1ZLUH

Fab 2g12 + man5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB 2G12, light chain
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 221
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH01
3MRCA 5FEBA 1G7QB 1A5FH 1YEIL 3D69B 2OYPA 2C7UA 3RTQB 1UKSA 4OAWA 2YK1L 3DMMA 5D7KD 4FTVD 3MJGX 3D2UB 5H37G 1Q1JL 5CJOL 4ZUVA 1K4CA 4G80A 2DMKA 3SGJC 4XXDB 1E27B 4XVJL 4KU1A 3QJFA 3QCVH 4ZDHB 5JXEA 4IJ3B 2E27L 3BH8B 4YHIB 5HDLA 5JQ6L 1IAOA 4X83A 1XAUA 4RIRB 4RSVA 1RUAL 4RNRB 4HIEB 4APQA 1A14L 1KB9K 5C0DB 1R3JA 3PWLB 3B5GA 2DIJA 4WJ5B 4Y1AA 3T08A 4KY1L 5IB1B 1J1OL 2P5EA 4NQED 3DPBA 5E7FA 5JR1L 4KTDL 4YHML 3A67H 1C5BH 4TUKH 4PY7A 3TN0B 1V7NL 3SE8H 4PB0L 2NZIA 2X4QB 4N90E 1J88A 2R0KH 1IFHH 2YEZA 4JM4H 4JKMA 4Q6IA 3OR6B 1T83C 3MACH 2EDEA 1H3VA 4XCYA 4P5TC 1INEH 5FHAL 2NW2B 1AO7D 3SE3C 2CKBH 4TVPE 3K2UL 3DVGA 3QFJB 4WUKL 2V2WA 2R1XA 1A64A 3QEHB 1NC4D 3VXOA 4B7IA 3CFCL 2R8SL 3NN8A 4WTWA 3H9YA 4L5FH 3P4MA 4D0DB 3SN6N 3PDOB 1R3IL 3OF6D 5HHME 2DQUL 5JUEH 2WBJA 1XFPA 5DMJB 1CFBA 3BD3A 4WFED 3C5ZA 4GAGL 5KVGH 1LO4L 4U1HA 2H45A 3TBWA 3X14A 2W92A 1MHPH 3DXAD 3HAEH 2Y1VA 4MLIA 1V3JA 2BVPA 1DEDA 1ETZB 5EOTB 1UM4H 3VA2C 4C4KO 1WCQA 1Z6JT 3W11D 4EUPA 5EO0B 2DQFB 4QTIH 3KPRD 4XP4H 2AV1A 1FYTD 1FZOA 4P23D 1CBVH 4MNQD 3GJFA 5GJSL 2Y07L 4ERSL 4Q9QL 3DIFA 2J1KA 4UINH 4XH2B 2V5SA 4NBXB 4QHLA 3SE9L 2BNRE 3KLDA 1CYGA 1IEHA 1VDGA 4Y5VA 1ZMYA 1OAUL 2VXVL 1CG9A 2MPAH 1RFDL 3T77A 4DUWA 1KIQB 4QOKA 1I3GH 1FSKB 3MLWH 2EDNA 2OMBA 1KIRA 4QRUA 4Z78A 3ARDD 4FQJL 2H9GB 4YGAB 3X3FH 3LPWA 2Q76A 4PJ8B 4QGTA 1KLUA 1FZMA 5GRJL 1EK3A 1VFUA 3F62A 3JZ7A 2QSQA 2KPNA 2O5YL 3STLB 4DVRL 4LGRB 5D7SH 1HHIA 1RZ7L 4ONFH 4M1GL 4RMQA 5J1TC 3LMJL 2CIKB 1RZKC 3P9LB 4G42B 2FECI 4RA0C 5CJBA 3ZE1F 1MWAH 3FQTB 5C0AA 1NANI 3VXPA 4KHTL 2L7UA 1H3WM 4OKVA 4B5EA 4R97C 4HEME 3CDCA 1W72A 5E24E 4R4NC 5ALCH 3CH1B 1DBBH 4XVUC 2WIIA 2PXYC 3QIUA 4PJAA 4PJXA 1JHKH 3A6CH 2CK0H 3HUJB 4JFZL 3PGCB 3O6FC 3RDTC 1A7PH 1A7BA 4J12A 2HJLB 2CDFA 4KXZH 4LNVA 2ICWB 1U8OA 4RFOL 1SBBA 4R4BA 4XPAH 3MFFB 4H88L 4CADA 2XKNB 1EAPB 4KTEL 2X1PA 2ZCLL 4ODSL 3T2NL 5DK2B 2V7HA 2OCFD 3QEQE 4DGYH 3MLUH 1T5XA 1A3RL 3NGBC 4JCLA 2FB4L 4K94L 4OV5B 4LASH 3VD5A 5JHDD 4RGND 3BO8B 2E6PA 3H6JA 2C5DC 3O2VH 4TOYL 4IOSD 1LDPH 5D9SA 3T0BA 5C0CE 5I15L 4UDTB 5EC2B 4Y4FB 2H26B 3RWIA 5DVKA 1SYSA 4KI5E 1KCRL 1YZZA 4J3UA 1OHQA 4NFDA 3UBXG 4KXZI 1CLZL 1QSZA 1N4XL 4OQ1A 4AY0A 1G6VK 2F53E 4OLZH 1S7TA 1C1EH 1ZT1B 4PRPA 1OAXL 2DRUA 1JZ8A 3CVHB 1JWUB 2CO7B 3QI9C 3UDWC 5MERA 3ZTJH 3BIAX 1F11B 3ARBB 2FIRT 5I8OH 4M43L 2PUQT 4FQLL 4YO0A 4RZCA 2FBJH 1IGYB 4U1NA 1GGBH 5MEPB 2QHRL 1PX3A 1NAKL 4OZHB 1YUHB 2NY1B 1UQSB 5DMYA 4GG6F 2VLJB 4GW5A 2YD5A 4S10A 5FM5M 3ESUF 1FNGB 5SWSD 5DSCA 5HGBB 3UTTD 2QQQA 3ARED 1A0QL 4PGCA 5FYJL 3FCTB 4PJ9B 1GHFL 5DGQA 4M3KB 5DVLA 4JHZA 5EBGA 3GSVB 4XCCL 1WCBA 4Z9KB 4LLWA 4XX1G 5SX4H 3H9SD 2ZOKB 2MCPL 4NJ9H 1KENL 1FVDA 2DIBA 3WV0A 1J1OH 3MV8B 4KV5F 1BFVL 3CCHB 3JWDH 2H32A 5I1HL 3ZE0F 3LQAC 3I02A 3IFOA 5H35A 1UZ6F 2EDLA 1L9NA 3RUGF 43C9B 5DJAA 3CDYA 4Y8DC 5IVZA 5D7LA 1B0WA 1WAAA 4QF1A 1TDQA 3V5HB 1RY7B 1LMKA 4LPVA 2UYLA 1N0XL 1D9KC 5DJXB 3RI5F 3K2UH 5ABDE 5SX4I 3RRQA 1HINH 2MTPA 4M8QA 4R4FH 2A77L 3GMOB 5HHOB 3L3DA 2BK8A 2JJSA 1HZHH 1ZE3C 1MFEH 4F7MA 5L8JB 2EZ0D 1M4KA 5GZOC 3QRGH 4O00A 1FJ1A 3O6KH 2VZ3A 3X3GH 4QRPD 3JVGA 4O51A 3H7BA 4YHOL 5L88H 4ORGB 1TVBA 1E4KC 2R9HD 1OGAE 4YAQA 4GKZB 5DUPL 5D7IA 4JPVH 1S7XA 4EDXB 3RKPA 3L5HA 4O58L 4JM2C 3SDCA 2VLME 4ORZC 5JIPA 4PFEA 2ZUWA 5CINH 4D9LL 4GAGH 3CPLA 4I5BB 4X6DE 2Y06H 1GRWA 1V3LA 4KJYB 4MDIA 2ZUQB 4M4RA 4ZOAA 4JY6B 3AGVA 3LKRB 3S4SG 4ZAKA 4K7PY 3WE6A 4LARH 1GL4B 4OUUB 4CDHA 1ZHNB 4OIIL 2CRZA 4U1GB 2VLKD 3RAJL 4YH6A 2FO4A 4PGEB 1P7KA 4LVOC 1GOFA 1MF2L 4IDLA 3EOTL 4CU6A 4RDQF 4UOJA 5DHVH 2CH8A 1YMMB 2A74B 4LLUB 3VGAB 4AIZA 1RFDH 1OPGL 1WBYB 3WFBH 2P45B 1PSKL 2K7PA 1KJ2B 3LKSA 1CGXA 2OL3B 1VPOL 2VDRL 1YEJL 3PQYD 5JOPD 1BX2A 3H2WA 1CXHA 1OTSC 4OFPA 3T09A 2COQA 5F1IB 5LCVH 1GGYA 1RZIB 2HTKC 4XNUH 5EU3B 1DVFC 1ROWA 4R4ND 3BOVA 1RAMA 1A9EB 3FJTA 43CAB 2PXYD 2P8PA 4M00A 4F33A 3FQWA 2JCCA 4LCUA 3N06B 2WK2A 5F3HA 4N8CL 3BT2H 2UWEA 2WNGA 3O6FD 5BQ7A 1JPSL 3O9WC 3RDTD 4HKJA 2APTA 4PJHB 3OHXB 5L6YH 5GSRB 5C9JB 2BC4A 2BNQA 1NBYA 5D1QB 4NT6B 4NDMB 2ZCHL 1W0WA 2GK0B 4ZSOB 5EBMA 5HHVL 3X11A 1D6EB 2VDNL 3EFFB 5F3BA 1HNFA 2VDKH 5K9QG 5LXGH 2DS4A 5DWUL 1DLHB 5C09A 3FO1B 3B6SB 1X4ZA 1Q9KB 2NLJA 1CGTA 2BY0A 1PG7L 2ENYA 3O3BB 4WW2F 1M05A 3TYFA 5EORH 5LG1A 3FRPG 3L1OH 3P0YL 4FMFA 4UI2A 4WI4A 2W65A 4KI5C 4XP6H 5DYOA 4CBPA 2OR9L 4OI7A 4GG8A 4UILL 4LCYA 4AK1A 4TOYH 1JE6A 2I9LA 4OLWH 4PGDB 5C3LD 4PLOB 3IDXH 2W0FA 4N1HB 1P9MC 3RVVC 3I6GB 4C57C 4NNYB 2RFXA 3UPRB 1IM3B 1TPXC 2VERN 3QFJE 5EU5B 4DCQA 1N4XH 1H3TA 1XF5B 3K8MA 4U49A 2XWBA 1ONQA 2VDOL 1T1XA 5GRZA 1A6TB 4XMLH 1P6FA 2FATL 4NNPH 4NKMB 3BIKB 5IW6A 5T33H 4YBQC 5KSAB 5IOPA 4KMTL 1H15B 2YA0A 3BPLC 5CCKL 3I9GL 1AR1D 4XPTL 1KN4L 3O6LL 5CIPA 1KYOJ 5H94A 4F7TB 3BKCH 1QFWL 4IIQA 3W2DH 3CMOL 2BXYA 3QIWC 2XY2A 1GZQA 