1ZLJA

Crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
DPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dormancy Survival Regulator
publication title Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 23
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zljA00
4O5VA 1IF1A 4OIPF 2EFQA 4WWCA 3F72A 3IKVA 3K2ZA 1FNNA 3WTXC 4OMYA 2HYGD 1YTYA 2KIMA 2ZFWA 3L09A 5HDNA 3MWMA 1G3SA 3KFWX 5E18F 4MEXF 2FBIA 4UVAA 4PZJA 4MHGA 3F8MA 5H20A 2HKOA 1IXRC 3WTUC 4Q47A 4MEYF 2L54A 2OQRA 4P96A 1T6SA 5CVIA 2DBBA 3IC7A 2NNNA 3WTTC 4L5IA 2JPCA 3O6BB 3D0SA 5LEJA 1BJAA 1F5TA 1H0MA 1G3TA 1XDUA 2FA5A 1EH7A 5L3FA 2WTEA 1KU9A 1YYVA 4ESJA 2W84A 3EQLF 4CDGA 2VBYA 4A5MA 1X3UA 1SD6A 2DK8A 2A61A 3FMSA 4U0VA 2XASA 4R1HA 1Q1HA 5IT9K 5DUIA 5CVRA 3IWZA 4ENMA 1R1VA 3FXQA 2Y75A 2OZUA 4WX9A 1OYWA 2CSOA 1G3YA 1BI3A 1Z9CA 3TQNA 3HRMA 4L0ZB 3ZP5A 5D5XB 1IZ1A 2Z5UA 2ESHA 3TO7A 1EV7A 4BNCA 2KIFA 1MD0A 3BJAA 2EFWA 3FMRA 1K79A 5ICEA 3RJPA 1J5YA 3SZTA 5L3EA 1B4AA 1V3FA 4ZYEA 4RB0A 1SD7A 3LQQA 3EUHA 3T8TA 2G7HA 1MDMA 3G73A 4EJOA 4M9SA 3GFJA 2GXGA 3DKWA 3VFZA 5E1WA 1TNSA 2HDCA 3J7AO 1P92A 4WXHA 2A3SA 1LB2A 4HQEA 2Z99A 5D5VB 3ZMUA 5IT3A 1SD5A 2G9WA 1AOYA 2VXZA 3GLXA 2F5EA 3TDUC 3N4MA 4HX8A 3ROUA 1KGSA 3K9TA 1I6XA 1CGPA 4IVNA 3J80Z 1ZLJA 5FFZA 4M9XA 4LMYA 4GCVA 3I4PA 1BM9A 4BHPA 4OIQF 2EV6A 3RPUA 1ZRCA 4PCQA 4KA4A 3KEOA 5A2QZ 2MA3A 3FF5A 4GXOA 1YW7A 4K2EA 4CYDA 1R00A 3JAMZ 5E8IA 5BQTA 3RIRA 1K6OA 3H3ZA 5DCFA 3KLOA 1WRJA 2VODA 4EM0B 1O3SA 2RV8A 2L3DA 5KK1A 4HX4A 4WCGA 2ELHA 1VTNC 3M1EA 5D5WB 2JSCA 2P7VB 3RKYA 4YFKF 4IF4A 4RB1A 4ZYHA 3GW2A 1P2FA 1TLHB 3HSRA 4HLYA 3WTWC 4G6QA 2OD5A 4FHTA 1ZG1A 3FWEA 3QP6A 1W7PA 5JFRA 2XAJA 1YW9A 1BI1A 4BYYA 2X0LA 3R4KA 2H6BA 4L9JA 3T8RA 1FSHA 4A5NA 3E5UA 4LLNA 3TGNA 5D6FA 2HQNA 1MGTA 3ZMVA 2IP2A 2JTVA 3ABUA 5LHHA 1J0RA 2O03A 2IPQX 3E3VA 2EFPA 2ISYA 4TV7A 2ZO4A 1QQIA 4HA8A 4LB5A 1BIAA 4I2OA 2EWNA 1L3LA 4KN4X 3VODA 4OU0A 5A2QK 4KDPA 1FBUA 4KYWA 4XSXF 3JAMK 4IRIA 2BBYA 5LHGA 2P5KA 1ZLKA 1U5TA 1UCRA 3MAJA 2HS5A 3FMQA 2VBXA 4IRGA 2VE8A 2D1HA 4EJWA 3F8CA 3I59A 5HLGA 1WI9A 1DUXC 2K4BA 3QP5A 1EH6A 3HRTA 3MCZA 2PLYA 5CJ9A 3CUOA 1OKRA 3HYIA 2XKOA 3SXYA 3Q9SA 2EK5A 3JW4A 1YG2A 2A69F 2A6HF 4ENKA 2FEZA 3NQOA 1FC3A 1I5ZA 2NS0A 2RDPA 4YFNF 2NAZA 1ZARA 2IA2A 3NEUA 1R22A 2Q0OA 3VB2A 2DAOA 3DPLC 2CG4A 3D5LA 3CDHA 2HQRA 1Z1DA 2JRTA 1QO0D 2VN2A 1WSUA 4EJTA 1WKMA 5F64A 3V4GA 5ERIA 1SFUA 2YU3A 1MJ9A 2O0YA 1XB4A 5HVQC 1CF7B 3FXUA 3GF2A 2LSOA 4RGXA 1KYZA 2FXAA 4L9VA 4DQ2A 2IRFG 2W57A 4ON0A 4HYEA 1JE8A 1B9MA 2QENA 3C3WA 2YX7A 2NRAC 4ZYGA 2O6GE 3I58A 5FFXA 1U6GA 2A6EF 1STZA 4JK1X 1ZHFA 3HIFA 3KP5A 1FBQA 3MFKA 4LLGF 4KT5C 2EFOA 4ASNA 3DQVC 2HGCA 4EQQA 2QBYB 2H6CA 2L4AA 1Z6TA 2VT3A 3EYYA 1HW2A 5TJJA 3BZ6A 1LDDA 4Q4ZF 3ZMDA 1SFXA 1Y0UA 1IN8A 1TBXA 5KVRA 3E6CC 2YR2A 1FY7A 4BAYA 5AONA 1S3JA 2Y0MA 2ZCWA 4IJAA 2FMYA 2PQ8A 2IJLA 1KQ0A 1KQ8A 2UXNA 1MZBA 2GWRA 4UVCA 6PAXA 1MJBA 4RGSA 1HBXG 2MLKA 1R1UA 5ICCA 4EJVA 5L3BA 1JHHA 2M1BA 2IT0A 4N0BA 4Y17A 2FRHA 4G7ZF 3U2RA 4KIBA 4A2UA 1ZYRF 1A04A 1F1ZA 4GGGA 1S7AA 3R60A 1QZYA 2ZNYA 4HW0A 3ZN1A 1TTYA 1LEBA 2EV0A 1F4KA 2K4JA 3BP8A 1RZ4A 2MH9A 5CVJA 5TRDA 3WU1B 2V1XA 3LWFA 1ZREA 1FYLA 1HSTA 3JTGA 1I1GA 2IA0A 4CXFA 2OAZA 4ETSA 4NHJA 2H09A 3M7GA 2MLGA 2JZYA 5D4SA 3F8FA 4UV8A 4I0AA 1PP8F 4E70A 4G8XA 2DPDA 2EJRA 4FX0A 2DO7A 1B9NA 2P7CB 2FF4A 2XAGA 3REOA 1PDNC 2HKXA 5CVUA 1YFHA 4LGWA 2IA1A 4NB5A 3ABTA 1KU3A 3GZ6A 3WE3A 5L3GA 4O3MA 2P5LC 2A68F 2R7DA 4U7DA 3C1DA 1HQCA 4LG0B 3K1NA 1WWXA 4CO8A 1U2WA 5L3CA 5D5UB 5ICFA 4G6DA 3GWZA 2CFXA 1FOKA 5HLIA 2M45A 2QQAA 2F5DA 4RB3C 1B1BA 2RC4A 5D6EA 2JT1A 4ZZDA 3V7CA 3BY6A 2DFIA 4I09A 3WE2A 5HS9A 4GO1A 5LGNA 2RQPA 5DV5A 1V4RA 2XRNA 2WC2A 2Q8KA 1B6AA 4AWXB 2W25A 1Z7UA 4RAYA 3KZYA 4ZYDA 4I98B 2CO5A 2VE9A 4P55A 1O3QA 2K86A 1H9TA 3CJNA 1MKMA 2HOEA 3IKTA 3KP3A 1BN5A 4QLCU 1PP7U 2L01A 5ILUA 1ON2A 3ZMTA 3WTZA 5FGMA 5DEQA 4CHUA 3MEXA 4G7OF 2XUBA 2KIUA 1TQPA 4R8HA 1UB9A 4ESBA 2H94A 4QWQA 5JR3A 3E5XA 2A5YB 4Q48A 2XVCA 2TDXA 3V8LA 3ELKA 4UHTA 3DPTA 2L02A 3HUGA 3ULQB 1R1TA 3CLOA 3QU3A 3HHHA 4Y15A 5D8LB 2KRFA 1LQ1A 4I0BA 2QM3A 2Y48A 1F9NA 4PGHA 4WXDA 5HDGA 4MGRA 4S04A 4EVIA 1S6LA 4B8XA 3QU6A 5LLQA 1Z91A 2GXBA 2D2WA 3V7SA 3VEPA 3LSTA 5E1ZB 3I64A 4G94A 3DV8A 4EJUA 2K27A 4M74A 3ZMZA 1J59A 5FD5A 4PDKA 1HKTA 2Z3YA 2BGCA 3I71A 3LAPA 1FWZA 2V79A 3QPHA 3KP6A 2DU9A 1KYWA 3MZYA 1IN4A 3K1PA 4CGZA 3I5UA 5DD4A 4MQVA 2Q2EA 2UZKA 3GVAA 1YQAA 4UUVA 3EDPA 3KP2A 3J81Z 2HFHA 2ZMEB 1IUYA 4GYIA 1XN7A 3RDIA 1ZAOA 2FNPA 1GHCA 2GA2A 3DP7A 4A6DA 3E6BA 1ODDA 1HKQA 4ZZLA 1T39A 2HYFA 1IRGA 3BPXA 4AVPA 2DTRA 3K69A 2PEXA 1WQ2A 1FZPB 5LGTA 3RYPA 2GZWA 4A0YA 1SFEA 2HWVA 3L7WA 3F23A 1G3WA 5HOOA 2ZKZA 5L3DA 5BPIA 1J9IA 2GQQA 2E1CA 1ZGAA 4XBFA 2OU2A 5LRSA 2HR3A 2VC1A 3F3XA 5AIPA 2MH2A 5HS8A 3P9CA 3WG9A 1T2KA 3J80K 3I53A 1K78B 1QGPA 2XAFA 3HSFA 4N9HA 2FOKA 2QLZA 3GO5A 3T5XA 2LNBA 5EEGA 4RB2C 3NRVA 5DDGA 3TOBA 2KJCA 3RYRA 2IW5A 4WF2A 3J81K 5K5RA 3GX4X 4KN7X 3QOPA 2M8EA 1FT9A 3ZN0A 3WGIA 2XGXA 3KE2A 3C18A 1SMYF 1T98A 2FBKA 3HRSA 1CF7A 3IRRA 5H6QA 1P4WA 4M73A 4RGRA 3F21A 4YIIA 2ZBKA 1IXCA 2J5OA 2DQLA 2HTJA 2RKHA 2PG4A 1Z6RA 4I7HA 5F1RA 1W5SA 2ETHA 3N97A 1YIOA 4KIGA 3IWFA 3IHUA 4LK1F 3W6JB 4YG2F 5ICGA 1ZGJA 3V8JA 1KU2A 4HF0A 3GYHX 5E20A 3L2CA 1BOAA 4LD5A 2QBYA 4L18B 1OMIA 2CQKA 1QNTA 2E1NA 4R79A 3OOPA 3H3UA 1ZH5A 4XLPF 4IPAA 3WTYC 3F22A 3ML6A 1J2XA 4KNYA 2VT2A 3GZ5A 3H92A 3E5QA 5DCMA 2W24A 3R0JA 2R7FA 4L5JA 4KIFA 1T0FA 1I27A 5CLSA 1PUEE 1J7KA 1RIOH 2DK5A 2KJBA 4N9IA 4L9TA 3T1BA 3FX3A 4YFXF 3CUQB 1BI0A 3IL2A 1TW3A 1TNTA 3PFIA 4IHSA 1IN7A 3SFZA 3JTHA 4KFCA 1HSJA 4RGUA 3PQJA 3AAFA 3R6SA 4EGYA 3TO6A 1REPC 2FU4A 2F5CA 4RAZA 1SAXA 1W7PD 2LF8A 3KZZA 4HDVA 5D4RA 1QBJA 4L9NA 5LEKA 1KA8A 2Z9OA 2QQBA 1HW5A 5DCMB 5K5OA 4AIKA 5K1YA 4UVBA 3FM3A 2D45A 1HKSA 3M8FA 1W4MA 2HZTA 1LJ9A 2R3SA 1KQ9A 2PN6A 2FNAA 3LA2A 3ZPLA 5FLXZ 4FX4A 1USTA 5ILVA 2OBPA 2H27A 1ZG5A 4EMSA 2WV0A 1G4DA 1JXSA 4Y13A 2PMHA 1RI7A 1LNWA 4A6EA 1U8RA 4ESFA 5K5QA 1J75A 1TQIA 4LG0A 1D3YA 4HAMA 1JHFA 3ERED 2V6CA 2C6YA 2BYVE 3KP7A 4CZZA 2RVCA 1RNLA 1GXQA 4WK8F 3TDZC 3U9GA 2ESNA 2YPRA 4JQFA 2DI3A 1XMAA 2Z33A 4EGZA 3FXRA 3R61A 5E1XA 1FP2A 3WTVC 2EA4A 1R23A 1YS6A 2XV4S 2CW0F 3HOSA 2EA2A 3R0AA 2FBHA 4EV0A 2MD5A 2QWWA 3CUQC 2UXXA 3Q9VA 4HLXA 2ZJ2A 1UFMA 4HDUA 2HTSA 3RKXA 1GXPA 3F8NA 5DYMA 5BOXA 4G9YA 1B59A 1XDSA 4XSZF 4M72A 3SHFA 5FLXK 3HHGA 5BMZA 2GA1A 3L9FA 2F2EA 3WU0A 3PQKA 2NNYA 1C0WA 1IW7F 1MJAA 1O3TA 3O2PE 1FYKA 5LGUA 4KUMA 4OIRF 1E2XA 1XGNA 3K1MA 4RS8A 1YLFA 2GAUA 4ZH4F 5AIQA 4M9ZA 2XAHA 3P7NA 2ZNZA 1IN5A 1XGOA 1LDKB 1D8JA 3M9AA 1U78A 1S29A 5JHUA 3E6DA 3ZMSA 1HXDA 5DD8A 2LF7A 1UHWA 1LEAA 1FYMA 2M5WA 5J6XA 5FB2A 2HEOA 4P9FA 2BE5F 4DNCA 4G7HF 1XD7A 2M87A 2XKPA 3S2WA 1JGSA 1USSA 3ECOA 2CYYA 5ED4A 1U3EM 3TOAA 3LQRA 4HF1A 3FM5A 1BI2A 1L0OC 1XGMA 4OOIA 4UXNA 5CYVA 2OZ6A 4AD9A 2PBIA 3DEUA 3CO7C 4M6YA 3HRUA 3LA7A 5HDKA 2BEOA 4D0PA 2VONA 3RPQA 4O6JA 1OPCA 2EV5A 3F8BA 1IRFA 1W5TA 2E7XA 3L00A 3LFKA 1UHMA 2OA4A 1BC7C 4P9UA 1H9GA 4IRHA 3LAJA 1ON1A 4U7BA 3JSPA 3QRFF 2ZMEA 2WWYA 2ACJA 4LLLA 1R5GA 1ULYA 3P9IA 2V1UA 1BIBA 5E17F 1S8NA 2V1DA 1D8KA 2L4MA 2F5FA 1OR7A 4I01A 2VBWA 2PJPA 1IN6A 5F6FA 5JI6A 3QPTA 2STTA 1HW1A 2XROA 3GFMA 2O3FA 4HX7A 4LJZF 4Q5SF 1XCBA 3CTAA 1Z05A 4B09A 1FLIA 4I02A 3GFLA 2VBZA 4AIJA 1ZRDA 1AWCA 4L0YB 3WTSC 1ONVA 2YX4A 3DFGA 5BS6A 2RGVA 4MQ9F 4KICA 3TKYA 1R58A 2M30A 3U1DA 3B73A 2VOOA 3DXJF 1K78A 1O7FA 3I54A 5HLHA 4YIFA 3KEQA 1P6RA 4U0YA 1S7OA 2ZXJA 1T38A 1SD4A 1TW2A 1MDMB 4GYGA 1OYIA 4CICA 2PI0A 2XAQA 1RUOA 2DLLA 4ENNA 2EFNA 3GUDA 3F6OA 4A12A 1IXSB 5BPDA 4IHTA 4FT8A 3TO9A 2AXLA 5JVTA 2J5PA 2K02A 4M6XA 1YO5C 3WODF 2QYOA 2DPUA 5EEHA 3G3ZA 3SQNA 4MTEA 2X4HA 2ADUA 4U0WA 1P4AA 5D8KB 3EETA 1O7LA 4P5OA 1R5HA 3DF8A 1DPRA 4HQMA 4A0ZA 2YSRA 3K0LA 3E97A 2G7UA 5FD6A 3V7RA 4M71A 3Q5FA 3BOQA 4UV9A 2DW4A 2P8TA 4S05A 1FPQA 1BBYA 4BXUA 2PMUA 3GEZA 3BWGA 4H0EA 1XMKA 1K7AA 3RTRA 3MZHA 1D5VA 4BHBA 3QAHA 5HS7A 2NYXA 5LHIA 3KP4A 4HBLA 1W7PB 2D1VA 2FE3A 1GVJA 4OINF 2IVMA 2LDUA 3KLNA 1OYYA 1FSEA 2RNJA 3CUQA 2UWMA 3KETA 1G6NA 3BROA 1EH8A 1R7JA 3W6KB 3FZVA 5E8GA 4XLNF 4F7ZA 1XSVA 4EM1A 3B02A 3M8EA 3C7JA 1E17A 2OQGA 3SZPA 2K7LA 2P5VA 2QVOA 1LDJA 2E7WA 3CO6C 1U5TB 2QQ9A 1BC8C 4MNUA 1DDNA 1O57A 4NQWA 3I59B 1YS7A 1O3RA 3GFIA 1I1SA 2DT5A 4OIOF 4LB6B 4BQAA 1IAWA 4U88A 1ZG3A 1TQMA 1ZRFA 2LKPA 4XRFA 3P9KA 3F6VA 2QZ8A 2MC3A 2KKOA 4HV6A 2FMLA 3RKWA 4OMZA 1FP1D 2O8XA 1FBSA 2EB7A 4BH9A 1LVAA 3JSOA 3OV8A 5H6RA 3BDDA 5LBQA 2QUFA 2AS5F 4Z2YA 4ENJA 2PFBA 1XGSA 1XCVA 2FSWA 5DUKA 2P4WA 4HV5A 2P6TA 1QZZA 3COAC 4BHCA 4IXAA 1XSXA 2W85A 3BJ6A 4PGGA 5LRRA 4A0XA 4HZFA 4AIHA 2CGPA 3RI4A 3I0TA 2FQ3A 3O3KA 3WGHA 2RN7A 4LK0F 4KMUX 4MTDA 2ISZA 3BPVA 2A07F 1QPMA 3MQ0A 2O61A 5FO5A 5CVVA 4WXCA 4HOBA 3HTSB 3KCCA 2XIGA 1FX7A 1DPUA 4KMFA 1SMTA 5J8FA 2VOPA 1XSDA 2P6SA 1U5TC 3WGGA 3FHZA 3GXOA 3HOTA 1NHAA 3V8KA 1DP7P 2JPBA 1P4XA 3IRQA 3ZQ7A 2CWEA 3HTUA 3EYIA 1KU7A 3T0YA 2COMA 4EM2A 3VOEA 1YW8A 2XHKA 2B0LA 4HF2A 4UNOA 2STWA 2V9VA 3HSEA 5J8CA 3BJOA 4LFUA 5IT9Z 4JBAA 3ISPA 2BV6A 3ECHA 2GIVA 3E6MA 1RUNA 1ZN2A 2VC0A 5ILSA 2MBFA 3LA3A 2DQRA 1R36A
chains in the Genus database with same CATH superfamily
4XONA 2KZGA 4O5VA 1IF1A 4OIPF 2EFQA 1POGA 3I4NJ 2VXDA 3TP0A 3F72A 4WWCA 1MIJA 1BR4A 1RETA 3IKVA 3HBLA 3K2ZA 1DU6A 1FNNA 4PFPA 1GT0C 2DMTA 5K7ZA 1FOWA 3PNYA 3WTXC 4OMYA 2HYGD 1YTYA 5FLVA 2KIMA 1T33A 2ZFWA 3L09A 2E71A 2EILH 5HDNA 1BA5A 3I56I 4M3GA 3MWMA 3G6EI 1TL8A 1G3SA 2JWTA 2DJIA 3KFWX 5E18F 4MEXF 2FBIA 4UVAA 1U0JA 4PZJA 1RR7A 5E3MA 5EYRA 4MHGA 5HLTA 3F8MA 4NUBA 5H20A 1VQ8I 1YX5A 2HKOA 1IXRC 3WTUC 4Q47A 3CCUI 4MEYF 2L54A 2R7SA 1M1EB 5TISC 2OQRA 4P96A 1T6SA 1S7EA 2CQQA 5CVIA 2DBBA 3IC7A 2NNNA 3WTTC 3LMMA 4L5IA 2JPCA 3O6BB 3D0SA 4AC0A 2DMPA 5F04A 1BJAA 5LEJA 1F5TA 1H0MA 1JI8A 1G3TA 1XDUA 1HF0A 2FA5A 1EH7A 3FK6A 5L3FA 4CUGA 2WTEA 5EZHA 3E0JB 1OCPA 2F4OB 1JT0A 1KU9A 1YYVA 4ESJA 3QPSA 2W84A 3EQLF 4CDGA 2JA5J 2VBYA 4A5MA 4IHVA 1X3UA 3K10A 1YOVB 1SD6A 5GPCA 3ABKH 3LSGA 2K9LA 2M0MA 2DK8A 3M3YJ 3KYDB 2A61A 3FMSA 1JTXA 5FKOA 4U0VA 2ID3A 2XASA 4R1HA 1Q1HA 4RM2A 4HSTA 2V6EA 5IT9K 1S72I 5DUIA 5CVRA 1D5YA 3ERMA 3IWZA 2LD5A 4ENMA 2W82A 1R1VA 3FXQA 2Y75A 2OZUA 2RAEA 3H36A 4HSRA 5F0FA 4WX9A 1OYWA 2DOAA 1IJWC 2CSOA 1G3YA 2LY2A 1K6YA 2LKXA 1BI3A 1HCRA 1D0ZA 1MBJA 2K85A 3H35A 1Z9CA 3O8GA 2O9LA 1I39A 2XPWA 3TQNA 4BXFA 3HRMA 4EEFG 5EG0B 4L0ZB 5IPAA 2X1EA 3ZP5A 3A4CA 5D5XB 3DTIA 5K7FA 1IZ1A 1SVLA 2Z5UA 1FMVA 1B8IA 2ESHA 3TO7A 4NNJA 1EV7A 3OOUA 2KRHA 5E3OA 4XICA 4BNCA 2KIFA 1MD0A 3BJAA 2EFWA 3FMRA 1K79A 5ICEA 3HPHA 1J09A 3RJPA 3L2VA 1J5YA 3BR6A 3SZTA 5L3EA 1B4AA 1V3FA 4ZYEA 3G71I 4RB0A 1SD7A 3LQQA 3MMYB 4I76A 3OY9A 1VQPI 2IGMA 5EGOB 2E5NA 3EUHA 3T8TA 1LFPA 2XGCA 2G7HA 1MDMA 4BJTA 5FKLA 3OYHA 3G73A 4DYCA 2NXNB 3FHNA 3SEZA 3OYMA 3GTPJ 4EJOA 4M9SA 1VI0A 3TL4X 3PUBA 3GFJA 2GXGA 1ZR2A 3DKWA 3VFZA 3IH3A 2MG4A 1HDPA 2DA5A 5E1WA 1QHGA 1TNSA 2HDCA 2LR8A 5JVGF 2NVUB 3J7AO 1P92A 4WXHA 1Z21A 2A3SA 2HI3A 1LB2A 4V2GA 4HQEA 1ZR4A 2Z99A 3BR0A 4BDZA 4FETA 2BW3A 3L2QA 5D5VB 5C4XJ 3ZMUA 5IT3A 1SD5A 2QA4I 2G9WA 2R7QA 1AOYA 4A3GJ 1V5EA 2P0WA 2VXZA 5M5YJ 1X3WB 1RRJA 3GLXA 2H8WA 2F5EA 2VJ4A 3TDUC 3OIQA 4BQNA 4HX8A 3N4MA 3ROUA 1A31A 3J7AY 3S17J 1KGSA 1A5JA 2AQFA 3K9TA 1I6XA 3SZGA 1CGPA 4IVNA 3J80Z 3GBGA 3IP4B 1ZLJA 3K4BA 5GTIC 5FFZA 4M9XA 4LMYA 2JRMA 4GCVA 3I4PA 1X1CA 5IY5H 1HC8A 1BM9A 4BHPA 3BG9A 4OIQF 2JSPA 2R7WA 2EV6A 3D5SC 3RPUA 4JP0A 1ZRCA 4PCQA 1G2HA 3K2AA 5DM7F 4KA4A 3KEOA 3HUGB 3H0DA 5A2QZ 3S1NJ 2MA3A 3FF5A 4GXOA 4UY8I 1YW7A 4K2EA 