1ZLUH

Fab 2g12 + man5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 221
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zluH01
1U92A 3QPQC 4JRWA 1JHKL 4LCUA 1AY1L 1P4BL 3TV3H 4MA3B 1RUML 2IH1B 1FO0A 1WFOA 5C8JB 1OTTC 3TPUB 2JK5A 1S8DB 3A6OA 2QSQA 5HPMB 1PY9A 1T5WA 2WUBH 4BUGA 5T33L 5F7EL 2FD6H 3M17A 4TRPH 2EDYA 4POUB 5I1IL 4JRYE 5HGAA 1CGWA 1WBXB 4OBRA 4ZFFA 1FE8H 1YY9D 4M1CC 3S35X 5FYJD 4LDLB 2E27H 3EDEA 3MLTA 4OB5H 5ICZA 4LLWA 4CADB 3V6FA 1MEXH 1GC1C 3VFNB 2HFEB 3O6FA 1JMXA 4KXZH 4GG6A 5K9JL 3O11B 4A6YA 2FYYB 1PY4A 1BEYH 1EFXB 1JE6A 4ODWB 1IFHH 4HC1L 2ED9A 1Q8MA 4QHLB 5EU7E 3BP5B 3BGAA 1F00I 1TZHA 3QUYD 1KB5B 1BJ1J 4HJ0C 2VN7A 5MEOA 4KVCL 1EAPB 1KOAA 2WBJB 5ABDE 1EMTH 1OWWA 4HS3B 4XXDB 3HZMB 4BQ8A 4Y8DC 1K8IA 2NW3A 5D9SB 3VGDA 2XYCA 3CLEH 3FQNB 4U1JB 3JV4B 4U1KA 4X9IA 5C09D 5H37G 2WK2A 3QEGL 1DDHB 1MLBA 2CIIA 4B5EA 5IOPA 4YDJA 5HYJB 4GRWF 3MV9A 5DJDA 4NBXB 3MOBH 1B4JH 2CO6B 4G8GB 1IM3B 4HWZB 2IFFL 4KDWA 3O3AB 1CGTA 2X4QA 4XP4H 4FFYH 2DKSA 4OKVB 4WHDA 3P4LA 4JN2B 4ZTPL 5TFSH 3N85H 1CD0A 1Y6NR 2VSDA 3D0VB 3QQ4A 2BJML 1T1XB 4V2CB 2BXYA 2EDFA 2GHWB 2I60H 1KELH 3O8XA 1CDIA 1UACH 3MFFA 4HQQH 2XICA 5CSZB 5D5ME 1YUHB 1MNUH 3NFPA 5BO1H 4EOWL 3MRPB 4F7TB 4WI8A 4H20H 4RA3A 4F9PA 4TYUA 4YFLF 1KT2A 1P84J 2UY7A 1G7HB 3BD4A 5MP6H 3VFTA 4XBEH 4CW1A 1FNLA 5IFHL 2A6IB 5B38B 1D5ZB 5FA4B 3P0VH 3G5ZB 5MI0B 3BVNA 4ZS7L 1JP5A 3VWKB 1GC1H 4OFYD 2CIKB 3RWGA 4X5XB 3QCUL 3EYQD 4IMKA 1YQVL 5LGJB 2XXMB 4NQDA 4HS6B 4PB9H 1I7UB 5BXFA 1WZKA 5JPMB 1LE5A 3OJ2C 1JTTA 1BM3L 2H9GB 4XCCL 2EEBA 4I1NB 1BREA 1TXKA 3BH8B 1PZUB 3DLQR 4OZGA 3GUTB 2N4IA 2VR9A 3EYUH 3KPNB 4G6JH 5K9KA 1KCVH 5E08H 3REWA 4ZUUB 3VXOA 4XP6H 4AIZA 1J5OL 2R56L 2IQ9L 2EYRB 1NGQH 2DQEH 1H9VA 3HNVH 1VENA 2PXYD 1XZ0A 3HLAA 4ZYKB 1VERA 1P2CB 5TF1H 3ARBA 3KJ4B 4GXVL 2AJXL 4U6VL 3BZ4A 3ESUF 3LZFL 3MRRB 3RDTB 4MXWH 4HUNB 4PJXA 4UNTA 2HJFB 3EOTL 3ORJA 1U3HD 1CT8B 3T0ED 1RIVL 3G9AB 5B38G 1A6VH 5I8OH 1JGDA 1JHTA 4O2CA 4Y2DA 2DLGA 5F89A 3ULSA 4PGJA 3HZKB 1BAFH 1FORH 3NZHL 5HDQH 3KPPB 3VW3H 3GMRB 3BUYA 4PYHA 1E4WH 3M45A 3SGJC 4R4FH 1F4XH 4M61A 2R9HC 2K1MA 1IAOB 1IGYB 1PYWA 2HN7A 4LK4A 1W2KT 1YN7B 3Q5TA 3VCLB 3WE6A 1TCRB 4YIQA 5IBUB 4YR6B 4Z6AT 3HE6A 4JFZL 1T04B 3MJ7A 4JDTH 3QRGH 3CX5K 3U2SB 4JM2B 3U9PH 2X6MA 3B6SA 2H26A 3LPGA 3N0PB 4ZNEE 1F4YH 1ZA3B 5DURD 5ILTH 4OUOA 2ILLA 5BOZG 3ZL4L 1HOCA 3BPOB 5D7LD 3QDGE 4ZXBC 5J7CC 3VFVB 4FTVA 5C7XL 1DJSA 4OFKA 5GXBB 4MNGE 1JGVL 3AGVA 5IBLD 3G6JE 3AMKA 1WLHA 3MBXH 4RFNB 5KG9A 1MREH 2BSRA 3EO1B 4G80B 5IW1B 1N64L 1CDHA 4MXQD 4JY4A 3VRLF 3TO2A 5T3ZH 1R3IH 3TWCH 3TJHD 4ZMAT 3VXRD 2APTA 4YGAB 4YHIA 2DQJL 3H9SE 3V4VH 3L3KA 1BOYA 2BHUA 2AW2A 1NDGA 1W0WA 1HQ4B 1OF2B 5DD6B 5IESL 4F58H 5KTEH 5BRZD 2BY1A 3S3PA 3BHBB 1I85C 4NO0A 1IKNA 3S4SB 5DF0A 4PJIA 2VLKD 3IFNH 4MJ5B 4DTGL 5IBUG 1XGTB 2HMID 3MYZA 1CL7I 5ISZE 4OUUB 1R3JB 2F19L 3W0WA 1DQJB 4AH2B 3BRFA 2WINA 4WUUD 3DVFA 2YPLA 1NC2B 5SV4A 2YUVA 3RRQA 3QUKA 2VQTA 4IRJC 4GLRI 2LVCA 2VAAB 1CDGA 3F7VB 1Q9KB 4DN3L 1YEFL 3UTTE 2ZOLA 5DD1L 1SY6H 4JFPA 3DOSA 4J8RA 3VJ6B 4XP1H 5HHMB 3NH7H 4JCLA 1BJMA 4EDXA 1B3JA 1IZKA 1J1PL 1MPAH 2HT3C 4RDQF 4Y19A 4HWUA 1JPTL 3DUHA 4H88H 1JWSA 1QHOA 4QTIH 4Y4KC 1CICC 1YEDA 3O4LE 1KN4H 1OLZA 5ENWB 2R1YA 5TE6L 2FWOB 4OCRL 2AERT 5DD5H 5CGMA 2F53D 2V17L 3S4SG 3STZA 3PQYA 1UYWH 32C2B 3NFSL 4WU7A 4G6KL 5FKAA 1WC7B 2C3VB 3HMXL 3JV6B 4LSSL 6FABH 4XX1G 1CBVH 4OZHF 5IT2L 4IDJL 3EO0A 3VXPA 4JLRB 1HINL 4Z7WA 5I30L 5CD3A 5IQ9B 5GGTH 2ZCKH 1IGJB 3MR9B 1J0YA 1ETZB 4QRPE 3TA3C 1HIML 3VI4E 1DR9A 1UKSA 5D7IE 1MFAH 1RURH 2BVQA 3TYGL 3K4DA 3ARGD 2BNQD 3DSFH 4LCYA 3DXAB 3SJVE 3PWLA 4OM0H 5DK0B 1NCNA 2H6PA 3BQUD 3QUZA 3E8UL 4CBPA 5IVXA 1INEH 3N1GC 3V0WL 1YPZF 2BOCA 1F02I 3CFCL 1D6EA 5D7JA 2F9BT 2DS4A 1UXWB 3MTRA 1VKXA 2VL5B 5EBMA 2ORBH 3JZ7A 4QGYA 3QFJA 1QBLH 5CILH 3QDMB 3ZE1F 4RFEB 1NCAH 1QRNE 1RULL 4RAVB 5F3HA 4LF3A 3O8XD 4NSKA 5EC2A 4DKAA 2J8UF 1GGBL 4OSUL 3GI8L 4XVUD 3MGOB 5I1EH 4NZRH 4LVHB 2GFBA 1X5AA 1KXTB 1CVRA 3ZTNH 4E5XB 1GGYA 4P3DA 5LGKA 4Y4HD 5DFVC 2APVA 3DTXB 2O61A 1FL6B 2YC1B 4O5LH 4O58H 5E6IB 2A73B 2BFVH 4FQXC 4LCWB 3VGHA 2WIIA 1D5XA 3GK8L 4CRPA 2CMRL 3BIKB 43C9A 3ROOB 2A1WL 3S36X 1NEZB 2W65A 4Z7VA 3FJTA 4YXLH 4QYOA 5TDOB 4P3WA 3ROLA 1MCIA 1PSKH 1JUFB 4PG9A 3MACL 5JXAH 3W5NA 1CDUA 4K7PX 1Q9OB 2UY6A 5KSAB 1Q38A 4L8SB 4QWWC 1R0AH 5CCKL 5E94A 3BYTA 4OZIA 1XGRA 1F3RB 5DC0A 1P9MC 1GHFL 2NQCA 1NGWA 4GO6B 5ID0A 1FPTH 5I1LA 4G8FA 1OD9A 1A14H 2NNAA 1KIQB 3IXTA 1A7PL 2XV6B 3Q5OA 3V6OA 5CSGA 2OP4H 3ARBD 4HHAA 5C6WH 2H3NA 2W07A 3U0WL 2A9NL 3EFFA 3DVNB 5D1ZB 3FRUB 3RL1A 3HZYB 2LU4A 1AGBA 2Q8AL 5DLML 4KHXH 3FQUB 5FXCH 4F9LA 4Y5XC 1T20B 5D2NB 5JA9A 1K2DB 1HH9B 1W0VA 4LVNB 3MCKA 3K4AA 4CKVX 4R90L 1MHHB 5SWSE 5DJ2B 1MIMH 4X6DB 1NEZG 2CLZA 4JRXA 5KS9F 3D85A 5EOCJ 4HUUA 3RIFK 3H7BB 4UAOC 5ITBH 2R0LL 1CFNA 4C56D 1ACYH 2W9EL 2NZIA 1NCCH 1HHKB 2FBOJ 5HI5D 1W72A 4R0LB 1YNLL 1Q1JL 1DBAL 5AZEL 3SDXA 2E6PA 4UINH 5DUPH 1V3KA 1XF4A 2NTSP 5C0CA 5F9DC 2DQCH 1EK3A 1ERNA 1GVIA 