1U6G A;  1TQM A;  4UHT A;  1UHW A;  5LHH A;  4EJW A;  2AXL A;  2V1U A;  2VXZ A;  1UCR A;  4KNY A;  1O3S A;  3M1E A;  2PMU A;  1B1B A;  2EFN A;  1H9G A;  1WKM A;  5IT9 Z;  4L0Y B;  2Q2E A;  1EV7 A;  2HKX A;  1XGN A;  1IXS B;  1XD7 A;  2V1D A;  2GAU A;  4IJA A;  5D5W B;  3LA2 A;  1R58 A;  3VOE A;  1BIB A;  3L2C A;  3KZY A;  4AVP A;  1IW7 F;  1BM9 A;  2BGC A;  2ISZ A;  3DPL C;  2XAH A;  2P8T A;  4KN7 X;  4WX9 A;  4PGG A;  5HOO A;  1TNS A;  2DBB A;  1V4R A;  5H20 A;  1J2X A;  4ESF A;  1YO5 C;  5ILS A;  2XUB A;  1LDD A;  3JW4 A;  2W57 A;  2GXG A;  1U5T B;  3MQ0 A;  2O61 A;  4UV8 A;  3LQR A;  1ZRE A;  1T2K A;  2HKO A;  2Q0O A;  5DD4 A;  3DEU A;  2GIV A;  4M9S A;  3FXR A;  3GFJ A;  3V7R A;  2G7U A;  3HIF A;  1PP8 F;  3Q9V A;  4U0V A;  3DXJ F;  4WXD A;  4Y17 A;  1BJA A;  4MHG A;  3B02 A;  1S6L A;  3W6J B;  1J9I A;  3F8F A;  3QP5 A;  5LHI A;  1OR7 A;  3V7C A;  2IJL A;  1AOY A;  2XIG A;  3E6B A;  5LLQ A;  1E17 A;  4M6Y A;  5D5X B;  4A2U A;  1D8K A;  4RGS A;  5LBQ A;  4HX7 A;  3I4P A;  3MAJ A;  4L0Z B;  1TQI A;  2DTR A;  3KEO A;  1G3T A;  3GEZ A;  4MEX F;  5BPD A;  3F3X A;  1UB9 A;  1SMY F;  4YIF A;  4HV5 A;  4S04 A;  2ZBK A;  5E18 F;  3HSE A;  4BYY A;  1D5V A;  4KT5 C;  4MNU A;  5BOX A;  4RGR A;  4R79 A;  2HEO A;  4A0Y A;  1H0M A;  2HYF A;  1P4A A;  3RJP A;  4Q47 A;  1SFE A;  4Y15 A;  3WGG A;  5ICF A;  2QQA A;  1J7K A;  4IVN A;  1FBU A;  3KLO A;  4G7H F;  1Z6R A;  1UHM A;  2QUF A;  1TW2 A;  4D0P A;  3I0T A;  1SAX A;  2A3S A;  4A6E A;  1QGP A;  4NHJ A;  3HOT A;  2KJC A;  3GYH X;  3C7J A;  1ODD A;  3MZY A;  1ULY A;  1ZN2 A;  1UST A;  1FSH A;  2E1C A;  1REP C;  4HA8 A;  1MZB A;  1KQ9 A;  1B6A A;  2VOD A;  2OA4 A;  3U1D A;  1MJA A;  4M9Z A;  2DW4 A;  2QLZ A;  2DI3 A;  3ML6 A;  1XDS A;  4FX4 A;  5L3G A;  3NEU A;  2FEZ A;  1L3L A;  2Y75 A;  2K7L A;  1CGP A;  2HOE A;  5LGN A;  2QBY B;  1O3R A;  2YSR A;  4YFX F;  5AON A;  1JGS A;  3I58 A;  4EQQ A;  5J8C A;  1P4W A;  5HVQ C;  4KMF A;  4O6J A;  4WF2 A;  1Z6T A;  3IWF A;  4EM2 A;  2W84 A;  2V1X A;  2ZJ2 A;  4WWC A;  1P92 A;  3JSO A;  3CUO A;  2E7X A;  4IHS A;  4I7H A;  1W5S A;  1F9N A;  3HSF A;  2D2W A;  1ZAO A;  5K1Y A;  5JVT A;  2E1N A;  2P5V A;  2NNN A;  1D3Y A;  3LWF A;  3EET A;  4LG0 A;  2LF8 A;  5KK1 A;  2P7C B;  4DNC A;  2STW A;  2FXA A;  1U2W A;  1GHC A;  2MC3 A;  3SXY A;  2FA5 A;  1TW3 A;  2QEN A;  2MLK A;  4M73 A;  3KCC A;  3M9A A;  4OIO F;  1S7A A;  2RC4 A;  3E6D A;  2ZKZ A;  1HKT A;  5E20 A;  1U78 A;  1FY7 A;  2EB7 A;  3E5Q A;  3RYR A;  2IP2 A;  1SMT A;  4LK1 F;  3RTR A;  1Y0U A;  4ZH4 F;  1R1U A;  2PMH A;  5AIP A;  4JK1 X;  2P6T A;  5LRR A;  4ETS A;  1TNT A;  5DUI A;  4EGY A;  4L18 B;  1QPM A;  1RIO H;  1ZG3 A;  1E2X A;  4CGZ A;  3TDZ C;  4KN4 X;  4FT8 A;  1ZYR F;  5D5U B;  4PZJ A;  2CFX A;  5L3E A;  1U5T A;  3AAF A;  1EH6 A;  4K2E A;  3TGN A;  2QBY A;  4CZZ A;  1R1T A;  3QOP A;  2L01 A;  1XGS A;  4GYI A;  1YW7 A;  3J81 K;  4EV0 A;  3JSP A;  2HS5 A;  2XAJ A;  1T6S A;  2IA1 A;  2A6E F;  4B8X A;  4QWQ A;  4LB6 B;  1RUN A;  3IKT A;  3SQN A;  2PN6 A;  2O0Y A;  5D8L B;  2EV5 A;  4MTE A;  4HF1 A;  1KGS A;  1J59 A;  4G7O F;  5CVI A;  2HWV A;  4G8X A;  3TO6 A;  1KU9 A;  1HW5 A;  2TDX A;  4M74 A;  4XLP F;  3MCZ A;  3VEP A;  4UNO A;  5HS7 A;  3BJO A;  3FX3 A;  3R4K A;  1RUO A;  2G7H A;  4R1H A;  2MH9 A;  1LJ9 A;  2DT5 A;  4LK0 F;  5FGM A;  1ZAR A;  2LNB A;  2F5F A;  1Z05 A;  3T5X A;  4KYW A;  3F22 A;  1XN7 A;  5KVR A;  1XB4 A;  4HW0 A;  2VT3 A;  2PFB A;  5FLX K;  4UVB A;  2XRN A;  1SD4 A;  1KYZ A;  4HF2 A;  4GGG A;  4P9F A;  1D8J A;  2EFO A;  3V4G A;  1JE8 A;  3EYI A;  3K2Z A;  3KET A;  1OMI A;  1YFH A;  3I64 A;  5HDG A;  3LAP A;  1SD7 A;  4ZZL A;  3WTY C;  2VT2 A;  1BI0 A;  2FF4 A;  3L09 A;  3K0L A;  2MA3 A;  2PBI A;  2FBI A;  5D8K B;  2FE3 A;  2RKH A;  4EVI A;  4P55 A;  1FBS A;  4NQW A;  3ZMV A;  2E7W A;  5LHG A;  3LFK A;  1EH7 A;  2RQP A;  3SZP A;  4WXH A;  4BXU A;  2PJP A;  2VBY A;  2XVC A;  3J80 K;  1HQC A;  3DPT A;  2F5E A;  3KP5 A;  1IXC A;  1DDN A;  1STZ A;  3NRV A;  2P6S A;  2FRH A;  3RYP A;  3G73 A;  2CO5 A;  2UWM A;  2A61 A;  2KJB A;  1YW8 A;  2HTJ A;  1EH8 A;  4EJO A;  5L3F A;  4RB0 A;  4CDG A;  3RKX A;  4YFK F;  3ZN0 A;  2H27 A;  1IZ1 A;  3GLX A;  1IXR C;  4I01 A;  1W5T A;  3WU0 A;  2DK8 A;  3F6O A;  3PQK A;  3GF2 A;  1HKQ A;  4A5N A;  3GFI A;  5HDN A;  1GXP A;  4N0B A;  4FX0 A;  3ZQ7 A;  4CIC A;  5HLG A;  3N4M A;  2CGP A;  2LDU A;  1BI1 A;  1J5Y A;  2ZME B;  3J80 Z;  1JXS A;  3FWE A;  2CW0 F;  2KIF A;  3EQL F;  4M6X A;  4G94 A;  1AWC A;  3N97 A;  2O3F A;  1YS6 A;  3DQV C;  2K4B A;  1XMA A;  2M87 A;  3K1P A;  3T0Y A;  2MD5 A;  5DCM B;  5FO5 A;  2L54 A;  5E8I A;  1G3W A;  2CSO A;  4XRF A;  4Q4Z F;  3GWZ A;  2EK5 A;  1WWX A;  5ILU A;  2FOK A;  2LKP A;  3ECH A;  3QU3 A;  1FX7 A;  2MH2 A;  3TDU C;  3ULQ B;  4DQ2 A;  2JPC A;  2RNJ A;  3MEX A;  4LMY A;  2EV0 A;  4PDK A;  2VBX A;  5L3D A;  1ZRD A;  2OD5 A;  4U0W A;  3HTS B;  4AWX B;  3CLO A;  4ESJ A;  3IRR A;  4OIQ F;  5ICE A;  3O3K A;  1Z9C A;  3HRS A;  4H0E A;  4KIG A;  1XGO A;  2A6H F;  1R23 A;  3TKY A;  1R1V A;  1G3Y A;  2FBK A;  2NRA C;  4Z2Y A;  4ZZD A;  3GO5 A;  3T8T A;  5FB2 A;  3R0J A;  1O7L A;  3DFG A;  2D1H A;  2OU2 A;  2RGV A;  1ONV A;  3F8N A;  3H3U A;  5DEQ A;  2ZME A;  1ZRF A;  3KP7 A;  4HLX A;  5CVR A;  4ESB A;  3DV8 A;  3M7G A;  4B09 A;  4I98 B;  3WE3 A;  1SFX A;  5FFX A;  2EFP A;  1HSJ A;  5D5V B;  2A69 F;  2H6B A;  2CYY A;  5K5O A;  3J81 Z;  2P5K A;  2ZXJ A;  3EUH A;  5HDK A;  2B0L A;  4IRG A;  2Z5U A;  4EGZ A;  3GFM A;  3KP3 A;  5CVJ A;  2DPD A;  1IN8 A;  1R36 A;  1MKM A;  2L3D A;  2W85 A;  2NNY A;  1RI7 A;  2Z9O A;  2VC1 A;  1V3F A;  4HX8 A;  3PFI A;  2KRF A;  1T39 A;  1GXQ A;  3G3Z A;  2ESH A;  3DP7 A;  4RGU A;  2BV6 A;  2DAO A;  5EEH A;  4IRH A;  4YG2 F;  4EM0 B;  4G7Z F;  4M9X A;  1SFU A;  1ON2 A;  2L4M A;  4LG0 B;  4L5J A;  2QQB A;  2IW5 A;  1YIO A;  5E17 F;  2YPR A;  3GZ5 A;  2DK5 A;  4ON0 A;  2CQK A;  4Q48 A;  1X3U A;  4P5O A;  2YX4 A;  3P7N A;  3VB2 A;  2XAG A;  5E1W A;  4Y13 A;  4U88 A;  2RDP A;  4OMY A;  4IPA A;  1WRJ A;  4RAZ A;  6PAX A;  4ENN A;  4RB3 C;  1WSU A;  3E3V A;  2K86 A;  1FP2 A;  4EJV A;  3WU1 B;  1R5G A;  3HHG A;  3F72 A;  1OYW A;  4I09 A;  4BHP A;  2BYV E;  3ZMT A;  4MQ9 F;  3GUD A;  2IA2 A;  4JBA A;  3CDH A;  2XGX A;  1FZP B;  1FNN A;  2FSW A;  1G6N A;  1RZ4 A;  3V8K A;  1XCB A;  4L9N A;  5ED4 A;  2ISY A;  1U5T C;  1T0F A;  4HQE A;  4CXF A;  3K9T A;  5CLS A;  1IN4 A;  3FF5 A;  3I71 A;  3F6V A;  2JZY A;  2FQ3 A;  4GYG A;  3K1N A;  1JHH A;  3FHZ A;  5LEJ A;  5FFZ A;  2H09 A;  4RAY A;  3RI4 A;  4N9H A;  2EWN A;  5HS8 A;  5EEG A;  4G9Y A;  4ZYE A;  1S29 A;  3SZT A;  2PLY A;  1IF1 A;  1W4M