4CYDA 1R00A 2E5ZA 3JAMZ 4HNUA 4D9JA 3W2WA 1F43A 5E8IA 2EIJH 2WAQA 5BQTA 2R7UA 3RIRA 1FOXA 1K6OA 3H3ZA 5DCFA 3BC8A 3RKQA 1MBHA 3KLOA 1WRJA 2VODA 4QTRA 3ZQFA 4EM0B 1O3SA 2K9SA 2RV8A 2L3DA 5KK1A 4HX4A 4XLCA 4WCGA 3JR9A 3GTKJ 2ELHA 1VTNC 1HLVA 1SANA 1KZHA 3M1EA 5D5WB 2JSCA 2P7VB 2DFEA 3RKYA 4YFKF 5J1RA 1TWFJ 4IF4A 2XDVA 3OSGA 4RB1A 4ZYHA 3GW2A 3NWTA 3JRHA 1P2FA 1TLHB 1OCRH 1GV2A 3HSRA 2CQNA 4HLYA 3BQYA 3WTWC 2EBIA 4G6QA 2VJ5A 2OD5A 4J00A 2IS2A 4FHTA 4PUSA 5DTDA 4S0HB 1ZG1A 3FWEA 1OFCX 1W7PA 3MD2A 2XAJA 3QP6A 5JFRA 4CYCB 3OSFA 1YW9A 1MBFA 1BI1A 3M1CA 4BYYA 2X0LA 2HOSA 4W1UA 2E19A 2OV7A 3R4KA 2H6BA 4L9JA 1JKRC 4GFBA 3T8RA 3EUKL 1FSHA 4A5NA 3E5UA 4LLNA 3OYEA 3B6AA 3TGNA 2OCCH 5D6FA 3IAM2 2K3PA 4QIWN 2HQNA 2KHMA 1MGTA 1T56A 2Q2EB 3ZMVA 2IP2A 2CV0A 1N78A 1BOBA 2JTVA 3ABUA 3CCQI 5LHHA 5DM6F 1J0RA 2CUJA 1K4SA 5TGTA 2O03A 2IPQX 3DPUA 3E3VA 2EFPA 2ISYA 2VPLA 4C3JJ 4TV7A 2RNGA 2ZO4A 1EKEA 4KITB 1QQIA 4HA8A 4LB5A 1FJLA 1Y0NA 1BIAA 2OJED 1CQTA 4I2OA 2EWNA 1L3LA 2CUEA 4KN4X 2X6WA 3VODA 4OU0A 5A2QK 1U9NA 4XN0A 4KDPA 1FBUA 4KYWA 4XSXF 3KPHA 3JAMK 1PJRA 1Z77A 4BY1J 4IRIA 3S32A 2BBYA 5LHGA 2PJRB 2OC6A 2P5KA 4BU2A 4IX7A 2DMQA 4LIVA 1ZLKA 1U5TA 1UCRA 4M3BA 3M07A 3BZCA 3MAJA 2HS5A 3FMQA 2V9PA 2VBXA 2WAFA 4IRGA 2VE8A 2D1HA 4EJWA 3F8CA 3I59A 5HLGA 1WI9A 1X3ZB 1DUXC 2K4BA 1D1CA 2CW8A 3HGGA 1BJZA 3QP5A 3H3VK 1EF4A 4F92B 3OYLA 1MH4A 3K70C 3D1NI 4PJJA 1EH6A 2ECBA 1V55H 3HRTA 3MCZA 2COBA 2PLYA 5CJ9A 1PVEA 3X2QH 3CUOA 1OKRA 3BR5A 3HYIA 2NS7A 2XKOA 4B44A 5C3EJ 1MSFC 3SXYA 3RCOA 3Q9SA 5B1BH 2EK5A 2HPIA 2VQHA 3JW4A 3SYTA 1YRNA 1YG2A 2A69F 2A6HF 2FJ1A 2F4IA 2HZDA 1X58A 4B47A 3S8PA 1X4PA 5HODA 2E2HJ 2NOJB 1IRXA 4AYBA 4ENKA 5EZGA 2FEZA 4FE4A 2OTJI 2PMZA 3NQOA 4YIRX 1FC3A 4NC8A 2K3FA 1I5ZA 2NS0A 2K9MA 2EIMH 2RDPA 4YFNF 1YX3A 1W5CC 1ZARA 2NAZA 4FE7A 4GRIA 4RLFA 2IA2A 3NEUA 1R22A 2Q0OA 1P7IA 3VB2A 2DAOA 3DPLC 2CG4A 1W36D 3D5LA 3CDHA 2JA7J 2HQRA 4II3A 1Z1DA 2JRTA 1QO0D 1QZEA 4AIDA 3NAUA 2VN2A 1WSUA 4II2A 4FISA 3C2GA 4EJTA 1WKMA 5F64A 3V4GA 5FKKA 1LUJB 4HNVA 2JA8J 5ERIA 3K4KA 1SFUA 2YU3A 1MJ9A 2B9SA 2WA0A 4E7HA 4DGWB 1ENHA 1MBGA 2O0YA 4F55A 1XB4A 5HVQC 4UUSB 2R7ZJ 2BZTA 3OR1C 1CF7B 3FXUA 3GF2A 2LSOA 4RGXA 1KYZA 2XSJC 2FXAA 3OYNA 3K7AJ 1H8AC 4L9VA 2B7EA 4DQ2A 2IRFG 2W57A 3BG6A 4ON0A 4HYEA 3CMEI 1B9MA 1JE8A 3FXKA 2QENA 4RAFA 3C3WA 1X1BA 2YX7A 4Y4RA 2NRAC 4FASD 4ZYGA 2O6GE 3I58A 3VYUB 5KHDA 3SJMA 5FFXA 1YJNI 1U6GA 2A6EF 2DDAA 1STZA 5EEAA 1JJ8C 1Q1VA 1G59A 4JK1X 1ZHFA 2L7MP 3HIFA 3KP5A 1FBQA 2EZIA 3IH2A 5IOYA 5IP6A 2KISA 3FDYA 3MFKA 4LLGF 1QVTA 4LIUA 4KT5C 1JUMA 2HQAA 2EFOA 1WFXA 4ASNA 1LKXA 2HGCA 3DQVC 3SDGA 4EQQA 2QBYB 2Y0SN 3ABMH 2H6CA 1A6QA 2L4AA 1Z6TA 2VT3A 3EYYA 1JJ6C 1HW2A 4OWRB 3BZ6A 1N75A 5TJJA 2GLOA 1LDDA 5F08A 4Q4ZF 4Y52J 2GBYA 4ANJA 3ZMDA 1HOMA 3FK7A 2HOAA 1SFXA 2E2JJ 1Y0UA 4A3LJ 4E7LA 1IN8A 1TBXA 5KVRA 3UKGA 3H5RA 1P7JA 3E6CC 2DA7A 2YR2A 1FY7A 3F0CA 3PM1A 4BAYA 3HDDA 5AONA 5BNGA 3ONQA 1S3JA 2Y0MA 2ZCWA 4IJAA 2ZC2A 4MFDA 2FMYA 3BCBA 3ZRGA 3K4CA 2PQ8A 1QA6A 5EF6A 2IJLA 1KQ0A 1FIAA 2LRDA 1KQ8A 3Q0WA 2UXNA 1MZBA 2GWRA 1OCOH 4UVCA 4Y7NJ 6PAXA 1MJBA 2QKMB 4RGSA 1VQ4I 1HBXG 1DGRM 2MLKA 3RQIA 2XF5A 1R1UA 5ICCA 4EJVA 3KZIC 5L3BA 1JHHA 1U9OA 2M1BA 2NVTJ 1B72A 4XKBA 2XF7A 2IT0A 1NG6A 4N0BA 4MLOA 4Y17A 2FRHA 4G7ZF 4JOMA 3U2RA 3H5AA 4KIBA 2IXSA 3MZ8A 4A2UA 5C44J 1H88C 1ZYRF 1D1AA 3I55I 1A04A 1TP4A 1F1ZA 4C3IJ 1IV6A 4GGGA 4AU7A 3O8HA 1S7AA 3R60A 1QZYA 2ZNYA 4HW0A 3ZN1A 2F5VA 1TTYA 1LEBA 1WJAA 2KFDA 1F36A 5LFAA 2EV0A 1F4KA 2CJJA 2K4JA 3BP8A 1RZ4A 3LFUA 2MH9A 2JK3A 3GMEA 1P9QC 1UHSA 4BUPA 5CVJA 5TRDA 2XRLA 4XR6A 3WU1B 1UMQA 3M8JA 2CS3A 2V1XA 3LSJA 3CJTB 3LWFA 4F52A 1E3OC 1ZREA 1MNMC 4DYQA 3GCMA 1FYLA 1JKOC 1HSTA 3JTGA 1JTYA 1I1GA 2IA0A 4CXFA 2ZJPF 2OAZA 4ETSA 2DYRH 4NHJA 2H09A 3M7GA 2Y9ZA 2MLGA 2JZYA 3QODA 5D4SA 3F8FA 4A69C 1JGGA 4UV8A 4XKVA 4I0AA 4BQOA 4E7SA 1PP8F 4CSWA 1DU0A 4E70A 3DBHB 2K9NA 4G8XA 1ERDA 1ZTRA 2DPDA 1PYVA 2EJRA 4FX0A 2DO7A 2BXYA 1B9NA 2P7CB 5J1UA 1K61A 2FF4A 2XAGA 2XSDC 5FLMJ 3REOA 1PDNC 2HKXA 3OL4A 2GOXB 5CQEA 2Y0SA 1MMNA 4KJZA 5CVUA 1YFHA 4LGWA 2IA1A 3FISA 2L2OA 4NB5A 4XMYA 2L9NA 3ABTA 2W7NA 4J01A 1KU3A 1DQUA 3GZ6A 4DOZA 5FRMA 3WE3A 5L3GA 4O3MA 2P5LC 2A68F 4XOTA 2R7DA 4U7DA 2X6XA 3C1DA 1HQCA 4LG0B 4A3IJ 2A05A 2R5ZB 2FOWA 3K1NA 1WWXA 3G1MA 4YRVA 4CO8A 1U2WA 5L3CA 5D5UB 3SFIA 4D7MA 3B6CA 4PSXA 1MNDA 1VFCA 5ICFA 4G6DA 4HG2A 3GWZA 2RQQA 1Z3XA 1T0FC 2CFXA 4BBSJ 1FOKA 3PIPF 2MSYA 5EG0A 5HLIA 3DU5A 2MW8A 2M45A 2EZLA 2QQAA 2F5DA 4RB3C 4CH7A 1B1BA 4PFOA 1ZKGA 2RC4A 3DEEA 5D6EA 1QVUA 2JT1A 4ZZDA 4JX5A 2CUZA 9ANTA 3V7CA 3BY6A 2VIXA 2DFIA 4I09A 1NH3A 3KYCB 5HS9A 3WE2A 3WG7H 4ZDOA 2DODA 4GO1A 2RQPA 5LGNA 5DV5A 1V4RA 3AG2H 2XRNA 2WC2A 5EGOA 2Q8KA 1B6AA 4JX6A 4AWXB 2W25A 1Z7UA 3UR3C 2BXZA 4RAYA 3KZYA 1T08B 4ZYDA 4I98B 1TWCJ 2CO5A 2VE9A 1SVMA 3QYEA 4P55A 1O3QA 2K86A 1H9TA 3S93A 3CJNA 1MKMA 5FRNA 2HOEA 1S5LC 2H1LA 3IKTA 3KP3A 4IHXA 1BN5A 2K40A 2WAQN 4QLCU 1Z3YA 3LOCA 1PP7U 3KIOA 3HOVJ 2L01A 5ILUA 4HPQA 1ON2A 2ICWG 3CF2A 3ZMTA 1KONA 2JA6J 2W4SA 3QYBA 3WTZA 5FGMA 5DEQA 4CHUA 1MMSA 1IGNA 3MEXA 2JA2A 2Q1ZB 2HVSA 3A01A 4BEHA 4G7OF 2LKSA 3BR2A 3WHBA 2XUBA 2JVHA 3BQZA 3ZQQA 2KIUA 1TQPA 3RSNA 4R8HA 1UB9A 2HDWA 4ESBA 1LE8B 2H94A 4RM3A 4QWQA 3CJRB 2KT0A 4ZTJA 5B5EC 5JR3A 3E5XA 4RAGA 2A5YB 4Q48A 3WU2C 5HNFA 4C3HJ 1SFOJ 3S2DJ 2XVCA 2TDXA 3V8LA 2R4GA 5M5WJ 3ELKA 4UHTA 3L2RA 3DPTA 2L02A 1MMDA 2B63J 4UUTA 3HUGA 4E6KG 3W2AA 3ULQB 1R1TA 3JRGA 3HC7A 3ZOBA 1D0YA 1GVDA 3CLOA 1Z0XA 2NOGA 3CDIA 2V7FA 2DYSH 3QU3A 3FXOA 3HHHA 4Y15A 1W0TA 2CH0A 4IO9F 5D8LB 3C2HA 3MN2A 2KRFA 2LVSA 1LQ1A 4I0BA 2QM3A 5KNLA 2Y48A 1F9NA 4PGHA 4WXDA 5HDGA 4MGRA 4S04A 4EVIA 3OYDA 1MH3A 1S6LA 4B8XA 1ETOA 1WCMJ 2BY3A 3QU6A 5LLQA 1Z91A 2XB5A 2DDBA 2GXBA 4P1WA 4OAZA 1SFKA 2D2WA 3GTQJ 2DTZA 4H4KC 2FQ4A 3D5RC 3V7SA 3E7LA 3CZ6A 3LSTA 5E1ZB 3VEPA 3I64A 2V9KA 4G94A 3DV8A 4EJUA 1A6IA 1AA7A 2K27A 4M74A 3ZMZA 1J59A 3S14J 3GLLA 5FD5A 3A01B 3H9QA 4BEHB 2KPMA 4PDKA 2M8GX 1HKTA 4RBOA 4I6ZA 4LOCA 1X2NA 1VQNI 2Z3YA 2BGCA 2L9SA 3I71A 4E7KA 3LAPA 3CDLA 4CYCA 2LBFB 4KISA 1FWZA 3BT9A 1ETVA 3S1QJ 2V79A 3QPHA 2EH3A 2WAEA 1UELB 3OYFA 3KP6A 2DU9A 1MMAA 1KYWA 3MZYA 1IN4A 3K1PA 2HPMA 4CGZA 3I5UA 2KIQA 5DD4A 3HPGA 4GDFA 1JUSA 4MQVA 1NG7A 1Z7LA 3ZQHA 5JLXA 3OYCA 2JJ7A 2M4KA 2Q2EA 2UZKA 3S3MA 2VQCA 1OCZH 1YQAA 3GVAA 4UUVA 3OYJA 4NC6A 3EDPA 3KP2A 1RPWA 2Y30A 3J81Z 2R7RA 2LMDA 2X6OA 2HFHA 2ZMEB 3K6GA 1IUYA 4GYIA 1XN7A 3RDIA 3WHCA 4CZCA 2YU9J 1ZAOA 2FNPA 1GHCA 2GA2A 4MIMA 3DP7A 2N8GA 4A6DA 3E6BA 1ODDA 1HKQA 2V1NA 4ZZLA 1IRZA 3G4SI 1T39A 2HYFA 2Y2ZA 1YJWI 3CLQA 1IRGA 3BPXA 4BY7J 4AVPA 3CMAI 2R5YB 2E34A 2M7BA 3Q0UA 4JX4A 4AYBN 4CCLA 2DTRA 3K69A 2PMZN 4IL6C 2LG4A 4BJ5C 2PJRA 5F0HA 1TT0A 1WQ2A 2PEXA 1FZPB 2AXTC 5LGTA 3AG4H 3RYPA 2GZWA 1BL0A 5F27A 4A0YA 5HNHA 3ASNH 4PJLA 1OISA 1SFEA 2HWVA 2Y31A 3L7WA 2BY0A 2LTPA 2DMNA 3OWTA 1G3WA 3F23A 2ME6A 5HOOA 2ZKZA 1AKHB 5L3DA 2EPFA 5BPIA 1J9IA 1YE9A 2GQQA 3E1SA 4A3FJ 3OS1A 2E1CA 1ZGAA 1OCTC 4C2MJ 3J7ZI 4XBFA 1OLTA 2OU2A 1WZ2A 5LRSA 2HR3A 4G12A 5FJ8J 2FD5A 3BZKA 2VC1A 3AKZA 1Y56A 3F3XA 3A0BC 5AIPA 4A3JJ 2MH2A 5HS8A 3P9CA 3ZGKA 3WG9A 4DJAA 2NVXJ 1T2KA 3J80K 3ZQCA 3I53A 1K78B 1QGPA 4NBQA 1G8XA 2E2IJ 2XAFA 1EA3A 3HSFA 4HEA2 4N9HA 4DYRA 4B3XA 5IOZA 2FOKA 2QLZA 2QCOA 3GO5A 3T5XA 2LNBA 4U87A 2ZB9A 1X1AA 1GLNA 4CCOA 5EEGA 4IKFA 3I3LA 4RB2C 1GDTA 3U1KA 5J1YA 3NRVA 5DDGA 2Z16A 2PX9A 5LD2C 3TOBA 4XIDA 4PSWA 2KJCA 3RYRA 2IW5A 4WF2A 4XRSG 3AG3H 4Z6YA 3J81K 5K5RA 3GX4X 1S9HA 4UB6C 4KN7X 4NDLA 3QOPA 3L1PA 2M8EA 2MD0A 1SVOA 3BTLA 1FT9A 1R4NB 4DZPA 3ZN0A 3WGIA 3S3OA 2XGXA 1ETXA 2F4MB 3KE2A 3HEFA 2DA1A 3C18A 1SMYF 2DFHA 3QWLA 1GUUA 3CF5F 2XPUA 2I10A 2VKEA 3IV5A 1FOYA 1T98A 2FBKA 3H9JA 4UUSA 4XRMA 2MFZA 3HRSA 4D5CA 3ZCOA 2CV1A 3CD6I 1CF7A 4F93B 3IRRA 1XPXA 1E0EA 5H6QA 1P4WA 4M73A 4RGRA 3VYTB 2D5VA 3G1OA 4IOCF 4V2FA 2BVLA 1ZK8A 3F21A 4YIIA 1ZQ3P 2ZMEC 2X1CA 2H1KA 2ZBKA 1IXCA 2J5OA 2DCEA 2DQLA 2HTJA 2RKHA 2PG4A 1Z6RA 4I7HA 5F1RA 1W5SA 2ETHA 5J4VA 3N97A 1YIOA 3CC2I 4KIGA 3IWFA 2TRTA 2DA2A 4M3FA 3IHUA 4LK1F 1RKWA 4BJ6C 3W6JB 4CCKA 4YG2F 3OYIA 1OR7C 4ZDPA 5ICGA 1UG2A 1ZGJA 5E3LA 3EUAA 4BL0B 4FTHA 3V8JA 1KU2A 4HF0A 3GYHX 3VSLA 5E20A 3L2CA 1BOAA 4LD5A 1MBEA 5GAEJ 1YIJI 2QBYA 4L18B 1OMIA 2R93J 2CQKA 1MSEC 1QNTA 2OUMA 2M3AA 2E1NA 1APLC 4R79A 2VJJA 3OOPA 3H3UA 1ZH5A 1LPQA 4XLPF 3LL7A 4IPAA 3GTGJ 1N25A 4A3KJ 3WTYC 3F22A 3ML6A 2IGKA 1ETWA 2NS8A 1J2XA 2XC7A 4KNYA 2HVRA 2IGNA 2VT2A 2ME0A 3BG7A 2A6TA 5H2FC 3GZ5A 3FXLA 1Z67A 2RREA 3H92A 3E5QA 4J19A 5DCMA 4XLHA 3RPUD 3A02A 2W24A 3R0JA 2R7FA 4XN3A 4L5JA 4KIFA 1VQ7I 1W36C 1T0FA 1I27A 4NC7A 5CLSA 1PUEE 1J7KA 2DOFA 2M0CA 3CMMA 1RIOH 2DK5A 2KJBA 2WBMA 3RZDJ 2VUMJ 2X1DA 5KAFC 3QYFA 3OYAA 1WJBA 4CCMA 3TP3A 3JREA 4N9IA 4L9TA 3T1BA 3FX3A 4YFXF 3CUQB 1BI0A 1VZ0A 3IL2A 1TW3A 1ETQA 1TNTA 1E3PA 1BW6A 3PFIA 4HNTA 1NTCA 1XMXA 4IHSA 4C2TA 2VQLA 2AHQA 1IN7A 3SFZA 3JTHA 4KFCA 3PFYA 2HQ5A 1HSJA 4RGUA 3PQJA 1H89C 1TZLA 4IOAF 3AAFA 3R6SA 4XLEA 4EGYA 2YUSA 3TO6A 1REPC 1VNDA 2FU4A 2OTLI 2F5CA 4RAZA 2VKDA 3CC7I 1SAXA 2ZFUA 3HG9A 1W7PD 2LF8A 3KZZA 4HDVA 5D4RA 1QBJA 3CCYA 4L9NA 5LEKA 2CMPA 4IEJA 2DJNA 1KA8A 5FROA 3TBIA 2X85A 2Z9OA 4RMNA 3DTKA 2QQBA 4N4OB 1HW5A 5DCMB 5K5OA 2WY8Q 4AIKA 1JKQC 2K5CA 2CRGA 2JN6A 3A0HC 2L7FP 3LSKA 5K1YA 3GTLJ 2DMUA 4UVBA 5FKNA 4BE0A 3FM3A 2D45A 4BQQA 1HKSA 1SEUA 3M8FA 1W4MA 2HZTA 1LJ9A 3JRCA 2R3SA 4NQWB 1UG0A 2P81A 3LSPA 1KQ9A 2PN6A 2FNAA 3LA2A 3ZPLA 2QSGX 2L5QA 5FLXZ 1Y8QB 3KYLA 3S15J 4FX4A 1USTA 5ILVA 2OBPA 2HOTA 2AO9A 2H27A 1ZG5A 4EMSA 3JCUC 2WV0A 2KQRA 1MW7A 1G4DA 1JXSA 4Y13A 2PMHA 3PSIA 1XTAA 1RI7A 1LNWA 4A6EA 1U8RA 1Y8RB 4OAYA 4ESFA 3W6VA 3S3NA 5K5QA 3ZQGA 2LREA 1J75A 2R7VA 1TQIA 3Q3SA 3HOYJ 2VPRA 4LG0A 5B66C 1QRYA 1D3YA 4HAMA 3ASOH 2R5ZA 2DA4A 1JHFA 4A3DJ 3ERED 2DN0A 2V6CA 2C6YA 3VYSB 2BYVE 4MFEA 3KP7A 4CZZA 5KAIC 2ZSHB 4XNFA 1PUFB 2RVCA 2BOLA 1RNLA 2CFOA 1GXQA 2DFFA 4WK8F 3TDZC 3U9GA 2ESNA 2YPRA 4BDYA 4JQFA 1W0UA 2DI3A 3FKIJ 1XMAA 1Y1VJ 2Z33A 1SC7A 2F6CA 2BHYA 4EGZA 3FXRA 2DA3A 3LSHA 3OS0A 3R61A 5E1XA 1FP2A 3LNQA 3WTVC 1SAUA 2EA4A 1R23A 1YS6A 3DWLE 3PNTA 5JHFA 2XV4S 2CW0F 3PL8A 3HOSA 3F9KA 1LFBA 3GZNB 2VASA 2EA2A 3R0AA 2FBHA 4EV0A 2MD5A 2QWWA 3CUQC 2UXXA 3Q9VA 2ZJQF 1T95A 4HLXA 3DBLB 2ZJ2A 1UFMA 2E1OA 2ZXIA 4HDUA 2HTSA 3CCJI 2R7XA 3RKXA 3AL0B 3OIOA 3F8NA 1GXPA 5DYMA 2X48A 2QEXI 5BOXA 3OR2C 4G9YA 1VQLI 1B59A 1XDSA 2LFBA 3DBRB 3CMYA 4XSZF 4MO7A 4ZYAA 1IUFA 4M72A 3L2WA 4JYKA 3CCRI 3G1LA 3SHFA 5FLXK 2QGUA 3HHGA 5BMZA 2GM4A 2GA1A 2XF6A 3BR1A 2Y9YA 3L9FA 2F2EA 4N4NB 3WU0A 4XK4A 2I5UA 3PQKA 2L7ZA 2LOOA 1E3HA 4BS9A 4CCJA 4C9YA 2NNYA 1C0WA 1IW7F 2LY9A 5B1AH 1BR2A 4CA0A 1MJAA 4B48A 3HL2A 1YI2I 4BKXA 4BE1A 1O3TA 1X1DA 3SDBA 3CCLI 3O2PE 4XQFA 1FYKA 1TT5B 5M3MJ 3OYGA 4BXXJ 1VQMI 1OJLA 5LGUA 4KUMA 4OIRF 1E2XA 3JRAA 1XGNA 3K1MA 2M4GA 1YLFA 2GAUA 4RS8A 4ZH4F 5DS9A 5AIQA 1LE8A 4M9ZA 2XAHA 3P7NA 5M5XJ 5FKMA 2ZSIB 3NWSA 1BR1A 1DP3A 2ZNZA 4B4CA 1IN5A 3KX2A 3A03A 4IQJA 1XGOA 4FQGA 4A3EJ 1LDKB 3K4MA 1D8JA 3M9AA 1U78A 3M4OJ 1S29A 3IUOA 3CP8A 1XG1A 5JHUA 4Y33A 3J7YJ 2UUZA 3E6DA 2X51A 4B1RA 1XS9A 3ABLH 3ZMSA 4D7NA 2VLAA 1HXDA 2BY1A 4AUXA 5DD8A 3I9V2 2LF7A 4XORA 1UHWA 1LEAA 3EPZA 1FYMA 2M5WA 4ABZA 5J6XA 5FB2A 2HEOA 4P9FA 1GV5A 2BE5F 2XPVA 1WVRA 4DNCA 4G7HF 1NK3P 1XD7A 2M87A 2XKPA 3W3CA 2QF7A 3S2WA 2QKLB 2CQ7A 2O8KA 2Z1DA 1JGSA 1USSA 1WH7A 2CYYA 3ECOA 4RA2A 4KT6A 5ED4A 1U3EM 1X19A 5J4YA 2A5WA 3TOAA 1HDDC 3LQRA 4HF1A 3PSFA 3FM5A 1BI2A 4W97A 3VDXA 1ETYA 1W1WE 1L0OC 1XGMA 3H9GA 4RDUA 4IHYA 4OOIA 2LLKA 2IBDA 2LC2A 3FBIB 3P5JA 3BG3A 3ZQIA 2EQRA 4UXNA 