2NY7L 1NCAL 1XZ0B 5E8NB 3QZWG 1HHGA 2VE6A 3DO7B 5CEZE 4N90D 2XACC 4M5YH 5EC1B 1GHFH 4K23L 1CZ8H 3BWAA 1ZA6A 4B53A 4XAWL 1C5DA 3IB4A 5IEHA 5I76B 5DEGA 1QRNB 4HFUL 3BKYH 4JO2L 2DDQL 1LO3H 1NGQH 1B0GA 1OM3H 4BH7B 3HNSL 4I3GA 4KJWC 2X89A 1ZVSA 4U1KA 4I48B 3VFMA 2Z31C 3HE7D 3RI5K 2O5ZL 2OJZL 5GGVY 5F88B 3WFHB 3CC5A 4FQXB 3Q3GB 4WFHE 3MLPA 3GIZL 3QHFH 1D9KD 4FQHB 3VGGA 2BSTA 4F8QA 5LGJB 1JWSA 5A40E 5HHMD 4Y2DD 3H0TB 3EHBC 4R0LB 2ZJSL 3N1QC 4ZOCA 5I1IH 2QSVA 3HMWH 1CXIA 4HUUB 1UEMA 4DGVH 5GZOD 3GMQA 4JRXB 3KPTA 5EU6A 1N0XH 2HJFA 4P3DA 4YXLH 3FB7B 3RZCB 2VDPH 5CKAA 5C0BA 1RMFL 4E5XA 4WENB 3E0GA 5I1LA 4OCWL 3QUZD 4JM2D 1QBBA 2H8PA 3ARGB 1ZLUK 3A6BH 4R2GB 5HDBE 1X7QA 5FGRA 1H8NA 2PF6A 1MPAL 2CKBA 3CK0L 5CBAA 3S36H 3SDXA 4CVZB 1TQBB 4WCYH 2FD6H 3D5OF 3HI5H 2CKNA 3VFGL 2AXFA 3LKOA 3RPIB 4KHXL 1OW0C 3HUJE 1H5BC 2BNRD 2AEQL 3HC4H 3QG6A 2HWZL 3QIBA 4OCYL 4RMSA 1JNJA 1QFPA 3MRCB 3FRUB 1Y18A 2NXZC 2ID5A 3L3KA 1WICA 5ICYB 3L5XL 2NTFA 5J89A 2VLRB 2C7UB 4EDWH 3AS2A 3M45A 3BVNA 4NZTL 3O41B 1CDJA 1HYRC 4M1DL 5GS2D 3NZ8A 1NUNB 4G80B 4CDGC 4X4MA 4XNZB 3QJFB 4I18C 1IAOB 1J12A 4U0QB 4PBWD 5ISZD 5BOPA 1FAIL 5DA4A 4APQB 4PJCA 3B83A 2ADJB 4L8DB 1OTSD 4J3SA 3RBSA 1CICD 3U0WL 1DANU 1EXUA 5JNYA 1PSKH 4Y1AB 2J8UA 3UYRH 4NHUA 1J18A 4PJDA 3S34H 3OXRA 1DVFD 5D7JA 1KB9J 1NCWH 3FN0L 1FDLL 2DTML 4TSCH 5CUSH 1INDL 3JWOH 2F9BT 2R2HA 2OSLA 4AL8H 1SY6L 2YUZA 3WS6C 1U91A 2R2CA 1EAJA 4CL7A 4TQEH 3O9WD 2YEZB 2DM2A 4JRYA 3E3QE 4Q6IB 4W6XB 1QR1A 4J3WA 5IFAL 4EOWL 4XCYB 1IC7H 1X5GA 4IJ3C 3NCYP 2RCSH 1PEZA 1JPSH 4OZHE 2V2WB 1A6UH 2R1XB 2VLJE 3VXOB 1F58H 3P9MA 1UM6L 3HE6C 1U8QA 5B3JE 5KANG 3NN8B 1JMZA 1HOCA 3G5XB 4G6FB 2B5IB 5LGHL 4UT6H 3ULUF 2DBLL 4HKZB 1MWAA 1CD1B 3TN0C 2XKSA 3MOAL 4GKNA 3BDXA 4RQQB 1SM3L 4HULB 5IQ9A 2WBJB 2X6MA 4ESKA 2HRPL 1FBIL 3MV8E 5FUOL 3C5ZB 2F53D 4LVNB 4U1HB 1UCBL 2X9XA 2D03H 3TBWB 3VGFA 3X14B 1JNLL 1MNUL 5DEZA 4YDLB 3RVVD 1KEMH 1WZ1L 3MV9A 4JHWL 4BK5A 4FZEH 2BVPB 5I1KL 4PRBA 1MHCA 4F3FB 1QA9A 3T1WA 4JDZA 5EU7C 1AD0B 2AV1B 1ES0B 1FZOB 3GJFB 1RU9L 2QSCH 4TTDD 2D7QA 4MD5A 4KI5F 3DIFB 4PR5B 3IDGA 3CGTA 4YBQD 4QHLB 1KPUA 4OD1H 4WI7A 3TNMA 1JNHA 4Y5VB 5HHOE 1HWHB 3ECBB 3AB0B 5HJ3A 4QOKB 3JXAA 1CDUA 1EO8L 1T2QH 3QIWD 1SMAA 1KIRB 4QRUB 4Q0XL 1NGPL 1IAMA 4KMTH 1IEAA 1KLUB 5D1XA 4AQOA 4JLRA 3IDYB 1I1YA 4M1CD 1G0XA 1HHIB 3CMOH 4UQ3A 2H3NB 1NCAH 4EBQL 2V2XA 3A0OA 1YNKH 1QSED 1CN4A 4NQUA 5B22A 4H0GA 1T22B 4FFZL 3VXMA 4KJWD 4JFHE 3RGVC 4YZFF 5C0AB 5KG9A 2UZXB 1O7VA 4OKVB 3HR5B 1JUFA 5BVJA 1M6OA 1IGFL 1W72B 3TIDB 1OD9A 2WIIB 1URLA 3QIUB 4GRMB 4PJAB 3BESR 2AJZB 1G7HA 3CX2A 4JCMA 5E00B 3AS0A 5HYQA 2X05A 2O5ZH 1PX4A 3EHBD 5HHNA 1F4WL 2ADGA 1NCBL 1YMME 2OJZH 2VZ1A 2VMFA 3ZDZE 2CDFB 3FO2B 5JQHC 2M26A 2XA8L 4GXUM 4CADB 2PO6C 5FYKD 3MRBA 5T1DH 3S88H 3W9EA 1T5XB 2VLMD 3QAZB 5AYQA 1TXKA 2CIIB 2ZP0T 2XY1A 1VCAA 1BQSA 4XP9H 1UKQA 1WFUA 3AFLA 2WINA 2FGWL 2CR6A 4AZ8A 5F7DA 1SYSB 3HB3C 4QT5A 5BS0B 1F6FB 1PY9A 4CN6A 2V2TA 1U8LB 4PJHE 3AY4C 1IBGH 3CK0H 1NUDA 3WSQL 3E8UH 3QPXL 3KPPB 1S7TB 1NLBH 2DQTH 2ZCKL 4EI5A 4PRPB 1YY8A 4ODBD 4ZSOE 4GSDH 4IRZL 5DMIL 1RHFA 3BRFA 3OX8A 3WXVL 1Z9SA 2F5BL 4NKIL 1OSZA 3EBAA 2AK4D 1S7UB 4YO0B 5GRUH 4JDVA 4L1DA 3QFDA 2ZSWA 5AG8A 2YS4A 1RZ8A 3P4LA 4U1NB 4MVBC 3GB7A 1TTFA 5I1EH 4ZMAT 1HSAA 2GYSA 2YBRA 1HYSC 5DSCB 3ZYOA 1PKQA 4HMCA 1MIML 4PGCB 1R3LB 3TF7C 1UB6A 4AG4H 1MRCL 5KN5B 2D7PA 1WCBB 4HK3N 3O81A 5HI3C 3U46A 4X9HA 2HLFD 2ORBH 3HPJA 2XRAL 1FVDB 1K5NA 3RVXC 2XNAB 5EOCL 2MKWA 35C8H 3UBXI 5HPMA 1BLNB 3ARBC 1Q0XH 1CXLA 3I02B 3IFOB 3B2VL 4FP8L 1BEYL 4WGVB 5DHVA 1NAML 2NY1C 1VERA 1F2XK 5DJAB 2FIKA 1X5JA 1R0AL 5B38G 5IVZB 5D7LB 4XBGA 3HE6D 1NJ9A 5HYSA 4QF1B 2BSED 3RY5A 2UYLB 2ITCB 3D18A 1HQRA 3LRSA 3SDAC 4JQXA 2P43B 4S0SD 2JTDA 4M8QB 5KVEL 3KDMA 3C8HA 2YRPA 1S3KL 1UM6H 3I2CH 4BA8A 1BBJA 4FXGA 1IAIL 3TLRA 4F7MB 4S1RL 3T3ME 1DE4A 2ICEA 3PDGA 2DBLH 4BUGA 4QYOA 4O51B 3MOAH 3H7BB 1FNFA 4RBPK 3GK8L 1QRNE 4KUCD 5MENA 1KTDA 3V4PH 3VD9A 4YAQB 5D7IB 1S7XB 4X7SL 2B1AH 4NZUL 1UT9A 3SDCB 1IMHC 1MCPH 2W1NA 5F8RC 4JFED 1YPZB 3MNVA 3RNKA 5EB9A 1G7LA 1Q72H 1JNLH 4WTXA 3CLFH 4MDIB 4JFPA 2IFFL 2YXFA 5HHQA 1OGTB 1RHHA 5E70A 2XZQH 3QEGH 4XT1C 4ZAKB 2YR3A 3WE6B 1XGYL 2H2PC 1P2CB 4X6EB 1ORQA 5HSFA 4RAVA 1I1AD 4XNYH 4XC3L 4Y16B 3PJSB 2AQ1A 1RZFH 2FO4B 1RU9H 1DZBA 4JRXE 4TNWF 1P7KB 5GGSB 1Z2KA 3K1DA 3QA3A 3LPGA 4JB9H 4OV6F 4AIXA 5JOEA 5MP6H 3PNWB 2IWGA 5E6YA 1OWRM 4AIZB 2FWOA 1GCFA 1YJDC 4OJFH 4PTTA 1INQB 4UTBL 2J12B 1G7IA 3M17A 3S9DB 3LKSB 4HS6B 4MA7L 1IGCH 3LQAL 3TM6A 1I7TA 4UB0L 4RWYL 4TVPL 3RL2A 2ZUQC 2FLRT 4KRPD 3INUL 3RGVD 4BUHA 1I1FA 4H8WC 1JF6A 3AXLA 4UIKH 2FR4A 1GAFL 3FO0H 5EO1A 3WD5L 1NEUA 4Q58C 5F97E 1IEBA 1I1RA 4U0RB 2DJSA 3FQWB 4F33B 3EJJX 1K3IA 2WW8A 2VLRE 4LCUB 2UWEB 1UWGH 3B9KD 4HKJB 4KUZH 4QXTB 1IGFH 1QTYT 3VGAC 3D25B 1RUPL 2BNQB 2VUYA 1W0WB 4BSJA 5EBMB 5ERWA 3X11B 3HFMH 2MOVA 5F3BB 2J3SA 2PO6D 1FNSH 4OD3L 1T5WA 1OAYH 3LEVL 4J3OC 3KJ6H 2HFTA 1BGXH 3JV5A 4HT1H 5T5FL 5F6IB 4XNQA 2NLJB 4NSKA 3LN5A 4Y1AE 5MEQA 4WFFE 3TO4B 