1ZLUH

Fab 2g12 + man5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 221
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH01
4WUUE 4MCYA 4U1LA 5MEND 1IT9H 1WTGT 5DJYA 2HG5B 3QEQD 4KRLB 3I3BA 4N5EC 4D3CH 4RA0C 1LMKA 4F37F 1YYLH 4OBRA 1X5IA 5BZWA 3S88H 2WMPA 4BUHA 1ZMYA 4XPHL 3GMMA 4QRPD 4KQ3L 4U6XA 3STZB 2ATPB 5HHOA 4G6KL 2BX5A 4NKMA 3L1OL 4HUNB 2AV7A 3LRHA 3KPOB 5FYKE 2J8UE 5ACLA 3OJMB 4QHMA 4XPBL 2ADGB 4R2GD 2DQGH 3ARGB 4MHHG 4ODWB 4JY5H 3P40A 4ODXB 4HC1L 4U33A 4L8BA 3PWPD 1Z3GH 2LABA 3PWVB 4G7VH 3CCHB 1U91B 5DRXB 4E5XA 1KIPB 3DETD 2KZ1B 2WW8A 1AGDB 4OCRH 3U1SH 3AXLA 1ZA6B 1CD0A 4NQCA 1UC6A 1YN7A 3P0VL 4YHNA 5E6IB 1M05B 3DX8A 4NC1C 4ONFH 4DOHE 5L2JA 1FLRH 2WUCH 1A7QL 1WZMA 1TJHH 1N6QH 2GSGB 4FQIH 4L3EB 2IJ0C 2OTWB 4M7ZB 1IKNA 4PJDA 4KV5E 3AY4C 4OFVA 1V7ML 1XFPA 3OR7A 1C5BL 4O5LH 4JO3L 3SO3C 3FFCA 3BIAX 2EH8L 4KPHL 2H1PH 1UQSA 2E6JA 3HPLB 1C5DA 1K9TA 4FQXD 5ILTH 4E42A 5E03A 2EECA 3MRPB 1PSKL 2E8YA 3L5JA 4HXAH 1NUGA 5BXFB 2CLRB 2X4PA 3SKNB 1CDIA 3LQAL 1CE6B 3SCMA 1MIML 1Q0XL 4ZAKB 4MQXD 5KVMC 1O7VA 1K6QL 1FFQA 4G9FD 5JOPE 1U8QA 5ICYA 3MRBB 1FG2A 1UXWA 4M62H 5J1AB 3SDDC 3SBWC 5FOJA 3UZEA 4NKIL 1KELL 5K33A 1YEGL 3OKDB 2C1PB 1NUFA 2V9QA 5AZEL 3KYMB 4YHOL 3ZT7A 4RX4A 3SDCA 4WW2C 1VERA 4L8CA 4KKCC 2HLFC 2NY7L 4NQXB 1G0DA 5CZXC 3TO4C 2G5RA 4PLJD 4P46B 1XEDA 4NQDB 1ORSB 5D6CA 1DN2A 3CSYA 5MP6L 2F58L 2OQJA 5IB2A 1UYWH 5IQ7H 4J12A 2M8XA 5TQ0L 4UOW1 1IFHH 3LKRB 1T04B 3LEXA 3SHSA 4CW1B 3VXNB 1QLFB 2Z8SA 4CKVX 2E6QA 5FGCB 3TZVA 2OMBA 4WEUD 2QLVB 3HE7B 4OSUH 4OZHE 2VTFA 3HMXH 4HH9B 5CJ5A 4YXLH 1LO4L 1N64H 5ICXB 3O8XA 4NZUH 3ECBA 3TVMC 4JHAL 4Q9RL 3D18A 3MRNB 4C56E 1MCOH 5ENWA 3OQ3B 4Y2DD 4FQ1H 3STBA 4YHLH 4HFWB 5F8QC 3EFFA 5IB1A 3EGSA 3PGDB 5A2JH 2Z0BA 1TFHA 1R0AL 4FQ2H 5C7XL 3KPNB 5DJ8B 1N26A 4RCAA 4UU9A 2VLME 1JK8A 4PJIA 3VI4F 3RX7A 5CEZE 1X44A 1N5AA 4LSSH 5JXAH 2DM2A 3EO1B 3LPWA 4QRQA 1ZT4A 4WRLA 3U48A 4XVUC 5K9OB 3EO9H 1DDHB 5H2BB 1BVLB 5EWIH 5CJBA 4LF3B 3TYFB 4CDHA 5FOBB 5F7MC 2F54A 2OJEA 3BEWB 4HGWA 3AUVA 1A6ZA 3HC3H 1AKJB 2XFXA 3QCTH 4TUOB 3IDYB 3CFEB 3LRSA 2ICEA 3IDUA 3P4LA 5FUCC 2GKIA 1D6EB 5F96H 1Z5LB 3CFKA 2XIDA 4GUPB 4NKQB 4LHJB 5IJKA 1U92A 2PCPB 4FXGA 3WXVH 2A83B 1TVBA 3CX5K 4DZBA 4WO4B 3IGAA 4EN3A 1DQTA 1KC5L 3O2VH 4YXHL 5GISL 4P5TC 3RBSA 1AD9B 4EDWH 3QFJE 3ESVF 1DSFH 1KJ2B 1YNTB 2VDKL 3B9KD 3L5WA 4EOWH 4R0LC 4I0PB 4Q74A 3BZ4A 2IADB 3E1F1 3AREC 4OZFG 1M71B 4JPKL 2I9TB 1BLNB 1VGKA 2J1KA 4KVNL 3UCRA 3DX6A 4D2NA 4QOKA 5BJTB 2VH5L 3VH8G 3RWGA 5TDPA 1B0RA 4U0RC 2EXWD 4LEXH 5HDOA 2ZCKL 2NX5A 2EDLA 5C0JA 1A6WH 4B7LA 4PLKD 4G80A 4XMLL 3CDCA 3S34L 3KVQA 4MA8H 2BVQB 1EO5A 4M5YH 2XN9D 1ZA3A 3ILPA 5MI0C 4BQCA 2BC4A 2GJ6E 2IC2A 3ARTA 3NIFE 1LNUA 5DJCA 5E8PA 3IDXL 4Y4FD 1ONQB 1OGTA 2FIKB 3V6ZB 5C09A 5E95B 4NZTH 1NGQH 3SDXE 4DFIA 4PB0L 5ADPL 3N06B 5T1KD 2ESVB 1Y18A 4HWBA 2E7CA 2I9LB 5BRZB 1NCBL 1DFBH 4WFGD 1CDBA 2ADJB 4W4NA 3VXRD 4Y89A 4DGVH 2O5YL 3G6JF 4P2RD 2HG5A 5C07E 5A2LH 3LZFH 4BUGA 2WUBL 3WSQH 4WI2A 4LSRH 3JUZA 1QRNE 2FEEL 4EI5C 3L3DA 4O00A 2W38A 1JGVL 1PFCA 3MODL 3STZA 1QFWM 5JPMA 4TULL 1AC6A 4NOBA 1JZ4A 4R26H 2CK0L 3KPOA 4AMKL 4U6YB 4BZ1L 1W8NA 1RUAL 1PYWB 1NSNL 4NO5B 4Z18A 1CT8B 3TWCL 4KJPC 4JJ5B 4KMTL 1EFXB 2ADGA 5EZLB 4TRPH 3ARGA 4WHYG 1Q9WB 4BQBA 2FX9H 2EDKA 4IBLT 3W81A 1EA9C 4ODXA 4BQ8A 3V52L 4JO4H 3V6OE 3QCVL 2YK1L 5AWNL 3T1WA 2Q6WB 2VNCA 43C9B 3PWVA 5GPRA 3CCHA 1U91A 5IOPB 1KIPA 3IRPX 1WWCA 4P59L 1AGDA 1M1SA 2FD6L 5MEPB 1EERB 2H26B 2R2CA 2Z9TA 3MUHL 5E6IA 3RA7L 3UBXI 1M05A 4Z7QF 2EH7L 4CUCA 3JWOC 2E3VA 4KGLA 2BSSB 3CPLB 2HT2D 1P4IH 4YGVB 4LLDB 3WV0A 2GSGA 4L3EA 1U8IB 2OTWA 2A77L 3EAKA 3MRLB 5FM5M 3QIWD 4KI1A 3RNKB 3B9VA 3PXJA 2XTJD 1A5FL 4UB0L 4WI7A 3P2TA 1ED3B 1OAXH 4HH8A 3HPLA 1A7PH 3HE6C 1MRCL 3MRPA 4NO3B 5FM4A 3BT2L 2P5WE 3PL6B 3VRLF 5HY9B 5BXFA 5DD3H 1XR9B 2CLRA 1DN0B 3NCMA 4FTVB 4TVPL 3MRQB 2W9EL 3SKNA 5GHWL 3H9ZA 1CE6A 3ZKND 4O02L 4P23C 4ZAKA 4AH2B 1EUUA 4M1CC 3GSUB 2R29H 3RPIB 3H9SE 4JRXB 3C2AL 3MRBA 1QO3A 5GS0C 1MI5E 5HPOA 4RA3A 5J1AA 2IALB 2VXSH 4NM4H 2H2SC 2VDRH 2UUDK 4PRDB 3OKDA 4GKOA 2C1PA 3HC4H 4B41A 3O6FB 5A2FA 2EDXA 1ND0B 3KYMA 4CRPA 4Y16D 5CS7A 1LDPH 3MLWH 1DVFD 2JKXA 4KZEL 4ZNEA 4H26A 1B2WH 4M5ZL 4Q6IC 4YEEA 4YX2L 4NQXA 2V2WB 1F8TH 3L95B 1JTOA 4P46A 1EHXA 1IQWL 1ORSA 4NQDA 2UZIH 4U49A 3KLHD 2KQNA 4JQVC 4K71C 1GPOL 1FGVH 2Z93B 4DAGH 1T04A 2XQBL 4OUUB 5IR1B 4MAYC 4N68A 2CKBB 4CW1A 4WUUB 1HEZB 3UTTE 1VESA 5SX4I 4HH9A 5DD0L 3IT8D 5ICXA 4RMUA 1MJJB 3MRNA 1FRGH 3MOQA 2OJZL 3HNVH 1DE4B 1JUFB 3QPQC 1F4XH 5EOQL 1WBYB 1I9JH 4LLQB 3PGDA 2YN5A 2OI9B 1GGTA 2X40A 2BFVH 3KPNA 2VLJE 2BJML 2J8UB 5HHQB 3A6CL 1IM9A 3PWLB 3O9WC 3LS5L 5FGBA 2ZUXA 1ZVHA 3EO1A 5IQ9A 3ALXA 1MRFH 1WWAX 5K9OA 1DDHA 2NY1C 5H2BA 4IOSD 2Z8RA 4LF3A 4BM7A 5FOBA 1AE6L 4HLZH 3VGAC 3AMKA 1I7RB 5DDHB 2BXYA 2YPVH 1JV5B 4R90L 1FO0B 4TUOA 3RZCC 3MNZB 3CFEA 2HFGL 5TQ2L 1H8NA 1FFNB 2EIBA 1Z5LA 4KKLD 3K80A 4M03A 4ONGH 2AP2A 4KDVA 4GUPA 4DOHB 3U0WH 4OJFL 3QXAB 1WITA 1J0ZA 4I9WE 4P2OD 2A83A 1MCEA 4JM2C 