5CYVA 1R6RA 2WB1A 3AG1H 3FIWA 2OZ6A 3MKZA 4AD9A 5CQGA 2PBIA 3HKZN 2LBFA 3DEUA 3CO7C 4M6YA 3VWBA 3HRUA 3LA7A 5HDKA 2BEOA 4D0PA 2IS6A 1JKPC 2VONA 3RPQA 4O6JA 3TMOA 2MYSA 2HYJA 2L0KA 1QHHD 1OPCA 1RKTA 2KMUA 3AL0C 2EV5A 2CUFA 3F8BA 1IRFA 1W5TA 2E7XA 3L00A 4AVZA 2O5RA 1IG7A 3LFKA 1UHMA 2OA4A 1BC7C 4P9UA 1H9GA 4IRHA 1UZCA 3LAJA 2NVYJ 1A35A 1X1PA 2L7KA 1ON1A 4U7BA 3JSPA 3QRFF 4C30A 2CU7A 2ZMEA 2WWYA 2ACJA 4LLLA 3CCSI 1R5GA 1ULYA 1RESA 4XM3A 1I3AA 3HB9A 2M7AA 1WJ5A 3DLLF 3P9IA 2V1UA 2R0QC 1BIBA 2W48A 5E17F 2HDDA 2EZKA 2IGOA 1S8NA 3FXMA 4YEJA 2V1DA 1D8KA 2L4MA 2LK2A 4ZDLA 2F5FA 1OR7A 2QSFX 4I01A 2R5YA 2VBWA 4DW6A 1N77A 2PJPA 1IN6A 2LP0A 4ZJZA 2MABA 5F6FA 1WJFA 5JI6A 1VQ6I 2KDOA 3QPTA 2STTA 3LSRA 4XL9A 1HW1A 2XROA 3JRIA 3GFMA 2O3FA 4HX7A 4LJZF 5GAGJ 1X4OA 4Q5SF 2IS4A 3U21A 2XGEA 4E7JA 5F0CA 1XCBA 3DCFA 2W1OA 1AKHA 3CTAA 1Z05A 4B09A 1FLIA 4I02A 1YJ9I 3GFLA 4ZTFA 3OL3A 2VBZA 2CW7A 4AIJA 3IH4A 4L5EA 3JRFA 1ZRDA 1AWCA 4L0YB 3WTSC 1ONVA 3OYKA 3CCEI 2YX4A 2OCEA 3DFGA 4X0GA 2IAIA 5BS6A 3PUFA 3DU6A 2RGVA 4MQ9F 2CQXA 4KICA 5IYDJ 2XB0X 1B8IB 2KRCA 3TKYA 4LITA 1R58A 2M30A 3U1DA 3B73A 1MMGA 2VOOA 3DXJF 3QOEA 1K78A 1O7FA 1JT6A 2G0EA 3I54A 5HLHA 2BY2A 4YIFA 3A2KA 3KEQA 1P6RA 1I50J 2WV1A 2ECCA 1IV8A 4U0YA 1S7OA 4BBRJ 2EIKH 3A1YA 4BACA 1U8BA 1WJCA 1ITYA 2CV2A 5GTHC 2ZXJA 1T38A 1SD4A 1TW2A 4HRIA 1TWGJ 1MDMB 3CC4I 4GYGA 4PJNA 1MBKA 1OYIA 1WH5A 4CICA 2PI0A 2XAQA 1RUOA 2DLLA 3HXLA 4ENNA 4YELA 2JQ7A 2EFNA 3V42A 2M34A 1WPKA 3HKZA 1NK2P 1XX5A 2ELJA 3GUDA 3F6OA 4M6VA 4A12A 2R7OA 1IXSB 5BPDA 3JRDA 4IHTA 4XLAA 4FT8A 1MNEA 2BW3B 2IS1A 3TO9A 2AXLA 3BLYA 5JVTA 2J5PA 3HOZJ 2K02A 1K4TA 2E1MB 2DT6A 4M6XA 4QPOA 1YO5C 3WODF 5CKTA 2QYOA 2DPUA 5EEHA 3BCAA 5IP9J 2ZJRF 3G3ZA 4UB8C 1VQ9I 3SQNA 1WJEA 1I3QJ 4MTEA 2KL4A 4E7IA 2X4HA 3TW6A 1VQOI 2ADUA 5GPAA 4U0WA 1P4AA 4C2UA 1X2MA 3TW7A 5D8KB 3MVPA 2LY1A 4B43A 3DLAA 3EETA 2H8RA 2F48A 1O7LA 4P5OA 2QSHX 1R5HA 3DF8A 1DPRA 1EJ9A 4HQMA 4A0ZA 2HXIA 1D0XA 2HNHA 4FCYA 2YSRA 1YITI 3VYRB 1O4XA 1BW5A 3RZOJ 3DTEA 1DGWY 5K7HA 3K0LA 3E97A 2M2EA 2G7UA 5FD6A 2O7OA 2VJIA 4LG3A 3V7RA 3GTJJ 4M71A 3Q5FA 3BOQA 4UV9A 2DW4A 2P8TA 2VQGA 3S16J 4S05A 4D1QA 1HA8A 1FPQA 3BTIA 2W00A 2QQ8A 4M3EA 1BBYA 4BXUA 2PMUA 3GEZA 3BWGA 3S1MJ 2Z2SB 4H0EA 1XMKA 4Y3OA 4IZZA 4F3QA 1K7AA 2OF7A 3K70D 3OYBA 3RTRA 3PJRA 2AQEA 3K4JA 3MZHA 1D5VA 5GADJ 5IP7J 4BHBA 4G6TB 3ZR8X 3QAHA 5GAHJ 3H0GJ 2NYXA 5HS7A 3UNGC 5LHIA 1R4MB 4IQ4A 3SEQA 4A3CJ 3KP4A 4HBLA 3L2UA 2FX0A 1W7PB 2D1VA 2FE3A 1GVJA 4OINF 1YHQI 2IVMA 5JLWA 2LDUA 3KLNA 1OYYA 4XOPA 1FSEA 2RNJA 3H1CA 1T8IA 3CUQA 4F91B 1QU3A 1ORKA 3EUHC 3ZXSA 3PNVA 2UWMA 4BGDA 2VKHA 3KETA 1R9TJ 1G6NA 3FXJA 2LH9A 3BROA 2Y69H 3FKJA 1EH8A 1R7JA 2JUCA 3W6KB 5CPRB 2KLOA 2KZVA 4DIQA 1R5ID 4CCNA 3FZVA 5E8GA 4X6AJ 4XLNF 4F7ZA 1UAAA 2GXAA 1XSVA 2ZXHA 4EM1A 3B02A 3N05A 1AU7A 3M8EA 3HOUJ 1OQYA 5E3NA 3C7JA 3VSKA 1E17A 2OQGA 2ELKA 3SZPA 2IEKA 2K7LA 4E4HA 3Q0VA 5F1JA 2YS9A 2WY7Q 2E1MC 2P5VA 2QVOA 1LDJA 2E7WA 3QPLA 4M3DA 3CO6C 3G2BA 3BR3A 1U5TB 3VPRA 4A3MJ 2WADA 2QQ9A 1BC8C 4ITVA 3H5NA 2BVMA 4MNUA 1DDNA 2E35A 1O57A 1TC3C 3CJQB 4PK4A 4NQWA 2MGQA 3I59B 1YS7A 1OCCH 1O3RA 4BE2A 3GFIA 1I1SA 1VQ5I 4X1EA 2DT5A 1WHUA 1D1BA 1Y6IA 2VL8A 1K83J 2HU9A 4ZC3A 4OIOF 2DT7B 1ZELA 4LB6B 4BQAA 2LYCA 1IAWA 3DKYA 4U88A 3HJEA 1ZG3A 2V26A 2R7TA 4XKWA 1TQMA 3W2VA 1ZRFA 2LKPA 3DKXA 4DBRA 3CP2A 2JMWA 4XRFA 3P9KA 5C4JJ 4RLQA 1R71A 3MKWB 2K9QA 3F6VA 2QZ8A 1FEXA 1AHDP 2MC3A 2KKOA 1V5GA 1YRNB 4HV6A 2FMLA 4E7ZA 1RC9A 3RKWA 2HVQA 1FTZA 4OMZA 1IDYA 1FP1D 1WGXA 3CQZJ 1R49A 2O8XA 4DBQA 1FBSA 2ID6A 3CCMI 5GP9A 2EB7A 4BH9A 1LVAA 1A36A 3PO3J 3JSOA 3OV8A 4V19K 5EDNA 5H6RA 3BDDA 2BHZA 5LBQA 2HXOA 1LVKA 1WI3A 1PUFA 2QUFA 2AS5F 3OS2A 2DOEA 3TEDA 2MC4A 1IO2A 3IAS2 4Z2YA 2OPTA 3DEWA 2XGDA 3CCVI 5M3FJ 1FIPA 4ENJA 4A93J 2PFBA 1XGSA 4PJ0C 1XCVA 3MKLA 5IYBJ 2FSWA 1Y1WJ 2X6YA 5DUKA 2P4WA 4HV5A 4IHWA 2EZHA 3GTMJ 2P6TA 1QZZA 4B3AA 3COAC 4BHCA 2GOMA 4I99C 1XSXA 4IXAA 2W85A 1V5FA 2VB6A 4XRSA 3BTCA 1VF9A 3HOXJ 1WJDA 5B3SH 3K4LA 3BJ6A 4PGGA 5LRRA 3HOWJ 2VKVA 2JVGA 3MKYB 4A0XA 4HZFA 3RQ4A 4AIHA 2CGPA 1XC5A 1V54H 3OIPA 4QSHA 3RI4A 3I4MJ 3I0TA 1TWAJ 2FQ3A 1FTTA 2X9DA 3GTOJ 2E36A 4D5FA 2R92J 3O3KA 3WGHA 2RN7A 4LK0F 2L9RA 1VQKI 4KMUX 4MTDA 4XKCA 2KP6A 2ISZA 2DXIA 3BPVA 2A07F 1QPMA 3MQ0A 2O61A 5FO5A 5J47A 5CVVA 5J3LA 4WXCA 4HOBA 4DZJA 3HTSB 3OMYA 3KCCA 2TCTA 2XIGA 1FX7A 3C2BA 1DPUA 4KMFA 1QPIA 1SMTA 5J8FA 2VOPA 2DA6A 1XSDA 2FUG2 3JRBA 2UV1A 2P6SA 3ZQLA 3PO2J 1JUPA 3LSMA 1U5TC 3AFHA 3KEYA 3WGGA 5J40A 5IYCJ 3FHZA 3GXOA 2E60A 3HOTA 1NHAA 3LSIA 3NARA 3V8KA 3CESA 1DP7P 3QQAA 2JPBA 3PIOF 1P4XA 3S2HJ 3IRQA 3ZQ7A 2CWEA 1LFUP 2WB1N 2XAUA 3HTUA 3K4NA 2ZXWH 3EYIA 1KU7A 3T0YA 3FBNB 3S1RJ 2COMA 3BG5A 1ZGWA 4EM2A 2V4JC 5KCMA 3HGYA 3VOEA 1YW8A 1UJ8A 2XHKA 2B0LA 2KDZA 4PJMA 1ACIA 4HF2A 4EATA 1Y39A 2VI6A 4UNOA 5EJCA 2STWA 2V9VA 1TWHJ 3HSEA 5J8CA 3BJOA 3HZJA 4LFUA 2EINH 2L9VA 4QPQA 1B72B 1IC8A 5IT9Z 2M9HA 4JBAA 3ISPA 1RR8C 2BV6A 1IDZA 3ECHA 2GIVA 2NVQJ 3E6MA 1RUNA 4A3BJ 4XLFA 3BTJA 1I6HJ 1FMWA 5E79C 1ZN2A 2VC0A 5ILSA 3HM5A 3ESWB 2MBFA 2GIZA 3LA3A 2DQRA 1R36A 2I8DA 2JUGA 4AM3A 1ETKA
chains in the Genus database with same CATH topology
4O5VA 1IF1A 4OIPF 2EFQA 4WWCA 3F72A 3IKVA 3K2ZA 1FNNA 3WTXC 4OMYA 2HYGD 1YTYA 2KIMA 2ZFWA 3L09A 5HDNA 3MWMA 1G3SA 3KFWX 5E18F 4MEXF 2FBIA 4UVAA 4PZJA 4MHGA 3F8MA 5H20A 2HKOA 1IXRC 3WTUC 4Q47A 4MEYF 2L54A 2OQRA 4P96A 1T6SA 5CVIA 2DBBA 3IC7A 2NNNA 3WTTC 4L5IA 2JPCA 3O6BB 3D0SA 5LEJA 1BJAA 1F5TA 1H0MA 1G3TA 1XDUA 2FA5A 1EH7A 5L3FA 2WTEA 1KU9A 1YYVA 4ESJA 2W84A 3EQLF 4CDGA 2VBYA 4A5MA 1X3UA 1SD6A 2DK8A 2A61A 3FMSA 4U0VA 2XASA 4R1HA 1Q1HA 5IT9K 5DUIA 5CVRA 3IWZA 4ENMA 1R1VA 3FXQA 2Y75A 2OZUA 4WX9A 1OYWA 2CSOA 1G3YA 1BI3A 1Z9CA 3TQNA 3HRMA 4L0ZB 3ZP5A 5D5XB 1IZ1A 2Z5UA 2ESHA 3TO7A 1EV7A 4BNCA 2KIFA 1MD0A 3BJAA 2EFWA 3FMRA 1K79A 5ICEA 3RJPA 1J5YA 3SZTA 5L3EA 1B4AA 1V3FA 4ZYEA 4RB0A 1SD7A 3LQQA 3EUHA 3T8TA 2G7HA 1MDMA 3G73A 4EJOA 4M9SA 3GFJA 2GXGA 3DKWA 3VFZA 5E1WA 1TNSA 2HDCA 3J7AO 1P92A 4WXHA 2A3SA 1LB2A 4HQEA 2Z99A 5D5VB 3ZMUA 5IT3A 1SD5A 2G9WA 1AOYA 2VXZA 3GLXA 2F5EA 3TDUC 3N4MA 4HX8A 3ROUA 1KGSA 3K9TA 1I6XA 1CGPA 4IVNA 3J80Z 1ZLJA 5FFZA 4M9XA 4LMYA 4GCVA 3I4PA 1BM9A 4BHPA 4OIQF 2EV6A 3RPUA 1ZRCA 4PCQA 4KA4A 3KEOA 5A2QZ 2MA3A 3FF5A 4GXOA 1YW7A 4K2EA 4CYDA 1R00A 3JAMZ 5E8IA 5BQTA 3RIRA 1K6OA 3H3ZA 5DCFA 3KLOA 1WRJA 2VODA 4EM0B 1O3SA 2RV8A 2L3DA 5KK1A 4HX4A 4WCGA 2ELHA 1VTNC 3M1EA 5D5WB 2JSCA 2P7VB 3RKYA 4YFKF 4IF4A 4RB1A 4ZYHA 3GW2A 1P2FA 1TLHB 3HSRA 4HLYA 3WTWC 4G6QA 2OD5A 4FHTA 1ZG1A 3FWEA 3QP6A 1W7PA 5JFRA 2XAJA 1YW9A 1BI1A 4BYYA 2X0LA 3R4KA 2H6BA 4L9JA 3T8RA 1FSHA 4A5NA 3E5UA 4LLNA 3TGNA 5D6FA 2HQNA 1MGTA 3ZMVA 2IP2A 2JTVA 3ABUA 5LHHA 1J0RA 2O03A 2IPQX 3E3VA 2EFPA 2ISYA 4TV7A 2ZO4A 1QQIA 4HA8A 4LB5A 1BIAA 4I2OA 2EWNA 1L3LA 4KN4X 3VODA 4OU0A 5A2QK 4KDPA 1FBUA 4KYWA 4XSXF 3JAMK 4IRIA 2BBYA 5LHGA 2P5KA 1ZLKA 1U5TA 1UCRA 3MAJA 2HS5A 3FMQA 2VBXA 4IRGA 2VE8A 2D1HA 4EJWA 3F8CA 3I59A 5HLGA 1WI9A 1DUXC 2K4BA 3QP5A 1EH6A 3HRTA 3MCZA 2PLYA 5CJ9A 3CUOA 1OKRA 3HYIA 2XKOA 3SXYA 3Q9SA 2EK5A 3JW4A 1YG2A 2A69F 2A6HF 4ENKA 2FEZA 3NQOA 1FC3A 1I5ZA 2NS0A 2RDPA 4YFNF 2NAZA 1ZARA 2IA2A 3NEUA 1R22A 2Q0OA 3VB2A 2DAOA 3DPLC 2CG4A 3D5LA 3CDHA 2HQRA 1Z1DA 2JRTA 1QO0D 2VN2A 1WSUA 4EJTA 1WKMA 5F64A 3V4GA 5ERIA 1SFUA 2YU3A 1MJ9A 2O0YA 1XB4A 5HVQC 1CF7B 3FXUA 3GF2A 2LSOA 4RGXA 1KYZA 2FXAA 4L9VA 4DQ2A 2IRFG 2W57A 4ON0A 4HYEA 1JE8A 1B9MA 2QENA 3C3WA 2YX7A 2NRAC 4ZYGA 2O6GE 3I58A 5FFXA 1U6GA 2A6EF 1STZA 4JK1X 1ZHFA 3HIFA 3KP5A 1FBQA 3MFKA 4LLGF 4KT5C 2EFOA 4ASNA 3DQVC 2HGCA 4EQQA 2QBYB 2H6CA 2L4AA 1Z6TA 2VT3A 3EYYA 1HW2A 5TJJA 3BZ6A 1LDDA 4Q4ZF 3ZMDA 1SFXA 1Y0UA 1IN8A 1TBXA 5KVRA 3E6CC 2YR2A 1FY7A 4BAYA 5AONA 1S3JA 2Y0MA 2ZCWA 4IJAA 2FMYA 2PQ8A 2IJLA 1KQ0A 1KQ8A 2UXNA 1MZBA 2GWRA 4UVCA 6PAXA 1MJBA 4RGSA 1HBXG 2MLKA 1R1UA 5ICCA 4EJVA 5L3BA 1JHHA 2M1BA 2IT0A 4N0BA 4Y17A 2FRHA 4G7ZF 3U2RA 4KIBA 4A2UA 1ZYRF 1A04A 1F1ZA 4GGGA 1S7AA 3R60A 1QZYA 2ZNYA 4HW0A 3ZN1A 1TTYA 1LEBA 2EV0A 1F4KA 2K4JA 3BP8A 1RZ4A 2MH9A 5CVJA 5TRDA 3WU1B 2V1XA 3LWFA 1ZREA 1FYLA 1HSTA 3JTGA 1I1GA 2IA0A 4CXFA 2OAZA 4ETSA 4NHJA 2H09A 3M7GA 2MLGA 2JZYA 5D4SA 3F8FA 4UV8A 4I0AA 1PP8F 4E70A 4G8XA 2DPDA 2EJRA 4FX0A 2DO7A 1B9NA 2P7CB 2FF4A 2XAGA 3REOA 1PDNC 2HKXA 5CVUA 1YFHA 4LGWA 2IA1A 4NB5A 3ABTA 1KU3A 3GZ6A 3WE3A 5L3GA 4O3MA 2P5LC 2A68F 2R7DA 4U7DA 3C1DA 1HQCA 4LG0B 3K1NA 1WWXA 4CO8A 1U2WA 5L3CA 5D5UB 5ICFA 4G6DA 3GWZA 2CFXA 1FOKA 5HLIA 2M45A 2QQAA 2F5DA 4RB3C 1B1BA 2RC4A 5D6EA 2JT1A 4ZZDA 3V7CA 3BY6A 2DFIA 4I09A 3WE2A 5HS9A 4GO1A 5LGNA 2RQPA 5DV5A 1V4RA 2XRNA 2WC2A 2Q8KA 1B6AA 4AWXB 2W25A 1Z7UA 4RAYA 3KZYA 4ZYDA 4I98B 2CO5A 2VE9A 4P55A 1O3QA 2K86A 1H9TA 3CJNA 1MKMA 2HOEA 3IKTA 3KP3A 1BN5A 4QLCU 1PP7U 2L01A 5ILUA 1ON2A 3ZMTA 3WTZA 5FGMA 5DEQA 4CHUA 3MEXA 4G7OF 2XUBA 2KIUA 1TQPA 4R8HA 1UB9A 4ESBA 2H94A 4QWQA 5JR3A 3E5XA 2A5YB 4Q48A 2XVCA 2TDXA 3V8LA 3ELKA 4UHTA 3DPTA 2L02A 3HUGA 3ULQB 1R1TA 3CLOA 3QU3A 3HHHA 4Y15A 5D8LB 2KRFA 1LQ1A 4I0BA 2QM3A 2Y48A 1F9NA 4PGHA 4WXDA 5HDGA 4MGRA 4S04A 4EVIA 1S6LA 4B8XA 3QU6A 5LLQA 1Z91A 2GXBA 2D2WA 3V7SA 3VEPA 3LSTA 5E1ZB 3I64A 4G94A 3DV8A 4EJUA 2K27A 4M74A 3ZMZA 1J59A 5FD5A 4PDKA 1HKTA 2Z3YA 2BGCA 3I71A 3LAPA 1FWZA 2V79A 3QPHA 3KP6A 2DU9A 1KYWA 3MZYA 1IN4A 3K1PA 4CGZA 3I5UA 5DD4A 4MQVA 2Q2EA 2UZKA 3GVAA 1YQAA 4UUVA 3EDPA 3KP2A 3J81Z 2HFHA 2ZMEB 1IUYA 4GYIA 1XN7A 3RDIA 1ZAOA 2FNPA 1GHCA 2GA2A 3DP7A 4A6DA 3E6BA 1ODDA 1HKQA 4ZZLA 1T39A 2HYFA 1IRGA 3BPXA 4AVPA 2DTRA 3K69A 2PEXA 1WQ2A 1FZPB 5LGTA 3RYPA 2GZWA 4A0YA 1SFEA 2HWVA 3L7WA 3F23A 1G3WA 5HOOA 2ZKZA 5L3DA 5BPIA 1J9IA 2GQQA 2E1CA 1ZGAA 4XBFA 2OU2A 5LRSA 2HR3A 2VC1A 3F3XA 5AIPA 2MH2A 5HS8A 3P9CA 3WG9A 1T2KA 3J80K 3I53A 1K78B 1QGPA 2XAFA 3HSFA 4N9HA 2FOKA 2QLZA 3GO5A 3T5XA 2LNBA 5EEGA 4RB2C 3NRVA 5DDGA 3TOBA 2KJCA 3RYRA 2IW5A 4WF2A 3J81K 5K5RA 3GX4X 4KN7X 3QOPA 2M8EA 1FT9A 3ZN0A 3WGIA 2XGXA 3KE2A 3C18A 1SMYF 1T98A 2FBKA 3HRSA 1CF7A 3IRRA 5H6QA 1P4WA 4M73A 4RGRA 3F21A 4YIIA 2ZBKA 1IXCA 2J5OA 2DQLA 2HTJA 2RKHA 2PG4A 1Z6RA 4I7HA 5F1RA 1W5SA 2ETHA 3N97A 1YIOA 4KIGA 3IWFA 3IHUA 4LK1F 3W6JB 4YG2F 5ICGA 1ZGJA 3V8JA 1KU2A 4HF0A 3GYHX 5E20A 3L2CA 1BOAA 4LD5A 2QBYA 4L18B 1OMIA 2CQKA 1QNTA 2E1NA 4R79A 3OOPA 3H3UA 1ZH5A 4XLPF 4IPAA 3WTYC 3F22A 3ML6A 1J2XA 4KNYA 2VT2A 3GZ5A 3H92A 3E5QA 5DCMA 2W24A 3R0JA 2R7FA 4L5JA 4KIFA 1T0FA 1I27A 5CLSA 1PUEE 1J7KA 1RIOH 2DK5A 2KJBA 4N9IA 4L9TA 3T1BA 3FX3A 4YFXF 3CUQB 1BI0A 3IL2A 1TW3A 1TNTA 3PFIA 4IHSA 1IN7A 3SFZA 3JTHA 4KFCA 1HSJA 4RGUA 3PQJA 3AAFA 3R6SA 4EGYA 3TO6A 1REPC 2FU4A 2F5CA 4RAZA 1SAXA 1W7PD 2LF8A 3KZZA 4HDVA 5D4RA 1QBJA 4L9NA 5LEKA 1KA8A 2Z9OA 2QQBA 1HW5A 5DCMB 5K5OA 4AIKA 5K1YA 4UVBA 3FM3A 2D45A 1HKSA 3M8FA 1W4MA 2HZTA 1LJ9A 2R3SA 1KQ9A 2PN6A 2FNAA 3LA2A 3ZPLA 5FLXZ 4FX4A 1USTA 5ILVA 2OBPA 2H27A 1ZG5A 4EMSA 2WV0A 1G4DA 1JXSA 4Y13A 2PMHA 1RI7A 1LNWA 4A6EA 1U8RA 4ESFA 5K5QA 1J75A 1TQIA 4LG0A 1D3YA 4HAMA 1JHFA 3ERED 2V6CA 2C6YA 2BYVE 3KP7A 4CZZA 2RVCA 1RNLA 1GXQA 4WK8F 3TDZC 3U9GA 2ESNA 2YPRA 4JQFA 2DI3A 1XMAA 2Z33A 4EGZA 3FXRA 3R61A 5E1XA 1FP2A 3WTVC 2EA4A 1R23A 1YS6A 2XV4S 2CW0F 3HOSA 2EA2A 3R0AA 2FBHA 4EV0A 2MD5A 2QWWA 3CUQC 2UXXA 3Q9VA 4HLXA 2ZJ2A 1UFMA 4HDUA 2HTSA 3RKXA 1GXPA 3F8NA 5DYMA 5BOXA 4G9YA 1B59A 1XDSA 4XSZF 4M72A 3SHFA 5FLXK 3HHGA 5BMZA 2GA1A 3L9FA 2F2EA 3WU0A 3PQKA 2NNYA 1C0WA 1IW7F 1MJAA 1O3TA 3O2PE 1FYKA 5LGUA 4KUMA 4OIRF 1E2XA 1XGNA 3K1MA 4RS8A 1YLFA 2GAUA 4ZH4F 5AIQA 4M9ZA 2XAHA 3P7NA 2ZNZA 1IN5A 1XGOA 1LDKB 1D8JA 3M9AA 1U78A 1S29A 5JHUA 3E6DA 3ZMSA 1HXDA 5DD8A 2LF7A 1UHWA 1LEAA 