1XGQB 3M8OH 4JPWL 1M05B 4OIAA 2IGFL 3TYFB 3MSPA 5E94B 1ZGLA 2R23B 4KPHL 2BMKA 2J6EL 2W65B 2B4CC 5DYOB 4NJAL 4MAUH 3GBMH 3HB3D 5DC9B 6FABL 4XNXL 3QHZH 4L3ED 4LCYB 2OI9C 3GEWB 3NCBB 1NFIA 2I9LB 1ULVA 2JB5H 4NO0D 5D1QC 1WWAX 1FIEA 4OZGF 3DRTB 1KGCE 4PP2A 2RFXB 4K7PL 1RJCA 4L4TB 5F71A 4LSSH 4DCQB 4XNMA 2XWBB 4MQXC 3FQUA 3VFNB 1YEEL 2ZCKH 4S0TD 2APBA 4DZ8A 4H25B 3WLBA 5AD0A 3ZYJA 4MVBD 3U79A 1A3QA 3WIHL 5IW6B 5C07A 1HYSD 5IOPB 4ODTH 3FN3A 2F5BH 4NKIH 4X5XA 3BSZH 5CIPB 5H94B 4IIQB 1ITBB 1JF1B 2OK0L 1RZKH 4LGSB 1GZQB 3ARXA 4P59H 2EE3A 2VE6B 4HWBL 2XZZA 1E4XH 2CMRL 2Y7QA 1KUMA 5C6TH 4TSBL 4HH9A 1HH6A 3BWAB 3TH4T 1ZA6B 3B9AA 1Q0YL 1U36A 4XP1H 5A16A 5IEHB 4FFVC 3ZKXB 2WUCL 5DD3L 5DEGB 4G6MH 2YD9A 3NA9L 3T3PF 1G9MC 3GKWL 4JREB 1B0GB 3EO9L 4OB5L 2IBGA 5JMOC 4CVXA 2VLJD 1ZVSB 4U1KB 1UENA 4WI3A 5KSAC 3VFMB 4A6YL 5LKNA 3P4OA 4HWZB 1X4YA 3CC5B 2G9HB 3NFNA 1IM9A 5KOVC 4FP8H 2N56A 3REWB 1N3NA 1FL5B 4N8VB 4QOKE 1F97A 2BZDA 2Z4QB 3NCCB 3SDAD 1NAMH 1C7TA 5F1OB 4X99B 2P8LA 2BSTB 5TF1L 4YXHL 3QWQB 1MH5A 3X17A 2J5LB 4G6KL 1KXTB 2GCYB 4R96A 3PHQB 5LGKA 2DM7A 1DQQA 5EU6B 2HJFB 4G7YH 5FK9A 2B2XL 4LIQE 1BVZA 1ED3A 5C0BB 4OZHF 4E5XB 2D9CA 3GHBH 5I1LB 5J11B 3NCJL 3Q6GL 3QG7L 2AAVA 2VZOA 3MGOA 4JZNA 7FABH 5C0AE 4PG9A 4G7VH 3ARVA 4ZPVB 1FFPA 1X7QB 4DGIH 4F9PC 3D6GA 5DJZA 5DQ9A 5CBAB 2Y23A 4FQXC 3PV7A 3VH8B 1MJ8H 2YRLA 3HMXL 4K55A 3SDXB 1BIHA 4PJAE 2YWZA 3U7AA 1WISA 3LKOB 3OMZA 3BGFB 4RMVA 3ROOB 4M7KL 2H2PD 2DLGA 3SO3B 4TNWK 4R0LC 2VQTA 1Y18B 3L3KB 2NTFB 1QZ1A 5E2WH 1YA5A 1G7MB 1U3HB 3MBED 3MTRA 1H3XA 4WHYH 4OGXH 3VWKA 3VFUA 5I74C 3OAZH 2LTQC 5D72L 4HGWA 1OF2A 4ELMF 3C9NA 3RVWC 4XC3H 4P2OA 4QRSA 4R2GC 3MRMA 5C92A 2XXCB 1LK2A 2EYSA 2R2BA 3DURA 5JXAL 3HAEB 3N9GL 4FFYH 4X7TA 5E1HB 5JOFA 5FM4A 5ITFB 4MSWB 5C2BL 4JFHD 3MNZA 2H1PL 1TZHB 4JY4A 5JNYB 1WEJH 3GBNH 1MFDL 2J8UB 5DFTA 5BS0E 3L5IA 3P0VL 4QHMA 3OXRB 5D7JB 1RURL 4R7NB 5T3ZE 4FTVA 3SY0A 1BF2A 3AC0A 4JVUA 5FOBA 2R2HB 1S8DA 2OSLB 2DQHH 3T0XA 1U91B 4PRPE 4G3YL 1CI5A 1FG2A 1J0YA 4JRYB 1IILE 1QR1B 1BBDH 4XMKL 5KSVA 2Z92A 3UXFA 4QY8A 1AGBA 4NQEA 4LSUH 2YD2A 4APQC 8CGTA 1BWMA 1AD9B 3P9MB 1NBQA 2VAJA 5IHZA 1U8QB 3FMGH 4WDIB 5FUZH 1S9VB 1G7PB 1HHHA 3LHPL 2P49B 4LVHC 1P7HL 1MWAB 2CGRL 4GXVH 4GKNB 4OTXL 2PW2A 4ETYA 4PJGA 2CUMA 2RHEA 5IQ9B 4K2UL 3UMTA 3ZDZF 2PCPA 5GPRA 1AO7A 1JGLL 5FGCB 1VHPA 4GAFB 2P1YA 2GJ6B 4U7SA 1MHHA 1J0IA 3IYLW 4ODUA 4X6BB 3MLVL 1NC4A 1I85A 3U30B 1CTNA 2L0DA 4JFYB 5E7BA 3C2AL 1WFNA 1JPGA 3TBVA 4BQ8A 4PRBB 3ZL4L 3ZSTA 3B5HA 1QA9B 3C6LB 3C60B 5D7LE 3OF6A 4PRAB 4W4OA 2B5IC 4RAUA 4YDIH 2FX8H 4MD5B 4UIMA 1KC5H 3IDGB 1B6DA 5D1ZC 5GS2H 1OTTC 1KPUB 2F58H 3TNMB 5KANI 4NP4H 4PJHF 5E6ZA 5HJ3B 5M7QA 5IT2L 5I9QC 2DQGH 4DKEL 3BFOA 1WIOA 2NMSA 4M6ML 3ARSA 1RJLA 1SVZA 3P30L 2R0LH 4M7LH 12E8L 3T0VA 1ZVYA 3WIHH 3BEVA 1DUYA 3WFCH 4PG2A 4P9ML 1IEAB 1S5IH 1X5LA 4GAJL 3UAJD 4H5SA 2JIXD 3BN3B 3KPRA 1FYTA 1XGPA 2HTLC 4JLRB 4P23A 1KJVA 2IMNA 4MNQA 5D7IE 3RWGA 3RWEB 3MLTA 2A6IB 5DC4B 3H8NA 2VDQL 4FFVD 2V2XB 1YPZE 5HXMA 3OB8A 1U42A 3VXMB 1I7UA 2OQJA 4NKOA 3UBXA 5I6XB 3S37L 3SKJH 3VFSA 3CZFA 1OP5K 2D31A 4YQXH 5IB5A 1M6OB 1PKOA 3ARDA 1RI8A 3ESVF 1RVFH 3AB0C 5I8EA 3NIDE 2A1WL 1MQKH 1G7HB 3G6DL 5HYQB 5C0EA 3GO1L 4A6YH 5HHNB 2ADGB 5GS1A 3K1KC 3IJSA 3WMSA 1YEHH 2NCMA 1UWXH 2OZ4H 1DCLA 1ZGLM 1EHAA 4HH8A 1UCTA 5JO5A 2VL4A 2YA1A 1IC5H 3TV3L 5BRZD 4GQ9H 4YIQA 1SYVA 1ZEAL 1FRGH 2A6KA 3W39A 1HIML 3MOBL 4FQXD 5IFJA 1DBKL 2WINB 4KH2A 1ZTXH 3QG7H 4PJFA 4PRHD 4QT5B 3T3MF 5HDQH 2V2TB 4AJ0A 2UWEE 2VKXA 4I3SL 1UYWL 2OP4L 4XWGH 4M61A 2BNQE 4EI5B 1S5HA 2JJTC 1YY8B 2UV3A 5CEZL 1YQ2A 3ET9F 2XT1B 5FA3A 5ACMA 2FNBA 3OX8B 5K93A 3WJLA 4A2MA 4JDVB 3QFDB 2ZSWB 3NIGE 1PJ9A 2Y72A 4YEFA 5E4IA 2D7TH 4R6UA 4EVNA 4M48L 5EOQL 2YBRB 2C1OA 2Y25A 4UOW0 4ZO6A 1PKQB 1KCSL 2XN9D 1UB6B 2W38A 1SBSH 4X9GA 5HGDA 5CLWA 1NDGA 2DD8L 5FAAA 5IB2A 3G6JA 3VRJA 2VLRD 2D4FA 3U46B 3HPJB 2EIZA 3HI1A 1K5NB 1FGNL 1BQLL 1JYVA 1MJUL 2RBLA 1VGKA 3LS4L 3MZGB 4L4TE 1AXTL 1F4YL 5DI8A 1MELA 2ADIB 1QFUH 4WHCA 4M6AA 2NNAA 2XPGA 5HHXL 3MR9B 5KZCD 4HLZH 5SWSA 3QH3A 3VMOA 5DZOA 3UTTA 4LOUC 4M9OA 5DHVB 3AREA 1G1CA 4KQ4H 1NMAL 1AFVL 4HQQH 2EEDA 2AJXH 2NY3B 3O4LB 2FIKB 4MNHA 2R15A 3STZA 5ADPH 5GGVH 2BNUA 2FX9H 3OGCA 4YHLL 1LEGA 1NJ9B 5HYSB 3H9SA 5L2JA 1Y6KR 5FYKH 3D18B 4YFLI 1HQRB 4PJ7A 3LRSB 3ISWA 1J8HD 1IAKA 2EDWA 4MD0A 5GISL 2LAAA 1CFVL 3KDMB 1GGIH 3C6SA 1T83A 1ZANL 4UQ2A 5HY9A 4FXGB 3EJYD 1F13A 1IGML 3P0GB 5CZVH 5DD1H 2PKDA 3LHPH 1NFDA 3SE3A 3QDGB 4HWNA 3VGEA 3B2UC 4RISH 4OFIA 3TJEL 4QYOB 2B39A 3HCVB 4OUOA 1JK8A 4OTXH 4YHYC 4D0CB 1NMBL 2GQHA 4LHQB 5MENB 1KTDB 4K3DH 5DEFA 1X3DA 2BX5A 3D3VD 5T1KD 3JV6A 2PYFA 1TITA 5FYLD 1K8DA 5F89A 1EIBA 1DANT 3B9VA 3CD4A 2VXSH 3MNVB 1MCLA 3UX9B 2W60B 3RNKB 1G7LB 1T03L 3QXVA 4O02L 2PTTA 4G6FD 4JFPB 4K3JH 5HHQB 4NO5A 4MAYB 4XPHL 1RHHB 4GRWH 1I8IA 1JPFA 1MCJA 5D1ZD 4HC1H 1OTTD 3LS5H 4JPIA 4QRPA 2JJSC 3O2WL 5GSVA 1ORQB 2QQLL 3CSYA 4RAVB 5ITBL 2NXYD 2MHAA 4LQ1A 1EFQA 1V7MH 4O4YH 3QA3B 5EU6E 1AQKL 1E6JL 5ACZA 2EIDA 3CVHL 3KS0J 