1PG7X 4WU5B 4UOW0 2AAVA 3GI9L 1G9NL 1BD2E 3FRPA 1AD9A 4UT7H 4AEIL 1EGJH 1HHJA 4RAUA 1KJ2A 1OQXA 1YNTA 3N85H 5T3XE 3VRJB 2IADA 4Q9CA 4UTBH 1M71A 2I9TA 1BLNA 7FABL 1EO8L 1UWGH 5FFLA 4LNVA 1ROWA 2F5AH 3OKYA 4G8IA 5IWLA 4Y0GA 4C58B 4OLWH 5BJTA 1SY6A 3MCG1 2VZTA 3OPZL 2DLHA 4HJ0D 2GFBB 4PP1D 4Y1AE 4P48A 2O61B 5EC1B 3UTQB 4PGDB 2AK4E 1OSPL 5LCVL 2BVQA 3QUXD 2IPUK 1CFTB 3VI4E 4DKEL 1RURH 3E0GA 1QUNA 1VFBB 2WIMA 5CUSL 4XNUL 5LAXB 3RTQC 5CKAA 1MHHB 1ONQA 2YA1A 5DMGD 3REWB 3VU2A 1N7ML 2FIKA 1Z9MA 3V6ZA 1FAIH 5GGRB 1WK0A 5HYEA 1KXVC 5J4MA 1P69B 1J05B 2HFFB 1A9EB 2I9LA 5C6TL 5KJRL 2JJSA 1SBSL 5K9QI 3KR3L 2Z92B 2DBLH 1P9MA 3X13B 5I1AB 2C7UB 2V7NB 5D7LE 2Q8BH 4N0YL 1M7DB 2C1OB 1BFSA 4OZHB 4WFHD 3TO2B 2PO6D 3TPUB 1WICA 1QBLH 4AYFA 3WFBH 4C56B 1I1CA 1RAMA 5GGTA 4RMSA 1MCIA 2VB5A 2WBJC 2R0KL 2KZWA 4OCLC 1Y6NR 2VN4A 4MXQC 4QWWD 1A1OB 2HLAB 1MCHA 2DYPD 1CGTA 1DQDL 4U6YA 4K23H 3SN6N 2VXTL 3M07A 1PYWA 5FYKH 1AFVL 4NO5A 3QDME 5FYLD 1CT8A 4JJ5A 3GJFK 1EFXA 2V9TA 5EZLA 5GRWA 1Q9WA 3AS2A 4UAOC 5LBSL 4NHCL 4BKLB 3WIHA 2A6IB 4M02A 5FCUH 4DN3L 3I2CH 4BH7B 4OQTA 2Q6WA 5I1IL 43C9A 1NAMB 5BOZG 3FMGH 4HZAA 5IOPA 4M1DL 4S1RH 1DQQB 1A3QA 1YEEH 2SEBB 3WMSA 5JW4Q 5MEPA 5INDB 2H26A 2FH8A 1HOCB 3UDWC 4RWYL 3WO4C 3OF6A 3OKMB 1CXHA 2BSSA 1FNSL 3CPLA 4NWTL 4WHTB 1UWXH 3NVQA 4LLDA 1J7VR 3BN9C 3SPVA 3ARBD 2JELL 1U8IA 1A14H 3MRLA 4PRID 2HMIC 5D5MF 1QYGH 5I1JL 3P9LB 1OTTD 5IGXH 5K93A 3GKZA 1ED3A 1RMFL 3D3VD 4D94A 3LEVL 4BK5A 5ADOH 3G6JE 1EAPB 3QFJB 2COQA 5A43C 1YEFH 3MZGB 3IKCB 5HY9A 3PL6A 4LIQL 4N9GB 3RZWA 1XR9A 1AQDB 1DN0A 2APBA 3MRQA 3D39D 5DHVB 2CXKA 3QEHB 3CDYA 5TH2B 2OP4H 3GSUA 3RPIA 4JRXA 2VXUL 1J11A 4L5FL 4D0BB 1A21A 3TF7C 2IALA 5BW7C 2P8MB 3QUZC 4PRDA 2X44D 2DOCA 4GH7B 4PBVC 4HKJA 3VFOB 1U8OB 4JLRB 1DUYA 3O6FA 4XVJL 3D85B 1ND0A 3GSRB 2R0LL 2GJ6B 3CFIC 2XQYK 3CLFL 5EIVA 3U0PB 1RULH 3UC0H 4LQFL 4XH2B 4P5KB 4D0DB 2V2WA 1X5FA 3L95A 4R97C 1E4WL 2B7DT 4XXCA 1F3JB 3SDXB 2AQ2A 4U1NA 4HAGA 4CJ0A 1CE1L 3MNVB 1A6AB 3IF1A 2BY0A 3B8SA 5DQ9B 2FJGB 4Z7QE 2Z93A 5HHVL 4FNLH 1FDLH 3QDJD 4OUUA 5IR1A 1EXUB 2CKBA 1MWAL 2KQMA 2Y07L 1D9KA 4WUUA 4MJID 4PTTB 2V9RA 4LVEA 2MQCA 4RGOL 5IMOA 3K8MA 5C07B 4K7PX 3IVKB 3UROR 2P47B 4G42A 5D1XC 5FO9B 1HHKB 5JMRA 1OF2B 1QRNB 1DE4A 1JUFA 3HNSL 1WBYA 4LLQA 4LKCB 1MREL 2OZ4L 3CK0H 5J13C 2EE6A 4X7DC 3PWNB 3VRLE 2DL2A 3QJFB 2ZUWA 5E56A 2J8UA 2DAVA 3N1MC 2OL3L 5HHQA 4HWZB 1H3PH 1FVDB 3P11L 4YQXL 2FCBA 3X14B 3U4EB 1B6DA 5CEZH 2D03H 1VEMA 4ZXBD 1KEMH 5HI4D 1NAMH 4U6VH 5SWQB 2XACC 4XNMB 4PV8B 1I7RA 5DDHA 1EJOH 3FO0L 2XI9A 5DJXB 1JV5A 1FO0A 1GSMA 3MNZA 5GZNC 2NY6C 1EVUA 5BO1L 5DS8B 1ZLUK 1FFNA 1CBVL 4CAGA 1T6VN 4F9PC 3QXAA 5J89A 5I18H 2D7MA 3PF2A 4XCFL 4WU5A 3HFML 4XRCB 1GH7A 4X7SL 1WT5C 1EFQA 2XNAB 4OZFB 3AAZB 5E8OB 2BNQE 3BKMH 4JFDE 4HG4K 3FQXB 5GJSL 4O9HH 1KLFA 1KJMB 2PW1B 3C6LC 3VFVB 5H35B 4LLVB 3CX2A 2B8OT 2R9HD 2P5WB 5DHVH 2V5RA 2WLZA 4PJXF 2FZ3B 4X7CC 1QR4A 4KJYB 2WM0A 1BBJB 5F9OL 3MOBH 2GFBA 1OAKL 1UKQA 2O61A 3TIDB 5EC1A 5L9DH 3UTQA 2MJWA 3CU7A 4PGDA 3H9SB 1IC5H 2YC1B 5BVPL 3BKJL 2NXZD 2VOTA 1MI5B 3OB0H 2CDFB 1CFTA 5DWUL 2FBJH 4LMQI 3GK8H 1LQSR 1MJUH 1VFBA 2AJSL 5B38B 1VHPA 9CGTA 2A9MH 5GRUL 4L4TA 5LAXA 3E2HB 4ZFOB 1MHHA 1VPOH 3REWA 2IPUG 1OWRM 5GGRA 3VGDA 4GRWH 1DL7H 3S3PA 4N5ED 3WIIH 1N8ZA 4DK6A 4KGJA 4X4YB 3L5HA 2KDGA 2P8LB 4ZUVB 5CINL 1BM3L 1A9EA 2HFFA 4QY8B 3X3GL 1QZ1A 4NP4L 4JM4H 2IFFH 1EBAA 1W72L 4TSCH 2Z92A 3CAFA 3U79A 4FHBD 5I1AA 5KSAC 4G8EB 1CL7I 2C7UA 2V7NA 2I24N 4PUBH 1D6VH 3L5IA 5HYFA 2X1PA 3UTTB 4RBPH 2C1OA 4OZHA 3TO2A 1A02N 4GRLD 1R3LB 1RZ7H 4PYHA 3BWAB 4DN4H 1HDMB 4MX7B 4OD1L 3VMPA 1KENH 4FRWA 2N56A 4C56A 3PG2A 5I6XB 1H15A 5D1ZB 3LN4B 4OCSL 1A0QH 3IRZA 4PRHB 1CDUA 4LLYA 5K59F 1U8MB 1T80A 2HLAA 1P84J 4XMKH 3JV6B 3CMOL 2VLJB 4NNYB 1MAMH 4XCEA 4G8GD 3SOBH 2O5XH 3EIFA 5DC0A 3D0VB 5C0CD 4BKLA 4ODSL 2A6IA 3GMOA 1J88A 3C5ZC 4BH7A 2J4WH 4U1JB 1NAMA 2VDNL 1DQQA 4HUWB 1E6OL 2SEBA 1ADQH 5INDA 1Q72L 3P77B 4KWUA 1X3DA 1HOCA 1MFAH 2Y4SA 1DQLH 3DGGB 1ZGLA 3QNXB 2VZUA 4L3CB 1CWVA 4YHKH 4WHTA 3SDAA 2R0ZH 1E4XI 2C9AA 1KCKA 4Y5XB 3QIUB 5E7BA 3ZO0A 4NJ9H 3V6FB 1VCAA 3MJ9L 1BD2B 1CCZA 4JANB 5KANI 5ESQA 1EAPA 3ULUF 3QFJA 3UTPE 2CR3A 1P53A 1GC1C 3H9HB 4N9GA 3SDDD 1UVQA 1AQDA 5ACZB 3ULVL 1VADB 1BMGA 3MGTA 4LFHG 1YEKH 3QEHA 1T1ZB 5DEFB 3ARWA 5TH2A 2MKLC 5CFHA 1JF1B 4XAWL 3SY0B 5DRNA 1MCCA 1CLOH 4Y1AB 4KKCD 2HLFD 3I6GB 2OR9L 2AEQL 3SCMC 4RGNC 4D0BA 1BF8A 3R8QA 4OT1L 5JHDA 5DZLA 2AK4B 5KVFL 4I3RL 2P8MA 3LOWA 4K3DL 3HI6L 3HB3C 5CJQL 3QCUL 4IMKC 5E2UH 5DQDL 1U8OA 5L8KB 4MQ7B 4KKAC 3D85A 5DI8B 4N0CC 3IETB 2GJ6A 4XH2A 4P5KA 3U30C 5HD8C 4HKBB 2QADC 1F3JA 1OT2A 1JGLH 3SDXA 3TBVB 2YXMA 3TVMD 2XQYG 4F33B 2M2DA 1A6AA 1GC1H 4K55A 1KUMA 5DQ9A 2FJGA 4UNTA 5HHPB 5CSZB 4JB9H 2KKQA 2FO4B 2GITB 2MWCA 2HH0H 3VFSB 1D5MB 4PTTA 3G5YB 5EOCL 3ZE1F 1A1MB 2W9DL 2X4UB 4JY4B 2V5MA 3IVKA 2O5ZH 5D7LB 1QLRB 1IL1B 5D5ME 3UX9B 1JRHL 2Y36H 5FO9A 1HHKA 3VA6A 1E0OB 2XZQL 4MJ4A 1Q9KB 1OF2A 3VFNB 3FAXA 4GW4B 3O8XC 1MCDA 1NKOA 2YSSB 2MCPL 3IDIB 