1ZLUH

Fab 2g12 + man5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
b'EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
molecule tags Immune system
source organism Homo sapiens
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
total genus 35
structure length 221
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH01
1C5DB 4NQVB 1XF1A 4Z6AT 5F7HA 4QCIA 1MH5B 1ZMYA 2ICWI 2HT4C 4P4KB 4MXWL 4X4ZA 1QVOA 2E8YA 4J8RB 3DMMC 1D5BA 4JY6B 3CAFA 3EGSB 3JV4A 1R6VA 4OUOA 5FGBA 4L4JA 3TWCH 4OAWA 4RRPG 3QUMB 3OSKA 1LE9B 3C5ZB 2Q7YA 3VRLF 5IOPB 2VAJA 4ERSL 3ARBC 4TTDC 4YXKH 5FYJE 3BP4A 5FKPA 4D0DA 5DWUH 4GRMB 4F9PA 4L3EA 1MNUH 2BVOA 1RZ7L 2JJUA 2NY6B 4WWKB 5D5MF 5MEQA 2R39A 3VCLA 4NKIL 3AAZB 2LVCA 1N6UA 2EYRA 5TE7H 1WVZA 4E41A 1J8HE 1IM9A 5I1LA 4NO5B 4OCWH 1EAPA 2R9HC 1RZJL 4PRPA 1JI2A 5FB8A 5E4IA 3SCMA 1KFAL 3HR5A 5BMFH 5C0RH 1NLDL 3QIWC 4Y16A 5GS1A 1FYTE 5E9DD 1G7PA 4G6AD 4F8TA 1QSZA 3ORJA 5I17A 1AI1H 2YBRB 2BSSB 3B3IB 3N1QC 3JV0A 1XIWA 2P8PA 4HLZG 1I75A 25C8L 3KPNB 5EIIB 3WIFB 2X4UB 1JE6A 3RRQA 4WWKC 4JR9L 1B2WH 5E8PB 1OTUD 3FN0H 4U3HA 5JNYB 1OWWA 5DEFB 4YWGL 4L3AA 2RGSA 1D6EB 2BRRH 1LEKB 3SDXA 4D0CB 3KPSB 5MEOA 2BNQA 3QA3B 2AJYH 5C2BL 4QCIB 5IV2A 5DJZB 2V2TA 4JO1H 1P69B 4X6FB 3MODL 4X4XB 1MI5B 2GT9A 1HKLL 3VXSA 2Z4QA 2Z91B 1KN2L 4NO3A 3EW3B 2E9WA 2A74B 3S5LA 2AXGA 4N0UE 4O00A 2HKHL 2CH8A 4RZCA 1A3LL 3QUMA 4MJIA 1P4BL 5C0ND 2IBBA 3IDGA 3WJJC 2VWEC 1VCAA 1GGUA 2JB5H 4ZXBB 5TE4L 1T2XA 1XGUB 4WO4A 3T0WA 4I77H 3FO9A 1S9YB 3WFEL 4GRLB 1I8IA 4S11A 1QHPA 3T77B 3L3HB 1YEFH 1BIIA 1XGTA 5INCB 1LD9A 4JM2A 1T2QL 1R3KA 3KWWA 1E4XI 3CDFA 5DQ9B 5EUOA 3LEVL 3V8CA 1Z0NA 4GT7A 3QULB 4DEPC 1W72H 5GISH 1F8TH 2VDPH 2DQCL 3TNNA 4S2SA 3ULUD 3I9GL 4U0QB 5D2LE 4QHUB 3CD4A 4Q6IC 5LG1A 4GXUM 5B39B 3W11C 1XIWB 3TIDB 2UVFA 3MRKB 3SCMD 2FCBA 4LK4A 1Q72H 1FVCB 2NX5A 5IGXL 4BQ8A 2AV7A 2GAZB 3MJ9H 1ES0B 5HPMB 2CD0A 1HEZB 2VXSL 2CLZA 3X14A 1G7JA 1FZKB 1RZKH 1XAUA 4WEBL 2C5DC 4HUNB 3VMPA 2BC4A 3O3EB 4Y5XA 1Y18B 2VLKD 3RZCB 3C8HA 3CVIL 4NWUH 2XY2A 5C08B 3ZKMC 3MYZA 3KPSA 2LU3A 2E7BA 4EN3C 4P9MH 3DVIA 2HG5B 3LB6C 3RWGB 1IGCH 4I3SL 3KYNB 3MRQB 5T1LB 4JN2A 4BYHA 2ZUWA 5T3ZE 5FA4B 4HUUA 2LQRA 4M62H 4UILL 4I77L 4TVSa 4Z7WE 1TJHL 3G6AA 3K0WA 3F6LA 4RZCB 2JCCB 1T22B 2AV1A 3QWOB 2R2CA 5HHPB 1EHLL 1NSNL 4LP4A 1VACA 4MDJA 4WFGD 3KJ4B 4U1MA 4M3JA 5AZ2H 4OZFB 1MCCA 3S3JA 1A1OB 4UBDC 1AQDA 4HH9B 1I9IL 4WU5B 5DSCB 1I1CA 4Y19A 4GRLD 4JFFE 3NTCL 3VXPB 4BZ1L 3VRJA 3FO9B 4JO2H 3JTTB 4XXCA 1PEWA 3MODH 5K9QG 4KK8D 3RU8L 4GMTH 3TFKC 3QDJE 1MIMH 2BVTA 4GSDH 4PUBL 1S9VB 5ADPL 5DQ9A 1K5NB 4M6NL 2AS5M 3L5WB 4JRYD 4YHNB 5KOVC 4MXQC 3ROLA 4CN6A 3WV0A 1WAAA 5CZXD 5C70A 4HUVA 2ZNXA 1ULVA 5IEKB 1JPFB 2B0SH 2E7LA 3SDCB 2CUMA 1II4E 1H3PH 5FO9A 1TTFA 3BH9B 2OCFD 1A1NA 5GRVL 2VZOA 5KSVB 4N0FA 3OJVC 4KVNH 2CLZB 2PXYC 3ALXA 3LN5A 3IJYB 4Y5XB 5BMFL 4XP9L 3V7AG 1KJVA 1MELA 3IFPA 4HEPG 1E4KC 5HHOB 1JF1B 1X5AA 4Y4FA 2HG5A 2V9TA 4ZTOH 1RUQH 1CQYA 3M1BA 5BV7C 4XNQA 2V5TA 1MFEL 4XI5D 3P2TA 5CILH 5IBTL 5TDOA 1JJUA 1AO7D 5DUPH 3L3DB 5EOCJ 1XCQA 3O4OC 5IESH 1T22A 2AV1B 3RTQC 1W8OA 2RCSH 5IWLC 4AT6B 3IXTB 2W9EL 4ERSH 4PB9H 4F9LC 5JA8B 1T6VN 4NUJA 4XCNB 4H5SA 4KDVA 2EICA 3LQAL 3WKNA 3IJHA 2ZG2A 3V4UL 5F7KC 1R24B 4HFUH 4BELD 3QPXH 1ZHNA 2CR3A 3CLFL 4Y8DC 3RVTC 4W6WB 1KB5L 3GUTA 1R3HB 4KMTL 4QTIH 4U4BA 1T1WA 3MRFB 4KHXL 4PJ7F 3KG5A 4DN3L 2F54B 4OGXL 2EYSB 3OKOA 4ALAH 7FABH 3RVXC 1CI5A 1K2DB 4EVNA 2BXYA 2A9MH 1FFOB 5CJQH 5BRZD 1HQ4B 3MRJA 2AJUH 4WI7A 2H32H 3AUVA 1NGYA 4M61B 3BT2H 4WIQA 4OLWL 5CCKL 1IEAB 1Q0YL 4L4VA 2GJZB 5SWZB 1KCSH 4PJXA 3O3DA 3VGDA 3EHBD 3SGDH 5DT1H 2Z8RA 1CF8L 1DBKH 5T3ZL 4XBGA 1A9EB 2OTUA 2B4CL 3ZYZA 3A6CH 1TJGH 1BP3B 2JIXA 3SE8H 1A7QL 3U4EA 2ADJA 3BPCB 4OF5A 2VLMD 3ZZ1A 4FTVA 2EDEA 1S7VA 3C6LA 5B21A 2IPKA 5FYKE 5HGDA 4D9LL 5JIKA 5C0GA 4UQ3B 3U9UA 5GXBB 1B0RB 2UY7A 4S0SD 1ZXQA 2DYPA 4PIRF 4MJ6B 1KLGA 5FGCE 3ARGD 5BVPH 4OD2A 3BWUC 4KI1A 5FYJH 4TNWF 4LGPB 4HBCH 4WFFE 2QBWA 2H26A 3M8OL 3PGFL 1TTUA 2R0WH 1KLUB 1RZFH 4EN3D 5E6IA 3WNOA 1YY8A 5ECJE 2V7NA 1I1YB 2BVUA 3NFNA 3F7VB 1BQHG 1T03L 1KN4H 4M6OH 2FWOA 5E2VL 5KANG 1I8LA 4OJFH 1ZEAL 3TBVA 4PJ7E 4MJ2A 1BQSA 2A83A 1QRNB 3U4BL 1MCOL 2ZUYA 4MSWB 3CGTA 1JHKL 4FABL 4Y1AE 1FO0H 4OLXH 4G5ZL 1DQJA 1UQSB 4N8CH 4G8GD 5I19L 1JGDA 3RVWD 3QZWG 4HQQH 1MCBA 1IAOA 3FB8A 1CDYA 2NR6D 3U4EB 3GBNL 3MV7D 1RI8A 3CXHJ 4QXGL 4FS0A 4WWKA 4G9DB 1NMAH 5AD0B 2QADB 3AB0C 2RJMA 5KAQG 4BJLA 1AHWC 4XAWH 1HILA 3F7YA 2AAVA 4KKLD 4JZJB 5A40E 4TVPL 2F9BT 1BD2E 4LQFH 4P48A 1CWVA 5FYKH 2K3TA 4Z7VB 4HS6A 3V6OE 2H41A 4Z7WB 3OF6A 3BEWB 3GDBA 5DD0H 1KLGB 2AJVL 3BJ91 1C16A 1S5HA 3QDGB 2CO7B 2YBRA 3LY6A 1J88A 2WP3T 3T1FB 2VMFA 3BD5A 4D94A 4H0HB 5HVWA 1N5YH 1AXTH 2Q76A 2XY1A 3NCCB 5TDPA 3DGGA 1M05A 3TJHD 4RWYL 3NIGF 5CSGA 4BFGA 3WUWB 2A2QT 3TCXA 4QOKB 4RQQA 1BLNB 3SKOA 2GTZA 5D7IA 1LEKA 1U91A 3CSYB 1QQDB 5IKCB 3DYPA 2Z93A 2FJHA 3VXSE 1KC5H 4P2QB 4QHKJ 4D9LH 4X6CF 1Y6MR 1M6OA 1F6LL 1QFPA 5SV4A 5DFWH 4UOW1 3D85A 4PJ9D 1Q94B 2DBLH 3HZMA 1U6AL 2GTWA 3NIFF 1NBYA 