2FX8H 2ARJA 4NQCB 4XCEA 1MJ8L 5EZIH 3VFWA 1HYRC 3ESVF 1FVDB 1BQLL 1H8SA 4OIIL 3UYRH 4PV9B 3VE0B 1N59B 1CR9L 1FSKB 2R69L 4F8TA 4P5TD 1HWGB 3IU3A 5JLZB 2AEQH 2OTPA 1MJJA 2ICEA 2ZJSL 2C7UA 1JGLH 1CXIA 2DB8A 3AFLA 5EZOH 3WUWA 2HLAB 4LARH 1JZ2A 1K5NB 2HRPL 3JWOC 1P5UA 4BH8B 5DVMA 2IAMB 2V2XB 5HYQA 2AXGB 3T77A 4PJ8A 4P2OC 1ZSDB 4OD1H 3ARFA 4ZD3L 1H3VA 5AD0B 3QH3B 3VXTB 4XNZB 2HT2C 2R23B 4ONFL 5FFLA 5J6HB 2Z9TA 2RIKA 2GTWA 5ADPH 5E8NA 3RGHA 4L8BA 4K3EH 4R2GC 3EYSL 4KUZH 3C8KB 4FABH 4ZUTA 3BGFB 1RHHA 1F3DH 2EDOA 5C0IA 1KC5H 1DVFC 1YMME 2Q8BL 2XTLA 2AABL 2MTPA 3W0WD 3D25B 2AK4E 1Q0XL 3GRWA 4NWUH 2I9TB 3L7FA 3WV0A 2C4FT 4L4VD 4LQ1A 3UPRA 4KU1A 4RMRA 4Y16C 5EC1B 5FYKL 5DTFB 5DVLA 1QFHA 4YEFA 2UWEE 4PJCF 1S5HA 2VTFA 3RWJB 4H25A 3UBXA 1BPVA 5IR1A 3G9VA 4PJDE 5HHVH 4URTB 3SKUD 2MCPL 3DURB 1IMHC 1QFWM 3BPLB 1IM9B 3FONB 4X4XA 5TQ2L 5C0NC 4RWYL 5BO1L 5DRWA 2YRZA 3WNOA 5FCUL 1RU9H 3ARYA 1KIUA 1ES0B 3Q1SH 4MB5A 4U1GB 3TCXA 1T1ZB 4CJ0A 2X89D 3P2TA 3BH9A 4YC2B 5EORH 4MB3A 4MJ6B 2J6EA 4OLYH 2AJYL 2PNDA 2V5RA 5CINH 4KQ4L 2QEJA 2UVFA 1TZGL 3FO1A 3JWOH 1A02N 5TQ0H 3G5XB 1XR8B 2BX5A 4JDVA 4XP9H 5F7DA 1G7IA 4ZAKC 3SDCC 5FUCE 5GS0C 1E4XH 3AVEA 3FO2B 4JCMA 1KLFA 3CCHB 5D2LF 3F7RA 3B9KB 4WWKC 1WISA 2IJ0C 4N5UA 4KUCD 3SQBA 2ICWA 3MRNA 4ZODA 4NCC2 3VGGA 1MAML 3HG1E 4GAJH 3N1QC 4IOFD 4XGZB 4MSWA 4NQED 3P4NB 3PGFL 3TFKC 3LAFA 4KK9C 1A6ZB 5DDHB 5DJ8A 1VGKA 1D9KD 4PJ7B 4HCRA 4JFDA 1CG9A 1C1EL 35C8H 3QCVH 5D7JD 3VFRA 3HMWH 1QSEB 2F5BH 4ODHH 5CEZE 2N56A 4FQ2H 3QBTB 1G7QB 1OAKL 3TNMB 4G42A 4EVNB 4NRXA 4XC3L 1EGJL 1HHHB 1N0XL 3C6SA 4JREB 4BZ1L 3C5ZB 5CJQH 5ERWB 1RUKL 3RQ3A 3O4OC 3OKOA 3OKNA 2OR9L 1A6VL 1DANU 3LB6C 3T1FB 3D9AH 5BS0E 3H42L 2Z8WC 5A2KH 4ORZC 5FUOL 1VSCA 3C6LB 1CDYA 3LH2H 4MA3A 1AO7D 3LIZH 4P4KD 2X9YA 3MRJB 5KBNC 3Q6GL 1S8DA 3TJEL 5CJBA 2QADD 5JORB 4J4PD 5HPMA 3WEXB 3QHFH 4KVNL 4RGNB 4APQC 3RY6A 3UJJL 4MJ2A 4Y0GA 5JW5B 1X5KA 3ZYOA 1KCRL 3IFLL 3ARRA 5GJSL 3P0YL 2J5LC 1EHLH 3IU4H 3VXSD 1FAIL 3O3BB 4FHBD 5GS0H 3N06B 3NIDF 5HYEA 1KJ2L 2BSTB 3ZE0F 2D03L 4CADA 1MCOL 3VFNA 2HFEA 2OZ4H 1S5IH 5A40E 3KXFA 3SOBH 3O11A 1EFXA 3TBYB 4ODWA 2B2XL 4LLQB 1XGYH 1H5BC 3LS4H 1MQKH 4QHLA 2VXSH 1UC6A 3BP5A 1UVQA 4ODBD 4XHQA 2EXYD 3OAYK 1KB5A 4HWNA 1KCKA 2WP3T 1WCQA 4ZFZB 1EAPA 2WBJA 1U8JA 2HT4C 2Y07L 2IADA 3BKYH 1WAAF 2HTKC 2KDGA 3HZMA 4XXDA 4HLZH 5D9SA 3FQNA 5C0AE 3JV4A 2Z93B 1EVUA 1LO2L 3J7HA 4G9FD 5IMKB 3INUH 2IBGA 4RCAA 5GRXG 5HYJA 1OL0A 2EKSB 1FNGB 1IM3A 3FL7A 1YECL 2HH0H 4XVTL 4HWZA 5FM4A 2XACC 3KHOA 5SWZD 3OB0H 4OGXH 4OKVA 1DBMH 3GEWB 3KYMA 4ALAH 3C2SA 3VG9B 2GEEA 4ONOA 2I5YL 5C07D 2X4TB 3D0VA 3ARPA 3KWWB 4KUCF 2AJSL 1T1XA 2NX5E 1M7IB 1Y18A 1WZ1L 4M02A 2X9XA 3DECA 1NFDE 3TH4T 2J1KA 3MJ9A 1ADQH 4KKAC 5F7KC 4JFFA 1G7MB 1XH3B 3SDAC 4F7TA 1SY6L 1YNKH 4Q6IC 1G7HA 2W60B 3GSUA 3EFDH 5KAQF 4MJID 2PYEB 3UPAA 5B38A 1D5ZA 5FA4A 3CC5B 1MPAL 5F1IB 3SKNA 3VWKA 3PE9A 2CIKA 4E0RB 4X5XA 1I3GL 4H88L 1I7UA 3HHRB 3IDIB 4NN7B 1DQLL 5GS1A 4WEBL 2D3VA 3MXVL 1CK0L 2H9GA 3EAKA 4UQ2B 4BELD 2VZ3A 1G1YA 3BH8A 5HVWA 3GUTA 1VEMA 3ETBF 2EDJA 2Z91B 1G1CA 4LSPL 3ARFD 3K8LA 3QPXL 4NKIL 3KDMB 5EO1B 3T2OA 3QSKB 5FK9B 5HVHC 3CVHH 4PJ9A 1A4JB 1P2CA 1A5FL 5ANMA 2BOBB 3RDTA 5FHBH 3TC9A 3IKKA 1ZVSB 2HJFA 4ZQKB 5FECB 3EJJX 3S8WA 1HHIB 5H8DA 2PUQT 1CT8A 3O9WD 2EYTB 1BZ7B 2ADIB 1RZ7H 5EUOF 2YUXA 2GQHA 3FT3B 1AQKH 2Y72A 3HZKA 25C8H 3KPPA 3GMRA 3QB7C 2V7HB 4RGMC 3BUTA 3I9GL 3OXSB 2GJ6B 1IAOA 2AJVH 1YEJL 2UYLB 1U6AH 1YYLH 5GRUH 4P23A 3FOLB 4XBGB 4YDVB 1CGXA 3VCLA 5I9QC 1I8MB 3F65A 4LQFL 5JUEL 3ZT6A 3DVGB 1OSPL 1T04A 4NCC1 1AKJD 1ZHLB 4JFED 3OV6A 4AENB 4JM2A 4JFXA 4LSTH 1SEQH 4CDGC 1ZA3A 4KZDL 4OCYH 3UJTL 5EO9B 2NYYD 2EDQA 1MELA 1JNHB 1YEKL 1A7RL 3VFVA 1L7IL 4P2RD 3CK0L 2MCG1 1T03H 3BE1L 4WW1A 2PTTB 1REIA 5LG1A 3EO1A 1U3ZA 4B7IA 5AG8A 3GBNH 4NM4H 4G80A 4PRDB 4YBLC 4KDTC 5IW1A 4ELKA 3B4NA 5F88A 3CSGA 3ARQA 3CFKB 4P46B 5SX5K 4XB8A 2DQFB 1PJ9A 1LMKA 4V1DD 5I76B 1D7FA 1XF5A 3WKML 5DD6A 2Y5EA 4TVSa 3IFPB 3IAPA 5LAXB 3S4SA 5EOCL 4U1NB 1XFPA 3LQAC 2J7LA 1MVUB 3E3QE 5TH2B 1XGTA 4GJTB 3GI9L 1KPVB 1R3JA 5CJXA 1FGVH 4AH2A 2YA2A 4GG6E 5AUMB 4KKLD 1R3HA 3PL6C 3PDGA 4E42B 5L0QB 5FUCC 1FGNL 1NC2A 5DRZA 5CKGA 3RP1A 2VAAA 3O3UN 3F7VA 4HK3J 4MX7B 5JZ7D 4YGVB 5TF0A 3HKFA 4L8DB 4OM1H 1UZ8B 4W81A 4MZ3A 3MFGB 1OT1A 3VJ6A 3W9DB 3Q48A 1T3FB 3GZKA 3QFDB 1X5HA 4MMZC 1KJ2B 4QRQB 3T3MF 3U0TB 4K7PH 3BN3B 4OZFA 3T2QA 1GRWA 3DGGB 4AYFA 1FVEB 3QRFM 5INCB 2QQQA 4RRPG 1GYAA 2VE6B 4HFUH 2ID5A 1T1YB 2WUCH 2X41A 4FZEH 2FWOA 4MNQB 3UYRL 4DW2H 2M2DA 3TVMB 2FHBA 4I48B 1WC7A 2C3VA 2NY2C 4MAYA 3JV6A 5JOFA 3KS0J 2WBJD 1JF5A 1G6VK 5J13C 3QUYC 5B21A 3NGBB 1UWGH 3GMPB 15C8L 2H2SD 2GY5A 2BSSB 1CS6A 4H1LB 4WFHD 5IQ9A 3QI9C 1IGJA 3MR9A 1G9ML 1ETZA 1AXSB 1S78D 3OL2A 2QQKL 2OX5A 1EUTA 4AY0A 4JZJC 1DFBH 4G8GD 2RCSL 4GT7A 4KV5E 4HD9A 4PB0H 3CVIH 3LQAH 3FB7B 3FQRB 2ENYA 4OT1L 4N0UB 5L9DL 2LQRA 5E8OB 3WS3B 5DK0A 1RZIB 3MRKB 4HIHB 5J9PB 1JF1B 3MREB 3PF2A 2VL5A 2K7PA 3BAEH 2R2HB 3BKJL 4MD4B 4RFEA 4TUKL 3ZZ1A 2BRRH 2FJHA 