1ZLSH

Fab 2g12 + man4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
223
structure length
213
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 213
sequence length 223
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlsH01
1YC8A 4JFFD 1OY3B 1DQLH 4YR6B 2Q76A 1XR8A 3OKKB 1DBAH 3VXQA 2Z31D 4MQ7B 2A73A 1IC1A 5CILH 3B3IA 3GSVA 5BCAA 3H8NA 1T7XA 1G9NL 1FVDA 3JZ7A 3OJDB 1KFAH 3ULUE 3RZWA 4JFOA 3ZT6A 3GM0A 2UY7A 3X13B 4K2UL 4HWUA 1C1EH 1PKOA 5FGBC 5JOEA 4JZJA 4Y4KA 3BIKB 5DMIH 3WUZA 1QVOA 1RZ7L 2BHUA 2YBRB 4WCYH 2D7TL 4JLRB 3TA3D 1TXKA 5IOPB 4K7FA 1DVFB 1A7OL 4Y5VA 4PJIF 3MX0A 4JG0L 5CZXD 2B5IC 3CFBA 4ZTPL 3QUZC 2DKMA 3B9AA 3B5GA 3LKRA 1XF3B 1Z0MA 4PYHA 2C1PA 4PJCA 4XXCA 5BS0D 5DEZA 4OT1L 3KDMA 2F54E 5KSAD 5HXMA 4P5TA 2MOVA 4GRWF 2EC8A 3JSSA 3N85L 5L8LB 5J1SC 4MJ4A 1ZHNA 5EZIL 1BGXL 1FZMB 5D4QA 5DO2D 2AERT 1TPXB 3T2OA 4OBSA 1LEGB 1RJCA 3ARFA 5CMAB 5ACZA 1A1OB 1MCCA 2WK2A 5D2LF 5A3ID 1ES0B 1N59A 3H42H 5F89B 4PRHA 3ARGA 2CK0H 4H0HB 4L8DB 4LVNB 4FQLH 4PJ7B 3NFSH 2QSTA 3CSGA 5T1DL 3DVIA 3RX7A 3BPOB 4XBEL 2ZUSA 4MLSA 4X5XA 4LRIA 4MAYA 2UYLA 5FYJD 2ESVE 4FFVD 2I25N 1YMMA 1VFMA 4GW4A 1X5AA 5DRXA 3MV7B 1Q9KA 3B5TA 5EBMA 3O6KH 1DZBA 1EGJL 3U7YH 3GI9L 1P4BL 2MTPA 3MUHL 3EJZC 5CBEB 4KJYB 4PLJD 5KSVB 3O4OB 3GO1L 4LPCA 4JFPA 3V5DA 5K59E 5EN2B 3NCYP 1S8DB 3VGAC 3CXHJ 3WN5A 1IBGL 2CIKB 3TZVC 3MRRA 4U1HA 3LPWA 1VGEL 4IRSC 4TSAL 3KR3L 2XZZA 3U0TB 3MREA 4EQ2A 1B0GB 1RIVL 1AI1L 4HF5L 4N8VG 3ULUD 5GJTH 2R2HB 1VFBB 2C3VA 3MRJB 2AGJL 1MVUB 3WMSA 3QDHA 3QIUA 1YEHH 1RUAH 1HINL 3FQWB 4OIBA 1AGBB 4I4WA 3L3JA 3I2CL 5KSBA 2VQUA 5J13C 3ARSA 2Y7QA 2ZUWA 3CK0L 4LPXA 4P46B 4TUJA 1T04B 2R2EA 4NWUL 3SKOB 3DX6A 3ZYZA 5C7XH 1NUNB 1CXKA 3BRFA 1OM3L 2G60H 4YX2L 4IJ3C 4OM0H 5DEFB 2F54D 3VWJD 1KIRA 2PN5A 3QNXB 1F4AA 1JTOA 1M7XA 4YZFF 2VLLB 1H15A 3GIVB 4FZ8H 5KS9A 1JZ3A 5L0QC 4K8RD 1TIUA 1PG7X 1A0QL 1UC6A 3QUYD 4H8WC 1TETL 2X1QA 2JIXB 1ZAGA 5D1XA 4RMQA 5L2KB 5IHBA 2C1OB 4KKCD 1ZLSH 3CNKA 2VABB 3E3QC 4U0RC 4GQ9H 3WFBL 5I8OL 2OR9H 5JMOC 1FGVL 3AFLA 1CR9L 3MV8B 2VDNL 2LAGB 4R4BB 5HVWA 1CFQB 4XMKH 4XP5L 4KMTH 3ME0A 1EEYA 1CD9B 4M5YH 3S9DB 1RFDL 1F5WA 4JGUA 3A6CL 3FQXB 1JUFA 3RY6A 5E56A 3WD5H 5E6IB 2ESVD 3FO9B 3WS3A 1RPQA 5JHDB 1T20A 1ZA3A 5HHNB 2AI0H 2DI8A 3CFEB 1ZK9A 3QDGD 4OZIF 2WBJA 4NQCE 1MHHB 4GRLB 3MBXL 2IPUK 4JN1H 1UB6A 1U9KA 3ZL4H 1LEKB 2EDJA 1HHJB 3D5OF 3FO2A 3U36B 2VDRH 5C0EB 3PV7A 4FQCL 5KAQG 3QEQE 5E8PB 1K8IB 3S5LB 1CXIA 2R0KL 3T2PA 4OD3H 4ACPA 3T8XA 1V3LA 2ATKB 1BFOA 1DQMH 3OSKA 5IEKA 3GBNL 5B22A 4ZS7L 1UACL 3HZVA 2E3VA 3P9MB 5TF1L 2YUXA 3TN0D 3QFDA 3SE8L 1YPZA 1G7LA 1FFQA 1K4DB 3EGSA 1B9ZA 4NM4L 1KN4L 4U33A 2M2DA 3NFPA 4LSDA 5D5MB 4Q9RL 2JCCA 2NY2C 3QI9B 2CMRH 1G6VK 1A9EB 5EUOE 2MPAL 1U2HA 1LDPH 1LP9E 5I1IL 1GZPB 2H1PH 1G9MH 4C57C 1JNNL 4JFEB 2OM5A 2ICES 3SDDC 1EFXD 4DVBB 1EIBA 2FO4B 5EU4B 4PRBB 4DGIL 4N0UB 1UJ3B 3BGFB 2EH8H 4BUHA 3K1DA 3QUXD 5DHVB 3KNBB 4Z7UA 4EN3B 5ILTH 1PBYA 1FAIL 3WLWD 3QDAA 2DI9A 3CIQA 1UWGL 1P1ZA 4PV8B 1JHLH 1S7RB 3O0RH 3VXMB 2HT2C 4O2CA 4OB5L 3MRPB 1M05A 3G04A 3TLRA 4LHUD 3OTTA 3UBXG 5ADPH 4CNIB 5C09A 5I18H 5GSRB 1L0XA 2Q86B 1UXSA 1F8TL 2NW3B 4WV1C 1FPTL 2PCPB 3QXAA 4IRJD 5I1CL 5FGCB 4EOWL 1IAOB 4M7JH 1N64L 1E6JL 4GO6B 3TH2T 4X5WB 1WGOA 3Q3GA 4FABL 3S36H 1E28B 1TDQA 3RA7H 25C8H 4NQCD 2C3XA 4J3VA 4MD5B 3SKMA 4Q9CA 2J8UF 1OSZA 2EIZA 4CVXA 1F3DH 4QXGL 4F80A 2AS5M 1S7XB 4EXKA 4PRIB 1G7JB 3RWHA 3GBMH 1WFTA 2GAZA 3BO8B 3C8KA 1GGIL 1HHKB 1PG7W 4HGWA 1VADA 4QT5A 3TGXA 4U7MA 2B20A 2EIBA 2D7PA 3OWEA 2FBJL 3O9WC 3MGOB 3T0EB 4HJ0C 1S5IH 3QQ9D 1FNHA 4R2GC 1DLFH 4BH8B 3HC3H 4YHNA 4MJ6B 3CPLB 2CIIB 3GSRA 4PJCE 1I1AA 3KPQB 4S0SD 5DF0A 5IVOA 1MIML 1U8JB 4K9EL 1CI5A 3OKLB 1VGKB 4WI3A 3V9FA 4RNRB 3VMPA 2QV2A 4PJGB 1U8MA 1NCCH 4M7ZC 4Y5YA 2B1AL 4BSWB 3ZTNH 1NC4A 4HFWA 4CJ0A 3HC0A 5J12B 4K3JH 4MX7A 4TQEL 3MRNB 5JIHA 3SO3C 4GG8B 4PRHE 4Y2DA 5EC2B 1X5HA 1YYMH 5FYJL 3RUGB 2IH3A 3VGHA 4AQOA 2RB8A 2RBLA 5DVNA 3JWOL 2XV6B 3S4SG 1JRHH 1PYWA 3S37X 4J12A 1ODAA 1PG7L 1MJJA 2GK2A 1YMME 1BIIA 3KGRA 3G6AB 5LKNA 3SGJC 3QIWD 4NM8L 4GBXC 2NY3C 3TBWA 4BK4A 3UROR 4NSKA 43C9A 1IGFH 1J18A 1UM4H 3TV3H 4KZDH 5FKPB 4LL9A 2VZ3A 4P2YA 1JBJA 4HULB 2BVQA 2XQBL 4ETQB 2ARJB 4O9HH 2W0FB 1G7HB 5DQ9B 2AKRB 4FS0A 5EOTA 2IAMA 4RWHA 4Y4HB 3CC5B 3VRIB 4G8GB 5D7LB 4PRAB 6FABH 3AUVA 4NYLB 2NZIA 1PEZA 1R3IL 4HJJL 1N5AA 1Z9LA 4YHIB 3GIZL 2D0FA 3QHTC 1CBVH 2BVUA 1WWBX 4XP6L 4Y4KD 5DD6A 1R5IA 4X6DA 4PY8J 1CVRA 1MY7A 3LV3B 5E2VH 3REWA 3VGEA 3WS6A 5KSBE 4C83A 4LCUA 1T3FA 3KXFB 2D31A 2EEDA 2KH2B 2OXHA 4R0LA 2F8OA 1JK8B 3DMMC 4IIQB 4X9GA 1FGNH 5C07A 3V8CA 3L3GB 3N1GC 2E5EA 2FDBP 2OCFD 1OGAB 5SX5H 4P5TD 2YPLB 1AJ7H 4PRNB 4LQFL 2NY1C 1HXMA 2FEDC 4CU7A 3ARFD 1S9VB 4Z7WF 4HLZG 1CGYA 5F7YC 4V1DB 1JN6B 4JQXA 3VFUA 2XA3A 2EO9A 4PRHD 5EIVA 4LKCB 5D1QA 2OTUB 5FA4A 5LXGH 1ZHLB 5DWUH 5KJRL 2G2RA 1RUML 5F6IB 4EUPB 1PKQA 5I15H 3PHOA 3ZO0A 4XVJL 2ZPKL 2AJYH 4MAYD 5KVEH 3V5HB 3HUJF 4WHDA 4DZ8B 4NC1E 4KQ4H 1YMMD 4GAGH 4AMKL 5IJVB 4HWBA 3BYTA 1SY6A 3TFKC 3U48A 1IM9A 2XZCL 