5C0BE 5JDSB 3SE4C 3MLYH 2FWOB 4PTTB 3O4OB 2HTLD 4YC2C 3SDCC 4MJ4A 5J1AA 1XGUA 4LAQH 4G5ZL 1MCDA 1I7TB 4YBLC 7CGTA 1FN4B 3RL2B 1N64L 4XGZA 5GGSY 3SDXE 3H9HA 3CXDL 2VLKA 1F45A 1LO2H 4ODVH 1QLFA 3UC0L 1MRDL 3AXLB 1X5HA 1OAQH 3DGGA 2VZVA 2Q8BL 3KYKH 3LN9A 2MSPA 4Y16C 1IEBB 3BZ4A 4EN3C 1KEGL 4OZFH 2UVEA 4UT7L 1LP9A 3HC3L 3SEPA 1AGFA 2JJVA 4Y4HB 3GKZA 3KLHC 2QADC 3BKMH 1UA6H 4QHNA 4X4ME 3IXAA 5ERWB 2PTVA 1HI6A 5ICXB 3G6DH 4AEIH 4MCYA 1T5WB 1F3RB 2DLEA 4U1JA 1MI5D 4WEBH 4NSKB 2PXYA 3LN5B 3TFKC 5TE4L 5MEQB 2J8UE 1JI2A 3KHOA 1QO3A 3C5SB 2APWA 3OGOE 3SDYL 4P57B 3O6FA 3LD8C 4BQ9A 3RDTA 4LSRH 4ALAL 1ZGLB 3T1FA 4JR9L 3EDFA 32C2A 3QYCA 2BMKB 4OLXL 4JANB 1FVCA 4KAQH 1K2DA 2APVA 3JTTA 3EOBB 1NFIB 1ZLVK 4JRYE 2QLVB 1NAMA 5DLMH 1MFCL 5E95B 1JWMA 4PP2B 4YWGL 1U95A 1A6AA 5IHBA 4I3SH 3VRLF 2J88L 1J1XL 1NPUA 1TJHL 3CFEA 5CEYA 5DRXA 4Q6YA 1MFBH 3MUZ1 3TO4C 4DZ8B 3WLBB 5AD0B 1FORH 1JGUH 1ZVHA 4PJXF 3WUZA 2AJYL 3PP4L 5C07B 3IT8D 1YN7A 4LNRB 2DLTA 4X5XB 4JQIL 4M7JH 5BS0D 3KPNA 4H8WL 1WK0A 5D2NB 5DRWA 3UDWA 1E28A 4UV7H 3CLEL 3NZHL 2JELH 5EUKA 5FGCE 4J8RB 1LK3L 2GJ6E 1N59A 1D5ZA 3TPUA 4JN2A 4HUVA 2Y7QB 2VOTA 4NCDA 1T0MA 5DF0A 3BXNA 2E7MA 1HH6B 4HH9B 3BJLA 5F7EH 5A16B 4YXKL 1KJ2L 5ICZA 2E8YA 4ENEC 4QLRA 2OL3L 4MXWH 4LOUD 2QL1A 4GW4A 2YD4A 4CVXB 4MJID 2XKUA 5F9JA 2DYPB 1BM3H 3QUXD 3RGHA 3U4BL 2B1HH 4PY8J 1WSST 3P4OB 3QO1A 3RWFB 5C71A 5FO9B 3QQ3A 4Z7VB 1A1NA 3KR3H 1IM9B 1C16A 1N3NB 4I2XB 1NMAH 1TJIL 1J86A 2P8LB 3KYNB 2B4CL 4JG1H 5EWIH 5KVDL 4MA3A 2HT4C 3B2UD 1DQQB 3RNQA 1A9BA 1K8IA 4AMKL 5FK9B 3U7YL 5DJCB 2ED9A 3ZKXC 1IQDA 1ED3B 1CD8A 1OAKL 3TBTB 2A83A 3HE7A 4X0KA 4JREC 4HS8H 2IALA 1NGYA 3VXME 4JZNB 3W9DA 1WBXA 4PG9B 4FS0A 1D9KA 5KJRL 4QNPE 1FFPB 1AH1A 4WHTA 1V5JA 1DFBH 5DJZB 5DQ9B 4Q7DA 4LSTH 1CK0L 1IC4H 4HJJL 3I3EA 5ESVA 5I18L 3Q1SL 1A6ZB 1RPQA 5IHUL 3NCYS 2J5LC 4I0KA 4MDJA 3ULVC 1T03H 1E4KA 3MC0A 1G9NH 4WU5A 3ZZ1A 5JW3H 4XPHH 3O45A 3MLZL 4JM2A 3UTQB 3VFUB 4B41A 2QQLH 1QQDB 1OF2B 1T2XA 4HGWB 5I16A 1EEZA 2LE9A 1WAAF 1GH7A 4O5LL 4P2OB 3MRMB 1HKFA 3CX5J 4F80A 1LK2B 2EYSB 4FQ2L 2R2BB 3DURB 1AQKH 4U1IB 2FL5A 4X7TB 5JOFB 2BHZA 2BNRA 4C4KT 1K85A 3MNZB 4JVPA 2CR3A 2VZUA 4JY4B 5EO9B 2VQ1A 4O9HL 3BGFC 4P2QB 5E8PA 3MROA 4XVTL 1EMTH 3W0WB 4ZFOB 4F57H 5I1GH 4QHMB 1HKLH 2YZ1A 5EBWB 4FTVB 2F15A 3QDMD 4Y16D 1CE1L 1RUML 5FIEA 1S8DB 4XP5L 1U3HC 3V4VH 1DJSA 1JHLL 2QBWA 4HMEA 4Z76A 4EN3D 2HFFA 5LBSH 5J7CC 4FZ8L 4F15B 4M5ZH 2Q8BH 1ADQH 5ISZA 1CFTB 4JO1L 3KLHD 5KSVB 2QADD 3GNML 3WIHA 1ITCA 2BY3A 4J4PC 4CRPA 4QY8B 1PQZB 1AGBB 1KEGH 4NQEB 3L3GB 4UT7H 2IMMA 1TVHA 1RIHL 2ZUSA 1MLBA 4TULL 1DVFA 4OCLC 4ODWA 4F2MB 3F7VA 3KPSB 1FNEA 2K3TA 5E2TH 3TFKD 2JJWA 1PKQE 2AJVL 3C8DA 5CHNA 1U93A 2DQEH 3T0WA 3HC0A 5IK3A 3PWJB 1B3JA 5D7JC 5F44A 4EQ3A 3O9WA 1C5CL 2DL2A 2EDRA 2O5XL 3G5ZA 2C3WA 5DJ2A 2PCPB 2AJSH 5TE4H 3PL6D 1AO7B 1NCUA 1MHHB 1J0HA 4AH2B 4RWHA 1KFAL 4ODUB 5F70A 4CNIA 1FZJA 5KSUA 1NC4B 4IRSC 4A6YA 4OGYL 2AJUL 5L9DH 4LPXA 3BPNB 1JPGB 3L7FA 3TBVB 1H8OA 1UKTA 2Y5EA 3O4LE 3HNTL 5D6DC 1BJMA 1CFQA 2DQJH 5F9DC 2VRAA 2OZ4A 2X4PB 4FNLL 3V52H 4C83A 2ADFL 3SJVD 5IR1B 2DAVA 4HAFA 4RAUB 4ZUUA 3R4DA 2JCCF 3NPSB 4XCFH 5I19L 1YJDH 2UWEF 2F53A 4MCZA 5DMGC 3TNNA 4Z5RB 2RAMA 4WI8A 3FTGA 3PXJA 1TJGH 5I1JL 1JNNL 1AHWA 3DXAB 1P9MA 1FVEA 1BFOB 1RJLB 3QDGE 4XC1H 5DURD 1R5IA 3BZDA 2ICWJ 3BJ91 3BEVB 3BH9B 3U30C 4H5SB 4TRPL 1EA9C 5D5MA 5MENE 3KPRB 4NM8H 1NLDH 1FYTB 4DAGH 4P23B 1KJVB 4MNQB 4KROC 3RWGB 1H0DA 3MLTB 4H0IA 1J1PL 3C6LC 2QEJA 2WUBL 3C60C 4QRQB 4XMPH 4ENED 4UTAH 2NW3A 1G6RH 4NHCL 3I6LE 4HPOL 2WQ8A 4UU9A 1I7UB 2OQJB 4KKBC 4NKOB 3UBXB 3NAAL 5IMMB 3VFSB 1N7ML 3CZFB 4ZS7H 3WN5C 3N85L 2D31B 3MGTA 3QIWA 5IB5B 3ARDB 3MCLH 4AM0A 1KJ2H 4EJ1C 1XR9A 2LAGB 4PRIB 3VCLA 2AABH 1U0QA 2CJUH 2EE9A 3LEYL 4Z7WE 3V0WL 4LLDB 2FJHA 4J23A 1JPTH 3GZKA 5C0EB 3KYMA 1CLOL 3KGRA 1FIGH 2DKMA 2Q7YA 1PBYA 3O2DH 5CBEA 1A6PA 5GS1B 1QSEA 1I3VA 3IJSB 2HT4D 3ZDYE 2QQNL 2IBZX 2VC2L 2EEBA 2HAZA 1GIGL 1DLFH 2F19H 3Q6FA 4CVWA 5C0FA 1NBVL 2IJ0C 4NZRL 1PW3A 3H7LA 3MO1A 5JO5B 5EFIA 2RJMA 3ZKMC 5EBLA 4ZUSA 4OFVA 2KQNA 1ZLSH 2HLAA 5I6XC 5JDJA 3QCUH 5IJVB 2BVQA 4E41B 1D5XA 3E2HB 2DLFH 2X4UA 4QHUA 3HS0A 1IL1A 3IDUA 3LQZA 3RP1A 3LAFA 4PJFB 3MCG1 2F54D 3ULVD 3E6HB 2YPKA 3LRHA 4CMMA 4A2LA 3E1F1 5FECA 3TPKA 4G6JL 4M61B 4MB3A 1CK0H 3UTZA 3V9FA 3IF1A 4LKXA 4G6AC 3MLXH 4DOHB 1HHKA 1I8LC 4OCSH 2DKUA 4HJ0C 2C4FT 4OLYL 4X6DA 5JHDB 5FA3B 5A43C 2DF3A 4WNQA 5AZEH 3H3BC 3U9UA 5GS3A 1BFTA 1L7IH 3RIFF 3JWDC 5JZ7C 1BZ9B 1T4KB 5GZND 3EDEA 1T1ZA 3MLZH 3WEXA 4O2CA 4EVNB 1ZOXA 3GSUB 4HCRL 2G5BA 2ATPB 2C1OB 4JKKA 4LK4A 1BFSA 5GGRB 4ZTOL 4BSVA 3SDDD 3VI4E 1ODAA 3L3HA 4FN0A 1G9MH 5IB2B 3QEUA 4NQTA 4HV8A 3VRJB 4JKWA 4HC1A 1A7RL 1U3HD 5IGXL 3HI1B 2AK4A 3VXQA 1BQHA 2DI8A 4I0PC 4I18A 1WF5A 3GI9H 4YHPA 2PYEB 5LQBH 1VGKB 3QQNA 4ODXA 3WL9B 3W5MA 5HPOA 2NNAB 2QJDA 3T0EC 2XPGB 5FYJU 3TT1L 4LIQL 4J4PD 3V5DA 4JZJC 3QH3B 4XP5H 5SWSB 1ZLUH 3UTTB 3X12B 4FXKA 4WGWB 3SDXF 3AREB 1RULH 1CVSC 4G9FD 1A3LH 5ANMB 5C6WH 1J5OH 4NRXA 3BZEA 3OB0H 3HHRB 