1ZM0A

Crystal structure of the carboxyl terminal ph domain of pleckstrin to 2.1 angstroms
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
96
Chain Sequence
GVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the carboxy-terminal PH domain of pleckstrin at 2.1 Angstroms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Pleckstrin
total genus 19
structure length 96
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zm0A00
1PLSA 4GMXB 2YT1A 1XX0A 1V88A 2EC1A 2D11A 3KRWA 5KCVA 2COCA 1MPHA 4EMOA 5JHHA 5D3VA 1U2BA 3SUZA 1FOEA 3SNHA 2J0KA 5C5BB 1WGUA 1MKEA 2AEHA 2YT0A 1OY2A 2DX5A 3DXDA 1GC7A 1X1FA 1LW3A 2QKLA 5J3TA 3D8DA 4XWXA 3D8EA 5CLQB 2DLWA 2DFKA 3O96A 2KCJA 3SYXA 1UPRA 1NTVA 2M14A 3HK0A 1WVHA 4ZRKA 3ZDTA 2HE7A 1ZVRA 2D9YA 5KQ4A 1AQCA 2J0MA 4YONA 3TW1A 4DX8A 1M7EA 2YS3A 1ISNA 1ZC3B 1U29A 1ZM0A 1WJ1A 3A8QA 4HB2B 4HAWB 3KZ1A 3ULCA 1DDWA 1V89A 3X23A 1OQNA 3IVFA 4A5KA 4DXAB 1X1GA 3ODXA 2Q13A 1KZGA 2KGXB 5CLLB 3KRXA 1PFJA 1H4RA 4H8SA 4TKNA 2YSZA 2I1KA 2DX1A 1UPQA 4K17A 4D0NB 2HTHB 3A8PA 4NY0A 1FHWA 2GJYA 3PP2A 4WJ7A 2I5CA 3MDBC 3AU5A 3T06A 1P6SA 1WI1A 3N7CA 2GCJA 2J0JA 1I2HA 1MIZB 3VIAA 4A6FA 3P7ZA 1MIXA 1H10A 2DKPA 2D9VA 2CRFA 4Z2NA 2RVBB 2COFA 1Y19B 4HDQA 3TCAA 3F0WA 2E2XA 3PG7A 1XODA 3SV1A 1XD4A 3ODWA 2Z0QA 3QWMA 1UNPA 2DKQA 5DIFB 1P5TA 2KUPA 2V76A 3RCPA 2K2JA 4KVGB 4Y94A 1XCGA 1EF1A 2NZ8B 3LJUX 2DN6A 2RNRB 2MFQA 4K81A 2EMTA 4EJNA 3BINA 2Z0OA 1FHXA 1UNQA 1J0WA 4HAUB 3PVWA 3AJ4A 4B6HA 4CYEA 2D9XA 2COAA 2GS0A 1K5GB 2D9ZA 3F5RA 3VOQA 1BWNA 1QQGA 4IAPA 2P0DA 4MT7A 4YL8A 2D4QA 1U5GA 4IFSA 3WA0A 2N23A 5HE0A 1OMWA 1XKEA 1M7RA 4HAVB 5C6RA 1KI1B 2ZPYA 1DROA 1EVHA 1UNRA 5DHAB 4F7HA 1FAOA 1SGHA 5DHFB 2IYBA 5D3XA 4GPTB 1V5MA 5J3QA 2AL6A 2H7EA 1FHOA 2M38A 1Z87A 2R0DA 1FGYA 3ODOA 1FB8A 2I5FA 1LB1A 4A6KA 3TVVA 1BAKA 2VSZA 2W2XC 2FJLA 1BTNA 4L6EA 2P8VA 4EKUA 5D27A 4KHAA 1X11A 5HE1A 2Z0PA 3TFMA 4ZRIA 2LOZA 2YS5A 2G35A 1TJ6A 2Y8FA 1AWEA 4TYZA 2L2IA 3U8ZA 2Y7BA 2ELBA 4GXBA 2LG1A 1U5DA 5LOPB 2D9WA 2DHIA 2CY5A 4KHBB 4WSFA 5J3YA 4F7UP 2W2WA 2R09A 3GYPA 3DXCA 3PSCA 1ZSQA 4HB0B 3QBVB 1EGXA 2DHKA 2YS1A 3NSUA 1U5FA 1V61A 2VRWB 1NTYA 4GZUA 4HATB 2MKRA 2L1CA 4IOYX 1DBHA 2DTCA 3CXBB 4DX90 3PVUA 4PQ0A 4KHOA 1GG3A 2YVCA 2JP2A 2LOXA 3ZVRA 2I1JA 2D2QA 2NMBA 2MWNB 1V5PA 4HB3B 3G9WA 1WG7A 3DXEA 3WYFB 5JHGA 1BTKA 4MY6A 2RUKB 3V5WA 5C79A 2N0YA 2YRYA 1Y5OA 3KY9A 5D3YA 2P0FA 5C5BA 4PNKA 1V5UA 4K2OA 4P7IA 3FSSA 2ADZA 2VKIA 3D8FA 2DYQA 1TXDA 2XQNM 2ROVA 