1IZKA 5DJCA 5FUZH 3GSUB 2XPGA 2NMSA 4C4KT 4HS3B 2IANB 4ODVL 5CLWA 5FYKH 2A74B 5IIEA 4Q97A 2IGFL 4W70A 4XGZA 3H7LA 1NGQL 1G9NH 3K2UL 2YWZA 1A14L 4ZFOL 1MCIA 3H9HA 1II4E 3IGAA 4MA7H 4PP1C 4XCYA 1JE6A 2ENSA 2QADC 4MA8H 7FABL 4MB3A 1N6UA 1D5BA 3L9RB 4X83A 1M4KA 1I3VA 4Z77B 1NEZA 5FO9B 1HEZB 2VL5A 1LO5A 4NZRH 2BY1A 4U4BA 5IWLC 1YPZE 5FV1L 4FQJH 3NAAH 4XWOC 3EFFB 3THML 2JCCE 4R3SA 4JO2L 2LABA 3C87A 1FBIL 3DI2B 2JELL 4PLKC 3CZFA 3DV6A 3OKEB 4ZO9A 1ZHBA 3S96A 4TUOB 1QOKA 3O3AB 4PRPB 2VXQL 3MJ8B 1BGXH 5FFLA 3OX8A 1RZGB 1DBKL 2QR0A 3MLSL 4JFFB 5FCUL 4Z7UE 2CLZA 4G43A 1D5XA 3ZDYE 1U8IA 2ITCB 5BW7C 4HUVA 3QPXH 2Z31B 1W8OA 5DJ2A 5D1XD 3W9EB 4ZQKB 1CQKA 2V5TA 5T1DH 2P7TA 4F37K 4JAMB 4OAWA 1T1XB 4U31A 1BZ9B 3NCJL 1KEMH 1SM3H 5C09E 5F7KC 3KPPB 1R5VA 4J4PC 3MNZA 4U1JB 1ONQA 4KKBD 4ODSL 5CEXB 4WFGE 1NANI 1SBBA 2UVEA 4FTVB 4LSRL 1P4BH 3RP1A 2IFFL 2Q7NA 4J3UA 4HCRH 4TUKL 2IWGA 4P23C 2WBJD 5MEQB 1IBGH 3P11H 2WMPA 4XP1H 4QY8A 3HCVA 3H9ZA 1HH6A 4G6JL 4OI7A 2A1WH 1AFVL 4J8RA 5I1HL 1AGCB 5HGHA 5GGTL 2H32B 4QHKI 2R1WB 4HF5H 5F7WC 1HE7A 5KANG 3PG2A 2AGJH 1XF2B 1OARH 4L4TA 2RQ8A 1VEPA 2UUDK 3MUGB 2R23B 3GMOA 1JNJA 1RIHL 2MSPA 2FYYA 2BSRA 1U8HB 2A9ML 5D2NA 2C26A 3I2CH 5IFAL 4YHMH 2ZCLH 2F15A 3CK0H 5JA8B 2EDEA 4M7KH 4F7EB 4W68A 1QSVA 4LASH 1QFOA 3DECA 1S78D 1LO2H 5D7IF 5I1EH 1GC1L 1YN7B 3T3PF 3HN3A 5JDJA 1ZVHA 1BQSA 1TZHB 1MFBH 2HKFH 4P5KA 4XVTL 1UYWH 3BUYB 2E7HA 2GJ6A 2AAVA 4LLAA 1A0QH 1G9EA 5HPOA 3D48R 1TETH 1AQDA 1BFVL 3NIFF 1WFNA 4ODBD 4KFZC 4KJQC 3HPLA 5I8OH 1FGVH 1YEDA 4NRYA 4YEFA 2P8PA 4G80A 1SQ2N 1I1YA 3FQRB 5HY9B 1QFUL 1N3NB 2CKBA 4C59B 4NN5B 1H9VA 3ZKQD 1DEEB 1AC6A 2HN7A 2AJXL 3A6CH 2NNAB 3GJFH 4JREB 5C09D 4YXKL 4NBYB 1KT2B 4MDJB 1RSFA 2V17H 2HLAA 3OG4B 4WFGD 3T04D 4F7PA 4I77L 3RJQB 3GNML 3VW3L 3QO1B 5EU3B 3WYRA 4KHTL 4X6EB 4JPIA 2X4TA 4ZUTA 3BI9X 3V4VH 1JI2A 4ISVA 4BZ1L 1FLRL 5IB1B 5DJZA 4UBDD 1PZ5A 1NLDH 1KC5L 5EH1A 4LFHG 5BVJB 4FQXC 2R39A 4HJGA 3MUZ1 2R0KH 1KG0A 3OKDA 2F54B 4RGND 3VWJB 4A6YL 3GBNH 3NABH 4JO3L 1UZ6F 5FHAL 4LPYA 1KCKA 5TF1H 1Z3GL 1WC7B 4GS7C 4F7CB 3SE8H 1A3LH 3BPOC 3IDYB 3QUYB 4XI5C 3QEGL 4N8CL 4NM4H 1O0VA 1AR1D 1DLHB 2WQRA 3DBXA 2GFBB 1QO3A 2FL5A 2P43B 4HHAA 1BJ1H 2MPAH 4PJBF 1T0MB 3MLYL 3MRHB 4IS6B 1QD0A 5I1IH 2QEJA 4PV9A 5F6HJ 4ZUWB 1GIGL 5C07E 1J8HA 4AIOA 3U4EB 1I75A 3ZYJA 1I1AD 1MVFA 4OTXH 4LLUA 3TT3L 2OSLA 1U93B 1QFWM 3IFNH 3P4OB 1WJ3A 2FD6H 5E4IA 2WM0A 4DGIH 1YY8A 1MQ8A 2ESVB 4G6AC 1UZ8A 4Q74A 1S9WB 2XNAB 1KPUA 2BVTA 3L3HB 1ZGLM 5C2UB 4G5ZH 3OAUH 3QDGB 5TPWL 1U3HC 3PHQB 1OD9A 4PJFB 3KS0J 4U2ZA 5ICYB 1JHTA 2FCBA 2IPUG 1V7MH 2E9JA 3N1PC 3IXAB 5E08H 1HSAA 5GPRA 4OLUL 1A7BA 1PKQE 1XH3B 3BVNB 5I1CH 5EWIL 4UT6L 3QWOA 1E6JH 2RR3A 3MOBL 4RFNB 5CJQL 1BFTA 5D6CA 4FABH 1JPGB 5IHLB 3P73A 1LE5B 4P46C 4ZFOB 4P49A 1FL3A 3HAEH 4X6BA 3MXWH 5CP3A 5EFIA 5HGDA 3TN0B 3VDCA 3D69A 3IS1X 2EO1A 4NKDA 5ERWB 5I1JH 4G6ML 4QXGH 2R0LL 3GHEL 4QWWD 1S7TA 1UT9A 3FQNA 4NIKB 3SKNB 1NCUA 2IAMD 4X4ZA 3WIFB 4I18A 3FJTA 5GGQL 4XCNA 3EAKA 3FQUA 4QHUB 3RWFA 5IB3B 3INUH 1KJ2H 1EFXB 1NCAL 2PETA 3QUXB 5IW6B 1ZS8A 2W0PA 4XPGL 1MJ8H 4ZUUA 4O2EA 1CICC 3HE6C 3EYUL 1U36A 2IBZX 5B38B 1A6AA 4XB8A 2Z4QB 3F62A 3CX5K 3EO0A 1JTPA 5DK2A 4UU9B 4EVNB 4WY7L 4LHUB 3BKML 1KJ3L 5DRWB 4Z8FL 1GXEA 4K9EH 5EB9A 5IVZA 1KCSH 4IRJB 4LPVA 3E2HC 2FLRT 2YPKA 2GUOB 2ZSWB 4LGPB 5J7CC 1JVKA 3UTZA 1KB9J 2B1AH 3MYZA 4HX1A 5IHUH 3WSQH 1WK0A 3VFMA 4U49A 3OGCA 1PX4A 4NQCB 2Q7YA 4CMHC 3F7YB 3DSNA 1W0YT 1QR1A 2HG5A 1TJHL 1L9NA 1PG7H 3UTTD 2P44B 4KWUA 1QSFA 3L3KB 4R7NA 4WEBH 2XN9B 4HMDA 5KG9B 1RURH 3BD3A 3HMXA 1CL7I 4M9OA 3U7AA 3LEYH 1ND0A 3QI9C 2BVPA 1ZGLA 1IAII 1IM9D 4LFHD 3UEZA 1GHFL 1ACYH 3T0DA 4XNMB 4UILL 4J6RH 4RISL 1NUGA 4ALAL 5DFVC 2CJUL 2DQEL 4DKFH 5DQJB 3GRWL 4RA0C 4MDIB 3MFFB 3MCKA 3FOMB 3BGFC 2XXCB 1T83C 2UV3A 3CFCL 8FABB 1R24B 2EEAA 4E42B 1R3IH 1BJ1J 5GHWH 1GZQB 2ZOKB 1LEIA 1FNEB 3NH7L 4L4TE 1W72A 4NQVA 5GS1A 2A83A 4XP6H 4HFUL 1VACA 3C5JA 3WLBA 4M1GH 4C56A 2ENYA 2D03L 3MV11 4OD2A 5D2NE 1ZA6B 5CKAA 3T65A 4QXUH 4HC1H 1BQHB 1QLRB 1VSCA 4XX1G 1HYSC 3JV5A 2AQ3A 1YEKL 3OXSB 3BXNA 4EDWH 1REIA 2FX9H 1A6ZB 5EO0B 4XNUL 1IQDA 1G9NC 1S5HB 2VQTA 4BZ2L 4JKPH 2R56H 4WI9A 4KDTA 4OI9A 4LGSB 4PLNC 1T1YB 1YNKH 4LQFH 1WZMA 1NDMB 1NCBH 3DIFA 4X4MA 2W65B 1HN1A 2GJ6E 2QSQA 3MRIB 2WINA 3PNWB 2CK2A 4JKLA 3BP7B 2ICWA 3BZFA 2DWDB 4NN6B 4JCMA 2Q76B 1Y6NR 3FB8B 4YUEL 3QRGL 1AP2A 4LLVB 1UG9A 1A5FL 2A73B 2YZ1A 3JXAA 4IMKC 3LKSA 2ERJB 2R4RH 1FVDB 4XVJH 2ZPKH 3UYOD 1QNZH 5DJXA 4JFOB 3FTGA 5I0DA 4WO4A 4QHLB 1FP5A 3ISWA 1FO0A 3LD8C 4Y4KB 5C1MB 1QVOB 2FHCA 1MRCL 5GZOC 3TIDA 2IGFH 3QSKB 2EYSA 4K7FB 4PJ9D 4A6YB 1MJUH 3K2UH 5TFSL 5B4MC 5F9WC 3CFBB 5EOCH 5HHME 5H8DA 4PJCB 1OHQA 2VR4A 1FZJB 3KDMB 5J12C 2L7JA 4P5TB 5F3BA 4QRSA 1JF1B 2J8HA 4MB5A 5TQ2H 4RX4D 4NCDA 4CRPA 4L4TD 1UKQA 4YBLB 4DJMA 3UBXB 4TULL 2DQUL 2BHYA 1CGSH 3ARFB 4EXPX 1NC2A 3PWNA 5D96B 4OGZA 3N1MC 4LLWA 1AHWC 4I48A 1T66C 4CMMA 3UJJL 1NGXB 3BZ4A 1JZ7A 5FF6B 5GRJL 1EMTH 3K7UA 5LG1A 1FBIH 2Q8BH 3K80A 1P4LA 1NBQA 3DWTA 1J8HE 1JGVL 