1ZLUH

Fab 2g12 + man5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB 2G12, light chain
total genus 35
structure length 221
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH01
4U1MA 1T2QH 3P9LA 2CH8A 5FYKH 2P42B 3OHXA 1LEIB 3EOYG 3MODH 3P30L 4YK4B 1DJSA 5E5UB 3BH8A 2ZKHL 4PJDF 4ZAKA 4EN3A 3T0VA 1QRNA 3R0MA 4BFEA 2VQTA 3V95A 1GCFA 5CEXA 4Y88A 3GMLB 2P8LB 2UY7A 1V3JA 4PTTA 3KR3L 3VXTA 5ERWA 5KS9F 3QDMA 3MSPA 5L2KA 5F3BB 4WJ5A 4JR9L 1I3GL 3MCLL 2DQHL 3BH9A 3QRGH 2Q1EA 1ADQA 1FFOA 4KKAC 2WP3T 5EC1B 4BH7B 1J1PL 3EOTH 4PGEA 5KSAA 2NX5A 5KVFL 2PNDA 4B53A 5HGAA 1RIVL 3N9GL 4ZOBA 4XP9H 1R3KA 3BXNB 2P24A 5DMIL 3CIQA 3RZCC 3X17A 3P3YA 4BSJA 3NMEA 4Y4KC 4ZODA 4WHTB 6CGTA 25C8L 1XF4B 1S7RA 5TDNB 3RWDB 1JHTA 4RMQA 2GUOA 4R26L 1C12B 1IC4L 1YN6B 4KHXL 5DMKA 4CVUA 5DJ6A 5MEQB 2NY5L 2UV3A 1VKXA 3BAEH 3QIWA 4NHCL 4GW1A 4L8SB 1TCRA 5T33H 5T1DH 2X89A 4L29A 1T04A 2X10A 4PR5A 2FLRT 5ICYB 2EDHA 1ZVSA 3BJLA 1AQKL 2ENYA 5EWIL 1S9VB 3ULUL 1AH1A 5BRZB 2ZUQC 3RVVC 4FFYH 1ZGLP 2VRAA 3BN9D 1A9BB 1Z0MA 1JRHH 1NQBA 5F9JA 5C9KA 2BSED 4YGVB 2AEPH 3VXQB 1I8MB 4P23B 4LFHG 4OUUB 4PJAB 1EHXA 1HKFA 3V8CA 1FFQA 2X5PA 3MR9B 5I16B 3QNYA 2OCFD 2P49B 4NYLB 3TIDB 2Q87A 5KSAD 2NY5H 1DFBH 1UZ8A 4QEGA 5KG9A 4NQCE 1KIRB 2JIXD 1HHJA 4JZJB 4PV9A 5BV7H 4P2OC 4X4XB 3GKWH 2ZNXA 1A02N 2B1AL 1A3RH 4ERSL 5GS2H 3D0VA 1N6QL 1BD2A 1I3UA 1A6ZA 2NY6D 4G6MH 1BVLA 1KCUH 4FMFA 4KI5F 1B0GA 2FBJH 3EDEA 1MCPH 1AGCA 3KJ4C 3ARDA 3RGHA 1OSPL 5K93A 5GGTH 1LO5A 3SKMB 3JTTB 1F3JA 3OKNB 3K7UA 4O51B 3QO0A 3MJ9H 1AQDB 4P2YA 3L3GB 3EYFA 2ZCKL 4LQFH 2AJYH 1IGMH 1J1XL 4XNQA 4D2NA 2FB4L 4LL9A 1NCNA 1DUZA 2VDQH 4NRZB 1A6UH 1WISA 3JVGA 5I1JH 3HZMB 3N1GC 3W39B 3V6FA 3VGAC 1W8OA 2BHZA 5EU6E 3ARQA 4PTUB 5A40E 1TZGH 2P5WA 1DN2A 3ARTA 2VZUA 2KQNA 5EUOE 2GSGB 4NQEB 3QXAB 5E8PB 2ORBL 3S36L 2FJGA 4F7PB 1Z6JT 2YBRB 5KSAC 4LVNC 4PJCE 4QT5A 5DVOA 5GJTH 3FB7B 3QUYB 5C9JB 5EZIL 1EHNA 3F7VB 4YDIL 1OF2B 3MOAH 1C16A 5M7QA 1SJHB 2GI7A 1V5JA 1A1NB 3MRMA 4ZUUB 5DD0H 4Z76A 1H15B 2XTJB 2MQ3A 5SWQA 2YWZA 4ZAKB 3O0RH 4MDJB 4MHHG 5CILH 5ICXA 3UPCA 4K8RC 1P5VA 3PHOB 3VG0H 3OF6A 5DMYA 5FGSA 4ZD3L 1FLRH 5DFVD 3KHOA 1ZE3C 3WIHL 3LS5H 4NN6C 3SOBH 5C07A 1DL7H 3T2OA 5FUOH 4LEOA 3MXVL 4Y2DB 4HH9B 5CINL 1F13A 3FRPG 5DWUL 5C07E 4PS4L 2X41A 1QEWB 4U7SA 4YDKH 1R5VA 5J1AA 1QO3A 3AAZB 2QR0A 3MRLB 4HKXA 3FT2B 4PJ7B 5JOFB 3T65A 3GJEB 3NPSB 2HMID 2RBLA 3DX9A 1KN4H 1U2HA 1AE6L 2EYRA 3RVTD 4U1KA 4HWUA 3KPTA 4AEHL 4GW4A 3O3BA 3T0BA 3KPMB 4MAYD 3T1WA 5IOPB 4X6EB 4PJIF 1V8HA 1ZEAH 5DHYA 4M5ZL 1BAFL 3BHBB 3C2SA 4ZO7A 4I2XB 2YZ1A 3TEUA 1YQVL 4M93B 5DQJA 4NRXB 4LPWA 5E7FA 4XCFL 3SDXA 4GG6E 3MLUH 5D93C 2HTKC 3D2UA 3RKPA 5FO9B 3WLWD 3G5ZA 4XVUC 1TCMA 4NCDA 2NY2C 5T1LA 4Y7MA 3RX7A 3VXOB 4C4KO 5CGYD 2BOBB 4HUVA 5IKCA 4I2XA 5SX4I 1FYTD 4E5XB 3HC3H 1N6UA 5I8EB 4RGMC 4DGIL 2DTSA 1QP1A 4NM8L 4G8IB 2Z91B 5A2LH 3BWAB 3GSOA 4KJPC 3KPMA 2XZQH 1T20A 5GSVA 3TN0C 1ZMYA 4APQA 2CKBH 1EERB 4G8GE 1A0QH 5IVZA 3RVXC 5HGGS 2PO6A 4KJWC 3LIZH 2OLDA 4HWBA 4M48H 4M7LT 3RTQA 1T66C 3T3PF 1PKQE 3ARGA 3DVNA 3L3HB 3Q5OA 4JDVB 4OI7A 3KJ4B 4BK5A 3QO1B 4R96B 5FYKU 3RGVB 1BWWA 1F4HA 4P2CG 1HDMA 2DIBA 3IXAB 5GRVL 4LSPH 3GI9H 2YD2A 4KROD 5HHNA 1IAOB 5JXED 1NBZB 4M5YH 4BQ6A 5L2KD 5I1DA 5CIPA 4N0UB 2H6PB 5TE7L 2Z91A 5CGYC 2OR7A 3CXHJ 2D9QB 4MNGE 5IW1A 3HNVH 3AS3A 4NN6B 4XNUH 5EORL 3CFJB 3DBXB 3DVGB 3DMMD 1VHPA 3LKOA 3OKLA 3WFDL 4U6XA 1OHQA 2ESVD 2X7LA 4WV1C 4EDXA 5IB5B 1JZ8A 1ND0B 4J12A 4XCYA 4FQ2L 4HWBL 4WCYL 3HFMH 1SEBA 3ZTJH 1LDPH 3RIAK 1VADA 2PW1A 4NRYB 3WMSA 5ENWB 1F42A 3ILPB 4O2EB 4JFXB 3UYOD 4NP4H 1P84K 1AJ7H 2VE6B 3TBTB 1RPQA 2ADGB 4HGWB 4U0QB 2A0LC 4PJ7E 3TM6A 2IQ9L 3T4YA 4EN3C 2B0SH 2F5AH 4PRNB 5GGQH 1A7RL 3ZDZE 4HIHB 5DRWA 4MJ4A 3U2SA 4N0YH 5BS0A 5JHDD 1WFNA 3VXRD 2VABB 2QBWA 2Y5TA 1Y6MR 5E95B 1A7NH 1DBKL 4KY1H 5DEZA 3RKDC 3PG2A 4S1QH 2H32A 3DXAB 4XVSL 4AK1A 1JFQL 1A1OA 2B39A 2ESVB 4P9HC 3UTQB 5JXAL 4JN2A 5CINH 1K3IA 3RAJH 5F3HA 1C08A 4E42B 3MRDA 4ELKA 1N6VA 4XPHH 3VE0A 1FQ9C 1KJ3H 3RA7L 5I1LA 1MJJA 3QT2A 3HS0A 2PYED 5BQ7A 3BYYA 4L5FL 5E5MA 1MFDH 3EOBB 1I1CA 2H8PA 1AGBB 2A1WH 1QA9B 1J12A 4LLUB 1Y0LA 1DCLA 1D5BA 1CDYA 2AGJH 2X4PA 4KROB 5DHVH 1X5HA 3TZVC 4ZXBD 1KCSH 4IRSB 3UBXA 1QBML 5CKGA 5FA4B 5HHOA 2XQBL 2HJKB 2IPTL 3ZKXB 1JPTL 1X44A 5CUSH 3P4NA 5DQDL 3MUY1 1GZQB 4ODWB 5FK9A 2YUWA 4RFEA 5K9KA 2WIMA 3EOBA 1LNUA 1G6RA 1MHHB 2EH7L 3WL9A 4F9LC 5B3NA 2F54B 4L4JA 2IH3B 1MHCB 5A1AA 2CIIA 1Q1JH 4PPTA 3DSNA 2BZDA 4ZFZA 3Q2CA 4XHJD 5FUOL 3QFJB 4M3JA 5E2VL 1ZGLB 4EDWH 4GQPH 3HC3L 3GEWB 5JUEH 4FA8A 3HZVB 1ZSDA 5LAXB 4JRXB 4A6YA 1A4JA 2VLME 4PJIB 4K9EC 3R06B 4GXVH 4BK4A 3CDGA 4I0CC 5D7KD 1OP3H 3R0NA 4Z7UF 1RHHA 4HXBH 4RGNE 5GRWA 1BIIA 1QKZH 5DK0A 1FZOB 4CN6A 4F9PC 1I1RA 2YPLA 2IBGA 5C0RH 5TQ2H 1RAMA 1ZVSB 4HS8H 1ZT4A 1II4E 4TSAH 2CDFB 2HT2D 4OLUH 2NNAA 5FOBA 2PW2B 4EI6A 5DZOA 4OFIA 5CCKH 4RA3A 1F4YL 4Y1AB 2VWEC 4WW2C 3L7EA 1RZKL 3R06A 1YEGH 5K9KB 1ITBB 2J12B 1M1SA 4ENEC 4M7ZC 4ZSOA 4UU9B 5EO0B 3GMMA 4YDLB 5KSBA 1JPGB 3TZVB 4RGNB 5LVEA 5KN5B 