1UXWA 3P3YA 3SE8L 4U33A 1DEEA 4ZXBD 5JHDA 3WDHA 5HI3D 4MJIB 3OKYA 4DOHE 5KVGL 1BFOB 4Q9QH 4PJCA 1F11A 3BPOC 4DK3A 1Z0MA 5GRXG 5D2NB 4JKPH 4QRSB 1WCQA 2BNUB 3UYRH 3GSUA 2IPTH 1DN2A 1YEIL 4UZGA 4L29B 1HHIB 4DQOH 4HUKB 4XCCH 4HIHB 1X5IA 2FBJL 3VGEA 3ESVF 3F7YB 4GRWH 3ARQA 1RULL 3CLEH 4JM2B 2VABB 5FDWA 3KPSD 1BBDL 2EEBA 4F33B 3BPNB 3HE6D 4C4KT 5LGHH 1QFUL 3NFSH 1QR4A 1Q9WA 2B1HL 4GUPB 3QULA 3SE4C 4OFIA 1IQDA 1YEDB 1K4CB 2J3SA 2EDFA 4WUUE 5IFAL 2WBJD 4WU7A 4YHKH 1XCTB 2NX5B 4I0PC 4UB0L 4HX1A 1XGRB 4PJEF 4L8DA 2ARJQ 4HK3J 1I7UB 3O2DA 3O2DH 1BJ8A 4P4RB 3RWFB 4YDLB 4NZTH 2XN9B 1YEEL 4QOKA 4RQQB 5FYLD 5D7LE 3SKOB 2LABA 1GGTA 1HH9A 3PV6B 1MCEA 3VA2C 1DUYA 3OKMA 2R1WB 4I18C 5FECB 2Z93B 3CFKB 4GSDL 2B39A 4GQ9H 3RDTB 1NEZB 2IF7A 4N0YH 3DO3A 5T1LA 2XWTA 3DO7B 2NY1B 1Q94A 4LCCA 2EO1A 3JV4B 3VU2A 4MNHA 2HFFA 1X5YA 3OGCA 1QBLL 1P4IH 4O2FA 4P9HH 5IB1A 3B9KC 1FYHB 2CK0H 5IHZB 5KVDH 4ZD3H 4KKBC 2GJ6E 4G8GA 3QDME 3BP4B 3U36B 3RZWA 5D7SL 4WU5A 5D2NA 1AGFB 1LWRA 2PTTB 5I16A 2ICCA 4M62L 1CE1L 5I66A 3JTTA 4IRSD 1FZOA 1EBAA 1JNHA 3I02A 2VSCA 1ZT4B 4PV9A 1ZHLA 2H9GA 4I2XE 3CXHK 1I9RH 4M7LH 4YHNA 3W81A 4M6ML 3VFPA 3WSQH 1AHWA 2FX7H 4MQ7A 5E7BA 3ZKND 3QI9B 1K4CA 2O61A 4G9FE 4HJGA 1WWCA 3H9SB 2X4OA 5F1IB 3C2AL 4IHOA 3B3IA 4JFFD 4MMXC 1C5BH 2ZCKH 4P3CL 1SVZA 3O8XC 4UV4L 4F58H 3QZWA 5C7XH 5I8KL 4WU7B 2VIRA 3WN5A 1A1NB 1TZHA 2BMKB 4QRTB 5L0QB 4L8DB 3QIBD 3EOYG 2OMNA 3I6GA 3ZT6A 2IWGA 1MCRA 1YJDL 1WWAX 2N4IA 3P4NA 3RKDD 2DYPD 2FX7L 1I9IH 2X1OA 4FQHB 3T1WA 1YN6B 2O5YH 3AFLA 2VXQH 5CJOL 4YDVA 1DQDL 1QBMH 4PRPD 4E0RB 4KJQD 5FECA 3LKSA 2C4FT 1A1MB 3I50H 2X40A 1QNZL 3H3KA 4NM8L 1JYVA 3RNKA 1VEOA 5JIPA 3M1BB 5F3HA 1FZMA 3T0BA 2Z4QB 2OI9C 5EH1A 2VLRA 2ZSWB 1NMCC 2GFBB 3S36L 3BUTA 5FUCE 2R2HB 1URLA 2IALB 3LZFH 1B6DA 3ZDXF 1MVFA 4I4WA 2MPAH 5CLWA 4HH8A 1XGUA 4KRMB 3RHWK 2PTTA 4DUVA 5I16B 3LEXB 4OCXH 1X4ZA 4HAGA 1I8IB 3MJ9L 1J8HD 5DJAB 4B41A 2I07B 4HFWB 5IGXH 3I02B 2KL6A 2NY5C 2DD8H 1LD9B 3MRBA 3ZKXB 3QCTH 5I1HL 4F58L 3KWWB 4FFYL 3K8MA 4ONHA 4WHYG 4RDQF 1FH5L 3MCKB 2OR8A 2Y07H 5DI8A 4EUPA 1DN0A 2ZOKA 2M8XA 3CFJA 3P4OA 4M7LL 5EFIA 2FBOJ 5BJTB 1A47A 1XR8B 4YH6A 3B5GA 3QUZA 5HYJA 3TIDA 3Q6GH 3V6FA 2YC1B 3N9GH 1KUMA 5FEBA 3UTSB 2XG4A 4ZS6C 3V95A 1FZKA 1TJIH 4E41E 5IW6A 4RAVA 4JO3L 5C0FB 4MD5A 2C4FU 1NCAH 1YN6A 4DFHA 5GGSB 4MD4B 2B1HH 3UZEA 3GBMH 3NGBB 1KPVB 5DR5L 3WFCL 1TITA 4HHAB 2JJSA 4PLJD 4YHIB 1RZJH 3WXWH 1IL1A 4LLYB 1PW3A 3WL9B 1P4IL 2JIXB 5F3HB 1I3UA 3UTTA 4DQOL 5JW3L 4RFOL 2AEPL 4HF5H 4HUUB 4M7ZB 4LSVH 2G5RA 3LMJH 3G9VA 3SOBL 5I73C 3QCUH 2WLYA 1JNJA 2O5XL 3D3VA 1J0ZA 5E4EB 3GI8H 4MLIA 3QDMB 4OZFH 5F89B 2Y5EA 2Q87A 2ED7A 1A1OA 3VXUA 4HH9A 1MCWW 2YA2A 2EC8A 1PD6A 2R23B 3QNYA 4PPTA 5ENWA 5GRUL 5I1GH 4OCNC 1MFAH 4XGZB 2I07A 4PJIE 4EI6B 4FQPA 3SE9H 3Q2CA 1S7SB 1G7LB 1BGXL 4R9HA 1MF2L 4WCYH 2BX5A 4WHDA 1H5BC 2GW5A 4R8WH 4AM0A 2V7NB 4NYLA 3B43A 4WI5A 4Q97A 1NBVH 3C5SA 4AH2B 2XPGA 1NQBA 4KROD 4U1LB 3HE7D 5IEKA 1JPFA 2W60A 1HHJB 2N7BA 1MRCH 1UZ8B 5D70L 2QKIB 5I71B 1A21A 1S8DB 1YMMA 3E6FB 2PNDA 1WSST 2W65B 5I30H 3ZL4H 5FUZH 4WUUB 5SX5H 4P2RB 4BSJA 1TMCB 1PKQA 1OCWH 3IFPB 4XBEH 1I3VA 4YHIA 3BP6B 3DTXA 3CDYA 2J8UE 2Y23A 4EI5B 2CMRL 2W9DL 4LRIC 3DXAE 1XF2B 2IQ9H 4YXLH 5IMLA 1HXMB 3ZYJA 4NZJA 2VDLH 2P42B 2MKLC 3QEHA 5CEXA 5DJ2B 3GBNH 1XCQB 2FIRT 4GS7C 2VL5B 3JWNC 4AT6A 2UZXB 2FEDD 3B83A 1RPQA 2NY4B 1UH3A 1MWAH 1IBGH 4DN4L 1CK0L 2GIYA 4XNUL 2GSGA 3WFBL 1JHKH 4FABH 4AEHL 4GXVH 3GSQA 4FNLL 2Z92A 3HB3D 5I15H 4U7MA 4OKVB 4O51A 1N5YL 4WI3A 4L3CB 2AK1L 2MWCA 3IKKA 5D1ZD 2V17H 5B22A 4G42B 4K94H 1IGJB 2WMPA 3IGAB 4AIXA 3MRLB 3IB4A 1RIHH 4MB4A 2F15A 2ICWB 4WI6A 2GTZB 1XF5B 2YPLB 5CHNB 1HKFA 5B38A 4G7YL 3LKOA 2OSLB 3QEQE 1CXIA 1YNKH 1DDHA 4GMSL 4RMWA 3LKQA 4TRPH 4X4YA 4PJDE 1WBZB 2WUBL 1T5XB 5IVXB 5KSUB 1NGPL 3QQ3B 4QKXB 5BXFB 3EYFA 3WFBH 3KXFE 4OGAD 4HWBH 2H6PA 4FQLL 3RX5A 5HHOD 3U2SA 2OR9H 4XC1H 3BP6A 1F11B 2E7MA 3MUGB 4HGWA 2QTEA 3GBLA 3SJVD 2D7PA 1JNLH 3AS2A 5ACZB 4BK4A 2MJWA 1NC2D 4L29A 2GK0A 4QWWD 2IQ9L 2MOVA 5C6TH 2P8LA 4J6RH 4C59B 4LSQH 5CEYA 2JJWA 5C3LD 2DQDL 2HKFH 5FB8B 4UUJA 2X44D 4KRLB 4FMFA 2DYPB 5CSZB 5A3IC 3QRFM 5GS1B 3QIUC 2A6DA 3NAAL 2FR4B 3CFDA 5FUZL 4HMEA 3ZL4L 4Y4KD 3FFCE 3U0WL 1EZVX 4ZNEA 3FRPA 4LCUA 3QCVH 5ETUA 1MCQA 3WNNA 2H26B 1JWMA 5IHUL 3STZA 2IG2L 3GMLB 1UM5L 2APXA 2NY2D 2KQMA 4X6DB 1YYMH 4QRPA 3RWFA 3TJHC 1YEJH 4MXQD 2K7PA 4CADB 4S1DC 3QO1A 1MWAL 1JZ8A 4LPUA 1KB5H 4LL9A 1KTDB 1WBYA 4Y1AD 4ZNEE 5HHXL 4LVHC 3QUKB 5KSBB 1NFDF 4F7MA 1R3JB 4NCC1 2DQEH 2GCYB 2ZPKH 1W72A 1T5XA 5IVXA 4R90L 1MI5A 1B90A 4DZ8B 3GSVB 1MHHA 1GRWA 4LCCB 4ETYA 4XX1E 4PGBA 4GRLC 3TYFA 1CE6A 4P2RE 2P43B 4NM4L 4QHLB 1OWRM 4JFYA 2CMRH 2W9DH 4YAQA 3A6CL 3F62A 4PRIE 1A7RL 1BVLA 2PYEB 4S1SL 5T3ZH 5GPRA 3X13A 2A1WL 1FIEA 2J5LB 3RL1B 2NY5L 3QJFA 3WJLC 2HTLC 3MOBH 3SY0A 2GK0B 3WFDH 1Q9KA 1HXYA 4LASH 1RK0B 4JFOB 3BRDA 2A9ML 4H8WH 4ODSH 3IVKB 2MHAA 3GSXA 4JZJA 1BVZA 3SDYH 4S1RL 1VGKA 4DVBB 4J7RA 4K9EL 1Q9LB 3U9PH 2R29H 4FN0A 4KHXH 2FR4A 4CGTA 4BZ2L 3BQUC 4IHOB 1NFKA 3QUYD 2ZCHH 