1WGQA 4KAXB 3QIJA 1GC6A 1N3HA 2DA0A 3PEGA 2UZSA 2X18A 3KSYA 1J19A 1B55A 5FI1A 5HE3A 1NU2A 4F7GA 5FI0A 3M1IB 1EAZA 1X05A 2J59M 1Q67A 3P6AA 4HB4B 4WVFB 1U5EA 5KQ1A 1IRSA 4HHVA 1MAIA 4DBBA 3PVLA 4Z2MB 1RJ2A 1K5DB 1PMSA 3HW2B 4GN1A 2DYNA 2K00A 2K2UA 1TQZA 2ELAA 4A6HA 4GMVA 2W2XD 3FM8C 3FEHA 2BCJA 1MK7B 2P0HA 4HAZB 5DH9B 4HAXB 2RLOA 2H7DA 3TO1A 1X86A 5LONB 3AU4A 5GOWB 4CHJA 2UVMA 1W1HA 3GYOA 3HQCA 2MDXA 4ZRJA 4BBKA 2CAYA 1RRPB 5C16A 2Y8GA 1ZC4B 1KZ7A 4CHMA 1QC6A 1U27A 2LYDA 2CY4A 1DYNA 3SO6A 3BJIA 2GCLA 5JP4A 1SHCA 1NI2A 5DI9B 2DHJA 2OQBA 1I7AA 3UZTA 3U7DA 2UZRA 4A6FB 2YF0A 5HE2A 2PZ1A 3A98B 1FGZA 5EFXA 2RSGA 3OANA 5L81A 2CODA 1P3RA 2QKMA 3CIKA 1E5WA 1XR0B 2D10A 2OTXA 2LULA 5JLJB 1DDVA 2EMSA 4NSWA 1WJMA 2IFSA 2LKOA 4HAYB 4C0AA 4K2PA 1DDMA 3MPXA 1W1DA 3ML4A 2RGNB 3PZDA 3ULBA 5D3WA 2EJ8A 1W1GA 1UEFA 4HDOA 2ROZB 1MK9B 4MK0A
chains in the Genus database with same CATH superfamily
1PLSA 4GMXB 2YT1A 2KIEA 1XX0A 1V88A 2EC1A 2D11A 3KRWA 5KCVA 2COCA 1MI1A 1MPHA 4EMOA 5JHHA 5D3VA 1U2BA 3SUZA 1FOEA 3SNHA 2J0KA 5C5BB 1WGUA 4L1RA 1MKEA 2AEHA 2YT0A 1OY2A 2DX5A 3DXDA 1GC7A 1X1FA 1LW3A 2QKLA 3B77A 3D8DA 5J3TA 4XWXA 3D8EA 5CLQB 2DLWA 2DFKA 3O96A 2KCJA 3SYXA 1UPRA 1NTVA 2M14A 3HK0A 1WVHA 4ZRKA 3ZDTA 2HE7A 1ZVRA 2D9YA 5KQ4A 1AQCA 2J0MA 4YONA 3TW1A 4DX8A 1M7EA 2YS3A 1ISNA 1ZC3B 5LG4B 1U29A 1ZM0A 1WJ1A 3A8QA 4HB2B 4HAWB 3KZ1A 3ULCA 1DDWA 1V89A 4OT1A 3X23A 1OQNA 3IVFA 4A5KA 4DXAB 1X1GA 3ODXA 2Q13A 1KZGA 2KGXB 5CLLB 3KRXA 1PFJA 1H4RA 4H8SA 4TKNA 2YSZA 2I1KA 2DX1A 3A58A 1UPQA 3DCXA 4K17A 4D0NB 2HTHB 3A8PA 4NY0A 1FHWA 2GJYA 3PP2A 4WJ7A 2I5CA 3MDBC 3AU5A 3T06A 1P6SA 1WI1A 3N7CA 2GCJA 2J0JA 1I2HA 1MIZB 3VIAA 4A6FA 3P7ZA 1MIXA 1H10A 2DKPA 2D9VA 5M4YB 2CRFA 4Z2NA 2RVBB 2COFA 1Y19B 4HDQA 3TCAA 3F0WA 2E2XA 3PG7A 1XODA 3SV1A 1XD4A 3ODWA 2Z0QA 3QWMA 1UNPA 2DKQA 5DIFB 1P5TA 2KUPA 1T77A 2ZKMX 2V76A 3RCPA 2K2JA 4KVGB 4Y94A 1XCGA 1EF1A 2NZ8B 3LJUX 2DN6A 2RNRB 2MFQA 4K81A 2EMTA 4EJNA 3BINA 2Z0OA 1FHXA 2GUMA 1UNQA 1J0WA 4HAUB 3PVWA 2KUQA 2YT2A 3AJ4A 4B6HA 4CYEA 2D9XA 4KHBA 2Z59A 2COAA 2GS0A 1K5GB 2D9ZA 3F5RA 3VOQA 1BWNA 1QQGA 4IAPA 2P0DA 4MT7A 4YL8A 2D4QA 1U5GA 4IFSA 3WA0A 2N23A 4OSNA 5HE0A 1OMWA 1XKEA 1M7RA 4HAVB 4QXAB 5C6RA 1KI1B 2ZPYA 4DIXA 1DROA 1EVHA 1UNRA 5DHAB 4F7HA 1FAOA 1SGHA 3NWFA 5DHFB 2IYBA 5D3XA 5I2MA 4GPTB 2K49A 1V5MA 5J3QA 2AL6A 2H7EA 1FHOA 2M38A 1Z87A 2R0DA 1FGYA 3ODOA 1FB8A 2I5FA 1LB1A 4A6KA 3TVVA 1BAKA 2VSZA 2W2XC 2FJLA 1BTNA 4L6EA 2P8VA 4QJ3B 