5IGXH 5JMRA 2BP3A 5EC1A 3ZE1F 1FRGH 1WWBX 2RHEA 4QXGH 1VKXB 3E6FA 4PJEF 2WNGA 1XR9B 1EDQA 4OLXH 1LP9E 2UY6A 1D5MA 4MAUH 2M26A 1OTUD 1UEMA 1J1XH 1QPPA 5C09D 1Q9WB 5FM5O 1N4XH 4DTGL 15C8L 4EI6B 4RFOH 5CFHA 4FABH 3QIUA 3QXUA 2QQNL 2B7DT 3V0WH 1TDQA 1MHEB 2CSPA 3BH8B 1R6VA 3X13B 3ULUH 4F2MA 4BSWB 2YEZA 5DRXB 2BNUA 4OF6A 4PRAB 1PKOA 5AZEL 1AGEB 3MA7A 3ULVH 4MHHI 3V52H 1F90L 1DVFB 5AZEH 3H9SE 2CGRL 3BKJL 1GHFH 1M71B 5HHXH 1EBPA 3IS1X 2GJJA 5FGCE 3RDTC 2V2WB 2DM3A 2EXWC 4P5KB 1KJVB 4MAYA 1HOCA 1XIWA 5JQHC 4OFYD 2MJWA 5LGHH 1Z9OA 2AXFA 4PUBH 3KLSA 3P4LA 2FIKB 4ZOEA 4K3GA 2HLAB 3TWCH 1S7SB 2RCSL 4MAUL 3IJSB 4P3CH 1JUFB 1JF1A 4GAJL 3PWLB 3FQWA 4XBEL 1I9IL 3T0ED 4QOKE 5FO8B 1J88A 5ALBH 3QUYD 1A6AA 2G5RA 4XVTH 5FYLH 2BC4A 4MWFB 4TUKH 1YEJL 4BQBA 5BOPA 5EIVA 4BA8A 5CWSA 1NMBH 4ZPVA 4KDVA 2DM4A 3U0TA 1AIFA 3UAJD 4ZNCD 4HX1B 2BVOB 2G5BA 1NUFA 1RJCA 1ZHNA 3MUZ1 4L8SA 4CRPA 2IPKB 3VFUA 1EFXD 5E8NA 4KJYA 4WI6A 1KG0A 1FYHB 3BZEA 3Q6FB 3RPKA 3IU4L 4MJ6A 3IVKA 4LRIC 2FIKA 5GS2D 3JV6B 3QIWC 1FNSH 2GHWB 5C0IA 2BVPA 1RVFH 3GMPB 5J6GB 5F9DC 1MRCL 5AZ2L 1A4KA 2ZSWA 5FB8A 3FQWB 4WTXA 3P73A 2GY5A 4QHNA 1JWSA 3S6CA 3UROR 1V3MA 4PD4K 4C55A 1L0XA 4H1LG 3KPOA 1M6OB 4PJ9A 2WW8A 1R5WA 5DSCA 3MNWB 5DD5H 4KMTH 3TJHC 5CWSB 1BBDL 2ZOKB 3B9AA 4OFKA 2W38A 4HXBL 3T04D 4PRPB 2QKIB 3O3EA 1K8DB 5DRZB 3S35H 4BH8B 4P4KD 3B9DA 3SDAD 3DTXA 2IPTH 3E6HB 1H15A 1JN6B 2MNUA 3IF1A 2CUIA 4UUJB 2BDNH 5KOVC 4H8WL 4CNIA 5KSBF 1CF8H 4L8DA 3ESUF 1ZLSH 2DQDL 2EDEA 5JDSB 1ULVA 2EH8L 1TQBC 4NUJA 4PRPA 3STZB 4FHBD 4N8CH 2R2HB 2QEJA 1I85C 4S1SH 2AK4B 5EPMB 1ZGLM 3S5LB 2A9NH 1W72H 4PJ9B 2AKRA 1M05A 1DQLH 4DZBA 4YDLC 1VEOA 1PG7L 2F53E 3JZ7A 1HYSC 1UA6H 4Y1AD 2C5DC 1OAXH 4H25A 3QXAA 2BHUA 3C08H 5C0FA 3QUZC 3RUGE 3ISWA 3EO1A 3BHBA 1CIDA 3U46B 2OR9L 1D5ZA 4GBXB 5GGSA 4UOW0 2YD1A 1F00I 4L8DB 3L3HA 3CCHB 2WM0A 1UKTA 4M1GL 4UT7L 4LHUG 4PRIB 3WD5L 1YNKL 1MQKH 3ULSB 3O8XD 1FZKA 4AL8L 3RTQD 3MYZA 1N4XL 1S9YB 3T0AA 3WFHA 4PJEA 4HS8L 4XXDB 1QTYT 3QG6B 3VXSE 4PJAE 3WNLA 1C1EL 3BW9A 5JO5B 1UCBH 3KYMB 1NGQL 1I3GH 2PXYB 2W0LA 1U58B 4HLZH 3MO1A 1C7SA 4O5LH 3S5LA 5EPMA 5DDHA 3BEWA 3UO1L 2OI9B 4OZGF 3MV9B 2FO4A 1EV2E 4J2XA 1IFHL 2GK0B 1KIRA 3PUCA 4I0PD 2GJZB 3MOQA 5I9QB 1KCKA 3DO7B 1DSFH 3OR6B 5I66B 4ZTOH 4K3EH 5L2JB 1MEXL 4MD5B 3HMXA 1NDMB 2BVQB 5A16B 4PY8I 4HS6B 5I2IB 1X6NA 1RI8A 2HP4A 2AQ1A 2F19L 2DWEB 2DS4A 1MFCH 4GLRI 3SDDD 4FQPA 3R1GH 5ISZA 1A7PH 1TJGH 3VU2A 1NGWB 3UTZB 4PIRF 1HQ4B 1I7UB 1H0DA 3CVHB 4N90E 5ESAA 2QTEA 5DI8B 2H1PH 4XNYH 3KNBA 3C60A 3HRZA 2MOVA 1B2WH 4YFDB 2NX5D 1PKQA 4XXDA 3HMXH 1CXLA 3IGAB 4D9QE 1VGKB 5I73B 2YUZA 4JPWH 4K3DL 4U1KB 3QUZB 4F7MB 1J9CT 3NABH 3T0DA 1FVDB 1MJUH 1HHHA 2HLFC 1LO0H 2NX5E 2BVOA 4QRTB 3DYMA 5DK2A 1I7ZB 2DKMA 2Y4SA 4XC3H 3WBDA 1BFVL 5IBUG 2NY4C 2B5IC 3WXWH 5J13C 1CFTA 1RIHH 2HWZH 3QZWB 4Q74A 3HAEB 2V2XB 4OI8A 3LRHA 2DWDA 3TA3A 4I0PC 3WE6A 3QXTA 1IVLA 2GCYB 1A7NL 1U8JB 4ZUTA 3VG9C 3EFDL 2DTML 2EDQA 1YYLH 1KBGL 1MVFA 1FORL 1SJEB 2YD5A 2Q8AL 2CKBL 4XAKD 3BEVB 4M1CD 2VC2H 4PY7A 2F5AL 3C6LA 5CJQL 3MV9E 1LILA 1N2RA 4WWID 1A5FH 1S9WB 4RZCB 2W9EH 1OGAA 4X80H 2XACC 5DUBB 3QWRD 1ORQB 4G8FB 4QRPB 3KXFA 1T83A 2NY1C 1Z3GL 2P4AB 4HWZB 4P2QB 1F3DH 4X0KB 3HZYA 1NANH 4KRPD 4Z7WB 4LVHC 4WWKB 2AV1B 4XX1E 5DEGA 4JB9L 4GFTB 1QLFB 3B6SA 4JFOA 4DQOL 2DQFB 1M7DB 1OVZA 3VRLE 5L2KB 1KC5H 1OGTB 2V17H 5IVXF 4C56D 1FC1A 2XZCH 4I4WA 3QIBB 1TQCC 3W9EB 3M1BA 4OD2B 4JAMB 2J8UE 4XNMA 1BQHB 4KRLB 3W0WB 3O2DL 4ODUB 4A6YH 1HYRC 3FRUB 5J9PB 5INCA 4FXKB 1D6EA 3QHZH 1U8KA 2X2YA 3P0YH 4ONHB 1LO4H 2BNRA 1CFNB 4PGJA 2BCKA 1FL6A 2F8XC 1OAXL 3LEVH 4JPIB 1RUPH 5DJAA 3NPSC 4G8EA 1NEZG 4JDTH 4HK0B 3VXSD 4E41A 3OPZH 3ZE2F 3JUYA 1QR1B 2PR4H 2X40A 2F54D 4FXLA 3VFPB 1IM9A 3F12A 3PHQA 2C3VB 2YS4A 3L5WB 1FCCA 4F9PA 3UXFA 4LCUB 5H2BB 1AO7A 2VH5L 3RPIB 4N9GA 3CMOL 3FOLB 4L1HA 1X7QA 1C5DA 2Y1VA 5I6XC 3NGBC 3QIBD 5IR1B 3WIHH 1A14L 4YX2H 3Q1SL 1RU9L 3GIZH 2OZ4A 1E6JH 4L4TA 3J8F7 1FO0B 2R4SL 3C6SA 1GOGA 1JZ6A 1XGRA 4XMLH 3LDBB 4XPGL 2N7BA 1LO0L 4S0TD 4FQXA 3UTTB 2APXA 4DKFH 1MSPA 3OKEA 1AR1D 4YLQT 5D6CA 4MAYB 5GQBA 1RJLA 1QRKA 4FQHB 1GZQA 1YEKL 1ACYL 1G7LB 3IJYA 3SCMC 2D0GA 3RY6C 3OHXB 4Y5VA 5JPMA 1KTLA 5DLMH 3MXWL 5BRZE 3C8KB 4RISH 1Y6NR 5JQ6H 1JGVH 5KOMC 1RZJL 1CICD 3HCVA 2XFXA 3C60D 4Y4HD 3SJVD 3VFMB 5JHDB 4KZEL 4UQ2A 2W9DH 2CKBB 4TYUA 1ZGLA 1LEGA 3TPKA 1CZ8L 1U93B 3CXDH 2G9HA 2RR3A 5FYJE 4DWHA 3L95A 1KEGH 2Y06H 4UDTA 2R2EB 1TZGL 1AD0B 1WEJL 3QDMD 4K8RL 1H9VA 1BD2B 3C6SB 5T3XD 1G9EA 3U0TB 1INQB 3ZTJG 1JF6A 4PB9L 2VLLB 3NN8B 1K4CB 5FM8A 3QHTC 4IIQA 3V0AC 3SDDC 3HPLB 4CW1A 5T5FH 1MCSA 3BXNA 2D7MA 1IL1A 1ORSA 3TV3L 2BMKB 4NT6A 3DGGA 3D9AH 3IB4A 4ZSOB 2NX5B 4GRLC 1M7IA 3MLZH 3IDIB 4JY6A 1MCLA 4Z77A 2FEDD 2HJFA 4KTDH 2DKUA 3PP3H 4TNWK 1YPZB 3FKUS 5J11C 3QEUB 2H2SD 1FNFA 4O2EA 1DBAL 3H0TA 5DQ9A 1H8OA 4NWTH 3HE7A 3UTQA 2ICES 2AJSH 3TA3C 1SY6H 2VWEE 4K94L 2R0LH 3C5ZD 1C5CH 4DOHE 3EZ8A 1WGOA 1U3HD 5AYQA 3VH8B 4P9HH 3MUGA 1YJDC 4MXWH 3RGVD 5D7LD 5IBUB 5LGJA 4IOFC 1T1XA 3S35L 2R0KL 