4Q9QH 3QDJB 4LLUB 3W5MA 4LOUD 5IMMB 3GSNH 3EBAA 4E5XA 1AQDB 1EBAA 4JKKA 3I6LE 2XKNA 2YOCA 4JG0L 3DTXA 1T0MB 3CZJA 3KJ6H 4DGYL 1FL6A 2YC1A 3D2UD 4YFLI 5E6IA 2A73A 4LCWA 3P0GB 4PJXE 5DJ6B 1UKQA 2O5ZH 1MJ7H 4PTUA 3S35L 3ROOA 2D31B 4M6OL 4ZXBB 5C3TA 2WSKA 2HVJB 4XZUB 2BY2A 1NEZA 2CR6A 5TDOA 4UV4L 1RZFH 5JW4N 1HQRB 4YZFE 1JUFA 2AJUL 3DUUB 5IB3B 1JIBA 1Q9OA 4DKDC 3IT8D 5KSAA 5BMFL 2DD8H 4LFHG 4L8SA 3QA3A 4I9WD 5IB2B 2R29L 1L9NA 2Y9RT 3BD5A 4GSDH 5DGQA 4KK6C 4PY8I 3MV11 3UPCA 1X5YA 1U8IA 5CINL 2RQ8A 4HWEL 1FYTB 1C16A 1OVZA 4IS6B 1X5GA 3EDJA 5TQ0L 3MA9L 2B1AL 5E56A 3OG6B 4X4YB 1BF8A 5KSVB 1HCVA 3E6HB 2MHAA 1KIQA 3H0TB 1ZLWH 1F8TH 4M6NH 4P9HC 3S96B 1DN0B 1FFNB 1QSZA 2JELL 2YHGA 3U6RB 4XMKH 2OXHA 1Z6JT 3DVNA 5D1ZA 1DBKL 3FRUA 3ULVD 1A21A 3FQUA 2HAZA 5FM8A 1EZVX 1JRHL 1T20A 4PRPB 2NY3C 5D2NA 3V7AE 3C2AH 4KMTL 3IDMA 1K2DA 1HH9A 3QNXB 1VHPA 2E7BA 1HDMB 1MHHA 4P48A 1N26A 5D1QD 2RJMA 3K2MC 1CI5A 2FATH 4O02H 1OP3K 3H7BA 3PWUB 5E2WH 4NJAH 2ARJQ 3VXQB 1T89A 4YHOH 3AY4A 3MMEA 3VD3A 2ZUTA 5C0BB 2NXZB 4P4RB 2DQGH 3AREB 3TH2T 5GRVL 5I1KH 4JY5L 4YQXH 2C1PB 2W0LA 3QXTA 1NMAH 4MA1C 4MAUL 3NPSC 3BI9X 4NQCA 4KROC 3QEHB 1NUDA 1U42A 1MCFA 3WKNA 2VR4A 4YUEH 2CDGB 2E9IA 4PV9A 4XXCC 1N59A 3VE0A 4HBQA 2JJVA 3I3EA 3RWIB 4R8WL 4YBQC 1X6LA 5IBLC 4LHUB 4NOBA 4P9HH 2IPTL 5CAYB 1K4CA 4JRYB 4Q97A 2HLAA 1K5NA 4R26H 3BP7A 3I02B 2B0SL 3CJJA 2AXGA 3LS4L 4XNMB 3O45B 5A2JH 1ZSDA 5AD0A 5J89A 4OLZL 4WW2C 2OK0L 4HS8H 3SGEH 5J6HA 5L7XL 1LWRA 2APWA 2FO1A 5JXEA 3TESA 3HNSH 1S7VB 1WIOA 4HEPG 3C8KA 3MBEC 2DQDL 5ALCL 4J2XA 1ZEAL 3HUJF 4NHUB 3D25A 3T3PE 2I9TA 1NC2D 3OKYA 4CMHC 4KK8D 1QKZH 1F4WH 2PO6C 3KLAB 5CUSL 1FFQA 5EULV 3B9DA 4PP1D 5DTFA 4ZSOE 3S5LB 1T66D 4XC1L 2F58H 1MQ8A 3RWJA 4PJCA 1VACB 2V5TA 2Z31B 4QGTA 3UYOD 4J7RA 2FECL 4NKOB 4LHUG 4S0TD 5C6TL 1JN6A 3STLA 2J4WH 1IM9A 1SYSA 3F62A 4BKLB 4GAGL 1QLFB 4D8PA 1T83A 1IL1B 4L3ED 1U8KB 1NGPL 3V79C 4M7LT 2BERA 1FNFA 3TIEB 4HIXH 3RHWF 1JI2A 2WBWB 1AXTH 4KMQA 4O4YH 1ES0A 3K3QA 4KGLA 3V5HB 4ELMF 5D5MB 3T65B 2UZIL 1T1ZA 3E1F1 3HMXA 4I2XE 4OBSA 1CLZH 4MJ6A 1Q94B 3O6FC 5TE7L 2X1XR 3WMSA 4M9PA 3N9GH 2V7NB 5AWNH 5JPNB 1ZA6A 4X4MA 4JO3L 3G5XA 3X14B 2OL3H 1NMBL 2J12B 1MHEA 1FNSL 2EH8H 1OM3H 3V8CA 3A67H 3CCHA 5JR1H 4CVWA 3B9KA 3S5LG 3MNWA 3F12B 5HY9A 5FGSA 1II4E 5JDSB 3DXAD 4XGZA 5GGVL 2DM7A 3P4NA 3B83A 4UAOB 4EUPB 4Z7VE 1A6ZA 1CL7H 1BZ9B 1G6RH 2V5MA 1NC4A 2NY6C 4PJ7A 1N6QH 5I17A 2Q7YA 1ZANH 1QSEA 3IB4A 5IW6A 3IDYC 4OLXL 4GLRH 1G7QA 2Y36H 3QDMD 2IF7A 3TNMA 1SEBB 4EVNA 1WWCA 5GGSB 1FO0H 4QHUB 5CHNB 1HHHA 2YD1A 3A6BL 3C5ZA 1S9WB 1JWUB 1TPXB 2BDNL 3O8XC 5ERWA 4ESKA 5J56B 5J1TC 2WWKO 5KVDL 3T1FA 3RTQD 4GAFB 1KF9B 2JIXB 3C6LA 1NCUA 1C5CH 4TVPD 1TETH 4ZNCD 3HB3C 3V6OE 4DZ8A 4F9PC 3MRJA 4LCWD 1CFVH 4JFHE 4YWGH 2ICES 3BZFB 5JO5B 5JORA 4GQ9H 4U3HA 3WEXA 5ALBH 1JZ3A 3CXDL 4M1GH 4TSAL 5JW5A 1FL3B 4GS7B 4IMKC 4A6YH 1DQDL 1MWAL 3VGAC 4NO3B 5D72H 4EUPG 4BQCA 1MFBL 4MHHG 2BSTA 5GGQL 4RMSA 3NVQA 2H32B 4HXBH 1LK3H 5IMLB 1IQDA 1ZLUK 1KJMB 4IJ3C 3RGVD 2A9MH 3MGTB 3CU1A 4O00A 5EBLB 3WJJA 3TBYA 2K3TA 4DN4H 4LLQA 4EZMA 4IOIA 4FG6D 5DJAA 5E8DH 4YHZH 3RUGF 4FXKB 3LSOB 4M5YH 4ZFZA 1V5JA 3WFCL 3ARBC 5C0CE 1WAAA 2C26A 3SDDB 1I1AA 3UTOA 2NY0D 3PWJA 5IMKA 4EDWL 4JHZA 3QDGB 4PJAE 5FYLE 1DE4B 4MNGB 2EKSA 2VC2H 4Y16B 3ARWA 3G6JB 1KGCE 3MRGB 3UTQB 5D7KD 5GRVK 3VXMD 3HC4L 4J6RH 3DRTB 4Y2DC 1TQBC 3TIDB 5IF0B 2A77H 3MLPA 2APXA 5DR5H 4HMCA 2B8OT 1UQSB 4JANA 3RBGA 4X7DC 3KWWA 1KUMA 3H9SB 1KCUH 3MUGA 1M7IA 1BHGA 4BQBA 1YEIH 1EX0A 3C9NA 4PLJD 3SKMA 3KPRE 5I1CH 1WTGT 4I18B 4KI5E 5JOEA 2HKFL 3DX7B 3MO1B 4NPYB 4HUWB 1S7UA 5ISZB 3KPLB 1QA9B 1NBVH 1XH3A 3NCYS 4M7LL 3HE6C 3S36L 3ULUL 3LKNA 1EHXA 2DTMH 2W60A 3QXUA 3DMMA 2PYEA 5I8CB 1RD6A 4RBPK 1O5DT 3O2VH 2YBRB 3CC5A 3UTTB 4OCWL 1KENH 4PTTB 4E0RA 2HKHH 3LMJL 2VDML 2VWEE 1XGQB 1XMWA 4G7VH 3P9MB 2EIEA 3KLHC 3IDIA 1CE6B 1E6JL 4JY6B 4XAKD 4UQ2A 4QF1B 2IAMD 3NIFE 5INDA 4HKBA 1AFVL 1FFPB 4NO5B 4XH2B 1U41A 3GDBA 4NRYB 5CWSB 1MHPH 3O4LB 2P4AB 3K80A 1HKLH 3KDMA 5AZ2L 3ECBB 4G6AD 5I16B 5C1MB 4D9QD 5JIIA 4ERSL 3FFDB 4XVSH 4DEPC 3RVUC 1KCSL 3O4OB 1IKNC 4HF5H 1V8HA 5D71H 4ZQKA 5FECA 4YDLC 1HHIA 5CGTA 4LEXH 3V52L 5C3LD 1D3CA 3HS0B 3BT2H 4Z8FL 3NABL 4YFEA 1MF2H 1BZ7A 1RHFA 5HDBE 4QRPB 4ZDHB 4OFVA 5DJCB 1WIUA 3FT3A 5D7IB 5EPMA 1Z0MA 4NDMB 3EHBC 4K9EC 1E0OB 3TBWB 2RGSA 3SJVB 3LV3A 5KVEH 1QZ1A 3WHXA 2E7LC 2FB4H 3TN0B 1BECA 4H5SB 5E99H 4DGVH 3OXSA 4S10A 4N5EC 1LP9E 2XTJE 1UG9A 3U4EA 4G43B 5T1KB 4X6DF 2UYLA 3TF7C 1QRNB 3FOLA 4XBGA 1NMCC 2D7QA 3QHTC 5CEZL 4ZOAA 1RK0B 1I8MA 1B9ZA 3DVGA 2LTQC 2VSCA 5DEFB 1KPRB 1ZHLA 1PEWA 3CH1B 4PS4H 4AENA 3ES6B 5GRJL 1OAYH 1HXYA 2VDLL 4KRMB 4XCFH 5KZCB 1FP5A 1FG9C 1UWEH 5F9AC 1NUFA 4U05A 4DFHA 4ODXA 1JNHA 2NCMA 1KULA 4I8DA 1OAQH 2NY1B 1V05A 4PUBH 2PKDA 3B9KD 2PTTA 4EN3D 5F9WC 1VPOH 2DBLH 4K8RD 3T8XB 4OD2B 3CDYA 1RV6X 2NY4C 5F7YC 1EO8L 3GMOB 3CFKA 1RSFA 4P46A 4M62L 1IC5L 4IOFC 1BGXL 1A3LL 1DUZB 1F8TL 3FQXB 5E6YA 3BP4B 4RRPA 4X5WB 4D9LL 3QUZC 1EGJA 2DQFA 1VFMA 2W0KA 5I76A 4U7MA 