4EKUA 2K8EA 5D27A 4KHAA 1X11A 5HE1A 3HSAA 2Z0PA 3TFMA 4ZRIA 2LOZA 2YS5A 2G35A 5I2SA 1TJ6A 2Y8FA 1AWEA 4TYZA 2L2IA 3U8ZA 2Y7BA 2Z13A 2ELBA 4GXBA 2LG1A 1U5DA 5LOPB 2D9WA 2DHIA 2CY5A 4KHBB 4WSFA 5J3YA 4F7UP 2W2WA 2R09A 3GYPA 3DXCA 3PSCA 1ZSQA 4QJ4B 4HB0B 5IRSA 3QBVB 1EGXA 2DHKA 3NWDA 3NSUA 2YS1A 1U5FA 1V61A 2VRWB 1NTYA 4GZUA 4HATB 3CXBB 2L1CA 1DBHA 2DTCA 2MKRA 4IOYX 4DX90 3PVUA 4PQ0A 4KHOA 1GG3A 2YVCA 2JP2A 2LOXA 2KR0A 3ZVRA 2I1JA 2D2QA 2R2YA 4HSIA 2NMBA 2MWNB 1V5PA 4HB3B 3G9WA 1WG7A 3DXEA 3WYFB 5JHGA 1BTKA 3NWAA 4MY6A 2RUKB 3V5WA 5C79A 2N0YA 2YRYA 1Y5OA 3KY9A 5D3YA 2P0FA 5C5BA 4PNKA 1V5UA 4K2OA 4P7IA 3FSSA 2ADZA 2VKIA 3D8FA 3HIEA 2DYQA 1TXDA 2XQNM 2ROVA 4D6WA 1WGQA 4KAXB 3QIJA 1GC6A 1N3HA 2DA0A 3PEGA 2UZSA 2X18A 3KSYA 1J19A 1B55A 5FI1A 5HE3A 1NU2A 4F7GA 5FI0A 3M1IB 1EAZA 1X05A 2J59M 1Q67A 3P6AA 4HB4B 4WVFB 1U5EA 4CSQA 4GOUA 5KQ1A 1IRSA 4HHVA 1MAIA 4DBBA 3PVLA 4Z2MB 1RJ2A 4GNKB 1K5DB 1PMSA 3HW2B 4GN1A 2DYNA 2K00A 2K2UA 1TQZA 2ELAA 4A6HA 4GMVA 2W2XD 3FM8C 3FEHA 2BCJA 1MK7B 2P0HA 4HAZB 5DH9B 4HAXB 2RLOA 2H7DA 2NBVA 3TO1A 1X86A 5LONB 3AU4A 2Z4DA 5GOWB 4CHJA 2UVMA 1W1HA 3GYOA 3HQCA 2MDXA 4ZRJA 4BBKA 2CAYA 1RRPB 5C16A 2Y8GA 1ZC4B 1KZ7A 4CHMA 1QC6A 3OHMB 1U27A 2LYDA 2CY4A 1DYNA 3NW8A 3SO6A 4QJ5B 3BJIA 2GCLA 2Z14A 5JP4A 1SHCA 1NI2A 5DI9B 2DHJA 2OQBA 1I7AA 3UZTA 3U7DA 2UZRA 4A6FB 2YF0A 5HE2A 2PZ1A 3FVCA 3A98B 1FGZA 5EFXA 2RSGA 3OANA 5L81A 2CODA 1P3RA 2KIGA 2QKMA 3CIKA 1E5WA 1XR0B 2D10A 2OTXA 2LULA 5JLJB 1DDVA 2EMSA 4NSWA 1WJMA 2IFSA 2LKOA 4HAYB 4C0AA 4K2PA 1DDMA 3MPXA 1W1DA 1ZYIA 3ML4A 2RGNB 3PZDA 3ULBA 5D3WA 2EJ8A 1W1GA 1UEFA 4HDOA 3U12A 2FJUB 1MK9B 2ROZB 2RRFA 4MK0A
chains in the Genus database with same CATH topology
1PLSA 4GMXB 2YT1A 1XX0A 1V88A 2EC1A 2D11A 3KRWA 5KCVA 2COCA 1MPHA 4EMOA 5JHHA 5D3VA 1U2BA 3SUZA 1FOEA 3SNHA 2J0KA 5C5BB 1WGUA 1MKEA 2AEHA 2YT0A 1OY2A 2DX5A 3DXDA 1GC7A 1X1FA 1LW3A 2QKLA 5J3TA 3D8DA 4XWXA 3D8EA 5CLQB 2DLWA 2DFKA 3O96A 2KCJA 3SYXA 1UPRA 1NTVA 2M14A 3HK0A 1WVHA 4ZRKA 3ZDTA 2HE7A 1ZVRA 2D9YA 5KQ4A 1AQCA 2J0MA 4YONA 3TW1A 4DX8A 1M7EA 2YS3A 1ISNA 1ZC3B 1U29A 1ZM0A 1WJ1A 3A8QA 4HB2B 4HAWB 3KZ1A 3ULCA 1DDWA 1V89A 3X23A 1OQNA 3IVFA 4A5KA 4DXAB 1X1GA 3ODXA 2Q13A 1KZGA 2KGXB 5CLLB 3KRXA 1PFJA 1H4RA 4H8SA 4TKNA 2YSZA 2I1KA 2DX1A 1UPQA 4K17A 4D0NB 2HTHB 3A8PA 4NY0A 1FHWA 2GJYA 3PP2A 4WJ7A 2I5CA 3MDBC 3AU5A 3T06A 1P6SA 1WI1A 3N7CA 2GCJA 2J0JA 1I2HA 1MIZB 3VIAA 4A6FA 3P7ZA 1MIXA 1H10A 2DKPA 2D9VA 2CRFA 4Z2NA 2RVBB 