2ADFH 3B8SA 4QOKB 3MV7A 4Z6AT 2OJZH 4G7YL 1NGZA 4HV8A 1O0VA 4QGYA 3T2PA 5D93B 5I30L 1ZAGA 4Y5YB 3EOAB 4PJXA 4G6KL 4RGNC 1ZWIA 5DFVC 3WFCH 4NGHL 1KELH 2F15A 4H20H 4MNQA 3LEYL 3RL1B 1A2YB 3PHSA 2ICWI 1ZLSL 1KFAH 1YA5A 4QOKD 1KELL 1OPGH 3I6GB 4PD4J 5D1QC 4CMHC 1IAIH 3LQMA 1SVZA 2WLYA 3SE3C 3IYLW 2WQRA 2ZPKL 1N8ZA 5B8CB 5DRZA 3FQTB 5SX5K 2VB5A 1OGAD 5JORB 3WL9B 5GS1C 3NZHL 3HMWL 1G7JB 5ITBL 4YH6A 2R0LL 4IRSA 4NQEA 5E8PA 4HK3J 1YZZA 3HMWH 3LEXA 3FB5B 4MSWB 3HHRB 3VRJA 3OJMB 1UWXH 5LJYH 3MLWH 3GHEH 2NY0C 2XPGB 3C09B 1XF2A 3B9EA 1OTTC 3W39A 5DVNA 4U6HA 4LLVB 3UC0H 3EYVA 5HYJE 3GBNH 1A6ZB 3BH9B 4O02L 5J6HA 4OLVH 1EHAA 3QUKB 4FRWA 1WWCA 3NIGE 1MLCA 2R29H 4LHUD 3QJFA 3T2QA 3CK0H 1W0VB 5J4MA 1PX4A 4E9LA 1LO5B 4TTDC 1BEYL 1I7TA 1P4LB 4KK5D 5MEOB 4I18C 4E0RB 1K3ZA 2DQHH 5J3HD 4WI9A 4DW2H 3D1MC 4BZ1H 4I13B 5DQDH 1DQDH 2GTWA 4WY7H 2B5IB 2HYMA 1GSMA 2E6QA 1QBMH 4U49A 3SDAB 1QYGL 3H3PL 3WN5B 4AM0A 1BFOB 2FNBA 1RK1A 3KS0H 4D3CL 1UB5A 5FHAL 5HYQA 4JCMA 5GGVH 4OCWH 4PRHB 2BNQE 5B38B 3RZCD 2ZKHH 4Z7VF 1EUTA 1XF5B 5JW4N 4WEMB 4NUJB 1EHLL 1NFDA 3KG5A 3L3JA 5IMMB 3FJTA 1XCTA 4U7KA 4LKXB 1RMFH 1ACYH 4NYLA 4RRPG 5IJKA 4AEEA 2EE6A 5DLML 2GTZB 1Q9LB 3V5KB 1IAKA 2DQGL 4Y16C 1KGCD 4IM8A 2VH5H 1XR8A 1QHOA 3S4SG 1P6FA 1OOAA 2VIRA 4LSVL 5GRJL 1FE8L 3PQYD 3WS6A 5E08L 2G75A 1C5BL 1XGPA 4FQQA 3NN8A 2VDLL 1BJ8A 5JUEL 1RU9H 1SEQL 2JB6A 4NO3B 1OAUL 4MQ7B 3N1PC 1PYWA 5J0BA 5FYKE 3U0WH 2H6PA 3IAPA 4AH2A 1VB9A 3INUH 2ITDA 5AUMB 3CSYB 5EN2B 5E9DD 1MJ7H 1LK2A 3U4BL 5FYKD 1SYSA 1WIOA 2IMMA 2Y6SC 1CXFA 5SWSB 5ICZB 1IC1A 3X3FL 1GH7A 4Q9QL 5I8EA 3RWCB 2UVEA 1QO3B 3GDBA 4F7EB 3IDMB 4K94H 2VAJA 2A73A 5J11B 3UTSE 4R0LB 3LMJL 4AEFA 1ZLWK 4U3XA 1T7YA 5IHUL 1NCDH 2ITDB 4YXHL 3VI3E 1WLHA 3JWDC 5DUMH 2KZWA 4HS6A 4KUZH 4XPGH 5ACZA 1IZKA 3FQXB 3H9ZA 3QI9C 2BRQA 1LDPL 3CFEB 3L6FA 1E4XI 3GNML 3DX7B 3W0WD 1OAKH 3CC5A 3SDCA 4L3CA 4X99B 4O2CB 1Q72H 1S3KH 5DK3A 2OXGA 4V1DB 5KZCB 3O3AB 3EYUL 1NDGB 5CJBA 3PWUA 3BWAA 1JPST 3EYSL 1U36A 3BN9C 3VXOA 3MLTB 2C3GA 4CU7A 1KYOK 4KC3B 5CLWA 2FO1A 4YXKL 3JV4B 5IBLC 1J1OL 4MX7A 2VC2L 1IRAY 4M43H 2B2XH 3OXSB 1RD6A 4RQQB 1CFVH 4XNXH 2I9TA 1K6QL 3D39D 4F7EA 1AGFA 4DKAA 3RY4A 1FGVH 3LQAC 2EXYD 3G6JF 3WHE0 3OL2A 3C5SA 2CDGA 1RZIB 2CO7B 3MRQB 5MP6H 3I02A 1KNOA 1Q1JL 1S8DA 2A1WL 4HT1L 5DJXB 4QHUB 2AEIT 4NFBA 3UTTE 4FQCL 1JTTA 3EHBC 1JNJA 5DXWA 4IMKA 3L3OB 4OGXH 4RAHA 3FT4B 4HKJA 4NQXB 2B20A 1U8NA 4Y2DD 3ARVA 5D5ME 3DX9B 1PDKA 4R4BB 1CLYL 4WI3A 4KU1A 1AY1H 4DGVL 4G8IA 3HUJE 4XPFL 1BFVH 3PGDA 5CEYA 4F15B 2ADGA 5JDSA 1T3FA 3V7AG 3AS1A 1QFOA 4NQCD 3A67L 2I9TB 3TESA 2WK2A 4PG2C 3TBWA 4JQIH 3BMVA 3TF7C 3U9PL 1UJ3A 3VFPA 1NCAH 1UM6H 5D7JA 2X44D 4L5FH 3BMWA 2B1HH 4X9BA 3VXME 2IPUK 2BFVL 1OTTD 1CD1B 3LKNA 3OWEA 5CJQH 4NC0B 5B38A 1G9NC 3PJSB 1BZQK 1FL3A 4BUHA 3K4AA 4OZGE 5I76B 1LK3H 5DYOB 4LIQE 4Y89A 1ZTXH 3V79C 3NACH 5BV7C 2Z92B 5B22A 4OQ1A 3VJ6A 1MFCL 1ZT1A 5FYJL 3OPZL 1NBZA 4QXTB 1JMXA 3KPNA 5DGRA 5EU3B 2FR4B 2YPLB 1Y18A 3TT3H 4G8GD 3U82B 3V0VA 3AY4A 3MZTA 5TDNA 4NQDA 1GYAA 4LHQB 3CNKA 3G6JA 2GFBB 1N64H 3N1QC 4ZG1A 4OZGB 3PJSA 4L4TE 2Z8RA 3T8XB 1KPVB 3EO1B 4H88H 5CP3A 1QG3A 1T4KA 5D9SB 3MGAA 3IDXL 1A7OL 4ACPA 3VJ6B 4L8CA 5KAQG 1EBAA 1KXVC 2EC8A 4XVUD 5E08H 1HH6B 4J6RL 4OZ4A 1Y6KR 4AG4L 4GBXC 1NGXB 1YN6A 4DUXA 4WWKC 1GOFA 3HUJB 3L3KB 3DROA 4PFEA 5ICZA 3MJ7B 3W0WE 2DIAA 2FHFA 3BP4A 3CFDA 3C5JA 4E41E 4QRUA 4MNHB 4PJ5E 3TVMD 1IC5H 1QLRA 2WP3O 4X7EC 1DQTA 4R7DB 2YRLA 4LF3A 1B0RA 4NO5A 1D5BB 3QWOB 1AO7B 1N5YH 1YEHL 3GSQB 2EH8H 2C3HA 1WAAA 1BQLL 1N3NB 3VXUB 3DXAE 2Z35A 1J8HE 4JZJC 4LPVA 4J3SA 2XZQL 1BECA 1H3PL 4KKCC 3HPLA 2DQGH 2XN9E 4NWUL 2X4TB 4HCRL 1QOKA 3FB6B 4EXPX 4GG8A 4QHLA 5KVDH 4P23D 1BQHA 1T2JA 1I7ZA 1MIEH 1RFDL 2LTQB 5F97E 4UOW1 3RBSA 4PJHE 5C2UB 4HG4J 5EU5A 1MREH 5H37G 1RUQL 5F1OB 2EYTA 1V7NL 5FUZL 3WO4C 1UH4A 1MHHA 3O4LE 2X4UB 2R0ZL 3ZT7A 2FDBP 3QG7L 4G7VL 4GRLD 5HXMA 4H8WH 1GXEA 4S1RH 1QLRB 3HLAA 5HYSB 3TCLB 2HJKA 4F57L 5TFSL 3C08L 4GJTB 3UPRB 2YUVA 1U8IA 4IRJA 5J57B 4U1GB 1W2KT 5JR1H 4NN7C 2FGZA 1HSBB 5F7EL 1N2RB 4OCRL 4DGYH 1NAML 4CADB 5I8KH 3RNKB 1QFUL 2MSPA 4FQJH 4JRWA 5IB5A 1IMHC 2H1PL 4AIZB 1YQVH 4XPAL 3VW3H 4FS0A 1OLLA 3K0WA 3HS0B 4XCNA 2ARWA 4M4RA 3SPVB 5I1HH 2LU4A 2XTJC 2NY6C 4R6UA 4IJ3B 5IUSA 3BP7A 4ALAL 3MLWL 1MRCH 1YEEL 5L9DL 1SJXA 1H8NA 5C09E 5J6HB 4G6KH 4HFWB 4B50A 2NY1B 3ZKXC 1HIMH 2AJUL 3QDGB 5BS0B 1G9NL 4UAOC 4HUKB 3I50H 2R23B 1O7VA 2ZOLA 5LGJB 4P3CL 3RWJA 5CZXC 3DURA 5I1EH 3BKCL 2BNRB 4HUUB 4M00A 1HEZB 1FFPA 3DIFA 4NZDA 2BXYA 3O3UN 4DAGH 1ZWIB 3ZTNL 4HIJA 3HE7B 5CEZH 4X6FB 3KPRD 2OTUB 2DQJL 3O3DA 3ET9F 5HI5D 1CE6B 3MXVH 2M2DA 2CGRH 1V3KA 4G7YH 2E7BA 2C3WA 5IHBA 1J0ZA 2JJWA 1JNHB 4ALAH 4U1MB 3BUYA 4TSCL 3CLFL 1JYXA 4PJ9C 3EO0A 4BQ8A 3ABZA 1ZT1B 4Y0GA 3O2VH 4KXZI 1EIBA 5D70L 2FL5A 1IQDB 4KMLB 4PUBL 3KLHC 4NNYA 4JY4B 3BT2H 2IQAB 7FABH 1MVUA 1F11A 1DBAH 1T1XB 4M93C 4MZ2A 1JZ3A 4WO4D 3SE3A 1SMOA 1WBZB 4CDHA 4X9IA 4L3EE 1WEJH 1UEYA 2ED8A 4LKXA 4WFGD 2CIIB 3EJYD 1JPSL 4WHDA 2OTUA 4XCEA 4X8XA 3UP1A 2AP2A 