5EUOF 4HK0A 1ADQL 3BP7A 1AC6A 4W6XB 3Q6GL 4LGSB 5GS0D 5DJ8A 3UJIH 2BMKA 1FIGH 2FRGP 1SQ2N 3GNML 3IDXH 1RJYA 4J3VA 2GAZA 4KV5F 4FZEL 4TSAH 3LSOA 3BN9C 5HGBA 4CADA 1RZ8B 1NDMA 3JWDH 4PBXA 3MRIA 1KB9K 3VJ6A 5I1HH 2XN9E 2V5YA 5C07B 3RNKB 2DLGA 5F8QC 4CL7A 3KPLB 3S34H 4HKJA 1KSRA 1NDGA 3MLPA 4LSVL 5FAAA 3SGJC 3QEUB 5FYJD 1OTSD 3TYFB 2D31B 2VZ3A 1P7KB 4JFYB 3T08A 4NQDE 3V52L 3L9RB 4NZUL 1RZIA 5CIPH 1G1YA 1GGIH 2VDQH 3X13B 5DK0B 4JVUA 1L9MA 4L4TE 4ZS7L 5JW5B 5BS0D 4DTGL 4JB9H 3ULUH 2VQ1A 1QZ1A 3BZ4A 4PJ9C 4P2OC 4GRWB 1IGCL 1F3DH 5BOPA 3QUYB 4NSKA 3QDJD 5T5NG 3AS0A 5K9KA 4PD4K 4Z8FL 3HNVL 1W2KT 4RFOH 3BKJL 5T3XD 3EFFB 3BKYH 2NXZC 2WV3A 3WIIL 1LEIB 2Y1VA 1T1ZB 2Q86A 4HS3A 2FYYB 3BO8A 5I0ZA 1NANH 1EFXD 5CMAB 2D2OA 3BP7B 5C8JA 4MVBD 2WWMC 3OXSB 5J11C 5GZOC 3V6FB 3AXLB 1U58B 3B9KD 5GSRA 3QIUA 1UWGL 1ZLUH 4TOYH 5T3XH 4M43L 3IRZA 4JG1H 1PG7W 2XKUA 5D7IF 3A0OA 4P4KC 4OB5L 1JWSA 5IW3A 3WFHB 1CCZA 2E27H 3MRIB 4O02H 5HHOA 2BHZA 4FFVC 2DIAA 1NCBH 1EA9C 2EXYD 3EYSL 1HH6A 4Y5VC 3WL9A 4G8EA 1QPPA 3I3BA 4K3EL 5C09E 1K8IA 3B2UD 3ZE0F 5TPWH 5GGTL 3ARBD 3BDXA 1OM3L 1O5DT 2W0LA 5DGQA 4NRZA 4K8RL 1LQSR 3T65A 2YD6A 3RI5K 4XXDA 2GKIA 4O2EB 1QBML 2Y25A 4PJAE 1CFBA 2ADIB 3IAPA 1NPUA 1S9XA 2CK2A 3H9ZA 5E70A 3HI6H 1R24A 4LLWB 1J05A 3IU4H 5T1KB 2X4QA 3VGAC 5I66B 3EYQD 4N90D 3S34L 1AP2B 1IVLA 1QRNE 4HJJH 4NJ9L 3SGKC 1BOYA 4PV8B 1ZT4A 4KRPD 1WICA 4NYLB 3ARXA 1FN4A 3HS0B 3VI4F 2ZNWA 5I1EL 3PP4H 3AB0B 2BOCA 2P5EE 2X4OB 1I9RL 4FTVD 1U2CA 4YEFA 5C8JB 4MA8L 1S8DA 1YMMB 5E08H 1D5IL 1EERB 3V79C 2HMID 2NTFA 3TNMA 1BM3L 1NGYB 4YPGA 4LIQH 1PKQE 4R4FL 3AREA 4PFEA 1IZJA 1UA6L 4PJXB 1EEYA 2AKRA 3QXDB 2G5BA 2LV4A 1PKQB 4JKLA 4K3JL 5SWSB 3V52H 2EEDA 4P9HL 5JORB 1DCLA 5DC4B 4ZQKA 3QEHB 4TVPE 3F7PC 1BQLL 1QRND 1XH3B 5CKGA 3G5ZB 3KPRB 3N0PB 2EZ0C 3WS3A 2R1XB 1G7MB 3E6HA 2VL5A 4JPWL 4M5ZH 5EZOL 2R2HA 2Y06L 1EK3A 4JO4L 4QNPE 1D3CA 1B0RA 4QLRA 1CR9H 5HBBA 4MA7H 4MA3B 3UBXI 4YR6A 3O6KL 4UBDD 3T3PE 1CIUA 2PYEE 3LB6D 1RUKL 3GSQB 5KVDL 3ARPA 3PWLA 2GHWB 4YHYB 5A16A 4OKVA 3DV4B 5HDBF 2H45A 1G0YR 2BSTA 4F9LA 5D6DA 4S1DD 2AI0L 4NJAL 1U8KA 3D25A 4UIMB 3F7VA 4RGNC 1L7IH 1L9NA 1TVDA 1P4LB 3LEYH 2VDML 2EDYA 3TBVB 4HWEL 3KXFA 1AR1D 2XKNA 4X99A 5K9JH 4X9BA 4R0LB 5IUSA 2XACC 2ATKA 2GITB 1UZ6E 1V05A 4EBQH 3UJIL 1CU4H 4TPRL 3WXVL 1DQJB 1UQSA 1NUDA 5T5NF 4WUKL 1ADQH 3Q1SH 4RAUA 3QUZC 5INDB 5L2KE 1RJLA 1T0NA 2Q3ZA 2EE9A 1AH1A 3T0EC 4EI5C 1NGWB 2JK5A 4J6RL 1IAOB 1IL1B 4LLYA 4HGWB 4YNYB 2X2YA 3DHMA 4ZQKB 2WK2A 1N0XH 2HLFD 1A7OH 5KTEH 4NBZB 4D2NA 5ID1B 4MYWB 1ZT7A 2VQTA 1Y6NR 2VR4A 1J1XL 3HE7B 5EN2B 5ILTL 1UH4A 3KLHC 4MB5A 1F42A 3TPUA 3VFGH 1YYML 3WBDA 3SPVB 3BZEB 1UKTA 1ZA3A 4HG4K 4HIXH 4Y19D 3TBSB 3OJDB 3S37H 4P4KD 3JTSB 3O3BB 3ILPA 1KJ2H 1H5BB 1SY6L 1S7SA 1BZ9A 4YE4L 3WD5H 3IETA 3VFOB 4ELMB 4AM0B 4X6DA 5FM8A 5J9PB 1CD9B 1TPXC 2ZPKL 4HC1A 4HC1H 1G7IB 5TQ0H 3WHXB 1BF8A 2B5IC 3LV3A 3PWPD 3SGKA 5EZJA 1KC5L 4NCDA 4MNQD 3PQYE 4JREB 2W60B 4LU5H 1BQHB 4N9OB 1OGTA 3O3AA 1TENA 1KJ2L 4GKSB 2I5YH 3VXRD 5I75C 2QR0B 4Z7QF 3UYPA 5BQ7A 3EFDH 1JK8A 3PL6C 4P5MB 3TO2B 3VXNA 3NN8A 4OZHE 2IBZX 4BUGA 4HIIA 1X7QB 2YS4A 3PQYA 3DVFA 2W38A 1T0NB 2XOTA 5L9DH 1NEUA 5EU4A 1NGWA 4I0PB 1QR1B 3RVXD 1OAZL 1LK3L 4D9RE 3QIWB 1FO0L 2F53A 2BNUA 2FHFA 1JTOA 1W0WA 2F53D 3UPRB 4WTZG 1QFWH 3AM8A 4ZUSA 1N2RA 1ZT7B 1QD0A 2AXJA 3JSSA 5JHLH 3WCYA 1RJZA 1B0GA 1JZ7A 2YSSA 4NNYB 3BZFA 3SDCD 1Q8MA 4JM2C 4ZDHA 1YNLH 1NGQH 1MY5A 3ZMRA 4DVBA 4Z76A 3HLAA 2C4XA 2J88H 4HC1L 1OAZH 5I8CB 4FQ2L 1RIVL 1MJ8L 1QHOA 2P48B 3LQAC 4F7TA 3RI5F 4HQQL 4RA3A 1J0HA 2R0WL 3NABL 3ILPB 3O3BA 3L3GA 3KVQA 5DJ8B 1VKXB 5FO7A 3PWPA 2Y4SA 1NMBL 1I3GH 4Y88A 4HIXL 4M1GH 5K9OA 4ELMA 4M1GL 3IDNB 4L1HA 3CDGA 4RFEB 3PIQA 4DN3H 2UZIL 3GSOA 2EDOA 4NQXA 4YBQC 4DKEH 1MCJA 1AGDA 2YPLA 1XF5A 1E6OH 1LDSA 2YOCA 1OL0A 2RIKA 5B38B 4I2XA 3EOAA 5HI3C 4NNXB 4PJXF 4L5FH 3VMOA 1OB1B 1YNLL 4K8RC 2XFXA 4KHTL 4AQ1B 5HHQB 1LO0H 3MLTB 2FIKB 3QQ3A 1GIGH 3FB5B 3FCTB 2HFEA 1BAFL 4L9LB 4RX4D 4WW2A 5C3TA 3HAEH 3U2SB 2V2XB 5EU4B 1CF8H 1DBKL 3HR6A 1TFHA 3P0VH 4I0PA 4U6TA 2CPCA 2CXKA 3MQIA 1H0DB 1AGFA 3QIWA 4WI9A 2ORBL 4CW1B 1CLZL 4RMQA 1J1XH 4ZS6D 1KEGH 3UTSE 5EDXA 1UENA 3U0TB 5D70H 1DQMH 4EDXA 4N8VA 4JZJC 1JZ2A 2W59A 4P2CG 3SO3B 3H9SD 3MNZA 4YX2L 3LEYL 1NKOA 1KCUL 2DKUA 3T4AA 4C83B 5CSZA 4FQXB 2CDEA 3NMEA 1OAXH 1W8NA 2B4CH 3PWNA 1U8MB 1KBGL 1F4HA 3DX8A 4R97B 4LDEB 1UB6A 2DWEA 1U58A 5GSRB 4EBQL 4LFHD 4XPFH 2PW1B 4OFYD 3QXAA 5DJYA 2DTMH 3QAZC 1FL6A 3KLHD 4FQIL 4XTRD 3PIQB 1SY6A 1MFCL 4XC3L 5D7JD 4NQED 3VD4A 4BSVB 4PUBH 2SEBA 3CU1A 3TF7C 3EYVA 1HH6B 2R56H 2IH3A 4F7MB 4M7KL 3ROOB 3DIFA 2ZUUA 3K2MC 4JANA 1RZGB 3MLTA 2OZ4H 1Y0LA 5J57B 1IARB 2Q1EA 1FG2B 4RGMB 3VDAA 1I85A 2NYYC 2XA8H 4LBEA 5ITBH 4KROC 2WQRA 1JZ3A 4NPYA 4R26H 3EJZC 4LLMA 4LLVA 4UILH 2BCKB 2VL4A 3D0LB 2X4QB 4UINH 4OLYH 5E2TH 3IDIB 3B2VH 3JWOC 3MRPB 4JFOA 5C0CB 4BFBD 3ZDXE 1F02I 2OR7A 4MNGB 1NL0L 1S9WB 4HT1L 5HVGB 3MREB 3ARED 3E3QC 1VGKB 2DLHA 2AK4D 5C0CE 1MRFH 1H8NA 3SQOH 4B53A 1JHLL 4TUOB 3PWNB 1U8OA 2Y07L 4G8IB 1ACYH 