2Q87A 5AAMA 1I8LA 3IFPA 5D7JC 4C4KT 1CGSL 2FH8A 3FCTB 5LAXA 4K9EH 5J3HD 4XAWH 5TH2A 1RJCA 4I0PB 4X6CF 3TP4A 4AL8H 5J0BA 3WFDL 2XZQL 1MIEH 5BW7A 4TNVK 1SMAA 4KH2A 5C0EB 5J6GB 2OMNA 3KXFE 3U0PB 5DEGA 3HI5L 4TNVF 4H26A 1F6FB 1C08B 3PNWB 1DLHB 4MVBC 3MCLL 2VXTH 4MX7A 5CZKA 5F7HA 4XTRC 4YGVA 1K8DB 1UZ8A 1MWAB 2E8ZA 5SWSB 2CLRB 2D0FA 3W9DA 3WNNA 3QFDA 4QRSB 5I75B 2CGRL 2Y23A 1MRFH 1MCWM 1KJ2A 4MD0B 4QRQA 3U0TA 4GRWE 1GIGL 1SJVA 3D39E 2JJUA 3I3DA 3EIFA 5A2LH 3DGGA 2ZCHL 1NMAL 4GQPH 1FVEA 5CEYA 1DBBH 4PRHD 1HXMB 4FQCH 4NNPH 1PG7L 5JA8B 5D93B 3DBXB 5A2FA 1U91B 4XMLL 4KPHL 1T1YA 1RVFH 2JE8A 4XNXL 4JR9H 4WO4D 2VISB 4U4BA 3A0OA 1KACB 4EJ1C 4NM8L 2K7QA 3TVMA 3K0WA 4LASL 2D7NA 4I48A 3HFMH 3JVGC 2FR4B 2BC4B 2VDRH 5MERB 1S7SB 1OPGL 4JDZB 4IRSD 4P9HL 3GMPA 1AR2A 3OZ9L 4JFFE 4H1LA 5D70H 4MWFB 1AD9B 4NNYB 4F9LC 1EJOL 1LHZA 1NLBL 3OGCB 2Z0BA 3FB7A 3S37X 4N0UA 5E8OA 3WS3A 1NCBH 3OKEA 1WWAX 5I73C 2ZSVB 4NBZB 3QIBB 4BA8A 1MCEA 1OW0A 5F1KC 5J9PA 2SEBB 4YDIL 2V2TB 1JF1A 4MQTB 4ENED 3MREA 1OHQA 3UAJC 5FO8B 2R2HA 4KRPB 3B2VH 4MD4A 3BPNB 3PV7A 2FGZA 3C08H 3ULUF 1WT5A 4OV6F 5I9QB 2E9WA 3BKML 3FN0H 3FHQA 3QDJA 4LLUA 1YMMB 4HJJL 1AQDA 4LKXB 5I6XC 5CJ5A 5JQ6L 4KTDH 1WICA 2AK4B 1OARH 3MNZB 1N5YH 1ZWIB 4S1SH 4MDJB 4M93C 1BLNB 5FYJE 4Z95L 3TPKA 2DYPB 5ANME 5J06A 2KZ1B 1U2CA 4JQIL 3CMGA 2C1OB 2D31A 2UWEB 4E41D 2YA1A 2QLVB 1A3RH 1IGCL 2A38A 1AE6H 3PIQB 1HQRA 4PJDB 3OAUH 1T7VA 4DKFH 4R4ND 4O51A 4CGTA 4L4TD 1VCAA 4ZS6D 5IB2A 4GKZB 4ETQB 5EU4A 3B2UD 3MXWL 5FCSH 2R4SL 1OAUL 4NYLA 3WXVH 1UM6L 5C09E 4IS6A 4R3SB 2X4NB 2CJUH 1SVZA 4KJPD 1TZIB 4PJ8C 1UM5L 3ARFC 5KSVA 2WANA 1C5BL 3UEZA 3H0TA 3C09B 2DQIL 3QIWB 1RUQL 1DN0A 1FFNA 4J3VA 3S96A 1NBZB 1NPUA 4OIBA 3U6RA 1IC4H 4ONGL 2O5XL 4HGMA 3RX8A 2O5YL 3LN4B 4L5FH 5J8OA 5FYKD 4QRUA 3QPQD 5H2BB 3B5GA 3SPVA 1HNGA 3ARUA 3HN3A 9CGTA 4JKPH 4PRPA 5I71B 4JN1L 2Q3ZA 3JUYA 4Z76B 4YDKH 1XEDA 2YPKB 4F15C 2CKNA 4MA7L 4G8IB 1W72H 4OF0A 1MRDL 5EIQA 4OTXH 5HHQB 3BDYH 4OI7A 3HG1B 2DIAA 2BSED 3AAZB 3PWUA 4R4BB 1V3JA 5IUSA 3MLSH 4KI1A 5H35A 1ZLVH 3VI3F 3MROB 3MLXH 5EOQH 4M1CD 3BRGC 1JMZA 5C0BA 4RX4A 2GJ6D 4ZPVB 3AREA 4X7FC 2VZSA 1KN2L 3D1MC 1P69B 4PLOB 4XVJL 4XI5C 5FF6B 3VRLE 2EH7L 5DD0L 2C1PA 1V7NH 2HWZL 3I75B 4R97C 3KPOB 5DRXB 1WEJH 3V4UL 2V5SA 2WQRA 2NXYC 3D0LA 3P11H 5ESVB 5BS0B 1LEIB 2DLHA 2NY2B 3QEHA 1UM4L 2JJSA 5FB8B 4HJ0D 1OTUC 4W4OC 5DUMH 5FO7B 2CDGA 3NFNA 3GKZA 4HIIA 1XF3B 3W11C 2AP2A 3MUZ1 1YEGH 4JZJB 3I50H 3TBSB 4LHUA 1FZKB 1KEGL 1A4KB 1V3MA 1FH5H 4QOKD 1UA6H 4RGOL 3MRQB 3QHZL 4JFOA 1XF1A 5GGRY 3I02A 4PGDB 4YE4L 4QXUL 1XF2A 3BIBX 2VB5A 2DQTL 1SJEB 3HAEB 3QULA 4PRBB 5KSUB 4XNMA 3O45A 5IFAL 4M43H 1F90H 4OGAC 1BQUA 5TPWH 3GRWH 4JFYB 3T0EE 4ZOBA 4LAQH 4KC3B 5B8CB 2N7AA 4LKCB 3MNVB 2BVYA 4DVRL 1GOGA 2GSGB 4KJQC 1P7HL 1MCRA 4XPGH 1I3VA 2KQNA 4NHUA 4YHLL 4OD3H 5T3XE 2X4UB 1CTNA 3IDXL 2EEDA 4OKDA 5C0AB 5B39B 5IB4B 2EIZB 3KLAA 3QIUA 3UC0L 5E2TH 1EHNA 1S7WB 1K85A 5F6HJ 5CZVH 4OZHE 3KNBB 1VACA 4WCYH 2Z31A 3KVQA 5K59F 3QJHB 1P6AB 3T4AB 4NKOA 3CMOL 3KYNB 4XPBL 3RY6C 4O2EB 5KJRL 2QBWA 5HHXH 2J6EH 3I3BA 4BKLA 4FFZL 3V4PL 3LKOB 5MHSE 1QLFA 2XT1B 4AEHH 3K46A 1IL1A 1U8KA 3HAEG 2NX5B 4Y4FA 3LRSB 3TIEA 4XCYB 1FLRL 3DYOA 1NFDB 3GBML 5D7LE 2FLRT 3NIGF 3RZCB 3V5HA 3T65A 5C0JB 3IDJB 1YPZE 5LWYH 5DFWH 3NN8B 1LNUB 2YN3A 4LSDA 4MNQD 5DGRA 2OBGA 4UUJA 3C60B 3GNMH 4NKMB 2YMXH 3ZE1E 1TTFA 5T3ZD 3X14A 2F54A 3VXRE 4N90D 3UTPD 2XKSA 2A74B 5B39G 4X4ZA 2WBJC 4FFWD 2VH5H 3QXDA 1L7TL 2VLJA 3L5JA 4LRIC 4HCRH 5BRZE 3GMNA 1FC2D 1RIHL 4X99A 3F12A 4NQUA 2VLKE 4Q9BA 2JB5L 5JDSA 3AC0A 3FO9B 4LFHD 4EUPA 4ZO9A 3QCTH 1BZ9A 2FSEA 4WUKL 1U3JA 2W9DH 5C0RL 5KVFH 2R9HD 5DD3L 1H3UA 1FZOA 4JO1L 4YHKL 3B9VA 3NTCH 1SEBA 5CGYC 1Z9LA 4Z0XB 2MSPA 4QHUA 5CHNA 4FQJL 5ICYB 1S9WA 2VDKH 5GGUB 1JWUA 2CO7B 4GG8A 1EFQA 3FT2B 3W9EA 2ADGB 3NPSB 4H8WC 5IGXL 4P2YA 1B0WA 4N0YH 2JIXA 2XWTA 4U49A 3MRLA 3MLYL 5ACLA 4CVZB 1Q72H 3BRDA 2A2QT 3EOAB 1RIUH 3WSQH 4LSVL 3E2HB 3DIFB 1JPSH 5EIVA 1X5LA 2Z8SA 3QQ9C 1HHGA 3BZFA 5JO5A 4ZXBD 4Y7MA 4YHPB 5MI0C 3HNTL 2HTLC 3VWKC 4YEEA 3BFOA 5C9KA 2F53E 1R3KB 3SHSA 3MV7D 5TGBB 2A83B 1BD2D 2G60H 1KIPB 5GJTH 1ONQB 2ESVD 3RPKA 4NO3A 1ORQB 4X7SL 5GS1C 1BFVH 3BMWA 3NAAH 1KB5H 3DNKA 4TNWF 2H32A 3H9ZA 1FYTD 5IMLA 5FUZH 4NN6B 1QNZH 1KJMA 3QUML 4TSCH 5T1LD 1U9KA 4PLKC 2LU7A 3IJYB 5EBLA 1N2RB 2X4SB 2P5EA 3GSVB 2F15A 4DJMA 1A7QL 1B2WL 2BHYA 2EDEA 2VLMD 2LFGA 4CVXB 5DHYB 3LSOA 2BNQE 3MBEB 4PJ9C 4PUBL 1T2XA 3ZKXB 4P5KA 4HKJB 1D5IH 3KJ4C 1FNEB 2YN5A 5BVPL 1EV2E 4HUKB 3RDTC 3SDDA 1I9RL 3WLWD 4CMHB 4IRJD 1FIEA 3QDGA 1A1NB 2PO6B 1U58B 1U92B 4MNGA 3QZWA 3QUXB 5L2KD 1KEML 2MWCA 3LDBC 3MRGA 4BFBD 4QXTA 1QSFA 1LEKB 2JK5B 3DRTA 3TIDA 4H8WH 4PJBF 3NA4A 4AT6B 3MJ9H 3WN5A 1GSMA 1BBDL 3D6GA 3MUY1 3H9SA 4GRMB 1FZJA 2Q76A 2AGJL 3U36B 1SJXA 2R8SH 4Y4KD 4AEIL 1CICD 4I18A 4XB7A 5DS8A 1WGOA 1A7BA 5I2IA 5F3BB 3DX7A 3MO1A 4LLWB 4HUWA 3C5SB 4XPAL 5ISZA 4GG6B 1QA9A 1H3PL 3BKCH 2D7MA 1PKQE 2G2RB 1W8OA 3NCBB 1G0DA 4JM2C 5I8CA 2YBRA 3UTTA 4O9HL 4UB0L 5J4MA 4PTTA 