3HR6A 4XVUD 4JFEE 4LKCA 3INUH 5ALBH 2DRUA 1NCNA 3PWNA 5DURB 3QJFA 4HS8L 3RGHA 2HFEA 1N6VA 2EC8A 4HWZA 3QDMB 1FVDA 3P4MB 3U4EA 2ZZUT 1A6VH 3V95A 4PLOB 4N1EA 4WHDA 2UWEF 3UPRB 1OP3K 3MLSH 3BPOC 4JDTH 3V6OA 5SWQA 3TH4T 3LN5B 4JE4B 4PV8A 32C2B 5C2UB 2YPLE 4DVBA 3T4YA 5DJXA 4K07A 1IAIL 3LEYH 5DS8A 3W0WE 2ZNXA 3LDBB 2ATKB 5E8DH 3ARED 3L3JB 2RBLA 1X7QB 2ED7A 1XCTA 4XRCA 5JUEH 3ARDC 2HKFL 4HK3J 1OTUC 2XNAA 4OZFA 5IJKC 3AAZA 5E8OA 3EOAB 3HE7D 2P4AB 3FQXA 1GIGL 4DTGH 3OZ9H 4DKFH 5DZOA 5CBAB 3DVFA 5TGBA 2DQUL 3G6JB 1KJMA 4KK9C 1U6AL 3VH8A 3VFVA 2OR7A 4K94L 5EUOF 3U9PH 2P5WA 3QG6B 4UBDC 4DVRH 2FZ3A 4CVUA 4KJYA 3VG9C 4O4YH 1TLKA 1BBJA 1JNLL 2HTKC 3VXUD 3TIDA 4RMVA 5D7JB 1NLBH 3BH8A 3QDGE 3DYPA 3KPPB 3H9SA 2V5TA 5DJZB 1KCVH 2YC1A 3LKPB 3WJJC 2YUZA 1MI5A 2CDFA 1XF5B 3DOSA 3E6FB 3MFFB 4J3SA 3QHZL 4M61B 1KYOK 4ZFOA 1JHKH 4ETQB 5GS2H 4JZOB 5JZ7C 2DLTA 1AKJD 1BQLH 1CXLA 4FZ8H 3V2AR 4X4YA 3FJTA 2P8LA 4ZUVA 4U6TA 4QY8A 2Q8AH 5JW5B 1G7QB 4EI5D 4OLXL 1A7OH 4OLUL 5FK9B 1IGCL 4WO4D 4G8EA 3T0EE 1UM6L 1SJHB 1X5GA 3VXSE 1QFHA 3UTTA 3G9VA 3O3EB 1UCBH 4OF0A 5C08D 4BELD 1R3LA 4KJPD 1YQVL 4Y4KB 1IGIH 4I0PD 4MX7A 3GHEL 2HA1A 1JZ3A 4NN7B 2B5IB 5D1ZA 3LN4A 3S97C 2CUIA 3CVHB 4XP9H 2CJUH 5IHUH 4P3CL 5DQJB 3RVTD 5I0DA 1U8MA 2ZUYA 4YR6B 5KTEL 3BSZL 3DIFB 3EYUH 5HDBF 1MJ8L 3JV6A 4PJXE 3ZYOA 3DMMB 2VLJA 4NNYA 1LE5B 3ISWA 5IB5B 5CD3B 4KI5C 1B0WA 1QEWB 3D0VA 4PYGA 1HH6B 4PB9H 4PD4K 3IYLW 4QT5A 4FQPA 5E08H 1CDCA 1YMHB 4U1JA 3VWKB 1KCUH 1OT1A 2Q20A 4HUWA 2ZUVA 5C0RL 5DVLA 4YFEA 3K8LA 2VWEC 3GO1H 4HWEL 4I3SL 1BEYH 1CD9B 3SE3A 3BZDA 3QNXA 3NFPB 1YEHH 4L3CA 2ESVD 2AJXH 3MGOB 3RVXD 1AO7E 2R39A 5BRZD 5E6IC 2UZXB 1T21B 1QSEE 4PJ5E 4Y5XA 3QIUA 5IROA 5JO5B 3MRRB 4PJ8C 3GNML 3GGWB 1LILA 4IRJC 3MLVH 1BD2A 4JANA 2D0HA 2BNQB 3Q5TA 3R1GL 4BSVA 4JFDB 2VL5B 1MAJA 2ICWA 3MRGB 3H9HA 2BOCB 3U4BL 5ACZA 2H2SD 1VADA 1MJ7L 4OUOA 4DGIL 3BZEB 1FE8H 1TQBB 4NFCA 5LGHH 4LSVL 3PP4H 4HUVB 5DEFA 1EK3A 3OG4B 4U1HA 4U2ZA 3MO1B 1TDQA 1JF1A 4QRRE 3IFLL 3SY0A 1VA9A 5K59E 2BSTB 1E4KA 2RGSA 3I6GA 1HINL 3IFPB 3MPCA 4JKPL 5D7KE 2AK4A 4HULB 5C0NC 1F42A 3BUYB 2G75A 1P7HL 1S7VB 3EJZC 3GSOB 5SWSE 4WW1B 3DXAE 3VG0L 5DFVC 5DI8A 1YQ2A 3IETA 4MAYD 5F7FA 3QI9C 5D4QA 1S78C 2VZ3A 2MHAB 1NC2B 4HKBA 1N2RB 3UJTH 3C5JB 4AIXA 1IE5A 3TBVA 1AR1D 4M3JA 4F33A 3MYZA 4PS4L 3MJ8B 4X7TA 2EDEA 4QXGH 1RJYB 2YMXH 5CSZA 4BQ6A 3QPQD 4RWHA 4ODTL 4YPJA 2FO4A 2PNDA 3VGBA 1JWMB 3T77B 1D5MA 3G5YA 5GJTH 1A1MA 4WGVB 2X4UA 4JY4A 1RJLA 2X89A 5D7LA 1QLRA 1IL1A 25C8H 3DARA 5AZ2H 3AM8A 1Q9KA 4K8RC 4J2XA 3IXAB 3VFNA 3KYNB 3TIEB 1IBGH 3GBLA 3ULUE 1GHFH 4GW4A 3CVHH 2YSSA 3IDIA 2V2TB 4FTVD 2ZG3A 2O26U 1KFAL 5CZVH 2CLZB 1CDJA 2WQRA 1XGPB 5I76A 2DIBA 1B3JA 4AK1A 3RZCD 1ACYH 3P4MA 4PGZA 1L7TL 2J6EL 1MIEH 4I2XE 3MTRA 1YJDC 4HCRH 2ORBL 5FECB 5MENE 1RZGB 3UPRA 4G6ML 3QEQE 3UXFA 1NBQA 3SJVE 5FGBC 3LN5A 4JM2D 3X3FL 1FYHB 2F19L 5E4IA 1M4KA 5C0BD 5EN2B 5JOFB 4AIZB 1NMAH 1U41A 4F9LA 4HPYH 4NUJB 1IKFL 3PNWB 5DD5L 1KOAA 4K8RH 4KRNA 2ATKA 5BV7C 3VFTB 4FS0A 1RZFH 2GEEA 4JPVH 1TIUA 4S2SB 4UINL 2W60A 4M6OH 3LKOB 5FV2A 1JRHI 3D9AL 2H32A 2VJXA 1H8SA 4HUUB 3KJ6L 3SKUD 2GIYA 5ESAB 2OSLB 2DM4A 3RQ3A 5DD1H 2AXJA 5EA0H 1EHLH 5CBAA 2X10A 3ZE1E 3NH7L 2AEWA 3PWPE 1ZE3C 1YJDH 5DO2D 1HSBB 3FTGB 1QNZL 1T5XB 3UBXG 2W1NA 3EDJA 2LTQC 1JNJA 2B1HL 4QRTB 3RTQD 5K9JL 2FBOJ 3H0TB 5FYKD 3ME0A 3QUYB 4LCUB 3KPPA 4QHKJ 4BQ9A 4CADB 5DJZA 3K3QA 2RHEA 3LKPA 5F1IB 2QQLH 1KEGL 1HK6A 1VGEH 4PJBF 4CN6A 5JR1L 2D4DA 3E6FA 1MNUL 2QR0A 3MFFA 5TDNA 4XB7A 1RIHH 4M61A 1II4E 5DF0A 2UWEE 3VFGH 4ELKA 4ETQA 4K3JH 5HYQB 4JZOA 1S7QA 3E3QE 2J8HA 2A6JA 2DI7A 2AQ1A 2H6PB 3LCYA 4I77L 4KTEL 3KYOB 3ARFB 3GSNH 3WLWC 1RIVL 3EHBD 4QTHA 3GHBH 4CBPA 5JW5A 1J1XH 1G7QA 4I18B 4G6JH 4H8WC 4LAJH 3MXVL 1B4RA 3ZDXF 2CDEB 1Z6JT 2B4CH 2WBJD 4G9FE 2IGFL 3H3PL 4AEEA 1XGYH 3WJLA 1SJHA 1P6FA 5IFHL 4LCIH 1UM5L 3O3EA 3P0YH 3RKDC 1B88A 4Y4KA 3JV4B 3MCLL 1KN2L 5D5MB 4WV1B 3UO1L 4M9OA 4NKOB 2AGJH 2HRPL 5ITBH 1XIWB 4JPWL 3CVHA 5FHAL 2HN7B 3MLRH 3BH9B 5DQJA 3WKNA 5H8DA 4IIQC 2RFXB 3EZ8A 4YR6A 2R2EB 4JFEB 5EUOE 5LXGL 1Q0YL 2BSED 2NPLX 3DIFA 3WNKA 3GJFB 4P5MB 3K4ZA 1DBBH 3SE9H 3DMMA 2Q86B 1LE5A 4Z76B 3CZFB 3D6GA 1K3IA 3QG7L 5ECJE 2IPTH 1HH6A 2DWEB 1JF5A 3MBEC 3QIBC 2JLLA 4H8WH 2AJYH 3IFNH 3VWKA 4AL8L 2GI7A 4YC2C 3F7VA 1HILB 1WZKA 3BN9D 4JQXA 1CN4A 3UMTA 1WUNT 2CGRH 4LNRB 1F6AB 3BP4B 2HMID 1ZT7B 3AVEA 3QRFM 4X6CF 4PBWD 2YPLB 4FOMA 4OLYL 3JV5A 5KVDH 2Y6SC 3NFPA 3QQ4B 1G6RB 1NH6A 1S7TB 1L7IL 3W0WB 5LWYL 1FGNL 2K1MA 4J3VA 1MCSA 1T21A 5A2IH 1T83C 3KPMA 4U1MA 4DQOL 1V7NH 4IRSC 3MV8E 5JO5A 3MRRA 5CJOH 5CD5C 5IEKB 4JG0H 4OCXL 3GGWA 1MHPL 1PX4A 4OLEA 2NY3C 4M7KL 1XGRB 4YFDB 3VD5A 1KULA 2D31B 4TSAL 2VZSA 2VL5A 3MRGA 4CU6A 2QSVA 2UV3A 1HQRB 4DEPB 1EDQA 2BOCA 4BH8B 3BZEA 3QUZD 2Q7NA 4M4PA 1G9MC 5L88L 1T2XA 4HUVA 2JB5H 4KHXH 4KJQC 2F74B 5EZOH 5FAAA 1IEBB 2F5BL 2W91A 3T08A 1I1YA 5IFJB 2BSTA 2DJSA 3HRZB 2X9XA 3S35H 2F53D 5CLTA 3IFPA 5FUZL 3QDGB 5HDBE 2N7AA 1RUKH 4M7JH 3BUYA 3OSKA 4NRYB 4JQIL 1FL6B 1KCRL 