4XCEB 5GGUB 1FH5H 4B50A 1JYWA 4QGTA 2VDMH 1H8OA 3PGCA 1VEPA 4GG6F 4LAJH 3O11A 2DJ4A 5E56A 2QL1A 1B3JA 4KI5F 3G5YB 5DD5L 3LSOB 5D7LA 1WBXB 4M8QB 3BKYL 5GGSA 3TLRA 2H8PB 2HYMA 3L3KB 1DQTA 3EYVB 4UOJA 4MCZB 3F8UB 3BWAB 4K8RH 3VE0A 8CGTA 1N4XH 1RZGA 5TPWL 3QEUA 3G5ZA 2CJUL 4M48L 1J8KA 1EXUA 1U92A 5C09B 1DVFA 2FLRT 3VXMB 3I50L 3LKRA 2AEQL 3QDMA 3D18B 1DFBL 4GBXA 2OLDA 3K74B 4UT9L 4OD1H 4YR6B 2NY3D 2WLZA 4X7CC 5JUEH 5DD5H 3IJSA 3QEQB 2WM0A 4C55A 1WCBB 3S8WA 3QDAA 1RSFA 1G9MH 4LEOB 2J5LC 5ADOH 1D5ZA 3MRPA 5A16B 4X6BA 3T0EB 5EU6B 3C6LC 1ZOXA 4WFGE 2ILLA 1DUZA 1G9EA 3MMEA 5GGTA 3D25B 3GMOA 1IM3B 1INEH 3TGXA 3QIUD 3EYSH 3FQUA 4MAYB 5EBWB 2NLJA 4U31A 5ANME 4H20L 3PGCB 5EU5B 2VN4A 3O4LA 5CJOH 5IJVA 1OT2A 4LVHB 4YHKL 3AXLA 3MRCA 4XVUC 1N7MH 3AC0A 4NQSA 3N06B 2JCCF 5LCVH 5F9AC 2Y5TB 4R96B 1U3JA 5CWSA 5IHBA 5ITFA 3NFSL 4KZDH 4PJFE 1G6RL 2ZCKL 4P3CH 4RAUB 5INDA 1AIFB 1YY9D 1UCTA 4MB3A 3GKZA 4H8WL 3PWJB 4ODSL 1RULH 3CLEL 3HI6L 2B2XH 1QEWA 1BECA 4C54A 5HYJE 4YHYC 5E2UL 4U6YB 4YNYA 1UJ3B 2BK8A 2P8MA 4XCCL 1JPST 2PXYD 3IAGC 4PJEA 5BS0A 3D69A 3DVGA 2R0LH 3RUGE 5FGSA 5ICYA 2EXYC 4HKBA 3EDJA 3RGHA 5D7JC 1P53A 4IDLA 1QTYT 2YK1L 1LO2L 3B8YA 3D18A 3GMRB 2CKBB 2BRRL 4PGEA 1RHFA 3ZE2F 5ACMA 2NW3A 3TWCL 5D7SH 2AJZB 1UYWH 5DJXA 5J6GA 1A8JH 2Z92B 2X9YA 4XPFL 2B7DT 5F72S 4Y19E 1E28B 1D5ZB 1O0VA 4RCAA 3CU7A 2ZSVB 3NCBB 5C0JA 3B5HA 4WHTB 4PLJC 3H3PH 4M43H 1ZWIA 2C3GA 1TZIA 2VLJE 2R29L 1CS6A 1GHFL 1VESA 4X0KA 2ICWA 5SWSD 5C2BH 5D9SB 4YX2H 1J7VR 2H1PH 4YFLF 2FX8H 3BYYA 3O4LB 1DQML 3D87B 1HOCB 5ACLA 1QO3B 3O45B 1RZJC 4QYOA 1FCCA 2VAAA 3S96B 1ONQB 5KSUA 4PGCA 2V7HA 3MUHL 4KGJA 4XMKL 4R96A 5CWSB 25C8H 2NW2A 3NN8B 1SEBA 4CBPA 2NY0B 3PQYB 3OJMB 4J3OC 2AK4E 3GSNB 3FRUA 1OAXL 3C60B 3K4AA 2P8MB 5FF6B 1HDMA 2APVA 4GKZA 5SX5K 4P0DA 4RWHA 4CAGA 5ICYB 4NBYB 1KXQE 2F5AL 5DRZA 1G7MA 3E6HB 2YSSB 1JGEB 2NY4C 2YN3A 5H94A 3RGVB 4EOWH 3O9WA 2IPTL 4UUJB 2PETA 1X5XA 3BW9A 3RVVC 4MA3A 1U8LB 4LLUA 5DJ6B 2G60L 4X5XA 4D9RD 3CFDB 4XPHH 4NFCA 5F6HJ 5HJ3A 2RAMA 2UUDK 2VTFA 1A02N 5J1TC 4LCUB 3W0WD 2HLAA 5KS9F 4HWUA 1CGUA 3HZYA 5BW7C 3LKNA 3UJTH 4H1LA 4KRNA 4Q0XH 3GMLA 2Y72A 2AQ3A 2P47B 3LIZH 3CDGB 2J88L 1IAMA 4C4KO 3E2HB 4R7NB 4ZOBA 1C5CH 5DEGB 4LEXL 2MFNA 1OAQH 3MGTA 1CD1A 1YMME 5EA0H 5DQJB 5L6YH 5JHLL 1T6WA 1DBAL 2VZVA 3MOQA 3D3VE 1IC7H 4XNZC 2GCYA 4KDTC 2DB8A 1A3RL 4DZ8A 3D5OF 4XAKD 1IEBB 3HI1A 3FCTA 1F2QA 4XNUH 1FFRA 1KB9J 1EBPA 1BMGA 3HNTL 5FM5O 1DL7L 4UI2A 4JPIB 3VFSB 5JXED 3LD8C 4U3XA 1EFXB 4X7SL 4M7ZC 5F3BB 2DLTA 1U2HA 3GMNB 2NY5H 2VWEE 5JQ6L 2FGWL 4NO0D 4LLDB 3U7WL 1CGVA 1NCTA 3RL1A 2YD9A 1CGXA 2DQDH 1NAKL 1F4YH 3LS4L 3NGBC 1TJGL 5DRZB 1ZVHA 4GMSH 3WLWD 3V9FA 4ZFOA 3PJSA 3FN3A 4HCRA 4BKLB 4C83A 2CDEB 4FQXA 5AWNH 1XR9B 3BMWA 3IRPX 3SPVA 3BZEA 3X17A 3ARTA 3DX8B 3DLQR 1A64A 4M00A 3VFNB 1FPTL 1ORSB 4HK0B 4X7DC 3VWJB 1I1FB 5I19H 5DUMH 3GK8H 1U95A 2P5WE 3O2VL 4U6HA 3RVTD 4DKEL 1CDGA 1U3HD 4NQDD 1BWMA 4MWFB 1A3RH 1W0VB 3ARSA 1L4IA 3VD3A 4MS8D 2CRZA 3P9LA 3GHEL 5T1DH 2RBLA 1UB5B 3E2HC 3MRNA 3VJ6B 1MJ8H 2M26A 1PBYA 1HN1A 3MGTB 4M6OL 5IFHH 4GKSA 5GGQH 1T1YA 3ZO0A 1FGNL 5FYLE 2QSCH 2IH1A 1TVHA 5JO5B 3TIEB 4QRPE 1P7KA 1W0YT 5GRJL 5GGSY 4P23D 2R0KH 3UBXB 1OGAD 5BVPL 1S3KL 1I7ZB 4IBLT 2CKBL 5DK0A 1HSAB 4XCFL 2O5XH 3RWEA 5JW5A 1KF9B 3LPFA 1X6NA 2XQBL 3RZCC 1H3GA 1W0WB 4RSVA 2A38A 1DEDA 3BESR 2Q20A 1ZGLA 3MRMA 3SE4A 4P99A 5C0CA 5DTFA 4POUB 1IFHL 3I85A 4K23H 1OSZA 4IRJA 3EFDL 4NKOA 1A3QA 4ZTPL 4F2MB 1IQWH 3RUGF 4CU6A 4Z76B 2IANE 3O3UN 3HLAB 2EC9T 2OI9B 3SGJA 2J1KA 4LCCC 5EOTA 3IT8D 4CN1A 4PJ9A 5CMAA 2HH0L 3O6LL 1YC7A 1OLLA 3OXSA 4ZUWA 2FH8A 5FO7B 2VLME 1GJIA 4RNRB 2EZ0D 3C8KA 4F15C 1RHHA 3LRGA 3MACL 5F7MC 1HI6A 2X7LA 3EZ8A 1CT8A 3K81A 3PGDB 4HUXB 1SY6H 4QT5B 3S37L 1KTLB 4R7DB 4LLQA 1I4FB 1C1EL 3ULVE 3L3KA 2VDOL 1VFAA 4PB9L 3F12B 2DM2A 5FYKD 3BWAA 1FDLL 3BFOA 4FOMA 5AEAA 3MC0A 1K8DA 1KNOB 2LU7A 2NY1D 1PKOA 4WEMB 3HRZA 3VI4E 4U1JB 3JWDC 1PLGL 3WXWL 3HG1A 3EO0A 3UBXA 4LCWB 4NC2B 2D03L 2A6IB 1MPAL 4MA7L 3K1KC 3FL7A 3MLZH 4KGLA 1FFNA 5TFSL 1N59A 3BDYH 3IF1B 4PJ5D 4I18B 5ISZB 1REIA 4EUPH 3H9HB 4PJ8C 1ZGLB 3MPCA 3G6DH 1GPOL 3HNSH 1VPOL 4JRXB 1OAYH 2JF1A 4QXWA 1BEYH 5KS9B 1WEJL 2IJ0C 4FQ1L 4X83A 4HF5L 5IBTH 1UZ6F 3RVVD 4NO0B 4H88H 1IRAY 3G9AB 5IVXE 5EOTB 4MAYA 1AR1C 4GW5B 1N5AA 4H25B 2HVJA 1GL4B 3HE6C 3VFVA 5DRXB 5LKNA 4XP9H 2BJMH 5GRZA 3MNWA 4ZUWB 4IIQB 3T3MF 3NPZB 5GS0C 2DWDB 3HUJF 5LQBL 4XMPH 1UA6H 1C08A 1U36A 3TNMB 1WZ1L 4CUCA 3DX7A 1PEZA 4S1QL 2X7LB 5E08L 4NQDB 4YDLC 3PGDA 4GJTB 1ZHKB 1F5WA 1PG7X 4KUCF 5CD5D 2J4WL 2IAMA 3PHOA 4IMLB 1AIFA 1A4JA 4BSWA 3FAWA 2YPLD 4L8CB 5EUKB 2IH3B 1ZLUK 1U8IB 3ROOA 5C0EB 3VW3H 4PJEB 4XPAL 1KEMH 3P40A 3MGOA 3T2OA 5BVJA 2Y06H 3KPRA 3HC4H 1A4KA 2R2EA 3S35X 3WS3B 4V2BA 1WV7T 4HKBB 3PL6A 4JFHE 3KS0J 4LBEB 4JZOB 1BQLH 3EO0B 1S9KC 4JO2L 1DQDH 1N8ZB 4NWUL 4BZ1H 5DHVB 1B0WA 2P44B 2HKHH 3HPJA 1U3HA 1FFNB 2BCKA 2R69L 3D0LA 4XBPB 2AEQH 4K3JH 1D5XA 3DETD 2MQ0A 1DE4B 1LNUB 2C26A 3C5JA 3DURB 3R06A 1SHMA 3ZDYE 5CJBA 2XQYG 3DETC 5C7XL 4R4FH 4Z0BH 5LAXA 3TBTA 