3STZB 3RJDA 2BNUB 3OGCB 5C07E 1LEGB 3ZHLA 1FYHB 3T0DA 3D69A 3H9SB 2CD0A 1W72L 5L2JB 3WS6A 2YD8A 4DZBA 5H2BA 1KF9B 5D2NE 4N8VG 5ID1A 2XQYG 3WFEH 2FBOJ 2NQCA 1QP1A 1OY3B 3HZKA 4OCXH 4UQ2B 2O26U 5HY9B 1QKZL 2DQIH 4HHAB 1SJHB 5HHPB 1CT8B 5BVPH 4UNVA 3UJTL 3BH8A 4YHIA 4XPFH 4HWEH 1QBLL 1GYAA 4X7FC 4U7KA 1T21A 4RNRA 1JK8B 2CLRA 3CSBA 2BSRA 4K3EL 2XQBL 4J6RH 2FSEA 5IESH 2BERA 3F5WA 1YYLH 4OZFA 4IRSD 3HE6A 4WJ5A 4PJCF 2PYFB 5IB1A 2MCG1 1EJOL 1K8DB 4DEPB 5F89B 2NY3C 1OB1A 1CQYA 1F6LL 4LLQB 2J8UF 5I8KL 3MV7B 8FABA 4PJDF 1X5FA 1XF4B 2PTTB 3D85D 1CTOA 3S35L 4Z7VE 5IIEA 1KCKA 4XVSL 3VH8G 2X4QA 1CR9H 4ONGL 3SKNA 1X6LA 4I2XE 5AYUL 1I8IB 1JPFB 5EG6C 1CU4L 3HNTH 1Z5LB 4JPIB 3OR6A 4QRPB 5DMGD 5GSVB 1XEDA 1SJXA 2NYYD 2MHAB 4HXBL 5T3ZL 1KCUL 2GJ6D 5HVGB 3TVMC 2FZ3A 3ETBF 5ACZB 3QEHA 5TQ0L 4JFEA 1P4BH 5T3XD 4KROD 2ESVB 1XGUB 3C6LD 4ZTPL 4U1SA 3TYGL 1MREH 2QHLA 3C60D 1I7ZB 2AEWA 3HAEG 3FQRA 3NFPA 5FCUL 4DFIA 3H9HB 4MAYC 1DN0B 4KKBD 4C54A 2PN5A 2VLKB 1J11A 3B9DA 2JB6A 1AJ7L 3DGGB 5TDNB 1E6OH 3QCTL 3ARWA 5KS9A 1Y6NR 4HPOH 2B7DT 2G2RA 1QHOA 3L3JB 3BZ4B 4IDJL 4R9HA 4X9IA 4Q9RL 5DGRA 3UTPD 2BFVH 1LP9B 2BJMH 5JA9A 2Y4SA 3PQYB 2AEPH 3DYPA 3O4OC 2IG2H 1EHLH 1JZ2A 4QHNB 2Z93B 3IXAB 1MSPA 1FFRA 2UZIL 1HI6B 3RGVA 2M8XA 4MCYB 1N6VA 4XH2A 4CN1A 4MNGE 5FV2A 3MBXH 5LWYL 3MA9H 2EYRB 2AXJA 2PXYB 1Q38A 3R1GL 4CVUA 15C8L 2LFGA 1QO3B 4P2QE 2H9GA 1BD2D 3ZE2F 5CMAA 3W0WE 4OLUL 3RDTB 3T1FB 5D7KE 4FTVE 3KPOB 5FYLH 32C2B 4YDKH 3MA7A 3STLA 1FVCB 1K2DB 3IU4L 1MVUA 1F3JA 1QBAA 3JTTB 2PO6A 2YC1B 4Y4HC 3P9LA 3HZMA 1DQLL 1N6QL 1IQWH 3PWUB 3KNBB 5EZLA 4BSWA 3NGBB 3FQTA 1JTOA 2NZ9C 4G6AD 1DBAL 1JWMB 2WZPD 3RIFK 3V4UL 3U1SH 5KVMC 4NQEE 4TN9A 3CH1A 3EZ8A 3CFEB 5CEYB 1JZ5A 4DQOL 5DRXB 2K7QA 5JZ7D 1KOAA 4BM7A 3MUJA 3KPSE 2DWDA 3T4AA 3I50L 3PGCA 4L3EA 2E7CA 1UGNA 2WLYA 3AY4A 3TH2T 3WFDL 1YN7B 3DUSA 4NO0A 3WYRA 1V8HA 2VZSA 4CMHC 1LGVA 1JGDB 1UVQA 2EDTA 4LVEA 4PJBA 4YX2H 1E28B 1AO7E 4L3AA 2GSIB 1OP9A 4Y5XC 3WKMH 5DK2A 4HCRH 1N59B 1D5ZB 1RZGB 3O3AA 3RKDD 4JN2B 5EZOL 3TPUB 1P7QD 1JHTA 4HUVB 4I0PD 1T0MB 3BO8A 4FQIL 2GFBA 3BXNB 5CD5C 1FQ9C 1CGYA 4IOIA 3T0ED 5ICZB 2P7TB 3MXVL 4AEHH 5E2UL 3ZTJG 1CDIA 5I17A 4JFDD 4GW4B 1T1YB 4QXGL 5EZJA 4NUJB 1P53A 4P5MA 4NZDA 3QO1B 1A1NB 1D6VH 1RV6X 2K1MA 4UT9L 1XIWC 3CVHA 5E99H 5D2NC 4EIZC 1JWUA 3DXAE 3BGMB 2GAZA 1XMWA 2OXHA 3LN4B 1RSFA 3VWJB 3BQUB 4LRNL 5D8JL 3SGEH 3KPRE 4HF5L 5BJTA 1FYTE 5MEPA 3RNQB 4MNQE 1K8IB 2HH0H 2VLJA 5DA0B 3MRFB 4X80L 1IQDB 1LNUA 1DQDL 1FNGA 3HE7B 4X0KB 2YN3A 4I77H 2X9WA 4KMLB 1NGYB 1QKZH 3BP6A 1ADQA 3O4LD 2NY3D 5CWSA 1M7DA 5GGTH 1D9KB 3SDAA 3A6OA 5IBTL 3GSVA 1MLCA 1OSPL 4WHTB 5CJQL 1Y6MR 4P46C 5HHMB 3CXHK 2ZOKA 4Y2DB 2BSSA 4PRIE 1EJOH 1QSFD 4RMUA 5ESVB 4GT7A 2R39A 4FFWC 4WTZA 3SQOL 2BY1A 2VDLL 4MDJB 3SGEI 3MMEA 4M6NL 2VN7A 4NGHL 4WU5B 4YHNB 2EC8A 3QDGD 3F6LA 1MCBA 43C9A 3QUZB 3TVMD 5AYUH 4JM2B 4X4XA 5L7XH 1CU4H 2VISB 3RY4A 2BDNL 4P5KB 5I16B 5ALBH 1EEZB 1I9RL 4HIXH 4KVCL 3FZUC 4YFDB 1O0VA 4P4KB 3NCEB 3TWCL 4E41E 3GMOA 2VZTA 1B2WL 5DUML 3O6ML 3TH3T 3U0TB 4KKAD 4ZD3L 2VQ1B 3NBNA 1BAFL 3ZSSA 1A7OH 1YNLH 3CU7A 4XTRC 5E8PB 4JFFD 4PJFE 5FDYA 4LVOB 3MBEA 4KC3B 3C2SA 4Y2OA 2WAHA 4ORGA 5J57B 5IEKA 4GKZA 1MCQA 2L7JA 3EZJB 4E42A 4LSVL 1IGJB 4GMTL 2HFFB 4DOHE 4RBPH 2AXGB 3GJEB 5JHDE 3DX9A 5ISZB 2MJWA 1A5FL 4KJYA 5I1DA 5HI5C 2EDYA 3QUMH 4P2OC 1EUTA 1CICB 5IVXF 4GW1B 3PGFH 3ARYA 3O8XB 1QPPA 1TVHB 4IM8A 5E8EA 4D8PB 1MLBB 1ZHNA 1TMCB 2GJJA 1WFTA 3ZHKA 4ODWB 1Z9LA 4Q9CA 3MJ8B 3F7VB 1FNEB 4WY7H 5CHNB 1U93B 3QCVL 5HYSG 3HC0B 3V6ZB 5IK3B 4D94A 4B50A 3LRGA 2IQ9H 2R2EB 1QD0A 1Q9LA 4NC0B 4RMTA 3KS0H 3O9WB 5JPNB 4LPUA 3V7MA 2A74A 1WBYA 1U8NA 5DJ2B 2MQCA 1KJ2A 3ARPA 4MB5A 5E5UB 4F15C 2PYEE 1C5BL 4TUKL 4Y4HD 4CU7A 5TQ2H 3P11H 2N4IA 4CNIB 1FZJB 2X1OA 1II4E 3SE8L 2P46B 4A6YB 1X9QA 5SWSE 1RZIA 2OR7A 3UTTE 1HWGB 3L7FB 4JZOA 1MEXH 5ANME 4JM4L 1CFQB 1A8JH 3MACL 3NIFE 4TTGA 4HBCH 3MRPA 1FG9C 4X4YA 4C83B 2X10A 1IKFH 2N1KA 4FQPA 5FA4A 1F02I 5IVNA 3MXWL 1XF2A 4MCZB 3TNNB 3DX8A 3FTGB 4MQ7B 4W81A 4P9HC 1AHWB 4L5FL 2GK0A 1UADC 1MCKA 1T89C 3I50H 3WO3B 1R5IB 3VI3E 3FONA 3MJ6A 2XG5A 1Q9KA 3OAUL 5D5MB 2J4WH 2I5YH 4ODHH 3MUHL 3MV01 3QBTB 2ZKHL 5CD5D 3C87A 1H0DB 5E4EC 2IANB 4NN6B 5KVGL 4HKXA 4OCNC 3MV7E 3RUGA 1MHPL 2GSGB 2NW3B 2IH3A 3HI6L 4W4NA 1JV5B 4U6HA 4OFDA 3NPSC 3S5LA 1B0RA 1UM4L 3QIWB 5GRXG 3MGTB 3VI4F 4QRPE 3VXRD 1PLGH 4XP4L 4QTIL 1CL7H 1JYNA 1XR9B 1XIWD 1CBVL 1CXKA 1ORSA 2JIXA 4Z7NF 2FJHB 1MIEH 4UINL 4WV1B 5M95B 4PPTA 2MPAL 5IB3A 5B8CC 1QSEB 1A6TA 3MV11 1I3GL 3MLWL 5J13B 3WKNA 3RPKA 2ESVE 3FFCD 3CFJA 4OI9A 3RWHA 3BIKA 5FO7A 3Q6FB 1CIUA 3T8XB 2A6DA 1H15A 5EFIB 1WVZA 4OBRA 2DYPD 2HLAB 1A7QH 5D7SL 4Z77A 2VLKE 1CL7I 5ID0A 2ZNXA 1XZ0A 2BVQB 2W0PA 3SHSA 1D5XB 3OZ9H 4P46D 5IG7A 4Z7QF 3DO7A 1OQOA 2X4UB 4QHUB 3TT3H 5BMFH 5EC1A 1MWAL 1F90H 4FFWD 2EDJA 4PJEA 1OSPH 1LP9E 1QRNA 1WT5C 5ALCL 1BVKA 2YPKB 4NCC2 4I0CC 4CMMB 5HYJD 1DBBL 3PQYE 5JOPE 4MXVE 4X7DC 4L8CB 3UTZB 1JHKL 3A6CL 3DI2B 2CK0L 5BRZA 2C4XA 1UH4A 1ZAGA 4I48A 1P1ZA 1A7PL 5T3XL 