2COFA 1Y19B 4HDQA 3TCAA 3F0WA 2E2XA 3PG7A 1XODA 3SV1A 1XD4A 3ODWA 2Z0QA 3QWMA 1UNPA 2DKQA 5DIFB 1P5TA 2KUPA 2V76A 3RCPA 2K2JA 4KVGB 4Y94A 1XCGA 1EF1A 2NZ8B 3LJUX 2DN6A 2RNRB 2MFQA 4K81A 2EMTA 4EJNA 3BINA 2Z0OA 1FHXA 1UNQA 1J0WA 4HAUB 3PVWA 3AJ4A 4B6HA 4CYEA 2D9XA 2COAA 2GS0A 1K5GB 2D9ZA 3F5RA 3VOQA 1BWNA 1QQGA 4IAPA 2P0DA 4MT7A 4YL8A 2D4QA 1U5GA 4IFSA 3WA0A 2N23A 5HE0A 1OMWA 1XKEA 1M7RA 4HAVB 5C6RA 1KI1B 2ZPYA 1DROA 1EVHA 1UNRA 5DHAB 4F7HA 1FAOA 1SGHA 5DHFB 2IYBA 5D3XA 4GPTB 1V5MA 5J3QA 2AL6A 2H7EA 1FHOA 2M38A 1Z87A 2R0DA 1FGYA 3ODOA 1FB8A 2I5FA 1LB1A 4A6KA 3TVVA 1BAKA 2VSZA 2W2XC 2FJLA 1BTNA 4L6EA 2P8VA 4EKUA 5D27A 4KHAA 1X11A 5HE1A 2Z0PA 3TFMA 4ZRIA 2LOZA 2YS5A 2G35A 1TJ6A 2Y8FA 1AWEA 4TYZA 2L2IA 3U8ZA 2Y7BA 2ELBA 4GXBA 2LG1A 1U5DA 5LOPB 2D9WA 2DHIA 2CY5A 4KHBB 4WSFA 5J3YA 4F7UP 2W2WA 2R09A 3GYPA 3DXCA 3PSCA 1ZSQA 4HB0B 3QBVB 1EGXA 2DHKA 2YS1A 3NSUA 1U5FA 1V61A 2VRWB 1NTYA 4GZUA 4HATB 2MKRA 2L1CA 4IOYX 1DBHA 2DTCA 3CXBB 4DX90 3PVUA 4PQ0A 4KHOA 1GG3A 2YVCA 2JP2A 2LOXA 3ZVRA 2I1JA 2D2QA 2NMBA 2MWNB 1V5PA 4HB3B 3G9WA 1WG7A 3DXEA 3WYFB 5JHGA 1BTKA 4MY6A 2RUKB 3V5WA 5C79A 2N0YA 2YRYA 1Y5OA 3KY9A 5D3YA 2P0FA 5C5BA 4PNKA 1V5UA 4K2OA 4P7IA 3FSSA 2ADZA 2VKIA 3D8FA 2DYQA 1TXDA 2XQNM 2ROVA 1WGQA 4KAXB 3QIJA 1GC6A 1N3HA 2DA0A 3PEGA 2UZSA 2X18A 3KSYA 1J19A 1B55A 5FI1A 5HE3A 1NU2A 4F7GA 5FI0A 3M1IB 1EAZA 1X05A 2J59M 1Q67A 3P6AA 4HB4B 4WVFB 1U5EA 5KQ1A 1IRSA 4HHVA 1MAIA 4DBBA 3PVLA 4Z2MB 1RJ2A 1K5DB 1PMSA 3HW2B 4GN1A 2DYNA 2K00A 2K2UA 1TQZA 2ELAA 4A6HA 4GMVA 2W2XD 3FM8C 3FEHA 2BCJA 1MK7B 2P0HA 4HAZB 5DH9B 4HAXB 2RLOA 2H7DA 3TO1A 1X86A 5LONB 3AU4A 5GOWB 4CHJA 2UVMA 1W1HA 3GYOA 3HQCA 2MDXA 4ZRJA 4BBKA 2CAYA 1RRPB 5C16A 2Y8GA 1ZC4B 1KZ7A 4CHMA 1QC6A 1U27A 2LYDA 2CY4A 1DYNA 3SO6A 3BJIA 2GCLA 5JP4A 1SHCA 1NI2A 5DI9B 2DHJA 2OQBA 1I7AA 3UZTA 3U7DA 2UZRA 4A6FB 2YF0A 5HE2A 2PZ1A 3A98B 1FGZA 5EFXA 2RSGA 3OANA 5L81A 2CODA 1P3RA 2QKMA 3CIKA 1E5WA 1XR0B 2D10A 2OTXA 2LULA 5JLJB 1DDVA 2EMSA 4NSWA 1WJMA 2IFSA 2LKOA 4HAYB 4C0AA 4K2PA 1DDMA 3MPXA 1W1DA 3ML4A 2RGNB 3PZDA 3ULBA 5D3WA 2EJ8A 1W1GA 1UEFA 4HDOA 2ROZB 1MK9B 4MK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLS A;  4GMX B;  2YT1 A;  1XX0 A;  1V88 A;  2EC1 A;  2D11 A;  3KRW A;  5KCV A;  2COC A;  1MPH A;  4EMO A;  5JHH A;  5D3V A;  1U2B A;  3SUZ A;  1FOE A;  3SNH A;  2J0K A;  5C5B B;  1WGU A;  1MKE A;  2AEH A;  2YT0 A;  1OY2 A;  2DX5 A;  3DXD A;  1GC7 A;  1X1F A;  1LW3 A;  2QKL A;  5J3T A;  