1FYMA 2M5WA 5J6XA 5FB2A 2HEOA 4P9FA 2BE5F 4DNCA 4G7HF 1XD7A 2M87A 2XKPA 3S2WA 1JGSA 1USSA 3ECOA 2CYYA 5ED4A 1U3EM 3TOAA 3LQRA 4HF1A 3FM5A 1BI2A 1L0OC 1XGMA 4OOIA 4UXNA 5CYVA 2OZ6A 4AD9A 2PBIA 3DEUA 3CO7C 4M6YA 3HRUA 3LA7A 5HDKA 2BEOA 4D0PA 2VONA 3RPQA 4O6JA 1OPCA 2EV5A 3F8BA 1IRFA 1W5TA 2E7XA 3L00A 3LFKA 1UHMA 2OA4A 1BC7C 4P9UA 1H9GA 4IRHA 3LAJA 1ON1A 4U7BA 3JSPA 3QRFF 2ZMEA 2WWYA 2ACJA 4LLLA 1R5GA 1ULYA 3P9IA 2V1UA 1BIBA 5E17F 1S8NA 2V1DA 1D8KA 2L4MA 2F5FA 1OR7A 4I01A 2VBWA 2PJPA 1IN6A 5F6FA 5JI6A 3QPTA 2STTA 1HW1A 2XROA 3GFMA 2O3FA 4HX7A 4LJZF 4Q5SF 1XCBA 3CTAA 1Z05A 4B09A 1FLIA 4I02A 3GFLA 2VBZA 4AIJA 1ZRDA 1AWCA 4L0YB 3WTSC 1ONVA 2YX4A 3DFGA 5BS6A 2RGVA 4MQ9F 4KICA 3TKYA 1R58A 2M30A 3U1DA 3B73A 2VOOA 3DXJF 1K78A 1O7FA 3I54A 5HLHA 4YIFA 3KEQA 1P6RA 4U0YA 1S7OA 2ZXJA 1T38A 1SD4A 1TW2A 1MDMB 4GYGA 1OYIA 4CICA 2PI0A 2XAQA 1RUOA 2DLLA 4ENNA 2EFNA 3GUDA 3F6OA 4A12A 1IXSB 5BPDA 4IHTA 4FT8A 3TO9A 2AXLA 5JVTA 2J5PA 2K02A 4M6XA 1YO5C 3WODF 2QYOA 2DPUA 5EEHA 3G3ZA 3SQNA 4MTEA 2X4HA 2ADUA 4U0WA 1P4AA 5D8KB 3EETA 1O7LA 4P5OA 1R5HA 3DF8A 1DPRA 4HQMA 4A0ZA 2YSRA 3K0LA 3E97A 2G7UA 5FD6A 3V7RA 4M71A 3Q5FA 3BOQA 4UV9A 2DW4A 2P8TA 4S05A 1FPQA 1BBYA 4BXUA 2PMUA 3GEZA 3BWGA 4H0EA 1XMKA 1K7AA 3RTRA 3MZHA 1D5VA 4BHBA 3QAHA 5HS7A 2NYXA 5LHIA 3KP4A 4HBLA 1W7PB 2D1VA 2FE3A 1GVJA 4OINF 2IVMA 2LDUA 3KLNA 1OYYA 1FSEA 2RNJA 3CUQA 2UWMA 3KETA 1G6NA 3BROA 1EH8A 1R7JA 3W6KB 3FZVA 5E8GA 4XLNF 4F7ZA 1XSVA 4EM1A 3B02A 3M8EA 3C7JA 1E17A 2OQGA 3SZPA 2K7LA 2P5VA 2QVOA 1LDJA 2E7WA 3CO6C 1U5TB 2QQ9A 1BC8C 4MNUA 1DDNA 1O57A 4NQWA 3I59B 1YS7A 1O3RA 3GFIA 1I1SA 2DT5A 4OIOF 4LB6B 4BQAA 1IAWA 4U88A 1ZG3A 1TQMA 1ZRFA 2LKPA 4XRFA 3P9KA 3F6VA 2QZ8A 2MC3A 2KKOA 4HV6A 2FMLA 3RKWA 4OMZA 1FP1D 2O8XA 1FBSA 2EB7A 4BH9A 1LVAA 3JSOA 3OV8A 5H6RA 3BDDA 5LBQA 2QUFA 2AS5F 4Z2YA 4ENJA 2PFBA 1XGSA 1XCVA 2FSWA 5DUKA 2P4WA 4HV5A 2P6TA 1QZZA 3COAC 4BHCA 4IXAA 1XSXA 2W85A 3BJ6A 4PGGA 5LRRA 4A0XA 4HZFA 4AIHA 2CGPA 3RI4A 3I0TA 2FQ3A 3O3KA 3WGHA 2RN7A 4LK0F 4KMUX 4MTDA 2ISZA 3BPVA 2A07F 1QPMA 3MQ0A 2O61A 5FO5A 5CVVA 4WXCA 4HOBA 3HTSB 3KCCA 2XIGA 1FX7A 1DPUA 4KMFA 1SMTA 5J8FA 2VOPA 1XSDA 2P6SA 1U5TC 3WGGA 3FHZA 3GXOA 3HOTA 1NHAA 3V8KA 1DP7P 2JPBA 1P4XA 3IRQA 3ZQ7A 2CWEA 3HTUA 3EYIA 1KU7A 3T0YA 2COMA 4EM2A 3VOEA 1YW8A 2XHKA 2B0LA 4HF2A 4UNOA 2STWA 2V9VA 3HSEA 5J8CA 3BJOA 4LFUA 5IT9Z 4JBAA 3ISPA 2BV6A 3ECHA 2GIVA 3E6MA 1RUNA 1ZN2A 2VC0A 5ILSA 2MBFA 3LA3A 2DQRA 1R36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5V A;  1IF1 A;  4OIP F;  2EFQ A;  4WWC A;  3F72 A;  3IKV A;  3K2Z A;  1FNN A;  3WTX C;  4OMY A;  2HYG D;  1YTY A;  2KIM A;  2ZFW A;  3L09 A;  5HDN A;  3MWM A;  1G3S A;  3KFW X;  5E18 F;  4MEX F;  2FBI A;  4UVA A;  4PZJ A;  4MHG A;  3F8M A;  5H20 A;  2HKO A;  1IXR C;  3WTU C;  4Q47 A;  4MEY F;  2L54 A;  2OQR A;  4P96 A;  1T6S A;  5CVI A;  2DBB A;  3IC7 A;  2NNN A;  3WTT C;  4L5I A;  2JPC A;  3O6B B;  3D0S A;  5LEJ A;  1BJA A;  1F5T A;  1H0M A;  1G3T A;  1XDU A;  2FA5 A;  1EH7 A;  5L3F A;  2WTE A;  1KU9 A;  1YYV A;  4ESJ A;  2W84 A;  3EQL F;  4CDG A;  2VBY A;  4A5M A;  1X3U A;  1SD6 A;  2DK8 A;  2A61 A;  3FMS A;  4U0V A;  2XAS A;  4R1H A;  1Q1H A;  5IT9 K;  5DUI A;  5CVR A;  3IWZ A;  4ENM A;  1R1V A;  3FXQ A;  2Y75 A;  2OZU A;  4WX9 A;  1OYW A;  2CSO A;  1G3Y A;  1BI3 A;  1Z9C A;  3TQN A;  3HRM A;  4L0Z B;  3ZP5 A;  5D5X B;  1IZ1 A;  2Z5U A;  2ESH A;  3TO7 A;  1EV7 A;  4BNC A;  2KIF A;  1MD0 A;  3BJA A;  2EFW A;  3FMR A;  1K79 A;  5ICE A;  3RJP A;  1J5Y A;  3SZT A;  5L3E A;  1B4A A;  1V3F A;  4ZYE A;  4RB0 A;  1SD7 A;  3LQQ A;  3EUH A;  3T8T A;  2G7H A;  1MDM A;  3G73 A;  4EJO A;  4M9S A;  3GFJ A;  2GXG A;  3DKW A;  3VFZ A;  5E1W A;  1TNS A;  2HDC A;  3J7A O;  1P92 A;  4WXH A;  2A3S A;  1LB2 A;  4HQE A;  2Z99 A;  5D5V B;  3ZMU A;  5IT3 A;  1SD5 A;  2G9W A;  1AOY A;  2VXZ A;  3GLX A;  2F5E A;  3TDU C;  3N4M A;  4HX8 A;  3ROU A;  1KGS A;  3K9T A;  1I6X A;  1CGP A;  4IVN A;  3J80 Z;  1ZLJ A;  5FFZ A;  4M9X A;  4LMY A;  4GCV A;  3I4P A;  1BM9 A;  4BHP A;  4OIQ F;  2EV6 A;  3RPU A;  1ZRC A;  4PCQ A;  4KA4 A;  3KEO A;  5A2Q Z;  2MA3 A;  3FF5 A;  4GXO A;  1YW7 A;  4K2E A;  4CYD A;  1R00 A;  3JAM Z;  5E8I A;  5BQT A;  3RIR A;  1K6O A;  3H3Z A;  5DCF A;  3KLO A;  1WRJ A;  2VOD A;  4EM0 B;  1O3S A;  2RV8 A;  2L3D A;  5KK1 A;  4HX4 A;  4WCG A;  2ELH A;  1VTN C;  3M1E A;  5D5W B;  2JSC A;  2P7V B;  3RKY A;  4YFK F;  4IF4 A;  4RB1 A;  4ZYH A;  3GW2 A;  1P2F A;  1TLH B;  3HSR A;  4HLY A;  3WTW C;  4G6Q A;  2OD5 A;  4FHT A;  1ZG1 A;  3FWE A;  3QP6 A;  1W7P A;  5JFR A;  2XAJ A;  1YW9 A;  1BI1 A;  4BYY A;  2X0L A;  3R4K A;  2H6B A;  4L9J A;  3T8R A;  1FSH A;  4A5N A;  3E5U A;  4LLN A;  3TGN A;  5D6F A;  2HQN A;  1MGT A;  3ZMV A;  2IP2 A;  2JTV A;  3ABU A;  5LHH A;  1J0R A;  2O03 A;  2IPQ X;  3E3V A;  2EFP A;  2ISY A;  4TV7 A;  2ZO4 A;  1QQI A;  4HA8 A;  4LB5 A;  1BIA A;  4I2O A;  2EWN A;  1L3L A;  4KN4 X;  3VOD A;  4OU0 A;  5A2Q K;  4KDP A;  1FBU A;  4KYW A;  4XSX F;  3JAM K;  4IRI A;  2BBY A;  5LHG A;  2P5K A;  1ZLK A;  1U5T A;  1UCR A;  3MAJ A;  2HS5 A;  3FMQ A;  2VBX A;  4IRG A;  2VE8 A;  2D1H A;  4EJW A;  3F8C A;  3I59 A;  5HLG A;  1WI9 A;  1DUX C;  2K4B A;  3QP5 A;  1EH6 A;  3HRT A;  3MCZ A;  2PLY A;  5CJ9 A;  3CUO A;  1OKR A;  3HYI A;  2XKO A;  3SXY A;  3Q9S A;  2EK5 A;  3JW4 A;  1YG2 A;  2A69 F;  2A6H F;  4ENK A;  2FEZ A;  3NQO A;  1FC3 A;  1I5Z A;  2NS0 A;  2RDP A;  4YFN F;  2NAZ A;  1ZAR A;  2IA2 A;  3NEU A;  1R22 A;  2Q0O A;  3VB2 A;  2DAO A;  3DPL C;  2CG4 A;  3D5L A;  3CDH A;  2HQR A;  1Z1D A;  2JRT A;  1QO0 D;  2VN2 A;  1WSU A;  4EJT A;  1WKM A;  5F64 A;  3V4G A;  5ERI A;  1SFU A;  2YU3 A;  1MJ9 A;  2O0Y A;  1XB4 A;  5HVQ C;  1CF7 B;  3FXU A;  3GF2 A;  2LSO A;  4RGX A;  1KYZ A;  2FXA A;  4L9V A;  4DQ2 A;  2IRF G;  2W57 A;  4ON0 A;  4HYE A;  1JE8 A;  1B9M A;  2QEN A;  3C3W A;  2YX7 A;  2NRA C;  4ZYG A;  2O6G E;  3I58 A;  5FFX A;  1U6G A;  2A6E F;  1STZ A;  4JK1 X;  1ZHF A;  3HIF A;  3KP5 A;  1FBQ A;  3MFK A;  4LLG F;  4KT5 C;  2EFO A;  4ASN A;  3DQV C;  2HGC A;  4EQQ A;  2QBY B;  2H6C A;  2L4A A;  1Z6T A;  2VT3 A;  3EYY A;  1HW2 A;  5TJJ A;  3BZ6 A;  1LDD A;  4Q4Z F;  3ZMD A;  1SFX A;  1Y0U A;  1IN8 A;  1TBX A;  5KVR A;  3E6C C;  2YR2 A;  1FY7 A;  4BAY A;  5AON A;  1S3J A;  2Y0M A;  2ZCW A;  4IJA A;  2FMY A;  2PQ8 A;  2IJL A;  1KQ0 A;  1KQ8 A;  2UXN A;  1MZB A;  2GWR A;  4UVC A;  6PAX A;  1MJB A;  4RGS A;  1HBX G;  2MLK A;  1R1U A;  5ICC A;  4EJV A;  5L3B A;  1JHH A;  2M1B A;  2IT0 A;  4N0B A;  4Y17 A;  2FRH A;  4G7Z F;  3U2R A;  4KIB A;  4A2U A;  1ZYR F;  1A04 A;  1F1Z A;  4GGG A;  1S7A A;  3R60 A;  1QZY A;  2ZNY A;  4HW0 A;  3ZN1 A;  1TTY A;  1LEB A;  2EV0 A;  1F4K A;  2K4J A;  3BP8 A;  1RZ4 A;  2MH9 A;  5CVJ A;  5TRD A;  3WU1 B;  2V1X A;  3LWF A;  1ZRE A;  1FYL A;  1HST A;  3JTG A;  1I1G A;  2IA0 A;  4CXF A;  2OAZ A;  4ETS A;  4NHJ A;  2H09 A;  3M7G A;  2MLG A;  2JZY A;  5D4S A;  3F8F A;  4UV8 A;  4I0A A;  1PP8 F;  4E70 A;  4G8X A;  2DPD A;  2EJR A;  4FX0 A;  2DO7 A;  1B9N A;  2P7C B;  2FF4 A;  2XAG A;  3REO A;  1PDN C;  2HKX A;  5CVU A;  1YFH A;  4LGW A;  2IA1 A;  4NB5 A;  3ABT A;  1KU3 A;  3GZ6 A;  3WE3 A;  5L3G A;  4O3M A;  2P5L C;  2A68 F;  2R7D A;  4U7D A;  3C1D A;  1HQC A;  4LG0 B;  3K1N A;  1WWX A;  4CO8 A;  1U2W A;  5L3C A;  5D5U B;  5ICF A;  4G6D A;  3GWZ A;  2CFX A;  1FOK A;  5HLI A;  2M45 A;  2QQA A;  2F5D A;  4RB3 C;  1B1B A;  2RC4 A;  5D6E A;  2JT1 A;  4ZZD A;  3V7C A;  3BY6 A;  2DFI A;  4I09 A;  3WE2 A;  5HS9 A;  4GO1 A;  5LGN A;  2RQP A;  5DV5 A;  1V4R A;  2XRN A;  2WC2 A;  2Q8K A;  1B6A A;  4AWX B;  2W25 A;  1Z7U A;  4RAY A;  3KZY A;  4ZYD A;  4I98 B;  2CO5 A;  2VE9 A;  4P55 A;  1O3Q A;  2K86 A;  1H9T A;  3CJN A;  1MKM A;  2HOE A;  3IKT A;  3KP3 A;  1BN5 A;  4QLC U;  1PP7 U;  2L01 A;  5ILU A;  1ON2 A;  3ZMT A;  3WTZ A;  5FGM A;  5DEQ A;  4CHU A;  3MEX A;  4G7O F;  2XUB A;  2KIU A;  1TQP A;  4R8H A;  1UB9 A;  4ESB A;  2H94 A;  4QWQ A;  5JR3 A;  3E5X A;  2A5Y B;  4Q48 A;  2XVC A;  2TDX A;  3V8L A;  3ELK A;  4UHT A;  3DPT A;  2L02 A;  3HUG A;  3ULQ B;  1R1T A;  3CLO A;  3QU3 A;  3HHH A;  4Y15 A;  5D8L B;  2KRF A;  1LQ1 A;  4I0B A;  2QM3 A;  2Y48 A;  1F9N A;  4PGH A;  4WXD A;  5HDG A;  4MGR A;  4S04 A;  4EVI A;  1S6L A;  4B8X A;  3QU6 A;  5LLQ A;  1Z91 A;  2GXB A;  2D2W A;  3V7S A;  3VEP A;  3LST A;  5E1Z B;  3I64 A;  4G94 A;  3DV8 A;  4EJU A;  2K27 A;  4M74 A;  3ZMZ A;  1J59 A;  5FD5 A;  4PDK A;  1HKT A;  2Z3Y A;  2BGC A;  3I71 A;  3LAP A;  1FWZ A;  2V79 A;  3QPH A;  3KP6 A;  2DU9 A;  1KYW A;  3MZY A;  1IN4 A;  3K1P A;  4CGZ A;  3I5U A;  5DD4 A;  4MQV A;  2Q2E A;  2UZK A;  3GVA A;  1YQA A;  4UUV A;  3EDP A;  3KP2 A;  3J81 Z;  2HFH A;  2ZME B;  1IUY A;  4GYI A;  1XN7 A;  3RDI A;  1ZAO A;  2FNP A;  1GHC A;  2GA2 A;  3DP7 A;  4A6D A;  3E6B A;  1ODD A;  1HKQ A;  4ZZL A;  1T39 A;  2HYF A;  1IRG A;  3BPX A;  4AVP A;  2DTR A;  3K69 A;  2PEX A;  1WQ2 A;  1FZP B;  5LGT A;  3RYP A;  2GZW A;  4A0Y A;  1SFE A;  2HWV A;  3L7W A;  3F23 A;  1G3W A;  5HOO A;  2ZKZ A;  5L3D A;  5BPI A;  1J9I A;  2GQQ A;  2E1C A;  1ZGA A;  4XBF A;  2OU2 A;  5LRS A;  2HR3 A;  2VC1 A;  3F3X A;  5AIP A;  2MH2 A;  5HS8 A;  3P9C A;  3WG9 A;  1T2K A;  3J80 K;  3I53 A;  1K78 B;  1QGP A;  2XAF A;  3HSF A;  4N9H A;  2FOK A;  2QLZ A;  3GO5 A;  3T5X A;  2LNB A;  5EEG A;  4RB2 C;  3NRV A;  5DDG A;  3TOB A;  2KJC A;  3RYR A;  2IW5 A;  4WF2 A;  3J81 K;  5K5R A;  3GX4 X;  4KN7 X;  3QOP A;  2M8E A;  1FT9 A;  3ZN0 A;  3WGI A;  2XGX A;  3KE2 A;  3C18 A;  1SMY F;  1T98 A;  2FBK A;  3HRS A;  1CF7 A;  3IRR A;  5H6Q A;  1P4W A;  4M73 A;  4RGR A;  3F21 A;  4YII A;  2ZBK A;  1IXC A;  2J5O A;  2DQL A;  2HTJ A;  2RKH A;  2PG4 A;  1Z6R A;  4I7H A;  5F1R A;  1W5S A;  2ETH A;  3N97 A;  1YIO A;  4KIG A;  3IWF A;  3IHU A;  4LK1 F;  3W6J B;  4YG2 F;  5ICG A;  1ZGJ A;  3V8J A;  1KU2 A;  4HF0 A;  3GYH X;  5E20 A;  3L2C A;  1BOA A;  4LD5 A;  2QBY A;  4L18 B;  1OMI A;  2CQK A;  1QNT A;  2E1N A;  4R79 A;  3OOP A;  3H3U A;  1ZH5 A;  4XLP F;  4IPA A;  3WTY C;  3F22 A;  3ML6 A;  1J2X A;  4KNY A;  2VT2 A;  3GZ5 A;  3H92 A;  3E5Q A;  5DCM A;  2W24 A;  3R0J A;  2R7F A;  4L5J A;  4KIF A;  1T0F A;  1I27 A;  5CLS A;  1PUE E;  1J7K A;  1RIO H;  2DK5 A;  2KJB A;  4N9I A;  4L9T A;  3T1B A;  3FX3 A;  4YFX F;  3CUQ B;  1BI0 A;  3IL2 A;  1TW3 A;  1TNT A;  3PFI A;  4IHS A;  1IN7 A;  3SFZ A;  3JTH A;  4KFC A;  1HSJ A;  4RGU A;  3PQJ A;  3AAF A;  3R6S A;  4EGY A;  3TO6 A;  1REP C;  2FU4 A;  2F5C A;  4RAZ A;  1SAX A;  1W7P D;  2LF8 A;  3KZZ A;  4HDV A;  5D4R A;  1QBJ A;  4L9N A;  5LEK A;  1KA8 A;  2Z9O A;  2QQB A;  1HW5 A;  5DCM B;  5K5O A;  4AIK A;  5K1Y A;  4UVB A;  3FM3 A;  2D45 A;  1HKS A;  3M8F A;  1W4M A;  2HZT A;  1LJ9 A;  2R3S A;  1KQ9 A;  2PN6 A;  2FNA A;  3LA2 A;  3ZPL A;  5FLX Z;  4FX4 A;  1UST A;  5ILV A;  2OBP A;  2H27 A;  1ZG5 A;  4EMS A;  2WV0 A;  1G4D A;  1JXS A;  4Y13 A;  2PMH A;  1RI7 A;  1LNW A;  4A6E A;  1U8R A;  4ESF A;  5K5Q A;  1J75 A;  1TQI A;  4LG0 A;  1D3Y A;  4HAM A;  1JHF A;  3ERE D;  2V6C A;  2C6Y A;  2BYV E;  3KP7 A;  4CZZ A;  2RVC A;  1RNL A;  1GXQ A;  4WK8 F;  3TDZ C;  3U9G A;  2ESN A;  2YPR A;  4JQF A;  2DI3 A;  1XMA A;  2Z33 A;  4EGZ A;  3FXR A;  3R61 A;  5E1X A;  1FP2 A;  3WTV C;  2EA4 A;  1R23 A;  1YS6 A;  2XV4 S;  2CW0 F;  3HOS A;  2EA2 A;  3R0A A;  2FBH A;  4EV0 A;  2MD5 A;  2QWW A;  3CUQ C;  2UXX A;  3Q9V A;  4HLX A;  2ZJ2 A;  1UFM A;  4HDU A;  2HTS