1S7VA 1T2JA 3GSOA 3HZMB 4WW1A 1FNGB 3BMVA 1VEOA 4MSWB 2AXHA 2K3TA 1MQKL 4WTWA 2CRZA 3G04B 2B1AH 4XAKD 4P3WA 5JW4R 2MHAA 4OTXH 1NC2A 1N2RA 2A38A 3C5JA 4XP4L 2WIIA 3TPKA 5D1XD 3FKUS 1UJ3B 3MJ8A 5HGHA 1RJYA 2ARJB 2P46B 5I75C 1ZAGA 1ZEAH 4JVWA 1G9MH 4HGKC 1JWMA 3T77A 5F21B 1OAUL 2MPAH 4JJHA 2WANA 1H0DB 2H45A 3T0EB 1H9VA 5D9SA 4KDTA 3VXSB 3GSWB 1D9KC 4C83B 2XN9E 2W07A 3IXAA 3NABL 5J3HC 5JHLH 2BDNH 3TIEA 5F7HA 3K4DA 4JFYA 4LVOC 2V2TA 4FQCL 3QWQB 3BQUB 4TUKL 43CAB 4Y5YB 2CLZA 4OZGF 3JXAA 4M1GL 1CD1B 3DSNA 4PJXB 3ZT5A 4WFGE 2NY6D 1XGTB 2JE8A 3S35X 3VXRE 3NCBB 3JWDC 3WS6C 1LO2H 3PIQB 4NO0D 1RZGA 2ZKHL 1JWUB 4GAGL 4P2RE 3V5DA 5I19H 1KT2B 1R6VA 3LVEA 1UWEH 2PF6A 1YNKH 2Z91B 1QQDB 5KAQF 2Y23A 4ZQKB 4G3YL 5EN2A 5JOFA 4AIZA 4ODVL 5I73C 2OYPA 4NUJA 4MQSB 3PNWA 1WEJL 2IH3B 3O0RH 1BBDL 3VFTA 4S2SA 1F90H 4OGZA 4HIXL 2BHUA 3LKOA 1AO7B 4XP1L 4GQ9L 4HUUA 1NFDF 1QSEB 5B8CB 4PJ5B 5ESAA 2OSLA 5DSCB 3VDAA 2X9YA 5HDLA 4HHAB 2ZSWA 3T3PF 5C07D 2F8VA 1I3GH 5E7FA 1IC7H 3NIGF 2YZ1A 4XPTL 2GQHA 3JWDH 5CCKL 1HSBA 2BOBA 1QRND 4HQQL 3R06B 3EYQC 3FTGA 1Q8MA 1DANT 5CZKA 1T5XA 1QOKA 1GGIH 4MAUH 1BGXH 4D3CL 2OMNA 1YEDB 4QRTA 1YEIL 3BP7A 4WENB 3VI3F 3H0TA 3Q1SH 4K3EL 4QRRB 3QUYA 4LCUA 4IHOB 4CADA 4GXUN 5D1QA 5F1IA 5HGAB 1HWGB 5D2NE 4ZOEA 3GEWB 3DECA 4H1LB 1HHGB 2NY0C 4NHUB 1MF2H 4U1KB 5SWSB 5KSAD 3DXAB 4CVXB 5LQBL 2VLKD 4X83A 5HYQA 1UKTA 4ZMAT 3IJSB 1RUMH 3SKOB 4OFYD 5DA0B 1MEXH 2H6PA 3SGKA 4JY5L 3ARFA 2MNUA 4R7NB 3BJ91 4XCNB 2XV6B 3U6RB 4POZC 2H41A 3PQYD 4I18A 4ODBD 2CPCA 2CDEA 3ZKMC 4X6BB 4KKNA 3L5XL 4WEBL 1L0QA 1FZKB 4YK4C 1KB5H 3RIFK 5HDQL 3LV3B 2HP4A 3GBNH 1EJ6A 1I7TB 3ZLQC 3JV4A 1OTSC 5D5MA 5I74B 3MRDB 4WV1A 4P9MH 4MD4B 4NKOA 2WUCL 5I1LB 1TJHL 1N6QL 4O2EA 3C5ZD 2HN7A 3BH9A 2YD1A 2RFXA 1NBZA 2R2EA 5J9PB 1EBPA 1WBXB 4JFEA 1KPRB 4A6YH 3DVGB 3GJFA 4U7KA 4OLVL 4MD5B 2Q86A 5ALCH 4Z76A 3CZFA 5ILTL 3FHAA 2JJVA 1Q1JH 4AIOA 2HVKB 1RZJC 1LHZA 4Z9KB 2DWEA 4RGMB 4I2XB 3GI8L 4YDJB 4MNHA 4MA1B 3BOVA 5MENB 2WWMC 4PJBE 3Q6GH 1HILA 3QEQB 4ZUSB 4FFVD 3SJVB 4Z0XB 3GMRB 1EX0A 5I9QB 3C9NA 4LNRA 1F6AA 2PTUA 3BP4A 1ZT7A 3MR9B 2KUTA 2YPLA 3T2NL 5F89B 3N0PB 3NAAL 2ICES 3LQZA 3OAYH 1B6UA 1RK0B 4U1IB 3QQ4A 1G6RA 1S7TA 3W0WA 3KG5A 1J0IA 3AB0B 3MGAA 1IC4H 1NGPH 5IEKA 4IDJL 3ZDXE 4DKAA 3SDAC 1NUNB 4R2GB 5E4EC 5DK2B 1XGRA 3ARUA 3WN5C 1PLGH 3KXFA 2D31A 5D6DC 1CFNB 1UYWL 4M7LL 1RZJH 5IQ7L 3SDYL 4RGND 4JFZH 3PWPB 1HQRA 1P1ZB 2CLVB 3ZTNH 3RL2B 3WKMH 3PABB 4X99B 3HB3D 4XC3L 5KVGH 4MXWH 4PRHD 5I0ZA 4PV9A 1T22B 4KKAD 2F74A 1IEBA 4NWUL 4N0CD 5IFJA 1G1YA 5EG6C 5IW3A 3HRZA 2Q3AA 1BVKB 1JYWA 4GKNB 2IFGA 3QDGA 5HD8D 4TTGA 1YNLL 2QADD 1Q9OB 4QHUA 4NRYA 1BIHA 4H1LH 4KTDL 2VLRD 1URLA 1FL6A 3SQOL 1E28B 3KAAA 3HZMA 1FNGA 5EZIH 4MSWA 4YBQC 3WE6B 1T66C 2R56H 3G04A 2UWEB 4TQEH 4AQ1B 3VFPB 1N0LA 4FQXB 4JRYD 4ERSH 4LSSL 3LH2H 3TH3T 3TT1L 1F6FB 1MFDH 4Q9QL 4EZMA 1UJ3A 5CP3A 1CU4H 2AXFB 2ARJA 3Q5OA 2IBZY 8CGTA 4XGZB 3OJDB 1TVDA 2YXFA 4FMKA 3EUUA 5KAQG 1YYML 4B50A 2DQIL 4OGYH 4G9FB 1MLCB 1H0DA 3LHPL 3T0EA 3B9AA 4S1QH 3TJEH 5F96L 3VXSA 4I0KA 4C83A 4F15C 3WD5L 1F13A 3BPLC 3GB7B 4B7IA 3RVWC 4NBZB 4TUJB 1MOEA 1HZHL 3BQUA 2OTPA 3O3BB 43CAA 4Y5YA 2Z4QB 3VMNA 1CD1A 5EUOB 3U0TB 3DSFH 4EOWL 3MLZH 3DTXB 4PJXA 4L1HA 1XGTA 3FB5B 4Y1AD 1IGML 4OM0L 1WV7T 5IB3B 2QEJA 3DROB 1Z9OA 3PIQA 4KK5C 1JWUA 4TNVK 3HLAB 1KT2A 2E9WA 2MOVA 2Z91A 1QQDA 4OM1L 3S7GA 4YJZL 4ZQKA 5LKNA 4WFHE 1P2CA 2V7HB 3Q2CA 3ARDD 4YWGL 1UH2A 1OTUD 4XHJC 3AROA 5L8LB 2R23B 4ZS6C 2VR9A 2IH3A 3MLXH 2D7TL 5SWZD 5GS1B 4WW2F 5L7XL 4KK9D 4KQ4H 1F02I 1GGUA 4RSVA 5FYLE 4R3SB 4UBDD 5F7KC 1L9NA 1QSEA 2XZCH 2EDDA 4PJ5A 2PYFB 3MV8B 5CWSB 1VEPA 1I8IB 3OKOB 4PJGF 5F1SA 4HHAA 3RHWF 2IG2H 4XNXH 2HJKA 1NMCC 1ZK9A 4K9EH 3UBXB 1DFBL 4JKMA 5DMYA 3R06A 3G6AB 4XCCH 3RFZC 3O2WL 2UVFA 3HAEG 1LO3H 1DBAH 4LPWA 3WSQL 3I6LD 5JW3H 1UZ6E 1YEJH 1YEDA 1S7XB 5T3ZL 3QUMH 1F97A 4QRRA 4QHKI 1SHMA 5JZ7D 5I66B 1WZLA 4IHOA 3NTCH 1TQCB 4OZGE 1DBML 3QDMD 4RAHA 5HGAA 3DURB 4PRIE 2APVA 3DBXB 1HHGA 4KC3B 5JIIA 3LD8C 3I3EA 5KANG 4NHUA 3I85A 5F70A 1TETH 3RY4A 3BPNB 3D3VE 4LLAA 4U1KA 5SWSA 3DXAA 2QQKL 4CVXA 5I1GL 1IILE 2BXZA 3B9KB 2VDOH 3MOAL 3VGEA 5CBEB 3IJSA 1TPXC 1R3JB 4R7NA 4OF8A 5E24E 4XCNA 1UA6H 5F8RC 3U6RA 1J0JA 4LMQE 1C5CH 1MY5A 4X6BA 1AXIB 1NLDH 4NGHL 5DMJB 1AC0A 1X5KA 1NANI 1FZKA 1JMZA 4GSDH 4PGJA 3LV3A 2VUYA 1A7NL 2CR6A 4UV4H 1NFDE 3RAJH 4H20H 3MRDA 1NCDL 1P4IL 5HTSA 1PY4A 4I5BB 5GRJL 2JJTC 2QQNH 2XN9B 2ID5A 4G8FA 5SX5H 4M93C 1I1AC 4FFZH 2IPKB 5MHSD 3N9GH 4Y4FB 4KJWD 5J9PA 1WBXA 3UTZB 2NY4C 3QEGH 4MA7L 3NN8B 1KJ2L 3W39B 3IJYB 3DVGA 2X6MA 4MD5A 1A7PL 3O2DH 5D7JD 4HF5H 4JCLA 1RJZB 2HVKA 3VI3E 4MQTB 3QDJE 5DD3L 3VXRB 4I2XA 3FAWA 2MTPA 3VMOA 4MJIE 1SY6L 5MENA 4P2RB 3IDNA 4HBCH 3QEQA 3QXDA 4ZUSA 5JNYA 1T20A 2Y1VA 3GMRA 5J11B 4XPGH 1WVZA 3GSQB 3DHMA 3U7WL 3MR9A 4PJ8D 1UZ8B 2W0KA 5F89A 4IRJD 5EU5B 2VISB 3B9EA 2BVPB 4QRPA 4U1IA 1ZLSH 2D2OA 1B0GA 4F3FB 1DQMH 4FFWD 2JK5B 4TPRL 2DQEH 2YKLL 4H0HB 4LASL 2JJWA 3HC4L 4KY1H 3OL2A 3MRKB 2FO1A 1C08B 3QH3B 1LDPL 1CGVA 