3D8D A;  4XWX A;  3D8E A;  5CLQ B;  2DLW A;  2DFK A;  3O96 A;  2KCJ A;  3SYX A;  1UPR A;  1NTV A;  2M14 A;  3HK0 A;  1WVH A;  4ZRK A;  3ZDT A;  2HE7 A;  1ZVR A;  2D9Y A;  5KQ4 A;  1AQC A;  2J0M A;  4YON A;  3TW1 A;  4DX8 A;  1M7E A;  2YS3 A;  1ISN A;  1ZC3 B;  1U29 A;  1ZM0 A;  1WJ1 A;  3A8Q A;  4HB2 B;  4HAW B;  3KZ1 A;  3ULC A;  1DDW A;  1V89 A;  3X23 A;  1OQN A;  3IVF A;  4A5K A;  4DXA B;  1X1G A;  3ODX A;  2Q13 A;  1KZG A;  2KGX B;  5CLL B;  3KRX A;  1PFJ A;  1H4R A;  4H8S A;  4TKN A;  2YSZ A;  2I1K A;  2DX1 A;  1UPQ A;  4K17 A;  4D0N B;  2HTH B;  3A8P A;  4NY0 A;  1FHW A;  2GJY A;  3PP2 A;  4WJ7 A;  2I5C A;  3MDB C;  3AU5 A;  3T06 A;  1P6S A;  1WI1 A;  3N7C A;  2GCJ A;  2J0J A;  1I2H A;  1MIZ B;  3VIA A;  4A6F A;  3P7Z A;  1MIX A;  1H10 A;  2DKP A;  2D9V A;  2CRF A;  4Z2N A;  2RVB B;  2COF A;  1Y19 B;  4HDQ A;  3TCA A;  3F0W A;  2E2X A;  3PG7 A;  1XOD A;  3SV1 A;  1XD4 A;  3ODW A;  2Z0Q A;  3QWM A;  1UNP A;  2DKQ A;  5DIF B;  1P5T A;  2KUP A;  2V76 A;  3RCP A;  2K2J A;  4KVG B;  4Y94 A;  1XCG A;  1EF1 A;  2NZ8 B;  3LJU X;  2DN6 A;  2RNR B;  2MFQ A;  4K81 A;  2EMT A;  4EJN A;  3BIN A;  2Z0O A;  1FHX A;  1UNQ A;  1J0W A;  4HAU B;  3PVW A;  3AJ4 A;  4B6H A;  4CYE A;  2D9X A;  2COA A;  2GS0 A;  1K5G B;  2D9Z A;  3F5R A;  3VOQ A;  1BWN A;  1QQG A;  4IAP A;  2P0D A;  4MT7 A;  4YL8 A;  2D4Q A;  1U5G A;  4IFS A;  3WA0 A;  2N23 A;  5HE0 A;  1OMW A;  1XKE A;  1M7R A;  4HAV B;  5C6R A;  1KI1 B;  2ZPY A;  1DRO A;  1EVH A;  1UNR A;  5DHA B;  4F7H A;  1FAO A;  1SGH A;  5DHF B;  2IYB A;  5D3X A;  4GPT B;  1V5M A;  5J3Q A;  2AL6 A;  2H7E A;  1FHO A;  2M38 A;  1Z87 A;  2R0D A;  1FGY A;  3ODO A;  1FB8 A;  2I5F A;  1LB1 A;  4A6K A;  3TVV A;  1BAK A;  2VSZ A;  2W2X C;  2FJL A;  1BTN A;  4L6E A;  2P8V A;  4EKU A;  5D27 A;  4KHA A;  1X11 A;  5HE1 A;  2Z0P A;  3TFM A;  4ZRI A;  2LOZ A;  2YS5 A;  2G35 A;  1TJ6 A;  2Y8F A;  1AWE A;  4TYZ A;  2L2I A;  3U8Z A;  2Y7B A;  2ELB A;  4GXB A;  2LG1 A;  1U5D A;  5LOP B;  2D9W A;  2DHI A;  2CY5 A;  4KHB B;  4WSF A;  5J3Y A;  4F7U P;  2W2W A;  2R09 A;  3GYP A;  3DXC A;  3PSC A;  1ZSQ A;  4HB0 B;  3QBV B;  1EGX A;  2DHK A;  2YS1 A;  3NSU A;  1U5F A;  1V61 A;  2VRW B;  1NTY A;  4GZU A;  4HAT B;  2MKR A;  2L1C A;  4IOY X;  1DBH A;  2DTC A;  3CXB B;  4DX9 0;  3PVU A;  4PQ0 A;  4KHO A;  1GG3 A;  2YVC A;  2JP2 A;  2LOX A;  3ZVR A;  2I1J A;  2D2Q A;  2NMB A;  2MWN B;  1V5P A;  4HB3 B;  3G9W A;  1WG7 A;  3DXE