2YR3A 1MAML 4X5XB 4DKEH 2EDXA 2QQLH 4ZUVB 5IBLC 4XVSL 3FT3A 4MAYB 2UYLB 2Z92A 1DBKH 3B5HA 3CFJA 5FCUH 4GW4B 5DRXB 1YYLL 3G5YA 4MJIA 1Q9KB 2GJ6D 4POUB 1J05A 5EBMB 3RVTD 3OKMB 4KTDL 2DQFA 5SV3A 1R3KA 4Y4HC 4X7SL 3LB6C 4IBLT 5T3ZL 5IESH 2E6PA 1DQDH 3WN5B 4JZOA 5DK0B 2DLHA 2I60L 3EO1A 1FVCA 3WFEH 4FXGB 5DI8A 3ZHLA 1DBBL 3NCJH 5INDB 4W6WB 1C5CH 4U1HB 2JJSC 2CR6A 3FQTB 4FFYH 4K94L 1A1MA 3MREB 5IB4A 2V2TA 3ZMRA 5JXEC 5EBWB 4DFHA 3U9PL 4JJHA 5H94A 1MHPH 5CCKL 2NTSP 1AY1L 4XC1H 4LMQI 5C70A 1X6LA 2IFFH 4KK8C 4Z78A 4TUKH 3SDXB 1DP0A 1TJGH 2P1YA 4IIQC 5AWNL 3S37H 3QCVL 4PJEF 1F02I 3QDMB 4X6CA 1Y18A 1YY9C 3W81A 4RAVB 3OR7A 5I1HH 4OCXL 3L3JB 3V0VB 5KSBB 1MCRA 4P2OA 1NMBH 5JQHC 2BK8A 1IC5H 2NZ9C 4TUJB 1UQSA 2APBA 5CJ8A 2R2EB 5HHMD 3PABA 4JANA 5IROC 1QZ1A 3NOIA 1LHZA 1A6TA 3BX7C 1YNTA 1E27A 1MCWW 1FZOA 1I8IA 4EBQL 1RIHH 3G9AB 4UIKL 1H15B 1X5GA 5CD5C 4PJXB 3S4SB 3ZKND 1J0HA 3ULSA 3PIQA 4TNWK 3CH1A 1MWAH 5D1XB 2DS4A 3KYOB 4NWTL 1MRDL 2G9HB 1GGUA 4JO1H 2FIKA 1UVQA 5FGBA 1J8HD 4N1CA 4UOW1 3QUKA 3P4MA 1EEYB 3ELAT 3SE4C 3D25A 4JCLA 2E8YA 3ABZA 5DVKA 5BO1L 5I1GL 4HPOH 5CP7A 2LE9A 3EYOA 2O5YH 4L29A 1T20B 1YN6B 5EZOL 1LO0L 3QUZA 3NACL 4GOSA 3FL7A 2XWBA 2WBJB 2F5BL 4DCQA 2PW1A 1QFUH 1HNGA 2E7CA 4M7LL 5DJ8A 2DLTA 1UB6B 1F42A 3FO2B 1OP3K 1FQ9C 4K3DL 5JXAH 1QSFE 4UV4L 3BEVA 1GPOH 3WFHA 5DZNA 2BHZA 4PR5B 4GLRH 1BFOB 3P40A 5I1AB 3EOAA 1FN4A 3VI3F 1BZ7A 4BZ1H 3BD4A 2JF1A 3K74B 4G6FD 3O41B 1AXTH 5A2IH 1RZFL 4ZDHA 5DJAA 5CHNA 3EGSB 4OLZH 3NFPB 2JCCB 4LOUC 2DL9A 4H5SB 1TVHA 3NCMA 5I9QC 1YECL 3MACL 2KBGA 5EU6B 1IKFL 3OB8A 2ZCKH 4JY5L 3HB3C 5BZWA 5EPMA 4HXBL 5JA9A 1NLBL 1YA5A 2H45A 3RU8L 3IXTA 2XKUA 1NMAH 3GSXB 2X05A 3RTQD 4PB0H 1Z3GH 4AEFA 1I8MB 2Q20A 3TZVA 3EFDL 3JTTA 4C56E 1IL1B 4XBGA 3QNYB 4NNXA 5MP6L 2C4FU 3NCEB 3EIFA 3MLYH 3QUML 2D3VA 3TIEB 4O2CB 1M05B 4IHOB 3E6HB 1A4JB 4HS8H 2QSCL 1EUUA 4KI5E 3TT3H 1WTGT 4K7PX 5L6YH 5C09B 2A6JA 1U8LA 3S3SA 1G7MA 1UXSB 3VG9B 2NTFA 5E99L 3DX8B 4R6UA 3QXAB 1A6WL 2P5EA 1A4KA 4PG2A 4HEPG 4YO0A 2NQCA 5CZXC 1G6RL 2EH7H 1ZEAH 2DTML 1G0XA 2GY7B 1KTLB 2OZ4H 4KKLC 4LSVH 5KVFL 4LVEA 3ZDZE 2DD8L 5B8CB 2B39A 1JWSA 3UPRB 3EOTH 2HTLC 3MRCA 1OSZB 2EIZB 3IDJA 4OLUH 5IW1B 4PJIA 2D0HA 5JMRA 2J8OA 3RWHB 1HSBB 1T1ZB 1VDGA 4UT6H 2GAZB 1QSFD 2GY5A 4RGNB 2EC9T 1I85A 1AQKH 4K9EC 4HGWB 4H26A 5INCA 4QT5B 1IE5A 3UJTH 5ESVB 4P99A 5CAYB 1QYGH 5HGBA 1IMHC 3TPKA 3FFCA 1YEIL 2LAAA 3GSOB 4H1LA 4G6MH 5SWZE 2R0LH 3GHEH 3LN4A 3QP3A 5IMMA 1U3ZA 4FFVC 1L7IH 4OZHF 3V7AG 1IT9H 2NY7L 1SJXA 1JV5B 2AK1L 5SWQA 3WDJA 1I1AB 1WLHA 5GGQH 3TJEL 5L88H 1TZIA 5CFHA 4FFWC 5C0FA 3C08L 3KPLA 1OQOA 1JTTA 4P9HL 4NNYA 1UCBH 1NDGA 3LKPA 4JM2C 4DN4L 1U8MB 1RULL 1SBSL 5D7JD 3P77A 4XPGH 2IADA 4NN5C 4C56D 4HFWB 4K23H 4LLMA 4M4RA 4QKXB 4MX7B 4JKMA 2CDFA 3DV4A 4K71C 2LFGA 1I1FB 4WY7H 3VD3A 1YUHA 3DTXB 1Z0NA 1U8KA 3A6OA 1NAML 2Y36L 1PYWB 1ZWIA 4KI5D 1FSKB 3QYCA 4NUJA 1I1CA 3SGDI 1MJJB 3LQAL 3SO5A 3CFKA 4MJIE 4YFDB 2NY5L 4U3XA 2DM3A 2OK0L 2F53A 43C9B 4E0RA 3ARWA 5H2BB 4PJAA 1S9KC 1FFOB 4G6KH 1T6WA 5CEYA 3W5MA 3HI1A 1FH5L 1HZHH 5ICZA 4LLDA 1GYAA 4QCIA 4XPHL 4OZFA 2BVQB 2XZAL 3ARBC 5J6GA 1T5XA 1BVKB 1YQVL 1JPTL 4XTRC 2ZJSL 1I9JH 1I9RL 2GSGA 1MLCB 5EOTB 2IAMB 2Y4SA 1SVCP 5DYOA 2FSEA 3WDIA 3FRPA 3V7MA 2J1KA 5D1ZC 4WO4D 3BQUC 3C6SA 4KKCC 3V7AE 4L3AA 2BRRL 1GHFH 1MCPL 2CLRA 1E4JA 3WNPA 1BJ8A 3VI4F 3FRUA 4QRPA 2HVJB 4UILH 5DD6B 4X6CE 1U95A 2FATL 3CCHB 2JTDA 3REWB 2OXGA 1RJYA 1A2YA 1KCVH 3I6KA 5SWZD 1T3FB 4WV1A 3U0WL 1KBGL 3SKUD 1BVLB 1CFNA 3B2UD 3IT8D 4JDZB 1IZJA 4M1CD 1XR9A 1VFAB 4OLEA 1JMZA 3VE0A 3WL9B 5LWYH 1OAKH 5GS0H 1BEYL 5DK3A 5H37G 5C3TA 2JJVA 2AQ2A 3ZE1E 4UV7H 4PP2A 3GKWL 5DZLA 2A38A 4AL8L 1HXMB 1LMKA 2D03H 4HLZH 4TOYL 4XWGL 1UM6H 1NC2D 3WIHA 4ZNEA 3IVKA 4S1QH 4OZIA 3UYRH 4M62L 5I1DA 4DN3L 1YEKH 4RMVA 4POZC 2W9LA 1MIEL 5JO5B 5JW5A 5C8JB 5FA4B 2APWA 4BZ2H 1OD7A 4ONFL 1KACB 2G2RB 3KWWB 2BFVH 1WICA 3UTTB 2P8MB 1PKQB 5F7NC 5F7HA 1P9MC 3O9WA 2K9UA 5FGSA 3KYKL 1OLZA 2X4NB 5JW3H 1BAFL 2FJGA 4MJID 1BIHA 3MJ6A 1BECA 4UNUA 1RUPL 4YUEH 5FM5O 3MJ7A 5DJCB 1KSRA 1A5FH 3FONB 4P3DA 2JJWA 3KLSA 1D5IH 2XPGB 2CGRL 4NNPL 4K7PL 2APTA 4JR9L 1ZLVH 4ORGB 2A77L 4AT6A 1EPFA 5IIEB 4DOHE 4XGZB 5B39A 4Q58C 2FWOB 5DHYB 3QUXC 3H9HB 3MRKA 4J3WA 4RGMB 4IOFD 2DQHH 3PQYA 5GGUA 3LZFH 5T5FL 1T0NA 1X4ZA 4JO4H 4HWZB 4U6HA 4LU5H 1CU4H 2CRIA 4PBVC 3VFGH 15C8L 2A6IA 1MRCH 5FDWB 4YBHA 4HUMB 1TNMA 2BNUA 2OTPA 3ORJA 5GJSH 3I50H 4JDTH 4R3SB 4YQXL 1BVZA 3SGJA 4KKNA 5T5NG 4GBXA 4NQTA 4KHXH 1MCJA 3DV6B 4G7YL 4GAYA 2Z93B 2DQIH 3S96B 3DARA 2C7UA 1U0QA 4G8IA 3MRFA 1M71B 4MD4A 4OLVL 5EORL 3TO4C 5IF0B 1ZANH 3IDIB 2QR0B 4TULH 1WWAX 4G43B 1OSPL 2O26U 4QRRA 1NFDF 1J0JA 2XTLA 3UJJH 2X70A 5EU5B 5DFTA 4WI8A 3H9SD 1CDCA 5CSZA 1AGEA 2P7TB 4HV8A 3MPCA 4LF3B 2J8UA 1H8NA 1MAMH 2FO1A 1G6RB 4ZFGH 3AS0A 4E9LA 3I75B 3A67H 3BHBB 2E7MA 4HIXH 1KCRL 1R5VB 1I3RA 1ONQB 1DUZB 4FRWA 3AU1B 1LO4L 4JM4L 5ADOL 4JFXB 1RI8A 1WIUA 1RD6A 1B88A 1AD0A 3RZCC 1QRNA 3DMMA 4Z7VA 3PGFL 5JLZB 4X7SH 5T3ZH 4LARL 4JHAH 3NN8B 1QACA 3WJLC 2I60H 