4XWGL 1JI1A 2JTDA 1G7HB 4C57C 3BEVB 5D9SA 3V6BR 4APQD 1MREH 1U42A 1M71A 5CP7B 1I7RA 1QO3A 1INEL 5I1AA 2VAAB 1AGEA 3HUJE 3FT4A 5FUOH 4OLYL 2MQCA 2Y36H 2Y6SC 3G5XA 1NC4B 4JFPB 2WSKA 5IR1B 4OZGA 3X12B 2OX5A 4Z5RA 2X4RB 1A4JB 3NZHL 4PJ5B 4Q7DA 1P4BH 5D5ME 4GLRI 1JHLH 3D39E 1W72L 5GISL 4JFDB 1QBLH 2GEEA 1MOEA 3DRQB 5FKAA 2OTWB 5FO8A 1YEIH 1JFQH 5F9WC 3HNVH 2OZ4L 4PRNB 1RK1B 3D39B 5E5RB 3QH3A 1A4KB 2R2EB 3VRLE 4QTHB 1XGQB 2VXVL 4GW1B 3B2VL 3BGAA 1WZMA 1GAFL 4FQCH 3IXAB 4LGRB 2BHUA 2R15A 4LSSL 1U8JA 1J87A 1U8LA 3VW3L 5FYLH 3TPUB 2EC9U 3U6RA 3TO4C 3BSZH 3D48R 4GQPH 4JE4B 5B8CB 3I75B 1MJUH 3O6ML 3DHJA 2MCG1 1C8PA 5TGBA 4X6CA 4UDUB 4QHNB 3REWA 3NOIA 3DROA 3T0EA 1X3DA 1XF3B 3ARGB 3ALWA 5B39G 1DANU 5HI5C 1XFPA 3OKNA 3OHXB 2IFGA 3WHXA 3FHAA 4LNVA 3VWKB 5I8KH 3MOAH 5EBWA 2XZAH 1PQZB 1Z5LA 3HCVA 3SDYL 5BV7H 4DGIH 1OGTB 4LSUH 5A2IH 1M71B 5CP7A 4V2CB 1C12B 1PY9A 2OJEB 2DLEA 4H88L 3RNQB 1ED3B 3FT4B 1A0QH 1U9KA 1IEBA 3HI1B 4NGHH 3UYRL 1VA9A 4RISL 1WEJH 2FJGB 2AJVH 4HD9A 2R2BB 3U82B 3HA0A 5DYOA 5IR1A 3VXNB 5J13B 3X12A 3SDAB 3C2SA 3GSRA 1BOGB 1YJDC 5KVGH 1R0AH 1AI1L 3FFCD 2IADB 3MLZL 1FGVL 2Z35B 3TEUA 2X1WL 5H2BB 3S88H 3C08H 3MRGA 3TBWB 5D96B 3IDMB 2VDQL 35C8H 1OGAB 3DVGB 3TN0D 2VH5H 4WFFD 4XPBL 1KEGL 1FL5A 1ZANH 4NKIH 4Z7UA 4K55A 5BS0E 3C6SB 5KVMC 3BZFB 5IB3A 4MAUL 3S35H 4YHPB 5L0QC 4WI4A 5IJKA 4EDWH 4I48B 4KV5E 4OFYA 5HHNB 2EIDA 1Q9OA 2X09A 3RJQB 1MCOH 3U4BH 5J6GB 4G43A 4S1SH 2YUXA 4X6CB 1OD7A 5IHUH 5DRNB 3I3DA 2BOBA 2EDLA 3MACH 4MGXA 5K9OB 1XF3A 3O6FC 1W0VA 3RX7A 5ESAA 4IS6A 3G5VA 4NKQB 4Y5YC 2CDFB 2HT4D 2HJLA 4WV1B 5ANMB 4Z9KB 2HKFL 4WY7L 2W0FA 4TSBL 5IFJB 3AVEA 3GHEH 4NRXA 4I5BA 5C0DA 5T1DL 1ZGLM 4ISVB 3QG6A 3O45A 1VFBA 1IQWL 5HHQA 4NN6C 4JHBA 3QHZH 4RWYH 2V7HB 1PZ5B 3P77B 3TIEA 1CL7I 3KHOA 2YXFA 3B9KB 1VEMA 4HXBH 4XHJC 4YK4C 3SN6N 3INUL 1SEBB 4EEEA 3B9EA 4HKXA 3CVHA 3JUZA 3U0WH 2OR9L 4R6UA 5D2NE 4BA8A 1NBZB 3QEQD 3KGRA 4HPOH 3FRUB 3ILQD 5H2BA 3TZVD 4G8FB 3TBWA 4PG9A 4U1NB 1HDMB 4GKZB 5T1MB 1GVIA 5C71A 1QFWI 4FXGB 3WKML 3F5WB 2AXFB 4OCSH 3Q6FA 4M1DH 2C3VB 1I3RB 4Z7UE 4M1CD 3TCLA 4JLRB 3LRSA 5H94B 2CLVB 1XMWA 1RUML 4TQEH 5A2JH 4OZ4A 5DVNA 5BZDA 5HYIA 2FO4B 1U8MA 2V17L 5HJ3B 2QV2A 3STLB 3ZSSA 1MCKA 2EECA 3FO0L 4PJXE 1UB6B 4FQLH 2EO9A 7CGTA 1ZAGA 4ZUTA 1OD9A 2DQFA 32C2B 3RUGA 2RQ8A 1UM5H 2VKXA 3RWHB 3V2AR 2ATPA 4ALAL 2WUBH 1H9VA 5JXAH 2EKSA 1IJ9A 2EKJA 4ODVH 4DGYH 1KPRB 1RZKC 3WIHL 3NIGE 1OAQL 4JN1L 5E8DH 5BCAA 2DQUL 1FQ9C 2FZ3B 2SEBB 2Y7QB 3OXRA 3MLYH 2FB4H 1RIHL 5DQJA 5DFVC 2XN9D 5F1NB 3P4MB 4LAQH 1Q1JH 1LO3L 4HS8L 5GZND 1Z6JT 4X9FA 4LHUA 2A0LD 1KCLA 1FG2A 3B9KA 4D3CH 5L88H 3AU1B 2X9XA 5DC9B 2LVEA 2NTSP 1EFXA 4WGWB 1YY9C 3RZCD 3BHBA 5DZLA 2RCSL 4I9WD 3PDOA 3A6BL 4KK9D 2YRLA 3SKNB 5FM4A 4HPOL 4Z0XA 4XB8A 4WHYH 3FFCB 4YBLB 4I18A 4J3TA 4N0RA 4RFNB 3ARDB 1F4AA 2YR3A 4NRYA 2CDGA 4R4BB 1RURL 2FO1A 3SCMC 4NQCB 4YBHA 1MCSA 4FFZL 2CLVA 4MAYC 3MREA 4KQ4L 1BBJB 5HGHB 3S97C 2JB6A 4I8DA 3U0PA 5HYEA 4G8IA 4XCEA 4KMTH 4QTIL 1ODAA 3CSPA 1EEQA 4XVUD 4C58B 3AMLA 4OIAA 4OZHA 4F15B 2OYPA 4RISH 3U46A 4FRWA 2XI9A 3MJ7B 5L2KD 4AYFA 4PP1D 1RUKH 2XNAB 3RUGB 5GSVB 2Z9TA 3C5ZA 3MFFB 4WRLA 5K9JL 2G75B 4JJ5A 1DVFD 4HBCL 1UB5A 3MRNB 4DGIL 4M93B 3QWRD 4MD0B 4BM7A 2FZ3A 2X89A 4ONFH 5I9QB 4L8CA 1L7IL 1U8IA 4F9PC 1NBVL 5IESL 1T1YB 3ZE1E 3T4YA 5JLZB 4U1KB 3L3IB 3BOVA 4NO5A 5JW3H 1ZANL 4HZLB 1S7RA 3U83A 1XT5A 4YQXL 1NCDL 3GFUA 3ARDD 3EHBC 3BKML 5F7YC 3ULSA 5CZKA 1WF5A 1A7QH 3PWPE 1Z9LA 2I26N 3OKLB 4KMQA 3QEQA 1R0AL 4U0RB 2QQKL 1TIUA 4PD4J 1SYSB 1D5IH 3IAQA 1UEYA 4JCMA 2D7QA 5LGKA 1TVBA 1K3ZA 3BP5B 5E8PA 1CVSC 2OL3B 4UTAH 3KYMA 4ZFFB 2CRMA 4UTBH 1DJSA 1AGBB 1R3LB 1D6EA 4D0CA 5EG6C 3MV7B 4JY4B 5I2IB 3PP4L 1EO5A 2D7TL 1IM3A 2X4TB 3OJ2C 4GAYB 5DD3H 4Z7WF 5FGBC 2B2XL 1D9KB 3REVA 4QXUH 4M6NH 1ZLVK 5ADPH 1IMHC 3G08A 4TVPD 4APQB 3GBML 4XHJD 5DR5H 5IJVB 3KPOB 4J12A 4HJJL 4NOBA 4NO3B 1X5GA 3IDYC 2EEAA 2NY6D 2ZOLA 2DQTH 2DLFH 3WJLA 5GIRA 3IU4L 2VLRE 3H3PL 4X98A 1HI6B 2AQ1A 1MF2H 4WCYL 4K7FA 3MGAA 3OG6B 5K59E 4JJ5B 4HJ0C 3HHRB 3BJLA 1A6UH 1I4FA 1MREL 4YUEH 4E42A 1T2QH 1R5WB 3H0TA 3PWJA 2N7AA 4KKAD 3EAKA 3V4UH 4U2ZA 4GRLA 4I3RL 3T77A 5I1EH 2VSDA 3T4YB 5A1AA 1TJHH 4U1KA 2W1NA 4Z0BL 1LK2B 4IOFD 3MA9L 4JREC 1S7RB 4JPWH 4M5ZL 4NJ9H 4ODUB 1RUPL 1MUJB 1QG3A 1QUNA 2R0LL 5GZNC 3QUXB 3LMJL 2QEJA 1FVEB 4Y4KA 5IG7B 5B3JF 2NY6C 5T5FH 1HKLH 3I75A 3QWRA 1CXHA 5H35A 2Q8BL 1NCAL 3FN9A 5IP4A 3FQXB 4ZFFA 3ETBF 1UM6H 4LP5A 4TNVF 3TVMD 3RZCA 1BM3H 2IANB 2VDPL 1YEGH 4GAYA 4G9FA 3TV3H 2GUOA 3SO3C 2YD4A 1PQZA 4H25A 3KPMA 4APQA 1C12A 3GRWL 3DGCR 2DWDA 3AM8C 3O0RH 3RNQA 3ABZA 5F93C 5HGAB 4CN4A 4S1QH 3S96A 3R0NA 2WBWB 4PGCB 3T3ME 3ULUL 1LO4L 5I71C 5IIEA 1QKZH 2O26U 2VLKE 3CDCA 4LF3B 4MDJB 3UDWA 1QFHA 2A77L 3QXUA 3KNBB 4Y7MA 3RWIA 5ADOL 3UTOA 5FYKU 2FL5B 4JKMA 1BOGA 3PHOB 1AQDB 2BVQA 4IMLA 5DSCA 4OLEA 1FYTA 3PHQB 4GAFB 1A9BB 5C9JB 5L7XL 1A6AB 3BXNA 4JGUA 2Z35A 4M6MH 3CC5B 5FF6A 3TVMC 2VLJB 1GGYA 4PGDA 3MGOB 3SE3A 1DP0A 1WFOA 3QUXC 3S36H 1VPOH 4ODUA 4ACPA 1BX2B 4RGNE 4KI5D 3OAZH 2YHGA 3LH2H 