A;  3I59 A;  5FLX Z;  3FXQ A;  2M8E A;  3SFZ A;  1KQ8 A;  1SD5 A;  1R7J A;  3JTG A;  4P96 A;  3WTU C;  3R61 A;  1R22 A;  4ENM A;  1FT9 A;  1K6O A;  1FPQ A;  5DV5 A;  1W7P B;  2CWE A;  2X0L A;  2XHK A;  3KP2 A;  2KKO A;  1MGT A;  2VBZ A;  4MQV A;  4YFN F;  4MGR A;  2UXX A;  3GXO A;  1TLH B;  3LST A;  5F6F A;  3BRO A;  2UZK A;  2J5P A;  1FYM A;  2OZ6 A;  4U0Y A;  3HRU A;  3SHF A;  5E1Z B;  3QP6 A;  1Z91 A;  1QO0 D;  4A0X A;  3E6M A;  3BJ6 A;  4FHT A;  3E97 A;  1QBJ A;  2STT A;  1G3S A;  4EMS A;  2PI0 A;  3IL2 A;  3KLN A;  2GA2 A;  1CF7 A;  3DF8 A;  5BS6 A;  3ZMS A;  1IUY A;  4XLN F;  3ZMU A;  2ZCW A;  2F5D A;  2VON A;  1DP7 P;  3KE2 A;  5JFR A;  1HBX G;  1P2F A;  2A07 F;  3BJA A;  4KUM A;  2NS0 A;  4A6D A;  3I53 A;  5LRS A;  3QPH A;  3EDP A;  5F64 A;  2OQR A;  3I5U A;  2DO7 A;  1YTY A;  2Z3Y A;  5TRD A;  2NAZ A;  5D6F A;  3ABT A;  2KIU A;  2HGC A;  2OAZ A;  3DKW A;  1S3J A;  4O3M A;  3L7W A;  4ZYD A;  2DPU A;  2K27 A;  4GCV A;  4KMU X;  3BDD A;  1R5H A;  2ADU A;  4U7B A;  1LVA A;  1ZGA A;  2RVC A;  2JPB A;  4O5V A;  2XAF A;  4GXO A;  5ERI A;  3GW2 A;  5BQT A;  3KFW X;  1QNT A;  3M8F A;  4G6D A;  4MTD A;  3H3Z A;  3FZV A;  5H6R A;  4AIK A;  2M5W A;  4CHU A;  1YS7 A;  3P9K A;  1QZY A;  1HXD A;  2YR2 A;  3E5U A;  1ZH5 A;  4OIN F;  2O8X A;  1C0W A;  4S05 A;  1BC8 C;  3R60 A;  1BI2 A;  5LGU A;  2EJR A;  3Q9S A;  4HX4 A;  4CO8 A;  2GA1 A;  2JRT A;  2K02 A;  3IRQ A;  4ENJ A;  4L5I A;  2Y48 A;  5D4S A;  4R8H A;  2HQN A;  1KU2 A;  1S7O A;  1IAW A;  2O6G E;  1FP1 D;  4YII A;  1J75 A;  3T1B A;  3K69 A;  4L9T A;  4OU0 A;  4HOB A;  1USS A;  1ZLK A;  3IKV A;  3R0A A;  2JTV A;  5JHU A;  1JHF A;  4I0A A;  1OPC A;  1YYV A;  2W24 A;  5CVV A;  5HS9 A;  4KA4 A;  1DPR A;  2DFI A;  3F21 A;  2NYX A;  2YX7 A;  3F8B A;  5D4R A;  2P5L C;  1ZLJ A;  3FM3 A;  5A2Q Z;  3V8L A;  3C1D A;  1KU3 A;  2RV8 A;  1ZHF A;  3WG9 A;  3WOD F;  1HW1 A;  1QQI A;  2BBY A;  4L9J A;  2X4H A;  4RB1 A;  4XSZ F;  1O3Q A;  3D5L A;  3WTS C;  4HQM A;  5CJ9 A;  3FXU A;  1I5Z A;  1UFM A;  2QWW A;  1XCV A;  3CUQ B;  5DD8 A;  1W7P D;  4RGX A;  5J8F A;  3ROU A;  1W7P A;  2L02 A;  4KDP A;  1MJB A;  3C3W A;  4Q5S F;  1B59 A;  2HR3 A;  3TQN A;  2QZ8 A;  4BH9 A;  2ZFW A;  3ZP5 A;  2FBH A;  3QU6 A;  4HBL A;  3I59 B;  2O03 A;  1K7A A;  4LLN A;  3NQO A;  3MWM A;  1FBQ A;  2EFQ A;  1XSD A;  2FML A;  3CO7 C;  4TV7 A;  5DYM A;  2LSO A;  2XKO A;  5ICC A;  1FWZ A;  3GFL A;  1TQP A;  1MDM B;  2ELH A;  4A5M A;  3CO6 C;  2OBP A;  2Z33 A;  1FYL A;  1FOK A;  4WCG A;  3Q5F A;  2VE9 A;  5D6E A;  3WTX C;  2V79 A;  3E5X A;  3HRT A;  4RS8 A;  3BY6 A;  1KU7 A;  2ZO4 A;  3RDI A;  3OV8 A;  1P4X A;  1KA8 A;  3WGI A;  1Z1D A;  2EFW A;  3WGH A;  2H6C A;  3L9F A;  2F5C A;  2IVM A;  3S2W A;  4XSX F;  3TO9 A;  3T8R A;  2D1V A;  3ZMZ A;  3KP6 A;  1LQ1 A;  4BHC A;  1MDM A;  2WV0 A;  4WXC A;  5H6Q A;  4I2O A;  3WE2 A;  4QLC U;  3EYY A;  1MJ9 A;  3E6C C;  3V8J A;  5AIQ A;  4LLL A;  3LA3 A;  5E8G A;  4GO1 A;  2K4J A;  1IN6 A;  3ERE D;  2G9W A;  3ELK A;  2GXB A;  2LF7 A;  3HOS A;  5K5R A;  3K1M A;  2M45 A;  3JTH A;  3O6B B;  1U8R A;  2A5Y B;  4XBF A;  4A0Z A;  2UXN A;  2HZT A;  1F5T A;  5L3B A;  2Z99 A;  4KIC A;  3HHH A;  4N9I A;  1J0R A;  3TOB A;  5LEK A;  1SD6 A;  4EM1 A;  5DCM A;  1FYK A;  2DQL A;  2QVO A;  5TJJ A;  2ZNY A;  3WTW C;  1IRF A;  1BC7 C;  2A68 F;  2RN7 A;  3BPX A;  3ABU A;  3ZN1 A;  2DLL A;  2Y0M A;  2EA2 A;  1ON1 A;  2OZU A;  2JSC A;  1Q1H A;  2GWR A;  1IN5 A;  3WTT C;  2YU3 A;  1YG2 A;  4M72 A;  3LA7 A;  1H9T A;  3V7S A;  2M1B A;  3U2R A;  4BNC A;  4BAY A;  3H92 A;  2QQ9 A;  1T98 A;  1HST A;  2WWY A;  2VE8 A;  1A04 A;  3IHU A;  4HV6 A;  3WTZ A;  3GZ6 A;  2COM A;  1CF7 B;  3JAM Z;  5CYV A;  1OKR A;  1BIA A;  3FMQ A;  1FSE A;  2FU4 A;  2P4W A;  4UUV A;  4EJU A;  2P7V B;  2CG4 A;  4LGW A;  4RB2 C;  1O7F A;  3RIR A;  3F23 A;  3W6K B;  2VN2 A;  2JT1 A;  2EA4 A;  1XSX A;  3BPV A;  3BOQ A;  1FC3 A;  1FLI A;  2HDC A;  3FM5 A;  4ZYH A;  1QZZ A;  1XMK A;  2WTE A;  5E1X A;  4HDV A;  3C18 A;  2BEO A;  1BI3 A;  2QM3 A;  5FD6 A;  5CVU A;  1ZG1 A;  2HQR A;  3JAM K;  1LB2 A;  1IRG A;  1I1G A;  3IWZ A;  3ZMD A;  2XV4 S;  4U7D A;  3FMR A;  3ISP A;  3FMS A;  1S8N A;  4L9V A;  4BQA A;  1IN7 A;  1U3E M;  3HRM A;  4LD5 A;  2H94 A;  2XRO A;  4LB5 A;  1NHA A;  1B9M A;  2L4A A;  3RPQ A;  1HW2 A;  5BMZ A;  4I02 A;  5F1R A;  5IT3 A;  3HTU A;  5L3C A;  1ZGJ A;  2VOO A;  3HUG A;  4HAM A;  1YLF A;  5DCF A;  3I54 A;  1OYY A;  4A12 A;  1MD0 A;  3QRF F;  2ACJ A;  3VFZ A;  2IPQ X;  3U9G A;  1DPU A;  3WTV C;  4AIJ A;  1YW9 A;  4OIP F;  4LLG F;  4ENK A;  2R7F A;  2IRF G;  2VC0 A;  3CUQ C;  3PQJ A;  2V6C A;  3QPT A;  4LJZ F;  1F4K A;  1TBX A;  2GQQ A;  4HZF A;  2OQG A;  1ZG5 A;  2FNP A;  4ZYG A;  2W25 A;  3IC7 A;  1XDU A;  1DUX C;  3GVA A;  4OMZ A;  2Q8K A;  3TOA A;  3KP4 A;  2R7D A;  4AIH A;  1KQ0 A;  2PQ8 A;  2XAS A;  1B4A A;  1G4D A;  3D0S A;  4IF4 A;  3RKW A;  5BPI A;  1LEB A;  1LDK B;  4F7Z A;  5LGT A;  1BN5 A;  1O3T A;  4AD9 A;  3KZZ A;  1GVJ A;  2EV6 A;  3RKY A;  1K78 B;  3B73 A;  1I1S A;  2XKP A;  5ILV A;  1PUE E;  2VBW A;  3ZPL A;  1L0O C;  3BWG A;  3CUQ A;  2IA0 A;  1XGM A;  1BBY A;  1R00 A;  4UV9 A;  4KFC A;  5IT9 K;  3ECO A;  3LQQ A;  1T38 A;  4NB5 A;  2ETH A;  2HYG D;  3R6S A;  4I0B A;  2MLG A;  4UXN A;  3KEQ A;  1OYI A;  5DDG A;  2GZW A;  1BOA A;  3VOD A;  4LFU A;  2FNA A;  2QYO A;  1VTN C;  2KIM A;  4MEY F;  4PCQ A;  1LNW A;  4KIB A;  4UVC A; 
#chains in the Genus database with same CATH topology
 4IL6 C;  2FMY A;  3CCY A;  2F2E A;  2IXS A;  3BZ6 A;  2GXA A;  2HNH A;  5ICG A;  4JQF A;  3C2B A;  1Z7U A;  4FQG A;  4BEH A;  2MBF A;  4G12 A;  3E7L A;  3HG9 A;  2HTS A;  4A3M J;  4I76 A;  1O57 A;  3PNV A;  1B9N A;  3KYC B;  2XRL A;  1T0F C;  2D45 A;  1IUF A;  3HSR A;  3P9C A;  1YIJ I;  2C6Y A;  1PVE A;  1LVK A;  1B8I B;  3K4K A;  4E70 A;  1R5I D;  3HBL A;  4HLY A;  3MZH A;  4PJ0 C;  5J6X A;  4G6Q A;  5HLH A;  3I9V 2;  4AU7 A;  1HKS A;  1YIT I;  2Y9Z A;  3L1P A;  2L0K A;  1Z3Y A;  3BT9 A;  3P9I A;  4PSW A;  5K7Z A;  1JGG A;  2YU9 J;  4Y7N J;  4V2G A;  2J5O A;  4EAT A;  4PGH A;  1K79 A;  2ESN A;  3QYB A;  3HYI A;  3S3O A;  2R7T A;  3GX4 X;  1VQ5 I;  1V55 H;  4OIR F;  3JRB A;  4XL9 A;  3GME A;  1E3O C;  3CJN A;  3D5R C;  1QPI A;  3J7A O;  4CYD A;  3BG7 A;  4J00 A;  1JT0 A;  2AS5 F;  4IRI A;  2QKL B;  3MFK A;  4EJT A;  2DFF A;  1XSV A;  3G1O A;  4ZC3 A;  4M71 A;  2XAQ A;  1I6X A;  2GBY A;  3REO A;  4ASN A;  4MFD A;  5F08 A;  4BY7 J;  1RNL A;  3CTA A;  1WI9 A;  4B3X A;  1PP7 U;  4P9U A;  3VYU B;  1WH7 A;  2LMD A;  3F8C A;  1YQA A;  2PEX A;  1LDJ A;  2V9V A;  2W00 A;  3BTJ A;  4KIF A;  4BHB A;  1VI0 A;  1P6R A;  2BW3 B;  4C9Y A;  