3H3KA 1XGQA 3O2DL 4U1KB 3TA3D 3BPOC 4FA8A 1CE6A 4YDJB 5HJ3B 5DJDB 4JG1H 4JY6A 4JRYD 4QF1A 1F2XK 2NY5C 2OJEB 3I84A 5EIIB 4P2QD 3VMOA 3DHMA 4PJCE 2Q20A 2X4QB 3U82B 4F7MB 1FFPA 1IAIL 1HSBB 4NO5A 4XH2A 2NY6B 4NRYA 5CWSA 5DZLA 1J88A 5GRZA 5B3NA 3O4LA 3ULVH 4KJWD 3IYLW 3LRGA 1B6DA 1PZ5B 4Y8AA 1DP0A 2V9RA 4NUJB 3FFDA 4UBDC 4X9BA 3OGOE 4QRRA 4XPHH 2WQ8A 5I15H 4Z7UF 3MFFB 2VDOH 4X7CC 2D7TL 3NFPB 5DFVD 2F5AL 5TDNB 5CJXC 2XN9D 5ADOL 3HI1B 1CE1L 3ZMRA 4QRPA 4N0CD 3BXNB 4FQXD 4ZDHA 4P9MH 3VFTB 4CW1B 1U8OB 2Q86B 4NWTH 4NDMA 5KW9L 3BVNB 2OJZL 3UROR 3SEPA 4ZFGH 2Z31D 3OR7A 1A6UL 3MRMA 4EI5A 5D2LE 3TN0A 1RI8A 3WJLA 3J8F7 4H5SA 3SE8L 2Y5TB 3MRBA 4ACPA 4QWWD 1CF8L 5GRWA 4G43A 5IHLB 2G9HB 1QRNA 1R24B 1NAKH 5JMRA 2JKXA 4YNYB 4N1CA 1RK0A 4S11A 1FG2B 4CJ1A 4XNYH 2AEPL 1KPRA 5EUKB 4ZTOL 4RISH 3ZHDA 4YPJA 3CH1A 2B20A 1CLOH 2DM4A 3WL9A 1UEYA 4BFIA 2NY5H 4OCXH 4HH9B 1V7MH 3C5JB 1KLUA 4MAYC 5M95B 4Z0BL 3OSKA 4PJXB 2X1WL 5TDPA 3RKDC 1UCBH 2HJKA 4PRIA 2DICA 1DLFL 2E3VA 3U4BH 1MCBA 4HBCH 4OD2A 3IETB 3S37H 1JGDB 4Y2DB 1TQBB 3GMOA 1JHKH 1AY1H 1BP3B 1DUZA 1G9NL 4IBLT 3FQXA 4BQ6A 1RUMH 3GJEB 3BP4A 4MHHI 5LQBL 4X5WA 4C54A 4ZOCA 4L4VE 3O3EA 5IK3B 5T33H 5F7EH 1QO3B 3QG6B 1ZT7B 3NIDE 3ZE0E 3F7YA 4I0PA 1WFTA 1WSST 3EKCA 4WFGE 1WF5A 5I1IH 5C0EA 5J6GA 4MZ2A 4YIQB 4LVHC 2H41A 4OJFL 3VMPA 3BDXA 3MJ7B 1PG7W 1K3IA 3L7EA 1QLEL 4NZUL 1ZGLM 5DO2C 5K9JH 1XIWB 1G7LB 5LXGL 5HGBB 1K8DA 5EU6A 1WAAE 1ZMYA 5E6IC 1MWAA 5SWSA 4WY7L 2VLLB 5FYLL 7CGTA 2CLRA 3SBWC 2V2WB 4QRSA 1MOEA 5C0FB 4YXHL 4MD0A 4FQIL 1KCLA 3OB8A 4KVCH 4PPTA 2W0PA 4FFVC 2BSRB 1T7ZA 4KK5C 4KQ3L 1SVCP 3QUMB 2EC9U 5JTWA 5KSAC 1HXMA 2X40A 3QEGH 4L8SC 4P2OD 3DBXA 1U91A 3CFEB 3P30L 3PGCB 1UWXK 5JHLL 2NY7L 2HT2D 3BJLA 1JTOA 2IFFH 2VISA 2R0ZL 1FAKT 3IGAA 1BZQK 4R2GD 1ZVHA 4ZTPH 2FR4A 2DTSA 5MERA 1S7SA 1JRHI 3FO0L 3RI5K 1DVFD 1NLDL 1HI6B 4JDZA 3QWQB 4KZEL 4YDLB 2BJMH 5D1ZC 2VXUL 4XNUL 1VFOA 3O6ML 4MWFA 3V7AG 3ARZA 1AD9A 1YEHL 4Y16D 1RUPL 2LE9A 5D2NC 3OGCA 3PWNA 3VWJB 1QD0A 2RR3A 4LVNC 2ZOLB 4EOWH 2IGFL 2FEDD 4A2LA 5I1JL 1OAXL 1TJHL 2SEBA 1KTKE 5IFHH 1T89C 3K1KC 1AO7E 5C0ND 4ZO7A 5FO8A 4CDHA 3QCUH 4GOSA 1YQVH 5HHOD 5J1AA 3QISA 5IQ7L 2DIJA 2YWYA 1H3TA 1YEDB 2LTQB 5F7WC 1BM3H 1YMMA 4XCCH 1GCFA 5L6YL 1XCTB 1LQSR 4LLYB 3MNZA 5DK3A 1ZWIA 3U46A 4MDJA 4M48L 1BLNA 3STZB 3VFSB 4U0RB 3VXSE 2DYPA 4ISVB 1J5OH 3SE9H 4ZAKD 4HPYL 3SDCD 3RKPA 2R56H 2IQ9H 3KPMB 4ZSOB 2C1OA 3UTTD 2J6EL 4EIZC 4Z5RA 4ZO6A 3IDNA 4FQPA 5F9WB 1FSKC 1A3QA 3PIQA 4PJDA 5CD3B 4GXVH 2AJXH 4U6VH 2W0FA 3LZFH 2B7DT 1N3NB 1P4IL 5EUOE 1U8NB 1WZMA 3EOTH 1N8ZB 4PREB 1F97A 4ETQA 2FHFA 3TFKD 4KK9D 1RJLA 2UZXB 1RIVH 2H6PB 3QQ3B 5I1DB 3QUZB 4K23L 4R3SA 4OLWL 2X4NA 3MZGB 4PJEF 2WMPA 1TZIA 3BOVA 3NCJL 4BH7B 2E7CA 4I2XB 3NZHH 2VXVL 3QIWA 4M8VA 2QHRL 1NBZA 5SWZE 2JLLA 4HCRL 1YJDL 5EC2B 3UO1L 5JXEC 3CSPA 4IIQA 3LB6D 4MCZB 2EZ0C 3LN4A 2GFBB 5H2BA 2QSTA 5C07E 4FNLL 2QQLL 4Z76A 1QBML 2MJWA 4WHCA 4QRPD 2MFNA 2YPKA 4G8IA 2EKJA 3VXUD 4F8QA 3T0BA 4JFZH 5HHQA 1Q0YL 2WIIB 4MYWB 4APQD 4LIQE 5HXMA 3K2UL 3SJVD 3AAZA 4R4BA 2ZKHL 4Z7VB 4CN4A 4QYOB 4XMPL 3ROLB 3TN0D 3MROA 3L9RA 5I18L 3ZL4H 2GY7B 5JIPA 1GJIA 2CLVA 5D1XB 3LEVL 3BPLC 5FF6A 5T1KD 1J1XL 1JGVH 1H3WM 2MKWA 1QRND 2XIDA 3KLSA 3JTTA 3I75A 1I9EA 5D4QA 5EBWA 1FDLL 5DRXA 1XGRB 4M4PA 2AEIT 3PJSA 1N64H 1I8KA 4HULB 1NGWB 5DXWA 4U1GC 4KHTL 1HZHL 5ESVA 1T2QL 2YD8A 4YC2C 5FB8A 4Y1AD 4AJ0A 2HT4D 2DQJH 2EE3A 2HTKD 4HZLB 3HI6L 5FO7A 5E2UL 5IESH 1JCKA 3HR6A 3EFFB 1XF3A 2ZNXA 5ECJE 1AGBB 3VA6A 5AYUL 1NCDL 5HYFA 4Z7QF 3BIAX 4DTGH 3TBSA 1A4KA 2NTFB 3B9KC 43CAB 2F19H 5FV1L 3MRQA 4PGDA 3O0RL 5CZXD 1NH6A 4PRBA 1SJEA 3FFCD 5KSUA 3S7GA 5MEQB 5FA3A 5LGHL 3ABZA 3WXWL 4DN3H 1YEFH 2ZWLT 3T3ME 4IRZL 3G6DL 3QT2A 1A7NL 2EDRA 5DD1H 5B8CA 4LKCA 4NC1E 5EZJB 4F2MA 2GSGA 2X44D 5AAWA 1B4RA 1NUNB 5JW4R 4TULH 4KKAD 1J1PH 1BQHA 3D18B 4JREC 3C5ZC 4HDIA 1YYML 5HD8D 3SDAD 5C0CB 5C0AA 1JPTH 4LVEA 1HKFA 2EIZA 4PJAB 3C6LC 2ARJB 1JNLL 4XCEB 5C2BL 1K6QL 1S7WA 1RUAL 5JNYB 1I1YA 1BFTA 4OCRH 3TZVB 3KNBA 2V17H 4PJGF 1CLCA 2WWMC 3QJHA 5C92A 3NCFB 3NFSH 4G6KH 3IU3B 4RGNC 3KYNA 3HMXH 4LPVA 5DSCB 4O2EA 3B5TA 4LSSH 3LKOA 3IDUA 5IT2H 2ZG3A 1N5AB 2NX5A 1ROWA 4DUWA 4XPFL 2DLIA 1HINH 3KPSD 2HVKB 3LRSA 5I30H 1A7OL 2VZTA 3KPRB 1NFDA 1HIMH 4JVWA 3ZHLA 3RZCA 2P5WA 2PCPB 4P2RE 3T77B 4PJ8B 3IDJA 1BOGA 3TYGH 3FZUD 3NN8A 3V8OA 4JQVA 1LNUA 3C60A 4NKMA 4LSUL 2HFFB 3WJJC 2DL2A 5E8NB 4L8BB 3NACL 3E8UH 3V0WH 1CU4L 1FN4B 3CFCH 2QL1A 1KB9K 3GB7A 4GMTL 3QDHA 1LDPL 4K3JL 4JPWL 4V1DE 5FYJL 1RULH 4XWOC 4OCLC 1GGBH 4OSUH 3GI8H 4F15B 3JV0A 2H1PL 1G84A 4UQ3A 1MFDL 2R4RL 4ZOEA 3FRPA 1FRGL 1S5HB 3FO9A 2Y6SC 3QIBD 3VG0L 3QO1B 5F7MC 5D96C 4WFED 3VG9C 1E4JA 5IVNA 4QLRA 3ARDB 1J0JA 3GK8H 2CMRH 3HRPA 4ENEC 1TJGL 2A1WH 4Z0XA 4LPTA 5E8EA 5DRWB 1GPOL 5ICYA 3CFIC 3MACH 4JEGB 3FT2A 3QAZB 2ADGA 2GJZA 1ZOXA 2AK4D 1ITCA 4UTBL 4TOYL 5CCKH 3WIHL 4YH6A 5F96L 3EOAA 4P2CG 4PD4K 1GHFH 2BNRA 2DMKA 4LSRL 5E1AA 4ZUSA 3DIFA 1LO4L 3DMMC 3OKKB 3RVVC 4KKBC 2OTUB 4PJFF 4Y5VA 5HSFA 1A7PH 1IT9L 2DN7A 