A;  3RKX A;  1GXP A;  3F8N A;  5DYM A;  5BOX A;  4G9Y A;  1B59 A;  1XDS A;  4XSZ F;  4M72 A;  3SHF A;  5FLX K;  3HHG A;  5BMZ A;  2GA1 A;  3L9F A;  2F2E A;  3WU0 A;  3PQK A;  2NNY A;  1C0W A;  1IW7 F;  1MJA A;  1O3T A;  3O2P E;  1FYK A;  5LGU A;  4KUM A;  4OIR F;  1E2X A;  1XGN A;  3K1M A;  4RS8 A;  1YLF A;  2GAU A;  4ZH4 F;  5AIQ A;  4M9Z A;  2XAH A;  3P7N A;  2ZNZ A;  1IN5 A;  1XGO A;  1LDK B;  1D8J A;  3M9A A;  1U78 A;  1S29 A;  5JHU A;  3E6D A;  3ZMS A;  1HXD A;  5DD8 A;  2LF7 A;  1UHW A;  1LEA A;  1FYM A;  2M5W A;  5J6X A;  5FB2 A;  2HEO A;  4P9F A;  2BE5 F;  4DNC A;  4G7H F;  1XD7 A;  2M87 A;  2XKP A;  3S2W A;  1JGS A;  1USS A;  3ECO A;  2CYY A;  5ED4 A;  1U3E M;  3TOA A;  3LQR A;  4HF1 A;  3FM5 A;  1BI2 A;  1L0O C;  1XGM A;  4OOI A;  4UXN A;  5CYV A;  2OZ6 A;  4AD9 A;  2PBI A;  3DEU A;  3CO7 C;  4M6Y A;  3HRU A;  3LA7 A;  5HDK A;  2BEO A;  4D0P A;  2VON A;  3RPQ A;  4O6J A;  1OPC A;  2EV5 A;  3F8B A;  1IRF A;  1W5T A;  2E7X A;  3L00 A;  3LFK A;  1UHM A;  2OA4 A;  1BC7 C;  4P9U A;  1H9G A;  4IRH A;  3LAJ A;  1ON1 A;  4U7B A;  3JSP A;  3QRF F;  2ZME A;  2WWY A;  2ACJ A;  4LLL A;  1R5G A;  1ULY A;  3P9I A;  2V1U A;  1BIB A;  5E17 F;  1S8N A;  2V1D A;  1D8K A;  2L4M A;  2F5F A;  1OR7 A;  4I01 A;  2VBW A;  2PJP A;  1IN6 A;  5F6F A;  5JI6 A;  3QPT A;  2STT A;  1HW1 A;  2XRO A;  3GFM A;  2O3F A;  4HX7 A;  4LJZ F;  4Q5S F;  1XCB A;  3CTA A;  1Z05 A;  4B09 A;  1FLI A;  4I02 A;  3GFL A;  2VBZ A;  4AIJ A;  1ZRD A;  1AWC A;  4L0Y B;  3WTS C;  1ONV A;  2YX4 A;  3DFG A;  5BS6 A;  2RGV A;  4MQ9 F;  4KIC A;  3TKY A;  1R58 A;  2M30 A;  3U1D A;  3B73 A;  2VOO A;  3DXJ F;  1K78 A;  1O7F A;  3I54 A;  5HLH A;  4YIF A;  3KEQ A;  1P6R A;  4U0Y A;  1S7O A;  2ZXJ A;  1T38 A;  1SD4 A;  1TW2 A;  1MDM B;  4GYG A;  1OYI A;  4CIC A;  2PI0 A;  2XAQ A;  1RUO A;  2DLL A;  4ENN A;  2EFN A;  3GUD A;  3F6O A;  4A12 A;  1IXS B;  5BPD A;  4IHT A;  4FT8 A;  3TO9 A;  2AXL A;  5JVT A;  2J5P A;  2K02 A;  4M6X A;  1YO5 C;  3WOD F;  2QYO A;  2DPU A;  5EEH A;  3G3Z A;  3SQN A;  4MTE A;  2X4H A;  2ADU A;  4U0W A;  1P4A A;  5D8K B;  3EET A;  1O7L A;  4P5O A;  1R5H A;  3DF8 A;  1DPR A;  4HQM A;  4A0Z A;  2YSR A;  3K0L A;  3E97 A;  2G7U A;  5FD6 A;  3V7R A;  4M71 A;  3Q5F A;  3BOQ A;  4UV9 A;  2DW4 A;  2P8T A;  4S05 A;  1FPQ A;  1BBY A;  4BXU A;  2PMU A;  3GEZ A;  3BWG A;  4H0E A;  1XMK A;  1K7A A;  3RTR A;  3MZH A;  1D5V A;  4BHB A;  3QAH A;  5HS7 A;  2NYX A;  5LHI A;  3KP4 A;  4HBL A;  1W7P B;  2D1V A;  2FE3 A;  1GVJ A;  4OIN F;  2IVM A;  2LDU A;  3KLN A;  1OYY A;  1FSE A;  2RNJ A;  3CUQ A;  2UWM A;  3KET A;  1G6N A;  3BRO A;  1EH8 A;  1R7J A;  3W6K B;  3FZV A;  5E8G A;  4XLN F;  4F7Z A;  1XSV A;  4EM1 A;  3B02 A;  3M8E A;  3C7J A;  1E17 A;  2OQG A;  3SZP A;  2K7L A;  2P5V A;  2QVO A;  1LDJ A;  2E7W A;  3CO6 C;  1U5T B;  2QQ9 A;  1BC8 C;  4MNU A;  1DDN A;  1O57 A;  4NQW A;  3I59 B;  1YS7 A;  1O3R A;  3GFI A;  1I1S A;  2DT5 A;  4OIO F;  4LB6 B;  4BQA A;  1IAW A;  4U88 A;  1ZG3 A;  1TQM A;  1ZRF A;  2LKP A;  4XRF A;  3P9K A;  3F6V A;  2QZ8 A;  2MC3 A;  2KKO A;  4HV6 A;  2FML A;  3RKW A;  4OMZ A;  1FP1 D;  2O8X A;  1FBS A;  2EB7 A;  4BH9 A;  1LVA A;  3JSO A;  3OV8 A;  5H6R A;  3BDD A;  5LBQ A;  2QUF A;  2AS5 F;  4Z2Y A;  4ENJ A;  2PFB A;  1XGS A;  1XCV A;  2FSW A;  5DUK A;  2P4W A;  4HV5 A;  2P6T A;  1QZZ A;  3COA C;  4BHC A;  4IXA A;  1XSX A;  2W85 A;  3BJ6 A;  4PGG A;  5LRR A;  4A0X A;  4HZF A;  4AIH A;  2CGP A;  3RI4 A;  3I0T A;  2FQ3 A;  3O3K A;  3WGH A;  2RN7 A;  4LK0 F;  4KMU X;  4MTD A;  2ISZ A;  3BPV A;  2A07 F;  1QPM A;  3MQ0 A;  2O61 A;  5FO5 A;  5CVV A;  4WXC A;  4HOB A;  3HTS B;  3KCC A;  2XIG A;  1FX7 A;  1DPU A;  4KMF A;  1SMT A;  5J8F A;  2VOP A;  1XSD A;  2P6S A;  1U5T C;  3WGG A;  3FHZ A;  3GXO A;  3HOT A;  1NHA A;  3V8K A;  1DP7 P;  2JPB A;  1P4X A;  3IRQ A;  3ZQ7 A;  2CWE A;  3HTU A;  3EYI A;  1KU7 A;  3T0Y A;  2COM A;  4EM2 A;  3VOE A;  1YW8 A;  2XHK A;  2B0L A;  4HF2 A;  4UNO A;  2STW A;  2V9V A;  3HSE A;  5J8C A;  3BJO A;  4LFU A;  5IT9 Z;  4JBA A;  3ISP A;  2BV6 A;  3ECH A;  2GIV A;  3E6M A;  1RUN A;  1ZN2 A;  2VC0 A;  5ILS A;  2MBF A;  3LA3 A;  2DQR A;  1R36 A; 
#chains in the Genus database with same CATH topology
 4XON A;  2KZG A;  4O5V A;  1IF1 A;  4OIP F;  2EFQ A;  1POG A;  3I4N J;  2VXD A;  3TP0 A;  3F72 A;  4WWC A;  1MIJ A;  1BR4 A;  1RET A;  3IKV A;  3HBL A;  3K2Z A;  1DU6 A;  1FNN A;  4PFP A;  1GT0 C;  2DMT A;  5K7Z A;  1FOW A;  3PNY A;  3WTX C;  4OMY A;  2HYG D;  1YTY A;  5FLV A;  2KIM A;  1T33 A;  2ZFW A;  3L09 A;  2E71 A;  2EIL H;  5HDN A;  1BA5 A;  3I56 I;  4M3G A;  3MWM A;  3G6E I;  1TL8 A;  1G3S A;  2JWT A;  2DJI A;  3KFW X;  5E18 F;  4MEX F;  2FBI A;  4UVA A;  1U0J A;  4PZJ A;  1RR7 A;  5E3M A;  5EYR A;  4MHG A;  5HLT A;  3F8M A;  4NUB A;  5H20 A;  1VQ8 I;  1YX5 A;  2HKO A;  1IXR C;  3WTU C;  4Q47 A;  3CCU I;  4MEY F;  2L54 A;  2R7S A;  1M1E B;  5TIS C;  2OQR A;  4P96 A;  1T6S A;  1S7E A;  2CQQ A;  5CVI A;  2DBB A;  3IC7 A;  2NNN A;  3WTT C;  3LMM A;  4L5I A;  2JPC A;  3O6B B;  3D0S A;  4AC0 A;  2DMP A;  5F04 A;  1BJA A;  5LEJ A;  1F5T A;  1H0M A;  1JI8 A;  1G3T A;  1XDU A;  1HF0 A;  2FA5 A;  1EH7 A;  3FK6 A;  5L3F A;  4CUG A;  2WTE A;  5EZH A;  3E0J B;  1OCP A;  2F4O B;  1JT0 A;  1KU9 A;  1YYV A;  4ESJ A;  3QPS A;  2W84 A;  3EQL F;  4CDG A;  2JA5 J;  2VBY A;  4A5M A;  4IHV A;  1X3U A;  3K10 A;  1YOV B;  1SD6 A;  5GPC A;  3ABK H;  3LSG A;  2K9L A;  2M0M A;  2DK8 A;  3M3Y J;  3KYD B;  2A61 A;  3FMS A;  1JTX A;  5FKO A;  4U0V A;  2ID3 A;  2XAS A;  4R1H A;  1Q1H A;  4RM2 A;  4HST A;  2V6E A;  5IT9 K;  1S72 I;  5DUI A;  5CVR A;  1D5Y A;  3ERM A;  3IWZ A;  2LD5 A;  4ENM A;  2W82 A;  1R1V A;  3FXQ A;  2Y75 A;  2OZU A;  2RAE A;  3H36 A;  4HSR A;  5F0F A;  4WX9 A;  1OYW A;  2DOA A;  1IJW C;  2CSO A;  1G3Y A;  2LY2 A;  1K6Y A;  2LKX A;  1BI3 A;  1HCR A;  1D0Z A;  1MBJ A;  2K85 A;  3H35 A;  1Z9C A;  3O8G A;  2O9L A;  1I39 A;  2XPW A;  3TQN A;  4BXF A;  3HRM A;  4EEF G;  5EG0 B;  4L0Z B;  5IPA A;  2X1E A;  3ZP5 A;  3A4C A;  5D5X B;  3DTI A;  5K7F A;  1IZ1 A;  1SVL A;  2Z5U A;  1FMV A;  1B8I A;  2ESH A;  3TO7 A;  4NNJ A;  1EV7 A;  3OOU A;  2KRH A;  5E3O A;  4XIC A;  4BNC A;  2KIF A;  1MD0 A;  3BJA A;  2EFW A;  3FMR A;  1K79 A;  5ICE A;  3HPH A;  1J09 A;  3RJP A;  3L2V A;  1J5Y A;  3BR6 A;  3SZT A;  5L3E A;  1B4A A;  1V3F A;  4ZYE A;  3G71 I;  4RB0 A;  1SD7 A;  3LQQ A;  3MMY B;  4I76 A;  3OY9 A;  1VQP I;  2IGM A;  5EGO B;  2E5N A;  3EUH A;  3T8T A;  1LFP A;  2XGC A;  2G7H A;  1MDM A;  4BJT A;  5FKL A;  3OYH A;  3G73 A;  4DYC A;  2NXN B;  3FHN A;  3SEZ A;  3OYM A;  3GTP J;  4EJO A;  4M9S A;  1VI0 A;  3TL4 X;  3PUB A;  3GFJ A;  2GXG A;  1ZR2 A;  3DKW A;  3VFZ A;  3IH3 A;  2MG4 A;  1HDP A;  2DA5 A;  5E1W A;  1QHG A;  1TNS A;  2HDC A;  2LR8 A;  5JVG F;  2NVU B;  3J7A O;  1P92 A;  4WXH A;  1Z21 A;  2A3S A;  2HI3 A;  1LB2 A;  4V2G A;  4HQE A;  1ZR4 A;  2Z99 A;  3BR0 A;  4BDZ A;  4FET A;  2BW3 A;  3L2Q A;  5D5V B;  5C4X J;  3ZMU A;  5IT3 A;  1SD5 A;  2QA4 I;  2G9W A;  2R7Q A;  1AOY A;  4A3G J;  1V5E A;  2P0W A;  2VXZ A;  5M5Y J;  1X3W B;  1RRJ A;  3GLX A;  2H8W A;  2F5E A;  2VJ4 A;  3TDU C;  3OIQ A;  4BQN A;  4HX8 A;  3N4M A;  3ROU A;  1A31 A;  3J7A Y;  3S17 J;  1KGS A;  1A5J A;  2AQF A;  3K9T A;  1I6X A;  3SZG A;  1CGP A;  4IVN A;  3J80 Z;  3GBG A;  3IP4 B;  1ZLJ A;  3K4B A;  5GTI C;  5FFZ A;  4M9X A;  4LMY A;  2JRM A;  4GCV A;  3I4P A;  1X1C A;  5IY5 H;  1HC8 A;  1BM9 A;  4BHP A;  3BG9 A;  4OIQ F;  2JSP A;  2R7W A;  2EV6 A;  3D5S C;  3RPU A;  4JP0 A;  1ZRC A;  4PCQ A;  1G2H A;  3K2A A;  5DM7 F;  4KA4 A;  3KEO A;  3HUG B;  3H0D A;  5A2Q Z;  3S1N J;  2MA3 A;  3FF5 A;  4GXO A;  4UY8 I;  1YW7 A;  4K2E A;  4CYD A;  1R00 A;  2E5Z A;  3JAM Z;  4HNU A;  4D9J A;  3W2W A;  1F43 A;  5E8I A;  2EIJ H;  2WAQ A;  5BQT A;  2R7U A;  3RIR A;  1FOX A;  1K6O A;  3H3Z A;  5DCF A;  3BC8 A;  3RKQ A;  1MBH A;  3KLO A;  1WRJ A;  2VOD A;  4QTR A;  3ZQF A;  4EM0 B;  1O3S A;  2K9S A;  2RV8 A;  2L3D A;  5KK1 A;  4HX4 A;  4XLC A;  4WCG A;  3JR9 A;  3GTK J;  2ELH A;  1VTN C;  1HLV A;  1SAN A;  1KZH A;  3M1E A;  5D5W B;  2JSC A;  2P7V B;  2DFE A;  3RKY A;  4YFK F;  5J1R A;  1TWF J;  4IF4 A;  2XDV A;  3OSG A;  4RB1 A;  4ZYH A;  3GW2 A;  3NWT A;  3JRH A;  1P2F A;  1TLH B;  1OCR H;  1GV2 A;  3HSR A;  2CQN A;  4HLY A;  3BQY A;  3WTW C;  2EBI A;  4G6Q A;  2VJ5 A;  2OD5 A;  4J00 A;  2IS2 A;  4FHT A;  4PUS A;  5DTD A;  4S0H B;  1ZG1 A;  3FWE A;  1OFC X;  1W7P A;  3MD2 A;  2XAJ A;  3QP6 A;  5JFR A;  4CYC B;  3OSF A;  1YW9 A;  1MBF A;  1BI1 A;  3M1C A;  4BYY A;  2X0L A;  2HOS A;  4W1U A;  2E19 A;  2OV7 A;  3R4K A;  2H6B A;  4L9J A;  1JKR C;  4GFB A;  3T8R A;  3EUK L;  1FSH A;  4A5N A;  3E5U A;  4LLN A;  3OYE A;  3B6A A;  3TGN A;  2OCC H;  5D6F A;  3IAM 2;  2K3P A;  4QIW N;  2HQN A;  2KHM A;  1MGT A;  1T56 A;  2Q2E B;  3ZMV A;  2IP2 A;  2CV0 A;  1N78 A;  1BOB A;  2JTV A;  3ABU A;  3CCQ I;  5LHH A;  5DM6 F;  1J0R A;  2CUJ A;  1K4S A;  5TGT A;  2O03 A;  2IPQ X;  3DPU A;  3E3V A;  2EFP A;  2ISY A;  2VPL A;  4C3J J;  4TV7 A;  2RNG A;  2ZO4 A;  1EKE A;  4KIT B;  1QQI A;  4HA8 A;  4LB5 A;  1FJL A;  1Y0N A;  1BIA A;  2OJE D;  1CQT A;  4I2O A;  2EWN A;  1L3L A;  2CUE A;  4KN4 X;  2X6W A;  3VOD A;  4OU0 A;  5A2Q K;  1U9N A;  4XN0 A;  4KDP A;  1FBU A;  4KYW A;  4XSX F;  3KPH A;  3JAM K;  1PJR A;  1Z77 A;  4BY1 J;  4IRI A;  3S32 A;  2BBY A;  5LHG A;  2PJR B;  2OC6 A;  2P5K A;  4BU2 A;  4IX7 A;  2DMQ A;  4LIV A;  1ZLK A;  1U5T A;  1UCR A;  4M3B A;  3M07 A;  3BZC A;  3MAJ A;  2HS5 A;  3FMQ A;  2V9P A;  2VBX A;  2WAF A;  4IRG A;  2VE8 A;  2D1H A;  4EJW A;  3F8C A;  3I59 A;  5HLG A;  1WI9 A;  1X3Z B;  1DUX C;  2K4B A;  1D1C A;  2CW8 A;  3HGG A;  1BJZ A;  3QP5 A;  3H3V K;  1EF4 A;  4F92 B;  3OYL A;  1MH4 A;  3K70 C;  3D1N I;  4PJJ A;  1EH6 A;  2ECB A;  1V55 H;  3HRT A;  3MCZ A;  2COB A;  2PLY A;  5CJ9 A;  1PVE A;  3X2Q H;  3CUO A;  1OKR A;  3BR5 A;  3HYI A;  2NS7 A;  2XKO A;  4B44 A;  5C3E J;  1MSF C;  3SXY A;  3RCO A;  3Q9S A;  5B1B H;  2EK5 A;  2HPI A;  2VQH A;  3JW4 A;  3SYT A;  1YRN A;  1YG2 A;  2A69 F;  2A6H F;  2FJ1 A;  2F4I A;  2HZD A;  1X58 A;  4B47 A;  3S8P A;  1X4P A;  5HOD A;  2E2H J;  2NOJ B;  1IRX A;  4AYB A;  4ENK A;  5EZG A;  2FEZ A;  4FE4 A;  2OTJ I;  2PMZ A;  3NQO A;  4YIR X;  1FC3 A;  4NC8 A;  2K3F A;  1I5Z A;  2NS0 A;  2K9M A;  2EIM H;  2RDP A;  4YFN F;  1YX3 A;  1W5C C;  1ZAR A;  2NAZ A;  4FE7 A;  4GRI A;  4RLF A;  2IA2 A;  3NEU A;  1R22 A;  2Q0O A;  1P7I A;  3VB2 A;  2DAO A;  3DPL C;  2CG4 A;  1W36 D;  3D5L A;  3CDH A;  2JA7 J;  2HQR A;  4II3 A;  1Z1D A;  2JRT A;  1QO0 D;  1QZE A;  4AID A;  3NAU A;  2VN2 A;  1WSU A;  4II2 A;  4FIS A;  3C2G A;  4EJT A;  1WKM A;  5F64 A;  3V4G A;  5FKK A;  1LUJ B;  4HNV A;  2JA8 J;  5ERI A;  3K4K A;  1SFU A;  2YU3 A;  1MJ9 A;  2B9S A;  2WA0 A;  4E7H A;  4DGW B;  1ENH A;  1MBG A;  2O0Y A;  4F55 A;  1XB4 A;  5HVQ C;  4UUS B;  2R7Z J;  2BZT A;  3OR1 C;  1CF7 B;  3FXU A;  3GF2 A;  2LSO A;  4RGX A;  1KYZ A;  2XSJ C;  2FXA A;  3OYN A;  3K7A J;  1H8A C;  4L9V A;  2B7E A;  4DQ2 A;  2IRF G;  2W57 A;  3BG6 A;  4ON0 A;  4HYE A;  3CME I;  1B9M A;  1JE8 A;  3FXK A;  2QEN A;  4RAF A;  3C3W A;  1X1B A;  2YX7 A;  4Y4R A;  2NRA C;  4FAS D;  4ZYG A;  2O6G E;  3I58 A;  3VYU B;  5KHD A;  3SJM A;  5FFX A;  1YJN I;  1U6G A;  2A6E F;  2DDA A;  1STZ A;  5EEA A;  1JJ8 C;  1Q1V A;  1G59 A;  4JK1 X;  1ZHF