3C6SA 4JZOA 4LVEA 2DIJA 1KEML 2QQKH 5E2WL 4GW4A 5TFSH 3C9NA 1JIBA 1HQRA 5D96C 4JVPA 3CXDL 1EHXA 5E99L 1YA5A 4PTTB 1DE4A 1LNUA 3CFBA 3DSNA 5BW7A 1GZQB 2NY0D 1X4YA 2NYYD 5F8RC 1XEDA 1J12A 2Q3AA 5I74B 3EYQC 2X70B 1U3YA 4LPXA 2ERJB 4W6YB 3O6FD 4XX1G 3EJZD 3QDJA 4G9FB 2EDXA 4QRUB 2BSRA 3S3SA 4ONFL 3FT3A 4XHQA 1YPZE 1TCRA 2RB8A 2XV6B 5D6CB 1MJ7H 1MY7A 3BRFA 2FBJH 1QFOA 2A0LC 4CMMA 2G9HB 2PO6D 2F5BL 1ZGLP 1OVZA 3KNBA 3CVHL 3VFRA 1I8KA 2CSPA 4P46D 4YXKL 5I1CL 1KIPB 5E2TL 5D7LD 4JAMA 5I8EB 5DMGC 4HDIA 4OQTH 3ZT7A 3PHQA 3PABA 2VERN 3RWCB 1XGYL 1AO7E 3FQRA 1T7YA 2GQHA 1T20A 3QQ9C 3OKKA 3FOMB 1H3TA 3WO3B 1ZE3C 4U1NA 4BH8A 3MCLH 1E4KA 4CNIB 1RK1A 1CFQA 3D39A 3RJDA 5KZCD 2NY3C 4UQ2A 4FFWD 3FFDB 3WFDL 3KPRD 3QNZB 4ZFOB 2BY1A 4JGMA 1INQA 4J1UB 4OM1H 5BZDB 2NNAB 4OZIA 5DK3A 4N0YL 2D0GA 2VZSA 3KPSE 5DA0B 4G6KH 1KLFA 4JZNB 1S7UA 3E0GA 3MRJB 3UO1H 3CH8A 3CFBB 5KSBF 5K93A 4LARL 4KKCD 2EYTA 4KY1L 4JDZB 4QRRD 1YQVL 4ZUTB 4AEIH 4N9GB 2XKSA 4DFIA 1NFDE 2P1YA 3I6KA 2BVPA 4TSAL 1Q1JL 1GGCL 4X6DF 3QQ9D 3ES6B 4QRUA 2UUDH 4KZEL 4RAHA 4WFED 2R9HD 2BERA 4XP1H 2VXTL 4K71B 2W0PA 3MRDA 2OJEA 1KGCD 3QSKB 1ED3A 3C6LB 3AAZA 4YGVA 3QQ4A 2EYRB 1Z3GH 3CFCL 5C0GB 2PO6C 3TT3L 4PJHE 1EEZB 1Z2KA 3SCMB 1T1XB 4RBPK 1QLFB 2BVYA 4KFZC 3MOBL 2JJSC 1P7QA 4OI9A 4JKPL 3B4NA 5IB5B 3M45A 4XNXH 4LQ1A 5DWUL 1NGQL 2JE8A 5FA3B 5JW4R 4R4NC 5J8OA 4OCRL 1IE5A 1K4DA 2CKBH 3FFCA 4W68A 1OGAA 2P7TA 3TJEH 5GGRY 2VZTA 4N1HB 3FJTA 5JW4M 3MV9A 1CICD 1J1OH 4KKAC 2IFFL 1QFWL 4NQCA 1YPZA 2WNGA 3DUUB 3QNZA 1MFNA 2G2RB 1OSZB 3VFTB 2QSCL 2CIIB 4PY8J 2ED8A 4NKOB 2DBLL 3TO4A 3NFPB 5KW9L 5JOEA 2JB6B 5B38G 2BSED 1OAKH 5C2UB 4TSCL 5SV3A 2F74B 3DRTB 3IFNL 1DBMH 4XPTH 2YEZB 3ISWA 2HTLD 3A67L 1BZQK 2UWEB 1YECH 4KUZH 3MBEC 1I3GL 4LPWA 2ADFH 3H7LA 4IS6B 1CT8B 4JG0H 1MJJB 5MEPA 4H0IA 2O5ZL 4U1GC 4AIOA 3GMMB 2VUOA 1VFBB 1G9NL 1BD2A 1BIIB 3TA3A 5ALCH 3LKPA 5INCA 5FYKL 4X7EC 5F7EL 1NFIB 3JV6A 2OM5A 5C0BD 5KJRH 3WHE1 5F6IB 3VG9C 1AXSA 5C0CD 2AEWA 4DKFH 2WINA 1HZHL 4LCWA 4C56E 4NKMB 3ULSB 1EVUA 1BD2D 4EDWL 3MJ6A 3MSPA 4OLVH 3W2DL 1QLRA 5L9DL 1VSCA 3DGGB 1SJEA 2ZKHL 5F7WC 4I0KA 4PJ5E 1ZLSL 1HEZA 4P49A 4OGZA 1CDBA 2PCPB 4X9IA 1MRCL 3LRSB 5EOQH 3VFTA 3SDDA 1NC2A 1JP5A 2CIIA 1Y18A 3ZKMD 4ZMAT 3C08L 4HIJB 1U91B 3D2UA 2GJJA 4P9HC 1FZJA 3L5HA 4O58H 4NQVA 4DCQB 5A2KH 3NZ8B 4U6VL 4JKKA 4BZYA 2VLLA 2HVJB 1ETZB 5CBAA 3ULUC 3FO1A 2ITCA 1C08B 4CJ0A 4OAWB 2XWJA 5JZ7C 3TO4D 4GKNB 3LS5L 4NQDA 4DAGH 1ZHKA 1MHPH 1NMCB 4PJCB 2C1OB 5I15L 5ISZE 4PRDA 5BV7L 2W07A 1MFBH 4JFEA 1MFDL 1F4WL 3GMMA 5JOFA 3VFGL 1GHFH 1A2YB 4Z7NF 2JKXA 4RMRA 2JELH 1JMZA 1B9ZA 3T09A 4OCMC 4ZAKB 4KVCH 1S9VA 3OR6A 3L1OH 3BD4A 5E1HB 2VH5L 5GJTL 4G3YH 5D1XB 1MJUL 4Z78B 1UYWL 3O8XD 5GRUH 5I1GL 2AW2A 4HUVB 4OZFG 3T0XA 3HPJB 4O5LL 1T5WB 5FGRA 1JPSL 3V4VL 4HEME 1JPSH 5EPMA 3FONA 3U30B 2XTJE 4B5EA 1ZHBB 5EZOH 3N9GL 2OL3L 2J8UF 1ZLVH 4NZRH 1FSKB 2MQ3A 4PJ8A 3SOBH 4KK8C 4RGOL 5JNYA 2YD7A 1NC2B 3ZTNH 5KG9A 1BWWA 3SJVB 3ULVH 1MHCA 1RJCA 2BNQB 4ELME 1NAMA 3L3JA 4CKVX 1JGVL 2GUOB 1V5JA 1A6VH 4X4XA 5CBAB 3ELAT 2GT9B 2EXWD 1HIML 3MRRB 1F4WH 3VFWB 3MZTA 4OZHB 4MNHB 4G8GE 3R0MA 4NO2B 1TJIL 2VE6A 4IEFB 2NY2C 3GJFB 3G5XB 4KVNL 2J2ZA 4FXKB 4KAQH 4ZAKD 4OZGB 1A7PH 1NJ9B 3D3VD 3H9YA 2FL5A 2BVQB 4MD0A 2X4RA 3DYMA 4PJ5A 3O2WH 4ZOAA 4MZ3A 4HLZH 5DHXB 2VISB 5K33A 4HPYH 3NCMA 3L3HA 3CXDH 5K9QI 2AJXH 5FKAB 5IVZA 3VGHA 4FQCL 3F65A 3VXOB 1XGQA 5F7LB 4Y2DB 1T89C 4JPVH 4QNPF 2EIZA 1UJ3C 3OKOB 3TNNB 1E6JL 1C7TA 3L3OA 3T0VA 2P49B 4N5UA 3QXWA 1FFPB 3BGMA 4UT9H 1RUQL 1T5WA 1FFOA 4KRPC 2WAHA 3QUZD 4KK5C 3PP3H 3CZFB 1ES0A 2XT1B 2EH7H 4QHNA 3TT1H 4RX4A 1EPFA 3HKFA 3I6GB 2DMKA 3CK0H 4AG4H 4YHLH 4ODWA 5E5MB 5E6IC 3AMKA 3JZ7A 5CD3B 3MV7A 4JY4A 5I2IA 3O0RL 3WSQL 3MTRA 4D8PA 1NAMB 3VXRB 3LVEA 1KIRA 2ZUQC 1H3XA 2ZUSA 4PG2C 5JPMA 1KT2A 3K4ZA 2OJZL 2DS4A 1EJ6A 2CGRL 2VE6B 1WZ1H 3GJFA 1G0XA 2Q7NA 4QO1A 2Z31A 1UM6L 3GMQA 4OLUH 3SO5A 3LQMA 4XMLL 2HTKD 4I4WB 5HHME 2EXWC 2DOCA 1DBJH 3MLVL 1G9ML 1KV3A 4ZSOA 4Z95H 4Y19B 2VLRD 3VXPA 3I9GH 3VRJB 3P9MA 2YPKA 2WZPD 5HHMB 1CFSA 4JFED 2D3VA 2GJ6A 5FXCH 3HC0A 2ZUQB 4HT1H 3RP1A 4OT1L 5IK3B 1CGSH 1QSED 1MUJA 4OF7A 5MEND 1OM3H 2XTJC 2MTPA 1J1PL 2GSIA 4PRBA 2NNAA 2XZCH 1AE6H 1N64L 5FO9B 1P1ZB 2P24A 4BH7A 1CBVH 2A83B 5DLML 4N0FB 5I18H 2ZUTA 1EDQA 4HXAH 1SJVA 1WAAF 4P2YA 3VI3E 1HYSD 3IJYA 4WEBH 2P45B 3RWJA 3UC0L 4PJIB 2DLFL 5T3XL 1IEHA 2VR9A 4HHAA 2D4FA 1EFQA 1B4RA 3G5VB 4XNMA 1B6UA 3TZVC 1M7XA 3VXRA 3BMVA 1WC7B 4DVRL 1ZLWK 3RWDA 5JPMB 2W0FB 5JIHA 3RIFK 5C0DB 4LCIL 2ICEB 5IB2B 2X41A 5ESVA 2VXTH 4KPHH 4QRRE 3LEVH 2DTML 5IIEB 1A5FH 1RZ7H 1T4KB 2BXZA 4KDTA 5F7DA 4RGOH 1NL0H 4R3SB 4OZGE 4ORGB 1SYVA 3W11D 2UY6A 2COQA 3RTQA 1HK6A 3HZVB 4JQVA 1C16B 4K7PX 3X3GH 5CAYB 3QDGA 1P7QB 1JL8A 5IB5A 1NLDH 5CGYC 3HC0B 3VD7A 1VERA 4K23L 2P7TB 3RA7H 5GJTH 3ARWA 1T7XA 4NZUH 4OM1L 4HWBA 2APTA 2JJTA 3KLDA 4JGJA 4WW1A 2ESVA 4ONOA 4P59H 3MLXH 3TO4B 3O9WD 3NFPA 1NGXA 3O81A 4RGND 3VRIA 2A1WH 4G6JH 1K6QH 4M4RA 3TBYB 5D1ZC 1F6FB 5TH2B 4PTTA 1QVOB 1MFCH 3UTPD 2VDKL 5CJ5A 2AJSH 4NZTL 