1AHWB 1IVLA 3IU4L 1F8TL 2IF7A 3A6BL 5ABDE 5DK2A 3FT2B 4HDIA 1QTYT 5JLZB 5HYJD 3RDTC 1CFNA 2PW2B 1PG7L 4LLMB 3PWPA 5DK0B 4IDLA 1P1ZA 5IT2H 2ENSA 3RL2A 5C0ND 4ZOCA 3PABA 4UILL 4YBHA 5DVMA 1YZZA 2FB4L 4FQJL 4P9HH 5IVXA 3F6IA 3EJZD 1T22A 3ETBF 3L3IB 3WL9B 4XPHH 1UG9A 3QI9D 1BVKA 3UYRL 4G6KH 2ZJSL 4F2MB 3L1OH 3QXVA 3AC0A 4GKNA 3CDFA 5FGRA 1P4BH 2BRQA 5GGTL 4PRBB 1F4XL 1N59B 1BOYA 4UT6L 1NDGB 5HGDB 5D2NB 4XPBH 1E28A 3FZUC 3QIWB 2RQ8A 1ZHLB 3T8XB 3WE6A 2UWEA 4POUB 4L9LB 5E8EB 4HC1H 1IGFL 4FQXA 4JRWA 3WIHL 3IB4A 2E7BA 3LQAC 5D70L 4OQTL 4CMHC 1U8LB 5FO8B 2Q76A 4K8RD 2R4RL 4Z78B 2ADFH 2DLEA 4XGZA 3OJDA 4ZPTB 3JBG7 3P0VH 2JCCF 4XBPB 3PWUB 4G9FA 3MV9D 2BCKB 1MLCA 1QFWL 2YPVL 3DNKA 2VDMH 3L7FB 5IUSA 1A7QH 1O5DT 4ONGL 2BNQD 2EDNA 5DJ0B 3PGFH 1V7MH 2YR3A 4JFDD 5DUML 1C5BH 1FVCB 4POYA 5HPMB 4JO3H 3GB7A 3SE4A 3ZKQD 1JGUH 4J7RA 1I9EA 5A40E 4TUJA 5F1OB 1VFUA 2OTUB 2EH8H 1KLUB 1KPUB 3AM8C 3QO0A 1BJMA 4KPHH 1DVFB 4Y16B 3N1GC 3O3BA 4NRZA 4KMQA 4UT7L 2Z4QA 1EGJL 3JV0A 3L6FB 3RWIB 5EUOA 4UI2A 3U0TA 4CNIA 1PSKH 1RVFL 4IJ3C 3DTXA 3FB5A 4UTBL 3LQAH 3BVNB 1I3RB 1MIMH 1Q0XH 1G0XA 3DROA 4JFFD 3QXUA 3OKKB 4LSPL 5IMLB 3HLAA 4HJJL 4KTYA 4YBLB 3IAPA 2V7HA 4PJBB 3CMGA 5JQHC 1OM3L 4K7FA 2R23A 4NKIH 3B2UC 4M6NH 1KELH 1YEGH 2EICA 5E6ZA 3RWDB 2EE9A 5AZEH 2DKSA 4Y2DA 4YHOH 2GSIB 5GS1A 1D7FA 3HZYB 2NY7H 2YD6A 2BRRL 1TTUA 4FFYL 4R3SA 3CLEL 5MP6H 2F58H 2PYFA 1INQB 5ISZD 4G8GE 5CWSA 5C0CE 4NC1E 1I8IA 3OKOA 3RGVC 5F3HB 4KKBC 3UBXA 1ZHNB 2A0LC 2FHFA 4YHYC 4LSTH 1OLLA 3G6AA 2CKBL 1LO4H 3LKNB 5JDSB 4F80A 1JPTL 4JHAH 4PG2A 4Q9RH 1EZVX 1UACL 5CIPA 4HKZB 1XGQA 1OW0C 1J0HA 5I66A 1QBLL 5CMAA 2XA3A 3WLWD 5B21A 1TNNA 2DM7A 3DURA 4P2OB 1R0AH 1SYVB 3LRGA 4O2FA 1B9ZA 3DBXA 4QXUL 5DA4A 1WAAE 1FORH 2ITDB 3QAZB 4OCYL 4PJEE 1KXTB 5FYKL 3RY6A 5KOVC 4MNGE 1OWWA 3B5TA 1TJIL 1VFAB 3B9KA 4GBXC 1MHEB 5CBEA 5FDWB 3C60C 4MDJA 1R3JA 3RKDD 3VW3L 4NN6B 3JWNC 1A6UL 2YD9A 4JVPA 2BVEA 1VB9A 1KPVB 3UAJD 1TCMA 1I9RL 1YEEL 1MCWW 1P6AB 3FQTB 1FO0L 1VFOA 4Z7UF 5BMFL 1LP9F 4X4MA 5GQBA 1GOFA 2OS7A 1ES0B 3I9GL 1PKQE 2NYYC 5I1CL 4RFEA 3BZFA 3QUXB 5EOTB 1GL4B 4PJGE 5DR5L 5DLML 1X6LA 1X4ZA 2XN9A 2X70B 3HI5L 3GBML 4YXHH 5GISH 3D1MC 3IKKA 1A14L 3MBED 3QIBD 2VDKH 2X4QB 2IPKA 3ZYZA 4Y4FA 4K7PL 1QYGL 5IBLC 3UTZA 4KK8D 1JZ6A 2P5ED 2QSTA 4JPKH 3NN8A 4W6YB 4KVNH 3W39A 3IJYA 5C1MB 5T1KA 5C9JB 1CTOA 3ZKXC 2DTML 4HW6A 1RJZA 4ZUWB 3UPAA 1K3ZA 4RMWA 2VH5H 2Y6SD 3T04D 3VXRA 1NAKH 2ZCKH 2J8OA 4J8RB 1X5HA 4P2RA 1XR8B 1F4HA 4UNUA 1RHFA 4XMLH 1ETZA 3S34H 3WHXB 4IRSD 4EXKA 5T1DL 3GSQA 2MSPA 5CD5D 5MEQB 1UZ8A 1XZ0B 5GGVL 2I5YH 4LL9A 2FDBP 2Q3ZA 5F9WC 5EU5A 2VISA 4W4OA 4JQXC 2NY3D 2BVPA 2R1WB 4WY7L 1CFSB 3LIZH 4F3FA 3IDXH 2JK5A 3KNBB 2DYPB 1KJVA 4XC1H 4YGAB 4PB0H 5ADPH 3TBTB 1C08A 3JSSA 3QH3A 5J57B 3HNTL 1AHWA 4GW5B 4S10A 3BUTA 3DWTA 4JREC 3SGJA 3CNKA 2EEBA 4KJQD 1NCBH 5FUCE 3FT2A 4NQED 1BOGB 4Q2ZB 2DQHL 1J1OL 3KPSD 3RY5A 5JLZA 4JFXB 2XG5A 2PW2A 4AZ8A 2O5YH 2XZZA 2VO5A 4NYLB 1CFBA 2DWDB 4O51B 7CGTA 5DK0A 2WUBH 2YHGA 1W0VB 1XIWD 4WI5A 1DCLA 1XF3B 4WFEE 8FABB 2R1YA 4NO2A 3F7YB 5FXCH 4OB5L 5JA8B 4OZIF 3WL9A 1W2KT 4PGBB 1NGWB 5J7CC 3MODH 5B39G 1FIGL 3U9UA 4TULH 3K4AA 4BZ1H 2ZUUA 2CK0H 1INEH 1F11B 2R2HA 4OZGB 2XZAH 4AMKH 1N59A 4R7DB 5E2TL 1FNAA 3ARBB 1NDGA 5HGDA 4XNZC 3TWCH 5D2NA 4KMTH 1NL0L 3CK0L 4PRIB 4PJ7F 3QIWA 1OCWH 1ZHLA 2YWYA 4M6AA 4U31A 3T8XA 3RU8L 4F7PA 3D3VB 3QCVH 12E8L 4L9LA 4UDTB 2YK1H 1H3PL 5E8EA 4ZSOE 1AGBB 4UUJB 5L0QC 2YRLA 5CEZL 3GMLB 4QNPF 2XTLA 5GGQL 4XMPL 4U7SA 3SGEI 1U8PB 1U8LA 5FO8A 5GRZA 1NAML 4Z78A 4ZPTA 1IARB 3VXUE 2EKSB 3RA7H 3NGBC 3RVVC 4XBPA 2EH7H 4KUZH 3PWUA 4YO0B 2BCKA 4X4XB 3AS0A 1K2DA 1ZLVH 4D0CB 1JE6A 3L7FA 3BISA 5EO0B 3C09C 4Y19D 1CICC 4HIJB 1NFDB 2A77H 2OLDA 5DJ0A 3FFDB 3C08L 4LCYB 5C70A 1FVCA 4KDTC 1A5FH 4UB0H 2OTUA 1KLUA 1KPUA 4Y16A 3NPSB 1DVFA 3ZL4L 3RWHB 1MRCH 3HUJF 3BT2H 3DJ9A 4TVPH 2MQ0A 2W9EH 4HUMB 3QULB 4HLZG 4LVNC 5GHWH 4ZFGL 4P2YA 3BXNB 1I3RA 3IXTB 4O02H 3C5SB 1ZLWK 1TITA 2AV1B 1T7VA 3QNYB 4XI5C 3QDJB 5IMLA 3C2AH 4MJIB 1CLCA 1BX2B 2B20A 5C08E 4PJBA 4PJ9B 4PFEA 1IC5L 1FFOB 4EUPG 3RWDA 3VD4A 3VD7A 1FC2D 1QKZH 3RVUC 1P5UA 1QFWI 2GSIA 1J5OL 3HZYA 4M5ZH 4YX2H 2BY2A 4UT9L 1I8KB 4NT6B 2PYED 3EYQD 4X5LA 1IQWH 1INQA 5E5MB 4U2YA 2JCCE 3WIIL 1PEWA 5ITFA 1FCGA 4TOYL 1UT9A 4YDLC 5F3HA 4LRNL 4PGEB 5J8OA 4JN1L 4LCCC 1ZHNA 4ZXBB 3HAEB 4JM4L 3S5LG 2PXYC 1AGFB 3UZQA 3EYSH 3OB0K 5DTFB 1I85C 3FRUB 5DD0H 3LKNA 5FM8A 3QEUB 4OCMC 5JDSA 3RKPA 2ICWJ 2NY0D 3VXME 3LKQA 1D6VL 1Z0NA 2OJZH 3STLB 4P4KC 5EOQH 1RZ7L 4X5XB 2VLLA 3MYJA 1KENL 5I8CB 3PV7A 3K2UL 1U3YA 1I1FB 4P2OA 1G9NC 5KSVB 4FZEH 1QFPA 1SYVA 3PWJA 2BJMH 3VXTB 5KS9F 2EDFA 2ITDA 3A6CH 5D1QC 3ZKMD 1BQUA 1G6VK 2ZSVB 3P3YA 1VFAA 4NFBA 1MHEA 3T2QA 3ZE2F 3DUUB 5FDWA 1OL0A 4RBPK 2XYCA 2O5XL 3NCYS 4LGRB 4LRIC 4J3UA 2G5BB 1MY7A 2G9HB 1ZXQA 1LD9B 1OTSD 4C4KT 4PR5B 4U1GB 1KPVA 2K7PA 3GRWH 5TQ2H 5T1MB 1AO7D 3TNMB 3HC0B 3FQTA 3O11A 3RWJB 4GAFB 3I50L 3REVB 1WFTA 1CZ8L 4NZRL 2DQTL 3MCKB 4X0KB 1EMTH 4OJFH 1MFAL 2G60H 4ZO7A 1ES0A 