1AIFB 4ZUSB 4P5MB 3FB8A 12E8L 2N1KA 1P2CA 3GFUA 4OLVL 4YNYB 3ULUF 1ZLVH 4P46A 4X6EA 5IW6B 4PJXF 2QL1A 1UVQB 4XP6H 3QG6A 4HXAL 4ODXA 1UWGL 1PGRB 4R7NA 3DWTA 4BUGA 1JZ7A 5DA0B 1IGYA 3O4LB 4ELMA 7FABL 3HE7C 5D1XA 4ELMF 5IM7A 1CG9A 1S78D 5J6GA 1FN4A 3QJFB 4XP1H 4TVSa 2NLJA 3QO0B 1P2CB 3PGCB 2B8OT 2ZG1A 2IBZX 3PXJA 2NTFB 3MV8D 1ACZA 3HNSH 4PRPE 3U4AA 1OM3L 3P11H 1ZHLA 3QDJA 5ELIA 3MLSH 1G7QA 1KV3A 5TF0A 1N7ML 4LPYA 2ZZUT 5E8EA 1KLUB 3UPAA 1CLZH 2EKSA 4RBPK 3ECBB 1JGDA 4OFPA 4X6CA 2JCCF 3MV8E 3FN9A 3ZO0A 5HD8D 4YX2L 1LEGB 1RUKL 4Y4HA 1SBSL 5TJWK 2XTJE 5I0DA 2OJEA 5E6IC 4P2OB 1BFTA 3C09C 2JK5B 3I6LE 3LQAH 4U31A 3NFPA 5A16A 1YMHA 5H8DA 2VDPL 2YHGA 2NY2D 2KZ1B 4ETYA 3BO8A 5TQ2L 4HIXH 2ADIA 3D25B 5JR1L 1VESA 5TE6L 4M8QA 1N5AB 2ZUSA 3LOWA 2HT4C 2EIEA 2NTSP 1ZA6B 5CUSL 4BM7A 2HFTA 3O3AA 2AJUH 5MENE 1A14H 4NHCH 1PQZA 2Y5EA 2MKLC 3LPFA 4PJHB 43CAB 1DQJA 2XN9D 3H3KA 4LLMA 4H0HB 4BZ2L 4HMCA 4ZNEA 4WDIB 1TPXB 1R24A 4HFUL 3PDOA 2EH7H 1NMAL 2VLKE 4MJID 4CVZA 4U1JA 4YHLH 2R0KH 4JFDD 4XP9L 4ZXBB 3ZHDA 4EIZC 3GHBH 2EICA 5KJRL 2QV2A 1YPZF 3OKYA 5MERB 3WFHB 1IQWL 4WW1B 5E0QA 3WNMA 3BKML 4KK8D 3CPLB 4LVHB 4LVNB 3MCG1 4DGYL 2PYEB 5FOJA 4LMQE 1MY5A 5ABDE 3KPLA 3U0PB 1JWMB 1PZ5B 5D5MB 4HKXB 1P7KB 1H0DB 3CVHA 4P9ML 4ZXBA 3LSOB 5SWZB 5C0FB 3RBGA 4GRWH 2N7AA 2HT3D 4Y4FB 4NRYA 1G7JA 1UM5L 3N1MC 4DN3L 1R24B 5ID0B 4Z7WF 2V7HA 4KY1L 4MD4B 2P8MA 1RUML 3HFML 1ZK9A 3NAAH 4KK6C 3SBWA 2J8HA 3NIGF 3MRKA 1TXKA 3DRTA 3VA6A 5AD0B 4GXVL 2A73B 3OAUH 4WFGE 5C0CE 5DFTA 3A6BL 5BMFL 1XGQB 5GGQL 1LQSR 2YPVH 5CKAA 2V5RA 3UTOA 4HH8A 1MCOH 4F58H 4ZFGH 4JFEE 3T09A 1A5FL 2NZIA 4F33A 1U8MA 2VKXA 5E2WH 1UM6L 1SJHA 2ZJSL 1RZKH 1AO7D 2ERJB 2RGSA 3ARDC 4XNXL 2HTLD 3F12B 4N5UA 4YHIA 2D3VA 3PWPB 4L8BB 4NWUH 5FGCB 5D96B 1TJHH 4QRRA 2GJ6B 4DEPC 5SWZD 5I19L 4UV4H 1LE5A 5FIEA 1OD9A 2VLRB 2I07A 4PGCA 5TPWL 3L5XH 4CMMB 5AYUL 1NJ9A 4HMEA 4NZUL 1FDLL 5CP3H 3CU1A 3F58L 3IDYB 4AMKH 1JPFA 3ARPA 3O6FB 4HDIA 4JFQA 1CVSC 3RZWA 4RWYL 4F7MA 3TO4D 3HG1A 5IFAL 3EYQD 1QZ1A 3DMMA 3GMRB 1GGYA 2VZ3A 3QDAA 4QLRA 3QEGH 2IQ9H 1UENA 3PWJA 5E6IA 1CK0H 4MGXA 1KF9B 2B4CL 3L5XL 1J0HA 3CFCH 3CMOH 1U92A 3AM8C 1YJDL 3WN5C 5GGUB 2PXYC 3LMJH 4Y8AA 4UILL 5BZWB 3QUXA 4G42B 5IF0A 6FABL 3GJFB 4XHQA 3RWIB 4U1LB 2Y07L 2HJLA 4PRDB 4I3GA 1D5IH 4K7PX 4ODSH 3P0YL 5EO9B 4AJ0A 2X4NB 4M6ML 2MQ0A 4Q9BA 5E94B 1ZTXL 1TZIA 4HJ0C 3MACL 2GSIB 2JJTC 4HZLB 5I74C 1U95A 4Z95L 3LN4B 4QRRB 2WV3A 4UT6L 3NAAL 4R8WL 2YPLE 5F3HB 1NAMB 2YK1L 1CQYA 5JNYB 5JHDA 4JAMA 4FQLL 3TBYA 3VMPA 3LRSA 4FFWC 3JTSB 5BMFH 4KVCH 2AJZB 5EZOL 4L9DA 1NAKL 1DQMH 1KIPB 4P4KC 4FQIH 3MLVL 2Q8BL 1J0JA 1NAKH 2HT3C 4U1NA 5GS3A 3ROOB 5IVXB 4X4MA 1FZKB 5DEGB 3BWUC 5I66A 5C0BA 4NN5B 5D72H 1CDBA 4OCSL 3M07A 3ALXA 5F9OH 3P0VH 2I27N 4XVSH 1LDSA 4NKDA 3VCLA 4PRHE 4G8FA 4QRPA 3MACH 4JRXE 5IB2A 3BEWB 4OF5A 3PP4H 5TDPA 3CSBA 4OZFG 5C08B 4RAVB 5C0NC 4K3JL 3G6JE 4HZLA 1A0QL 1HKLH 4MD0A 3GSXB 1QSED 4LVOC 4YJZL 4NFDA 4M5ZH 1E28A 4YDKL 1K5NB 4KVCL 4WENB 1KIQA 1X5FA 4XVJH 4IIQB 1G1CA 2HG5A 4HF5H 4HS3B 1I8KB 4KZDH 3DVGA 1AE6H 4NKOA 3P0GB 4PP2A 1E4KA 1OSZB 1CF8L 1MCWW 4J3TA 1JRHI 2BERA 1D9KB 4NUGL 3BP4B 3CFDB 4HJGB 2FX9L 3V6OA 2Q6WA 4DFHA 1CBVH 1H3XA 3AXLB 5E2UH 5I74B 1ONQA 4CN4A 4DZ8B 3G5YA 4X8JB 4HFUH 1I9RL 5IK3A 5EBMA 4GKZA 4YBLB 3C9NA 3MJ8B 2BOCB 1FL6B 1I3RA 3HMXL 3HR6A 2AAVA 3I02B 1P7QB 2EIBA 5ESVA 3HR5B 1U3ZA 4I18B 5FKAB 2F5BL 3N85L 5F7WC 5DRWB 5GPRA 5JIKA 4UU9A 5JHLH 5F88A 5DZNA 3ULVC 1A6VH 3NABL 4Z9KB 1FE8H 4PG9B 1YC8A 4MS8D 2VN4A 1Q9KB 1J0KA 3MPCA 1MF2H 4HUUA 4JFXA 4ZAKD 1ADQL 2XTJD 4LAQL 2PCPA 2CRYA 2ZUVA 4RX4D 4TOYL 4N9GB 1XGYL 2HH0L 2D31A 1RY7B 4HIEA 1BFSA 4HIHA 3EYSH 3RHWF 5LBSH 1TZHA 5CGTA 4N8PA 5EBLB 1AHWB 4HC1H 1OAYL 4Y19D 2FD6L 1BLNB 2L7UA 2VDQL 2XPGA 3STLA 2R1WA 3ILPA 2VLJA 2NMSA 1KACB 3KPRB 5T3XE 2DI8A 1Q0YL 5ANMA 5DD1L 4XNZB 2DL2A 2M1KA 5HGBB 2O93L 1NC2A 4OAWB 5DJAB 2ORBH 3S36H 1AI1H 2AJXH 4OBRA 4PGEB 5CJ8A 1OAUH 1T0PB 4O02H 2D7QA 2YPVL 5CSBA 5E5MB 2OL3L 1X9QA 1A6WH 1P4IL 1JNNL 5ADOL 3QHFH 4E0RA 3TJEL 1CFBA 3IFNH 5J3HC 4HKZA 4RIRA 1FV1A 2XWTA 4JM2D 2AXFB 1HCVA 1Q8MA 3UBXB 3BIKA 4N0FB 4HK0A 4PLOB 4XVTL 5D70H 1BJ1H 1TPXC 1ETZA 5C0DB 1I9IH 5FDWB 1I3VA 4G9FD 4ZFOB 1JZ5A 4LMQI 4G6ML 5MHSD 3BUYB 5EZIH 1VACB 1D5XB 4WEUD 1LEIA 4OF0A 4R90L 1FSKC 2UYLA 4LLQA 1CD8A 4LRIA 1XF1A 3EFFB 3RVUC 2VXTH 5BRZA 2NQCA 1UC6A 3GB7B 4YPGA 4WFHD 4KQ4H 4QT5B 3EYQC 3MBEA 4JG1H 3MOBH 3O81A 2WBJD 3QUML 1I1AB 1PG7H 4Z7VB 2JLLA 4JQVC 2OJZL 3GHBL 3SKJH 3DURB 1MCFA 4X5WA 2OL3A 2C9AA 5HHQA 32C2B 4YO0B 3UTSA 3HI1A 1YUHA 3ORJA 1A2YA 3QDJE 3CK0L 3VWJD 3L5JA 2IANB 3P9WB 4KJWD 3REVA 4OGYH 1KENL 3GUTB 4RFOL 3ZZ1A 5BJTA 2JK5A 1DR9A 1AR2A 1AQDA 3F65A 2BVUA 4LLWA 4P2OA 1E6OH 1BBJB 3OXRA 1J10A 3V4VH 3ULVD 4PJCF 3ARSA 1MUJB 3QYCA 1KT2B 5T33L 4RRPA 1CDUA 4M1DL 3HNSL 2NY3D 2XV6B 5DEFB 5T1DL 1XH3B 3C8DA 3B2UC 4J3WA 3VXUD 4KRNA 4Q0XL 5F7FA 3G5VB 2XQYK 4ZUVB 1CI5A 5CHNA 1I7TB 1KN2L 4DCQB 5GGRY 5IGXL 3PNWA 2J8UB 2BSSB 3GK8L 3JV6A 4WDIA 2QR0B 3MRLA 2ERJC 5DMIH 4MAYC 2YA1A 1UACH 3CFKB 1RIVH 3B8YA 3BQUA 4XP6L 3UMTA 3K1KC 1W0WB 3D18A 3P73B 3VFUB 4O2FB 5IB4A 4U6HB 4MMXC 2P47B 1GPOL 3N85H 4EI5B 4Z5RA 2X4UA 4U2YA 3KNBB 4QHMB 2VISA 5HHMB 4P23A 4L4VA 2CJUL 3NFNB 5EO1B 5FYLL 1X5XA 5KS9B 3HAEH 3MLPA 1RJYA 3ZTNH 3NZHH 4TN9A 4XP4H 4ZS7H 4NKQB 3MROB 2DQEL 2W0FA 5F1IA 3VFVA 1BQUA 2O61B 1GGCH 4XCNB 2RJMA 3P9MB 4D9LL 3WHXA 4PJCB 4L3CB 1I7UA 2PR4L 3ARFA 3FQUB 4WHCA 4OZHA 3KYNB 2SEBA 1IT9H 2YPLD 4WGWB 5EIIB 2APWA 2QQLH 1AC6A 3FT3A 5D7LB 1U42A 4ESKA 4LLDA 1AKJB 3MRIB 4FTVD 4KRMB 1N5YL 1X5GA 2AGJL 4I3RL 4QKXB 3TYGH 3GMOA 4M8QB 3H2WA 4Y4KD 5E8EB 1KCRL 3O2DA 1LD9A 5D8JH 4PJCA 4IRZH 3MMEA 3W11D 3O11B 1N6QH 5TDOA 2VQ1A 4QO1A 5IT2H 2P5WE 3PP4L 3WJLA 4DKEH 3TBSA 1A47A 5AUMA 3P40A 3K8MA 3MV8B 2MQCA 4OBSA 2Z31B 4OJFL 3ZE2E 2FCBA 5CD5C 4PJGE 4X4ZA 4TVPE 5HVFB 4XMLL 5MHSE 3U2SB 4NQEE 1J18A 3MMEB 2B0SL 4NUGH 2XYCA 1TVHA 2GEEA 1YNLL 2PKDA 3BP5A 4M7JH 4Y16B 5E9DE 1SYSB 1CT8B 4Y5YC 1YEDB 4C83B 1V7NH 4RMTA 2ED7A 4QXUL 2DDQH 1RZJH 4UQ3B 1CE1L 1E27A 2D9CA 4FG6C 5L8JB 4WHYH 1LO4L 2WZPD 4FQXD 2D7TL 2FEDC 4J8RB 1WCQA 5ETUB 2Z92A 5LBSL 3SKNA 4AEIH 3BQUD 3HTLX 3VW3L 4PJXE 1XGPB 3QDJD 6FABH 4EUPH 4FQJL 4TRPL 2FO4B 3LAFA 4KV5F 5HYQB 4JDTL 2HTLC 1MFAH 1U0QA 4OCRH 3JWDH 3GSUB 4NZJA 5C08D 1P53A 1RV6X 4PLKC 4YHPA 4HKBA 1A6VL 1T1WA 5F96L 4HWEH 3QWRA 3EKCA 2EEBA 4M5YL 4LSPL 4KI1A 1FDLH 4D9QD 2NW2A 4A6YL 4M61B 2V2XA 1MRDH 1FCGA 1PSKH 3NGBB 1UXWA 1DQQA 2P7TA 4DGVH 4OGAC 4P5TD 5C2BH 4XNUL 4LCIH 1QQDA 4G9FE 4O4YH 3BP6B 4TSAL 3QFJA 1MIML 4U1IA 1DLHA 3PF2A 4KKNA 4R2GB 1YY8B 1K2DB 3I2CH 3QQ3A 1TETH 3UTPD 2DTMH 4ZPTA 1WF5A 3WJJA 4JQIL 4JANA 4FMKA 5IBTH 4GW5A 3IKKA 5GS0C 4RNRA 3PWVA 2WBJA 3D39A 5CHNB 4HF5L 2Z9TA 5FECA 5E2VH 3VE0B 4H25B 5A2FA 1MH5A 4JJ5A 1MOEA 3B83A 5C8JA 1XGTB 2G2RA 4ZO9A 5CBAB 3VWJC 1G7PB 2LV4A 3RWIA 4U1HA 3HG1B 3VFSB 2IAMC 5I8OH 5IKCB 2EDNA 5C07B 2GCYA 3PV7A 3QDGE 5JIHA 1AGBA 5E2UL 5E9DB 3F58H 2QADC 4LF3B 4GRMA 3VFOB 1EJOH 1HSAB 3PGDB 3VFGL 3AXLA 2BRRH 1FZJB 2RQ8A 4BZYA 5A2IH 3EIFA 5T1LB 1WJ3A 1AFVH 1JGLL 2AJVH 4YHMH 4LASL 3SKUD 3EJZD 3IFPA 5F21B 1MFBH 1Q94B 5DVLA 2XZAL 4E41B 2XA3A 4QF1B 4F7TB 3ZKND 4KK5C 5TE4H 4JCLA 3B2UD 4IMLA 1G6RL 5DHVA 2B1HL 4JKMA 3SE8L 3LS4L 2W07A 2Z93B 3AGVA 3S88L 1LE9B 4QTHB 2Q7NA 2VOTA 3RP1A 3LS4H 4OZHB 4YHYC 5E1AB 2NPLX 3Q5YA 2ZUYA 3GBMH 3TP4A 3NCMA 1KPVA 1S7TA 1MCHA 4RDQF 2ESVA 4GRLB 2V5TA 3JTSA 1S7UA 2NXYC 1CLYH 5FKAA 3CDGB 5ESVB 1TENA 3DX8A 3VXMA 5I1CL 3GMQA 4HIIA 4KVNL 4GRMB 2XZZA 4ETQA 3RZCB 5F88B 1FLTX 2HLFD 3I3BA 2JF1A 2K1MA 3ROOA 1FSKB 5CIPB 3RVTC 5D7LE 2F54E 4S1DC 4KV5E 4LHJB 2WLZA 3ARUA 4Y16D 2O5YH 5IMKA 4B41A 4AEHH 5IHUH 3VI4F 1FGNL 3TN0A 3RL2A 3L3KA 1CR9L 2WMPA 2VXVH 2EDXA 4ODVH 4HWNA 1YNLH 4R7DA 1PLGH 4XCYB 5DT1H 1QFWI 5IW1B 5DTFB 3GSRA 1C5BH 3BEVA 4UB0H 4O5LL 4WU5B 3QJHB 2EIZA 1YYML 4R97B 1Y0LB 5ISZD 2XKNA 3O0RL 5CEZE 3IFLL 5JXEC 3CDFA 2DWDB 4NOBA 1MQKL 2OMBA 8FABB 1CXEA 5HHVH 4HIIB 2E7LA 3VXPB 4HPYH 4XWGL 4KUCD 3CH1A 1OWRM 3LKPB 4PJIA 1KLFA 4MLSA 4FTVB 1AKJD 3D85A 1OY3B 2BSTB 2NYYC 1R3KB 1AHWC 1F97A 1MJUL 4G6AD 2YMXL 1JF5A 3U30C 4JZNA 4P2RD 1G7MA 2YA2A 2D2OA 5DJXA 4I1NB 4TVPD 5DURD 2YEZB 4LNVA 5DRXA 3HZYB 3RVXD 3QI9D 1B2WL 3IU4H 4R3SA 2ICEA 2VSCA 2HFGL 3K80A 1FNHA 3W9DB 2QQLL 4TRPH 1U8HA 4A6YB 1MWAA 4OQTA 5BW7A 3E0GA 5C0EB 1EK3A 1S78C 3D2UD 5DC4B 3P9LB 4Q6IA 1RUMH 3U36A 4PJGA 4NM4H 3MREB 4ZQKA 32C2A 3PWNB 1K9TA 4EN3B 4QRSA 4RMWA 1I4FA 4IDJH 3WNNA 1ND0A 1I1AA 3ZKQD 5I73C 3B2VH 1NMCC 1U3HB 3HC4H 3DV6B 3S97C 4HUXB 5DJ0B 1LNUB 3GNMH 4JVWA 3SHSA 5HPMB 3M8OL 3S9DB 1CD1A 4PLKD 3GHEL 4OLZL 1AP2B 5BV7L 1U8OB 3ARRA 2XY1A 3T0XA 4HG4K 3I3EA 2W91A 4JN1L 5EBLA 5ITBH 5EFIA 4QHKJ 4UDTB 2LAAA 4OZIA 4LCWA 1QBBA 3VFNB 4NPYA 2KL6A 3FL7A 1T89A 4M6NL 4ODXB 2GJ6E 1ZA3B 4N8CL 5D2NA 2J5LC 1VGEL 2JELH 3PWPE 5JW4R 3FAXA 5L6YH 4OM0L 5T3ZE 1KYOJ 3WFCL 4DUVA 2DQCH 5T1MB 3O4LD 3P77A 2PW2A 1VDGA 1ZSDB 1HNFA 4ZTPL 5LAXA 4ORGB 2CRZA 4FQHA 3QPXH 5EFIB 1BD2D 1J05A 3D5OF 5DJCB 3TNMA 1YEIL 5BW7C 3TPUA 3GJFH 3EO0B 2E9WA 2XOTA 4JHWL 4X7DC 4M62H 5IWLC 1FZOA 2ID5A 4M3KB 4P9HL 2FIRT 5GGSY 2OK0H 3HPJB 4LKCA 4JG1L 4P4KB 2DQEH 3EO9H 3VDCA 4U3HA 4PS4H 3X11A 1IM3A 3H9HB 4XNZC 4QXGL 3B9KA 3CFJA 2J1KA 5FO8A 2H45A 4PJHF 3REVB 5CBEA 3NIFF 5C92A 5DD0L 5DRNB 4R26H 2X4TA 4IHOA 5IP4A 1QPXA 5DC9B 1UZ6E 2BVTA 4G9FB 4LLDB 5C6TL 4YDIH 3IDNB 4C57C 1JWUB 4CU6A 1DP0A 3RWEA 5B21A 3L3DB 2YA0A 4HIXL 5IK3B 3TYGL 4ZD3H 3AY4C 3NH7H 3ARBB 4LSVH 3U48A 1MAMH 2FRGP 5AZ2H 3T1FB 5K9JH 3KWWB 5CEZD 1HH9B 5CP7A 15C8H 3FZUC 4HIJB 1S7VA 3K4DA 4WW2B 5D1ZD 2OS7A 1HYSD 4I3SH 3EUUA 3HE6A 5AAWA 4Q0XH 2NY4D 1WZLA 1AGEA 3MA7B 4I5BB 1G9MH 1GHFL 3MYJA 2F58H 3F5WA 5DEFA 5C71A 4PGDA 4YHZH 2J5LB 2EKSB 4LCYA 3V52L 5D7IA 3SGDH 3ARDD 1PW3A 4ZS7L 3BRGC 12E8H 1OW0C 4S1RL 5F44A 1YEFL 5F1NB 2H2SC 5D7JC 3D0VB 3HUJF 4OUOA 2CK2A 4UAOB 4KH2A 4XT1C 2HVJB 2ZWLT 3CXHK 2VDOL 1MLCB 3WUWA 2Z31A 4Z8FH 4U1SA 3AC0A 4RAUB 2G75B 3QDGD 3IAQA 3NVQA 4PJDA 5JW3H 1R5VB 2RCSH 2NY1D 4JFPB 1AGCB 4N5ED 4ODBD 4NO0B 1OB1A 4I3SL 4HCRH 4U6YA 4NJ9H 4J7RA 4OZIF 3CXDL 2BK8A 3EYFB 3IFOA 