4PJ9B 4M43L 3HCVB 4QY8B 3TJHC 1DBBH 1HH6B 1X5LA 2VR5A 3HE7B 5JUEH 4J8RB 2HKHL 4PJIE 4UAOC 3M1BA 3W82A 4X98A 3I6LE 4GSDL 5IQ7L 4B7IA 3ARUA 3S34H 3H7BA 4ZOEA 5DVOA 4LIQE 3U9PH 5CCKH 1KXTB 2MWCA 4GRWE 3E3QE 3HNVH 5HI4C 1LNUA 3DRQA 4L4TB 4XP9H 3FFCE 1EHNA 3QCVH 2FYYB 4XPBL 3V4UL 3VFNA 2HJLB 1K4CA 1SYVA 1T1WB 5D2NB 2UWEA 5D2LE 3TM6A 1DBJL 1PGRB 4AH2A 3EJYD 3HI6H 5ANMB 1U91A 1W72L 3ULVH 4M4PA 3EJZD 4X4YA 1CG9B 3VXPA 4UIKH 5HHXL 3EOBA 3SBWC 1MQKL 3K1KC 2GJ6B 5E5UB 1NAMB 2HFTA 3BFOA 1WCBA 2N7BA 2IH1B 4M93B 2CDEB 5E4EC 4IRSD 1BM3H 2YRLA 4NWTH 5E5RB 4P4KA 2YKLL 1MRDH 1KELL 4HIIA 3O2WL 3STLA 3TPUB 1YEDB 4KRPB 2P8PB 4G80B 4CKVX 2RAMA 5C0CA 4JPVL 1JGDB 3T3MF 4N9GB 2HN7B 3CJJA 5FOBB 1KUMA 1FJ1A 3NGBC 3L3IB 4OKVA 3KLAB 5IWLA 4M1DL 2OL3A 3P9LA 4FNLL 4XCEA 5DJYB 2FNBA 4TNVK 2HYMA 1N2RA 1SJHA 4Z7OE 2LVCA 4I5BB 2F53E 2WSKA 3NACH 4PJAE 5C71A 5SX5K 4F57H 2F5BH 2X4TB 1HDMA 4F3FA 3HHRB 1JNLL 5JPNA 5DJZB 2A6DA 4NRXA 2GTZA 4UT9L 4JN2A 4K3DH 1GGCH 3I6LD 5HHMB 1FO0L 3IDXL 5DJ0A 5BW7A 5FECA 5BJTB 3IDNB 2DMCA 2LU7A 1ZLWH 3ARZA 5D96C 1AKJD 1X5YA 4BA8A 3OKDB 2IQ9L 5K9KB 4HK0B 2P4AB 4YZFE 3OGOE 1YEJH 4QRPE 1G7QA 2YD4A 3FFCD 1OVZA 4PJDA 3L5IA 3M45A 2GHWB 4HDIB 1WAAF 4FQ1H 3U82B 5CZKA 3DBXB 3U9UB 3BSZL 1JRHI 2FL5B 4HIHB 1QEWB 3BGMA 3EBAA 4NN7C 4IRZL 1CD0A 1IKFH 2EXYC 1ZE3C 4JY5H 1J8HB 2O5ZL 5IGXL 1RQ5A 1TFHA 4LLUB 1NLBH 1N6QL 3RU8H 5DJDA 4P23A 3WFCH 3ECBA 3HNSL 5TDOA 3GMNA 1GRWA 5D8JH 4Z7QE 4N68A 4DGVL 5T1LA 1UZ8B 4TVPE 3HZKA 4KY1H 5B21A 2X42A 1U8OA 5AYUL 1MHCB 4OZIE 3QUMH 2MKLC 3GMQA 1VPOL 5CIPB 3ALXA 4PJ8C 4MA3B 1UEMA 2D9QB 2DBLH 3OPZH 4LPUA 4LSQL 1YJDH 2X1PA 4KI1A 1UFUA 4U1GC 4LK4A 4X0KB 3BEWA 3Q6FA 4QTIL 1B6UA 2EDTA 1KB5L 3EZJB 1N8ZA 4PGBA 4L5FL 4MD0A 3QWOB 5GGVY 3BP5A 2AK4A 1G6RH 5D6CB 2DTMH 2NY2D 5AZEH 3P73B 5F7EL 2F53D 1WBYA 1OP5H 2CUMA 3DI3B 4JFYA 5EA0L 1NBVL 1EHAA 2DD8H 1R0AH 4G6FB 2HTKC 4X6BB 5HGDB 2RIKA 3OKKA 4JJ5B 4YR6A 4BQ9A 4MQ7A 5C08E 2YZ8A 3BISA 4EEEA 3SDDD 3FQNB 3DETC 3PQYE 3NMEA 2DAVA 2VDQH 4LRNL 1EEUA 3RWFB 1B0WA 4J7RA 1TQBB 3RTQB 1WZLA 1IEBB 4OF0A 2JB6B 2IBBA 2HT2D 3P4NB 3WKNA 3A0OA 2PYED 4O2EB 3WNNA 1DL7L 2FECI 2YC1B 2YBRA 3GK8L 4KKBC 4X9BA 5I30H 3X3FL 4JLRA 1T21B 1CL7L 1IGYB 2NY7H 5D71H 3EO0B 1Y6KR 3LPGA 1IAIL 4YXLH 1QRKA 3FCTB 4YJZL 4FOMA 2EDWA 4P9HH 3S88L 1XF3A 3DO3A 4JKWA 2Y06H 3UZQA 2ARJQ 5AEAA 2X4OA 2YPKB 4WIQA 1RJZB 4QRRE 5IFHL 4PJHB 5HVFB 4NKOA 4BQ8A 2C3HA 1A7RH 4FQXA 3OGCB 1A1OA 4HH8A 5I75B 4U1KB 1ULVA 4Q7DA 1ZKAA 5FA3A 3CDCA 2J8UE 4YH6A 5F89A 4TSCL 4DEPC 1NAMH 4L8DA 2BY3A 2AEWA 2HG5B 3KYAA 5L7XH 1LK3L 4MJ5B 5D5MF 4IM8A 1JWMA 5J9PB 3W11C 1KEGH 1DDHA 3I02A 4Q6YA 4A2MA 1ND0B 1QRNE 2I5YH 3MA9H 4JKKA 4Z7VE 5ENWA 1FH5H 5DA0B 3MV7A 4D9RE 1NCNA 1UA6H 2FX8L 3QEHA 1XEDA 3LVEA 1C12A 4KJYA 5DUBA 2VTFA 5KSVA 1QUNA 3VXOA 2DLGA 2B7DT 5EN2A 5C08D 3RVVC 1S8DA 4Z6AT 1HK6A 2AEPH 2OMBA 4M6AA 3MCKB 2DQTL 1K3IA 3VFSA 2BY0A 4L8CA 3T4AB 3M07A 4Y4FB 3U0TA 1U3HA 1B0GA 1LEIB 1KB9K 3GMPA 3MLVL 1W72B 5GS1B 2A83B 1VFBA 2R2HA 3GJFK 1VACB 5D7JB 3MRJA 3W0WD 3WLBB 2FATH 1MVUA 4C56B 1FIGL 1JWUA 4MQXD 3P2TA 3U0WH 4I3RH 2O61B 3B9VA 2VXTH 3WXWL 3VG9C 4M6NL 3FQWA 3VGFA 1AGBA 4FXLA 5I0ZA 1P2CB 3BXNB 2YPVL 4GBXD 3N50A 3SEPA 5BRZD 4WUKL 1IQDB 4P46A 3AXLA 1T04A 4PGCB 3SKOA 1ADQH 4M9PA 2EKJA 5B8CC 1C5BH 1NCWL 1YEEL 4UBDC 4AL8H 5DEFA 4GMSH 1RMFL 2WINB 1SVZA 3QNXA 3BZFB 2FB4L 5EIIA 1AE6L 2VLLA 3GIVA 4QRRD 4ODTL 4DWHA 5I73C 4M62H 1A7PL 3ULVF 4Q2ZB 1BHGA 4XNZC 3D3VB 1MIEH 1J9CT 3LS5L 2Q1EA 5C0CE 4DVRH 4RGNC 4C58B 5L2KA 4ONFH 3LKSB 1OPGL 3LKOB 5J3HC 4ELMF 2GT9B 4ZPVA 3MV8A 4L8SB 5ACMA 5FV2A 5CIPH 4R4BA 4NQDD 3KYKH 1CFQA 1AR1C 1CICA 4YDIL 2WUBH 5DJXB 3FTGB 4WO4B 3MRGB 1RUPH 2FHBA 2BDNL 3FQXA 4R8WL 3LSOB 2R0ZH 4Z0XB 5JQ6H 1QRND 1FZKA 1FO0B 3DMMD 1X3DA 2PR4L 4QO1A 3BN3B 4K7PH 4S1SL 4D9RD 5JHDA 3GEWB 5HHNA 3CFEA 3TIDB 4HZAA 4LIQL 4YDJB 4H8WL 2EYSB 5SWZB 4OM1L 3QJHA 4PJGF 3CVIH 1DANU 3MLTB 2JLLA 1MHHA 3IAPA 1T03L 3GHBH 3OXRA 1PSKL 1F2XK 2NY1D 3P30L 4H88L 3NPZB 2FEDD 4MNQA 5T5FH 3ESUF 1NGYA 1LEKA 5C0EA 4L4VA 3IFLH 1YMHB 3RUGF 4QRSB 3F65A 2E7LA 1MCFA 1K8IA 3EW3B 4PJDE 1NC2B 4I13B 3PWNB 1QBML 1UEYA 3WDHA 1JIBA 4LLWB 1MEXL 5MEPB 4I48B 4D0CA 3P9MA 2D2OA 1F58H 1GVIA 1MH5B 1NANH 3ZT7A 2BZDA 5KVMC 3DOSA 4QXWA 1P4LB 3QI9A 1JGUH 1A9EA 1N4XL 2AXGA 3IF1B 4JQIH 4M6MH 2XQYK 1OCWL 4WFHE 2VIRA 4OLVH 5EORH 4MAUL 5J11C 2BX5A 3FT3B 5BVPL 3QBTB 2EDRA 2FRGP 3CFJB 4PBWD 1OAXH 2C5DC 4MJIB 1OSPH 4RMTA 4IDJL 1J05B 2AJVH 4DVBA 4PRBA 3K8LA 3LMJL 4N0UA 2DQFB 1T83A 1R3KB 4KH2A 3KNBA 4PP1D 2AABH 4JZOB 4KGJA 3BKCH 4WWKD 5C0CD 2H3NB 1S7RA 1P7QD 4HKJA 3MRPA 1DBML 4XMPL 4XAWL 5ETUB 1MSPA 3MLWL 3ULVC 2OR8A 5ADOH 3MV01 5H94B 2AK4E 1XGRB 5GSRA 2NW3A 3IFOA 3EDDA 1OAYL 2BSSA 4Z78B 1IAOA 3GJEA 1TCMA 4LARH 1I9IH 4PLKD 2UVFA 5GS2H 4X5WA 3D87B 3K46A 5E1HB 1E28A 2VXUL 3QJFB 5IVXF 3L6FA 1F4HA 1CTOA 1N0XH 5IQ7H 4MD5A 1UQSB 3MUJA 2Q8AH 5LQBL 4XPAH 4JANB 2HWZL 5AAWA 1MJ7L 4PRIA 1G7JA 2YUZA 3BIBX 5I74C 2LU3A 4JFQB 3VJ6A 1HHKA 3WFZA 4XPBH 4IMKA 4GAJL 4LBEB 4DGYH 4KGLA 4HKBA 3B8YA 4APQC 1IQWL 