2WLZA 3OF6D 2F74B 1EH9A 1R3KA 3AS2A 2Z4QB 3QG7L 1VFAB 1OGAD 3H8NA 3U0WH 2A83A 2A9NH 1KIPA 2VXQL 5BVJB 3SKOB 1QSVA 1EEUA 3MRNB 4NN7C 1ORQA 4R4NC 2Q8AH 5DLMH 1LP9B 2XTJB 4D2NA 4YPGB 3MLRL 3ISWA 3OAYH 2FDBP 1QYGL 4R90H 1N2RA 2X4SA 2FL5B 4X0KB 2DLTA 4CVXA 3R06B 1TCMA 4CNIA 3SCMA 2R0LH 1YQ2A 2HP4A 2XY1A 4WDIB 1F6LL 1WBYA 3C6SB 4DK6A 2W9EH 4HKJA 3P77B 1FNEA 1Z5LB 3PL6D 4YO0A 3OKNB 3S37L 4UV7L 5IJVB 5I8KL 1YNLH 1KXVC 1Q1JH 4LU5L 1DBAH 1AXIB 1MI5A 5AZEH 1A1NA 1U58A 3M8OL 1UT9A 4AK1A 1S7TB 4X80L 3RNKB 3QUXA 4KKCC 3DUSA 4K2UL 2EE6A 1IGFL 4PRNB 5CIPB 1LEKA 4L9DA 3UTSD 3BN9C 3HG1D 1MCPL 3VU2A 1S9KC 3O2WL 4AT6A 1MJ8H 1J05A 4GRMA 3SQOL 3D69B 1BQLH 4FN0A 4OIIH 3MLWL 4M9OA 5ETUB 1CR9H 2R69H 3KPQB 1S7RB 3U36A 2V9QA 3LEYL 4GRLB 2B1HL 2ZJSH 2ZNWA 5F3BA 1BJ1H 1SBSL 1CGYA 3OAZK 4UDUB 3C5SA 3KXFB 2HRPH 4F7EB 5BS0D 1JPFA 2NY2D 4I9WE 4P57A 2G2RA 1NSNL 2CDEB 3FB6B 4ZD3H 1UVQB 4PJ5D 3P9WB 1OB1B 5T3XL 4ONFH 1JTPA 1U8JB 4NZTL 2IADB 3HUJE 3QI9D 1DN2A 1X44A 3EYSH 3OWEA 2DLFL 3GHBL 1KBGL 3S6CA 3RIAK 1JPGB 5HJ3A 1KIRA 2Q8BH 4GRWB 3RIAF 2AABH 5C08D 3D39B 1Q0XH 4OCSL 2OJEA 3RA7L 5EIIA 3CLFL 2DKUA 1KTDB 4I3SL 3ZYJA 4DKEL 4F7MA 1HSBA 1J8HD 2UUDK 4UT6L 3KYMB 2EEAA 4P46C 5FYKH 1IAMA 1PZ5A 1J87A 4NUJA 2FEEL 1R5WB 1Y18B 1I8LC 3L3HA 4HXAL 7FABL 2MCPH 2DAVA 1EDQA 4ELME 1W8NA 4OLUL 5TQ2H 4Z7NE 4RWYH 5TDNA 5BW7C 3PWPD 2E7MA 2XOTA 4JFFB 5FCUH 5L0QC 3HI1A 4LBEB 2DQHL 3BXNA 4MLIA 1MCDA 3CNKA 2F54E 3GSUB 1NAML 1U8OA 2Q86A 5F1NB 4HPOL 1J0HA 1CN4A 2AJYH 3P73A 4FZ8L 3IS0X 3SKNB 4KQ4H 1A2YB 1TZGH 2J88L 1ZTXL 2VLJE 3H3PL 1N4XL 5FM5M 2Y5TA 2HFTA 4M03A 3V5DB 5GS1B 3SY0A 2GUOB 3D5OF 4KK6D 2GIYA 3T0XA 2G9HA 3GHEL 1R24A 4NNXB 1DL7L 1GH7A 2DM2A 4YNYA 4PJHF 3AS3A 3SE9L 1FG2A 1RZKL 3LS5L 1CDJA 1MAMH 5EUKA 1P53A 2VR5A 12E8L 4PJ9B 3PGFH 3VRIA 4HH9A 4OV5B 1LO5B 5ANMB 4TN9A 4G6ML 3TVMC 1C1EH 3C5JA 3OJVC 1OAKH 1CIDA 3NGBC 3H2WA 2NY3D 1E6OL 2C4XA 4FFWC 4XC3H 1EGJH 3X17A 4HUXB 4YX2L 1N0XH 3ZDZF 1FV1B 3W82A 4BZ1H 1O7VA 2KQMA 5SX5H 1RUKH 3LDBB 5KSBF 2OR9H 3IETA 1I7RB 5HDOA 1CVSC 3I85A 5FDWB 1S7QA 3H42H 5FUOH 5K93A 5FIEA 3GJEA 3UZQA 1AP2B 5DZOA 1IZJA 5C09B 1OW0C 3F6IA 3Q6GH 4KAQL 3TJEH 2RHEA 5IK3A 3L95B 4Y89A 4KVNH 1QO3A 3UJJH 3QG6A 4LPCA 1ZT7A 4NBYB 1Y6MR 2CQVA 3QEQD 1KCRH 1EEYB 4P23B 3W2DL 3IFLH 5GJSH 3P0YH 2XNAB 3MSPA 3RPIB 1WT5C 3WD5L 4GW4B 3VD5A 1EBPA 1FAIH 1S9VB 5F97E 4WU5B 2P5EE 1E28B 1KJ2H 4KROD 2D03H 4L3EE 2Z8RA 4IHOB 4JPKL 3RUGE 1MCOH 4JFXB 1MFEL 3UZEA 1XIWA 3QWRA 5CBAA 1G7LA 3S3SA 3WDIA 5HGBA 5I1HL 3ZKQD 2VLLA 2B2XH 2VKWA 2V2WA 1CZ8L 3PHOB 4YBQD 5GPRA 5C0FA 3TT1L 5IWLA 1LGVA 5MENA 1I1CA 4WW1B 2Y07H 2Z8VC 1I7TB 3QUMA 1QSFE 5BV7L 1LO2H 5FKPA 4ELKB 5F88B 2ZZUT 1M7DB 3CFEA 3MLZL 4Z7OF 4KRLB 3H6JA 3PGCA 4Y5YB 1YECH 3HPJA 4XVTH 5D6DA 4H1LH 5DA4A 1XF5B 4RMQA 3SE4A 1Q9LB 4WWID 1CWVA 2VLRA 2AXFB 3MBED 3ZHKA 2LU3A 3BWAB 1LE9A 4GMSH 2I5YH 3EZJB 5E2VL 3MJ8B 1HI6A 2XQBL 4AM0B 1P9MA 2AJSH 3F7PC 3SN6N 5SWQB 1I1FA 3U7WL 1WZ1H 3RWHB 3VFGL 1R3HB 2ITCA 3S34L 4HX1A 2R1WA 2PO6D 4JKMA 3WLWC 1A1OB 2UV3A 5DRZB 2ZPKL 2XFXB 3VWJA 2PXYB 4DWHA 3V5KB 5JHDA 3KYKL 4NFDA 2H2PD 4Y5XA 1AC0A 2D7PA 1NEUA 1QRKA 1SYVB 3BMVA 1U3HB 4TVPE 4K7PY 3PDDA 2ICWJ 4TULL 5E5MB 3T0EB 1J1OL 4OZFB 1TIUA 2YZ1A 5ACZA 3QR2A 4NGHL 2NXZC 2FJGA 3AREC 1I3GH 5T1DL 4GBXA 1DQLH 1HILA 4WEBH 3MXVH 2WWKT 1CK0H 1QFUL 2VDNL 3B43A 3O6FD 1XCTA 3L1OL 2X5PA 4LLYA 4M5ZL 2R0KL 3VFSA 3G08B 2VNCA 4QRRE 2OSLB 3O2DA 4ISVA 4LSPH 2AJZA 4KKNA 4MAYB 1T6WA 1ULVA 2JJSC 3KPMA 5TE4L 3QPXH 5JOFB 4ZSOA 1S7XB 4NKIH 3KLDA 1FJ1B 2EDHA 4OZHB 3RAJL 1A5FH 4DK3A 3WDJA 2G75B 3MV9D 1OSZB 1N3NA 3F58L 2QKIB 3EYOA 1WBZB 1IKFL 5EFIB 4M1DL 1M05B 1OLLA 5F7UA 1U8NA 1N8ZA 4PREA 3AUVA 5DURB 2E9JA 3QQ3A 5I1DA 3OXRB 2NY6D 3GMLB 3KR3L 5D7LB 5IB5B 4OZFG 2XG5A 4PJEA 4BH7A 4RDQG 1YPZB 4KJWC 4G5ZL 4I2XA 3TO4A 3CX2A 4F7CA 1LILA 5D7KE 3VXME 3CDGB 2I24N 1KJVA 4F7PB 2FJHB 3I9GH 4WW2F 4MCZA 5EU7C 5CP3A 3VXRB 4BJLA 2VDPL 1NAMB 1YEJH 3LKSA 3RJDA 2RB8A 4P99A 2YK1L 4UIMA 4WTXA 3HB3D 4U6XB 1YDPA 3MOQA 2XKNB 1OP3H 5BRZB 5D7SL 2IANE 4XPTL 4LQFH 5JUEH 4J12A 4N0CC 5F1SA 1NKRA 1OSPH 1CCZA 5DC4B 4PRAB 2VLKB 2ZUQB 5DT1L 2X1PA 4KRNA 3NCMA 3SKJL 4PTUB 3JTSB 2JB6B 4MXVF 4PRIE 2Z31C 2VZVA 4JM4L 4NQDD 4KZDH 3UJTH 1KNOB 4NN5B 2C5DC 2PW2A 4FMFA 5D1XA 1YEKH 2Z35A 1R5VB 1A7RH 1L7IH 1F4AA 4N1EA 3QA3B 4HG4J 1H0DA 3CK0H 4XRCB 4Y4FC 3BE1H 5DJ0B 1A6PA 1U8IB 3MCG1 1TTUA 4K3DL 1C16B 3KYAA 4G8EB 4JB9L 2MHAB 1F2QA 3EYFA 3RL2B 1EO5A 4HZLA 3CPLB 3JWNC 4XT1C 3WKMH 4TTDC 4X6CE 1G9MC 2CKBL 5L2JB 3G6AA 3BJ91 4S1QL 4LGSB 5DMGC 2ATPA 5EOCH 3O81A 1CTOA 4D9QE 2D9QB 4I13B 2F53B 1M6OA 1ZHBB 2NTFA 3GI9H 3IDMB 1A9BA 43CAA 4YXKL 4QNPF 5EU6E 1FGNH 4Y2DD 4ZPTB 4QY8A 4B53A 4LNVA 5MEQA 4BZYA 1QR1B 5JMOC 3ARTA 3PG2A 4HMEA 4WWKA 5KS9B 5L88L 4EKXA 2B5IB 3MMEB 4AMKL 3VMNA 4BM7A 5EZJA 3LN5B 5IG7A 2WV3A 3ARGB 2VKXA 2BNQB 4W4NA 3V2AR 3D18A 3BQUB 1LO0L 3QEUB 5F9OL 1TPXC 1A47A 4DZBA 4L8CB 3HE6D 4L29A 4Q0XH 1WFNA 4PJAA 4FQHB 3B8SA 3BO8B 5SV3A 5JNYA 1CLYL 3TZVA 8CGTA 1JFQL 2EDNA 4RFOL 3L5WA 4OGYL 1CD1B 