A;  2L7M P;  3HIF A;  3KP5 A;  1FBQ A;  2EZI A;  3IH2 A;  5IOY A;  5IP6 A;  2KIS A;  3FDY A;  3MFK A;  4LLG F;  1QVT A;  4LIU A;  4KT5 C;  1JUM A;  2HQA A;  2EFO A;  1WFX A;  4ASN A;  1LKX A;  2HGC A;  3DQV C;  3SDG A;  4EQQ A;  2QBY B;  2Y0S N;  3ABM H;  2H6C A;  1A6Q A;  2L4A A;  1Z6T A;  2VT3 A;  3EYY A;  1JJ6 C;  1HW2 A;  4OWR B;  3BZ6 A;  1N75 A;  5TJJ A;  2GLO A;  1LDD A;  5F08 A;  4Q4Z F;  4Y52 J;  2GBY A;  4ANJ A;  3ZMD A;  1HOM A;  3FK7 A;  2HOA A;  1SFX A;  2E2J J;  1Y0U A;  4A3L J;  4E7L A;  1IN8 A;  1TBX A;  5KVR A;  3UKG A;  3H5R A;  1P7J A;  3E6C C;  2DA7 A;  2YR2 A;  1FY7 A;  3F0C A;  3PM1 A;  4BAY A;  3HDD A;  5AON A;  5BNG A;  3ONQ A;  1S3J A;  2Y0M A;  2ZCW A;  4IJA A;  2ZC2 A;  4MFD A;  2FMY A;  3BCB A;  3ZRG A;  3K4C A;  2PQ8 A;  1QA6 A;  5EF6 A;  2IJL A;  1KQ0 A;  1FIA A;  2LRD A;  1KQ8 A;  3Q0W A;  2UXN A;  1MZB A;  2GWR A;  1OCO H;  4UVC A;  4Y7N J;  6PAX A;  1MJB A;  2QKM B;  4RGS A;  1VQ4 I;  1HBX G;  1DGR M;  2MLK A;  3RQI A;  2XF5 A;  1R1U A;  5ICC A;  4EJV A;  3KZI C;  5L3B A;  1JHH A;  1U9O A;  2M1B A;  2NVT J;  1B72 A;  4XKB A;  2XF7 A;  2IT0 A;  1NG6 A;  4N0B A;  4MLO A;  4Y17 A;  2FRH A;  4G7Z F;  4JOM A;  3U2R A;  3H5A A;  4KIB A;  2IXS A;  3MZ8 A;  4A2U A;  5C44 J;  1H88 C;  1ZYR F;  1D1A A;  3I55 I;  1A04 A;  1TP4 A;  1F1Z A;  4C3I J;  1IV6 A;  4GGG A;  4AU7 A;  3O8H A;  1S7A A;  3R60 A;  1QZY A;  2ZNY A;  4HW0 A;  3ZN1 A;  2F5V A;  1TTY A;  1LEB A;  1WJA A;  2KFD A;  1F36 A;  5LFA A;  2EV0 A;  1F4K A;  2CJJ A;  2K4J A;  3BP8 A;  1RZ4 A;  3LFU A;  2MH9 A;  2JK3 A;  3GME A;  1P9Q C;  1UHS A;  4BUP A;  5CVJ A;  5TRD A;  2XRL A;  4XR6 A;  3WU1 B;  1UMQ A;  3M8J A;  2CS3 A;  2V1X A;  3LSJ A;  3CJT B;  3LWF A;  4F52 A;  1E3O C;  1ZRE A;  1MNM C;  4DYQ A;  3GCM A;  1FYL A;  1JKO C;  1HST A;  3JTG A;  1JTY A;  1I1G A;  2IA0 A;  4CXF A;  2ZJP F;  2OAZ A;  4ETS A;  2DYR H;  4NHJ A;  2H09 A;  3M7G A;  2Y9Z A;  2MLG A;  2JZY A;  3QOD A;  5D4S A;  3F8F A;  4A69 C;  1JGG A;  4UV8 A;  4XKV A;  4I0A A;  4BQO A;  4E7S A;  1PP8 F;  4CSW A;  1DU0 A;  4E70 A;  3DBH B;  2K9N A;  4G8X A;  1ERD A;  1ZTR A;  2DPD A;  1PYV A;  2EJR A;  4FX0 A;  2DO7 A;  2BXY A;  1B9N A;  2P7C B;  5J1U A;  1K61 A;  2FF4 A;  2XAG A;  2XSD C;  5FLM J;  3REO A;  1PDN C;  2HKX A;  3OL4 A;  2GOX B;  5CQE A;  2Y0S A;  1MMN A;  4KJZ A;  5CVU A;  1YFH A;  4LGW A;  2IA1 A;  3FIS A;  2L2O A;  4NB5 A;  4XMY A;  2L9N A;  3ABT A;  2W7N A;  4J01 A;  1KU3 A;  1DQU A;  3GZ6 A;  4DOZ A;  5FRM A;  3WE3 A;  5L3G A;  4O3M A;  2P5L C;  2A68 F;  4XOT A;  2R7D A;  4U7D A;  2X6X A;  3C1D A;  1HQC A;  4LG0 B;  4A3I J;  2A05 A;  2R5Z B;  2FOW A;  3K1N A;  1WWX A;  3G1M A;  4YRV A;  4CO8 A;  1U2W A;  5L3C A;  5D5U B;  3SFI A;  4D7M A;  3B6C A;  4PSX A;  1MND A;  1VFC A;  5ICF A;  4G6D A;  4HG2 A;  3GWZ A;  2RQQ A;  1Z3X A;  1T0F C;  2CFX A;  4BBS J;  1FOK A;  3PIP F;  2MSY A;  5EG0 A;  5HLI A;  3DU5 A;  2MW8 A;  2M45 A;  2EZL A;  2QQA A;  2F5D A;  4RB3 C;  4CH7 A;  1B1B A;  4PFO A;  1ZKG A;  2RC4 A;  3DEE A;  5D6E A;  1QVU A;  2JT1 A;  4ZZD A;  4JX5 A;  2CUZ A;  9ANT A;  3V7C A;  3BY6 A;  2VIX A;  2DFI A;  4I09 A;  1NH3 A;  3KYC B;  5HS9 A;  3WE2 A;  3WG7 H;  4ZDO A;  2DOD A;  4GO1 A;  2RQP A;  5LGN A;  5DV5 A;  1V4R A;  3AG2 H;  2XRN A;  2WC2 A;  5EGO A;  2Q8K A;  1B6A A;  4JX6 A;  4AWX B;  2W25 A;  1Z7U A;  3UR3 C;  2BXZ A;  4RAY A;  3KZY A;  1T08 B;  4ZYD A;  4I98 B;  1TWC J;  2CO5 A;  2VE9 A;  1SVM A;  3QYE A;  4P55 A;  1O3Q A;  2K86 A;  1H9T A;  3S93 A;  3CJN A;  1MKM A;  5FRN A;  2HOE A;  1S5L C;  2H1L A;  3IKT A;  3KP3 A;  4IHX A;  1BN5 A;  2K40 A;  2WAQ N;  4QLC U;  1Z3Y A;  3LOC A;  1PP7 U;  3KIO A;  3HOV J;  2L01 A;  5ILU A;  4HPQ A;  1ON2 A;  2ICW G;  3CF2 A;  3ZMT A;  1KON A;  2JA6 J;  2W4S A;  3QYB A;  3WTZ A;  5FGM A;  5DEQ A;  4CHU A;  1MMS A;  1IGN A;  3MEX A;  2JA2 A;  2Q1Z B;  2HVS A;  3A01 A;  4BEH A;  4G7O F;  2LKS A;  3BR2 A;  3WHB A;  2XUB A;  2JVH A;  3BQZ A;  3ZQQ A;  2KIU A;  1TQP A;  3RSN A;  4R8H A;  1UB9 A;  2HDW A;  4ESB A;  1LE8 B;  2H94 A;  4RM3 A;  4QWQ A;  3CJR B;  2KT0 A;  4ZTJ A;  5B5E C;  5JR3 A;  3E5X A;  4RAG A;  2A5Y B;  4Q48 A;  3WU2 C;  5HNF A;  4C3H J;  1SFO J;  3S2D J;  2XVC A;  2TDX A;  3V8L A;  2R4G A;  5M5W J;  3ELK A;  4UHT A;  3L2R A;  3DPT A;  2L02 A;  1MMD A;  2B63 J;  4UUT A;  3HUG A;  4E6K G;  3W2A A;  3ULQ B;  1R1T A;  3JRG A;  3HC7 A;  3ZOB A;  1D0Y A;  1GVD A;  3CLO A;  1Z0X A;  2NOG A;  3CDI A;  2V7F A;  2DYS H;  3QU3 A;  3FXO A;  3HHH A;  4Y15 A;  1W0T A;  2CH0 A;  4IO9 F;  5D8L B;  3C2H A;  3MN2 A;  2KRF A;  2LVS A;  1LQ1 A;  4I0B A;  2QM3 A;  5KNL A;  2Y48 A;  1F9N A;  4PGH A;  4WXD A;  5HDG A;  4MGR A;  4S04 A;  4EVI A;  3OYD A;  1MH3 A;  1S6L A;  4B8X A;  1ETO A;  1WCM J;  2BY3 A;  3QU6 A;  5LLQ A;  1Z91 A;  2XB5 A;  2DDB A;  2GXB A;  4P1W A;  4OAZ A;  1SFK A;  2D2W A;  3GTQ J;  2DTZ A;  4H4K C;  2FQ4 A;  3D5R C;  3V7S A;  3E7L A;  3CZ6 A;  3LST A;  5E1Z B;  3VEP A;  3I64 A;  2V9K A;  4G94 A;  3DV8 A;  4EJU A;  1A6I A;  1AA7 A;  2K27 A;  4M74 A;  3ZMZ A;  1J59 A;  3S14 J;  3GLL A;  5FD5 A;  3A01 B;  3H9Q A;  4BEH B;  2KPM A;  4PDK A;  2M8G X;  1HKT A;  4RBO A;  4I6Z A;  4LOC A;  1X2N A;  1VQN I;  2Z3Y A;  2BGC A;  2L9S A;  3I71 A;  4E7K A;  3LAP A;  3CDL A;  4CYC A;  2LBF B;  4KIS A;  1FWZ A;  3BT9 A;  1ETV A;  3S1Q J;  2V79 A;  3QPH A;  2EH3 A;  2WAE A;  1UEL B;  3OYF A;  3KP6 A;  2DU9 A;  1MMA A;  1KYW A;  3MZY A;  1IN4 A;  3K1P A;  2HPM A;  4CGZ A;  3I5U A;  2KIQ A;  5DD4 A;  3HPG A;  4GDF A;  1JUS A;  4MQV A;  1NG7 A;  1Z7L A;  3ZQH A;  5JLX A;  3OYC A;  2JJ7 A;  2M4K A;  2Q2E A;  2UZK A;  3S3M A;  2VQC A;  1OCZ H;  1YQA A;  3GVA A;  4UUV A;  3OYJ A;  4NC6 A;  3EDP A;  3KP2 A;  1RPW A;  2Y30 A;  3J81 Z;  2R7R A;  2LMD A;  2X6O A;  2HFH A;  2ZME B;  3K6G A;  1IUY A;  4GYI A;  1XN7 A;  3RDI A;  3WHC A;  4CZC A;  2YU9 J;  1ZAO A;  2FNP A;  1GHC A;  2GA2 A;  4MIM A;  3DP7 A;  2N8G A;  4A6D A;  3E6B A;  1ODD A;  1HKQ A;  2V1N A;  4ZZL A;  1IRZ A;  3G4S I;  1T39 A;  2HYF A;  2Y2Z A;  1YJW I;  3CLQ A;  1IRG A;  3BPX A;  4BY7 J;  4AVP A;  3CMA I;  2R5Y B;  2E34 A;  2M7B A;  3Q0U A;  4JX4 A;  4AYB N;  4CCL A;  2DTR A;  3K69 A;  2PMZ N;  4IL6 C;  2LG4 A;  4BJ5 C;  2PJR A;  5F0H A;  1TT0 A;  1WQ2 A;  2PEX A;  1FZP B;  2AXT C;  5LGT A;  3AG4 H;  3RYP A;  2GZW A;  1BL0 A;  5F27 A;  4A0Y A;  5HNH A;  3ASN H;  4PJL A;  1OIS A;  1SFE A;  2HWV A;  2Y31 A;  3L7W A;  2BY0 A;  2LTP A;  2DMN A;  3OWT A;  1G3W A;  3F23 A;  2ME6 A;  5HOO A;  2ZKZ A;  1AKH B;  5L3D A;  2EPF A;  5BPI A;  1J9I A;  1YE9 A;  2GQQ A;  3E1S A;  4A3F J;  3OS1 A;  2E1C A;  1ZGA A;  1OCT C;  4C2M J;  3J7Z I;  4XBF A;  1OLT A;  2OU2 A;  1WZ2 A;  5LRS A;  2HR3 A;  4G12 A;  5FJ8 J;  2FD5 A;  3BZK A;  2VC1 A;  3AKZ A;  1Y56 A;  3F3X A;  3A0B C;  5AIP A;  4A3J J;  2MH2 A;  5HS8 A;  3P9C A;  3ZGK A;  3WG9 A;  4DJA A;  2NVX J;  1T2K A;  3J80 K;  3ZQC A;  3I53 A;  1K78 B;  1QGP A;  4NBQ A;  1G8X A;  2E2I J;  2XAF A;  1EA3 A;  3HSF A;  4HEA 2;  4N9H A;  4DYR A;  4B3X A;  5IOZ A;  2FOK A;  2QLZ A;  2QCO A;  3GO5 A;  3T5X A;  2LNB A;  4U87 A;  2ZB9 A;  1X1A A;  1GLN A;  4CCO A;  5EEG A;  4IKF A;  3I3L A;  4RB2 C;  1GDT A;  3U1K A;  5J1Y A;  3NRV A;  5DDG A;  2Z16 A;  2PX9 A;  5LD2 C;  3TOB A;  4XID A;  4PSW A;  2KJC A;  3RYR A;  2IW5 A;  4WF2 A;  4XRS G;  3AG3 H;  4Z6Y A;  3J81 K;  5K5R A;  3GX4 X;  1S9H A;  4UB6 C;  4KN7 X;  4NDL A;  3QOP A;  3L1P A;  2M8E A;  2MD0 A;  1SVO A;  3BTL A;  1FT9 A;  1R4N B;  4DZP A;  3ZN0 A;  3WGI A;  3S3O A;  2XGX A;  1ETX A;  2F4M B;  3KE2 A;  3HEF A;  2DA1 A;  3C18 A;  1SMY F;  2DFH A;  3QWL A;  1GUU A;  3CF5 F;  2XPU A;  2I10 A;  2VKE A;  3IV5 A;  1FOY A;  1T98 A;  2FBK A;  3H9J A;  4UUS A;  4XRM A;  2MFZ A;  3HRS A;  4D5C A;  3ZCO A;  2CV1 A;  3CD6 I;  1CF7 A;  4F93 B;  3IRR A;  1XPX A;  1E0E A;  5H6Q A;  1P4W A;  4M73 A;  4RGR A;  3VYT B;  2D5V A;  3G1O A;  4IOC F;  4V2F A;  2BVL A;  1ZK8 A;  3F21 A;  4YII A;  1ZQ3 P;  2ZME C;  2X1C A;  2H1K A;  2ZBK A;  1IXC A;  2J5O A;  2DCE A;  2DQL A;  2HTJ A;  2RKH A;  2PG4 A;  1Z6R A;  4I7H A;  5F1R A;  1W5S A;  2ETH A;  5J4V A;  3N97 A;  1YIO A;  3CC2 I;  4KIG A;  3IWF A;  2TRT A;  2DA2 A;  4M3F A;  3IHU A;  4LK1 F;  1RKW A;  4BJ6 C;  3W6J B;  4CCK A;  4YG2 F;  3OYI A;  1OR7 C;  4ZDP A;  5ICG A;  1UG2 A;  1ZGJ A;  5E3L A;  3EUA A;  4BL0 B;  4FTH A;  3V8J A;  1KU2 A;  4HF0 A;  3GYH X;  3VSL A;  5E20 A;  3L2C A;  1BOA A;  4LD5 A;  1MBE A;  5GAE J;  1YIJ I;  2QBY A;  4L18 B;  1OMI A;  2R93 J;  2CQK A;  1MSE C;  1QNT A;  2OUM A;  2M3A A;  2E1N A;  1APL C;  4R79 A;  2VJJ A;  3OOP A;  3H3U A;  1ZH5 A;  1LPQ A;  4XLP F;  3LL7 A;  4IPA A;  3GTG J;  1N25 A;  4A3K J;  3WTY C;  3F22 A;  3ML6 A;  2IGK A;  1ETW A;  2NS8 A;  1J2X A;  2XC7 A;  4KNY A;  2HVR A;  2IGN A;  2VT2 A;  2ME0 A;  3BG7 A;  2A6T A;  5H2F C;  3GZ5 A;  3FXL A;  1Z67 A;  2RRE A;  3H92 A;  3E5Q A;  4J19 A;  5DCM A;  4XLH A;  3RPU D;  3A02 A;  2W24 A;  3R0J A;  2R7F A;  4XN3 A;  4L5J A;  4KIF A;  1VQ7 I;  1W36 C;  1T0F A;  1I27 A;  4NC7 A;  5CLS A;  1PUE E;  1J7K A;  2DOF A;  2M0C A;  3CMM A;  1RIO H;  2DK5 A;  2KJB A;  2WBM A;  3RZD J;  2VUM J;  2X1D A;  5KAF C;  3QYF A;  3OYA A;  1WJB A;  4CCM A;  3TP3 A;  3JRE A;  4N9I A;  4L9T A;  3T1B A;  3FX3 A;  4YFX F;  3CUQ B;  1BI0 A;  1VZ0 A;  3IL2 A;  1TW3 A;  1ETQ A;  1TNT A;  1E3P A;  1BW6 A;  3PFI A;  4HNT A;  1NTC A;  1XMX A;  4IHS A;  4C2T A;  2VQL A;  2AHQ A;  1IN7 A;  3SFZ A;  3JTH A;  4KFC A;  3PFY A;  2HQ5 A;  1HSJ A;  4RGU A;  3PQJ A;  1H89 C;  1TZL A;  4IOA F;  3AAF A;  3R6S A;  4XLE A;  4EGY A;  2YUS A;  3TO6 A;  1REP C;  1VND A;  2FU4 A;  2OTL I;  2F5C A;  4RAZ A;  2VKD A;  3CC7 I;  1SAX A;  2ZFU A;  3HG9 A;  1W7P D;  2LF8 A;  3KZZ A;  4HDV A;  5D4R A;  1QBJ A;  3CCY A;  4L9N A;  5LEK A;  2CMP A;  4IEJ A;  2DJN A;  1KA8 A;  5FRO A;  3TBI A;  2X85 A;  2Z9O A;  4RMN A;  3DTK A;  2QQB A;  4N4O B;  1HW5 A;  5DCM B;  5K5O A;  2WY8 Q;  4AIK A;  1JKQ C;  2K5C A;  2CRG A;  2JN6 A;  3A0H C;  2L7F P;  3LSK A;  5K1Y A;  3GTL J;  2DMU A;  4UVB A;  5FKN A;  4BE0 A;  3FM3 A;  2D45 A;  4BQQ A;  1HKS A;  1SEU A;  3M8F A;  1W4M A;  2HZT A;  1LJ9 A;  3JRC A;  2R3S A;  4NQW B;  1UG0 A;  2P81 A;  3LSP A;  1KQ9 A;  2PN6 A;  2FNA A;  3LA2 A;  3ZPL A;  2QSG X;  2L5Q A;  5FLX Z;  1Y8Q B;  3KYL A;  3S15 J;  4FX4 A;  1UST A;  5ILV A;  2OBP A;  2HOT A;  2AO9 A;  2H27 A;  1ZG5 A;  4EMS A;  3JCU C;  2WV0 A;  2KQR A;  1MW7 A;  1G4D A;  1JXS A;  4Y13 A;  2PMH A;  3PSI A;  1XTA A;  1RI7 A;  1LNW A;  4A6E A;  1U8R A;  1Y8R B;  4OAY A;  4ESF A;  3W6V A;  3S3N A;  5K5Q A;  3ZQG A;  2LRE A;  1J75 A;  2R7V A;  1TQI A;  3Q3S A;  3HOY J;  2VPR A;  4LG0 A;  5B66 C;  1QRY A;  1D3Y A;  4HAM A;  3ASO H;  2R5Z A;  2DA4 A;  1JHF A;  4A3D J;  3ERE D;  2DN0 A;  2V6C A;  2C6Y A;  3VYS B;  2BYV E;  4MFE A;  3KP7 A;  4CZZ A;  5KAI C;  2ZSH B;  4XNF A;  1PUF B;  2RVC A;  2BOL A;  1RNL A;  2CFO A;  1GXQ A;  2DFF A;  4WK8 F;  3TDZ C;  3U9G A;  2ESN A;  2YPR A;  4BDY A;  4JQF A;  1W0U A;  2DI3 A;  3FKI J;  1XMA A;  1Y1V J;  2Z33 A;  1SC7 A;  2F6C A;  2BHY A;  4EGZ A;  3FXR A;  2DA3 A;  3LSH A;  3OS0 A;  3R61 A;  5E1X A;  1FP2 A;  3LNQ A;  3WTV C;  1SAU A;  2EA4 A;  1R23 A;  1YS6 A;  3DWL E;  3PNT A;  5JHF A;  2XV4 S;  2CW0 F;  3PL8 A;  3HOS A;  3F9K A;  1LFB A;  3GZN B;  2VAS A;  2EA2 A;  3R0A A;  2FBH A;  4EV0 A;  2MD5 A;  2QWW A;  3CUQ C;  2UXX