1E4WL 5I76B 3PIQB 1RU9L 2DJ4A 3CH1B 5HDQH 2Y6SD 4J4PD 3H9SB 3MGOA 4UIMB 5DS8A 3QXDB 2BP3A 3PDGA 5GRUH 3MLXH 2IFGA 3RNKB 4L3CB 3CLFL 4MJ6A 4JHZA 3IAGC 1XGUA 3P4MB 4MNGA 1ZTXL 4P23D 4F58L 7CGTA 1MQKH 4U6VL 3QQ4B 5CP7B 4FFZL 3TNMA 1U8JA 2AJUL 5BQ7B 3S97C 4H0IA 3IFPB 5HJ3A 4GKNA 4RGMC 1G7IB 4YDLC 3RVUC 4N0YH 4XNYH 5FKAA 3RIAK 2VLKE 1JZ5A 2O93L 4JPVH 4GG8A 4DQOL 3WHE0 3WUWG 4NKIL 2RJMA 2KQMA 4CUCA 3D0VB 4M1DH 4OCRL 1CFSB 3GB7B 1P84J 3DHMA 2UZYB 3WFHB 5KTEL 1AHWA 1ZVYA 3VFPA 5DC4B 4HCRA 4WUUA 4JY4B 2MCPH 2BERA 3G6AA 1FN4B 1J1PL 1FE8H 1BZ7B 1E0OB 5IB2A 3O8XD 3EDJA 2VL4A 3U1SH 3VFTB 5KVGL 1BX2A 4ODHL 4UQ3B 2OJZH 5DJAB 5FKPA 4L9LC 1TVHB 2IMMA 2X89A 2WLYA 3RKDC 4ETQA 2W0FA 1G7HA 2AKRA 1HHIA 1RHHB 1ORSB 3T3PE 2V2XA 3IU4H 5EPMB 4Y4HA 1NBYA 3CC5A 3RIFF 4KJQD 4G8GA 4EJ1C 4PRAA 4NYLA 4OCSL 4YHYB 4D9LL 5EOQL 2AEQL 2IALA 3F12A 5K9JL 1J0KA 1S7UB 2VZTA 4XBGB 4IRSB 1A1NB 4BZYA 4WI4A 2XA8H 3BSZH 4DW2L 5JXEA 2ICCA 4O2FA 1NCDL 2G5BA 4QHKJ 1X9QA 4ZFZA 4GUPA 2VITA 1IEHA 3UJIH 5I17B 2IF7A 2O5ZH 2O5XL 3KXFA 1W2KT 1WIPA 1C08A 1JFQL 3TF7C 4LSUL 4IIQA 2A6JB 1G7MB 4OZGF 2NTFB 3L3GA 1BWWA 2P46B 1OGAA 5LCVH 1A4KB 3HE7C 1L0QA 3TC9A 1MFCL 1NGPH 4PRNA 1CDHA 1VPOH 1TNNA 2X6MA 1LWRA 3C60D 3B8SA 4FQXD 5IROA 2VN7A 3PWLA 1JWSB 1DUYA 4LSQH 1A3QA 1JN6A 3PWPA 1YDPB 3MRCB 2VLKD 4IJ3B 4D0BA 5L2KE 3IDJB 4MXWL 4WWID 1AR2A 1E4KC 4PJIB 1KB5H 2AJSH 3MV8E 2ADFH 5CILL 2XRAH 1JZ8A 2Z9TA 3HG1B 3UZEA 1IC7H 1AKJB 4AEHH 4OF5A 4EUPA 3G5XB 4P9HC 2H8PB 2XWJA 1XAUA 2VKXA 2NW2B 4GRWB 1KFAL 4U0RB 4PYGA 3QB7C 1UZ6E 4DZ8A 1L0YA 3FFCB 4I3SH 3LRHA 2XY1A 3T0WA 5HDBE 4YHLL 12E8L 4HUUA 3HRPA 1DSFH 5D2LB 3SE4A 1F4YH 3SE3A 5DMIL 2E8ZA 2IANA 5IMMB 4MXVF 5FGRA 2DDQH 4R4NC 3CFIC 3LOWA 4WCYL 4G6AD 1K8DA 5DJ6A 4MNQE 3TVMD 2R1XA 1TZIB 4L4VE 5C0FB 3KPLB 2ZUUA 1U3HD 3K81A 5BZDB 2YSSB 4QTHB 4NNYB 4N90E 2NY5C 2EECA 2DYPA 3LKPB 4KRPC 3L9RA 4PTTB 3ZZ1A 1F4XL 1Q8MA 2APXA 4M5ZH 3P77B 5FO9A 1HEZA 2WWMC 3VCLB 4LLMB 3ULUF 3F5WA 1CL7H 1N26A 3ZSTA 1XGTA 2EZ0C 1FYTE 4UTBH 1UB5A 3BE1H 3EFFA 1A3RL 1EJ6A 4U1SB 4CN6A 1CXFA 3QFJD 2Y1VA 4P46D 2CK0L 5F7UA 3OKNB 4FQLL 3CDYA 1IFHH 3OKEA 4NUJB 3DURA 4ZD3L 2BCKA 4TUOA 3CFKB 3O3AA 3A6BH 2NY2B 5IFHH 4P57B 5HVHB 4N0UE 1RZGA 4PJAB 5CEYB 3EO9L 3PDDA 2ITCA 3QH3B 4LLDB 1N6VA 4QCIB 4RBPH 2BSED 5J6GB 3MODH 1T5XB 3W9EA 1N0LA 3QIBC 5L2KD 3SDDB 1EO7A 1A7QH 5DZOA 2YXFA 4FQHB 4JAMA 1K5NB 3KJ6H 3ILPB 4BSVA 1T1XA 5J1AA 4ODWB 5GIRB 5I1KL 5DYOB 1CICD 3HE6D 4LVOC 3VWKD 4O00A 4U1JA 3PL6C 3GMRB 3C6SB 5CEXA 2R69H 3SDAD 5FYKE 5HHOA 4NO0A 5GJTL 4FTVA 5HHQA 2PYEB 2J7LA 5E2WL 1RJYB 1A2YB 3I6KB 3MSPA 4X9FA 4WW1B 4ZNCD 2DQTH 1CDYA 1XR9B 3BPCA 1KJVA 3VE0B 3T2QA 2GTWA 1AGCA 4TRPH 4MNQD 2H32A 2R1WA 5K59F 3RI5F 3OV6A 4L4VD 1UKSA 4ZS6D 4PP2B 3DUUB 4N90D 3HC4H 2NR6C 1T7ZA 1FIGH 2GJJA 4OM0L 3VU2A 4QEGA 3OHXA 3RWGA 3WXWH 1ZHKB 3MV9A 4FZ8L 3HZMB 4OZIB 1U8HA 3RJDA 1N5YH 2VAAA 1FYTD 3OJVC 3L1OH 3SDCC 1ZLSL 4F7TB 4GQ9L 1XF1A 4MNGE 3UDWC 2OR9L 4G9FD 1NCWH 4ONOA 1TZHA 3RGVC 5DFVD 5C6TH 1FNSH 4KMTL 2FB4H 1V05A 3ARRA 2W9DH 2JKXA 3BUYA 1A7PH 1OQXA 3MJ7B 4KK5D 2K7QA 4GRMA 4P3DB 3C6LC 3LS5H 3I6GB 3O4LA 3QPQC 5GRVL 1IILE 2FH6A 5IM7A 1VFOA 4Y89A 1DQQA 5B39B 3FO1A 5C08B 1TQBC 4JM2A 4ZSOB 3BMVA 5HY9A 4M7ZB 1N3NA 1M7IB 4YDIH 1DEEA 4JN1L 1EJOH 2B0SH 5C0GB 1XIWC 3SO3B 1T0NB 2CO6B 3ZL4L 4WUUE 4U6HB 2P47B 5FYLH 1KT2A 4GMTL 4MDJA 2Z35A 3KPMB 5FYKD 3W0WB 5F72S 4S1SH 3IDGB 4OD3L 3NFNA 3QO1A 4YWGL 5EU3A 2BNUB 2Z0BA 3KPOA 9CGTA 1PSKH 4FP8H 5IB1A 2XKNB 5CGYC 5A43C 3ZYOA 5IBUG 5BRZB 5F97E 3VXUD 2VDLL 4G8IB 3MRFB 2OBGA 3ZKMC 3ARBA 2H1PL 4Y5XB 1GOFA 1G9ML 2F54A 4P5MA 2WIMA 1LE9B 1MF2H 4HC1A 4QRRB 1AIFA 4GKSA 1WC7A 4F7CA 5CSZB 1FCGA 1AGEB 4HV8B 5D1ZA 3KXFE 2J8UB 3BQUA 4QGYA 1X5XA 1B4JH 3MCLH 1OCWH 1T0MA 3MRHA 4IS6A 1JHLL 1T2JA 2J4WH 1CK0L 2DJSA 4MAUH 3O0RL 3R1GL 4ZUWA 4NQDB 2ZSVB 2J5LC 1B0RB 5HHPA 5ADPL 1OGAE 2EIEA 1U93A 5EUOF 2YK1H 4NOFA 3FHAA 2W38A 1LP9F 3DMMB 3E0GA 1S9WA 4Z7VB 3X11A 2XNAA 2H41A 4M7JL 3R4DA 2AP2A 1FORL 4Y4FC 2J6EL 3PWPE 3QDGA 4R96A 3WIIH 3PHQA 4PJFA 5ICYA 1U6AL 3M1BB 2NY1B 25C8L 4X98B 1HQRA 3LPFA 5D7JC 3H7BB 4MQSB 3CX5J 3MGTA 5ECJE 5IHZA 3WO4C 1C7TA 3IB4A 2VDPH 1T66D 1IJ9A 4NUGH 2X4SB 1I7UA 3EOYG 4WUUD 3MR9A 3HPJB 3BIAX 3AC0A 1JPGA 3VFNB 3DGGB 1K4CB 5FK9B 2HT3C 2VXUH 4ZFOA 4JDVB 3N1QC 4KVCL 2H26B 4ZTOL 1P9MA 2Z8WC 3FFDB 3PWVA 2W0KA 4AH2B 2IANE 5CZVH 3HAEG 1U91B 5ERWA 2X89D 3JUZA 1S5IL 5LQBH 1ZT4B 5I2IB 1X5IA 2DLEA 2DM2A 5DUMH 1KOAA 2DIJA 3CDGB 2VO5A 3SKNA 2F8VA 1KULA 4ESKA 1ITBB 1H3VA 3LB6D 3Q6GL 3BDBA 2PXYD 4P2QA 1V3JA 4QHUA 1CCZA 1IQWH 1EFXA 1RU9H 5EULV 3QUXA 3V6FA 3U0PB 5IW6A 4JHBA 5J8OA 4M48L 4EQ3A 1NCCL 3OKOB 4FG6C 4HIIB 1OWRM 1BPVA 3STLB 1Q0XH 5IR1B 1ZMYA 3ZTNL 4WWKB 3L3OA 5C0CB 5T3XL 4K3JL 3KXFD 1P7QB 3KYMB 4KK8D 3DO7A 1YYML 3M17B 4F58H 4PRDB 2EYTA 4UU9A 4I0PC 3P9LB 4XCEB 5BV7H 1NFIA 4OGXH 3PXJA 1G1CA 1JRHL 1UENA 1YY9D 1SJHB 1OGAD 5E94A 1WZ1L 3SGEH 4M1CC 1INQB 2NZ9D 4MWFB 2WBKA 5HI3D 3WEXA 2HT4C 4J23A 1IGFL 4DQOH 2A6DB 4F7MA 4NKIH 3PWPD 3HLAB 4N8VA 4KZDL 2GTZB 3TO2A 1CGTA 4HGMA 