3KLHD 1MAJA 5BV7B 4FTVD 2BVEA 5DSCA 1JYWA 3V7MA 1IGTB 1IGML 4GS7C 1M71A 1N5AA 4XHJC 15C8H 1I3RA 4PFEA 3RX7A 1K4CB 2HVKA 1UEMA 5A2IH 1NKOA 1CD9B 3BP7B 1G9MH 1TENA 3KPRA 3GSOA 2QQKH 3GJFK 2PCPA 1OOAA 2CUIA 2RCSH 4N8CL 2WZPD 5IHUL 1MFNA 3TLRA 4OT1H 5L9DH 3GJFB 2HFFA 3HE7B 4JQXA 3RVUD 4C58B 2AJ3A 4NO0D 1NGZB 1PKQB 1WK0A 1FN4A 1BMGA 4OZGF 1YY8B 3ULUE 5T5NF 4PP2B 5BQ7A 2VZUA 3LY6A 1WV7T 1OT2A 4EUPH 4H0IA 5HBBA 1F42A 3BKJH 4YHYB 4TUKH 1ZHKB 2YPLD 3SDDC 3TYFA 4M6ML 4C59B 1HHJB 5C0GB 1PX3A 1G7PB 4ETYA 4N9GB 3EOBB 2EC8A 2JTDA 3U30B 1I9JL 1Z9SA 3EHBD 1FZMB 4LLVB 1X9QA 2MNUA 4OI8A 4PJCB 4FMKA 4JG0H 3QO1A 2FEDC 4DGYH 1IQWL 1NBQA 2P48B 1JN6B 4N5ED 3STLB 3Q6FB 3ARDA 3MOAL 5CSBA 3S35H 1SYSB 4M6OH 5GRYA 4Y19D 4D8PB 3LQZA 2IBZY 3NCEB 4WI5A 2BMKB 4D0BB 4EIGB 1J12A 5E9DA 1VGEL 1I3UA 4IMLB 4UV4H 3WFBL 2AJUH 3DI2B 3MRDB 4I18C 5CJ8A 5BMFH 5FV2A 2X4OB 2R29H 2B4CL 2QQNL 5JOPD 4HFWB 1PG7X 4HWEH 5D6CB 4PRHE 3PQYD 4L9LB 1ZA6B 3MA9H 2B1AH 5CMAB 1CXEA 1RJYB 3OKKA 2OTUA 1MHEB 2IWGA 2PYFA 4PJFA 2H32H 1AGDB 2AAVA 1KSRA 2F74A 1DBJL 2PR4L 4PR5A 2JELH 2ARWA 2Z4QA 3EJYC 1I9IL 1K4DB 4FP8L 3WYRA 1VFAA 5D2LB 5C2UB 1FIGL 1IAII 3MNWB 5IP4A 5BVJA 3SKOA 1DBKH 3WUZA 2NY4D 5HY9B 4LIQL 1LP9A 3DETC 1JRHH 2IQAA 3FN3A 5GISL 4KMTH 3QUZD 1GGUA 4YPGA 4UT9L 3L5XL 1H8NA 1NC4B 4X6FB 5ID1A 5I17B 2Q7YB 2FIKA 3ZE2F 4RAUB 2FL5A 5IW6B 4X0KA 1T22B 3QFJD 3R06A 2MKLC 4HW6A 4WDIA 1MCQA 2OI9B 2CUHA 3P77A 3QXVA 1Z5LA 4OAWA 2GT9B 5IJVA 2GTZB 2XRAL 4OLEA 4JY5H 4MVBD 1S7TA 3RNKA 3MX0A 2FZ3B 1UH4A 3IAQA 2OTWB 4XTRD 5DVNA 2JCCF 3BPCB 1U8QA 4DZ8B 4PJIF 4MAUH 1WUNT 4PRNA 5CIPA 2BVTA 5E5UB 2ZG2A 4WHYG 1B88A 3D69A 4EI5C 4L4VB 1M1SA 5ETUA 4UT7L 3TN0C 3WJLC 3OHXB 1BWWA 3KPQA 1S7RA 4AEFA 3VXNB 2Y06L 4GRLA 3SDYL 4R8WH 5FO9B 3MLUL 1A6WL 1CFSB 4E41E 4UDUA 1CGUA 1ND0B 1IQDB 2IPTH 3GIVB 4RBPH 3K81A 4F7EA 4WJ5B 3X12B 2B0SH 2MOVA 5GSRA 1PKOA 5L8KB 4L4TE 4IOIB 1YN6B 2CDEA 3FB6A 3P4MB 5DJAB 3VH8A 1IRAY 4OLZH 2OK0H 1OB1A 4S0SD 5L7XH 1DEEB 1Z3GL 3L3GB 4M7JL 4NJ9L 3ZYIA 1I1AB 3PWJB 1ZXQA 4LHJB 1JPGA 2NY1C 3MV01 2DQDH 4UI2A 5ALCH 1DUYA 3GSQB 4JJHA 3NMEA 1ZEAH 3D39A 1ED3B 2BP3A 3NCCB 1KTDA 4JRXD 2XXCB 5CUSH 5CZXC 3D85D 5K59E 4Z7WF 5D96B 4EI6A 3TBVB 4GMSL 4JANB 3UAJD 4XC1H 1DQML 5CJOL 4WFFD 4I5BB 3MUGB 1R5WA 1VFBA 5DVOA 3BISA 3C9NB 3SKMB 4ODTL 5C6TH 4M7ZB 2P5WE 2CXKA 1B0RB 3NIGE 4Z77B 4NQEB 5IVXF 4GAGH 3ARVA 4I0PC 3REVB 3WBDA 3DYMA 1NGPH 1S7UB 5C0CD 1D9KB 1PLGH 4IDLA 5DQJB 5HD8C 5HI4C 2ITDB 4LBEA 3HR5B 3LKNB 5HI3C 5E4EB 1P7KB 5IM7B 1YZZA 2UZIH 1T1WA 3DMMB 3IFOB 2NR6D 5F1NA 5F44A 5TE7H 3WDHA 1A2YA 4OZ4A 4FQ1L 1NFKA 1F58L 3UXFA 4KFZC 4JO3H 3D3VA 4NP4L 1NMBH 5I75C 2DM3A 1FNSH 2EDTA 3V5DA 2F8VA 2GUOA 1AO7B 3PDOB 1K9TA 4NNXA 5INDB 4HKBB 2QADB 1EO7A 4OF5A 3BP6B 4IM8A 5D93C 4PJ8D 4UOW1 4KI5D 3M1BB 1NCWL 4JAMA 1CQKA 3DJ9A 1TITA 4GXUM 4XNQB 2ADJA 3FZUC 4QOKE 5GGVH 5DMJB 3DX9B 3RU8L 3VXSB 1L6XA 4P59L 4OV5A 2GITB 1LO5A 1OQXA 4OZIF 4OLXH 2EECA 1JGUL 4HUXA 1KJ3L 5C9JB 1P84K 3O6LL 1FV1A 3A6BH 4RSVA 6CGTA 2BDNH 5KAQG 2BNRE 1I7RA 5KSBA 5KVDH 4PYGA 5FDWA 5EPMB 5EUOB 1RMFL 2YRPA 1ZE3C 4C55A 1T4KB 3JWDL 5F6HI 5F70A 4N0FA 3LV3B 1AP2A 3QIBC 1NGYB 5C09A 4UTAL 3WHXB 2FH6A 4F57L 3L95A 4XI5D 1CXFA 2DQUL 4CU6A 1NL0L 3U4EB 3CXDH 4KRPC 4TSAH 3T0DA 3BPNC 3S88L 1RAMA 1EEYA 5SWZB 1DQDH 2XNAA 3RPIA 4RMTA 1MWAH 3WIHA 2NXYD 1KFAL 4GW4A 3ULUC 1S9VA 1URLA 3JBG7 4WU5A 4ODSL 1MFBH 1E28A 5GGQH 5C07B 5DZNA 2AVGA 1OTUD 4IHOA 3TNNB 4I77L 1SM3L 1HXYB 5I74C 3SDXF 1RZ8B 4WHTB 3W11D 2F8XC 1VB9A 1X5XA 4ODXB 5GIRB 3PHOA 1MI5E 3ZDYF 3FQTB 5FAAA 4G9DB 1NQBA 3WFCH 2HG5B 4POZD 1XGPA 1I7TA 5T3ZE 5FYJU 2DKMA 3QQNA 1N6UA 4NRZB 1SQ2N 4EDWH 3MRFA 1BQSA 4N90E 1VDGA 3G5VB 1M7DA 4U6TA 4JGMA 4OGAD 4OFYA 1IEBA 2IG2L 5T1MB 4UIKL 3CSBA 4Y5YA 1G9EA 4TQEL 5BCAA 4JFDD 3HC4H 3TCLB 1Q9LA 1MJUL 4KJQD 1QLRB 2AXFA 2CRIA 3BWAA 3C09C 5EWIL 3QIWC 4YK4B 1OWRM 3MJ8A 4AM0A 4WI3A 5SWQA 3P40A 1V3LA 1H15B 4IIQC 3P4OA 3RWHA 1MFCL 4NZDA 5DEGB 4H26B 2ZOKB 1A1OA 3DX8B 4RIRB 2XFXA 5I71C 2HKFH 2PXYA 1LK2A 2DOCA 3MODL 5IIEB 1JWMB 3V5KA 4YAQB 4M7LH 1JBJA 1TMCB 3S36H 3ULUH 1GGCL 1X4YA 4LRNL 3FHAA 1SYVA 1U3HA 1X5FA 3R1GL 5E5MA 3O9WB 3T0EA 1OP5K 5DMYA 2PTUA 4OCWH 3LMJH 4WNQB 2VDMH 3IF1A 1OAZL 5CEYB 3WO4B 4M7KL 4Q0XL 2YKLL 5BZWA 1AR1C 3KS0H 1QBBA 1E6JH 2BY0A 5BZDA 3KXFD 3RWCB 3MV7E 2QTEA 3FMGL 1BD2E 3V6ZB 1EFXD 4HMDA 2ESVE 3G08A 1AFVH 1MRCL 4R96B 4NO2B 1F45A 2OSLA 4Z7UE 1S7XA 5AZ2H 5I19L 2BK8A 2YZ8A 4L3AA 1FJ1A 4PLNC 1OTSC 4QKXB 4OZHA 4ERSH 4J3OC 4HWBL 1EZVY 2Y25A 2QSCH 1CDCA 1KCSH 2G75A 1J86A 4DOHE 2VLME 5HYJD 1OSZA 1PX4A 2QKIA 1JNNL 1WBZA 1RJZB 5EFIA 1M05A 1QFWL 3V52H 2Q1EA 4TPRL 4OIAA 4OF3A 3FQWA 1YEEL 3OKEB 4K71B 2FCBA 3OXRA 4Z8FH 3NABH 3GMLA 5D7LA 5GZNC 5IB5A 3UJIL 4P2RB 1MH5A 1YPZA 4KDVA 5CGYD 4G3YL 5L2KE 4F3FA 2CK0L 3GO1L 2FX7L 3MZTA 4Z18A 5B8CC 3CDGA 5EO0A 1E27A 4F7PA 3IXAB 2J8UA 3VXRA 3K8MA 1NAMA 3RVTC 1X5IA 4V1DB 4JFFD 4DQOL 4U6XA 4JVUA 4U2ZA 5BRZA 5CEZH 3QQ9D 4FQLL 4PRAA 2VLKA 4QXWA 1O0VA 1CFQB 2HTLD 3JTSA 5GHWL 4H1LG 5I1AB 3VWKD 3ZO0A 1AHWB 1ZLSL 