3LAJ A;  4OOI A;  2DQR A;  5JR3 A;  2E19 A;  2BHZ A;  3CF5 F;  4HDU A;  4A3I J;  4JP0 A;  3F8M A;  3FBI B;  3QAH A;  1F1Z A;  4M3F A;  5K5Q A;  2DDB A;  1E3P A;  4A69 C;  1BA5 A;  1K6Y A;  4HYE A;  3L00 A;  4IHW A;  1PDN C;  5A2Q K;  2M30 A;  2PG4 A;  5JI6 A;  1K78 A;  3W3C A;  2PJR B;  2MAB A;  1R49 A;  1I27 A;  3BC8 A;  2DU9 A;  1K61 A;  2V6E A;  5F0F A;  2IT0 A;  2R3S A;  3BP8 A;  1T33 A;  2COB A;  2HFH A;  1TWH J;  1VQO I;  2LRD A;  1KYW A;  2WC2 A;  2FOW A;  3OOP A;  2ZJQ F;  3ZR8 X;  1ZRC A;  3TO7 A;  4HF0 A;  3O2P E;  1B72 B;  1MBJ A;  3COA C;  4IXA A;  1E3H A;  2BE5 F;  5DUK A;  3IAS 2;  5FD5 A;  5HLI A;  3OYN A;  2VOP A;  5C44 J;  2ZNZ A;  1WQ2 A;  4OAZ A;  2R7X A;  3RPU A;  3QYE A;  3HGG A;  4IHT A;  1LEA A;  2Y69 H;  2R7V A;  4UVA A;  4WK8 F;  3SDG A;  3M8E A;  5IYB J;  1TTY A;  5B5E C;  2R5Z B;  1U6G A;  1JUP A;  3OYM A;  1TQM A;  2KLO A;  3AG1 H;  4UHT A;  2NVX J;  1UHW A;  3EUA A;  5LHH A;  1T08 B;  3S1M J;  4EJW A;  2AXL A;  2V1U A;  4MIM A;  2VXZ A;  3QQA A;  1UCR A;  1QU3 A;  1X3Z B;  4KNY A;  3AG2 H;  4F3Q A;  3M1E A;  2PMU A;  1O3S A;  4CCK A;  1B1B A;  2EFN A;  2K5C A;  1BW5 A;  1H9G A;  2KFD A;  1WKM A;  5IT9 Z;  1IJW C;  1WJE A;  3PNT A;  2WB1 A;  4L0Y B;  2Q2E A;  3ZQQ A;  1MH3 A;  4NBQ A;  1EV7 A;  2HKX A;  1G2H A;  2EIJ H;  1XGN A;  2IAI A;  1IXS B;  1I3Q J;  3GTJ J;  1XD7 A;  2V1D A;  3QOE A;  2EIL H;  1TZL A;  2GAU A;  4IJA A;  3K7A J;  5D5W B;  3ONQ A;  3LA2 A;  1R58 A;  3VOE A;  1BIB A;  3KX2 A;  3L2C A;  2WY7 Q;  3KZY A;  4AVP A;  1IW7 F;  2KL4 A;  1BM9 A;  9ANT A;  2BGC A;  2DA4 A;  1RR7 A;  2ISZ A;  3DPL C;  2ICW G;  1YRN B;  4FE7 A;  2XAH A;  2P8T A;  4KN7 X;  4WX9 A;  4HNV A;  1LE8 A;  4JX5 A;  4PGG A;  2CFO A;  2Q1Z B;  2XF5 A;  3RZO J;  5HOO A;  3K4N A;  1TNS A;  2DBB A;  1V4R A;  2LRE A;  5H20 A;  3CC7 I;  3HJE A;  1J2X A;  2TCT A;  1UJ8 A;  4ESF A;  2VL8 A;  1YO5 C;  3C2H A;  4XR6 A;  2KIQ A;  3H0D A;  4I99 C;  4QPO A;  4IQJ A;  1X1D A;  3HC7 A;  5ILS A;  2XUB A;  4BY1 J;  1LDD A;  3JW4 A;  2W57 A;  3EUK L;  2GXG A;  1U5T B;  2NS7 A;  4V2F A;  3MQ0 A;  3MKY B;  3M07 A;  4RBO A;  2O61 A;  4FTH A;  4UV8 A;  3LQR A;  1ZRE A;  4KIS A;  2ZXH A;  1T2K A;  1DQU A;  2HKO A;  2Q0O A;  5DD4 A;  1SAN A;  3DEU A;  4C3H J;  3CCQ I;  1RPW A;  2GIV A;  4M9S A;  4PUS A;  3FXR A;  3GFJ A;  3V7R A;  2G7U A;  3HIF A;  2JVG A;  1PP8 F;  1EF4 A;  1GUU A;  2V9P A;  3S2H J;  1BR4 A;  3Q9V A;  3KIO A;  3DXJ F;  4U0V A;  4WXD A;  4Y17 A;  3MKZ A;  4F93 B;  2L9V A;  1VQ6 I;  3L2Q A;  1BJA A;  1D0X A;  3TED A;  4MHG A;  3ZOB A;  3OIQ A;  3BQY A;  3B02 A;  2MYS A;  1S6L A;  3W6J B;  1J9I A;  1FEX A;  3F8F A;  3QP5 A;  4B43 A;  5LHI A;  1JJ6 C;  1OR7 A;  2XDV A;  2RRE A;  3V7C A;  5LFA A;  3NWS A;  2IJL A;  1AOY A;  2PX9 A;  2XIG A;  3E6B A;  4RA2 A;  3TP3 A;  5LLQ A;  1E17 A;  4M6Y A;  5D5X B;  2K9Q A;  1D8K A;  4A2U A;  4D7N A;  4RGS A;  2R7S A;  5LBQ A;  4HX7 A;  3I4P A;  4RM3 A;  4B1R A;  1OCT C;  3MAJ A;  4L0Z B;  1TQI A;  2DTR A;  3KEO A;  1G3T A;  5B3S H;  3GEZ A;  1X3W B;  3M8J A;  2TRT A;  3F9K A;  3D5S C;  4MEX F;  2K85 A;  5BPD A;  2HVR A;  1OQY A;  3F3X A;  1UB9 A;  1IGN A;  1SMY F;  1JKO C;  4YIF A;  3ZCO A;  4HV5 A;  4S04 A;  4BE0 A;  4OWR B;  2ZBK A;  5E18 F;  3HSE A;  1SVM A;  4BYY A;  3WHB A;  1D5V A;  4KT5 C;  4ZDL A;  2XC7 A;  3BTL A;  1Y1V J;  1N77 A;  4MNU A;  5BOX A;  1AHD P;  4RGR A;  3N05 A;  4R79 A;  1MBK A;  2HEO A;  2HOS A;  4A0Y A;  1MBE A;  1H0M A;  3K4M A;  2HYF A;  1P4A A;  2VKD A;  2DT6 A;  3RJP A;  1XTA A;  4Q47 A;  1SFE A;  4Y15 A;  1X1B A;  1AKH A;  3WGG A;  5H2F C;  2JSP A;  5ICF A;  4F92 B;  2QQA A;  1SFK A;  1J7K A;  1D1A A;  2BVM A;  4IVN A;  1FBU A;  2BY3 A;  1Y8Q B;  3KLO A;  5E3O A;  4G7H F;  1Z6R A;  3OYI A;  4E7I A;  1UHM A;  2R7Q A;  4HRI A;  1W36 D;  1WGX A;  2QUF A;  2KP6 A;  1TW2 A;  2L7M P;  1V5F A;  4D0P A;  5GAE J;  3VSL A;  2LY9 A;  4PJJ A;  2L7K A;  3I0T A;  1SAX A;  2A3S A;  2XGE A;  1QGP A;  4A6E A;  3C2G A;  1Z21 A;  4BBR J;  3AL0 C;  4NHJ A;  4CYC A;  1POG A;  3IV5 A;  3HOT A;  2KJC A;  3S1R J;  2ECC A;  3X2Q H;  4Z6Y A;  5EJC A;  1MH4 A;  2HXO A;  3GYH X;  1V54 H;  3C7J A;  1ODD A;  3MZY A;  2HZD A;  1ULY A;  1ZN2 A;  2KPM A;  5EYR A;  1UST A;  1FSH A;  2E1C A;  3CDL A;  3A0H C;  5CPR B;  1REP C;  4HA8 A;  2VJ4 A;  1MZB A;  1MNE A;  1KQ9 A;  1B6A A;  3TMO A;  4HNU A;  2VOD A;  2OA4 A;  3U1D A;  4H4K C;  4AID A;  1AKH B;  1MJA A;  4M9Z A;  4BUP A;  5J4V A;  3MVP A;  1U0J A;  2DW4 A;  2QLZ A;  1VQK I;  2DI3 A;  4A3G J;  3ML6 A;  1XDS A;  3LMM A;  4AUX A;  4FX4 A;  5L3G A;  3NEU A;  2FEZ A;  1L3L A;  5EZG A;  2Y75 A;  2K7L A;  1CGP A;  1X58 A;  2HOE A;  3I55 I;  5LGN A;  2QBY B;  1O3R A;  1Z77 A;  1MBF A;  1FOX A;  3HOW J;  3RZD J;  2YSR A;  4YFX F;  5AON A;  1KON A;  1LPQ A;  1WJ5 A;  1JGS A;  1OCZ H;  5M5Y J;  3ZQF A;  3I58 A;  4E7L A;  4D9J A;  5IOY A;  5DTD A;  4EQQ A;  3CJT B;  5J8C A;  1E0E A;  1P4W A;  1V5G A;  1Z0X A;  5HVQ C;  4D5F A;  2OV7 A;  4KMF A;  4O6J A;  4WF2 A;  1Z6T A;  3IWF A;  2B9S A;  5FRM A;  4EM2 A;  2W84 A;  3BR2 A;  3FIW A;  2V1X A;  4IOA F;  2ZJ2 A;  1BOB A;  3G6E I;  4AYB N;  4HG2 A;  2GLO A;  4WWC A;  1P92 A;  3JSO A;  2OTL I;  3CUO A;  3Q3S A;  2E7X A;  5KCM A;  3LSM A;  2BXZ A;  1A36 A;  4IHS A;  4I7H A;  1W5S A;  3P5J A;  1F9N A;  2IS4 A;  2LC2 A;  3HOU J;  1YOV B;  3HSF A;  2D2W A;  1ZAO A;  5K1Y A;  4BJ6 C;  5JVT A;  1NH3 A;  2E1N A;  2P5V A;  3DTI A;  2UV1 A;  2EIN H;  5FLM J;  2NNN A;  1D3Y A;  5M5W J;  1JTY A;  1YI2 I;  3HOZ J;  3OSG A;  3LWF A;  2A05 A;  3EET A;  2LF8 A;  4LG0 A;  2VB6 A;  5KK1 A;  2BY0 A;  3LSJ A;  4DNC A;  5IP9 J;  3DBR B;  2FXA A;  3IH4 A;  2P7C B;  3SYT A;  2STW A;  4X6A J;  2R93 J;  1EKE A;  3S16 J;  1U2W A;  1GHC A;  2MC3 A;  2VJI A;  3RSN A;  3SXY A;  2FA5 A;  4V19 K;  1D1C A;  1TW3 A;  2QEN A;  4FE4 A;  2MLK A;  4M3D A;  4M73 A;  1OFC X;  3KCC A;  1H8A C;  3M9A A;  1YX5 A;  4OIO F;  1N25 A;  1S7A A;  3HB9 A;  4OAY A;  2RC4 A;  3E6D A;  2ZKZ A;  2L9S A;  1GV5 A;  1MBG A;  2Y31 A;  1IG7 A;  2RQQ A;  1HKT A;  2GOX B;  2Y0S N;  5FJ8 J;  1HF0 A;  5E20 A;  2L2O A;  2ID3 A;  5K7F A;  3FKI J;  1U78 A;  2M34 A;  1FY7 A;  2EB7 A;  4QIW N;  3JRC A;  3MMY B;  3E5Q A;  1P7I A;  3RYR A;  2IP2 A;  1SMT A;  1D5Y A;  1BR1 A;  4LK1 F;  3RTR A;  1Y0U A;  3M3Y J;  4ZH4 F;  1R1U A;  2PMH A;  1T8I A;  1P7J A;  4BXX J;  5AIP A;  4JK1 X;  2DN0 A;  2E2H J;  2QGU A;  2P6T A;  5HLT A;  5LRR A;  4ETS A;  2GOM A;  2VJ5 A;  2M9H A;  5TIS C;  3S2D J;  1WJF A;  4XON A;  1TNT A;  5DUI A;  2GIZ A;  4EGY A;  4RLF A;  4L18 B;  1QPM A;  3BQZ A;  3QYF A;  4ANJ A;  1RIO H;  3CC2 I;  1ZG3 A;  2DCE A;  1U9O A;  3Q0W A;  1E2X A;  