4G43A 4QNPF 5HVWA 5ID0A 4YUEL 5F7EH 2W9DL 5EU4B 3MRQA 3SPVA 4PRHA 2CDEA 3I6LD 1BLNA 1EGJL 5FK9B 1S9VA 4NQCB 5GGTA 3DRTB 1S9XA 1BVKA 3MLZL 5ETUA 2X6MA 2X4RB 1IEAA 1JYWA 3RDTD 3LKQB 4PLJD 1CL7I 4KTYA 3EYOB 5B3JF 1UADC 4G6FD 1UB5B 5IEKB 4YHOL 4OLUL 1JZ4A 5F1IB 1BHGA 3NZ8B 4JRYE 4L9LC 2NXZB 3V6ZA 2A2QT 2P5EA 3GSVB 1T3FB 4HJ0D 3PGCA 1KPUA 4TNWF 2J8UA 4YWGH 3AFLA 3X12A 4M6OH 5K9QI 1U8PA 4QRQB 4ODVL 4NHUB 1RK0B 2DJUA 4KHTH 4EUPB 4YHIB 2UWEF 4JFDE 2CK0H 1CR9H 1VENA 3FFCE 1KLGB 1QHPA 4DVRL 2APTA 5KBNC 2UUDK 2NCMA 3LEYH 1FRGL 3MRBA 4N9OB 4FFYL 4LPUA 1LP9B 1BQHG 5FF6B 2ZCHH 5CAYB 5EB9A 2VQ1B 1BJMA 3WKMH 4L29B 3UTSD 3O9WB 5BVPL 1G9NH 1S5HB 2IANA 4HH9A 3QUKA 4FP8H 2WINB 4J3XA 4OSUH 5IROA 1DTUA 1T6WA 4NJAH 2EC9T 1WFUA 1DQJB 5D96C 4Z7OF 1IC4H 3M8OH 3NIDE 4V1DD 3LEVL 1IBGH 2OL3B 3H7BB 4HKBB 1HINH 3PL6B 2V2TA 1T4KB 3S88H 1FPTL 5IQ9A 5GRZA 1L9MA 4JFHD 3E8UL 2D7NA 2YBRA 1MCIA 4HK3N 5SWZA 4R8WH 5GISL 1RUQH 2CXGA 3MRKB 2VR4A 1HHKB 4NSKA 4F2MB 1OF2A 3REWA 3QCUL 3PABA 2YOCA 4NNPL 2DLFL 3MR9A 5I16A 3BX7C 2V7HB 1T2QL 2DBLL 2LVEA 5C3LD 1JWUA 4ZUUA 4ELMB 2HKHL 3DX8B 2MCG1 5GZNC 4QNPE 4UTBH 2NLJB 5DJDB 4DKDC 4YXLH 3LQZB 2FH8A 1HHGA 4O51A 1SEBB 1CFTB 2HN7A 2UVFA 3WUWG 2I24N 1I8KA 2HFEA 4IRSD 3O6FD 4TQEH 4PRIE 4OD1L 3CLEH 5FKPB 4O58H 5JTWA 1E6JL 4DJMA 2PO6B 4D8PA 4XGZB 3L3IB 2FBOJ 4ZO8A 1JI1A 2H41A 3LRGA 1PYWB 2R2CA 2W0KA 3LKRB 1CLOH 5FGBA 3GSNA 1OP5H 2OYPA 3QWOA 4MB3A 3SKMA 3G5YB 2DYPA 5GZOD 5GS0D 3NCJL 2VL4A 1SJVA 4J6RH 3RFZC 4TUOA 4JM2A 2R2EA 3UYPA 1KC5L 2BY1A 3GMOB 3FFDB 4E5XA 3MRHB 5EUKB 4J3UA 4ODTH 4Q2ZB 1WUNT 4S2SA 3BGAA 4ISVA 2V9RA 3WCYA 5J89A 2KKQA 1HH6A 5C0CD 1ZEAL 1FAIH 1ED3A 5D7LA 1GGIH 2Y7QB 4XH2B 4JJ5B 2O5ZH 4MD5A 3OAZH 4NZRH 3C5ZA 5JZ7C 1N0LA 1S7TB 2CRIA 4MS8C 3TH2T 1N64L 1F2XK 4DVBA 4K7FA 5IB2B 4YAQA 3RWHB 4NRXA 5GSRB 4Z7WE 4QRTA 3ALPA 3UO1H 4JM2C 4ZUWB 4P2QE 3QUXC 1XGUA 4W81A 1UCBL 3IDXH 3NACL 1TZHB 3X3FH 1EVUA 1NBYB 1FIGL 1S9YA 3C2AL 2DLFH 1MCDA 5F7DB 3WD5H 3AU1A 3VD9A 1KJ2B 2JJSC 5EORH 3GBML 2P5EB 3ARXA 5JIPA 4HJGA 2NXZC 1NCUA 2WWMC 2V5YA 5EA0L 5C0EA 5TE4L 4M7LL 4BFBD 5KVGH 5EBMB 3D3VB 1L6ZA 3OGCA 4Z78A 5MI0B 4J23A 2A6KB 3X3GL 1I3RB 3WEXA 4U6XB 1LEKA 3S34L 4P2QA 1LE5B 3JV0A 5GSRA 4PREA 3JWOH 1HE7A 1DBBL 4DKEL 5EUOB 1T1ZA 1RZGB 4UI2A 1R3HB 2BX5A 1NCCL 5DHYB 1ONQB 4DZ8A 3GIVB 3MZGB 1YNTA 1V05A 2W59A 4UBDD 4NKDB 5B8CC 4QRPE 2VXQH 4XI5C 3U7WL 4OGXL 1KIQB 4NQUA 4OCMC 5EZLB 1BMGA 4JFHE 3STBA 4MA7H 4PP2B 4ELME 4NZTH 5L0QC 3RPIA 1FO0H 3HKFA 1SYVA 3VMNA 1WFOA 3WDIA 3AB0B 4ZFFB 4MA7L 1ZT4B 2D31B 3ZE1E 2E7CA 2B4CH 1QFWM 3VXSB 5KS9E 2CK0L 1REIA 5BV7B 4UTAL 4UT9L 7CGTA 4NQDD 4Z7VA 1JTPA 4S1SL 4FQCH 1IAII 3TVMA 1YYLL 4L4TD 4M1CC 4P2OD 5F3BA 2NYYD 2FL5B 5AYUH 1AGDA 2A9ML 3G6AA 2E27L 4IIQC 3QCUH 4OIIH 4MJIE 4NC1C 1OAZH 4N0RA 3G6JB 4ZFZB 3UJIL 4Z0BL 4JM2F 2FHBA 5GRUL 5CMAB 5F9JB 1CXHA 1HQRA 3PQYB 3E3QE 3S37X 4KTEH 1U8KB 2YR3A 1J05B 4KDWA 4RFEB 2Y9RT 4GMSH 1YN7A 1A6PA 1EEZA 3JWDL 4OCYL 1CFVL 4JEGB 1U95B 2VXSL 3PV6B 3TO4A 3HI1B 1MFNA 1FVCA 5KW9H 3L1OL 5FHBL 3M17B 4XP1L 1C5DB 3FHQA 1X7QB 5GGVY 3VXSA 4E41D 5I6XB 3O6LH 2D7TH 5B4MD 2XKNB 4G8GA 3ZT5A 5DRNA 5ILTH 3LY6A 1I1AC 2A9NL 4QXUH 5JPNA 2KH2B 4DW2L 4YIQB 1OAKL 1I9EA 1FH5L 1G7IB 3BSZH 4OAWA 2UWEA 4NIKB 4I48B 4GAGH 4ZS6D 4FQXC 1J0YA 4NQSA 3OKMB 1BZ7A 4X83A 3T8XA 1H3WM 3MJ9L 3WNOA 2VLJB 5K9QG 1FN4B 2VYRE 3QBTB 3VI3F 3MA9L 4WFFD 2P8LA 4H20L 1WICA 4U6VH 3DUSB 2GKIA 3BZFA 4KKBD 4I8DA 4K07A 1NCWH 2OR9H 4TUJA 1FLRL 4WFFE 5DK2B 4U1NB 5M95B 1XCQB 4MNGB 3DUUB 2OMNA 2ZNWA 1WK0A 1H5BA 4GG6A 3M17A 4NO3A 5ERWB 3KLAA 2X4OB 3K81A 2ENSA 3BAEL 3UTTD 4F9LA 2EIDA 3U79A 1A6TB 1VFMA 1CLOL 3F7YA 3OG6B 4NN5C 4OZIB 1DQLL 5H94B 4MQTB 3WV0A 2HTKD 4GG8B 4P5TC 1JNLL 4HX1A 3ULVL 1KT2A 4HUWA 3TIEA 4NN7B 4OF8A 2I25N 3VDAA 3DJ9A 3RWEB 1H3VA 4FFWD 1FNAA 4EJ1C 3O45A 4G6JL 5DJ6B 2CQVA 1HHJB 1N26A 3AMLA 1OGAB 1L0QA 1JRHL 3BFOA 1P9MA 4G43B 5HY9A 3FONA 3FN3A 3FQXA 4EVNA 3HPJA 4CVXA 2XY2A 1WCBA 4N1EA 1Q9KA 1QVOA 4PJ8A 3RVWD 3FN0L 1KTRL 1SY6L 4FZEH 4U0RC 4KGJA 4RMSA 2QQNH 4UNVA 1SBSH 2CJUH 1Z5LB 2Y36H 3HB3D 5DJZA 1R3HA 5K59F 4Z7VE 1LO3H 2QSTA 3MNZB 5I17A 1XH3A 4JRYA 3KPLB 3U0PA 3MRFB 4LCYB 1J8HB 3UDWA 3TPUB 4W70A 2CPCA 43C9A 2AS5M 1CL7L 1OB1B 43CAA 4F37K 1MLBA 4G9DA 1IGYB 5K33A 3EOTL 1G7HB 2Z31D 3CSYA 5EN2A 5J1SC 5T5FL 3HE6B 3BIKB 4N0FA 1JIBA 4D9RE 1OQOA 4TOYH 3SCMD 1I8LC 2DLIA 3BT2L 3TH3T 4U1SB 1P5UA 1D5MB 3MYJB 4MMZC 1QSEA 2H9GB 3PHOA 3WFZA 2E8ZA 2MMXA 2QHLA 4UINH 3CX5K 1TTFA 3WSQH 1T21A 2R2HA 2P1YA 1TTGA 4WVRA 1AXTH 3Q6GH 5DJ8A 5C0GA 3V4VL 4QRPD 2AK4D 1ZLVK 2X89D 3EYOA 4YDVA 2PF6A 5IQ7H 4LOUD 4GKOA 3MV8A 2Y36L 4XI5D 1YMME 2QQKL 3FB7A 3WHXB 5JA8B 4HEME 1KCVH 5D2LB 4LCCC 1HEZA 1GGTA 3GRWL 4JG0H 4BH8A 2FJHA 5AG9A 2ADIB 3QXDA 2APFA 3SN6N 1CBVL 2IBZY 3DYPA 4UTAH 1YUHB 4H1LB 3K1DA 4MDJA 4YDVB 5EU6D 3ARGC 3N1FC 3T4AB 3OGOE 5MEOA 4RBPH 5L9DH 1P4LA 1VPOL 1A3LL 5LWYH 5CSGA 5IW6A 4OZFB 5JPMB 3QUMB 3BD3A 2MFNA 5KTEL 1E4XH 5HDBE 5SWSA 4APQC 5HPOA 2UWEB 3I9GH 4MXWL 4FOMA 3F8UB 1KJ2L 2V7NA 3G5XA 5H37H 5HJ3B 3MLXH 