4IM8A 2EEAA 3TT3H 2NXZB 1X5LA 3SE8L 3QUXA 1UENA 1KTKE 5EOTA 3GI9H 4P4RB 1G9NH 3IS1X 2R0ZL 5DGQA 3QHFH 2X70A 4AEIH 3PXHA 4GRWF 4LPVA 2X4QA 1T3FB 4NM8L 3VGHA 4WV1C 4M6ML 4Y4HC 4NJ9L 2R15A 1CL7H 2WWMD 3B9DA 5F9JB 5JW4N 1BFVL 1A9BB 1YY9C 7FABH 3ZHLA 1LVEA 5DJ6B 1U36A 5INCB 2A1WL 4DUVA 4ZUWA 1KCLA 3OPZH 2B2XL 4M8VA 5DHYA 3FQWB 2VITB 3WFCL 1XR8A 3U83A 3WO3B 3OKLB 1FJ1A 5HGBB 3FCTB 5LCVH 1UADC 2B0SL 2C3WA 3FONB 3WXWL 5MEQA 1TXKA 2PO6A 3M17A 4HK3N 4L29B 2N4IA 1KF9B 2VXQH 1WIPA 1WZ1L 2NR6C 5CUSH 2FJFB 4XNUH 3MRJB 5HI5C 3HZKB 1CFSA 2Y72A 1ZSDB 6CGTA 4FTVE 2LAGB 5TE7L 4F37K 3KNBA 2DYPA 2HKHL 4ZFOL 2A74B 5D93C 4GW5A 5C6TH 3CX5J 3N50A 1SBSH 2YN3A 4G8GB 3KR3H 1BOGA 4JZJC 5C0CB 4Q2ZA 4Z7UE 1LP9E 4V1DD 2E7LC 4NYLA 3W11D 1NCWL 4O51A 5BQ7B 5C0BE 2AABH 1W0VA 3HA0A 1OAYH 1E4XH 1XF3A 3F7YA 4PGBA 3SO3B 1NGWA 3T65B 1T66D 3I75B 2DMBA 4QYOA 1INDL 2Y36L 4KAQL 5I8OL 2R0KH 1XF2B 2J88H 2HVJA 4U3CA 1GAFL 1OVZA 1DQDH 1F11A 4OZGA 5EU3B 2VKWA 4JO2L 2VXTH 1AFVH 3ARBA 3MZTA 1NEZG 4PRIA 5ALBL 2CUMA 1CTNA 1WC7B 4NHCH 3SJVD 1YECL 1BREA 3D3VA 3GIZL 4PJEB 2EE3A 4Z8FH 1OLZA 2DD8L 4UDTA 4P57B 4MNGB 1AGBA 2YD8A 3ARSA 4UUJA 3L9RB 3O3AB 2CH8A 3GIVB 1BIIB 1JI2A 4M1DH 3GMLA 3NA9L 3V5KB 3SDDB 3QB7C 4QRSB 5C0DB 5GGSB 3D39A 1S9VB 3G5ZB 1XGUB 1C1EH 3RVWD 4RWYH 2VRAA 3U7YL 1UJ3C 4YO0A 4X4XA 3LPFA 4WW2B 4NWTH 3TO4B 5EO0A 4D8PB 2ARJQ 3NFSL 2JELH 1NFDA 5E8DL 1PKQB 2H9GB 1PG7W 3FFDA 5CHNB 4LCYA 3T0EC 5I1JH 1X5YA 4OGXL 1KLGB 4PJGB 4K3GA 4KK5D 3LEVH 5ESVB 1A3RH 2ITCA 3RWHA 3WNPA 2GUOB 2YA2A 2VZVA 4LIQH 1UB6A 3OZ9L 4XHJD 3TVMB 3W5MA 5EBLB 3QULA 4NQTA 5T3XL 4AENB 4OZIE 4ZS6D 3BXNA 5J12C 3L3KA 3IXTA 3C5SA 4DGYL 2AV1A 3QNYA 5J56B 3V6BR 3QDJA 5GXBB 2VXUH 4MJIA 1FSKC 4L5FH 1RU9L 4X98B 2D9QB 2FGWL 3VRIB 1QFOA 2ZOKB 4PJ7E 4OF5A 5L2KD 1G7JA 4LPXA 4B0MM 2YD7A 5FB8B 1CF8L 4X7FC 2R0LH 3CLFH 4X80L 3C2SA 3BPCA 4LQFH 1I8KA 4QNPE 2EIDA 4PRPE 1E4WH 4XZUB 1JHKL 3OGCB 5E5MA 4HKXB 4JR9H 1CE1H 4LVHC 4WFFE 1BQLL 1U93A 4N0RA 5IB4B 3CVIL 4FZ8L 5HHVH 3FQRB 4ORZC 5E5RB 1HHHB 3UJIL 1TZGL 4PGEA 3CZJA 3HS0B 1MWAH 2CIIA 2WV3A 2Y07H 3HAEA 4S11A 4U1SA 4ZXBA 2IQ9L 1AP2B 2F8XC 4QXWA 4RGOH 3FRUA 3QEUA 3T2PA 1KJ3L 4PRAA 5BVJB 4P5TB 3HNSH 3STLA 2D0FA 2P48B 4X5XA 3D2UD 4R0LB 1IGIL 3HUJE 1MREH 2OZ4H 1P7QD 3AREB 2MCG1 5I8CA 3BMWA 1I1FA 5KSVA 4XP9L 4LPCA 3PGCA 3VXTA 3V4UL 1RIUH 2OL3H 3EOYG 1FPTL 2AS5M 3P11H 4YQXH 5HSFA 4U6HB 4HXBL 3BKYL 1MCJA 3WS3B 4U0RB 1T0NB 3DUUA 3GM0A 4PJIF 2HFTA 3D69B 1YUHB 4ZSOB 1OB1B 4MNQD 2G5BA 1Q94B 5E9DD 2G9HA 4NC0B 2ZCHH 1LD9A 3EYVB 4PR5A 5CJXC 3RPKA 5MI0B 3DI2B 5J1TC 4LU5L 1YPZF 3OX8B 1YMMD 1J0KA 5T1MA 3TNMA 3HC0A 5IW6B 3VXUB 1I1AD 4LP5A 2F53E 3RWJA 1IC1A 5EO9B 5B3NA 3REVA 3MCKA 4X0KA 2NY4D 1BEYL 1FP5A 3MV8D 1YEHL 3HFMH 4WI3A 3HG1D 2V6HA 4X7SH 3MNWB 4P4RA 4RRPG 3U46B 5GGUB 3S96A 1T3FA 3VWJC 1Z0MA 2BSRA 5GJSH 4XAKE 5F9JA 5CSBA 1A9BA 2A73A 4L8SC 2IH1B 3MLUL 5E0QA 5GIRA 1CR9L 5INCA 3GSXB 4FN0A 2AJ3B 4EI5B 2FWOB 3HR5B 1JPST 5D2LA 2NLJB 2ZUQC 2NY5L 4RFOL 1MCLA 1FE8L 1OAKH 3OG6B 4MYWB 3FQWA 2VITA 3PP4L 1R5WB 3FL7A 1JNHB 3OKLA 1QHOA 3FCTA 5BVPH 4WWKC 4YUEL 5KS9E 2AJZB 2X1QA 5C08B 3FONA 4GRLA 3Q48A 4L29A 3RBGA 5DWUH 3EKCA 2A6KB 3WFHB 2AJSH 2ZWLT 2FJFA 5GRUH 3MRJA 4Z7VF 3HZKA 1ZSDA 2J7LA 1J8KA 3RDTD 4RNRB 4C57C 1K4CB 5E2VL 2A74A 5CINH 4ZFZB 4F7EB 4NP4H 4G8GA 1W72H 2F15A 2JCCB 2CRYA 3UJTL 5C0CA 1MLBB 5TE6L 5FYJU 4QXGL 4BK4A 4H88L 5BQ7A 3VD9A 3K81A 5AG8A 3RUGF 3QUKB 5B39B 3TN0C 3QR2A 4HIHB 4OI7A 3AY4A 2WSKA 2DMKA 4OD1H 3VXMB 1ZANH 4GRWE 3WNNA 5BZDB 3I75A 2Z31C 1XF2A 4ZTPL 5JXED 5B38G 3V0VB 1MRDL 5EU3A 3WUWG 3LB6C 2M1KA 3CVHL 4TTDD 3G6DL 5B4MC 1LK2B 1SEQL 3CMOH 5CZVL 4KI5F 1WAAA 4ODSH 4YHMH 4PJEA 2YPKB 3HMXA 4P57A 3KHOA 4MNGA 3D0LB 3ULVC 1ACYL 2IMMA 3L9RA 3O3AA 3GIVA 1BIIA 2VDNH 1EEQA 5F7EL 2DS4A 3V5KA 1E6OH 3SDDA 3SBWA 4HWNA 4QRSA 3HN3A 5C0DA 1LWRA 5GGSA 2ATPA 3G5ZA 1MCNA 1Q72H 1WWWX 1JPFB 1QD0A 4LHUD 2VR5A 4M43L 3O6MH 4GXVH 2GY5A 3OHXB 4WW2A 4Q6IB 1RUQL 4F57H 2GYSA 5M7QA 4D8PA 4ODWA 5FKAB 1BZ9B 1RZFL 1Q9LB 5CHNA 4LK4A 1A47A 4K71B 1RZKL 2BVOB 4M6OL 3MJ9H 4PJGA 2KBGA 5DRXA 2VLKE 2QHLA 4MAYB 2XWJB 3IFOB 1OP5K 1U58B 5EORL 4Q0XL 5A2KH 3BESR 1ZA6A 2GUOA 5DD1L 3QPXL 4AY0A 3ULVH 3TVMA 3MV7D 5EBLA 4CVWA 3PQYE 1FL3B 3B2UD 5FF6B 4AENA 1OAZH 5C86A 5LGJB 2L7JA 1FV1B 1LO5B 2XOTA 4XAWH 2Z8VC 3DRTB 4J4PD 4MGXA 1ZWIB 4XVSH 3MLTB 4EUPB 4KUCF 4HS3B 4OT1H 4CDGC 4X98A 2N1KA 3Q3GB 3VRIA 3L3GB 5KVFH 4I3RH 4PJAF 2ZOKA 4K3DH 5CJQH 2LV4A 3GKWL 3QCUH 4LOUC 5DQDH 3ZE0F 2DKMA 3O9WB 2QQLL 1VGEL 5FB8A 3RGVD 4HPOL 4KKBD 2FJHB 5C0EB 2A0LD 5HVWA 5F7DB 2NY1B 5HHXL 4KRPC 1BFOB 4UIKL 5TPWL 5BS0D 4XZUA 3VGAB 2ARWA 4Y2DC 5JTWA 4ZPVB 4JGJA 3BHBB 3OGCA 3S5LB 2EDHA 2YWZA 3RZCB 3QWOB 1E6JL 5IB4A 3FQRA 1HHHA 2EDOA 1U3JA 3O4LD 3JWOH 3AU1B 4H0GA 5IW1B 3HS0A 4AT6B 1NBYB 3P30L 4Z7UB 1AP2A 4Y2OA 4Z7OF 1LP9B 5EOCH 1QACA 2W9DH 2PN5A 2B4CL 4JM2B 2BNUB 5CP7B 5C0BB 2ICWI 1QBML 4LARL 1JRHH 5BVJA 1Y0LB 2BY3A 2XZQH 4FXKB 4L1DA 5IHLB 1OP3H 4NQSB 3WNOA 1T1WB 3P0YL 1WCBB 5TDOB 5IESL 4R4NC 4B5EA 3S6CA 4GBXD 