2IGK A;  4CGZ A;  1VFC A;  3TDZ C;  4LIV A;  3BLY A;  2KDO A;  3I4M J;  4BAC A;  4KN4 X;  4FT8 A;  2OC6 A;  3TW6 A;  4UUS B;  2P81 A;  2QEX I;  1ZYR F;  2E1O A;  5D5U B;  5EEA A;  2WBM A;  4PZJ A;  2CFX A;  5L3E A;  4II3 A;  1U5T A;  3CES A;  3AAF A;  1TP4 A;  2V26 A;  3ABL H;  1X19 A;  4UB8 C;  2R5Y A;  1EH6 A;  4K2E A;  3TGN A;  2QBY A;  4CZZ A;  1R1T A;  2X1D A;  3QOP A;  2L01 A;  1XGS A;  4GYI A;  2I10 A;  3K70 D;  3HKZ A;  1YW7 A;  1DP3 A;  4A3K J;  3J81 K;  4LIU A;  1MBH A;  4EV0 A;  3JSP A;  2HS5 A;  4YRV A;  2XAJ A;  3IH2 A;  4E6K G;  2R0Q C;  1QHH D;  1T6S A;  2YUS A;  3HEF A;  1FOW A;  1NTC A;  2HYJ A;  2IA1 A;  2A6E F;  4B8X A;  5FKM A;  4BE2 A;  4QWQ A;  1ZR4 A;  4LB6 B;  1RUN A;  4BQN A;  3IKT A;  3SQN A;  2PN6 A;  2O0Y A;  3MKL A;  2KRH A;  3DEW A;  5D8L B;  2A5W A;  2EV5 A;  4MTE A;  4HF1 A;  2HI3 A;  1KGS A;  3SJM A;  1J59 A;  3SEQ A;  4B44 A;  4G7O F;  3A4C A;  5CVI A;  2HWV A;  3OR2 C;  3JRI A;  2MFZ A;  4G8X A;  3TO6 A;  1QZE A;  2CMP A;  1KU9 A;  4BKX A;  1HW5 A;  1I50 J;  2TDX A;  2E71 A;  1BW6 A;  4M74 A;  1VQL I;  1DU0 A;  2DMU A;  4XLP F;  3MCZ A;  3VEP A;  1RC9 A;  4UNO A;  5HS7 A;  3DKY A;  3BJO A;  3IAM 2;  2CW7 A;  3RKQ A;  3FX3 A;  3R4K A;  1I39 A;  1RUO A;  2G7H A;  2ZC2 A;  4R1H A;  2MH9 A;  1LJ9 A;  2IS6 A;  2QSG X;  2DT5 A;  5EZH A;  2F4I A;  3CQZ J;  5GP9 A;  1WJB A;  3FDY A;  3L2R A;  4W1U A;  4LK0 F;  2F4O B;  3J7Z I;  2DJN A;  5FGM A;  4XQF A;  1ZAR A;  4Y33 A;  2LNB A;  2F5F A;  3S8P A;  1Z05 A;  2LR8 A;  3T5X A;  4KYW A;  2E35 A;  3IH3 A;  1TWC J;  1H89 C;  3F22 A;  1XN7 A;  5KVR A;  2M0M A;  2FJ1 A;  2W1O A;  1R9T J;  1XB4 A;  4HW0 A;  5LD2 C;  2VT3 A;  3DPU A;  5EF6 A;  2ELJ A;  2PFB A;  5TGT A;  3GTM J;  5FLX K;  4UVB A;  2XRN A;  1SD4 A;  1KYZ A;  3VDX A;  4HF2 A;  4GGG A;  4P9F A;  1D8J A;  4XRS A;  5FLV A;  2EFO A;  3V4G A;  4J01 A;  2M4K A;  2F5V A;  1JE8 A;  4UUS A;  3EYI A;  3K2Z A;  3KET A;  1OMI A;  1YFH A;  3I64 A;  1KZH A;  5HDG A;  3LAP A;  1SD7 A;  4ZZL A;  3WTY C;  2XPV A;  1J09 A;  2VT2 A;  1BI0 A;  2X85 A;  3H5N A;  2FF4 A;  2L5Q A;  2R7Z J;  3L09 A;  1HDD C;  2LK2 A;  3H9G A;  3CD6 I;  3K0L A;  5B66 C;  3FXJ A;  2MA3 A;  5GAH J;  2PBI A;  2FBI A;  5F04 A;  2EZL A;  5D8K B;  2FE3 A;  2HQA A;  1K83 J;  2RKH A;  4Y4R A;  4P55 A;  4EVI A;  1FBS A;  4NQW A;  2XF7 A;  4XMY A;  3ZMV A;  1YX3 A;  2E7W A;  5LHG A;  1GVD A;  3Q0V A;  3ASN H;  5F1J A;  3LFK A;  5EG0 B;  4ZJZ A;  1EH7 A;  2RQP A;  3SZP A;  2LG4 A;  4WXH A;  4BXU A;  5IPA A;  2PJP A;  4A3E J;  2VBY A;  2XVC A;  3AG4 H;  2EZH A;  3J80 K;  4IEJ A;  1HQC A;  3PNY A;  3DPT A;  3JRA A;  2F5E A;  3KP5 A;  2X1E A;  1IXC A;  1DDN A;  1STZ A;  3DTK A;  3NRV A;  3WG7 H;  2BZT A;  1FTT A;  2P6S A;  2FRH A;  3RYP A;  3G73 A;  2CO5 A;  2UWM A;  2A61 A;  2KJB A;  1YW8 A;  2HTJ A;  3OYL A;  2JA8 J;  1EH8 A;  1QVU A;  2CUZ A;  4EJO A;  5L3F A;  5EGO B;  1A31 A;  1ETW A;  4RB0 A;  4CDG A;  5IP6 A;  3RKX A;  2KZV A;  4NC8 A;  2EQR A;  5F0C A;  4GDF A;  3S1Q J;  1GT0 C;  3A01 B;  4YFK F;  3ZN0 A;  2H27 A;  3AFH A;  1IZ1 A;  2X6X A;  4IQ4 A;  2CQX A;  1X2N A;  3GLX A;  1TWF J;  1IXR C;  4I01 A;  3MZ8 A;  3CCL I;  4N4N B;  2DYR H;  1DU6 A;  4RMN A;  1W5T A;  3BCB A;  3WU0 A;  2DK8 A;  3F6O A;  3L2U A;  3A02 A;  2CUE A;  1ZR2 A;  4NUB A;  3PQK A;  3GF2 A;  1HKQ A;  4A5N A;  4F55 A;  3GFI A;  5HDN A;  1JUM A;  1V5E A;  4A3L J;  1HCR A;  1GXP A;  4N0B A;  4FX0 A;  4J19 A;  3ZQ7 A;  1D0Y A;  4CYC B;  3H9Q A;  4CIC A;  1FIP A;  5HLG A;  3N4M A;  2LDU A;  1BI1 A;  3OYH A;  1J5Y A;  2CGP A;  3GTL J;  2ZME B;  3J80 Z;  1JXS A;  3FWE A;  3KYL A;  4M3G A;  2CW0 F;  3BG9 A;  1OCC H;  3OL3 A;  2KIF A;  3EQL F;  1FJL A;  1EJ9 A;  4HPQ A;  4M6X A;  4G94 A;  1AWC A;  3N97 A;  2O3F A;  1YS6 A;  2AHQ A;  1MNM C;  4XK4 A;  3DQV C;  2K4B A;  3PO3 J;  4IOC F;  1XMA A;  2VPR A;  2M87 A;  3K1P A;  3T0Y A;  2IGN A;  4E4H A;  2VQC A;  2BY1 A;  2MD5 A;  5DCM B;  5FO5 A;  3FBN B;  2L54 A;  3GTK J;  3DTE A;  2CH0 A;  5E8I A;  4XLE A;  1G3W A;  2QF7 A;  2CSO A;  4XRF A;  1S7E A;  2Z1D A;  3UKG A;  2L7Z A;  2NVY J;  2VQG A;  4Q4Z F;  3GWZ A;  2BHY A;  2EK5 A;  4X1E A;  1WWX A;  5ILU A;  4DGW B;  2FOK A;  2LKP A;  3BR0 A;  2O5R A;  3ECH A;  3QU3 A;  3S15 J;  1FX7 A;  1TT5 B;  4XIC A;  2MH2 A;  3TDU C;  3ULQ B;  3S14 J;  2KZG A;  3CCE I;  1HDP A;  4DQ2 A;  5HOD A;  2JPC A;  2RNJ A;  3MEX A;  2ZME C;  4LMY A;  1GDT A;  4CZC A;  1XC5 A;  2EV0 A;  4PDK A;  2VBX A;  3Q0U A;  5L3D A;  1ZRD A;  2OD5 A;  1MMS A;  4U0W A;  3HTS B;  4AWX B;  5J1Y A;  3CLO A;  3BG5 A;  2YS9 A;  3CLQ A;  4ESJ A;  3IRR A;  4OIQ F;  4A3D J;  1Y56 A;  5ICE A;  1X1C A;  3PIP F;  3O3K A;  4YIR X;  1OIS A;  1Z9C A;  3HRS A;  4H0E A;  4KIG A;  1PUF B;  2HQ5 A;  5C3E J;  3PL8 A;  2FUG 2;  4BJT A;  3K10 A;  1XGO A;  2A6H F;  1R23 A;  3TKY A;  1R1V A;  2VKV A;  3PM1 A;  4XOT A;  2VAS A;  2I5U A;  2UUZ A;  3CP2 A;  1G3Y A;  3KPH A;  2FBK A;  1UZC A;  4YEJ A;  2V7F A;  5K7H A;  2NRA C;  4A93 J;  5E79 C;  3PFY A;  2W7N A;  1A6Q A;  2JA7 J;  4G6T B;  1DGW Y;  4Z2Y A;  4ZZD A;  1S9H A;  3GO5 A;  3T8T A;  4DYR A;  2IGM A;  5FB2 A;  3R0J A;  1O7L A;  3DFG A;  2D1H A;  5C4J J;  2OU2 A;  4B4C A;  3DLA A;  2RGV A;  3OYC A;  3RCO A;  1ONV A;  4KT6 A;  4EEF G;  3CP8 A;  3F8N A;  3H3U A;  3G1L A;  3UNG C;  2JN6 A;  5DEQ A;  1QHG A;  3LSK A;  1X1A A;  3OMY A;  5FKK A;  2ZME A;  1ZRF A;  3FK7 A;  3KP7 A;  4HLX A;  1IC8 A;  5CVR A;  2F48 A;  4ESB A;  3DV8 A;  2HVQ A;  2LD5 A;  3BTC A;  2CV1 A;  3M7G A;  4B09 A;  2Y2Z A;  3CF2 A;  4I98 B;  3WE3 A;  2Y30 A;  2G0E A;  1G8X A;  1SFX A;  5FFX A;  2EFP A;  2DYS H;  2VKE A;  2IS1 A;  3GTO J;  2Z16 A;  1HSJ A;  4BE1 A;  5D5V B;  2A69 F;  2H6B A;  2CYY A;  5K5O A;  2X1C A;  2R92 J;  4XN0 A;  2P5K A;  2ZXJ A;  3EUH A;  3J81 Z;  3BZC A;  2B0L A;  5HDK A;  3QPL A;  4IRG A;  3HOY J;  2BXY A;  3JR9 A;  3DU5 A;  1A35 A;  2Z5U A;  4EGZ A;  3GFM A;  3KP3 A;  4C30 A;  5CVJ A;  1IN8 A;  1R36 A;  2DPD A;  1MKM A;  2L3D A;  1VZ0 A;  2W85 A;  1UMQ A;  2QQ8 A;  2ZXW H;  2NNY A;  1RI7 A;  5F27 A;  2Z9O A;  2VC1 A;  1V3F A;  4HX8 A;  3PFI A;  3ZQI A;  2VIX A;  2KRF A;  1T39 A;  1GXQ A;  4E7K A;  3G3Z A;  2ESH A;  4A3C J;  2Y9Y A;  3DP7 A;  2BV6 A;  3JCU C;  4RGU A;  2DAO A;  3O8G A;  5IYD J;  1ETO A;  5EEH A;  4IRH A;  5E3M A;  4YG2 F;  4E7Z A;  4EM0 B;  1JI8 A;  4G7Z F;  4M9X A;  2KHM A;  1SFU A;  4JX4 A;  4N4O B;  1MND A;  1ON2 A;  2L4M A;  4LG0 B;  4L5J A;  2QQB A;  2IW5 A;  2E5Z A;  2LBF A;  1YIO A;  4DYC A;  5E17 F;  2R5Z A;  2YPR A;  4NQW B;  3FKJ A;  4Y3O A;  3GZ5 A;  2DK5 A;  3OIP A;  4ON0 A;  2CQK A;  4FCY A;  4Q48 A;  4AVZ A;  4HNT A;  1JKQ C;  3CCS I;  1X3U A;  1Y0N A;  2WAQ N;  3H9J A;  4D5C A;  1F43 A;  4P5O A;  2YX4 A;  2XF6 A;  3P7N A;  1R4N B;  3VB2 A;  2ZSH B;  2XAG A;  5E1W A;  4Y13 A;  4U88 A;  2RDP A;  3DBL B;  4OMY A;  4IPA A;  2LBF B;  1WRJ A;  2CUJ A;  4XOP A;  2IBD A;  3SEZ A;  3OYD A;  2DOA A;  1JT6 A;  2XPU A;  4RAZ A;  6PAX A;  3CCR I;  4ENN A;  4RB3 C;  1WSU A;  2WAD A;  3E3V A;  3OYE A;  1LFU P;  2K86 A;  4E7J A;  1FP2 A;  4EJV A;  3JRG A;  1MIJ A;  2FX0 A;  2NVQ J;  1WCM J;  3A1Y A;  3F0C A;  3U1K A;  2VI6 A;  3WU2 C;  3WU1 B;  4D1Q A;  4ZTF A;  4CCL A;  4CCM A;  2VQL A;  1ERD A;  1R5G A;  3JRE A;  3HHG A;  2KDZ A;  5FKO A;  3F72 A;  3DWL E;  1OYW A;  4ITV A;  4I09 A;  1FTZ A;  5FKL A;  2X9D A;  2VXD A;  3PIO F;  2JK3 A;  4BHP A;  2BYV E;  3ZMT A;  4MQ9 F;  3GUD A;  2IA2 A;  4JBA A;  1PJR A;  3CDH A;  1HLV A;  1CQT A;  2XGX A;  1FZP B;  1FNN A;  2FSW A;  1G6N A;  1RZ4 A;  3V8K A;  1XCB A;  1I3A A;  3LFU A;  4L9N A;  5ED4 A;  2ISY A;  1U5T C;  3M1C A;  1T0F A;  4HST A;  2JA2 A;  4HQE A;  4CXF A;  4C3J J;  2PMZ N;  1JJ8 C;  3K9T A;  1ZKG A;  5CLS A;  1IN4 A;  4F52 A;  3OY9 A;  3FF5 A;  3CCJ I;  3I71 A;  1GV2 A;  3F6V A;  4NNJ A;  2JZY A;  2FQ3 A;  2NOJ B;  4GYG A;  4BDY A;  4C2U A;  1AA7 A;  3K1N A;  3VSK A;  1JHH A;  3FHZ A;  1LFB A;  2DTZ A;  2LY2 A;  5LEJ A;  5FFZ A;  3FHN A;  2H09 A;  3G1M A;  1A5J A;  4B48 A;  2LVS A;  4RAY A;  5JVG F;  2IGO A;  3RI4 A;  4N9H A;  2EWN A;  5HS8 A;  4HSR A;  1BR2 A;  2OJE D;  2I8D A;  3K6G A;  3HOX J;  5EEG A;  4G9Y A;  1JKP C;  3V42 A;  4ZYE A;  1S29 A;  3SZT A;  2PLY A;  1OCO H;  4I6Z A;  1IF1 A;  1W4M A;  2XAU A;  3I59 A;  5FLX Z;  3QWL A;  3FXQ A;  2CJJ A;  4JOM A;  3S32 A;  3S93 A;  1VQ7 I;  2V9K A;  4XLF A;  2M8E A;  3SFZ A;  1KQ8 A;  1MW7 A;  1SD5 A;  1R7J A;  2L7F P;  3JTG A;  3RQ4 A;  4RM2 A;  4P96 A;  3WTU C;  3BR3 A;  3R61 A;  2QSH X;  4DZJ A;  2ZXI A;  1R22 A;  1X1P A;  2CQ7 A;  4ENM A;  2M4G A;  1FT9 A;  3FIS A;  1K6O A;  4CCN A;  3ZRG A;  1FPQ A;  3OSF A;  3A01 A;  5DV5 A;  4II2 A;  3H3V K;  5J1U A;  1W7P B;  2CWE A;  2DXI A;  2X0L A;  2XHK A;  3KP2 A;  2KKO A;  2VUM J;  3I3L A;  2XSJ C;  5JLX A;  1MGT A;  4QSH A;  2VBZ A;  2E60 A;  3KZI C;  3S3M A;  3A03 A;  3HKZ N;  4MQV A;  4YFN F;  4MGR A;  1P9Q C;  2HU9 A;  2UXX A;  3GXO A;  3S17 J;  2LFB A;  1TLH B;  2WY8 Q;  1TC3 C;  1T95 A;  1WVR A;  3LST A;  3BR6 A;  3BRO A;  4XKB A;  5F6F A;  4XKW A;  2UZK A;  5DM6 F;  2J5P A;  2F4M B;  2NXN B;  1FYM A;  3DKX A;  2OZ6 A;  4U0Y A;  1F36 A;  3HRU A;  1W0U A;  3SHF A;  2NVT J;  5E1Z B;  3OS1 A;  1VQM I;  5M3F J;  3QP6 A;  2MW8 A;  2XPW A;  1Z91 A;  2F6C A;  1QO0 D;  2VLA A;  4A0X A;  1VQ8 I;  4QPQ A;  3BCA A;  3E6M A;  3BJ6 A;  4FHT A;  3E97 A;  5CQG A;  3SDB A;  1QBJ A;  2STT A;  3ESW B;  1G3S A;  4EMS A;  2PI0 A;  3IL2 A;  2HPM A;  4DJA A;  5HNH A;  3KLN A;  3M4O J;  2X6W A;  2CRG A;  3AL0 B;  2GA2 A;  3CCU I;  1CF7 A;  3CDI A;  5FRN A;  3DF8 A;  3HM5 A;  3TBI A;  1QRY A;  3GZN B;  5BS6 A;  3ZMS A;  1IUY A;  4XLN F;  3ZMU A;  2ZCW A;  2F5D A;  2VON A;  1DP7 P;  4M6V A;  2LLK A;  4BQO A;  3KE2 A;  5JFR A;  4ABZ A;  1P2F A;  1HBX G;  4AYB A;  1B8I A;  5IYC J;  3LSI A;  2A07 F;  3OS0 A;  4NC7 A;  1XG1 A;  2DOD A;  3BJA A;  4KUM A;  2NS0 A;  4UUT A;  3LSG A;  5EGO A;  4A6D A;  3I53 A;  3ZQH A;  4DBQ A;  5LRS A;  3QPH A;  2O8K A;  3EDP A;  5F64 A;  1SC7 A;  2OQR A;  1U8B A;  2DFH A;  1YJN I;  3I5U A;  1W5C C;  5C4X J;  2DO7 A;  2A6T A;  4PFP A;  1YTY A;  2Z3Y A;  5TRD A;  2NAZ A;  5D6F A;  3ABT A;  2KIU A;  2HGC A;  2OAZ A;  2M7B A;  1ETK A;  2L9N A;  3DKW A;  1S3J A;  4ZYD A;  3L7W A;  4O3M A;  4XRS G;  2DPU A;  2K27 A;  1VQ9 I;  4GCV A;  1BJZ A;  4KMU X;  3BDD A;  4RAF A;  1OLT A;  1YRN A;  1R5H A;  2GM4 A;  2ADU A;  4U7B A;  1LVA A;  1ZGA A;  2RVC A;  2JPB A;  4O5V A;  2XAF A;  2DA3 A;  4UY8 I;  2DA5 A;  5GPC A;  4GXO A;  5ERI A;  2AO9 A;  3CMM A;  3GW2 A;  5BQT A;  3KFW X;  5BNG A;  2HOA A;  3CCV I;  1ITY A;  1B72 A;  3VPR A;  2K3F A;  3VWB A;  1QNT A;  3M8F A;  4G6D A;  4DIQ A;  3ERM A;  4MTD A;  3H3Z A;  3FZV A;  5H6R A;  1D1B A;  4AIK A;  3IUO A;  4BDZ A;  2XGC A;  3IP4 B;  4MO7 A;  2H8R A;  3W2A A;  2M5W A;  1YE9 A;  1YS7 A;  4CHU A;  3P9K A;  4W97 A;  1QZY A;  1YJW I;  4CA0 A;  1MMD A;  1HXD A;  3K4C A;  2YR2 A;  1WHU A;  3E5U A;  1ZH5 A;  4OIN F;  2KMU A;  2O8X A;  1VQN I;  1C0W A;  3K4L A;  4S05 A;  2LKS A;  1VQ4 I;  2W48 A;  4A3F J;  1BC8 C;  3RPU D;  3JRH A;  1WH5 A;  3R60 A;  1BI2 A;  2EJR A;  5LGU A;  3Q9S A;  4HX4 A;  3HPG A;  1APL C;  4CO8 A;  2GA1 A;  2JRT A;  1Z7L A;  3I56 I;  3LSH A;  2E1M B;  2K02 A;  3IRQ A;  3PUB A;  5JLW A;  3E1S A;  2VQH A;  2M3A A;  4ENJ A;  4L5I A;  2Y48 A;  1MMN A;  1UHS A;  5D4S A;  2PJR A;  2DA6 A;  4CCJ A;  5GAD J;  4ZTJ A;  4R8H A;  3LNQ A;  1SVL A;  3JRF A;  4C3I J;  2HQN A;  1KU2 A;  1S7O A;  1IAW A;  2O6G E;  2O9L A;  1FP1 D;  4YII A;  3PUF A;  1MMA A;  2Y0S A;  1J75 A;  3T1B A;  3I4N J;  2N8G A;  2EPF A;  3K69 A;  3NAU A;  4HOB A;  4L9T A;  4OU0 A;  1USS A;  3OL4 A;  1ZLK A;  2CUF A;  3IKV A;  5GPA A;  2QKM B;  2JTV A;  3R0A A;  2B7E A;  5JHU A;  1JHF A;  3QPS A;  3RQI A;  4I0A A;  3FXL A;  1OPC A;  2HOT A;  1YYV A;  3H35 A;  2AQF A;  2W24 A;  5CVV A;  5HS9 A;  2OTJ I;  4KA4 A;  2KQR A;  2E2I J;  1DPR A;  2LY1 A;  3ABM H;  2WA0 A;  2DFI A;  3GLL A;  3F21 A;  2NYX A;  2YX7 A;  3F8B A;  5D4R A;  2P5L C;  5J47 A;  1ZLJ A;  4DYQ A;  2LKX A;  1D0Z A;  1IV8 A;  4GFB A;  1SEU A;  3TP0 A;  3FM3 A;  5A2Q Z;  3H5R A;  3V8L A;  3C1D A;  5DS9 A;  3J7A Y;  1KU3 A;  2OPT A;  4LIT A;  1N75 A;  3GTP J;  2RV8 A;  4CSW A;  1ZHF A;  2R5Y B;  3WG9 A;  3WOD F;  1HW1 A;  1ACI A;  1QQI A;  2BBY A;  2WV1 A;  1X4P A;  1BL0 A;  2O7O A;  4L9J A;  2X4H A;  5E3L A;  2FQ4 A;  2JUC A;  5CKT A;  1LUJ B;  3BR1 A;  4XLA A;  4RB1 A;  3SFI A;  2E5N A;  4XSZ F;  1O3Q A;  3D5L A;  3WTS C;  4HQM A;  5CJ9 A;  2K9L A;  3UR3 C;  4BL0 B;  1Q1V A;  3FXU A;  1I5Z A;  1UFM A;  2K40 A;  2QWW A;  5FRO A;  1XCV A;  3MD2 A;  3FXM A;  3W6V A;  1RRJ A;  3ASO H;  2JRM A;  3CUQ B;  1G59 A;  5DD8 A;  2X6Y A;  1W7P D;  4RGX A;  5J8F A;  4IX7 A;  3ROU A;  1W7P A;  2DA2 A;  2L02 A;  3H0G J;  3LSP A;  2CV0 A;  3HL2 A;  4KDP A;  2IS2 A;  3QOD A;  3PO2 J;  1MJB A;  3C3W A;  4CUG A;  4Q5S F;  4YEL A;  1B59 A;  3H36 A;  3HOV J;  3CJQ B;  2ID6 A;  2HR3 A;  4PJL A;  3TQN A;  2QZ8 A;  4BH9 A;  2ZJP F;  2HXI A;  2ZFW A;  3ZP5 A;  3ZXS A;  2JQ7 A;  5KAF C;  2FBH A;  2CU7 A;  3QU6 A;  4HBL A;  3I59 B;  1W0T A;  3K4J A;  4PK4 A;  2O03 A;  3TL4 X;  1OCR H;  1K7A A;  4LLN A;  4PSX A;  3NQO A;  1FMW A;  4M3B A;  3MWM A;  2R7W A;  2RAE A;  1ETY A;  1FOY A;  1FBQ A;  2FD5 A;  2EFQ A;  3MN2 A;  2KT0 A;  2LP0 A;  1XSD A;  1FIA A;  2FML A;  1WPK A;  3CO7 C;  