A;  3Q9V A;  2ZJQ F;  1T95 A;  4HLX A;  3DBL B;  2ZJ2 A;  1UFM A;  2E1O A;  2ZXI A;  4HDU A;  2HTS A;  3CCJ I;  2R7X A;  3RKX A;  3AL0 B;  3OIO A;  3F8N A;  1GXP A;  5DYM A;  2X48 A;  2QEX I;  5BOX A;  3OR2 C;  4G9Y A;  1VQL I;  1B59 A;  1XDS A;  2LFB A;  3DBR B;  3CMY A;  4XSZ F;  4MO7 A;  4ZYA A;  1IUF A;  4M72 A;  3L2W A;  4JYK A;  3CCR I;  3G1L A;  3SHF A;  5FLX K;  2QGU A;  3HHG A;  5BMZ A;  2GM4 A;  2GA1 A;  2XF6 A;  3BR1 A;  2Y9Y A;  3L9F A;  2F2E A;  4N4N B;  3WU0 A;  4XK4 A;  2I5U A;  3PQK A;  2L7Z A;  2LOO A;  1E3H A;  4BS9 A;  4CCJ A;  4C9Y A;  2NNY A;  1C0W A;  1IW7 F;  2LY9 A;  5B1A H;  1BR2 A;  4CA0 A;  1MJA A;  4B48 A;  3HL2 A;  1YI2 I;  4BKX A;  4BE1 A;  1O3T A;  1X1D A;  3SDB A;  3CCL I;  3O2P E;  4XQF A;  1FYK A;  1TT5 B;  5M3M J;  3OYG A;  4BXX J;  1VQM I;  1OJL A;  5LGU A;  4KUM A;  4OIR F;  1E2X A;  3JRA A;  1XGN A;  3K1M A;  2M4G A;  1YLF A;  2GAU A;  4RS8 A;  4ZH4 F;  5DS9 A;  5AIQ A;  1LE8 A;  4M9Z A;  2XAH A;  3P7N A;  5M5X J;  5FKM A;  2ZSI B;  3NWS A;  1BR1 A;  1DP3 A;  2ZNZ A;  4B4C A;  1IN5 A;  3KX2 A;  3A03 A;  4IQJ A;  1XGO A;  4FQG A;  4A3E J;  1LDK B;  3K4M A;  1D8J A;  3M9A A;  1U78 A;  3M4O J;  1S29 A;  3IUO A;  3CP8 A;  1XG1 A;  5JHU A;  4Y33 A;  3J7Y J;  2UUZ A;  3E6D A;  2X51 A;  4B1R A;  1XS9 A;  3ABL H;  3ZMS A;  4D7N A;  2VLA A;  1HXD A;  2BY1 A;  4AUX A;  5DD8 A;  3I9V 2;  2LF7 A;  4XOR A;  1UHW A;  1LEA A;  3EPZ A;  1FYM A;  2M5W A;  4ABZ A;  5J6X A;  5FB2 A;  2HEO A;  4P9F A;  1GV5 A;  2BE5 F;  2XPV A;  1WVR A;  4DNC A;  4G7H F;  1NK3 P;  1XD7 A;  2M87 A;  2XKP A;  3W3C A;  2QF7 A;  3S2W A;  2QKL B;  2CQ7 A;  2O8K A;  2Z1D A;  1JGS A;  1USS A;  1WH7 A;  2CYY A;  3ECO A;  4RA2 A;  4KT6 A;  5ED4 A;  1U3E M;  1X19 A;  5J4Y A;  2A5W A;  3TOA A;  1HDD C;  3LQR A;  4HF1 A;  3PSF A;  3FM5 A;  1BI2 A;  4W97 A;  3VDX A;  1ETY A;  1W1W E;  1L0O C;  1XGM A;  3H9G A;  4RDU A;  4IHY A;  4OOI A;  2LLK A;  2IBD A;  2LC2 A;  3FBI B;  3P5J A;  3BG3 A;  3ZQI A;  2EQR A;  4UXN A;  5CYV A;  1R6R A;  2WB1 A;  3AG1 H;  3FIW A;  2OZ6 A;  3MKZ A;  4AD9 A;  5CQG A;  2PBI A;  3HKZ N;  2LBF A;  3DEU A;  3CO7 C;  4M6Y A;  3VWB A;  3HRU A;  3LA7 A;  5HDK A;  2BEO A;  4D0P A;  2IS6 A;  1JKP C;  2VON A;  3RPQ A;  4O6J A;  3TMO A;  2MYS A;  2HYJ A;  2L0K A;  1QHH D;  1OPC A;  1RKT A;  2KMU A;  3AL0 C;  2EV5 A;  2CUF A;  3F8B A;  1IRF A;  1W5T A;  2E7X A;  3L00 A;  4AVZ A;  2O5R A;  1IG7 A;  3LFK A;  1UHM A;  2OA4 A;  1BC7 C;  4P9U A;  1H9G A;  4IRH A;  1UZC A;  3LAJ A;  2NVY J;  1A35 A;  1X1P A;  2L7K A;  1ON1 A;  4U7B A;  3JSP A;  3QRF F;  4C30 A;  2CU7 A;  2ZME A;  2WWY A;  2ACJ A;  4LLL A;  3CCS I;  1R5G A;  1ULY A;  1RES A;  4XM3 A;  1I3A A;  3HB9 A;  2M7A A;  1WJ5 A;  3DLL F;  3P9I A;  2V1U A;  2R0Q C;  1BIB A;  2W48 A;  5E17 F;  2HDD A;  2EZK A;  2IGO A;  1S8N A;  3FXM A;  4YEJ A;  2V1D A;  1D8K A;  2L4M A;  2LK2 A;  4ZDL A;  2F5F A;  1OR7 A;  2QSF X;  4I01 A;  2R5Y A;  2VBW A;  4DW6 A;  1N77 A;  2PJP A;  1IN6 A;  2LP0 A;  4ZJZ A;  2MAB A;  5F6F A;  1WJF A;  5JI6 A;  1VQ6 I;  2KDO A;  3QPT A;  2STT A;  3LSR A;  4XL9 A;  1HW1 A;  2XRO A;  3JRI A;  3GFM A;  2O3F A;  4HX7 A;  4LJZ F;  5GAG J;  1X4O A;  4Q5S F;  2IS4 A;  3U21 A;  2XGE A;  4E7J A;  5F0C A;  1XCB A;  3DCF A;  2W1O A;  1AKH A;  3CTA A;  1Z05 A;  4B09 A;  1FLI A;  4I02 A;  1YJ9 I;  3GFL A;  4ZTF A;  3OL3 A;  2VBZ A;  2CW7 A;  4AIJ A;  3IH4 A;  4L5E A;  3JRF A;  1ZRD A;  1AWC A;  4L0Y B;  3WTS C;  1ONV A;  3OYK A;  3CCE I;  2YX4 A;  2OCE A;  3DFG A;  4X0G A;  2IAI A;  5BS6 A;  3PUF A;  3DU6 A;  2RGV A;  4MQ9 F;  2CQX A;  4KIC A;  5IYD J;  2XB0 X;  1B8I B;  2KRC A;  3TKY A;  4LIT A;  1R58 A;  2M30 A;  3U1D A;  3B73 A;  1MMG A;  2VOO A;  3DXJ F;  3QOE A;  1K78 A;  1O7F A;  1JT6 A;  2G0E A;  3I54 A;  5HLH A;  2BY2 A;  4YIF A;  3A2K A;  3KEQ A;  1P6R A;  1I50 J;  2WV1 A;  2ECC A;  1IV8 A;  4U0Y A;  1S7O A;  4BBR J;  2EIK H;  3A1Y A;  4BAC A;  1U8B A;  1WJC A;  1ITY A;  2CV2 A;  5GTH C;  2ZXJ A;  1T38 A;  1SD4 A;  1TW2 A;  4HRI A;  1TWG J;  1MDM B;  3CC4 I;  4GYG A;  4PJN A;  1MBK A;  1OYI A;  1WH5 A;  4CIC A;  2PI0 A;  2XAQ A;  1RUO A;  2DLL A;  3HXL A;  4ENN A;  4YEL A;  2JQ7 A;  2EFN A;  3V42 A;  2M34 A;  1WPK A;  3HKZ A;  1NK2 P;  1XX5 A;  2ELJ A;  3GUD A;  3F6O A;  4M6V A;  4A12 A;  2R7O A;  1IXS B;  5BPD A;  3JRD A;  4IHT A;  4XLA A;  4FT8 A;  1MNE A;  2BW3 B;  2IS1 A;  3TO9 A;  2AXL A;  3BLY A;  5JVT A;  2J5P A;  3HOZ J;  2K02 A;  1K4T A;  2E1M B;  2DT6 A;  4M6X A;  4QPO A;  1YO5 C;  3WOD F;  5CKT A;  2QYO A;  2DPU A;  5EEH A;  3BCA A;  5IP9 J;  2ZJR F;  3G3Z A;  4UB8 C;  1VQ9 I;  3SQN A;  1WJE A;  1I3Q J;  4MTE A;  2KL4 A;  4E7I A;  2X4H A;  3TW6 A;  1VQO I;  2ADU A;  5GPA A;  4U0W A;  1P4A A;  4C2U A;  1X2M A;  3TW7 A;  5D8K B;  3MVP A;  2LY1 A;  4B43 A;  3DLA A;  3EET A;  2H8R A;  2F48 A;  1O7L A;  4P5O A;  2QSH X;  1R5H A;  3DF8 A;  1DPR A;  1EJ9 A;  4HQM A;  4A0Z A;  2HXI A;  1D0X A;  2HNH A;  4FCY A;  2YSR A;  1YIT I;  3VYR B;  1O4X A;  1BW5 A;  3RZO J;  3DTE A;  1DGW Y;  5K7H A;  3K0L A;  3E97 A;  2M2E A;  2G7U A;  5FD6 A;  2O7O A;  2VJI A;  4LG3 A;  3V7R A;  3GTJ J;  4M71 A;  3Q5F A;  3BOQ A;  4UV9 A;  2DW4 A;  2P8T A;  2VQG A;  3S16 J;  4S05 A;  4D1Q A;  1HA8 A;  1FPQ A;  3BTI A;  2W00 A;  2QQ8 A;  4M3E A;  1BBY A;  4BXU A;  2PMU A;  3GEZ A;  3BWG A;  3S1M J;  2Z2S B;  4H0E A;  1XMK A;  4Y3O A;  4IZZ A;  4F3Q A;  1K7A A;  2OF7 A;  3K70 D;  3OYB A;  3RTR A;  3PJR A;  2AQE A;  3K4J A;  3MZH A;  1D5V A;  5GAD J;  5IP7 J;  4BHB A;  4G6T B;  3ZR8 X;  3QAH A;  5GAH J;  3H0G J;  2NYX A;  5HS7 A;  3UNG C;  5LHI A;  1R4M B;  4IQ4 A;  3SEQ A;  4A3C J;  3KP4 A;  4HBL A;  3L2U A;  2FX0 A;  1W7P B;  2D1V A;  2FE3 A;  1GVJ A;  4OIN F;  1YHQ I;  2IVM A;  5JLW A;  2LDU A;  3KLN A;  1OYY A;  4XOP A;  1FSE A;  2RNJ A;  3H1C A;  1T8I A;  3CUQ A;  4F91 B;  1QU3 A;  1ORK A;  3EUH C;  3ZXS A;  3PNV A;  2UWM A;  4BGD A;  2VKH A;  3KET A;  1R9T J;  1G6N A;  3FXJ A;  2LH9 A;  3BRO A;  2Y69 H;  3FKJ A;  1EH8 A;  1R7J A;  2JUC A;  3W6K B;  5CPR B;  2KLO A;  2KZV A;  4DIQ A;  1R5I D;  4CCN A;  3FZV A;  5E8G A;  4X6A J;  4XLN F;  4F7Z A;  1UAA A;  2GXA A;  1XSV A;  2ZXH A;  4EM1 A;  3B02 A;  3N05 A;  1AU7 A;  3M8E A;  3HOU J;  1OQY A;  5E3N A;  3C7J A;  3VSK A;  1E17 A;  2OQG A;  2ELK A;  3SZP A;  2IEK A;  2K7L A;  4E4H A;  3Q0V A;  5F1J A;  2YS9 A;  2WY7 Q;  2E1M C;  2P5V A;  2QVO A;  1LDJ A;  2E7W A;  3QPL A;  4M3D A;  3CO6 C;  3G2B A;  3BR3 A;  1U5T B;  3VPR A;  4A3M J;  2WAD A;  2QQ9 A;  1BC8 C;  4ITV A;  3H5N A;  2BVM A;  4MNU A;  1DDN A;  2E35 A;  1O57 A;  1TC3 C;  3CJQ B;  4PK4 A;  4NQW A;  2MGQ A;  3I59 B;  1YS7 A;  1OCC H;  1O3R A;  4BE2 A;  3GFI A;  1I1S A;  1VQ5 I;  4X1E A;  2DT5 A;  1WHU A;  1D1B A;  1Y6I A;  2VL8 A;  1K83 J;  2HU9 A;  4ZC3 A;  4OIO F;  2DT7 B;  1ZEL A;  4LB6 B;  4BQA A;  2LYC A;  1IAW A;  3DKY A;  4U88 A;  3HJE A;  1ZG3 A;  2V26 A;  2R7T A;  4XKW A;  1TQM A;  3W2V A;  1ZRF A;  2LKP A;  3DKX A;  4DBR A;  3CP2 A;  2JMW A;  4XRF A;  3P9K A;  5C4J J;  4RLQ A;  1R71 A;  3MKW B;  2K9Q A;  3F6V A;  2QZ8 A;  1FEX A;  1AHD P;  2MC3 A;  2KKO A;  1V5G A;  1YRN B;  4HV6 A;  2FML A;  4E7Z A;  1RC9 A;  3RKW A;  2HVQ A;  1FTZ A;  4OMZ A;  1IDY A;  1FP1 D;  1WGX A;  3CQZ J;  1R49 A;  2O8X A;  4DBQ A;  1FBS A;  2ID6 A;  3CCM I;  5GP9 A;  2EB7 A;  4BH9 A;  1LVA A;  1A36 A;  3PO3 J;  3JSO A;  3OV8 A;  4V19 K;  5EDN A;  5H6R A;  3BDD A;  2BHZ A;  5LBQ A;  2HXO A;  1LVK A;  1WI3 A;  1PUF A;  2QUF A;  2AS5 F;  3OS2 A;  2DOE A;  3TED A;  2MC4 A;  1IO2 A;  3IAS 2;  4Z2Y A;  2OPT A;  3DEW A;  2XGD A;  3CCV I;  5M3F J;  1FIP A;  4ENJ A;  4A93 J;  2PFB A;  1XGS A;  4PJ0 C;  1XCV A;  3MKL A;  5IYB J;  2FSW A;  1Y1W J;  2X6Y A;  5DUK A;  2P4W A;  4HV5 A;  4IHW A;  2EZH A;  3GTM J;  2P6T A;  1QZZ A;  4B3A A;  3COA C;  4BHC A;  2GOM A;  4I99 C;  1XSX A;  4IXA A;  2W85 A;  1V5F A;  2VB6 A;  4XRS A;  3BTC A;  1VF9 A;  3HOX J;  1WJD A;  5B3S H;  3K4L A;  3BJ6 A;  4PGG A;  5LRR A;  3HOW J;  2VKV A;  2JVG A;  3MKY B;  4A0X A;  4HZF A;  3RQ4 A;  4AIH A;  2CGP A;  1XC5 A;  1V54 H;  3OIP A;  4QSH A;  3RI4 A;  3I4M J;  3I0T A;  1TWA J;  2FQ3 A;  1FTT A;  2X9D A;  3GTO J;  2E36 A;  4D5F A;  2R92 J;  3O3K A;  3WGH A;  2RN7 A;  4LK0 F;  2L9R A;  1VQK I;  4KMU X;  4MTD A;  4XKC A;  2KP6 A;  2ISZ A;  2DXI A;  3BPV A;  2A07 F;  1QPM A;  3MQ0 A;  2O61 A;  5FO5 A;  5J47 A;  5CVV A;  5J3L A;  4WXC A;  4HOB A;  4DZJ A;  3HTS B;  3OMY A;  3KCC A;  2TCT A;  2XIG A;  1FX7 A;  3C2B A;  1DPU A;  4KMF A;  1QPI A;  1SMT A;  5J8F A;  2VOP A;  2DA6 A;  1XSD A;  2FUG 2;  3JRB A;  2UV1 A;  2P6S A;  3ZQL A;  3PO2 J;  1JUP A;  3LSM A;  1U5T C;  3AFH A;  3KEY A;  3WGG A;  5J40 A;  5IYC J;  3FHZ A;  3GXO A;  2E60 A;  3HOT A;  1NHA A;  3LSI A;  3NAR A;  3V8K A;  3CES A;  1DP7 P;  3QQA A;  2JPB A;  3PIO F;  1P4X A;  3S2H J;  3IRQ A;  3ZQ7 A;  2CWE A;  1LFU P;  2WB1 N;  2XAU A;  3HTU A;  3K4N A;  2ZXW H;  3EYI A;  1KU7 A;  3T0Y A;  3FBN B;  3S1R J;  2COM A;  3BG5 A;  1ZGW A;  4EM2 A;  2V4J C;  5KCM A;  3HGY A;  3VOE A;  1YW8 A;  1UJ8 A;  2XHK A;  2B0L A;  2KDZ A;  4PJM A;  1ACI A;  4HF2 A;  4EAT A;  1Y39 A;  2VI6 A;  4UNO A;  5EJC A;  2STW A;  2V9V A;  1TWH J;  3HSE A;  5J8C A;  3BJO A;  3HZJ A;  4LFU A;  2EIN H;  2L9V A;  4QPQ A;  1B72 B;  1IC8 A;  5IT9 Z;  2M9H A;  4JBA A;  3ISP A;  1RR8 C;  2BV6 A;  1IDZ A;  3ECH A;  2GIV A;  2NVQ J;  3E6M A;  1RUN A;  4A3B J;  4XLF A;  3BTJ A;  1I6H J;  1FMW A;  5E79 C;  1ZN2 A;  2VC0 A;  5ILS A;  3HM5 A;  3ESW B;  2MBF A;  2GIZ A;  3LA3 A;  2DQR A;  1R36 A;  2I8D A;  2JUG A;  4AM3 A;  1ETK A; 
#chains in the Genus database with same CATH homology
 4O5V A;  1IF1 A;  4OIP F;  2EFQ A;  4WWC A;  3F72 A;  3IKV A;  3K2Z A;  1FNN A;  3WTX C;  4OMY A;  2HYG D;  1YTY A;  2KIM A;  2ZFW A;  3L09 A;  5HDN A;  3MWM A;  1G3S A;  3KFW X;  5E18 F;  4MEX F;  2FBI A;  4UVA A;  4PZJ A;  4MHG A;  3F8M A;  5H20 A;  2HKO A;  1IXR C;  3WTU C;  4Q47 A;  4MEY F;  2L54 A;  2OQR A;  4P96 A;  1T6S A;  5CVI A;  2DBB A;  3IC7 A;  2NNN A;  3WTT C;  4L5I A;  2JPC A;  3O6B B;  3D0S A;  5LEJ A;  1BJA A;  1F5T A;  1H0M A;  1G3T A;  1XDU A;  2FA5 A;  1EH7 A;  5L3F A;  2WTE A;  1KU9 A;  1YYV A;  4ESJ A;  2W84 A;  3EQL F;  4CDG A;  2VBY A;  4A5M A;  1X3U A;  1SD6 A;  2DK8 A;  2A61 A;  3FMS A;  4U0V A;  2XAS A;  4R1H A;  1Q1H A;  5IT9 K;  5DUI A;  5CVR A;  3IWZ A;  4ENM A;  1R1V A;  3FXQ A;  2Y75 A;  2OZU A;  4WX9 A;  1OYW A;  2CSO A;  1G3Y A;  1BI3 A;  1Z9C A;  3TQN A;  3HRM A;  4L0Z B;  3ZP5 A;  5D5X B;  1IZ1 A;  2Z5U A;  2ESH A;  3TO7 A;  1EV7 A;  4BNC A;  2KIF A;  1MD0 A;  3BJA A;  2EFW A;  3FMR A;  1K79 A;  5ICE A;  3RJP A;  1J5Y A;  3SZT A;  5L3E A;  1B4A A;  1V3F A;  4ZYE A;  4RB0 A;  1SD7 A;  3LQQ A;  3EUH A;  3T8T A;  2G7H A;  1MDM A;  3G73 A;  4EJO A;  4M9S A;  3GFJ A;  2GXG A;  3DKW A;  3VFZ A;  5E1W A;  1TNS A;  2HDC A;  3J7A O;  1P92 A;  4WXH A;  2A3S A;  1LB2 A;  4HQE A;  2Z99 A;  5D5V B;  3ZMU A;  5IT3 A;  1SD5 A;  2G9W A;  1AOY A;  2VXZ A;  3GLX A;  2F5E A;  3TDU C;  3N4M A;  4HX8 A;  3ROU A;  1KGS A;  3K9T A;  1I6X A;  1CGP A;  4IVN A;  3J80 Z;  1ZLJ A;  5FFZ A;  4M9X A;  4LMY A;  4GCV A;  3I4P A;  1BM9 A;  4BHP A;  4OIQ F;  2EV6 A;  3RPU A;  1ZRC A;  4PCQ A;  4KA4 A;  3KEO A;  5A2Q Z;  2MA3 A;  3FF5 A;  4GXO A;  1YW7 A;  4K2E A;  4CYD A;  1R00 A;  3JAM Z;  5E8I A;  5BQT A;  3RIR A;  1K6O A;  3H3Z A;  5DCF A;  3KLO