4R0LA 1E27B 3C60D 1F2QA 3DRQB 3KYKL 1SJXA 3AREA 3H2WA 4PY8J 2AGJL 3G08B 5CGYC 4HS8H 2AJUL 3QJHB 4XT1C 3MLRL 3LKRA 3VXNA 1QLFA 1CXKA 4XWGL 2FECL 3HE7A 1HCVA 3WS3A 1T0NA 4K94C 4RGNE 2ERJC 3S37L 3TA3C 5GS0H 2BMKB 1YUHA 1OB1A 4HUKB 1Q94A 2WBWB 4BFIB 5F6IC 1OGAD 1JP5A 2NYYD 4Z95H 2AJYL 4PRHE 1KACB 3EYVA 3RX5A 4HFWA 1LE9B 2XA8H 3TLRA 4JY6B 3OX8A 1JHLL 4MA3B 3VXUA 2XG4A 3RTQB 5EO9A 5DJ8A 4DZ8B 3TH2T 3T0BA 5FUOH 5KVDL 4WUKL 2VLRE 2HKFH 2CD0A 3MNWA 2XWBB 3DUHA 5EBGA 2L0DA 1BVLA 1GGCL 3PDDA 2IAND 5E99H 3TYFA 1V7NL 1ZT1B 5GGUA 3BYTA 3U46A 3E8UL 1GIGH 4ZFFB 3BEWA 2ADIB 4JRYE 1AKJA 4WCYL 1T1YB 4K94H 4DCQB 1F4WL 4NPYB 3UEZA 4G7YL 2Y5TB 1D6EA 4HFUL 3CJJA 5E5UB 3O6LL 2AJ3A 4EI5A 1U3ZA 3O41B 2FWOA 3HR5A 4OZIB 1HIMH 1JNLH 2NLJA 4E41D 3LS4H 4M48L 2PCPA 4MDIB 2WBJB 4WO4A 4EUPH 1X5XA 4KHXL 5EZOL 1JNHA 1X5ZA 5FO7B 1DBJH 2AJZA 5C08A 1FBIH 3S35L 3NCYP 4ZUTB 4PJ7B 4I0PA 1O7SA 2A6KA 3WFHA 4UAOB 2DI8A 3QHZH 1A4JB 5J11C 5FV1L 1RUKL 3DUSB 1I8LA 3JVGC 3JTTB 4PJIE 3ZHKA 4RNRA 3OMZA 5CEYB 1AQKL 4APQC 1G7MB 4W4OC 1K4CA 2VZOA 3ZHDA 4PRPB 3IDGB 4FP8L 1FN4B 1S7UB 4ZFZA 4F7EA 4BZ2L 4J6RH 4OLXH 1YPZE 2JCCA 1ULVA 3HCVB 3TBYB 1MLBA 3WO4B 3NZHL 4JKKA 3OR6B 3TNNB 4X9BA 1GZQB 1UM6H 3V9FA 2EYRB 4HG4J 2AW2A 1GYAA 3QUKA 5B39A 4AG4H 2MPAL 4YIQB 5I1KL 3QFDB 1NC4D 3FB7B 3GHEH 1GOGA 1NPUA 5EBMB 4HX1B 4LPUA 5BZDA 4S1SL 5ICZB 5SWZE 1PY9A 3V0VA 2VDQH 2XKSA 1NEZB 2ESVA 5AYQA 4TVPD 5KTEH 3BSZH 4GS7C 3HUJB 5BRZA 2ADJA 1CQKA 1ERNA 1MJ8H 4U3XA 1KXQE 2HT2C 2E27L 1KTLB 3RVVD 4EEEA 2YPKA 1KV3A 3F5WB 4OD3L 2DDQL 1M7XA 3D0LA 3ELAT 1H3TA 2XTJC 1HYSC 5DHXB 1CICD 1LO2L 3VDCA 1F58L 4AQOA 5C0RH 5IP4A 1LEIB 3QUZB 3MXWL 1UWEL 1KIUA 4CU8A 1YNKL 4HWEH 3I6LE 4I3SH 1JPFA 1RHHB 4Z7VE 2PTTB 4B53A 4XP6L 3CC5B 3AMLA 3HKFA 4Q6IA 2F53B 4JGUA 5D96C 4DUXA 3ALPA 1ORQB 4R97B 3BP5B 1G6RL 2DQFB 5FKAA 1MSPA 1BZ9A 3C8KB 1Q9LA 5T33L 3KPQB 3BIBX 4D9RD 3GNMH 2P45B 2BVOA 4NIKB 1N5YL 3KDMB 1FHGA 3V4VL 4JEGB 2X41A 4XI5D 1A6TB 4K2UH 2NY2C 4MAYA 2XWJA 3IFOA 4PP2B 1U58A 1JZ2A 3RUGE 1R5VB 1DEEB 3U4BH 5HHMD 1IC7L 1MJ7H 1IAKB 5DK3A 5D1XB 1FL3A 2GT9B 3V79C 5FF6A 1B4JL 4LSVH 1KTRL 4OBSA 5LGJA 4NQUA 1FV1A 3RVUD 4YGVA 3IFLH 3DRTA 3VFWB 2IAMC 1ZTXL 1ZWIA 5H94B 3MLTA 4EUPA 2FEEI 4JKPH 5J13B 1BF2A 1XMWA 3P0GB 4RFNC 3RNKA 4R96B 4S1DC 2EC9T 3B6SB 3MREB 3L3GA 1DR9A 1TTGA 3VFRB 1EGJA 5KS9B 4KI5E 4UV7L 1S7WB 2EDQA 5E2JA 4A2LA 4HT1L 4YBLC 2EDRA 3O9WA 5F7UA 3GSVB 3R4DA 4Z0BH 3VG0H 4QKXB 3OGOE 1EEYB 5E2WH 4NO3A 1BAFL 2FJHA 5MHSE 2R4SL 3F58H 3W9DB 5C0EA 2PXYD 5DC9B 4FTVA 5F7DA 1KB9J 2L7UA 1BFOA 2C3HA 4QHNB 2NZIA 2VXVL 5A16B 4KH2A 1J8HD 2VWEE 4ZPVA 3BHBA 4AH2A 1FZOB 1C7SA 4OZ4B 5CILL 3S5LA 1D5XB 3KJ4C 3RZCA 3QWOA 3UYOD 1U3HC 1MEXL 2NY6B 4M3KB 5FGSA 4P4KD 4ODTH 3AU1A 2WLYA 5IW1A 6FABL 2V17L 2LE9A 4NO0B 1NBYA 4Z7UA 1LP9A 5B22A 2W65B 2E7MA 2EDJA 4OGAC 4JM2A 1CFVL 1NJ9B 5CP7A 5EU6D 5C0BA 1VACB 2XICA 3V8CA 1Y0LA 3MRCB 3T4AB 4NQSA 1T1WA 1WCBA 1H5BC 3CGTA 4GRWB 3H6JA 4DJMA 5KN5B 3HMWL 3DRQA 3PUCA 4BFGA 1UFUA 3C6LB 3DVIA 3G08A 3ZKSD 5LGKA 4KRMB 2YBRB 1UB5B 4KKLC 2A6DB 2BERA 3G5XB 1HEZA 1L7TH 2J6EH 4F7MB 5HYJE 3WFZA 2ORBH 4PJ9D 2OXGA 4G6MH 1MFBL 3OTTA 1MJJA 1IGYB 2BMKA 2QTEA 1M7IB 4PJAE 3X3FH 4L9DA 4BFIA 5DZNA 4OLZL 3ZE0E 1IAMA 5HVHC 1PDKA 4JY6A 1BHGA 1IKFH 1GOHA 3KS0H 3X12B 1MCBA 4P2QD 3IAGC 4RMTA 5DD5H 4MA3A 4OD2B 3RTQA 5DT1L 3BRDA 2C4XA 2E5EA 4Y4HD 1MVFA 4L4VD 4DZ8A 3EBAA 4UINH 2NXYC 2Z8WC 1YY9D 3K2MC 3PWLA 4H5SB 3M1BB 4ZNEE 4OF7A 3KJ6H 2XWBA 2FX8L 1JF6A 2NW2B 1ZT1A 3K0WA 2W0FB 4Z7OE 4ZFFA 5KSAB 3NH7H 2VLKB 1PEZA 3BGFC 5E1HB 1A7BA 1RK1B 3QT2A 1T1YA 4DCQA 4NPYA 2OK0L 2Y5TA 1RV6X 1QNZH 5DUPH 3GZKA 4K7PY 3PQYB 3OAYK 3O41A 3K1KC 1U95B 4OZIA 3ZTNL 2NR6D 5EOCJ 1UJTA 5HI5D 4ODHL 1NMBL 5F3BB 4U0QB 2WZPD 4GG6F 4MDIA 2WBJA 1JZ5A 3MV9E 5BZWB 5F93C 3GUTB 5T5FL 4D9QD 5FO7A 1D5IL 1MFEL 2DF3A 1T6WA 3M8OL 4U6XB 4WU7B 3ZTJH 2HYMA 5JR1H 4ZUTA 4PJ7A 3VRJA 1MCPL 2I27N 4PREB 1A4JA 2D7QA 1G84A 3DUSA 3EDFA 3JTTA 3ESUF 2PO6C 3C5ZB 5CEYA 1FYTD 4NUGL 1UGNA 5F72S 5GGVY 3ILQC 4I77H 1WGOA 4N9OB 3IDGA 3RL1B 1RIVH 1FN4A 4L8BB 3CFJB 4QWWC 4ERSL 5IVZB 3UDWA 3HCVA 3BD5A 3TBYA 4JFFE 3MUY1 3TBSB 1MFDL 2IGFH 4N0UE 5F1KC 3AXLB 3OR6A 3TNNA 1GZQA 5FCSH 5GGRY 1UM5H 2JIXD 4MB4A 4OGYL 4YIQA 3MCLH 1KN2H 4WEMB 5JQ6L 3FB7A 3UO1H 5EBMA 3TJEL 3WUWB 4HX1A 3QXWA 3MACH 2HRPH 5ICZA 4UQ3B 4JPWH 1NEZA 5CAYB 5FHAH 1J05A 1A22B 1KGCD 3MJ7B 1Q0YH 4KROC 3ULUL 5L6YH 3R8BB 1XH3B 5ISZE 5ETUB 3X13A 1S9YB 3QG7H 1KTLA 3ORJA 3BRGC 3F5WA 1M7DA 4ZODA 4I13B 4Y8AA 4AL8H 1KYOJ 3TPUA 3SCMB 4RGNB 2R69L 1OTTC 1X9QA 1NCAL 3RWFB 4JFQB 5BW7A 2BHZA 1LEIA 5TFSL 3QUZA 1JPGB 1RHHA 1A1OA 3EOBB 5KSUB 4OLYH 2PTTA 2LFGA 3CFDB 2DQJL 3T0WA 3MRHB 3CC5A 4LGPB 3QNZB 1L7IH 2AVGA 2F53A 15C8L 3ZSTA 1FGNH 5LWYH 1K8DB 5I16B 3TJHC 3U30B 3BP5A 3MLXL 2QADB 4DQOH 5KW9L 3C8KA 4ZS7L 4L8CB 2VLRB 3F7RA 3KPQA 3T3MF 4OCXH 1MHPH 1NGZB 2P8PB 3KDMA 5CGTA 4YXKL 5C0IB 1T2QL 2WP3T 5FYJE 1AXTH 2XZCL 4PP2A 2AK1L 4TSAH 3O3DB 2X4OB 1R5VA 1DEEA 2XWTB 4JRYB 3U7AA 4K9EL 1GGYA 1IAKA 5D1XA 2GT9A 3OKMA 1TCRB 1QPPA 