4TV7 A;  2K9M A;  2X6O A;  2LSO A;  2XKO A;  5DYM A;  5ICC A;  2EIM H;  1FWZ A;  4IHX A;  2R4G A;  2WAE A;  3H1C A;  3JRD A;  2E2J J;  2WB1 N;  3GFL A;  1TQP A;  1IDY A;  3DU6 A;  2ELH A;  5GTI C;  3OYF A;  1TWA J;  1MDM B;  4A5M A;  3CO6 C;  5IOZ A;  3B6A A;  5J40 A;  2JA6 J;  4CH7 A;  3PSF A;  3OYA A;  3A2K A;  1WZ2 A;  3S1N J;  2OBP A;  4ZYA A;  2Z33 A;  1FYL A;  2JUG A;  1FOK A;  4WCG A;  3Q5F A;  4XNF A;  2VE9 A;  5D6E A;  3WTX C;  3NAR A;  2P0W A;  1RR8 C;  2KIS A;  2V79 A;  3E5X A;  3HRT A;  4RS8 A;  1Y1W J;  4D7M A;  3BY6 A;  1XPX A;  1KU7 A;  2ZO4 A;  4QTR A;  3RDI A;  1WJC A;  2DOF A;  4E7H A;  3OV8 A;  2DFE A;  1SVO A;  2CQQ A;  3A0B C;  1P4X A;  1KA8 A;  2JMW A;  3WGI A;  1LFP A;  1Z1D A;  4F91 B;  2CS3 A;  2EFW A;  3OOU A;  4BGD A;  1O4X A;  4NC6 A;  4RLQ A;  5J1R A;  3GCM A;  3WGH A;  2H6C A;  3L9F A;  2MD0 A;  2F5C A;  2IVM A;  4ZDP A;  2K9N A;  3S2W A;  4XSX F;  1Y6I A;  3TO9 A;  3T8R A;  2ECB A;  3O8H A;  2D1V A;  1K4S A;  3ZMZ A;  4A3J J;  1TL8 A;  3KP6 A;  4FAS D;  4FET A;  1LQ1 A;  4XKV A;  2X48 A;  4BHC A;  1MDM A;  2WV0 A;  1SFO J;  4WXC A;  5H6Q A;  2M2E A;  1RES A;  4S0H B;  4I2O A;  1R6R A;  3WE2 A;  2MC4 A;  4PFO A;  2DMN A;  3HDD A;  4QLC U;  3EYY A;  3K4B A;  1MJ9 A;  3E6C C;  3V8J A;  2NVU B;  4DW6 A;  5AIQ A;  4LLL A;  2LOO A;  2JA5 J;  3LA3 A;  1UEL B;  5E8G A;  1Z67 A;  4GO1 A;  4JX6 A;  2K4J A;  1IN6 A;  1TT0 A;  3ERE D;  2G9W A;  3ELK A;  4LG3 A;  2GXB A;  4JYK A;  2HVS A;  2X51 A;  2LF7 A;  3HOS A;  2DMT A;  4RDU A;  2D5V A;  4XOR A;  1IO2 A;  3K1M A;  5K5R A;  2M45 A;  2MGQ A;  3HUG B;  3ZQL A;  3BTI A;  1NK2 P;  3JTH A;  3O6B B;  1U8R A;  4U87 A;  3K70 C;  2JJ7 A;  2A5Y B;  2H1K A;  4XBF A;  5EDN A;  4A0Z A;  2UXN A;  2ZSI B;  4BBS J;  2HZT A;  4NDL A;  2VJJ A;  4IO9 F;  1F5T A;  1MSF C;  5L3B A;  5E3N A;  2Z99 A;  4UB6 C;  2IEK A;  4DOZ A;  1IRX A;  4BXF A;  1ZQ3 P;  4KIC A;  3HGY A;  3HHH A;  4N9I A;  1J0R A;  3TOB A;  1ORK A;  5LEK A;  4XRM A;  1YHQ I;  1SD6 A;  3CMY A;  4EM1 A;  5DCM A;  1FYK A;  2DQL A;  4X0G A;  1MSE C;  2M7A A;  3VYS B;  2QVO A;  5TJJ A;  2ZNY A;  3OYB A;  3WTW C;  1IRF A;  3GTQ J;  1BC7 C;  4C2M J;  3KYD B;  1IV6 A;  5KNL A;  2A68 F;  2RN7 A;  3BG6 A;  2W4S A;  3BPX A;  1HA8 A;  3ABU A;  3ZN1 A;  4XLC A;  2DLL A;  2Y0M A;  3G2B A;  1XMX A;  2ME6 A;  2EA2 A;  1ON1 A;  2OZU A;  3DBH B;  2JSC A;  4ZDO A;  2EZI A;  2MSY A;  1ETX A;  1Q1H A;  1EA3 A;  2GWR A;  1IN5 A;  2LH9 A;  3WTT C;  4AM3 A;  3SZG A;  2YU3 A;  2LTP A;  1YG2 A;  1YJ9 I;  3H5A A;  4M72 A;  4BEH B;  4DBR A;  1X2M A;  3LA7 A;  1H9T A;  3V7S A;  2M1B A;  3U2R A;  4BAY A;  2PMZ A;  3MKW B;  3L2W A;  4BNC A;  1A6I A;  2R7R A;  1NK3 P;  1LKX A;  2DDA A;  3H92 A;  2QQ9 A;  4Y52 J;  3PSI A;  1T98 A;  1VF9 A;  1HST A;  1WJD A;  2WWY A;  3W2W A;  1T56 A;  3EUH C;  2VE8 A;  1A04 A;  2LYC A;  2V4J C;  3IHU A;  1LE8 B;  2DA1 A;  4HV6 A;  3WTZ A;  3GZ6 A;  3VYT B;  2KRC A;  3U21 A;  3FXO A;  1UG2 A;  5KAI C;  2COM A;  2OUM A;  3OIO A;  1CF7 B;  3JAM Z;  5CYV A;  1OKR A;  2ME0 A;  4GRI A;  1K4T A;  1BIA A;  3KEY A;  3FMQ A;  1FSE A;  2FU4 A;  2P4W A;  3OWT A;  3TW7 A;  4UUV A;  4KJZ A;  1SAU A;  1IRZ A;  5M5X J;  4EJU A;  3AKZ A;  1W36 C;  2P7V B;  2L9R A;  2CG4 A;  4LGW A;  4MLO A;  4PJN A;  2DJI A;  4XN3 A;  4RB2 C;  1RKT A;  1O7F A;  1ZGW A;  3RIR A;  3OS2 A;  3F23 A;  3CME I;  2DMP A;  4E7S A;  3W6K B;  5KHD A;  3BZK A;  3BG3 A;  2VN2 A;  2JT1 A;  2EA4 A;  5B1B H;  1XSX A;  3BPV A;  3BOQ A;  1FC3 A;  1FLI A;  2HDC A;  1R4M B;  1RET A;  2R7O A;  3FM5 A;  2R7U A;  4ZYH A;  4BQQ A;  1QZZ A;  4IKF A;  1W1W E;  3OR1 C;  1ETV A;  1XMK A;  1PUF A;  2WTE A;  5E1X A;  4HDV A;  3C18 A;  2M0C A;  2JWT A;  2BEO A;  2WAF A;  3OYK A;  1BI3 A;  3FXK A;  3B6C A;  2QM3 A;  3DEE A;  5FD6 A;  3GTG J;  3D1N I;  5CVU A;  1ZG1 A;  2HQR A;  1ZEL A;  4XID A;  4FIS A;  1S72 I;  2XB5 A;  3EPZ A;  3JAM K;  1MMG A;  1LB2 A;  1ZK8 A;  5J4Y A;  1IRG A;  1ZTR A;  3CC4 I;  1I1G A;  3IWZ A;  3ZMD A;  2XV4 S;  3VYR B;  4U7D A;  2HDD A;  3FMR A;  3ISP A;  3G71 I;  3FMS A;  3S3N A;  1S8N A;  4L9V A;  3BR5 A;  5GAG J;  2VPL A;  4BQA A;  1IN7 A;  5JHF A;  1U3E M;  2AQE A;  1R71 A;  3HRM A;  4LD5 A;  2H94 A;  2XRO A;  4LB5 A;  1NHA A;  1B9M A;  2V1N A;  1FMV A;  2L4A A;  3RPQ A;  1HW2 A;  2XB0 X;  3DCF A;  5BMZ A;  4I02 A;  3G4S I;  2DMQ A;  1HOM A;  5F1R A;  5IT3 A;  3HTU A;  4B47 A;  5L3C A;  1ZGJ A;  2VOO A;  2W82 A;  1XX5 A;  3CMA I;  1WFX A;  3HUG A;  3ZGK A;  4HAM A;  1YLF A;  2E1M C;  2OF7 A;  3I54 A;  5DCF A;  3E0J B;  2AXT C;  1OYY A;  2RNG A;  4A12 A;  2H8W A;  2Q2E B;  2EBI A;  1MD0 A;  3QRF F;  4C2T A;  2ACJ A;  3VFZ A;  2IPQ X;  2M8G X;  1TWG J;  5IY5 H;  2EH3 A;  3U9G A;  1DPU A;  3ZQG A;  1U9N A;  1PYV A;  3CZ6 A;  2CQN A;  3WTV C;  1UAA A;  4AIJ A;  2MG4 A;  1YW9 A;  4BS9 A;  1VQP I;  3W2V A;  2ZJR F;  4OIP F;  4LLG F;  2XSD C;  2HDW A;  4ENK A;  1N78 A;  4M3E A;  3CJR B;  4L5E A;  1AU7 A;  2Z2S B;  3DLL F;  4IHY A;  2R7F A;  1Y39 A;  2IRF G;  4HEA 2;  2VC0 A;  3CUQ C;  3NWT A;  3PQJ A;  2EZK A;  2V6C A;  2B63 J;  1ETQ A;  3QPT A;  4LJZ F;  4LOC A;  5M3M J;  1F4K A;  1TBX A;  3HPH A;  1ENH A;  1M1E B;  1JTX A;  2GQQ A;  4XM3 A;  4XLH A;  4IZZ A;  1OR7 C;  4HZF A;  4XKC A;  2OQG A;  1ZG5 A;  5J3L A;  2DOE A;  2DT7 B;  2FNP A;  4MFE A;  1X4O A;  2BOL A;  4ZYG A;  2K9S A;  2W25 A;  4BJ5 C;  2EIK H;  1NG6 A;  2OCC H;  3WHC A;  3IC7 A;  1XDU A;  1DUX C;  3ZQC A;  3GVA A;  2BVL A;  4OMZ A;  2Q8K A;  3TOA A;  3KP4 A;  1VND A;  2R7D A;  4AIH A;  5B1A H;  3FK6 A;  1OCP A;  1KQ0 A;  2NS8 A;  2H1L A;  2PQ8 A;  2XAS A;  3OYG A;  2BW3 A;  2WAQ A;  1HC8 A;  3LL7 A;  1Y8R B;  2QSF X;  2XGD A;  1QA6 A;  1Z3X A;  1WJA A;  1B4A A;  1RKW A;  1G4D A;  1XS9 A;  5IP7 J;  3D0S A;  4IF4 A;  3RKW A;  3AG3 H;  5BPI A;  1LEB A;  4BU2 A;  1LDK B;  4F7Z A;  3LOC A;  2HPI A;  5LGT A;  1BN5 A;  3CCM I;  1O3T A;  2BY2 A;  4AD9 A;  3KZZ A;  5EG0 A;  1GVJ A;  2ZFU A;  2EV6 A;  2QA4 I;  5HNF A;  3RKY A;  1IDZ A;  3LSR A;  1K78 B;  2QCO A;  3B73 A;  1I1S A;  2NOG A;  4AC0 A;  2XKP A;  5ILV A;  1PUE E;  2VBW A;  4IHV A;  2ELK A;  3ZPL A;  1I6H J;  1L0O C;  4PJM A;  2E34 A;  3BWG A;  3CUQ A;  4B3A A;  3GBG A;  1H88 C;  2JVH A;  2IA0 A;  5DM7 F;  1XGM A;  4CCO A;  1QVT A;  1BBY A;  1R00 A;  4UV9 A;  4KIT B;  3K2A A;  4KFC A;  2OCE A;  5IT9 K;  1NG7 A;  3ECO A;  3L2V A;  3HXL A;  3ABK H;  3LQQ A;  4RAG A;  1T38 A;  4P1W A;  3PJR A;  1JKR C;  4NB5 A;  2ETH A;  2HYG D;  3R6S A;  1DGR M;  1OJL A;  2K3P A;  4I0B A;  2MLG A;  4UXN A;  3KEQ A;  1OYI A;  2ZB9 A;  1WI3 A;  3HZJ A;  1S5L C;  5DDG A;  4DZP A;  1JUS A;  5F0H A;  2GZW A;  5GTH C;  1BOA A;  2E36 A;  3VOD A;  2CV2 A;  3J7Y J;  4LFU A;  5CQE A;  2FNA A;  2QYO A;  1VTN C;  1UG0 A;  2KIM A;  4MEY F;  4PCQ A;  1LNW A;  2DA7 A;  2VKH A;  3OYJ A;  4KIB A;  5FKN A;  4A3B J;  2CW8 A;  4UVC A;  1GLN A; 