4G8FB 3U9UB 4JKPH 4MXQC 4F9PA 1MCHA 4FQXA 1T2JA 3Q3GA 3RWDA 3TGXA 2KH2B 3FZUD 1TZGH 4XPAL 3CFKA 5MHSD 1T1ZB 4PRHA 4O2CB 3GMNA 3ORJA 3IFLL 2WQRA 3H0TA 2BRRL 3MLUL 1ZXQA 4HUUA 5BZWB 4LASL 4XTRD 1ND0A 4KVCH 4BSVB 3O2VL 2E6QA 3DTXA 4S11A 4R90H 3L3HB 1LDPL 3VXNA 3LB6C 3PGDB 1R5WB 1XCQB 3QEUB 4GRWB 1U58A 3ALXA 2ICES 4PY8I 2AK4B 3QHTC 1BQHB 5ESQA 4I18B 1QFWM 1B88A 4NKDB 4ODXB 4WI9A 1WTLA 2MQ0A 4OLZL 4WI5A 5HI5D 1C1EL 1F8TL 4LRIC 3WNLA 1CDHA 4KMQA 3V5DB 3ZT6A 1CD9B 4FXKB 4LPYA 3DRQA 4GMTH 2XN9A 4NRXB 3BZEB 1GGCH 1XH3A 5I8OL 3FRUA 5D70H 4D0BA 5JW5A 5ICYA 4N1EA 3I85A 4P2QD 2VLRA 2FBJL 1GGBL 3W0WD 4DZBB 5H2BB 4L4VB 3O41A 5ID1B 2DJUA 2BVOB 3HZKB 2E8ZA 2H2SD 3CU1A 3BEWA 3TC9A 3KPQA 5BXFA 1MCEA 4NC2B 1S7SB 2GT9A 4Y5YB 4D2NA 1OOAA 4X7EC 1L9MA 1NUGA 1T21B 2CLRB 2ADJA 1H3PL 2BSRB 3P9WB 4H0HB 2FSEB 4L8DA 5F6HJ 3F5WB 4OZFB 4NJ9L 3HE6B 3AREC 4NPYA 4HGKC 4RFNC 1OB1B 3ULVH 4JKLA 1J8HA 3JWDL 2W59A 5A2FA 8FABB 1TENA 1QRKA 2AGJH 3KPSD 3WUWA 2YRZA 2Z8SA 5IIEB 2X2YA 3MQIA 1MAMH 4W70A 4Z7UA 3BI9X 3SKNB 4Y0GA 4BZ2H 1J87A 2CO6B 5BV7H 2CUHA 1MVFA 1JP5A 3GIVA 1UXSA 4JAMA 5T1KA 3D3VA 3L6FA 3KPLA 1WZMA 1HINL 2FZ3B 3MXWH 3BMVA 4R4FL 1UG9A 4X5LA 1HZHL 4JFEB 1MFEL 4DEPC 2EE2A 1F5WA 3BDYH 3G5XA 3QRGL 2E6JA 4Z8FH 3O6KL 3X3GL 1DDHB 1NSNH 1RIUL 4HKZA 4U1SB 1T0PB 1CD1A 3QDHA 4JQVC 3O0RL 5L88L 5D1ZA 2V5RA 5TJWK 5JW4R 3FQRB 3NFPB 1JFQH 4RQQA 4DWHA 5TPWH 3OAUH 3TESA 3CNKA 4JPVL 3U2SA 3PP3H 1I1AB 4I1NB 2EZ0C 4KDTC 2ZKHH 4PJGF 2MWCA 5CINL 4Z0BH 2JB6B 3G9AB 2Y06L 5KS9B 1AI1H 2R9HC 2G2RB 3TA3C 3HI6H 2NY6D 5IW1A 5K59E 4KK9C 4LARL 4F3FA 3OKLB 3IDNA 3QXDA 1AD0A 1DBML 1YQVH 1UEYA 2DWEB 4F9LC 1ES0A 4PB9H 4HCRA 5AZ2H 4KRPB 3AS1A 3RGVB 5CSZB 1NCDH 4PR5A 2O61A 3BYYA 3L7EB 2FEEL 4GQPH 1P4IL 1NMCB 3ECBA 3P2TA 3WFBL 2R0WH 4JFQA 4R3SA 3K7UA 1MJ7H 1OVZA 4OZ4A 3RX7A 2ICCA 5CMAB 4HXAH 3B9KB 5AG9A 5DMKB 4PRID 5LCVL 1T3FA 3MA7B 5CS7A 1JZ7A 3WNOA 2NY4C 1MVUB 1OAZH 1F3JB 4XNUL 2H3NA 4TUJA 2PO6B 1SEBA 1KT2A 4IBLT 5IMKA 3HZMB 5ISZE 3CJJA 1T22A 5DT1L 5EZLB 4BSWB 3U6RA 3BT2L 4HEPG 4L9LB 1JVKA 5E5MA 3HR5A 5FM5O 4BZ1L 2P44B 2DMBA 5L6YL 4HJGB 4MXQD 4Z6AT 3TIDA 2HKHH 5MEOA 4GRMA 2AJZA 2DWDB 5E00A 1OP5H 3T4AB 2V7NA 4L3EB 2VDKL 4E41D 1HSBA 5HBBA 4KVNH 4NM4H 4LP4A 5DJ8A 5LXGL 3DETD 3EDKA 5T3XH 4AEFA 2NX5D 1CDCA 3DUSB 5GGTA 4NO0B 3QJHA 2AK1L 3FO2A 5IMLB 2JJTA 4G8EB 1MCNA 4PV9A 1UVQB 1UFUA 2VABA 4PJBB 2R1WA 4JO4H 4AYFA 5EORL 1FC1A 3LB6D 5INDA 3IFLH 3L1OL 3AS3A 3NABH 1E0OB 1U8PA 2GW5A 2BRRH 3O3AB 4XP6L 3UO1H 5KBNC 1JHTB 4KK5C 2A9MH 3I3BA 2CIIA 2IH1A 2GFBB 2XZCH 3T2QA 4OLWL 4DW2H 4IOIB 3IDXL 4LQFH 3FB8A 4ZFGH 4Y4KC 2VDMH 5I17B 5BS0A 3PXHA 1KN2H 5EZJB 5DDHA 1U8LA 4PJFF 1S78D 4P5MB 4JG0H 3KPPA 4TUOA 5LAXA 3ZO0A 1F8TH 4LFHD 4XMLL 4R7DA 3EOYG 1NH6A 5I1AA 1DR9A 4NNPL 2HT2C 3GRWH 2GAZB 1RIVH 1OT1A 1AC0A 3LH2H 1DQTA 3D0LB 5T33L 2C9AA 3DSFL 5JLZB 2ZOLB 4QWWC 3RA7H 3NFSH 1S7UA 1PYWB 3BKCL 5D5ME 5F96L 3W2DL 2PYED 5DFWH 1KCVH 5BJTB 4XCEB 3ZDXE 2D7NA 4MJIA 2IANE 5CJ5A 3OJDB 1LNUB 5TE7L 25C8H 1AR1C 4M5YL 3CSPA 5DD6B 4XXCA 1R3LA 1N8ZA 2NY5H 3BP6B 4NRYA 3QNXA 1UH2A 4XWOC 5CWSB 1CZ8L 1M7DB 3QUMA 3SDAB 3PHOA 5KN5A 5L8LB 2R0ZH 3T2OA 1MLCB 3BKYL 2MMXA 1H3PH 2WWKT 2Y36H 1LO3L 4Z7OF 5DQJA 3RY6C 1NGQL 1OM3L 3G6JF 2BSSB 4HUMB 2XNAA 3TBSA 4NUGH 1U8HA 5I66A 1BLNA 2V5TA 4FABH 2GITB 3VWJC 3BQUC 3CXHJ 4UZGA 3MMEB 1QFHA 1X5ZA 1QSEE 3QHFL 4HUKB 4X4XB 4MJ2A 1K3ZA 3HE7C 4K9EH 5E8DH 3WDJA 5I1IL 1VEOA 1YN6A 2CPCA 2VXTH 3HMWL 4H20H 4DGVL 3V0VB 3WBDA 5EZIH 2ITCA 2FHFA 3MV7D 4Z18A 4YXLL 3HG1D 1J9CT 2VDPL 4PJ7F 2HFGH 2XXMB 3TT1H 3PWPD 4Y2DC 5I30H 5GJTH 1L6XA 1MJJB 2C26A 3A6BL 2Y9RT 1RIUH 1HNGA 1N5YH 3MBEB 4M02A 6CGTA 1NFDF 3BP4B 3O0RH 5FYKE 3VI3F 1CXEA 3ALWA 3S36L 2ARWA 2VXUH 3DUUA 2FD6L 4WCYL 5IEKB 3SE4A 3TA3D 3HI5L 3GFUA 3QUZC 3RIAF 4E42B 4KK9D 5C08D 3IS0X 3HC4L 1TLKA 1YPZA 1D5IH 5C0IA 3DX9B 1NKRA 1A22B 5EA0H 4PGBB 5I1DB 1IZKA 1J05A 2ESVD 4HIJA 5IQ7H 2HG5A 1UC6A 4EDWL 1OGTA 4P4KC 2D3VA 5E8EB 1P2CA 4X6EA 1DBMH 5E1AA 4M6OH 3QDMA 4Y16A 3PJSA 3RX5A 2DLIA 4MYWB 5FGSA 2WANA 5GGSA 1G6RB 1UM5H 5GGUA 2ENSA 1Q9LB 4EN3A 4XBEH 3TZVC 1F3DJ 3PNWA 1P4IH 2ARJA 4GS7C 4UOW1 4GRWE 1U8NB 1S9XA 2VNCA 1INQA 1SEQL 2WSKA 2GI7A 2AK4E 4HS6A 2NY4D 5SV4A 3LY6A 3UYRL 3S34L 1WBZA 3QNZB 3RWJA 4WEUD 1NCWL 4TSCL 5CUSL 3JWOL 2EIBA 4ZUWA 1CICC 4AL8L 5DK0A 2EDQA 3O8XC 3BP7A 2V5YA 4TQEL 3GSNH 3IDIA 4JZOB 1YYMH 1T7VA 4I3RH 3MRPB 4X4YB 5DT1H 2F8OA 1IC7L 1XF3A 1EEUA 2FEEI 3MRNA 1ZKAA 3HZVA 5FA4B 4LCIH 2RCSL 5HGAB 1S7WA 3ARQA 3VXTA 2OI9B 3PL6A 1FH5H 4BZ1H 4L4VE 1IC1A 1X6NA 4JHAH 4QXTA 1A6UL 1XF2B 2W9EH 3DX8B 3D25A 5DRZB 1F58L 1LP9F 3ZYZA 1UXWB 2GK2A 4X98A 5GHWH 3UJJH 3QIBD 4NIKB 4UT6L 5K33A 1JYXA 5E6ID 3FONB 3GHEL 5F7HA 5C1MB 1CGWA 2BVYA 5HVHB 3RHWF 4KQ3H 2AK1H 4KK5D 2FDBP 2EEAA 3TO4A 1XGQA 1TQCC 3SJVA 1A1MA 1QLEH 4TPRH 1OCWH 4HKXB 1JPST 2J2ZA 5E94A 4ZYKA 2D03L 5DQDH 3RUGB 2R23A 5F1NA 4LP5A 4Y4KD 4QHKJ 1KEML 2IH3B 4FZEL 3JTSB 4U6HB 3S5LB 1B0RB 1U8IA 2HMIC 1AHWC 1ZSDA 1AXSB 4ZFOL 4JFXA 3EFDH 3DRTA 2QSCL 1ORSB 2JIXB 3NTCH 2HT2D 2UUDH 4L4TA 