5I16A 5CD5D 1ZLUH 1UJTA 3OF6D 5DJ0B 1J0ZA 4O9HL 1WBZB 4U1IA 3G6DL 3UZVB 5IUSA 3PUCA 3WJJC 4PY8I 4NHCH 3U4BL 5HHOE 2XN9A 4NO5B 5KG9A 4W4NA 3V52H 2X5PA 3RDTD 5MEOA 4FTVE 2OS7A 4ODHH 5GGTA 1J1XH 4PJDB 4QOKA 2W91A 1CBVL 2Q6WA 2XIDA 3BGMB 3LHPL 3U7WH 1HXYA 5DQJA 1CF8H 4OLXH 4MDIA 3RZCA 2B4CH 5TDNB 1ZLVK 5HYEA 1CS6A 1ZV5A 8FABA 5DJDB 4P23B 2EICA 3ECBB 5TDOB 4OCSH 1FGNL 1U58A 3GMNB 3WJLA 4E42A 5IKCA 5EOQH 2AEQH 3HNTH 2XZQL 1V3MA 3HUJB 2DQDH 1GZQA 2DYPD 1FNEA 5AD0B 1AJ7L 3VGBA 3SKJH 3MV9E 3NIDF 3GMQB 4IOFC 2YN5A 4P4RA 2BRQA 4F15C 2X4PB 1OAUL 35C8H 1ZA6A 2O5XH 4Y7MA 5IMOA 1JFQH 3ARQA 4LSUH 1JGEA 2AJZA 3BEWB 3VD7A 3Q6FB 3OXSA 4PG9A 1UADC 1A6ZA 1N8ZB 3E1F1 5DRNB 3LDBC 1S5HA 5DWUL 2FECL 3BKYL 1NGZA 4MD0B 1T1YA 5L8KB 2I27N 5MERA 4JZJC 4LOUD 4DUXA 1PJ9A 5FYJU 4PTUA 1C5DA 3VI3E 5KVEL 2YUVA 1XZ0B 3BP7A 3O8XB 4R4FH 3VXTA 4KQ4L 2DWDA 4GAGL 4PGEB 4BSJA 1AH1A 3HB3D 3FB8A 3O4LE 2ZUXA 4MXWH 4LLVA 4Y16C 5FUZL 4I2XB 2C4FT 5KS9F 3SBWA 4JGJA 5FYKL 5HD8C 3QXVA 5EZLA 5C0BE 4MYWB 1EV2E 2P24B 3T2NL 3W9DA 1IGML 1WV7T 1IAMA 4MA7L 3FB5A 5HHOD 4NO0D 4MA8L 4QGTA 4QHLA 3IKCA 2PF6A 4FTVD 12E8H 4YHLH 1IAKB 2CUIA 2V5RA 3SGDH 3HKFA 1VHPA 4NZRL 4LCCB 2ILLA 3WO3B 4A6YA 1MFNA 4FQJL 3NAAL 5DLMH 4HW6A 4KKLD 2EEBA 4NQEE 2V5YA 4JE4B 5MHSD 1FZJA 5IK3A 2X4OB 3V5KA 5CSGA 1F4XH 4FMKA 2HTLD 5E7BA 1JF1A 2MNUA 5AYQA 3HFML 5T5NF 5E5MB 1Z9OA 2WV3A 1CLYH 4NKOB 3UBXA 4HIJB 3C60B 3MV9D 1P6AB 4FQXB 5FA3B 3EJJX 1A3RH 2VLKB 4UOJA 1I8LC 1H3GA 3QPXL 5GRZA 3RVXC 4U3CA 1NGXA 1JL8A 2ZWLT 5FF6A 1DFBL 1QLFB 4GS7B 1YPZF 4ZD3H 1ZXQA 2V2WA 32C2A 2YEZB 3RHWF 1KEML 1SM3L 3O45B 1JWMB 4ZUVA 1CD1A 3EJYC 3RPKA 1B4RA 5FUCC 1DDHB 3I02B 3L7EB 5ENWB 2XI9A 3EO9H 3F7VB 4G8FB 5HGAA 3OKMA 3QEHB 2QBWA 3QDGE 1C12B 5DUBB 3O4LD 1MCQA 4FFWD 1D9KB 4PJFE 3TBTB 3VXOB 4HCRL 2XFXA 4Z7UF 3P11L 5JIKA 5DK0A 3ZDYF 4OZHE 4JM2D 4YHYC 4XP1L 4FXGA 5INDA 3VFSB 3TVMB 4L8CB 2A1WL 5I1KH 4HS6B 3FQTA 3GGWA 5C0BD 4HKXB 1U3HB 5F7MC 4AM0B 4PJ8A 2PKDA 2ZOLB 1GSMA 5EBWA 3GMPB 1MCHA 2CQVA 4O58L 3BJ91 1JWUB 1OARL 5E2WH 3SDXA 5IJKC 5ID0A 2VUOA 2ADIB 4NBXB 4TTDC 3QDMA 5ABDE 5IT2H 3D18A 4RAVA 1F4WH 3V0VA 2YD6A 1AXSA 2ZCLL 4YHML 3QFJB 2NY0C 3BUTA 3MNWB 3AXLB 4M7KL 1AO7A 5I8KL 2B8OT 4LASL 1M7DA 2R4SL 1NGWA 4LAQH 1LO2L 4NQED 5I1EL 1OTSC 4P2QE 2PTTA 3ARBD 2F58H 1OAZH 1MFBL 2R9HD 4ONGH 4XTRD 1ZLWK 1XCQA 2HKFL 3CH8A 4LLQA 5EIIB 3VA2C 2GIYA 1UYWL 2P45B 4RA3A 2DTSA 5DUPH 4PJXA 3S4SA 4S1RL 1U92A 4NPYB 5IV2B 5KANI 4WNQB 5D1ZD 3KYOA 4YBQC 3BQUD 2G9HA 3RWIA 3JWDL 1MY5A 4ZPVB 3LEXB 1OTUC 4IMLB 4DUWA 4KDVA 1WUNT 4OFIA 1CICB 3HE6B 3VWKB 2L7UA 2YD7A 3VRLF 3SDAB 3RBGA 3WNKA 4Y1AA 4WHCA 4U1NB 4DK6A 1FZKB 3VI4E 2V17L 2X9XA 5FM8A 4FHBD 3OZ9H 5EBLA 1QFHA 1YN6A 3O2VH 4P0DA 3HI5L 1CZ8L 2CKBH 3N06B 3QJHB 5CBAB 5HHVH 3E2HB 3V4VL 3OXRB 4PJBB 2XKSA 5ALBL 3TYGH 1KCUL 1H5BB 4EIGB 2I24N 4MNQB 1NLDL 1NGYB 4L4VB 4LKXA 4NKMB 5HGGS 4GMTH 5TE7L 4KZEL 2XN9E 5BOZG 5F9DC 1MFEH 4POZD 4PR5A 4CMHB 3GRWA 4YWGH 1HWHB 5I1AA 1CGUA 3NABL 5TQ0L 3PGCA 4QOKE 1FC1A 5F6HI 4D0CB 1OOAA 3TYFA 3O41A 1OP5K 2ITDA 1A3LL 1FYTB 2GK0A 2BOCA 4H5SA 4Z76B 5BXFB 5HVHC 1BFSA 2AXGB 1JZ4A 2VDLH 1UWEH 2VIRB 4G9FB 2HRLA 5EU6A 4XMLH 1FV1B 4HD9A 1J86A 4OTXL 3ARTA 4P2QD 4X9IA 3MJGX 3IFNL 3GSXA 3R0MA 2FD6L 5A2LH 1RVFH 1I8MA 4DAGH 3BGAA 3BWAB 4NHUB 1IL1A 2FEEI 3QNYA 1KN2L 2M8XA 2JB5H 4G5ZL 3OAUL 5CSBA 3TIEA 1CK0H 3MOAH 2HFEB 3R1GH 4HKJB 2CXKA 4X6DF 1V7ML 4IHOA 3E6HA 1A4JA 4KRMB 2BVEA 5E08L 5E6YA 5ITFA 1FL6A 4BKLB 4YFLF 3IFOB 3MBED 3DX8A 4JFDD 2BSSB 3GJEB 4OUOA 5SWSA 1FORH 2J6EH 1KTLA 1VERA 3X12B 1U6AH 5B8CA 3L6FB 1JYXA 3UPRA 3MXWL 3TO4D 3UPAA 4U1MA 5I1JL 5IW1A 1Q72H 3VXUB 2WBWB 4MHHI 1XGYL 5DA4A 1HSBA 1T1ZA 2XN9D 5BV7C 3VJ6B 5CP3H 4OGAD 4HKBB 4KVCH 5ESVA 3INUL 1KJ2L 1NFDE 4ZTOH 3STZA 2EDFA 4QOKD 2YWYA 3GSOA 5DS8B 5TE6H 1JCKA 3ZSSA 1MJ8L 1HNFA 4KJPC 3RIFK 1CDJA 2DM7A 1S7QA 5E8OB 3NA4A 3RZCD 3LD8B 1XGUB 2DLFH 2QKIA 4PGDB 4MNGB 1JV5A 1CLZL 3Q6GH 4WU5B 1TTUA 4CADB 1LQSR 1H0DA 3TJHD 3TNMB 1MRFL 1CYGA 3UTPE 1UKTA 2I07A 5F9WB 1KCSL 1K85A 2HFGH 4L8BA 5HJ3B 5FXCH 4M48H 1S9YB 4X4XA 4GKNB 4J1UA 5CWSA 2CDGB 3TH4T 2NYYC 3BRDA 5JNYA 5E8EA 5FKAB 5T3XH 5IHUL 3H0TA 1MCWM 3WSQL 3F7RA 5E2TL 1EX0A 1KTKE 1T7YA 5HI4D 1X44A 1I1FA 1EZVX 3PGDA 1D6VL 1KXQE 3MROB 4WRLA 5AG9A 3DTXA 1HH9A 3SGKC 5LGJA 3FZUC 4MQXC 3SE9L 3S3JA 1AHWB 3VFPB 4AIZA 1WZ1H 4WUUB 3U79A 3L5WB 4WEBL 3JV4B 1X6NA 1WEJL 3VMNA 1RURL 5FB8B 5IB2B 2EXWC 4RSVA 3WS6C 5H2BA 1FFOA 1BX2B 3LEYL 1CFBA 4ENEC 5CJXC 2VLRD 3WBDA 3ZHKA 4X80H 4IEFB 1ACYL 4OCWL 3UPCA 3DVGB 1QFWH 3I85A 4Y5XC 4PPTA 4J6RL 2MCG1 1BVKA 3W2DH 5C0NC 3FN0L 4DKFL 1HHIB 3G6DH 3RRQA 2Y5TB 3HMXH 2V2XB 3RFZC 1MLCA 3U4BH 3EHBC 4R7DA 1V3KA 1NBYB 4YXHH 2EDKA 2PXYB 4C4KO 3DROA 4NJAL 1DTUA 2X40A 2IALB 3F12B 5GHWL 4EDXA 3OAZH 3SDXE 4NO2A 2HVJA 3BT2H 3JVGC 3QDME 1OAQH 3J8F7 4HT1H 4O2FB 3LHPH 3CCHA 4M1GL 2G5BB 1KIPB 5E2UL 3MXVH 4ZFZB 3DVNB 4GUPB 2VITB 5DR5H 5C0IB 3JTSA 1BVLA 3T3ME 4JDZA 1C08B 1AO7E 4QXUL 4DZBA 1P84K 1VFAA 4HC1L 1SJEA 3WL9A 1DEDA 5GSVB 4EDWL 2FX9L 1I7TB 2X44D 3GSNL 3T0BA 2XZQH 