#chains in the Genus database with same CATH homology
 2FMY A;  2F2E A;  3BZ6 A;  5ICG A;  4JQF A;  1Z7U A;  2MBF A;  2HTS A;  1O57 A;  1B9N A;  2D45 A;  3P9C A;  3HSR A;  2C6Y A;  4E70 A;  4HLY A;  3MZH A;  5J6X A;  4G6Q A;  5HLH A;  1HKS A;  3P9I A;  2J5O A;  4PGH A;  1K79 A;  2ESN A;  3HYI A;  3GX4 X;  4OIR F;  3CJN A;  3J7A O;  4CYD A;  2AS5 F;  4IRI A;  3MFK A;  4EJT A;  1XSV A;  4M71 A;  2XAQ A;  1I6X A;  3REO A;  4ASN A;  1RNL A;  3CTA A;  1WI9 A;  1PP7 U;  4P9U A;  3F8C A;  1YQA A;  2PEX A;  1LDJ A;  2V9V A;  4KIF A;  4BHB A;  3LAJ A;  1P6R A;  4OOI A;  2DQR A;  5JR3 A;  4HDU A;  3F8M A;  3QAH A;  1F1Z A;  5K5Q A;  4HYE A;  3L00 A;  1PDN C;  5A2Q K;  2M30 A;  2PG4 A;  5JI6 A;  1K78 A;  1I27 A;  2DU9 A;  2IT0 A;  2R3S A;  3BP8 A;  2HFH A;  2WC2 A;  1KYW A;  3OOP A;  1ZRC A;  3TO7 A;  4HF0 A;  3O2P E;  3COA C;  4IXA A;  2BE5 F;  5DUK A;  5FD5 A;  2VOP A;  5HLI A;  2ZNZ A;  1WQ2 A;  3RPU A;  4IHT A;  1LEA A;  4UVA A;  4WK8 F;  3M8E A;  1TTY A;  1U6G A;  1TQM A;  4UHT A;  1UHW A;  5LHH A;  4EJW A;  2AXL A;  2V1U A;  2VXZ A;  1UCR A;  4KNY A;  1O3S A;  3M1E A;  2PMU A;  1B1B A;  2EFN A;  1H9G A;  1WKM A;  5IT9 Z;  4L0Y B;  2Q2E A;  1EV7 A;  2HKX A;  1XGN A;  1IXS B;  1XD7 A;  2V1D A;  2GAU A;  4IJA A;  5D5W B;  3LA2 A;  1R58 A;  3VOE A;  1BIB A;  3L2C A;  3KZY A;  4AVP A;  1IW7 F;  1BM9 A;  2BGC A;  2ISZ A;  3DPL C;  2XAH A;  2P8T A;  4KN7 X;  4WX9 A;  4PGG A;  5HOO A;  1TNS A;  2DBB A;  1V4R A;  5H20 A;  1J2X A;  4ESF A;  1YO5 C;  5ILS A;  2XUB A;  1LDD A;  3JW4 A;  2W57 A;  2GXG A;  1U5T B;  3MQ0 A;  2O61 A;  4UV8 A;  3LQR A;  1ZRE A;  1T2K A;  2HKO A;  2Q0O A;  5DD4 A;  3DEU A;  2GIV A;  4M9S A;  3FXR A;  3GFJ A;  3V7R A;  2G7U A;  3HIF A;  1PP8 F;  3Q9V A;  4U0V A;  3DXJ F;  4WXD A;  4Y17 A;  1BJA A;  4MHG A;  3B02 A;  1S6L A;  3W6J B;  1J9I A;  3F8F A;  3QP5 A;  5LHI A;  1OR7 A;  3V7C A;  2IJL A;  1AOY A;  2XIG A;  3E6B A;  5LLQ A;  1E17 A;  4M6Y A;  5D5X B;  4A2U A;  1D8K A;  4RGS A;  5LBQ A;  4HX7 A;  3I4P A;  3MAJ A;  4L0Z B;  1TQI A;  2DTR A;  3KEO A;  1G3T A;  3GEZ A;  4MEX F;  5BPD A;  3F3X A;  1UB9 A;  1SMY F;  4YIF A;  4HV5 A;  4S04 A;  2ZBK A;  5E18 F;  3HSE A;  4BYY A;  1D5V A;  4KT5 C;  4MNU A;  5BOX A;  4RGR A;  4R79 A;  2HEO A;  4A0Y A;  1H0M A;  2HYF A;  1P4A A;  3RJP A;  4Q47 A;  1SFE A;  4Y15 A;  3WGG A;  5ICF A;  2QQA A;  1J7K A;  4IVN A;  1FBU A;  3KLO A;  4G7H F;  1Z6R A;  1UHM A;  2QUF A;  1TW2 A;  4D0P A;  3I0T A;  1SAX A;  2A3S A;  4A6E A;  1QGP A;  4NHJ A;  3HOT A;  2KJC A;  3GYH X;  3C7J A;  1ODD A;  3MZY A;  1ULY A;  1ZN2 A;  1UST A;  1FSH A;  2E1C A;  1REP C;  4HA8 A;  1MZB A;  1KQ9 A;  1B6A A;  2VOD A;  2OA4 A;  3U1D A;  1MJA A;  4M9Z A;  2DW4 A;  2QLZ A;  2DI3 A;  3ML6 A;  1XDS A;  4FX4 A;  5L3G A;  3NEU A;  2FEZ A;  1L3L A;  2Y75 A;  2K7L A;  1CGP A;  2HOE A;  5LGN A;  2QBY B;  1O3R A;  2YSR A;  4YFX F;  5AON A;  1JGS A;  3I58 A;  4EQQ A;  5J8C A;  1P4W A;  5HVQ C;  4KMF A;  4O6J A;  4WF2 A;  1Z6T A;  3IWF A;  4EM2 A;  2W84 A;  2V1X A;  2ZJ2 A;  4WWC A;  1P92 A;  3JSO A;  3CUO A;  2E7X A;  4IHS A;  4I7H A;  1W5S A;  1F9N A;  3HSF A;  2D2W A;  1ZAO A;  5K1Y A;  5JVT A;  2E1N A;  2P5V A;  2NNN A;  1D3Y A;  3LWF A;  3EET A;  4LG0 A;  2LF8 A;  5KK1 A;  2P7C B;  4DNC A;  2STW A;  2FXA A;  1U2W A;  1GHC A;  2MC3 A;  3SXY A;  2FA5 A;  1TW3 A;  2QEN A;  2MLK A;  4M73 A;  3KCC A;  3M9A A;  4OIO F;  1S7A A;  2RC4 A;  3E6D A;  2ZKZ A;  1HKT A;  5E20 A;  1U78 A;  1FY7 A;  2EB7 A;  3E5Q A;  3RYR A;  2IP2 A;  1SMT A;  4LK1 F;  3RTR A;  1Y0U A;  4ZH4 F;  1R1U A;  2PMH A;  5AIP A;  4JK1 X;  2P6T A;  5LRR A;  4ETS A;  1TNT A;  5DUI A;  4EGY A;  4L18 B;  1QPM A;  1RIO H;  1ZG3 A;  1E2X A;  4CGZ A;  3TDZ C;  4KN4 X;  4FT8 A;  1ZYR F;  5D5U B;  4PZJ A;  2CFX A;  5L3E A;  1U5T A;  3AAF A;  1EH6 A;  4K2E A;  3TGN A;  2QBY A;  4CZZ A;  1R1T A;  3QOP A;  2L01 A;  1XGS A;  4GYI A;  1YW7 A;  3J81 K;  4EV0 A;  3JSP A;  2HS5 A;  2XAJ A;  1T6S A;  2IA1 A;  2A6E F;  4B8X A;  4QWQ A;  4LB6 B;  1RUN A;  3IKT A;  3SQN A;  2PN6 A;  2O0Y A;  5D8L B;  2EV5 A;  4MTE A;  4HF1 A;  1KGS A;  1J59 A;  4G7O F;  5CVI A;  2HWV A;  4G8X A;  3TO6 A;  1KU9 A;  1HW5 A;  2TDX A;  4M74 A;  4XLP F;  3MCZ A;  3VEP A;  4UNO A;  5HS7 A;  3BJO A;  3FX3 A;  3R4K A;  1RUO A;  2G7H A;  4R1H A;  2MH9 A;  1LJ9 A;  2DT5 A;  4LK0 F;  5FGM A;  1ZAR A;  2LNB A;  2F5F A;  1Z05 A;  3T5X A;  4KYW A;  3F22 A;  1XN7 A;  5KVR A;  1XB4 A;  4HW0 A;  2VT3 A;  2PFB A;  5FLX K;  4UVB A;  2XRN A;  1SD4 A;  1KYZ A;  4HF2 A;  4GGG A;  4P9F A;  1D8J A;  2EFO A;  3V4G A;  1JE8 A;  3EYI A;  3K2Z A;  3KET A;  1OMI A;  1YFH A;  3I64 A;  5HDG A;  3LAP A;  1SD7 A;  4ZZL A;  3WTY C;  2VT2 A;  1BI0 A;  2FF4 A;  3L09 A;  3K0L A;  2MA3 A;  2PBI A;  2FBI A;  5D8K B;  2FE3 A;  2RKH A;  4EVI A;  4P55 A;  1FBS A;  4NQW A;  3ZMV A;  2E7W A;  5LHG A;  3LFK A;  1EH7 A;  2RQP A;  3SZP A;  4WXH A;  4BXU A;  2PJP A;  2VBY A;  2XVC A;  3J80 K;  1HQC A;  3DPT A;  2F5E A;  3KP5 A;  1IXC A;  1DDN A;  1STZ A;  3NRV A;  2P6S A;  2FRH A;  3RYP A;  3G73 A;  2CO5 A;  2UWM A;  2A61 A;  2KJB A;  1YW8 A;  2HTJ A;  1EH8 A;  4EJO A;  5L3F A;  4RB0 A;  4CDG A;  3RKX A;  4YFK F;  3ZN0 A;  2H27 A;  1IZ1 A;  3GLX A;  1IXR C;  4I01 A;  1W5T A;  3WU0 A;  2DK8 A;  3F6O A;  3PQK A;  3GF2 A;  1HKQ A;  4A5N A;  3GFI A;  5HDN A;  1GXP A;  4N0B A;  4FX0 A;  3ZQ7 A;  4CIC A;  5HLG A;  3N4M A;  2CGP A;  2LDU A;  1BI1 A;  1J5Y A;  2ZME B;  3J80 Z;  1JXS A;  3FWE A;  2CW0 F;  2KIF A;  3EQL F;  4M6X A;  4G94 A;  1AWC A;  3N97 A;  2O3F A;  1YS6 A;  3DQV C;  2K4B A;  1XMA A;  2M87 A;  3K1P A;  3T0Y A;  2MD5 A;  5DCM B;  5FO5 A;  2L54 A;  5E8I A;  1G3W A;  2CSO A;  4XRF A;  4Q4Z F;  3GWZ A;  2EK5 A;  1WWX A;  5ILU A;  2FOK A;  2LKP A;  3ECH A;  3QU3 A;  1FX7 A;  2MH2 A;  3TDU C;  3ULQ B;  4DQ2 A;  2JPC A;  2RNJ A;  3MEX A;  4LMY A;  2EV0 A;  4PDK A;  2VBX A;  5L3D A;  1ZRD A;  2OD5 A;  4U0W A;  3HTS B;  4AWX B;  3CLO A;  4ESJ A;  3IRR A;  4OIQ F;  5ICE A;  3O3K A;  1Z9C A;  3HRS A;  4H0E A;  4KIG A;  1XGO A;  2A6H F;  1R23 A;  3TKY A;  1R1V A;  1G3Y A;  2FBK A;  2NRA C;  4Z2Y A;  4ZZD A;  3GO5 A;  3T8T A;  5FB2 A;  3R0J A;  1O7L A;  3DFG A;  2D1H A;  2OU2 A;  2RGV A;  1ONV A;  3F8N A;  3H3U A;  5DEQ A;  2ZME A;  1ZRF A;  3KP7 A;  4HLX A;  5CVR A;  4ESB A;  3DV8 A;  3M7G A;  4B09 A;  4I98 B;  3WE3 A;  1SFX A;  5FFX A;  2EFP A;  1HSJ A;  5D5V B;  2A69 F;  2H6B A;  2CYY A;  5K5O A;  3J81 Z;  2P5K A;  2ZXJ A;  3EUH A;  5HDK A;  2B0L A;  