5GS0H 1WIUA 3VRIB 2CLZB 1XFPA 5KVFH 3QIWB 3MJ9A 3GSVA 2XKSA 1Z9MA 3IFNL 4OT1L 3WKNA 4DN4L 1NLBL 5E8NB 3SKOB 4TSBL 3S96B 2OL3H 3D87B 2BNQB 4X98A 2Q8BH 1T7XA 1A7RH 1CGVA 4U6VL 4R4BA 1D5ZB 4XCCL 5MEND 3FO2B 5KG9B 2IMNA 1EFXB 2XNAA 4PBVC 5C3TA 5M94B 1TTUA 4LCWD 1VFAB 3FB8B 4MSWA 1FNGA 1G6VK 5HI3C 3MRBB 3TT3L 1FH5H 2XTLA 1ZXQA 3QRFM 2GYSA 2HA1A 5JW4Q 2PXYD 3V5DB 4WI2A 1KLUA 5C08A 2AQ3A 1UXSB 3VA2C 3AB0C 4ETQB 2GK0A 3DHJA 4JZJA 5B39B 2XWBB 5EOQH 3NOIA 5KS9A 2DF3A 3SGKA 5IVOA 4OZIE 2EYSA 1CGTA 3PL6D 2FECL 1FAIL 3V6OC 1E0OB 4POZC 1F58H 4JFPA 3MRCA 4RWYH 4NC1E 4P59H 1UM4H 2I5YH 5SWZE 4YR6B 2H32H 5B39A 3A6CH 3PGFL 2J88H 2HVJA 3V6BR 1AXSA 3UZEA 3AREA 4MVBC 3PDOB 3HR5A 4HC1A 1HI6A 4JKLA 2YD8A 3LZFL 3U7AA 3NBNA 5KVDL 4PJGF 1RZKC 4OCNC 5DTFA 2EC9U 3R1GL 4G3YL 4LCCB 2GT9A 2CIKA 1YNTB 2VSDA 4JO1H 3VD7A 4Z7UB 1UWEH 2VR5A 5EH1A 3WLWC 3S98A 2EIZB 3UBXG 1XGTA 3WJLC 3MGTA 4QY8A 2VLKB 2NZ9D 1MI5E 3E2HB 5IG7B 3EDJA 2VAAB 5FM4A 1MCOL 4F58L 1UYWL 1F8TH 4K2UL 1LD9B 3D39B 4UTBL 2VL5A 2FJFA 5ACLA 5D4QA 2J6EL 5DVKA 5IVXA 1FGVL 5GGRB 2XXMB 4Q9CA 4ZDHB 4MA3B 4Z76B 1U8QA 3CFBB 4OZHE 1K6QH 4KMQA 2CLVA 1NGQH 4TPRL 3TO2B 4HJJH 1WZKA 1QUNA 1N59B 2FYYA 2Y25A 3SEPA 1AXSB 1K85A 3QISA 4AG4H 3MLUL 3TN0D 4K7PL 4M7LH 5TDPB 3P0VL 2X05A 1WFTA 5IEHA 2BFVH 1HHGB 2PO6C 4WIQA 3HI5L 1KPUB 1NSNL 4KTEL 5HGHB 4IRJD 4BSVB 1AGFB 2Z31C 5GHWH 4UV7H 2OZ4L 4DK6A 2Y7QA 1A4JB 3QXVA 3RWJB 3ILQC 1QACA 1EAPB 2CLVB 1SMAA 4X7CC 3WN5A 1IGJB 4LU5H 3RNQB 4HHAB 1T5WB 5HTSA 4URTB 3G6AB 1FO0A 3HI5H 1OW0A 5D1ZA 4ZYKA 3V4PL 4K7FB 1DQQB 2P7TB 4NDMB 5ALCL 2FJFB 1A4KB 1U8LA 4YXHH 3QIBA 4WU7A 4X0KA 1EFQA 4ZUWA 1OTUC 2Q8AH 4PJ8C 1NDGA 5JOFA 1JMZA 5F71A 1CICA 4HKJB 3U46A 2NZ9C 1EH9A 2R15A 1Z0NA 1FORH 4AEIL 3TYFA 1QNZH 5IFJA 4LBEA 3UJTH 4OLYL 3QR2A 1RIHL 2F54A 3T0EB 1ES0A 4I0PB 3N0PB 2VLRA 3DHMA 4X80L 3VXUA 3MV9D 5I1LB 2VXQL 3U7WH 3V2AR 3QUXB 5D1ZC 4N0CC 3P4MA 2GAZB 1G7PA 4JQVA 4N8VB 2VERN 4NZUH 2FZ3B 2AI0H 2R1WB 4YHKL 4W68A 3U36B 1WQVT 3VFOA 4NQDE 4RNRB 2X4PB 3ULSA 2FWOA 4IOIA 4LHUA 4HBQA 5CS7A 1DDHA 2X09A 1J11A 3MX0A 1VSCA 3W9DA 3PABB 1DVFD 1P1ZB 1QRND 3OZ9L 5D71H 5DF0A 5IJVA 4YGVA 4Z7NE 4YFLF 2AJZA 3SGEH 1AR1C 3PQYE 4TQEL 1Q0XH 3DV4A 5D2NC 4IHOB 5FCSH 5TE7H 2ADJB 4Q6IB 5JW5B 5CGMA 5F96H 5CIPH 4GAYB 1UG9A 1I8IB 2AK4E 3T0WA 1IEBB 3LKPA 4EOWH 3HZKA 4KK9D 2YD7A 3OAUL 3KDMB 1MEXH 2BVYA 1P1ZA 4ZFGL 4JZNB 1A21A 3O6KH 2QADD 2EDWA 3NCBB 3RU8H 1CFSB 1WTGT 4WW2A 2BMKA 1A7QH 5DA4A 4XBPB 1UQSB 4NO5B 4Z7UE 4Q9QH 4KQ3L 2OQJB 5KVGL 1ZHBA 1S7RB 5IHZA 5EU7E 2F74B 1URLA 3TBYB 3TZVD 2JJVA 2X70B 1BEYH 4M9PA 1FC2D 5KSUB 5FFLA 5HGDB 3QPQC 1JHKH 1INDH 3WE6B 4F15C 3WS6C 3LB6C 4LSQL 2AV7A 2DMCA 3SOBL 1G6RH 1SEQH 4XMKH 3DOSA 4OT1H 3OAYH 2F58L 4AT6A 1JPGA 1JV5A 1NFDE 1M7XA 3SDAC 4LKCB 1K4CA 5E1HB 2CKBA 4X7SH 4LRNH 4KXZH 3DX6B 4WJ5B 3W5MA 1R3IH 3HAEA 2DLTA 2VLRD 5KANG 3G04B 1RJZB 2VISB 5I8CA 5KJRH 3KXFD 4YHYB 5EBGA 3JVGC 2QHRL 1AD0A 4LNRA 1KTLB 5EBWB 4PJEE 2R2BA 4TUJB 5JLZB 4OF7A 5HYSG 2AERT 4YHNA 1OQXA 4P2RE 2F53B 1QLFA 3B6SB 4P4RB 4UQ2B 1KSRA 1F6LL 4WFEE 1NMAH 4LLAA 2DN7A 1BVKB 5CJ5A 2DQDH 3BGFB 2E3VA 3JWOC 4JFFA 4X6DB 1PD6A 3QP3A 5F1SA 4BZ2H 1S7VB 1KEML 1C08B 4E42A 4ELKB 4F3FA 4U33A 4LARL 5AWNH 3DPBA 5CEZL 4Z7QE 4PP1C 5DR5H 4D3CH 3QNZA 2FGWL 4GO6B 3WUZA 1FL5A 3QNXB 4WUUD 3QXWA 1U8HB 3G08A 2VDLH 4HUWB 5EWIH 3TIEB 2E7LC 1JF1B 2Z8WC 1IJ9A 1UJ3B 1BZ9A 1MQ8A 3FQNA 1S9XB 4AQOA 5JXEA 3Q3GB 1DANT 1OT1A 5C0GB 1FP5A 4PJDE 4GKNB 4P2RB 3LKOB 4KHXH 4WGVB 2QSCL 4X6BB 4JFFB 4H0IA 3TA3B 3FONB 1U8LB 3QAZB 1F6AA 4GSDL 3S35X 3QDME 5MI0C 3B9KB 5EC2A 1JUFA 4NO2A 1YMMA 4OF3A 5GIRA 3O9WC 4P46C 3O45B 3LKSA 1JGUH 3SE4C 2EDKA 3FQNB 3LVEA 5AEAA 1T7ZA 5I9QC 43C9B 4QHMA 4LCUA 4FN0A 5BO1H 3KLDA 4AYFA 4XRCB 4GRWE 5L0QB 4BELD 3O3DB 1BBDH 1QFUH 3GBLA 3LEXB 2O61A 3D39E 1P69B 2ZOKA 3VXRB 4OLZH 4K8RD 2A83A 2IGFL 1CU4H 3QDMB 4IJ3C 4D9RD 1TCRB 1WTLA 2BSSA 3QUMA 5A2JH 1VACA 4JFDB 3FQTA 1A1OB 1QVOB 3TT1H 5JDJA 4MJIB 3QHFL 2GW5A 1MHEA 1UWGH 4UOJA 1IL1B 2DQTL 1OPGL 1BOGA 2CDFA 5CJOL 1KB5L 1I8LA 3SJVB 2D03L 3ULVF 5ALBL 1OP3K 5J9PA 5EC2B 3HUJA 4X6DF 1KJMB 2NY0B 3KGRA 2YC1B 4JREC 2FBJL 5J1AB 2LE9A 1A9EB 2EDFA 4YEEA 4OJFH 5HPMA 2VTFA 5F1KC 1CDHA 4YIQA 1NUDA 2R8SH 5DDHB 4HULB 5AWNL 1LHZA 1JN6A 3IF1B 5IQ9B 4YZFE 4XAWH 3T3ME 3VXNA 1ZHNB 4ERSH 3MLRH 4AM0B 5KN5A 3WNKA 2ITCA 2HMIC 4P46D 3BKYH 3IJSA 5I71B 3MBEB 1EO7A 4PLNC 3NA9L 1RIUH 3T2NH 2QLVB 1VEMA 2FLBT 4B0MM 2WWKO 3RI5K 1CGSH 1B4RA 2ICCA 4MA1B 3IKCA 3VWJA 2W1NA 1A9EA 2PYFB 4X5XA 2D0HA 4L1DA 4D0DA 2Q86B 1IC5L 2O26U 3ARBC 4NNXA 1MFEL 1BFOA 3BKYL 3CH8A 5IIEB 1CG9B 1RIUL 4P3DA 1IM3B 3H9HA 4ORZC 2G60H 1HNGA 3PDDA 1KFAL 3NCYS 4NRZA 1A1NA 3CUPB 3A6OA 3VXQA 3B5HA 1PFCA 1M6OA 2C7UB 4BSWA 3HG1D 1MHPL 3I50L 1DBKH 3T65B 4JRXD 1YEIH 4WO4C 5I1KH 4I5BA 3VD3A 3BIBX 3QFJD 1M71A 4GMTL 4F7PA 2R1YB 4P5TA 3O11A 3QEUA 1A3QA 5FYJD 1KCSL 1YEEH 5J7CC 1ED3B 1RUPL 4KJQD 5C0AE 4BYHA 4P57A 4NP4L 1UJTA 4L9LB 3MA9H 2CLRB 1IKNA 1FYTB 3OMZA 4ZFOL 3GSWB 3U4EB 1IGFH 2R69H 5E4EB 5EIQA 1VGEH 3SBWC 3MODL 3P30H 2WUCH 