5IF0B 4Y8AA 2O93L 3WEXA 1DTUA 1AO7A 1CZ8L 1LE9A 2AXHA 3QNXA 4KMLB 5EO9A 5D72L 3KHQA 4ZUVB 4ZAKC 3AGVA 4XNMB 5DD0L 5T1LD 1A7BA 5IWLA 3V8OA 3MV9D 1A5FL 5FKPB 1JF6A 4EI5A 3VWJD 1TCRB 3K8LA 1XF2A 1UWEL 4GRMA 4X8JA 4LPVA 3BPCA 3SDXF 1KBGH 4PBVC 3KLAA 4GS7B 3GSUB 1JPGA 4G6FD 4BQ9A 5EUOE 4NWTH 3VCLB 5DJ2A 4G6AC 1SMOA 5HGDB 4L4VE 1QA9A 2VYRE 3PXHA 5I1LB 2DQJL 4GG6A 1ZA6B 4JRYE 3LRHA 3GKWL 3FQNA 1SYVB 3GK8L 3O2VH 2Z31D 3HR5B 4NHCH 4ELKA 2AEIT 1BFVH 4HKZB 4YDKL 3ARVA 5CEZL 3FQRB 1MRDH 4PJ7B 5J4MA 3I2CH 3AREC 3FOLB 3OMZA 3P0VL 5D6DC 4PJDB 2X89D 3EDEA 4CNIA 2X4UA 4LSQL 4PJBB 2H3NA 2ED9A 4DKFL 4YLQT 1IAKB 4ZOCA 2PCPA 4G42A 4NUGL 1NMAL 5M7QA 5DRWA 3OR7A 4H1LH 2EIEA 4OZIB 4R4ND 1NGXB 3U0PB 3CFKA 3MUZ1 3HUJB 4OZHF 5JDSA 3LKQB 5JPNB 4KQ3L 1S7UB 3LAFA 1S7WB 5D7JA 3VDBA 4G5ZH 4DOHB 4X7FC 5JHDD 5FYJU 1MCLA 5FHBL 4WFEE 3MJ7A 3MO1B 1NGPH 1CYGA 4UAOB 3WEXB 1V3KA 2EDRA 2OK0H 4GKNA 5KVEH 4ZUVA 3D39D 3EO1B 4NOFA 2G75A 3N1MC 4YHOL 4TTGA 5J1AA 4PRDB 2L7UA 2QHLA 4XRCB 3GRWH 1CFVH 4NQCE 2B4CC 1T03H 5TQ0L 4KTDL 3UTTD 4Q6IA 1OHQA 4TQEL 1JNHB 2AGJH 5ESQB 3RDTC 4LQFL 4ONGL 4PV9B 4ENED 4EJ1C 2NX5D 3FQNB 1LP9F 4Y5XC 2AABH 1OAUH 2R4RH 1NAKH 5DS8B 1I8MA 5D1XA 4Z78A 5I6XB 4HKZA 4AEHH 2O61B 1OF2A 4HJGB 3DXAB 3DV6A 5EORL 2FDBP 5KANI 2X05A 5FFLA 4DN4H 3QZWB 1FBIH 1D9KC 3FOLA 4C56B 3MRKA 4GOSA 1FVCA 3FONB 1EZVY 2D4DA 4HXBL 3MV9B 4HWBL 4RGMC 1X44A 3EJJX 4PJ8B 4UU9B 2V6HA 1N6VA 3BQUB 4M7JL 3RPIB 1QACA 5DRWB 4GBXD 3MBEB 3WNPA 3AS3A 3THML 1ORQB 3L7EA 1DBAH 2FJHB 5JDSB 4ZNCD 1EUUA 3RWGA 2J8UA 4JN2B 2MCPL 1RV6X 5D7JB 4JDVB 3D85B 4LVOB 3KPOA 3HZMB 4JY6A 3WXVH 3MRRA 4GLRH 3VFWA 3G6AB 1IKNA 2ZSWA 1NBYB 3LIZL 5L8KB 3MO1A 2ZOLB 5DZNA 1HINL 3KS0H 2E6QA 4OIIL 2W91A 3EO1A 3VXQB 4FA8A 4Y5VA 4KY1H 4XNYH 1SVCP 4E42B 4XPHL 1HIMH 4QRQB 2G60H 4OKDA 4GG8B 3HE7C 5H37G 3T8XB 4MAUH 1KCVL 1LK2A 4IOIB 4LKCA 4X5WA 4H26A 1NFIA 1KB5A 1EAPB 5CILL 4JFZL 1MLCA 4Y16C 2BDNL 2WINB 3TYGH 3QPXL 3T3PF 5EO0A 5GS2D 1FVEA 4Y4KB 4U1IA 2PO6B 1KELL 2OL3H 2QQNH 1E4XH 3QUZB 4L8SC 3BH9A 1EO8H 4XBEL 3MCG1 3PWVB 3HPLB 3D2UD 2UVEA 4J3SA 4W4OA 4TPRH 4X80H 4MHHG 3BQUA 4MD5B 4CU8A 2OTPA 2KZ1B 4WWID 4Z7OE 5E2JA 3D2UB 5GS1C 1GOHA 3L7EB 4LNRB 4HLJA 3T0AA 3OKEA 3QIBC 1JWUB 4HIEB 5DJZA 2V2TB 3EO9H 3NZ8A 3KPLA 3KPMB 3FMGH 5IQ7L 2A73A 7FABL 3S6CA 4XCYA 4BQBA 4LPTA 4M9PA 3HFML 5T33L 4PYGA 3ZYIA 3T2PA 1JTTA 3PXJA 3L9RA 5F71A 1RZIB 3VXQA 3P9WB 4Z77A 4MA8H 3N1GC 2HT3D 5F89A 4ZXBA 5JDJA 5JW4N 3IJHB 4HULB 4ZSOB 1G84A 3BGFB 1F58H 1S78C 2B0SL 3ARDC 1U0QA 2VXUL 4PLNC 1GYAA 2VLJD 5DF0A 5ENWB 1JUFB 4QRQA 5JOFB 4MJ4A 2A9NH 1UC6A 1CFSB 1H15B 2GK2A 4PP2B 4EI6A 4IOIA 4LKCB 2E7CA 3DMMA 4Q74A 2W0KA 4HMCA 4KDWA 5EUOB 3EFFA 1FJ1A 4I9WE 4MQ7B 5EOQL 4CVXB 5DUPL 3EYUL 4POZD 2GSIB 4PRBB 2FYYA 3BO8B 5E6YA 2MPAL 1DFBH 3G04A 3WLBB 1ERNA 5EPMB 1JYNA 1HQ4A 4O9HL 1UACL 3FQTA 5EORH 4OI8A 3MJGX 1PVHA 1G7QA 2C3XA 1NLBH 2GJZA 5SWZA 5D5MB 1AD0B 1CVRA 1VADA 3QIBB 1PAMA 1NAML 2K1MA 3BD3A 4KUCD 2ERJC 4NNPH 4LNRA 2FSEB 3BIKA 3LKSB 4C56D 5IB4B 3BPNC 4G8EB 3M07A 4ESKA 4HZAA 1E4JA 2NXYB 2F58H 4XCYB 4OZIE 4P2RD 5HD8C 5ESVB 1YEGL 1NUGA 4U2YA 5JHDE 2QSVA 3GJFH 2G9HA 2GFBA 3OX8B 3KJ6H 1KXVC 5DD6A 4U1MB 3K3QA 3GSWB 1MIML 1IT9H 4Z77B 4NN6B 2WIIB 3MXWH 3B5TA 4HDIB 4WJ5B 3LEXA 1JUFA 3V4PH 1DLHA 3HG1E 5HD8D 5T1KA 5E00B 2VISA 4CVWA 1H15A 4PP2A 1PYWB 3ZSTA 4HFWA 4Y5YB 4PV8A 3QFJB 4KJYA 1KLUA 1CFQB 3OB0K 4L3CA 4UQ2B 1FN4B 3R8QA 1DN0B 4NUGH 1HHGA 3KPRE 5CZXC 4ZXBC 5F44A 1FL3B 1WISA 1U8PB 1WLHA 3SDCA 4OCSL 1XR8A 3LKOB 4KXZH 4QHKI 1QNZH 3G04B 1LDPH 4V1DB 5DUBB 2FEEI 3G6JE 1T0MB 1KG0A 4KTDH 2CK0L 3CVIH 4MVBC 4GXUN 1DSFL 1UVQA 2F19H 5GRWA 4X4ME 3ARFC 2H6PB 1L6XA 4JFXB 1AO7B 2G5BB 4MDIA 5CJ8A 1M7IA 4GH7B 5EO9B 4M7KH 4XP6L 5KVEL 4R0LC 4N1EA 2BJML 3C87A 3FB8B 1IKFL 3E1F1 1CXLA 2FJFB 4LHQB 4LSPL 1JPGB 4UMGA 4UDTA 1XH3A 2I27N 1O7VA 4X4MA 2Z31B 4FXLA 4GG6B 3GSWA 3IDJA 5DURB 1EEZA 1V8HA 2ZJSH 1SMAA 4ELKB 4JQXA 5TF0A 3WFEH 2WBJC 2R23A 3RVWC 1WITA 1CGTA 2DL9A 3CH1B 3VXSD 2YPKB 3NA9H 3DVNB 1JNNL 3SGEI 2V5SA 5TE4H 5BRZA 1AQKH 3MLUH 2BY3A 3BKMH 5DVMA 5J12C 2NR6C 1M05B 1RMFH 2FHBA 1MRDL 2PYED 3VXTA 4AMKH 3KYOB 1A3LH 5A2LH 4ZFGL 1U8KB 3NIDE 3MV8E 3IFLL 1BFVL 4IRZL 1KIQA 4AH2A 3IFLH 4IRZH 1NEZG 4UT6L 3V0VA 3OR7B 4EXPX 4WO4D 4O4YL 1UZ8A 2IMNA 3QHFH 3S98A 3KXFB 3G6JA 3HN3A 1M6OB 2VDOH 5D7IE 1C1EH 1T3FA 12E8H 5C0AB 2F74A 4I0CC 1RY7B 4OQTL 4WTZA 4BFIA 3D0VB 4AIZB 2YRPA 3ARGC 5GGRA 3MLWH 4Y2OA 3TN0B 1F6AB 5GS0H 1IM9D 4WNQA 5KN5A 2RR3A 4PJEE 1JZ6A 3C6LD 1D7FA 3CIQA 1A7NH 2FJFA 3QJHB 1MJ7L 4XWOD 5I1IH 4Q9BA 4I1NB 1HHIA 3KYAA 1BD2B 1GC1H 1EGJL 1HXYB 2R4SH 5LGHL 1MHEA 3QHFL 1CL7H 4UQ3A 4KK6D 3B8SA 4R3SA 4XP6H 1AXSB 5EN2A 1FNHA 3MLXL 1BREA 4NKMA 4ZFGH 5D7KD 4OQ1A 5HI4D 2DTSA 3H9SE 4OFPA 5E9DA 15C8H 1MCPL 2F8OA 5IT2L 3QB7C 3AS1A 4Q9QL 4HX1B 3QISA 1AQKL 5AAWA 2HJKA 1RJYB 2E7LC 3VXTB 5HYSA 4D3CL 1PG7L 5GRJH 2F54E 4L9LC 4NM4H 4P4RA 2ESVB 4KXZI 1OOAA 3AROA 3LH2L 4G7VL 1LO3H 4WTXA 1LO0L 3EUUA 2HFGL 3VDCA 1ORQA 1BQHA 3TESA 1FZJB 3ULVF 5GGQL 5IFHL 1A22B 1OP3H 2QR0A 3OBAA 4P5TC 1WBZA 1ETZA 