5DEGB 2F5BH 3Q6FB 4X6FB 3O8XB 3VFWA 3H42L 5H94A 2VUOA 3U82B 5ENWB 5AYUL 5AEAA 2DKUA 3P9LA 3MREA 2HT4C 5IB1B 4JQIH 4I3GA 5KS9A 5D7SH 1S7WA 1KCRH 1IKNC 4XHQA 4JHWL 4EIZC 4WNQB 3GSVA 5ID0B 4GMSL 3S4SG 2HRLA 3IKCA 4BYHA 2XKNB 4OFKA 1MQKH 3W9DA 3BPOB 5T5NF 3NCEB 5DRZB 1E4JA 4PJIB 2P5EE 5DHVA 4QHNA 3L7EB 5E70A 3C8HA 5A16A 1ZHKB 1X4XA 4X6DF 4QRQB 1BWMA 4UZGA 3CSPA 1FZOA 2FYYB 3RWCB 4OZ4A 4FXLA 4W68A 1IEHA 5JIKA 4EQ2A 1D5XA 2FEDC 5CZXD 3TO4D 1Z9SA 1AY1H 1YPZB 2FATL 4NO0A 1OAUH 1QBAA 2GJZB 4F9PA 2W65A 3VFOA 2ICEB 1K8IB 3QWRD 4JLRA 1NJ9A 1F45A 4Q6YA 1VACA 3CFKB 3ARDB 4MXVF 3GSRA 1WT5A 1O0VA 3MRCA 3U0PA 3T4AA 1H3GA 3KYAA 3NABH 4D0DA 2J5LC 4H20L 1X5JA 4DZBB 3EOTL 5KN5A 1LO0H 5SWZB 1EHAA 4KXZH 3SDCC 4PY8I 3MA9L 4TUKH 3MNVA 5J0BA 1P7KB 1IEAB 1A3LH 4QF1B 4Z5RB 4M1GH 1CGSL 1UB5A 1CVSC 3B83A 1LDSA 3PE9A 2XRAH 2A6DA 1EXUA 3G5XA 4P49A 1NUDA 3QEGL 3VG9B 3TYGL 3ZT6A 4ZUUB 4NQEE 4O58H 3KPSE 3KPRD 4F7MA 4AEHL 4JZNB 5C07A 2LQRA 2HAZA 2ZKHH 4GAGH 1IGYA 3TZVC 3S3SA 1M7IA 5C0AD 1QRNA 4G3YH 2X7LB 1EUTA 4HMEA 4NN5C 5DMIH 3EFDL 4WTXA 4HBCL 1DBKL 3THML 3X12A 4Z7VB 1ZS8B 4OD2A 1WEJH 2R9HC 3VWJD 1JTTA 1MCKA 2GJJA 4RRPA 4RISL 4ENEC 2XY1A 3SGDI 1EHNA 4HIXH 1QG3A 4H5SA 4L8DB 4XP1H 3X14A 1F4YL 2EO1A 5E8PB 4XPAL 2DQEL 1GGBL 2AERT 2ZPKL 2NW2A 2W0FA 4XNMA 5KSAA 2VLKA 4X9IA 2JF1A 1QLEH 1ADQA 1Z9LA 4GKSB 1NANH 5CCKH 1EVTC 4OFYA 4PG9B 4WFED 4WWKD 4HQQH 4P5TD 3RUGB 4R4FL 4TNWF 1OARL 4NNPL 4LCWD 2GK2A 5KSBF 2H3NB 3NCJL 3PQYA 1U95A 5F3BA 5IT2L 4LLUB 1YEIH 3O4OC 4K3EH 4P9HL 3GUTA 2R0WL 3L3DB 3D87B 1T0MB 3DV4B 4Y19E 4WU7A 4EN3C 5JPMB 5IBTL 5TF1L 1P4BL 3F7PC 3J8F7 4PREA 3A67H 4DW2L 2AJVL 1I9IL 2PW1A 1TZHB 5H35A 4LLVA 3CDGB 5LJYH 4GRLC 5LQBH 3C5ZA 2BP3A 3CXDL 1B90A 2X09A 5EC2B 3TN0D 3RL1A 2ED8A 3A0OA 1KG0B 3VXQB 1X6NA 3CFJA 5IVZA 4YDIL 3MUGB 3SQBA 2Z31D 4XTRC 3TBSA 3F6LA 5I1DB 2Y9RT 3L5XH 4X5WB 4WEBH 1CQYA 2ADFL 2ZCLL 5HDQH 1OD9A 3LB6D 4GMTH 2M26A 5B38A 1NCCL 3KS0J 5B4MD 1V3LA 2NMSA 3DX9B 2VDML 4PJ8B 3WUWA 4H1LG 4QO1A 4IRJB 4UQ3A 2EEDA 3ARYA 4NC2B 5EBWB 1SM3L 3PGFL 3ULVD 2PYEE 1U9KA 3QRGL 3QDHA 3MJ7A 1A64A 1JGUL 1WFNA 4NJAL 1XH3A 4OLVH 5ETUA 2NQCA 4BFBD 1S9YA 3WBDA 4JFOB 2CXGA 4GG6E 1JFQL 2UVEA 3GI8H 5HYJB 3BWAA 1HDMA 1UCTA 3IDMB 3RWFA 4IS6B 4JFQA 1QPXA 4PJAB 4N8PA 5EZJB 4BZYA 3MV11 4IMKA 5EIQA 4P2CG 1JPGA 4PRHA 3T2NH 1QO3B 35C8L 3NAAH 1NDMB 1SVZA 3EOBA 4N0FB 5KSUA 3CFDA 3MRHA 2AI0L 3ZDZF 4YAQB 3QNZA 3QI9B 4M6NL 5I1HH 1K8DA 5I16A 2Y7QB 4J3OC 4L4TE 1FAKT 1J1PL 4A2MA 2VLRA 4H26B 1F00I 4IDJH 5T5NG 1NGZA 2P8PA 5IFAL 5C0IA 1FNLA 3ARGC 3BFOA 4MCZB 1FL5B 3IJHB 3V8OA 3WNLA 4HWBH 1AJ7L 1S9KC 3O3DA 2X4OA 5FDYA 4M7LH 3L3HB 3SDYH 3OJVC 4CMMB 1A7RL 2XWTA 2DJUA 3P77A 4GRMB 4JRYA 4XNYL 3VXMD 1KBGL 3DGGA 1N0XL 4OCWL 1CVRA 4XC3H 4LOUD 1TCRA 2YUVA 3F8UB 4LSTL 5DEGA 5I15H 5F88B 1NQBA 3HE6D 3Q6FA 4NWUH 4X6FA 3IDJB 3UYPA 3MV9B 4IEFB 4KRPD 3O45B 1YNLH 4GO6B 3V6FA 4QEGA 4P23D 5IKCB 1SEBB 3CUPB 2AKRB 4KTDH 4M1CD 3SQOH 1C16B 4M7ZC 2EDWA 2QHRL 4WNQA 5ID0A 5GS0D 2XKNA 4HD9A 1L6XA 4D9LL 5DRZA 1FORL 1PZUB 1IM9B 3L7EA 3CH1B 4JG1L 1ZHKA 2QKIB 1T1ZA 5IQ9B 4PJHF 4OFIA 2AEPL 1V8HA 2FYYA 2P7TB 4RAVB 4YDKL 3RWCA 3TT1H 3BP6B 4Q9QH 1CGYA 3H7LA 2IMNA 4XPFL 4Y1AA 2PR4H 2YUXA 1YPZA 3MJ6A 1YYMH 4R4ND 4XVTL 2FLBT 4ZAKC 2DQIH 4JFFB 1TJGL 2E9BA 5BV7B 4N0UB 3LHPH 2GJZA 4YHZL 1V5JA 1CD8A 1K8IA 1AGEB 5CGYD 3AS3A 3CFCL 4MQ7A 4J3XA 3T3ME 3ARDA 3S3JA 3WD5H 5I30H 3TGXA 3VDBA 2VL4A 5D72L 5SWZA 3GSNB 4PJFF 1HZHH 1HSAB 3TA3D 1P7KA 1IEAA 4QF1A 4GJTB 4Z5RA 1HHJB 5HHPA 4P46C 4RAUB 4JO1L 5DD6B 2GITA 5ISZB 1CLZH 2LTQB 1IGMH 2RCSL 4ZUUA 3VFSA 5AUMB 4OM0H 4JZNA 4V1DE 3R0NA 4G8IB 3JTSB 1F4AA 1FNFA 3WJJA 5C0GB 3O9WD 4OM1H 3HE7C 4UOJA 3T2OA 2X7LA 5HVGB 4YWGH 1NAKL 4FABL 5EU7E 2VC2L 5JHDE 1FZJB 2NY1D 3F62A 3FOMB 4Z7VA 1FNHA 1ZS8A 2D7TH 5T1LD 1YA5A 1F3DH 2I5YL 3NACH 4G5ZL 5L7XH 1L0YA 3ULSB 4X6DE 3QDMA 4EDXB 2DQCH 1FC1A 4L8DA 3LIZL 4GG8B 3WFEH 4LHQB 4XC1L 3MMEB 5D71L 3S36L 1T03L 4E0RB 3MBXL 32C2A 3P9MB 2OBGA 3W2DH 4GKSA 3P4OB 4PG9A 4MXVE 3TP4A 2YD3A 3RUGA 2HWZL 1OAQL 5IM7B 1K5NB 3O2WH 2H3NA 4N1HB 1QSFD 3IDYC 4LLUA 3L3JA 4MMZC 4GAJL 1X7QA 2APFA 1JBJA 2VDPL 5T3ZH 3O6KL 1MPAH 5H37H 1BQHG 4IIQB 4APQD 1DBMH 1T0MA 3DV4A 4LSUL 2LVEA 3FN0L 3EOAA 4IOFC 4AM0B 4WO4C 3DYOA 1JMXA 1INEL 3G6JA 2XZAL 1TZHA 3CDGA 4C59B 2GCYB 2QQKH 3K7UA 3UTSD 5I1GH 3MBEB 3QIBB 3MOAH 3QG6A 4I0PC 4UTAH 1F6LL 1OCWL 4YC2B 2P5EB 1I8LC 4ZTOL 1YY8B 5EC2A 2QJDA 1P5VA 2N7BA 2VQ1B 3P4NB 5F9DC 5DEZA 5A3IC 1KG0A 3RVTC 2DTSA 5D7JA 3VXQA 3BAEL 5IWLC 3MUGA 1X5AA 4UNVA 5I1DA 2CSPA 4XP5H 5BV7H 4X5WA 4NGHH 1NBVL 1XF5A 4GKZB 1A7NH 1IAII 5D8JL 5AAWA 4KUZL 1R3IH 4IRSB 5L2KE 3DX9A 5I1EL 4PJ8A 1NCDH 4LPTA 2EXYC 5GRJH 2BZDA 4KVCL 4IRJA 1R3KB 2NY3B 4OIIL 3SPVB 2WWKO 5KVEL 4OI9A 5EBWA 4KZDH 2CMRL 2X1XR 5FKPB 1CI5A 2BVUA 1HYSD 4MA7H 1KJ2H 1RFDL 3MLYL 4BJLA 5KSBE 5FK9A 5F9AC 4JFOA 4G6FB 3RVXC 4LQ1A 4MXQD 2JB6B 2JJSC 1RPQA 4NQEB 3LMJH 1ZLVK 3KPSB 1P9MC 5HYJA 2DB8A 1SY6H 1R5IB 3DGCR 3IDMA 4IS6A 2Q1EA 1JIBA 4PJAA 5EZJA 3U7WH 4E9LA 4V2CB 1G7HB 1NDMA 3ZZ1A