2JB6A 5GRJH 2VDLH 3AMLA 1FCGA 3CZFB 1QVOB 1KNOA 2AI0L 2WAHA 4O51B 4S1DC 1R5VA 5E03A 3FB5B 5HHNB 4UOW0 4DAGL 3IJHB 4XRCA 2D0GA 1G7JB 5DJ0A 1SBBA 5EU4B 4PLKD 1F4HA 3OPZL 4NYLB 3RZCC 2XQYK 5LJYH 1JHLL 5LBSL 4L1HA 3ZSSA 4G8EA 5CLTA 1EO8H 5H94B 2YPVL 4JQVC 3BZEB 2VDQL 4PJ9D 1WVZA 1IC5H 4M62H 1BGXH 1A3LH 4P49A 2PETA 2N1KA 2C3HA 2EC9T 3C60C 4P2QE 4PG2A 3RL2A 4D9LH 2APBA 2IC2A 1DSFL 3CPLA 1HWHB 2P8LB 3WNLA 3RDTD 2FBJL 3HAEH 5L2JA 1CGSH 2C3XA 4QRUB 3LPWA 3SPVB 4FXGB 2KL6A 2F53A 1TDQA 1ZHBA 3WFDH 2XZQH 4L1DA 1IEHA 1QFPA 3BGMB 5IVOA 2LVEA 3HI5H 4ZPTA 4G7YL 5I66B 1A6TB 2YD3A 4MQ7B 1QR1A 2XN9E 3UMTA 5KS9A 4RZCA 5MENE 3MCLH 3MQIA 4LSQL 5H35B 4BSJA 3MV8E 3LN5A 3NCYP 4HG4K 3U7AA 4X98B 4DFIA 5AEAA 4LCIL 4WENB 2CGRH 3ARGA 4BSVB 2BNQA 4P23D 3TM6A 2UZYB 1GIGH 3BQUA 1A0QL 5DJXB 2EIBA 3QEUA 5J11C 2VYRE 4KY1L 2XZCL 2ED8A 3MRCA 2ZCHH 3EW3B 1T2JA 2XA8L 3D0LB 3SGDI 4L8CA 2XQYG 3L6FB 1PG7H 2VLRE 4AG4L 4FQHA 4JM2D 4XMLH 4LLMB 4KPHH 1JZ6A 4XNXH 3BO8A 1MCJA 1P4LB 1EEQA 3E2HC 3NFNB 4HIIB 1AGEB 2ZCLL 4NM8H 4KGJA 1CD1A 4LASH 4Y5VC 4EXKA 3MRHB 4ZUWA 3TT3L 5J12B 4Y4HA 1OPGH 1IGTA 5DHVB 2XZAL 1AI1L 3THMH 3T09A 3OZ9H 3D2UB 4JFOB 1GGIL 2EE9A 1XF2B 3U1SL 5JHDE 1EJOH 3QULB 4TVPL 3P9LB 4KJYB 1NLBH 2DMCA 4NN6C 1Z0NA 4JGUA 2Y4SA 3GJFA 5EDXA 4UBDD 3HE7A 5J57B 1NGZA 1PKQA 4JGJA 3SO3B 5HTSA 3RWDB 4YDIH 1YY8A 3LHPL 5F6IC 4U1SB 1IGIL 3SCMC 4PP2A 3ZKXC 2OMBA 1CFBA 1ZHKA 3HUJB 1R3LB 4ODUA 3CU7A 2K9UA 1BJ8A 5IEKB 1HHJA 5C0GA 3BKMH 1G7PA 3QIUB 4N9GA 3EOBA 2A6DB 3QUXC 4GW1A 1ACZA 4HJJH 2EDXA 1WQVT 1FZMA 4LLVA 1D6VL 1PD6A 5JQ6H 5E95B 3ZT5A 4JHAL 3T2NL 4WI7A 3ALXA 3OMZA 3ULVF 4Z95H 4X8JB 4JJ5B 5HHMD 2H2PC 3SGEI 2L0DA 3Q6FA 5ITFB 1IAKB 4JQIH 1UFUA 5HDLA 4AQ1B 2ADFL 3RHWK 3PHQB 3CUPB 4OFIA 2BMKA 4D0BA 1FCCA 1C5DB 4Y4FB 4I3RL 4IMLA 1IGCH 1PLGL 5D1QB 4EBQL 4NUGL 1TVDA 2AXHA 3QNZA 5JIHA 1BVLB 3MRDA 2KBGA 2MPAL 4W6YB 2EIDA 5IFJB 4PJEE 3E3QC 4ELMB 2X4OA 1XAUA 5T3XD 2ENSA 4C56A 3NA9L 4UUJB 4HFWA 3X3GL 3MXWH 4ODVL 4Q9RL 5D6CA 2R4SH 1OAUH 1S9YB 1UM6H 4BZ2L 4L9LA 5DRNA 4MAYD 5JW3L 5CMAA 2X4PA 1RJYA 2F54B 1UM5H 1HK6A 1C5BH 3CAFA 5KOMC 1RFDL 3QP3A 3RKDD 2DQIH 1AGDA 1T21B 3A6CL 1RUQH 1S3KL 3QXDB 2VLJB 1J9CT 1K4DA 5F71A 5D2LA 3GMNB 4ONGH 4X99B 4JM2F 1FFOB 2O5XH 4OQ1A 2O5YH 3JXAA 5MHSD 1AGFB 2D2OA 4JZOB 5DWUL 3MLVL 4JN1H 4PBXA 3S3JA 1I4FB 3HC3L 2FEEI 4NHCL 2AXJA 1GZQB 2FSEB 4MA7H 4P5TA 4RNRB 4X6FA 1ZT1A 4Q6YA 3GKWL 4RAUA 2NZ9D 4LHQB 1MRDH 4PGEA 1QFOA 1T22A 1PW3A 1FZOB 4DUXA 4D0CB 2AQ1A 1P1ZB 1OCWL 4RQQB 1JYVA 4UILL 4GG8B 2CRYA 3U4AA 3W9EB 2JJWA 4JO2L 2GT9A 2QHLA 1KN2H 4X8XA 4XVJH 2GTZA 2EH7H 5DD0H 5GS3A 2XWTB 2ERJB 5CFHA 3MRLB 3WS6A 2FZ3A 2HWZH 1J0ZA 2ZUVA 5DO2D 2OTWA 4P3CL 5HHOE 3BPCA 3V4UH 4OFDA 4HLJA 5E6ID 2JCCA 1T7XA 4K94L 4LLAA 5EU5B 3QWOB 1HHGB 4D0DB 1UM4H 2P8PB 4D3CL 4XWGL 1INDL 4HIJB 4NQTA 1J7VR 4Z7QE 4FFVD 4KK5D 2A6KB 4L4VA 3OHXA 1TQCB 5KSAD 3VXNA 2CXGA 4XCNB 2FX9L 5FO9A 3H9HB 1CFSA 1KEGH 1ND0A 5DJZB 1RZJL 2E7LA 4RGOH 3GIVA 3L3JB 3QHZH 3EZ8A 4WJ5A 4YE4H 4QXUH 3X12A 4LVOB 1HYSC 1UENA 2CKBA 1UGNA 2DQTH 2P5EB 1L4IA 1YN6A 1FQ9C 3P4MA 4LAJH 3E0GA 5IFAH 4L3EB 3RUGB 1H8OA 1ITBB 4XBPB 1DEEA 3L3GA 4P5KB 5FM5O 5D1ZD 1JJUA 4DVRH 4UDTB 4TUOB 3UX9B 1IBGL 3PP4L 4S1RL 2X89A 3GIZL 4QO1A 3GSQA 3QZWB 3RY5A 2JF1A 3CSYB 1AD0B 4YHLH 1UJTA 2EDWA 1ED3A 3CFDB 4QXTB 1QSFB 3IDXH 4LCCB 4PJGE 1QPPA 4HIEB 3UC0H 4KTEL 3WN5B 3S9DB 2OR7A 3TBVA 5FHAL 1NANI 1IVLA 2COQA 4I5BA 1FZJB 2Q76B 3L3DB 3ILQC 2BNUA 3VXUE 2YS4A 4YHML 4DUVA 3CMOH 4U31A 5MEPB 4TUJB 3LD8B 4XPBH 3I2CL 5KJRH 4JFQB 5DS8B 2DL9A 1B0RA 5DC9B 1MLCA 4NQEA 4Z77A 5I2IB 4FFZH 3V4PH 3REVA 4K8RL 4YLQT 3X3FL 3KYOB 5LCVL 1D9KA 5B3JF 5DQJA 4R6UA 4QXGL 1FLRH 2ITDA 2R1XA 3HR5A 2J3SA 3GBMH 4NQCD 2GK0B 5IM7A 1P7KA 1TJIL 1QACA 3IFOA 1MUJB 4JO4L 3GSRA 1XIWC 5I8EB 3WIIL 1EIBA 5E1HB 5KVGH 3QZWG 1PEZA 1IE5A 3QXAA 3R8BB 3RTQB 4KTYA 5IWLC 4JPVL 4Y1AE 4BUHA 1U36A 1AO7A 4P4KA 3U7YL 3T04D 4U3CA 1L7TH 3PDOA 2DDQL 2VJXA 1RIHH 2DWEB 4J4PA 3BP6A 1AJ7L 3EO9L 1LO3L 2KZWA 3M1BA 4J3SA 1CGVA 3CXHJ 2JB5H 3IAGC 2C9AA 2APFA 2DRUA 4XNQA 5D6DC 3T0VA 3LN9A 3DX9A 3HE7D 5AYQA 4ZFOA 3SE4C 2YD9A 3VXSA 5E9DE 4WUKH 5JXED 2GITA 5CP7B 3P3YA 5IBTL 2QSCL 3KG5A 4QRRB 3FFCE 5C0RH 5C70A 2EZ0D 5DD3H 1GAFL 5T5FL 2FGWL 3B9EA 4JO1H 4MB4A 4YHKH 3RGVB 3EDKA 1PVHA 1ZS8B 4FQJH 5C9JA 1X7QB 3MGAA 5EA0L 3JVGA 5IGXH 2PTVA 4QT5A 5DYOB 3GFUA 3B9AA 3VWJC 5EUOA 4MQXC 1CDBA 4PJFE 2AK1H 3MLYH 1T4KA 3OR7B 1JZ7A 4Z78A 2NY0B 1U93B 3MRMB 2CH8A 4G9FA 1NGYA 4LSVH 4EI5B 3G04B 3W39A 2YWZA 1IM9D 4HKXB 3MRBB 2QR0B 4OQTL 5FGRA 3RX5A 3HNTH 1QPXA 5DQDL 3VXMB 4N1HB 5SWZA 4GBXC 3R4DA 1D5MB 3NBNA 2X05A 4X7SH 5C07A 2OS7A 3RIFF 1N0LA 3K8KA 3TNNA 3KPSE 3O6KL 1IC7L 3WL9B 4BFIB 3QUMH 4U0RC 2CRMA 4E9LA 3R0NA 2IANB 5JW4Q 1RZ8A 3WFHB 1RQ5A 4WHTA 1LVEA 3ZTJG 1KLUB 1A7QH 1B2WH 3RVXD 3TV3L 4HSQA 5GIRA 3FQTA 3O41B 4BK5A 5TDPB 4MCYB 4G9DA 2HJKB 4PRIB 4MDIA 3VDCA 2HG5A 4HZAA 1UWXH 3MPCA 2WUBL 3PP3K 5BVPH 2FD6L 1GGTA 3RVWC 1I9RH 4POYA 4NRZA 3Q3GA 4TRPL 4HK0A 4MJIA 3G5VA 5FGCE 1T5XA 1FE8L 5T1MA 3KGRA 1KEMH