2BNQE 1LILA 1KIUA 4JKPL 3UMTA 4H25A 4JGMA 2R56L 5D93B 3O3EB 1T0PB 2DN7A 3MRDA 1YNKL 3L5XL 4J3SA 3UTPD 4PJXE 1NCBL 3LS4H 5FOJA 3Q1SH 2ZUYA 1OAUH 5J0BA 3PWLB 1DUYB 3IJHB 3PWPB 4M8QA 4D0BB 5JZ7C 3GJFB 4R97C 5CUSH 1I9EA 1WZKA 5AUMA 4HAGA 3WE6B 4UINH 1JHKL 5JO5A 5C8JA 3QA3B 4APQA 3BKYH 3DYMA 3KWWA 3UTTA 2P8MA 2P8LA 5DT1L 2R4RL 1Q9WA 2XWJB 4FXKA 2V9RA 2CRYA 3FMGL 4Y1AE 4G8EB 1QNZL 3RDTB 1RZJL 2VZVA 1F3DJ 2X4NA 4FQ2L 4MGXA 4I1NB 4WTZG 2DKUA 3MLUH 4CAGA 2EXYD 4KUCF 1AXIB 4HUUB 3FONA 3HMWH 2YHGA 2Z8SA 1N7MH 3TBVB 4ORGA 4AZ8A 4JB9H 1PD6A 1K8DB 5DJ6B 3T2NH 1MJUL 2FWOA 5DHYA 1J1OL 2R1XB 1IGMH 1F3RB 1QSED 5EOCL 2P5WA 2FIRT 1OGTA 3QO0A 4PJ8D 5EO1B 2DYPB 4WWKC 5KOMC 3QDJA 2VKWA 4HWZA 4GT7A 5B3NA 1F6AA 5TQ2L 5C2BH 4NGHL 4H20L 4ERSL 5FDWA 4OLWH 2VN4A 5LBSH 3F5WB 1CGSL 1XGTB 3QDMD 1QG3A 3VXRE 1UB5B 2E27L 1TTGA 3ETBF 1EMTL 2Q8BL 1AO7D 4NCC2 5ESQA 1Z9MA 5EU6E 1KPRA 3G5ZB 2HTKD 2Z93A 3DURB 2V5SA 2BCKB 3S5LG 3VXNA 4DKEL 1DN0A 2BNQD 3EYQC 1MLBB 1M71A 3HFMH 3QUMA 5EDXA 4L9LA 5KSUA 4Y19B 2QQLL 1FHGA 5IF0A 4XHQA 1S3KL 5I9QB 3IDIA 3MGAA 3BPNB 4AY0A 1LVEA 3DETD 4F9PC 4PJEB 4ELKA 5EU5A 1W0VA 5ISZE 1DFBH 5IVXA 4JPKH 2VRAA 5IESL 4LF3A 3AAZA 1MCDA 3CSBA 1DQDL 4YHPA 1G6RA 4BSVB 5J1AB 3WFEL 2ZG1A 3I75A 5M95B 5IMKB 1C5CL 3BHBA 5TDPA 4RFOL 1GJIA 5SV4A 2Y6SC 4FFYL 4TTGA 3HAEB 1DQTA 1DUZA 3AU1A 5HHOB 1FFRA 1NAKL 4NO0B 4Y1AD 4JFXA 5SWSE 1MHPL 5LAXA 5HHQB 4TVSa 4XC1L 1T22B 2UZIH 5JLZA 3E8UL 3VH8G 4WHYG 1TJGL 3NN8A 3BW9B 4EKXA 5JHLL 3QG7H 5CLTA 3S37L 4H0GA 4PJ9A 1QQDB 5FM4A 2B1HL 3HE7A 3BPCB 1KJVB 3LRGA 3LAFA 3AGVA 2GTWB 1KJ2B 5IQ9B 3FB7A 1IM3A 4PB9H 1NMBL 4WI7A 1IC5L 2LU4A 5CGTA 1A7NL 5GRWA 4RGNE 4PS4H 4U05A 4Z5RB 4O58H 3TESA 4RX4A 3SDYH 5C6PB 4AJ0A 5F1OB 1E4KA 5ICXB 1X5FA 2R29H 3OHXB 2DQGH 4L3EA 3RWGB 3MV9B 4ZAKD 3V79C 3LKQA 2HJLA 3QHZH 1T1WA 3MRMB 4N1EA 5GS0D 1NCTA 2VAAB 3RVWC 4XCFH 3GFUA 3VXRD 3TT1H 3W11D 2VLME 1MWAL 4JY6A 5ANMA 5I8KH 2VQ1A 5I6XC 2R4SH 3Q5TA 2JK5B 3O8XC 4JO1L 5EU6D 5IG7B 3SOBH 1CG9A 4XH2B 2HLFC 1QKZL 3F6IA 3RVVD 4FQIL 2JJTC 5CEZH 4AEIH 4S1RH 1EERB 2XTJC 4HPOL 4GRMB 1NAMA 4QHNA 4LCWB 2IH1A 2CDEA 1D7FA 3NZ8B 2O5YL 3O4LB 4GFTB 5IM7B 1DQQB 5ISZD 2XG5A 3FO1B 3JWDH 3TPUA 4JM2B 4M6OH 3ARDC 1JGDA 2XOTA 5C0BB 4N9GA 5FOBA 4XVUC 5FM5M 5T3ZE 4S10A 3L3IA 2BXYA 3BN9D 2YMXH 3KLAA 5KW9H 5DJYA 5JXAL 3C8HA 4K71B 4LCCC 1G9MC 2Z35B 1GPOL 1CT8B 4I5BA 2N1KA 3V8OA 2DBJA 3HI5H 1CZ8H 3GDBA 5SWSD 3NFNB 4JVPA 3LRSA 3KPOB 5ALBH 5DDHA 1KCUH 4NQXB 1AXTL 1WIOA 1YNLL 1JGLL 4OLZL 1JYWA 2DI7A 4ODUB 1U3JA 4Q6IC 4OLYL 5TE7H 2BNRE 4KZEH 3DX9A 3C60C 1IVLA 5BJTA 3IDNA 4NQEB 4UQ2B 2BVYA 2JE8A 4XXDA 3ARBB 2ZCKL 5H35A 4NDMB 5DSCA 4P5MB 5KN5B 5K9KA 3QIBA 4HK0A 5TQ0H 1MCNA 5C0DA 5J3HD 2RHEA 1NMAL 1AIFB 1EDQA 4GKSB 4PB0L 3GSNB 4LEOA 5MEND 3ULVE 4HDIA 3NA9L 5ID1A 1EXUB 4NC0B 5D1ZB 3RX5A 3PL6A 2X41A 3BQUB 3R06A 3U9UA 4HIHA 4D9QE 1QEWA 2VLMD 1DANT 1KV3A 1T89C 4YDKH 3DNKA 4WDIB 3QZWG 4HS8L 5HHPB 1SHMA 5L6YL 3DUSB 1D9KC 2PNDA 5F1SA 1EAPA 4O51B 3X11B 1QBLH 1CIDA 1KN2H 4PD4K 3RY5A 3TVMC 4MHHG 1B6DA 3QHFH 1RJLA 1CFTA 1ERNA 1MHCA 1X5ZA 1ZEAL 2EH7L 4R96B 4QNPE 3W39B 2OZ4L 5CIPA 3AMKA 4LSVL 4MA3A 1R6VA 1HQRB 3EOTL 4OZHB 2ED8A 4GW1A 4X0KA 4NZTL 2Z8RA 3MGTB 2DICA 1UM5H 3UTTE 5IHZB 2FGWL 4DFIA 4OFKA 4G9DB 4KAQH 5T3ZD 1F3JA 1I7UB 1CTNA 3MR9B 1GOHA 1NSNH 4YEEA 4OFYA 1AQKL 1HKFA 1EHLL 4RWYH 3UDWA 3UJTL 1QYGL 3PWVB 1XGQB 4JJ5A 3RGVA 4XHJC 2FH8A 4RBPK 1XGYH 2NY4D 5GGSA 4N0CC 3ZDZF 1L7IL 2P5WE 5D70L 5ACLA 2BNRD 1IT9L 3C6LA 4QRTA 5L88L 3QDJE 3LEVH 4P2QB 3RTQA 4OD1H 1IEBA 4RDQF 2QHLA 2JB6A 5FHBH 3P4NA 1UCBL 3H9YA 3V6FB 5JOPE 2WWKT 1J12A 1CXLA 4UUJA 3ULVD 3BYYA 1XIWA 3VWKC 5J06A 3L3OB 2YC1A 3DX7A 4K23L 1NKOA 3SDAC 1T21A 1S7VB 4LEXL 5EU7C 1IGYA 3FAXA 4D9QD 1CLZH 3DO7B 3TBSA 3ARPA 4G42A 2EYTB 1OWWA 3EYVA 3FCTA 2OQJA 4KTEL 1NFIB 4OFPA 3NIGF 1MRFH 2ARWA 3MBEB 4JFDB 3MMEA 5E94B 1RJZA 4JFZL 5JW4R 3FAWA 5GRXG 1H5BC 3WEXB 4PJHA 2HAZA 3KG5A 5E2TH 4F7MB 4G6KL 4N8VB 5IVXE 5HYSG 3MC0A 3CSYB 1FCCA 4U1KA 1D6VH 3TO4B 1HZHL 3TO2B 4ZS6C 1A02N 5I16B 4V2BA 1F11A 4RGOH 2GW5A 3SE9H 2DWEA 2E9BA 4APQD 5EBGA 1U8QA 1I9JL 1MCSA 1MPAH 3JV0A 5BMFL 4MJ5A 3GMMB 5GISH 1JYNA 1WEJH 3VFWB 4UI2A 5J9PA 5MEOB 2X1OA 2BVOA 3ILQC 1HQ4A 1MREL 3DVFA 5F21B 3CMOL 4QOKB 1NFKA 1A9BB 4OCWH 2Q6WB 2Q87A 4OCYH 3FN0H 4ZUSB 1HXYB 3I3EA 1JNHA 4KV5F 1KCVL 1R5WA 3RZCB 2ADJA 4KKAC 2IPTH 1JI1A 5DD3H 4R26H 4KK5C 3ZTJH 1XCTA 2QHRL 2AV1A 3T4AA 2P5WD 5LWYL 1OAKL 1U58B 4Y4FA 4KK6C 3RVUD 5IKCB 4NJAH 5GS0L 3C09C 1MWAB 3OB0H 3QDJD 1GH7A 1KTDB 1TCRA 4UAOB 5DD0H 4L3EE 4UV7L 5D7JA 5E2UH 5JOPD 4WENB 4P4RB 1UM6L 4CDGC 2O61A 1INDH 3QCTL 5IMOB 4S1QL 3FO0H 5ANME 5JORB 3UYRL 1JGEB 2AJZB 1VKXA 4RRPG 1P2CA 4P2RE 4PG9B 1YEFL 3HR5B 4X6CF 3GSNH 3ROLB 5K9OB 1T7VA 1IGCL 1KJMB 4PGCA 4TVPH 1NGZB 2BFVL 5IFJA 3MJ9L 1Q0YH 2FX7L 3L5XH 5TF0A 5MERB 1B2WH 4PTUB 1C5DB 3GZKA 5JW4N 3OAYH 4Y88A 3RKDD 5JW3L 3VXTB 3OR6B 3QQNA 1QHPA 2VLRB 4MNHA 4RFEB 4Q2ZA 3RL1A 1D5IL 3D3VA 4UT7L 1JHKH 4U7SA 3RHWK 2D7QA 1RK1B 1NMCC 5C0JB 1UWXH 3LKOA 3D9AH 5E4EB 1SMOA 5EZLB 5DT1H 2GT9A 4LLYA 