1ZLVH 5FCSH 4OD1L 3EYOB 2OX5A 3DNKA 5CP3H 4QWWD 3VFNA 5IB3B 2IBZY 3AROA 4JFEE 4OIBA 5EU7E 4H25A 1T2QL 3BX7C 4TTDC 1QYGL 1RUQH 4NN6C 1IRAY 4MJ6B 1XGTA 1LO0H 2LU4A 3CFJB 1OARL 4WWKD 3RWHB 4DVBB 2Q86A 5FO7B 4OZIA 3DSFH 2A6DB 5DRNA 1YC8A 1NUFA 4GBXB 1FLRH 5F96H 3MYZA 4XWOD 1YMHA 4JY5H 3EYUH 4DKDC 4Z77B 3VDBA 1JF1A 1WIUA 5ID0B 2P42B 5JW4Q 3TP4A 1PZUB 1YNKL 5DD5H 4EIGB 5IG7B 4KZEH 5TE7H 1YY9D 3FB5B 1UB5A 5KS9E 1EO7A 3U7WH 3WJJA 3BUYA 3V6BR 4M1CC 3WXWH 1AKJD 3S37X 4WV1C 3VWJD 4J7RA 3BQUD 2PR4H 1GPOH 4NNXB 4PJEB 3F12A 3EW3B 1BVKB 4GH7B 2CDGA 2FJGB 2ZWLT 5J13C 5BRZB 3NH7H 1P1ZB 5TGBA 3MV9D 2V9QA 4KK6C 4HWZA 2G9HA 5DZLA 3RWDB 3REWA 1A47A 1FL5A 4N8VA 2Z4QA 1A6VH 3CFKB 4X99A 4PRHB 3GMNB 4ZS6C 4DK6A 4JO3H 3S3SA 4Q9BA 5T1DL 4R26H 2F54A 1BMGA 3MRGA 3S88L 2WP3T 3U4AA 1U8JB 5EIVA 2GCYA 4XPBH 1X44A 5FGBC 3PHQA 1ND0B 1JCKA 4KJQD 3DTXB 3E6FA 4XP9L 3RIAK 2Z0BA 3VXNB 1KXVC 5JIIA 2I07A 3Q5TA 4P99A 5I74B 2LTQB 1U58B 4ZUTA 2R1YA 3HRZB 4K94C 3RVUC 5ESQB 1R6VA 4ZPVA 5GS0C 1QBMH 2ZUYA 1IBGL 3NACH 3VH8A 3E8UL 4K8RH 1NLBL 2DQTL 1CDYA 2ITDA 4IMKC 4NQCD 4LLVB 4WHYG 2AKRA 3DRQB 4GSDL 5MI0C 1K6QH 4P4KD 4MZ2A 1TNMA 3ROOA 2XN9B 4L3EE 5DFVC 1HXMA 3SDDA 4L4JA 1T20B 1XH3B 4D0BB 5JW5B 5GRUL 3ES6A 4NWUH 1QOKA 1OP3H 1G7MA 1U3HA 2D4DA 4DJMA 5I1EL 4PJBE 1ZK9A 3TZVD 5K59F 2FO1A 4JM2F 4M62L 2X44D 3BEWB 3BYTA 2A6JA 3KPQB 5BXFB 1B4JH 4J4PA 5KZCB 4AG4L 1CGVA 2GT9B 1I7RB 3HAEA 5A2LH 3ZHDA 5ITFA 4MSWA 3BW9A 1TZHA 2ORBL 5C9KA 1JN6A 3O8XD 4NPYB 1B9ZA 1SEQH 4YUEH 35C8L 5FF6B 2IAMC 3Q48A 3QXAA 2YHGA 4R7NA 4LVHB 1J8HB 1Q0XL 2FEDC 3WS3A 3PABA 3WUWB 2HLFC 2W9DH 3GI8H 4D9QD 1GC1H 3L5WA 4Y19E 5T5NF 4Z7UB 2BVUA 1UACH 4RRPG 3IU3A 5IBLC 2X7LA 3CVIH 2XV6B 1NC2D 2PNDA 4MA8H 1DSFL 5D2LA 1HH9A 1S7RA 3GIVB 4IRSA 1UXSB 4JAMB 5T1KB 3D3VB 4Y5YC 3L6FB 3KPLB 5D6DA 4H1LH 1AD9A 4UV4H 5CD3A 3FT3B 3I2CL 3QDJB 4MD4B 4DN4H 4WDIA 1S9VA 2Z9TA 1G7PA 3D85A 3QXTA 3UROR 3GHEH 4DUXA 5J1SC 5D1ZB 5I71C 1TVDA 3V4PL 1HE7A 1JGEA 3GSOA 1PEWA 2B0SH 1T0NA 2Q20A 2XFXA 2IPUG 5I75C 3U2SB 2NXYB 2B1AL 5I9QB 3VGHA 3LKPB 4GMSH 5F9AC 1MCPL 4B0MM 2HMID 4MGXA 2GJ6A 2HFEB 1FL3B 4FQCH 1Q72L 4X6BA 3CLFL 3ARFD 1NDMA 5T5NG 2IC2A 4JFYA 1KNOA 2IPKA 4ISVA 4K3HA 2Q87A 5IW1B 5ELIA 2XZQL 3QEGL 5E2VH 3BRGC 2FX7H 3C6LA 5JHLL 4TYUA 3L5JA 1OWWA 1C08A 3IDNB 3QXDB 4FG6D 3C60A 1T7ZA 4HFWB 4XNYL 1A7NH 2OMNA 1JZ6A 4PRAA 1RZFL 4RFEA 2IAND 1BJ1J 5C8JA 4LSPH 4JB9L 2O61B 4ELKB 2R29H 3U48A 3WN5A 5MP6L 2H6PB 4NYLA 1F6AB 1G84A 4OF7A 1LEKB 5GQBA 1QSVA 1ZHLA 4OJFL 1I1AC 4FRWA 4JFQB 4R3SB 1YNTA 1QYGH 1IGCL 1BIIB 3T04D 4OZ4B 4C55A 3PWNA 5AWNH 1OARH 1MCOH 1CE6B 3K8LA 3CFIC 3V79C 3D39B 4P2RD 3UCRA 3HRPA 3ALPA 1T3FB 3RWEA 5D5MF 2A6IA 4UIKL 4TUJB 4NRZA 1SEBB 1KT2B 3ZDXF 3FO0L 5IMKB 5ACLA 4JHBA 2Q8AH 1KIPA 1MI5B 4KRPC 1FV1B 4QKXB 3U6RB 1EPFA 2YUVA 1UWGL 5E5MB 1NMCC 4KUZL 1BD2A 4P9HH 3BWUC 4KK6D 1JL8A 4YK4C 2MQ3A 1B90A 3ME0A 5FHBL 5MEOB 3HFML 4PIRF 4XAKD 1NL0H 1FNSL 2V7NB 4U6VH 1HSBB 5J3HC 1OAYL 1IT9H 4ZS6D 3B9KC 1D5BA 5DJ8B 3KJ6L 1BGXL 4HT1L 4Y89A 4U1MA 2K9UA 3ZYIA 3QJHB 3T2PA 3M8OL 4PV9B 2VABB 1I8LA 2R1WB 4YFLF 5INDB 1FGVH 1A6WL 5DJ0A 4ZODA 2EE6A 1FE8H 1U8PB 4N0CC 4MAUL 3GBML 3QHZL 4JPKH 4L9LC 1WQVT 3RVUD 1MCCA 1VFMA 2OTUA 2IH1B 1EJ6A 2D0FA 5E08H 5LVEA 5GS0D 1VA9A 5E2JA 4NOFA 2JB5L 2DI7A 1U8KA 3FB8B 5F21B 3UPAA 1I75A 2NR6C 2EH8L 1KJ3H 4TNVF 2EDXA 1CXFA 5D6CA 5DDHB 5DFVD 4LSSL 1LEIA 4TUOB 5LAXB 2DBJA 4HZLA 2WV3A 3H3PH 1MCIA 2H32H 4XB8A 4R7DB 1P7QA 5I1AB 4YFEA 4I0PA 1JGVH 4ODTL 3JV4A 3FQNA 4OCRL 1PAMA 4X6DF 4YGVA 4WHDA 2XG4A 3BSZL 3T0EA 3ZLQC 1RJYA 4KV5E 3H42H 4JZJA 5J6GB 4HWUA 1G9NC 4JFDA 3ZE0E 1RZKL 4MJIB 3QUXB 4P59L 4M62H 3RUGE 1E4XL 1H8SA 4NRYB 1N8ZB 3RFZC 3MRRB 3QNXB 5FYJD 1FPTH 1TETH 5C6TL 2Y6SC 4HG4K 2IAMD 4YE4H 3QUMB 2CLVA 3PHOB 4XP1L 2DQDH 3SOBH 3WIIH 2FEDD 4HLZG 4G6ML 5CILH 1GSMA 4OF0A 5DQJB 5C86A 4L4VD 3MRJA 3TBSB 1A2YA 4QRRB 1U8HB 5IBLD 1ZLWH 5I66B 4UBDC 3MPCA 3C08H 3EGSA 4D3CH 2ADIA 4YHYB 1QR4A 1WV7T 4S1QH 3CIQA 3MR9A 5B21A 2AV7A 3B3IA 1CLYL 4FHBD 1T80A 3O4LA 1N26A 2RGSA 2R4RH 1V3MA 1YN6B 3VW3H 1DSFH 3GUTB 3HNVH 2EH7L 2OM5A 3IDMA 3SGDH 3VXSD 1Z0MA 4G7YL 1QSFA 2EICA 1TTGA 1U41A 3GSNA 4LLYA 4PREA 4MQSB 5JMRA 5JIHA 2XIDA 3GHBL 3QDGA 7FABL 4G7VL 1JRHH 4DGIL 5DJYB 3AAZA 3TVMA 3HCVA 2IQAA 4D0CA 4LDLB 4PJEE 1MJ8L 3DUUB 4YPGA 1K9TA 3W5NA 4YC2B 4L8SC 3GDBA 1YEGL 4NO2B 5BRZE 1UWXK 1BQHG 1CDGA 4LCWB 2W60A 2FJFA 5C0IB 3LDBB 4YBLB 1ZHKB 1KYOK 4KRMB 1J05B 4MAYA 4HIJB 5E2WL 5C7XH 1FO0H 2HG5B 3AMLA 4OGXL 4JFFA 4PRHE 5JHLH 4NN7B 4P3CH 3OBAA 4OM0H 5E1AB 3BUTA 2QKIA 3QDMB 1JRHI 4Z7WA 4UMGA 2YKLH 4DKFH 4PTUA 1NGWA 3MBEC 4KUCF 5GGUB 4MX7A 4FFYL 4EN3B 1LWRA 4CGTA 5A2IH 4ETQA 2ARJB 4MS8D 3KWWA 5JDSA 4BQBA 4NO3A 2UVFA 1JI1A 4R8WH 1S9XB 1WEJL 3GBNL 2QADB 5EUOA 5C2UB 2C1PA 4BQCA 3MRKB 2ZSVA 3S98A 2VR4A 1WBZB 3RWJB 3WLWC 4XPGH 5CKGA 1FN4A 4JRWA 5C0RL 4C56B 4ZUWB 4OKDA 1FL6A 2DQHL 3IXTA 2YUWA 5DK0B 2IPTH 4OZFG 4HIHA 3BP7B 5SWZD 4NC1C 4RX4D 5TE6H 1HDMA 2D7MA 3IDIB 2XN9E 3IAPA 1BBDL 3LD8B 4G8IB 5KAQF 4XHJC 5KSBA 3IRPX 1GZPB 1XF3B 5KS9F 2AI0H 