A;  3WYF B;  5JHG A;  1BTK A;  4MY6 A;  2RUK B;  3V5W A;  5C79 A;  2N0Y A;  2YRY A;  1Y5O A;  3KY9 A;  5D3Y A;  2P0F A;  5C5B A;  4PNK A;  1V5U A;  4K2O A;  4P7I A;  3FSS A;  2ADZ A;  2VKI A;  3D8F A;  2DYQ A;  1TXD A;  2XQN M;  2ROV A;  1WGQ A;  4KAX B;  3QIJ A;  1GC6 A;  1N3H A;  2DA0 A;  3PEG A;  2UZS A;  2X18 A;  3KSY A;  1J19 A;  1B55 A;  5FI1 A;  5HE3 A;  1NU2 A;  4F7G A;  5FI0 A;  3M1I B;  1EAZ A;  1X05 A;  2J59 M;  1Q67 A;  3P6A A;  4HB4 B;  4WVF B;  1U5E A;  5KQ1 A;  1IRS A;  4HHV A;  1MAI A;  4DBB A;  3PVL A;  4Z2M B;  1RJ2 A;  1K5D B;  1PMS A;  3HW2 B;  4GN1 A;  2DYN A;  2K00 A;  2K2U A;  1TQZ A;  2ELA A;  4A6H A;  4GMV A;  2W2X D;  3FM8 C;  3FEH A;  2BCJ A;  1MK7 B;  2P0H A;  4HAZ B;  5DH9 B;  4HAX B;  2RLO A;  2H7D A;  3TO1 A;  1X86 A;  5LON B;  3AU4 A;  5GOW B;  4CHJ A;  2UVM A;  1W1H A;  3GYO A;  3HQC A;  2MDX A;  4ZRJ A;  4BBK A;  2CAY A;  1RRP B;  5C16 A;  2Y8G A;  1ZC4 B;  1KZ7 A;  4CHM A;  1QC6 A;  1U27 A;  2LYD A;  2CY4 A;  1DYN A;  3SO6 A;  3BJI A;  2GCL A;  5JP4 A;  1SHC A;  1NI2 A;  5DI9 B;  2DHJ A;  2OQB A;  1I7A A;  3UZT A;  3U7D A;  2UZR A;  4A6F B;  2YF0 A;  5HE2 A;  2PZ1 A;  3A98 B;  1FGZ A;  5EFX A;  2RSG A;  3OAN A;  5L81 A;  2COD A;  1P3R A;  2QKM A;  3CIK A;  1E5W A;  1XR0 B;  2D10 A;  2OTX A;  2LUL A;  5JLJ B;  1DDV A;  2EMS A;  4NSW A;  1WJM A;  2IFS A;  2LKO A;  4HAY B;  4C0A A;  4K2P A;  1DDM A;  3MPX A;  1W1D A;  3ML4 A;  2RGN B;  3PZD A;  3ULB A;  5D3W A;  2EJ8 A;  1W1G A;  1UEF A;  4HDO A;  2ROZ B;  1MK9 B;  4MK0 A; 
#chains in the Genus database with same CATH topology
 1PLS A;  4GMX B;  2YT1 A;  2KIE A;  1XX0 A;  1V88 A;  2EC1 A;  2D11 A;  3KRW A;  5KCV A;  2COC A;  1MI1 A;  1MPH A;  4EMO A;  5JHH A;  5D3V A;  1U2B A;  3SUZ A;  1FOE A;  3SNH A;  2J0K A;  5C5B B;  1WGU A;  4L1R A;  1MKE A;  2AEH A;  2YT0 A;  1OY2 A;  2DX5 A;  3DXD A;  1GC7 A;  1X1F A;  1LW3 A;  2QKL A;  3B77 A;  3D8D A;  5J3T A;  4XWX A;  3D8E A;  5CLQ B;  2DLW A;  2DFK A;  3O96 A;  2KCJ A;  3SYX A;  1UPR A;  1NTV A;  2M14 A;  3HK0 A;  1WVH A;  4ZRK A;  3ZDT A;  2HE7 A;  1ZVR A;  2D9Y A;  5KQ4 A;  1AQC A;  2J0M A;  4YON A;  3TW1 A;  4DX8 A;  1M7E A;  2YS3 A;  1ISN A;  1ZC3 B;  5LG4 B;  1U29 A;  1ZM0 A;  1WJ1 A;  3A8Q A;  4HB2 B;  4HAW B;  3KZ1 A;  3ULC A;  1DDW A;  1V89 A;  4OT1 A;  3X23 A;  1OQN A;  3IVF A;  4A5K A;  4DXA B;  1X1G A;  3ODX A;  2Q13 A;  1KZG A;  2KGX B;  5CLL B;  3KRX A;  1PFJ A;  1H4R A;  4H8S