3W9DB 3C5SA 4YNYB 5D7SH 4L8SA 4YE4L 3FMGH 1RZJH 4MZ2A 5TJWK 4FQ2H 5E6ZA 5GZND 3ZE2E 2DQHL 3FB5B 4BELD 3LZFL 3MRGA 4LDEB 1MI5E 3CLEH 3IKCB 3LSOA 4JO4L 4Z0XA 3CVHL 1CU4L 4LU5L 5E1AB 3VFGL 1IAIM 1NFDB 4EIZC 3NGBB 4I0PA 3KJ4B 4YDJA 3V6OC 2B2XL 1QPPA 5SWZA 5GJSL 3HE7D 1BLNB 3I50L 2DMKA 3MLTA 1J1OH 1I3GH 4JDTL 2YXMA 1LD9A 4AENB 5TE4H 4CJ1A 4ZO8A 4LAJH 4UOW0 1WT5C 2YUWA 4KHXL 1F6FB 2IG2H 1GCFA 5IK3B 1DQJA 3V5KB 1YMHA 2DQIL 4HUKB 2ADGA 4XX1E 5E00B 4BFGA 4LCYB 4NGHH 4ZFFB 4H20H 4ERSH 4LSPH 1NUFA 3U2SB 2VH5H 3S6CA 1ZANL 4X99B 4L3ED 1CFVH 2X4RB 1HCFX 1WQVT 3QISA 5MEPA 2E27H 3WJJA 1MH5A 1HILB 4N5ED 4PJ5D 2VXSH 4P2RD 2V2WB 3IF1A 4ZFGL 4CW1A 32C2B 1AD9B 3A67L 2DRUA 1CD1B 4HIXL 1S3KH 2EDBA 3MZGB 2CPCA 5FUOL 4NN7B 2C3GA 4R4ND 4QRUB 4NP4H 4N1HB 5HGAB 3UAJC 4EI5C 4D3CH 1KB5A 2H2PC 1RY7B 2HJFB 3SJVA 2VLJB 1NL0L 2XFXB 3UC0L 2PXYC 4JHAL 2IBZY 3N0PB 2LV4A 3OBAA 4KRPD 3QAZC 3G6JF 2H3NA 2A9NH 5JUEL 1ZSDA 5E8NA 5A40E 4RFOH 3JV6A 3GGWB 2WWMD 1QSEB 5ETUA 1NAKH 4PJ8B 3S34L 3EKCA 1Q1JL 2EZ0D 1A6UH 3BD5A 1C7SA 3HR6A 3RWEB 3VGDA 1XGRA 2QQNL 4LVHB 4U1GB 1MI5D 3HNVL 3O3BB 3E8UH 2R1YB 4XP9L 3QXTA 3IJSA 5ID0B 5JHLH 1Q38A 2B1HH 4YHOH 3D18B 3QJFA 3BZDA 5D93C 3AB0C 1WF5A 1AXSB 1NJ9B 3VFVA 3HI6L 3JWDC 4CU6A 2UY6A 1AO7B 1A7NH 5DD5L 5HI3C 5KVDL 5F7DB 2BJMH 1M7DB 4XRCA 1NGWB 3ULVL 5I19L 1J10A 2BNQB 2PTTB 1ZLUK 4Y16A 3O2DL 4X7TB 2BOBB 3QIBD 3S35X 2ICEA 4HLJA 1XCQB 4LLQB 4JFQA 4P9ML 5TGBA 4LBEA 4Z7NE 2YD5A 1U92B 2R8SH 3C5ZC 5I76A 3V6ZB 1BM3L 3H9SA 3V95A 3PL6D 4B5EA 4UIMA 2J88H 3MLPA 3RDTC 3QXDA 3RWIB 5J6HB 4AYFA 4I0CC 3S3PA 1E4XI 3AREC 3GMLA 3RNKA 4L3CA 1CE6B 1RZ8B 2OTWB 3QCUL 1QKZH 1BJMA 4U6XA 4FQIH 5JW4M 4Y1AB 3BPLC 1SEQH 1UXWB 3QQ4A 2J12B 5BQ7A 5LGHH 5EBLB 4PJHE 2X09A 3IFPA 3EYSH 5CINH 5CJOH 2PO6B 5B38G 4F57L 5HSFA 1G7IA 2D0GA 1CDIA 1KLUA 5I66B 2OL3H 3Q2CA 2NR6D 4XPFH 1EEQA 3BP4A 4LHUG 1MHEA 4DKAA 4U3HA 1ED3B 2FEEL 1P53A 3D0VA 4LKXB 5I71C 1CFSA 3GB7A 3U46A 1GGCL 1S7SB 4OQTL 2WUCL 3QG6B 1I8LA 2BC4B 4DEPB 3OG6B 4KMQA 5EOCJ 4JY4A 4OFYD 3PGCB 3SDCD 4ZAKB 5F9JB 1OT1A 1AGDB 3TYFB 1KYOK 4E41E 3VFTA 1YEJL 4Z7OF 2E6JA 4UQ3A 1M1SA 2ITDB 1YNLH 1JGLH 1PQZB 3RGVD 3VXRB 4PJAF 2GK0B 4FQ1L 2BOCB 4PUBL 5CD3B 4XPTH 4OLYH 1L7TL 3BPNC 3SGEI 2FBOJ 1RHHA 1ORSA 3C6LD 4NOBA 4PG2C 3B9KB 3QPQD 1A8JH 2NXZC 4G7VH 5DFWH 2GCYA 3MLRL 3WFCL 2EKSB 5D8JL 4Y8AA 4GG6F 5E9DA 4FN0A 3NA9H 1S7UA 4NFBA 4IRSA 1A1NA 3P3YA 4KY1L 3MYJB 1GGBL 1XIWD 5ISZB 4OF6A 1OB1A 3I9GH 3WKMH 1QP1A 2J2ZA 5I17A 2DBLL 3OPZL 4RAHA 1YJDL 4OZ4B 2EE9A 3D0LA 4XCCH 5IJKA 1I85C 4IOIA 3T0XA 5ITFB 1FL6B 1BOYA 3D85A 3ALWA 3ZE0F 4OV6F 3T1FB 5IEHA 5CGYD 1X7QB 3CDFA 3PWUB 5SWSB 4HH9A 2CKNA 5AZEL 2X4UB 4Z7QF 3ZKMD 3D3VE 4F8QA 3MRBA 1CLCA 1MCEA 3PP4H 1R0AL 1BQHG 3PDOA 1KCLA 2J3SA 1YDPA 5JTWA 2SEBB 4U1MB 4NZTH 2W60B 1G7PB 3CVHB 2FGWH 1QPXA 5I73B 3HG1A 4XNZB 1AKJA 3TNNB 2ED9A 2OI9B 5GS2D 4D94A 3G5XA 3BDYL 5FO8A 3T0AA 2H8PA 1NH6A 4YFLI 2VDQL 4LCIL 1EHLH 2NW2A 3OJ2C 2HRPH 1JPFB 5F93C 4GJTB 3STZB 3NPSC 2Y72A 5MENB 3RL2A 1F90L 4MLIA 1IGIH 4E41D 4NQSA 5D2LA 1Z6JT 2VR9A 1S7QB 3FT2B 1Y0LB 3B9EA 2Y9RT 5I30L 3PV6B 5D70H 3WHXA 2GI7A 2QKIB 5D71L 2CO7B 2DQCH 4YXLL 1D3CA 2A0LC 5DMKB 1H0DB 2XXMB 3C9NB 4Y4FD 2Q3AA 5BZDA 3BOVA 4TNWF 2YSSA 4LSTL 4QTHA 2I07B 2Y06L 2NLJB 4L8BB 2EDHA 4PTTA 4X4XB 4J1UB 3L3DB 5CWSB 5JNYB 1J0IA 5E8EB 3VCLA 1VESA 1J0YA 3H0TB 4LEXH 4NFDA 1A7RL 1TJIL 3PGDB 1T80A 4U1SA 2C3WA 3S35L 1P6FA 1HH9B 4KTEH 5LGJB 5MI0C 1A6VH 3VH8B 2HT3D 3OKNA 3IETA 1HCVA 5L7XL 4AIZB 1T4KB 1M6OA 4HPYH 1RUKL 4JG1L 4JFZH 1CDUA 1IC4L 2CLVA 1MNUH 1GOGA 4P57A 1KEGL 2AXHA 3N1FC 5DEGA 2I5YL 3MA9L 3SJVE 5J11B 2AV7A 3B2VL 4CL7A 3QH3A 3WXVL 1UA6L 3D3VD 4MVBC 1P7KB 4MCYB 2R9HC 5DRZA 3SDDA 2NY4B 3D2UD 3TCXA 3L5HA 3MA7B 4FQHA 1LDSA 2AEPL 1K5NA 3ILPA 1QHOA 1DR9A 2BNRB 3IJYB 5BMFH 4ODWA 4L1HA 4R7DB 2CH8A 5GIRA 4FG6D 1ETZA 3VFRB 3DROB 1MREH 3GMRA 4MB4A 4Z95H 2X4QA 3CMOH 4EDXB 4HZLB 3O3DB 4NO2B 3SQOH 4OIAA 4N8PA 2Z91B 4MJ2A 4WU7B 3MNVA 3QEQD 4I0PD 2VDML 3LCYA 4QXTB 2PYEA 4OIIH 5JIIA 4YHKL 1O7VA 4Z7VF 3JTSB 4I3RL 5GRVK 4WW1A 2VXTL 5F7LB 2QHRH 4DZBB 4ELMB 1EEZB 1SJEB 4EI6B 1GAFH 4WW2F 3O11B 2HT4D 3O6FC 4ZXBC 3DSFL 4H25B 1FG9C 1ADQL 1RZJC 3MRDB 3QXWA 4ONHB 3DUUA 3LKNB 5L2JB 2XACC 1C5BL 4BFIB 4GMSL 3WNMA 5K9QI 1ZHKA 3QCTH 4M8QB 3H9SE 3HZMA 3TP4A 3PP3H 4HQQH 1GL4B 3I84A 5AUMB 2ED7A 5I74B 1YEFH 2VWEC 3HZYA 3W5NA 1IGCH 2UWEF 4DVRL 2I9TA 4APQB 4Z0BL 4F7TA 2Z8VC 3MJ9H 2P8LB 2FX7H 1Q9WB 2VSCA 3PWJB 4FXKB 2HJKA 1EAJA 4MXQC 1UH4A 3CD4A 2AJ3B 2WUBL 5EG6C 5E0QA 3DYOA 5I8CB 3CUPB 3FHQA 3ZKXC 5D72L 2R0ZL 2M26A 5JQ6L 3O6MH 4UT7H 3SJVD 5KOVC 2FLBT 4NZUH 3I6GA 1RUQH 5C08A 3CVIL 4JHWH 3U6RA 4YE4H 4ZSOA 1FRGH 3LIZL 3GHBL 5DTFB 1M7IA 2P5WB 4YDLB 3ULUL 4K7PY 1OGTB 4K3HA 4LQ1A 3QO0B 3TCLB 4YC2C 5C0GA 2CRMA 3QDJB 3IFLL 3CVHH 2VAJA 3KPMA 1F6AB 2CD0A 4OSUL 3W0WA 4O5LH 3SY0A 3IDGA 3NIDE 2IEPA 3QZWB 4M61A 3SGKA 2F5AL 1QLEL 3UTQA 2B2XH 2VZOA 2HH0L 1V5JA 2VZSA 5FUCE 4GKZB 4PBXA 3MBEC 4D8PB 1F58L 1I7ZB 3C2AH 3VG0H 2BXZA 2XKNA 5F9OL 3G08B 5GGSY 4UTAH 5FO7A 2IC2A 5ESQB 5BRZA