4IRG A;  2Z5U A;  4EGZ A;  3GFM A;  3KP3 A;  5CVJ A;  2DPD A;  1IN8 A;  1R36 A;  1MKM A;  2L3D A;  2W85 A;  2NNY A;  1RI7 A;  2Z9O A;  2VC1 A;  1V3F A;  4HX8 A;  3PFI A;  2KRF A;  1T39 A;  1GXQ A;  3G3Z A;  2ESH A;  3DP7 A;  4RGU A;  2BV6 A;  2DAO A;  5EEH A;  4IRH A;  4YG2 F;  4EM0 B;  4G7Z F;  4M9X A;  1SFU A;  1ON2 A;  2L4M A;  4LG0 B;  4L5J A;  2QQB A;  2IW5 A;  1YIO A;  5E17 F;  2YPR A;  3GZ5 A;  2DK5 A;  4ON0 A;  2CQK A;  4Q48 A;  1X3U A;  4P5O A;  2YX4 A;  3P7N A;  3VB2 A;  2XAG A;  5E1W A;  4Y13 A;  4U88 A;  2RDP A;  4OMY A;  4IPA A;  1WRJ A;  4RAZ A;  6PAX A;  4ENN A;  4RB3 C;  1WSU A;  3E3V A;  2K86 A;  1FP2 A;  4EJV A;  3WU1 B;  1R5G A;  3HHG A;  3F72 A;  1OYW A;  4I09 A;  4BHP A;  2BYV E;  3ZMT A;  4MQ9 F;  3GUD A;  2IA2 A;  4JBA A;  3CDH A;  2XGX A;  1FZP B;  1FNN A;  2FSW A;  1G6N A;  1RZ4 A;  3V8K A;  1XCB A;  4L9N A;  5ED4 A;  2ISY A;  1U5T C;  1T0F A;  4HQE A;  4CXF A;  3K9T A;  5CLS A;  1IN4 A;  3FF5 A;  3I71 A;  3F6V A;  2JZY A;  2FQ3 A;  4GYG A;  3K1N A;  1JHH A;  3FHZ A;  5LEJ A;  5FFZ A;  2H09 A;  4RAY A;  3RI4 A;  4N9H A;  2EWN A;  5HS8 A;  5EEG A;  4G9Y A;  4ZYE A;  1S29 A;  3SZT A;  2PLY A;  1IF1 A;  1W4M A;  3I59 A;  5FLX Z;  3FXQ A;  2M8E A;  3SFZ A;  1KQ8 A;  1SD5 A;  1R7J A;  3JTG A;  4P96 A;  3WTU C;  3R61 A;  1R22 A;  4ENM A;  1FT9 A;  1K6O A;  1FPQ A;  5DV5 A;  1W7P B;  2CWE A;  2X0L A;  2XHK A;  3KP2 A;  2KKO A;  1MGT A;  2VBZ A;  4MQV A;  4YFN F;  4MGR A;  2UXX A;  3GXO A;  1TLH B;  3LST A;  5F6F A;  3BRO A;  2UZK A;  2J5P A;  1FYM A;  2OZ6 A;  4U0Y A;  3HRU A;  3SHF A;  5E1Z B;  3QP6 A;  1Z91 A;  1QO0 D;  4A0X A;  3E6M A;  3BJ6 A;  4FHT A;  3E97 A;  1QBJ A;  2STT A;  1G3S A;  4EMS A;  2PI0 A;  3IL2 A;  3KLN A;  2GA2 A;  1CF7 A;  3DF8 A;  5BS6 A;  3ZMS A;  1IUY A;  4XLN F;  3ZMU A;  2ZCW A;  2F5D A;  2VON A;  1DP7 P;  3KE2 A;  5JFR A;  1HBX G;  1P2F A;  2A07 F;  3BJA A;  4KUM A;  2NS0 A;  4A6D A;  3I53 A;  5LRS A;  3QPH A;  3EDP A;  5F64 A;  2OQR A;  3I5U A;  2DO7 A;  1YTY A;  2Z3Y A;  5TRD A;  2NAZ A;  5D6F A;  3ABT A;  2KIU A;  2HGC A;  2OAZ A;  3DKW A;  1S3J A;  4O3M A;  3L7W A;  4ZYD A;  2DPU A;  2K27 A;  4GCV A;  4KMU X;  3BDD A;  1R5H A;  2ADU A;  4U7B A;  1LVA A;  1ZGA A;  2RVC A;  2JPB A;  4O5V A;  2XAF A;  4GXO A;  5ERI A;  3GW2 A;  5BQT A;  3KFW X;  1QNT A;  3M8F A;  4G6D A;  4MTD A;  3H3Z A;  3FZV A;  5H6R A;  4AIK A;  2M5W A;  4CHU A;  1YS7 A;  3P9K A;  1QZY A;  1HXD A;  2YR2 A;  3E5U A;  1ZH5 A;  4OIN F;  2O8X A;  1C0W A;  4S05 A;  1BC8 C;  3R60 A;  1BI2 A;  5LGU A;  2EJR A;  3Q9S A;  4HX4 A;  4CO8 A;  2GA1 A;  2JRT A;  2K02 A;  3IRQ A;  4ENJ A;  4L5I A;  2Y48 A;  5D4S A;  4R8H A;  2HQN A;  1KU2 A;  1S7O A;  1IAW A;  2O6G E;  1FP1 D;  4YII A;  1J75 A;  3T1B A;  3K69 A;  4L9T A;  4OU0 A;  4HOB A;  1USS A;  1ZLK A;  3IKV A;  3R0A A;  2JTV A;  5JHU A;  1JHF A;  4I0A A;  1OPC A;  1YYV A;  2W24 A;  5CVV A;  5HS9 A;  4KA4 A;  1DPR A;  2DFI A;  3F21 A;  2NYX A;  2YX7 A;  3F8B A;  5D4R A;  2P5L C;  1ZLJ A;  3FM3 A;  5A2Q Z;  3V8L A;  3C1D A;  1KU3 A;  2RV8 A;  1ZHF A;  3WG9 A;  3WOD F;  1HW1 A;  1QQI A;  2BBY A;  4L9J A;  2X4H A;  4RB1 A;  4XSZ F;  1O3Q A;  3D5L A;  3WTS C;  4HQM A;  5CJ9 A;  3FXU A;  1I5Z A;  1UFM A;  2QWW A;  1XCV A;  3CUQ B;  5DD8 A;  1W7P D;  4RGX A;  5J8F A;  3ROU A;  1W7P A;  2L02 A;  4KDP A;  1MJB A;  3C3W A;  4Q5S F;  1B59 A;  2HR3 A;  3TQN A;  2QZ8 A;  4BH9 A;  2ZFW A;  3ZP5 A;  2FBH A;  3QU6 A;  4HBL A;  3I59 B;  2O03 A;  1K7A A;  4LLN A;  3NQO A;  3MWM A;  1FBQ A;  2EFQ A;  1XSD A;  2FML A;  3CO7 C;  4TV7 A;  5DYM A;  2LSO A;  2XKO A;  5ICC A;  1FWZ A;  3GFL A;  1TQP A;  1MDM B;  2ELH A;  4A5M A;  3CO6 C;  2OBP A;  2Z33 A;  1FYL A;  1FOK A;  4WCG A;  3Q5F A;  2VE9 A;  5D6E A;  3WTX C;  2V79 A;  3E5X A;  3HRT A;  4RS8 A;  3BY6 A;  1KU7 A;  2ZO4 A;  3RDI A;  3OV8 A;  1P4X A;  1KA8 A;  3WGI A;  1Z1D A;  2EFW A;  3WGH A;  2H6C A;  3L9F A;  2F5C A;  2IVM A;  3S2W A;  4XSX F;  3TO9 A;  3T8R A;  2D1V A;  3ZMZ A;  3KP6 A;  1LQ1 A;  4BHC A;  1MDM A;  2WV0 A;  4WXC A;  5H6Q A;  4I2O A;  3WE2 A;  4QLC U;  3EYY A;  1MJ9 A;  3E6C C;  3V8J A;  5AIQ A;  4LLL A;  3LA3 A;  5E8G A;  4GO1 A;  2K4J A;  1IN6 A;  3ERE D;  2G9W A;  3ELK A;  2GXB A;  2LF7 A;  3HOS A;  5K5R A;  3K1M A;  2M45 A;  3JTH A;  3O6B B;  1U8R A;  2A5Y B;  4XBF A;  4A0Z A;  2UXN A;  2HZT A;  1F5T A;  5L3B A;  2Z99 A;  4KIC A;  3HHH A;  4N9I A;  1J0R A;  3TOB A;  5LEK A;  1SD6 A;  4EM1 A;  5DCM A;  1FYK A;  2DQL A;  2QVO A;  5TJJ A;  2ZNY A;  3WTW C;  1IRF A;  1BC7 C;  2A68 F;  2RN7 A;  3BPX A;  3ABU A;  3ZN1 A;  2DLL A;  2Y0M A;  2EA2 A;  1ON1 A;  2OZU A;  2JSC A;  1Q1H A;  2GWR A;  1IN5 A;  3WTT C;  2YU3 A;  1YG2 A;  4M72 A;  3LA7 A;  1H9T A;  3V7S A;  2M1B A;  3U2R A;  4BNC A;  4BAY A;  3H92 A;  2QQ9 A;  1T98 A;  1HST A;  2WWY A;  2VE8 A;  1A04 A;  3IHU A;  4HV6 A;  3WTZ A;  3GZ6 A;  2COM A;  1CF7 B;  3JAM Z;  5CYV A;  1OKR A;  1BIA A;  3FMQ A;  1FSE A;  2FU4 A;  2P4W A;  4UUV A;  4EJU A;  2P7V B;  2CG4 A;  4LGW A;  4RB2 C;  1O7F A;  3RIR A;  3F23 A;  3W6K B;  2VN2 A;  2JT1 A;  2EA4 A;  1XSX A;  3BPV A;  3BOQ A;  1FC3 A;  1FLI A;  2HDC A;  3FM5 A;  4ZYH A;  1QZZ A;  1XMK A;  2WTE A;  5E1X A;  4HDV A;  3C18 A;  2BEO A;  1BI3 A;  2QM3 A;  5FD6 A;  5CVU A;  1ZG1 A;  2HQR A;  3JAM K;  1LB2 A;  1IRG A;  1I1G A;  3IWZ A;  3ZMD A;  2XV4 S;  4U7D A;  3FMR A;  3ISP A;  3FMS A;  1S8N A;  4L9V A;  4BQA A;  1IN7 A;  1U3E M;  3HRM A;  4LD5 A;  2H94 A;  2XRO A;  4LB5 A;  1NHA A;  1B9M A;  2L4A A;  3RPQ A;  1HW2 A;  5BMZ A;  4I02 A;  5F1R A;  5IT3 A;  3HTU A;  5L3C A;  1ZGJ A;  2VOO A;  3HUG A;  4HAM A;  1YLF A;  5DCF A;  3I54 A;  1OYY A;  4A12 A;  1MD0 A;  3QRF F;  2ACJ A;  3VFZ A;  2IPQ X;  3U9G A;  1DPU A;  3WTV C;  4AIJ A;  1YW9 A;  4OIP F;  4LLG F;  4ENK A;  2R7F A;  2IRF G;  2VC0 A;  3CUQ C;  3PQJ A;  2V6C A;  3QPT A;  4LJZ F;  1F4K A;  1TBX A;  2GQQ A;  4HZF A;  2OQG A;  1ZG5 A;  2FNP A;  4ZYG A;  2W25 A;  3IC7 A;  1XDU A;  1DUX C;  3GVA A;  4OMZ A;  2Q8K A;  3TOA A;  3KP4 A;  2R7D A;  4AIH A;  1KQ0 A;  2PQ8 A;  2XAS A;  1B4A A;  1G4D A;  3D0S A;  4IF4 A;  3RKW A;  5BPI A;  1LEB A;  1LDK B;  4F7Z A;  5LGT A;  1BN5 A;  1O3T A;  4AD9 A;  3KZZ A;  1GVJ A;  2EV6 A;  3RKY A;  1K78 B;  3B73 A;  1I1S A;  2XKP A;  5ILV A;  1PUE E;  2VBW A;  3ZPL A;  1L0O C;  3BWG A;  3CUQ A;  2IA0 A;  1XGM A;  1BBY A;  1R00 A;  4UV9 A;  4KFC A;  5IT9 K;  3ECO A;  3LQQ A;  1T38 A;  4NB5 A;  2ETH A;  2HYG D;  3R6S A;  4I0B A;  2MLG A;  4UXN A;  3KEQ A;  1OYI A;  5DDG A;  2GZW A;  1BOA A;  3VOD A;  4LFU A;  2FNA A;  2QYO A;  1VTN C;  2KIM A;  4MEY F;  4PCQ A;  1LNW A;  4KIB A;  4UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...