1TTGA 2DQUH 2HMIC 3FO1B 1NDGB 5C0AA 3WUWG 3VXSB 1FNGA 4LCIH 3MV9E 1A6PA 1JK8B 2AXGB 1IAIM 4XPGL 3OAUL 1EJOL 2ITDB 4RA0C 4DVRH 1MQKL 1GGBL 5IHZA 5IVOA 1FORL 2IG2H 3QNXB 6FABL 3TN0A 1F6AA 1P5VA 4WNQB 5FCUH 3NABH 1ZT1B 4X6EB 4DGVH 3L95A 4JFEB 1CLYH 4LU5L 4PLOB 4W4NA 3GRWA 1YZZA 3ET9F 4PRHD 1PFCA 3UPRA 5AD0A 4NN5B 1Y6KR 4X5WB 1YEKL 3WD5L 1KB5B 3RGVD 4NSKB 4XI5C 3OR6B 2YMXH 5B4MD 4TNVK 4DUWA 4TUKL 3CNKA 5FYJL 3BQUD 4P3WA 3WKMH 5F96H 3AY4A 1N3NB 4N68A 5EZLA 3H9SA 5F1IA 2AVGA 3T1FA 3V5HA 4OUUA 2IPUG 2HWZL 3OPZL 4PJDA 1VKXA 2J12B 3K8KA 3STZB 3NA4A 5HYSB 2YD3A 3GSNL 5I76A 1JGUH 5F88B 2ZUVA 4ZPVB 5KTEL 2J6EA 2NY1C 4U1GB 4Z95L 5JR1H 2BC4B 5DFTA 3VH8B 3S4SB 5FHAH 1QQDA 1MHCB 4LPYA 5DK2A 2WWMD 4UT7H 1CLCA 1JWUA 1YNKL 4HIEA 2GY7B 5F97E 2DQHH 5C0AE 1K8IB 4I3RH 4J8RA 4HCRH 5E2VH 2DAVA 1LILA 2VNCA 2FIKA 1CU4L 5I0DA 5JIIA 1CE6B 4Y2DD 5TJWK 4WW2B 2NPLX 1OQXA 4L4TB 4WTWA 5D2NC 3HAEB 2YD8A 4XXDB 4L8BA 4AEFA 2PTVA 2FX9H 2ADIA 4OLZH 3RY6A 2XA3A 4P5KA 1YUHB 4UIKL 2H2SC 4L3EB 2BVOB 3QJFB 3U1SH 4RMTA 4CVUA 4KWUA 1YYLH 1AR2A 4KC3B 1Q9KB 4PYHA 3L5XL 4WV1C 1RK0A 3MRBB 3GM0A 3U0TA 2FNBA 2VABA 3DOSA 2D7TH 5DD3L 3VXOA 3C09B 3WN5C 3WYRA 2HT2C 2QQLL 4ODHH 3WDJA 1I8MB 1JVKA 3KYKL 4JQVC 4PREA 3DARA 1G7PB 3EOBB 2YN5A 2BOCB 2OS7A 3QDGD 4JHAH 1IC1A 2P5WA 3LHPH 3PE9A 1FGVH 3ZDZF 1X5FA 4LRNH 1XCTA 3RBSA 4CMHB 1RAMA 2PW1A 2OMBA 3Q1SL 3QRGL 5KSVA 2OP4L 1UADC 1CD8A 1EH9A 4Y4HD 4Z7QE 1FL6B 1KCSL 4UU9A 2WUCL 4RAVB 1Q0YH 2HRPL 3VH8A 5I30L 4ODXA 2I60L 3MRHB 3O6FB 3PV6A 1T21A 1VB9A 1F3DJ 5DJCB 43CAA 2NZIA 1JF1A 5AYUL 1CXFA 1YMMD 2AERT 4D8PB 5BO1L 2YA1A 1X5LA 1NEZA 5GHWL 2J8UB 1AFVH 4XB7A 2XZAL 4HKJB 5LBSL 3MOAL 5M95B 3X3FL 2HFFB 2D31A 5EOCH 4NJAH 3SDAC 5I1DA 4R8WL 3EO9L 1EIBA 1CGWA 3D3VB 4KRPB 1JGVH 3LS5H 1HNGA 4L8BB 4XCNA 4LVNB 3OQ3B 4ZOEA 4XVTH 3U36A 4F57H 4P5TD 1KJ3L 4D0BB 2WBJA 1I9JL 4GG8A 2Q6WB 5E00A 4Q9CA 2NY3B 4JQXC 1ZHNB 1XGTB 3VGGA 1WTGT 4RIRB 1LO2H 4FFYH 4O5LH 1G7LA 4KJWC 4MNGA 3QUYA 5JA9A 3GUTB 1OARH 1R3HA 2MMXA 4GKOA 3VFPB 3EOBA 1BPVA 1FL3A 3O41A 3GSNH 1U8PA 4NP4H 3PNWB 2C3HA 2PYFB 2X4PB 3J8F7 5HYSG 3E6FA 1LP9A 4LDLB 1IC5L 3W2DH 4K2UL 2AV7B 2ATKB 3QDGE 5HPMA 1JV5B 3X14B 3Q0HA 1UVQB 1S3KH 1MAJA 3RHWF 1WIPA 4P2OD 4JHZA 5D1XD 3DECA 3RWJB 1D6VL 4MDIB 1M7IB 4K3EH 1CDHA 1CFNB 4PLKD 1RJLB 4OIIH 4PJAB 5MHSE 4OI7A 1A9EA 2OTUB 5F7EH 1FVDA 4J4PC 2ADJB 1ZVSB 5CEXB 2UWEF 5L8LB 4UDTB 1JZ4A 1YJDH 1M4KA 3LD8B 3SBWC 2JCCA 3K46A 5HHPA 1I1AD 5I1DB 2X1XR 4PJBE 3T65B 3VXMA 5GRVK 1FFQA 4YHOH 5I75B 5JXAL 3RY5A 1OPGH 1P2CB 4OZFA 3JBG7 3OAUH 1LEGA 5KVFH 4P57A 3D9AL 2VB5A 5IBUG 1KIUA 3UXFA 1WIOA 1OTSC 3NACH 1G6VK 3TC9A 1RFDH 3TBSA 3UPCA 4UNTA 3DMMB 3MV8A 4U1HB 1SM3H 2EDNA 2NY4D 1FBIL 1TZGH 3E8UL 4NC1C 1K5NA 1BFTA 1WTLA 3L5WA 3KYOA 1EHLH 3MMEB 5DI8B 3FKUS 1I8LC 4EUPB 3ROLB 1FAIH 1JTPA 2AP2A 4PJ8D 1CDJA 3GHBH 2YUZA 5EFIB 3FQUB 5CHNA 5BJTA 2JLLA 4WFHD 5D8JL 3TJEL 1U8NA 4LOUD 3DMMD 1NCCH 4OFDA 3WLBA 4OCYH 4ZYKA 3MRCB 1QRNA 2VXQL 5BQ7B 3CFEA 4N1CA 3NBNA 3UTPE 1AXIB 2QHRL 3MV11 1G7QB 5BXFA 4F7EB 1M7DA 5IW6B 1Z9MA 5C0IB 2YPVH 3ARYA 3TO2A 1KPVA 3QIBA 1DL7H 3GEWB 1ADQA 1UM4L 3H3BC 4PJAA 4EIGB 2OK0L 2YZ1A 2YWZA 5HY9B 2B1AH 5IB4A 1UJ3A 4JFFA 3A67H 5TDOB 1ACYL 3KLAB 2DQCH 4W4OC 5ICZB 1YEEH 1F8TL 3D69B 4IRSC 4ZUUA 4XVJL 1QSFE 3FN0L 2YWYA 3BKJH 1HILB 2PTUA 5E8OA 2R1XA 1MHEB 5DD6B 3FO2A 1P2CA 1YEHL 4TULH 4U6XB 5HTSA 4P2OB 4Q0XL 5IM7A 1S5HB 2VDRL 4ORZC 1DLHB 1LO5A 2QSTA 1MPAH 1JPTH 3MUJA 3ZLQC 1WK0A 5E4EC 5TE7L 2BNQE 1IAKA 3L5IA 2NXYC 2A6KA 1A14H 4OM0H 1A14L 4OM0L 2ESVD 2EYSA 5CBEA 3QO1B 2X4NB 4I2XB 3RA7L 4EVNB 4ZG1A 3HUJA 4H0GA 1U8NB 2R56L 1HOCA 3O9WC 5EIVA 4V1DA 5DUBA 4HGKC 1S7WA 1OB1A 3JWDL 2E9BA 4NN7B 2GITA 3WO4C 3W9DB 3RIAK 1T7WA 1DZBA 1EGJA 5GJSH 2AK4A 4FQIH 5C0IA 1DEEB 1B2WL 1F00I 2VC2H 1BVLB 2D7NA 4TYUA 1OP5H 1FIGL 2FD6H 2JK5B 3PUCA 2F5BH 3C60A 3L95B 1G9MC 1RIUH 2ZCLL 4QRSA 2NCMA 4FTVB 2VQUA 3VFMA 4N0CC 4OGAC 3BE1H 4HIHA 2IPKB 5GRYA 1KCUH 5JXEA 2LAGB 4Y4FC 4S1RH 1WFUA 1IM9B 2BNQD 1JGEA 3GSXB 4N8VB 3GIZL 3FO2B 2BNRA 3HE7A 3P0YL 3GIVB 2FATH 5TDNB 1Q38A 5EWIH 1FNEB 2DIBA 4FQQA 3QT2A 2QHRH 5I17B 1SEQH 3CH1A 2BSSA 3DVNA 2APBA 1TETH 1V7MH 3V5HB 4AL8H 1S7TA 3K4DA 2EE6A 4XVSL 5EIIA 1LDPL 3BSZL 3MBXH 4O51B 2E8ZA 4OF3A 4H1LB 1WWBX 4H1LG 5DFVD 2HP4A 5DMIL 2FECI 1I7UA 5D93B 5DEZA 5DJ0A 4LSSH 4ZPVA 1IGJA 2BY2A 5AUMA 1G7IA 5F1KC 3RPIA 5LXGL 4FFVD 4P5TB 2D9QB 3LV3B 4KKNA 2FWOB 1QSEA 1J86A 3SDXB 5ALBL 2R1WA 1E4WL 4DW2H 1JHTB 1CD1B 1I1AA 3W39A 3G6JB 3WUZA 2XWTB 4JDVA 3ZTJH 3DO7A 5I8OL 2HT3C 5E03A 1J0YA 3L5JA 3QP3A 3KDMA 4L3ED 1KCKA 3EYFB 1DANT 3D0VA 2PR4L 3BZDA 4FZ8H 4L8SB 3HAEA 1EEUA 3FB7A 5FK9B 3DX9B 4Y5VB 4TRPL 1QR1A 3KPPA 5GGVL 3P73A 1FPTH 4P3DB 4LLMB 1T83C 2F53B 4LLVB 3UPAA 5M94B 3QIWD 5I18L 4K94L 4KJPC 1CBVL 3CCHB 4ZUSB 2P8LB 4AENA 1RZFL 1R3KB 2N56A 3M17B 5CEYB 3ULUE 3BAEH 1ZHLB 2BNRB 4XWOC 1OQOA 5C6TL 3GHBL 3K2UL 4D9QD 5CINL 5IMMA 5I8CA 4U1IB 1U8OB 3WHE0 2K7QA 1AY1H 5E8EA 2ZWLT 4QHUA 2EH7L 4HS3B 5E9DB 4L9DA 1ZS8B 1S7TB 4MAYD 4U6HB 4ODBD 4XC1L 4YHML 5JW4Q 1FLRL 2VDNH 3HPLA 2VZUA