A;  4TKN A;  2YSZ A;  2I1K A;  2DX1 A;  3A58 A;  1UPQ A;  3DCX A;  4K17 A;  4D0N B;  2HTH B;  3A8P A;  4NY0 A;  1FHW A;  2GJY A;  3PP2 A;  4WJ7 A;  2I5C A;  3MDB C;  3AU5 A;  3T06 A;  1P6S A;  1WI1 A;  3N7C A;  2GCJ A;  2J0J A;  1I2H A;  1MIZ B;  3VIA A;  4A6F A;  3P7Z A;  1MIX A;  1H10 A;  2DKP A;  2D9V A;  5M4Y B;  2CRF A;  4Z2N A;  2RVB B;  2COF A;  1Y19 B;  4HDQ A;  3TCA A;  3F0W A;  2E2X A;  3PG7 A;  1XOD A;  3SV1 A;  1XD4 A;  3ODW A;  2Z0Q A;  3QWM A;  1UNP A;  2DKQ A;  5DIF B;  1P5T A;  2KUP A;  1T77 A;  2ZKM X;  2V76 A;  3RCP A;  2K2J A;  4KVG B;  4Y94 A;  1XCG A;  1EF1 A;  2NZ8 B;  3LJU X;  2DN6 A;  2RNR B;  2MFQ A;  4K81 A;  2EMT A;  4EJN A;  3BIN A;  2Z0O A;  1FHX A;  2GUM A;  1UNQ A;  1J0W A;  4HAU B;  3PVW A;  2KUQ A;  2YT2 A;  3AJ4 A;  4B6H A;  4CYE A;  2D9X A;  4KHB A;  2Z59 A;  2COA A;  2GS0 A;  1K5G B;  2D9Z A;  3F5R A;  3VOQ A;  1BWN A;  1QQG A;  4IAP A;  2P0D A;  4MT7 A;  4YL8 A;  2D4Q A;  1U5G A;  4IFS A;  3WA0 A;  2N23 A;  4OSN A;  5HE0 A;  1OMW A;  1XKE A;  1M7R A;  4HAV B;  4QXA B;  5C6R A;  1KI1 B;  2ZPY A;  4DIX A;  1DRO A;  1EVH A;  1UNR A;  5DHA B;  4F7H A;  1FAO A;  1SGH A;  3NWF A;  5DHF B;  2IYB A;  5D3X A;  5I2M A;  4GPT B;  2K49 A;  1V5M A;  5J3Q A;  2AL6 A;  2H7E A;  1FHO A;  2M38 A;  1Z87 A;  2R0D A;  1FGY A;  3ODO A;  1FB8 A;  2I5F A;  1LB1 A;  4A6K A;  3TVV A;  1BAK A;  2VSZ A;  2W2X C;  2FJL A;  1BTN A;  4L6E A;  2P8V A;  4QJ3 B;  4EKU A;  2K8E A;  5D27 A;  4KHA A;  1X11 A;  5HE1 A;  3HSA A;  2Z0P A;  3TFM A;  4ZRI A;  2LOZ A;  2YS5 A;  2G35 A;  5I2S A;  1TJ6 A;  2Y8F A;  1AWE A;  4TYZ A;  2L2I A;  3U8Z A;  2Y7B A;  2Z13 A;  2ELB A;  4GXB A;  2LG1 A;  1U5D A;  5LOP B;  2D9W A;  2DHI A;  2CY5 A;  4KHB B;  4WSF A;  5J3Y A;  4F7U P;  2W2W A;  2R09 A;  3GYP A;  3DXC A;  3PSC A;  1ZSQ A;  4QJ4 B;  4HB0 B;  5IRS A;  3QBV B;  1EGX A;  2DHK A;  3NWD A;  3NSU A;  2YS1 A;  1U5F A;  1V61 A;  2VRW B;  1NTY A;  4GZU A;  4HAT B;  3CXB B;  2L1C A;  1DBH A;  2DTC A;  2MKR A;  4IOY X;  4DX9 0;  3PVU A;  4PQ0 A;  4KHO A;  1GG3 A;  2YVC A;  2JP2 A;  2LOX A;  2KR0 A;  3ZVR A;  2I1J A;  2D2Q A;  2R2Y A;  4HSI A;  2NMB A;  2MWN B;  1V5P A;  4HB3 B;  3G9W A;  1WG7 A;  3DXE A;  3WYF B;  5JHG A;  1BTK A;  3NWA A;  4MY6 A;  2RUK B;  3V5W A;  5C79 A;  2N0Y A;  2YRY A;  1Y5O A;  3KY9 A;  5D3Y A;  2P0F A;  5C5B A;  4PNK A;  1V5U A;  4K2O A;  4P7I A;  3FSS A;  2ADZ A;  2VKI A;  3D8F A;  3HIE A;  2DYQ A;  1TXD A;  