A;  1WRJ A;  2VOD A;  4EM0 B;  1O3S A;  2RV8 A;  2L3D A;  5KK1 A;  4HX4 A;  4WCG A;  2ELH A;  1VTN C;  3M1E A;  5D5W B;  2JSC A;  2P7V B;  3RKY A;  4YFK F;  4IF4 A;  4RB1 A;  4ZYH A;  3GW2 A;  1P2F A;  1TLH B;  3HSR A;  4HLY A;  3WTW C;  4G6Q A;  2OD5 A;  4FHT A;  1ZG1 A;  3FWE A;  3QP6 A;  1W7P A;  5JFR A;  2XAJ A;  1YW9 A;  1BI1 A;  4BYY A;  2X0L A;  3R4K A;  2H6B A;  4L9J A;  3T8R A;  1FSH A;  4A5N A;  3E5U A;  4LLN A;  3TGN A;  5D6F A;  2HQN A;  1MGT A;  3ZMV A;  2IP2 A;  2JTV A;  3ABU A;  5LHH A;  1J0R A;  2O03 A;  2IPQ X;  3E3V A;  2EFP A;  2ISY A;  4TV7 A;  2ZO4 A;  1QQI A;  4HA8 A;  4LB5 A;  1BIA A;  4I2O A;  2EWN A;  1L3L A;  4KN4 X;  3VOD A;  4OU0 A;  5A2Q K;  4KDP A;  1FBU A;  4KYW A;  4XSX F;  3JAM K;  4IRI A;  2BBY A;  5LHG A;  2P5K A;  1ZLK A;  1U5T A;  1UCR A;  3MAJ A;  2HS5 A;  3FMQ A;  2VBX A;  4IRG A;  2VE8 A;  2D1H A;  4EJW A;  3F8C A;  3I59 A;  5HLG A;  1WI9 A;  1DUX C;  2K4B A;  3QP5 A;  1EH6 A;  3HRT A;  3MCZ A;  2PLY A;  5CJ9 A;  3CUO A;  1OKR A;  3HYI A;  2XKO A;  3SXY A;  3Q9S A;  2EK5 A;  3JW4 A;  1YG2 A;  2A69 F;  2A6H F;  4ENK A;  2FEZ A;  3NQO A;  1FC3 A;  1I5Z A;  2NS0 A;  2RDP A;  4YFN F;  2NAZ A;  1ZAR A;  2IA2 A;  3NEU A;  1R22 A;  2Q0O A;  3VB2 A;  2DAO A;  3DPL C;  2CG4 A;  3D5L A;  3CDH A;  2HQR A;  1Z1D A;  2JRT A;  1QO0 D;  2VN2 A;  1WSU A;  4EJT A;  1WKM A;  5F64 A;  3V4G A;  5ERI A;  1SFU A;  2YU3 A;  1MJ9 A;  2O0Y A;  1XB4 A;  5HVQ C;  1CF7 B;  3FXU A;  3GF2 A;  2LSO A;  4RGX A;  1KYZ A;  2FXA A;  4L9V A;  4DQ2 A;  2IRF G;  2W57 A;  4ON0 A;  4HYE A;  1JE8 A;  1B9M A;  2QEN A;  3C3W A;  2YX7 A;  2NRA C;  4ZYG A;  2O6G E;  3I58 A;  5FFX A;  1U6G A;  2A6E F;  1STZ A;  4JK1 X;  1ZHF A;  3HIF A;  3KP5 A;  1FBQ A;  3MFK A;  4LLG F;  4KT5 C;  2EFO A;  4ASN A;  3DQV C;  2HGC A;  4EQQ A;  2QBY B;  2H6C A;  2L4A A;  1Z6T A;  2VT3 A;  3EYY A;  1HW2 A;  5TJJ A;  3BZ6 A;  1LDD A;  4Q4Z F;  3ZMD A;  1SFX A;  1Y0U A;  1IN8 A;  1TBX A;  5KVR A;  3E6C C;  2YR2 A;  1FY7 A;  4BAY A;  5AON A;  1S3J A;  2Y0M A;  2ZCW A;  4IJA A;  2FMY A;  2PQ8 A;  2IJL A;  1KQ0 A;  1KQ8 A;  2UXN A;  1MZB A;  2GWR A;  4UVC A;  6PAX A;  1MJB A;  4RGS A;  1HBX G;  2MLK A;  1R1U A;  5ICC A;  4EJV A;  5L3B A;  1JHH A;  2M1B A;  2IT0 A;  4N0B A;  4Y17 A;  2FRH A;  4G7Z F;  3U2R A;  4KIB A;  4A2U A;  1ZYR F;  1A04 A;  1F1Z A;  4GGG A;  1S7A A;  3R60 A;  1QZY A;  2ZNY A;  4HW0 A;  3ZN1 A;  1TTY A;  1LEB A;  2EV0 A;  1F4K A;  2K4J A;  3BP8 A;  1RZ4 A;  2MH9 A;  5CVJ A;  5TRD A;  3WU1 B;  2V1X A;  3LWF A;  1ZRE A;  1FYL A;  1HST A;  3JTG A;  1I1G A;  2IA0 A;  4CXF A;  2OAZ A;  4ETS A;  4NHJ A;  2H09 A;  3M7G A;  2MLG A;  2JZY A;  5D4S A;  3F8F A;  4UV8 A;  4I0A A;  1PP8 F;  4E70 A;  4G8X A;  2DPD A;  2EJR A;  4FX0 A;  2DO7 A;  1B9N A;  2P7C B;  2FF4 A;  2XAG A;  3REO A;  1PDN C;  2HKX A;  5CVU A;  1YFH A;  4LGW A;  2IA1 A;  4NB5 A;  3ABT A;  1KU3 A;  3GZ6 A;  3WE3 A;  5L3G A;  4O3M A;  2P5L C;  2A68 F;  2R7D A;  4U7D A;  3C1D A;  1HQC A;  4LG0 B;  3K1N A;  1WWX A;  4CO8 A;  1U2W A;  5L3C A;  5D5U B;  5ICF A;  4G6D A;  3GWZ A;  2CFX A;  1FOK A;  5HLI A;  2M45 A;  2QQA A;  2F5D A;  4RB3 C;  1B1B A;  2RC4 A;  5D6E A;  2JT1 A;  4ZZD A;  3V7C A;  3BY6 A;  2DFI A;  4I09 A;  3WE2 A;  5HS9 A;  4GO1 A;  5LGN A;  2RQP A;  5DV5 A;  1V4R A;  2XRN A;  2WC2 A;  2Q8K A;  1B6A A;  4AWX B;  2W25 A;  1Z7U A;  4RAY A;  3KZY A;  4ZYD A;  4I98 B;  2CO5 A;  2VE9 A;  4P55 A;  1O3Q A;  2K86 A;  1H9T A;  3CJN A;  1MKM A;  2HOE A;  3IKT A;  3KP3 A;  1BN5 A;  4QLC U;  1PP7 U;  2L01 A;  5ILU A;  1ON2 A;  3ZMT A;  3WTZ A;  5FGM A;  5DEQ A;  4CHU A;  3MEX A;  4G7O F;  2XUB A;  2KIU A;  1TQP A;  4R8H A;  1UB9 A;  4ESB A;  2H94 A;  4QWQ A;  5JR3 A;  3E5X A;  2A5Y B;  4Q48 A;  2XVC A;  2TDX A;  3V8L A;  3ELK A;  4UHT A;  3DPT A;  2L02 A;  3HUG A;  3ULQ B;  1R1T A;  3CLO A;  3QU3 A;  3HHH A;  4Y15 A;  5D8L B;  2KRF A;  1LQ1 A;  4I0B A;  2QM3 A;  2Y48 A;  1F9N A;  4PGH A;  4WXD A;  5HDG A;  4MGR A;  4S04 A;  4EVI A;  1S6L A;  4B8X A;  3QU6 A;  5LLQ A;  1Z91 A;  2GXB A;  2D2W A;  3V7S A;  3VEP A;  3LST A;  5E1Z B;  3I64 A;  4G94 A;  3DV8 A;  4EJU A;  2K27 A;  4M74 A;  3ZMZ A;  1J59 A;  5FD5 A;  4PDK A;  1HKT A;  2Z3Y A;  2BGC A;  3I71 A;  3LAP A;  1FWZ A;  2V79 A;  3QPH A;  3KP6 A;  2DU9 A;  1KYW A;  3MZY A;  1IN4 A;  3K1P A;  4CGZ A;  3I5U A;  5DD4 A;  4MQV A;  2Q2E A;  2UZK A;  3GVA A;  1YQA A;  4UUV A;  3EDP A;  3KP2 A;  3J81 Z;  2HFH A;  2ZME B;  1IUY A;  4GYI A;  1XN7 A;  3RDI A;  1ZAO A;  2FNP A;  1GHC A;  2GA2 A;  3DP7 A;  4A6D A;  3E6B A;  1ODD A;  1HKQ A;  4ZZL A;  1T39 A;  2HYF A;  1IRG A;  3BPX A;  4AVP A;  2DTR A;  3K69 A;  2PEX A;  1WQ2 A;  1FZP B;  5LGT A;  3RYP A;  2GZW A;  4A0Y A;  1SFE A;  2HWV A;  3L7W A;  3F23 A;  1G3W A;  5HOO A;  2ZKZ A;  5L3D A;  5BPI A;  1J9I A;  2GQQ A;  2E1C A;  1ZGA A;  4XBF A;  2OU2 A;  5LRS A;  2HR3 A;  2VC1 A;  3F3X A;  5AIP A;  2MH2 A;  5HS8 A;  3P9C A;  3WG9 A;  1T2K A;  3J80 K;  3I53 A;  1K78 B;  1QGP A;  2XAF A;  3HSF A;  4N9H A;  2FOK A;  2QLZ A;  3GO5 A;  3T5X A;  2LNB A;  5EEG A;  4RB2 C;  3NRV A;  5DDG A;  3TOB A;  2KJC A;  3RYR A;  2IW5 A;  4WF2 A;  3J81 K;  5K5R A;  3GX4 X;  4KN7 X;  3QOP A;  2M8E A;  1FT9 A;  3ZN0 A;  3WGI A;  2XGX A;  3KE2 A;  3C18 A;  1SMY F;  1T98 A;  2FBK A;  3HRS A;  1CF7 A;  3IRR A;  5H6Q A;  1P4W A;  4M73 A;  4RGR A;  3F21 A;  4YII A;  2ZBK A;  1IXC A;  2J5O A;  2DQL A;  2HTJ A;  2RKH A;  2PG4 A;  1Z6R A;  4I7H A;  5F1R A;  1W5S A;  2ETH A;  3N97 A;  1YIO A;  4KIG A;  3IWF A;  3IHU A;  4LK1 F;  3W6J B;  4YG2 F;  5ICG A;  1ZGJ A;  3V8J A;  1KU2 A;  4HF0 A;  3GYH X;  5E20 A;  3L2C A;  1BOA A;  4LD5 A;  2QBY A;  4L18 B;  1OMI A;  2CQK A;  1QNT A;  2E1N A;  4R79 A;  3OOP A;  3H3U A;  1ZH5 A;  4XLP F;  4IPA A;  3WTY C;  3F22 A;  3ML6 A;  1J2X A;  4KNY A;  2VT2 A;  3GZ5 A;  3H92 A;  3E5Q A;  5DCM A;  2W24 A;  3R0J A;  2R7F A;  4L5J A;  4KIF A;  1T0F A;  1I27 A;  5CLS A;  1PUE E;  1J7K A;  1RIO H;  2DK5 A;  2KJB A;  4N9I A;  4L9T A;  3T1B A;  3FX3 A;  4YFX F;  3CUQ B;  1BI0 A;  3IL2 A;  1TW3 A;  1TNT A;  3PFI A;  4IHS A;  1IN7 A;  3SFZ A;  3JTH A;  4KFC A;  1HSJ A;  4RGU A;  3PQJ A;  3AAF A;  3R6S A;  4EGY A;  3TO6 A;  1REP C;  2FU4 A;  2F5C A;  4RAZ A;  1SAX A;  1W7P D;  2LF8 A;  3KZZ A;  4HDV A;  5D4R A;  1QBJ A;  4L9N A;  5LEK A;  1KA8 A;  2Z9O A;  2QQB A;  1HW5 A;  5DCM B;  5K5O A;  4AIK A;  5K1Y A;  4UVB A;  3FM3 A;  2D45 A;  1HKS A;  3M8F A;  1W4M A;  2HZT A;  1LJ9 A;  2R3S A;  1KQ9 A;  2PN6 A;  2FNA A;  3LA2 A;  3ZPL A;  5FLX Z;  4FX4 A;  1UST A;  5ILV A;  2OBP A;  2H27 A;  1ZG5 A;  4EMS A;  2WV0 A;  1G4D A;  1JXS A;  4Y13 A;  2PMH A;  1RI7 A;  1LNW A;  4A6E A;  1U8R A;  4ESF A;  5K5Q A;  1J75 A;  1TQI A;  4LG0 A;  1D3Y A;  4HAM A;  1JHF A;  3ERE D;  2V6C A;  2C6Y A;  2BYV E;  3KP7 A;  4CZZ A;  2RVC A;  1RNL A;  1GXQ A;  4WK8 F;  3TDZ C;  3U9G A;  2ESN A;  2YPR A;  4JQF A;  2DI3 A;  1XMA A;  2Z33 A;  4EGZ A;  3FXR A;  3R61 A;  5E1X A;  1FP2 A;  3WTV C;  2EA4 A;  1R23 A;  1YS6 A;  2XV4 S;  2CW0 F;  3HOS A;  2EA2 A;  3R0A A;  2FBH A;  4EV0 A;  2MD5 A;  2QWW A;  3CUQ C;  2UXX A;  3Q9V A;  4HLX A;  2ZJ2 A;  1UFM A;  4HDU A;  2HTS A;  3RKX A;  1GXP A;  3F8N A;  5DYM A;  5BOX A;  4G9Y A;  1B59 A;  1XDS A;  4XSZ F;  4M72 A;  3SHF A;  5FLX K;  3HHG A;  5BMZ A;  2GA1 A;  3L9F A;  2F2E A;  3WU0 A;  3PQK A;  2NNY A;  1C0W A;  1IW7 F;  1MJA A;  1O3T A;  3O2P E;  1FYK A;  5LGU A;  4KUM A;  4OIR F;  1E2X A;  1XGN A;  3K1M A;  4RS8 A;  1YLF A;  2GAU A;  4ZH4 F;  5AIQ A;  4M9Z A;  2XAH A;  3P7N A;  2ZNZ A;  1IN5 A;  1XGO A;  1LDK B;  1D8J A;  3M9A A;  1U78 A;  1S29 A;  5JHU A;  3E6D A;  3ZMS A;  1HXD A;  5DD8 A;  2LF7 A;  1UHW A;  1LEA A;  1FYM A;  2M5W A;  5J6X A;  5FB2 A;  2HEO A;  4P9F A;  2BE5 F;  4DNC A;  4G7H F;  1XD7 A;  2M87 A;  2XKP A;  3S2W A;  1JGS A;  1USS A;  3ECO A;  2CYY A;  5ED4 A;  1U3E M;  3TOA A;  3LQR A;  4HF1 A;  3FM5 A;  1BI2 A;  1L0O C;  1XGM A;  4OOI A;  4UXN A;  5CYV A;  2OZ6 A;  4AD9 A;  2PBI A;  3DEU A;  3CO7 C;  4M6Y A;  3HRU A;  3LA7 A;  5HDK A;  2BEO A;  4D0P A;  2VON A;  3RPQ A;  4O6J A;  1OPC A;  2EV5 A;  3F8B A;  1IRF A;  1W5T A;  2E7X A;  3L00 A;  3LFK A;  1UHM A;  2OA4 A;  1BC7 C;  4P9U A;  1H9G A;  4IRH A;  3LAJ A;  1ON1 A;  4U7B A;  3JSP A;  3QRF F;  2ZME A;  2WWY A;  2ACJ A;  4LLL A;  1R5G A;  1ULY A;  3P9I A;  2V1U A;  1BIB A;  5E17 F;  1S8N A;  2V1D A;  1D8K A;  2L4M A;  2F5F A;  1OR7 A;  4I01 A;  2VBW A;  2PJP A;  1IN6 A;  5F6F A;  5JI6 A;  3QPT A;  2STT A;  1HW1 A;  2XRO A;  3GFM A;  2O3F A;  4HX7 A;  4LJZ F;  4Q5S F;  1XCB A;  3CTA A;  1Z05 A;  4B09 A;  1FLI A;  4I02 A;  3GFL A;  2VBZ A;  4AIJ A;  1ZRD A;  1AWC A;  4L0Y B;  3WTS C;  1ONV A;  2YX4 A;  3DFG A;  5BS6 A;  2RGV A;  4MQ9 F;  4KIC A;  3TKY A;  1R58 A;  2M30 A;  3U1D A;  3B73 A;  2VOO A;  3DXJ F;  1K78 A;  1O7F A;  3I54 A;  5HLH A;  4YIF A;  3KEQ A;  1P6R A;  4U0Y A;  1S7O A;  2ZXJ A;  1T38 A;  1SD4 A;  1TW2 A;  1MDM B;  4GYG A;  1OYI A;  4CIC A;  2PI0 A;  2XAQ A;  1RUO A;  2DLL A;  4ENN A;  2EFN A;  3GUD A;  3F6O A;  4A12 A;  1IXS B;  5BPD A;  4IHT A;  4FT8 A;  3TO9 A;  2AXL A;  5JVT A;  2J5P A;  2K02 A;  4M6X A;  1YO5 C;  3WOD F;  2QYO A;  2DPU A;  5EEH A;  3G3Z A;  3SQN A;  4MTE A;  2X4H A;  2ADU A;  4U0W A;  1P4A A;  5D8K B;  3EET A;  1O7L A;  4P5O A;  1R5H A;  3DF8 A;  1DPR A;  4HQM A;  4A0Z A;  2YSR A;  3K0L A;  3E97 A;  2G7U A;  5FD6 A;  3V7R A;  4M71 A;  3Q5F A;  3BOQ A;  4UV9 A;  2DW4 A;  2P8T A;  4S05 A;  1FPQ A;  1BBY A;  4BXU A;  2PMU A;  3GEZ A;  3BWG A;  4H0E A;  1XMK A;  1K7A A;  3RTR A;  3MZH A;  1D5V A;  4BHB A;  3QAH A;  5HS7 A;  2NYX A;  5LHI A;  3KP4 A;  4HBL A;  1W7P B;  2D1V A;  2FE3 A;  1GVJ A;  4OIN F;  2IVM A;  2LDU A;  3KLN A;  1OYY A;  1FSE A;  2RNJ A;  3CUQ A;  2UWM A;  3KET A;  1G6N A;  3BRO A;  1EH8 A;  1R7J A;  3W6K B;  3FZV A;  5E8G A;  4XLN F;  4F7Z A;  1XSV A;  4EM1 A;  3B02 A;  3M8E A;  3C7J A;  1E17 A;  2OQG A;  3SZP A;  2K7L A;  2P5V A;  2QVO A;  1LDJ A;  2E7W A;  3CO6 C;  1U5T B;  2QQ9 A;  1BC8 C;  4MNU A;  1DDN A;  1O57 A;  4NQW A;  3I59 B;  1YS7 A;  1O3R A;  3GFI A;  1I1S A;  2DT5 A;  4OIO F;  4LB6 B;  4BQA A;  1IAW A;  4U88 A;  1ZG3 A;  1TQM A;  1ZRF A;  2LKP A;  4XRF A;  3P9K A;  3F6V A;  2QZ8 A;  2MC3 A;  2KKO A;  4HV6 A;  2FML A;  3RKW A;  4OMZ A;  1FP1 D;  2O8X A;  1FBS A;  2EB7 A;  4BH9 A;  1LVA A;  3JSO A;  3OV8 A;  5H6R A;  3BDD A;  5LBQ A;  2QUF A;  2AS5 F;  4Z2Y A;  4ENJ A;  2PFB A;  1XGS A;  1XCV A;  2FSW A;  5DUK A;  2P4W A;  4HV5 A;  2P6T A;  1QZZ A;  3COA C;  4BHC A;  4IXA A;  1XSX A;  2W85 A;  3BJ6 A;  4PGG A;  5LRR A;  4A0X A;  4HZF A;  4AIH A;  2CGP A;  3RI4 A;  3I0T A;  2FQ3 A;  3O3K A;  3WGH A;  2RN7 A;  4LK0 F;  4KMU X;  4MTD A;  2ISZ A;  3BPV A;  2A07 F;  1QPM A;  3MQ0 A;  2O61 A;  5FO5 A;  5CVV A;  4WXC A;  4HOB A;  3HTS B;  3KCC A;  2XIG A;  1FX7 A;  1DPU A;  4KMF A;  1SMT A;  5J8F A;  2VOP A;  1XSD A;  2P6S A;  1U5T C;  3WGG A;  3FHZ A;  3GXO A;  3HOT A;  1NHA A;  3V8K A;  1DP7 P;  2JPB A;  1P4X A;  3IRQ A;  3ZQ7 A;  2CWE A;  3HTU A;  3EYI A;  1KU7 A;  3T0Y A;  2COM A;  4EM2 A;  3VOE A;  1YW8 A;  2XHK A;  2B0L A;  4HF2 A;  4UNO A;  2STW A;  2V9V A;  3HSE A;  5J8C A;  3BJO A;  4LFU A;  5IT9 Z;  4JBA A;  3ISP A;  2BV6 A;  3ECH A;  2GIV A;  3E6M A;  1RUN A;  1ZN2 A;  2VC0 A;  5ILS A;  2MBF A;  3LA3 A;  2DQR A;  1R36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...