4G8GD 3MRNB 1E4WH 3HZVB 5J3HD 3MODH 1S7WB 5GRVL 3VXTB 4LSUL 3PL6B 5K9OA 2WIMA 4Y4HA 2HA1A 3LEXA 2F5AH 3FMGL 5F7FA 5FUZL 1MRFL 5FHBH 1TFHA 4S1DD 4X98B 1N5AA 1NGZA 3M07A 5ICXA 3BE1H 1UWEH 1X4XA 3BHBA 4OFYD 4GXVL 4N0CD 4LU5H 2XZAH 1FLTX 1KELL 2AEIT 3SJVB 3C5SA 2X4TA 1A1MB 3ULSB 4CW1B 4P57A 2E3VA 2N7BA 4TNVK 1KLGB 1A6WH 4ZYKB 1J8HE 5F1NB 1JTPA 3U9PH 3FOLA 1K4DA 2NR6D 3F58H 2ZUUA 4JANA 2PTUA 2V17H 4NQDB 4Z7UE 3MRIA 1U8IB 4S1SH 3EOBA 2ZUTA 5DURB 3LKNB 1AY1H 4Y5XA 5KAQG 2ZG2A 3NVQA 2CXKA 1ZSDB 3UP1A 2VSDA 1NCTA 2I24N 4IRJD 4JFXB 4YDIL 2EH8H 2G75A 2FX8L 3D3VE 1KC5L 1EFXD 5FYLE 5HDBF 2F58L 2Q6WA 5HVHC 3VMPA 5CP7B 4NP4L 4YR6A 5DHXB 5F7UA 3QDJE 3MRQA 2CDEA 4PJ5D 4JGMA 2DQGL 1HXYA 4KRNA 1CGUA 5ILTH 3MJ9H 1CGSL 1V05A 1EGJL 1KB5H 2R0LL 4M7LL 4UUJA 1XGTB 3HUJF 2Q86B 4OZIB 1LO5A 5DRNB 3WFCL 1S5IL 4LNRA 4OCRH 3VXRA 5ESAA 3VG0H 3KAAA 1YMHB 1XIWA 4J3VA 2Y6SD 3UTSB 5TDOA 3V8OA 5D2NA 5KW9H 2EKSB 2X09A 3IGAB 2GTWA 3ARRA 1VACA 4J8RA 4PJBF 4Y19D 1L0YA 1UB5B 3UAJC 1XCTA 5IFHH 4HS3A 3QRFM 3BUYB 2D9QB 4LSQH 3SKJL 1NKOA 1VGEH 3MZTA 4UBDD 4YQXL 2I9TA 4M7LT 3FFCA 1RVFL 3F12B 3ZTNH 1YECL 4TSAH 2CDGB 2X4RA 1MQKL 2XYCA 2C4FU 3F65A 2DYPA 5F9WC 3DROA 5TGBB 4PUBH 4N5EC 4GBXC 3RWFA 5FO9A 4P46A 4Z7VA 1RK0B 4NFBA 1YEHL 5B39A 1CLYH 3FQXB 4I2XA 4WUUD 1F42A 2OZ4L 2KKQA 3KYNA 1E4XI 5HGHA 3EJZC 3B8SA 2F54B 3MRGB 1F4XH 1KBGH 3D39E 1S7VA 1IC5L 2VITB 2EH7H 1UJ3C 5HYJA 1QFOA 5JORA 3GSRA 3TIEB 4GQ9L 1D5MA 4YDJA 2LVEA 5DJCA 3E6FB 1FRGL 5C0NC 3TBTA 3BKJL 2I07B 4ZXBC 3VFRA 4ZUTB 1DL7H 5B3JF 5BV7B 1ZTXL 2R1YB 1MI5E 4FQ1H 5HDQL 1U2HA 3W82A 3QUYC 4XWGL 3UYOD 1YEKH 2ITDB 1I8MA 4H1LA 4CUCA 2AKRB 1VSCA 4OM1H 1A6ZA 1AGEB 1YEGH 5KOMC 1CWVA 1NANH 3S7GA 1HXMB 1IKNC 3TJHD 2R56H 3SDDB 4U2YA 2Q1EA 1QACA 4ZO7A 5L2KD 3ES6B 2X70A 1MY5A 2D7TL 1FNHA 1OLLA 3EYSH 3UTQA 5J4MA 3G5VA 2DJ4A 1QQDA 3DYMA 3IJYA 2B8OT 2ZPKH 2FCBA 5IBUB 4MQTB 1T6WA 2A6JB 3D9AH 1QEWB 3FT2B 3BISA 1SBSL 3MLRH 4BELD 4U1IA 1QHPA 4MNGA 3WLWD 4G9FB 4OZGB 4XBPB 1G0DA 4KGJA 3BW9B 5EO9A 1JN6B 2HJKA 2V6HA 4YHZH 1IGIH 4P2QA 4CN4A 2NY2C 3TCLA 1L7TH 3W0WA 4ZFOA 3QXAB 3GMMA 4BJLA 1QFUL 5EBWA 2DMCA 4WW2C 4XHJD 3KXFD 5C0RH 3WS3B 3PABB 3ULUE 2HN7A 3L5WB 5D93C 4KQ4L 1Z3GH 2ZZUT 4HQQL 4MB4A 5ENWA 4YBHA 5GGQH 5J6HA 2AJXL 3IU3B 2X7LB 3RJQB 2X1WL 5ADPL 5GGVL 2FX9L 1SJVA 4QXWA 1CFTA 4PD4K 4WTZG 4PJIA 1REIA 3MCKB 5D2LB 1HH9B 1S7RB 1YEFH 1I8KA 1GOHA 4IRSB 4KKLC 5FYKL 1RUKH 5DD0H 5HD8C 2M2DA 5CEXA 1PQZA 4V1DD 3L3GA 3QWRD 3P77A 1KG0B 1CQKA 4HK0B 4MJIE 2VL5A 2WWKO 1GGIL 5CD3B 2CSPA 3FOMA 4F2MA 3KPSA 1MRFH 5KTEH 2YMXH 3D85B 5CZVL 4OF8A 3DYOA 5DD1L 5GS0L 5IM7A 3PWJA 4RISL 2A0LC 3O11A 2IEPA 4OFKA 3TCXA 1F3DH 3DHMA 2E9JA 3X13A 1RJZA 4K3DL 1JGEB 3GSOB 3S96A 3BAEH 3EJYC 3IFNH 1T0NB 2XFXB 5DHYA 1KELH 3I75A 1RZJH 4XZUB 1AXIB 5EOCJ 1T89A 4QRRE 1M71A 2VXSL 3FFDA 4AH2A 3LVEA 2CLZA 1A4KB 5IP4A 5L0QC 4OSUH 4WFGE 4DTGH 4QRTB 1NDMB 4K3JL 5F7WC 4WI6A 1KNOB 3S35X 2IPKB 4ISVB 1EHNA 4XRCB 3MGAA 4KROB 2MFNA 4HC1L 4N0YH 3LS5L 1C08B 1YEIH 2ZUXA 2X4PA 1NEZB 3FN9A 1KJMA 5IR1A 4RFEB 1V7ML 4O4YL 5C8JB 5DS8A 2YK1H 5I8CA 2YPLD 3V6OA 1NGXB 5I2IB 2KL6A 2XI9A 1Q1JH 5CJOH 5EULV 4Z5RA 3WN5B 4NYLB 4X8JB 1L0XA 3SCMB 3J8F7 1FFNA 3MLYL 4YZFE 4XVJH 4M3JA 1ZHLB 2NXYC 3DXAA 4ONOA 2YUXA 2E27H 9CGTA 5JQ6H 1CGSH 1YNTB 1EGJH 1BFOA 3W81A 4LAQL 4DK3A 1RUAH 3PWNB 1A14H 3BH9A 1J10A 5DR5L 3B5TA 4ZNCD 4KY1H 5B8CA 1EVUA 1KXQE 5JR1H 1LO2L 4KTDH 4ODVL 4YHMH 3RWCA 3IVKA 1RD6A 3WHXB 2ERJC 1OAQL 1ZV5A 1V7NH 4NRZB 4QRQA 4LCWE 3KYKL 4WI2A 4P5TD 3V5KB 2KZ1B 4PB0H 1KIPB 3GBLA 4ELMB 5IMMA 1BD2B 5CJ8A 4N5ED 4GBXD 3VXUD 1YECH 2GKIA 4NZJA 5FHAH 3BKML 1UA6L 4PRIA 3QDME 1R24A 1A02N 4WUKH 4LLDA 4AEIL 1D5BB 3EJZD 5EDXA 3CFCH 2R8SH 1WT5A 4WEBL 2ZUVA 4U1MB 2CRYA 1U3JA 5T1MA 3QNYB 1R3IH 5TDPA 1KTKE 4QHKI 5C0ND 3G6AB 4LSRL 5DJ0B 3MRLA 4ZXBD 2DQUH 4C56E 3S8WA 2X4SB 4KAQL 1BF8A 2OTUB 5I30L 1LO4H 5IJVA 3QUYD 4E41A 2UY7A 1L6ZA 1IGTA 4Z0XA 2JK5B 3BKJH 3LPFA 4IMLB 5DLML 2NX5A 1U8KB 1BZ7B 3FHAA 2J8HA 5D6CB 3LKQA 1DQML 2BP3A 1LEIB 3S5LG 3VJ6B 3WIFA 3WO4C 3E6HA 1Q8MA 3C09C 1BOYA 4HZLB 4PJEF 1MFBL 2EDOA 1EZVX 5GJSH 2Y07H 4ERSH 4Q9QH 1P7QB 1FORL 1JGUL 5JHDA 4I0PB 3SE9H 2C3HA 1OAUH 2VXVH 3JV4B 3FQNB 4YGVB 2P48B 4NBYB 3FT4A 4KZDL 5E9DD 4M7JL 3T0EB 1BZ9A 1T4KA 1RJYB 3QUKA 4LRIA 4JZJB 4L29A 4FQJH 3S97C 4JFDB 2P5WD 3SJVE 4UV7L 2JELL 3GSUA 3PWVA 5GRJH 1JTTA 2ATPA 1N6UA 2BVTA 2O5YH 1GGUA 5GGRA 4DVRH 5GIRA 2L4OA 1RZ7H 2NY2D 2P24A 4KKCC 4M1GH 5C3TA 4NQDE 2CLVB 2IFGA 3LMJH 4XCNA 5F7EL 1FO0A 4XVUD 1P5UA 3ULUC 1I9IL 4M93C 1S9WB 4MXWL 1AIFB 1OD7A 4KHTH 1YDPB 4HG4J 3MRJB 4D9RD 2ATKB 1A2YB 2PYEA 1BM3L 4FQQB 1MCRA 4EXKA 3WL9A 1EX0A 2B1HL 3EGSB 4HBQA 4YNYA 4S2SA 5DXWA 2AS5M 1PY4A 3KR3L 1PFCA 2AV7B 4KKLD 4HLJA 3IJHA 3B3IB 4JFZH 3X12A 1SVCP 5HD8D 1U3ZA 4HUWA 5ANMA 4RDQG 3QUXC 4K7FA 2ILLA 4JG1L 4PRNB 3P73A 4GLRH 3FHQA 4OZIE 4NQXB 2ZG3A 4U6XA 4RFOH 4XXCC 1MCWM 5EWIL 3IDMB 4LAJH 4H88H 3VA6A 3LV3B 1I1CA 4KTEH 2A0LD 3UTSE 5BW7C 2ZCLH 4ODSH 1QSFB 3T2NH 5A3IC 4N0FB 1A3RH 3GSNB 3FKUS 4LLYB 4HS8L 4PREB 2FB4H 3EO0A