5J56B 1B0GB 5FYJH 3RWDA 4P3DB 2AEQL 3MV01 1P6AB 4Y8DC 4P5TB 2IG2H 5ESAB 3O6LL 4JGMA 3OKNA 2XZCL 4K23H 3BPNB 1F4YH 2X4QA 3LN5A 2W60A 4HLJA 1YMHB 2VLRE 1S7SA 1IGCL 4WI4A 4OCSH 4PJBE 1U9KA 1U58A 2AEWA 1GL4B 2IEPA 4LSUL 2R1XB 3SY0B 5DJ2A 3F7VA 1YY9C 5F93C 2FEEI 1C8PA 4Y5YA 5ANME 1T5XA 5LGKA 1QSFB 4R0LA 5DGQA 3W11C 4MB4A 4LSRL 2H32B 2Z0BA 5GGSB 1AKJA 3D85D 3MRIA 3KYMA 3MO1B 3K46A 5F8QC 1M7IB 1BF8A 3U83A 4M03A 4LGSB 4ONGL 5E6ZA 5EZJA 2FX9H 3BJ91 2BRRL 4JDZB 4TVPL 3HZMA 3PL6C 1JGVL 3LHPH 4YHPB 3QPXL 4KJYB 1R3JB 2GITA 5F70A 5FO7B 3J7HA 3I84A 3OR6A 3H0TB 3FRPA 2DQCL 5DMGD 4WI8A 2MTPA 2N56A 3KS0J 4JY5L 4M7KL 3KPRE 4S1DD 1JI2A 1Q38A 1ODAA 1WZMA 5EU4A 2Q3ZA 4XAKE 4RZCA 1BQLH 5SWSE 3IJHB 4KZDL 3K2MC 1QBLL 3UJTL 2XICA 3QQNA 4DOHB 5T3ZH 5FUCE 3IXTA 1F5WA 4OB5H 3QWQB 1RULL 2IALA 5DD6A 5FYKL 2X1OA 5TQ0H 3O6MH 2HJLB 3VFRA 4XTRC 3DMMB 1NKOA 2LVCA 2VZVA 4I9WE 5IVXE 1ZLUK 5D9SA 2O5XH 4Y16A 4XWGH 1S5HA 1JP5A 1EUUA 3I6GA 2IFFH 1S7QA 4ZQKB 3RL2B 3KPSA 4GUPB 1NMCB 4JPKL 5C6WH 5KSVB 2DMKA 3BYTA 1BF2A 1UH2A 1E27B 1PG7W 1XZ0A 1R3JA 2GITB 3VFWA 3RQ3A 5ID1A 1MWAH 4OQTH 3DARA 1GIGL 2CXKA 2NY3B 4IDJL 3VXTB 4JFOB 1RZ8B 5FYLE 4X6CE 2K7PA 4D8PB 1EAPA 1M05B 1IGIH 3FCTA 1CFNA 3G5XB 2LU7A 5I75C 1Q0YH 3G5ZB 4OLYH 1F2QA 1IEBA 4TTGA 1QNZL 5IB3A 3SDYH 3OB8A 4HQQL 4OGAD 4QF1A 4XNMB 5KANI 2EE2A 2NR6C 3HNTH 4R2GC 1QSFE 4X5XB 1PAMA 1MI5B 3NCFB 1R5WB 4JFYA 1IAKB 5ALCH 3G9VA 5E5RB 1W0YT 3O8XB 1CCZA 1QSZA 3GSQA 3L1OH 1CK0L 2X9XA 4JE4B 1AJ7L 1X3DA 1JHTB 1XZ0B 5GGUA 1JHLL 3HI6H 5EU5B 1GGIL 3TCXA 2V5MA 4MNQE 3DRQA 2QJDA 3CDCA 5IG7A 4XPBL 3ULUE 4QYOB 5DQJB 3MV11 4N1HB 3ZE0E 5TPWH 1H3GA 1RK1B 2VQUA 3MV7E 1XT5A 4PR5B 2IAMD 4Z0BH 3LKRA 4AMKL 1TVDA 1K5NA 1UA6L 2VDMH 5E6YA 4WU5A 5C8JB 1LO2H 4IOFD 2HFEB 3NCYP 3GSWA 5IF0B 4LSTH 4U1HB 3SDCC 3GJEA 1HXMB 2DBJA 2HKFL 2R4RH 5E2WL 4JFYB 1KBGH 3PE9A 2VDNL 1HQ4A 1MNUL 5JHDE 5BQ7B 1XCQA 1L7IL 2J3SA 4MNGA 2GJ6A 4AT6B 5C0BB 2JCCE 4LLYB 4BFIA 2EDYA 5BRZD 2IF7A 2NXYB 3AMKA 1NGXA 1BM3H 3HG1E 5DUPH 1EPFA 3OQ3B 2EYSB 3GO1H 5FHAH 3QQ9C 5J1TC 1NCBL 4OZHF 3H3BC 3VGBA 1YDPB 1MIMH 3C6LD 2JJUA 3GMNB 4WY7L 4XXCC 1IGCH 1I8IA 3LKNB 1K4DB 2VUYA 1Q94A 4JQXC 3T3PE 3OKDB 4WI5A 1X5KA 2IH1B 4KMTL 2VDPH 3QA3A 3PIQB 3GGWB 4MD4A 4JREB 5IJVB 2IH3A 1MCQA 1X5YA 2Z93A 4PRDA 4S10A 3RI5F 3ULUC 1D6VH 1U8JA 2MPAH 4ZUTB 4LLUA 1HHIB 3OX8B 5T3XL 2OR8A 3G08B 2PETA 3LD8C 1JHLH 3HI6L 4NJAL 3O6FC 1XGQA 5F6HI 1NC2D 4NQVA 1OCWH 4FFZH 2WWKT 4HJJL 3WO4B 2UWEE 3CVIL 1UFUA 1DLFH 1OSZA 5JOEA 1P7QA 2NR6D 4MJ5A 3MUJA 3EGSB 3FMGH 1KB9J 2Y07H 4JRYD 3TNNB 2AVGA 5FDWA 3OB0K 2DRUA 3T77A 3ES6A 3O4OB 2RAMA 3SDYL 1IGFL 3IGAA 1MCBA 1J5OL 1W8NA 2ADJA 2AABL 1F4XL 4NQVB 2ZCKH 4LQFL 5I1AB 3U0WL 4X4XA 1RJZA 4JN2B 4LDLB 1S7QB 4H1LH 5CEYB 5I8CB 3VXRE 2DI9A 4XRCA 3U4BH 3QIUD 3IETB 4KJPD 2VLKD 3GI8L 1RHHB 1D9KC 1NFIB 2Q7YA 2J7LA 1MFEH 3DGGB 3OX8A 4JO1L 4L4VE 5HYSA 1EO8H 5CEXB 4JO3H 1EXUB 5B39G 4W4NA 2Y5TB 3QAZC 3WYRA 1QSFD 1MCJA 5F9AC 5TF1H 2EDJA 4YWGL 2LFGA 3SQOL 3QJHA 3DUSA 1T6VN 4TVPH 5GRJH 1EO5A 2UZIL 4LBEB 2XWJA 3G04A 4HEPG 4S0SD 1BIIB 2FJHB 5ANMB 1C5CL 1T66D 1RZFL 4ZSOE 4I48A 3VRLF 4X6BA 4PREB 5HSFA 2F74A 3A6CL 2P5EE 3P4NB 5C0ND 1T03H 1BGXL 4KGLA 3W2DL 1CGSL 3ARGD 2K3TA 2BHYA 3AS2A 5KZCD 2JE8A 1CN4A 1P7QD 5FXCH 3VXMD 1EMTH 3IDNA 4WTWA 5MEPA 5D5MF 3Q5TA 2JIXB 4JKPH 4FXGB 3FO0H 4K71B 1JGEB 1GAFH 3H42H 2I9LA 3ECBA 4GS7B 3HLAB 3QNXA 1KJVA 5CBEB 4UIKH 4Z0XA 1K8IA 3THMH 4LSSH 1HWHB 1RJLB 5F6HJ 5FM5M 2XQYG 3DROB 1XF3A 2OX5A 1YC7A 3EYVB 1BIHA 3MUGB 3DI3B 3KPOB 3H9SD 3BZ4A 1JGDB 4PGDB 4GBXA 2F53A 4R9HA 1IGTB 4H26B 4BH7A 4YE4L 5GS1A 3OKMA 1ETZB 1C12A 1NMBL 2AXHA 5BO1L 4UMGA 4I77L 4M8VA 4P5MA 2ZSWB 2BC4B 4MWFA 3BP6A 1CVRA 2E7HA 4OLEA 3NFSH 5DO2D 5JPNB 4BKLB 3RHWK 1MCNA 5JQ6L 1MCPL 3ME0A 1PEWA 2FHCA 3DUUA 2I60H 4HZAA 4CNIB 4HUNB 5IEKA 1AC0A 3V5KA 4K23L 5L88H 2HH0H 3DETD 4CW1B 2Z8VC 5BJTB 3GUTA 1CWVA 5GS0L 1MH5B 3K3QA 1HHKA 4P46B 1WBZA 5CD3A 4GOSA 1NFKA 5E8OB 1WT5A 5BCAA 3M45A 1QSEE 1DVFA 2A6IB 3DMMC 3UPRA 1UH3A 2EDRA 1UXSA 4YBHA 5HYJD 3QIUC 3T1FA 2SEBB 3OKKB 5F89B 5I30H 2AEPL 4M6AA 4CADA 4LPCA 2E5EA 3TNMB 2IC2A 5BS0E 1KPRB 1T1YB 1X5LA 5DK0B 4G9FA 4JVPA 4KI5E 4EVNB 5HHPA 5K9OA 2VNCA 1HIML 2HJFB 3KJ6L 3DVFA 2VLJE 3KLAB 1UT9A 4IDLA 4M62L 5D5MA 4GH7B 4YPGB 1RUAL 2YD3A 5L88L 3CSGA 4IOSD 1KG0B 5D7IF 3OKKA 5F89A 1ORSB 1JWSB 3FOMA 3Q6GL 5HVHC 2A6DB 1H3PH 5EBWA 3BSZL 4AIOA 4S11A 4XNQB 3MLSL 5HYEA 1FVEB 4LSQH 1S8DB 4JN1H 1F90H 5DS8B 2GUOB 3RVUD 3QEQE 1PQZB 4ZUSA 1EGJA 4JDVA 3X12B 1FFPB 2YXFA 1A6AB 4XHJC 2QHRH 1YY9D 2DICA 1CGUA 1J1PH 3N9GH 2JB5L 3TC9A 1P84J 4G5ZH 4LGPB 2VDKL 4NKMB 3SKOA 1NGPL 1XAUA 3BO8B 2E7MA 4Y19A 3U4EA 1DBJL 4OCYH 4F37F 3BD4A 5FA3B 5TH2A 3QI9A 1EFXA 2XNAB 1BZ9B 3KR3H 4LPXA 1J8HD 2P43B 3KYNA 3DYOA 5TGBA 1BPVA 4X98B 2Y06L 4NNYB 4WUUB 4ZPVB 1CZ8H 5D7SL 2YRZA 5I18H 3QNYB 1NUGA 3L5HA 4FZEL 1CLCA 3JUZA 1JPSH 2D0FA 5FCUL 1HHHB 5SX5H 3GM0A 3OKOA 1GGBH 1UZ8B 3CC5B 3MXWH 3SDCB 1YECH 3G9AB 1LE9A 4RISL 1C16B 2HFGH 4X6CB 5IMOB 1YEKH 1BGXH 4U6YB 5C09A 1MIEL 1RFDH 2F53D 1A8JH<