2XQN M;  2ROV A;  4D6W A;  1WGQ A;  4KAX B;  3QIJ A;  1GC6 A;  1N3H A;  2DA0 A;  3PEG A;  2UZS A;  2X18 A;  3KSY A;  1J19 A;  1B55 A;  5FI1 A;  5HE3 A;  1NU2 A;  4F7G A;  5FI0 A;  3M1I B;  1EAZ A;  1X05 A;  2J59 M;  1Q67 A;  3P6A A;  4HB4 B;  4WVF B;  1U5E A;  4CSQ A;  4GOU A;  5KQ1 A;  1IRS A;  4HHV A;  1MAI A;  4DBB A;  3PVL A;  4Z2M B;  1RJ2 A;  4GNK B;  1K5D B;  1PMS A;  3HW2 B;  4GN1 A;  2DYN A;  2K00 A;  2K2U A;  1TQZ A;  2ELA A;  4A6H A;  4GMV A;  2W2X D;  3FM8 C;  3FEH A;  2BCJ A;  1MK7 B;  2P0H A;  4HAZ B;  5DH9 B;  4HAX B;  2RLO A;  2H7D A;  2NBV A;  3TO1 A;  1X86 A;  5LON B;  3AU4 A;  2Z4D A;  5GOW B;  4CHJ A;  2UVM A;  1W1H A;  3GYO A;  3HQC A;  2MDX A;  4ZRJ A;  4BBK A;  2CAY A;  1RRP B;  5C16 A;  2Y8G A;  1ZC4 B;  1KZ7 A;  4CHM A;  1QC6 A;  3OHM B;  1U27 A;  2LYD A;  2CY4 A;  1DYN A;  3NW8 A;  3SO6 A;  4QJ5 B;  3BJI A;  2GCL A;  2Z14 A;  5JP4 A;  1SHC A;  1NI2 A;  5DI9 B;  2DHJ A;  2OQB A;  1I7A A;  3UZT A;  3U7D A;  2UZR A;  4A6F B;  2YF0 A;  5HE2 A;  2PZ1 A;  3FVC A;  3A98 B;  1FGZ A;  5EFX A;  2RSG A;  3OAN A;  5L81 A;  2COD A;  1P3R A;  2KIG A;  2QKM A;  3CIK A;  1E5W A;  1XR0 B;  2D10 A;  2OTX A;  2LUL A;  5JLJ B;  1DDV A;  2EMS A;  4NSW A;  1WJM A;  2IFS A;  2LKO A;  4HAY B;  4C0A A;  4K2P A;  1DDM A;  3MPX A;  1W1D A;  1ZYI A;  3ML4 A;  2RGN B;  3PZD A;  3ULB A;  5D3W A;  2EJ8 A;  1W1G A;  1UEF A;  4HDO A;  3U12 A;  2FJU B;  1MK9 B;  2ROZ B;  2RRF A;  4MK0 A; 
#chains in the Genus database with same CATH homology
 1PLS A;  4GMX B;  2YT1 A;  1XX0 A;  1V88 A;  2EC1 A;  2D11 A;  3KRW A;  5KCV A;  2COC A;  1MPH A;  4EMO A;  5JHH A;  5D3V A;  1U2B A;  3SUZ A;  1FOE A;  3SNH A;  2J0K A;  5C5B B;  1WGU A;  1MKE A;  2AEH A;  2YT0 A;  1OY2 A;  2DX5 A;  3DXD A;  1GC7 A;  1X1F A;  1LW3 A;  2QKL A;  5J3T A;  3D8D A;  4XWX A;  3D8E A;  5CLQ B;  2DLW A;  2DFK A;  3O96 A;  2KCJ A;  3SYX A;  1UPR A;  1NTV A;  2M14 A;  3HK0 A;  1WVH A;  4ZRK A;  3ZDT A;  2HE7 A;  1ZVR A;  2D9Y A;  5KQ4 A;  1AQC A;  2J0M A;  4YON A;  3TW1 A;  4DX8 A;  1M7E A;  2YS3 A;  1ISN A;  1ZC3 B;  1U29 A;  1ZM0 A;  1WJ1 A;  3A8Q A;  4HB2 B;  4HAW B;  3KZ1 A;  3ULC A;  1DDW A;  1V89 A;  3X23 A;  1OQN A;  3IVF A;  4A5K A;  4DXA B;  1X1G A;  3ODX A;  2Q13 A;  1KZG A;  2KGX B;  5CLL B;  3KRX A;  1PFJ A;  1H4R A;  4H8S A;  4TKN A;  2YSZ A;  2I1K A;  2DX1 A;  1UPQ A;  4K17 A;  4D0N B;  2HTH B;  3A8P A;  4NY0 A;  1FHW A;  2GJY A;  3PP2 A;  4WJ7 A;  2I5C A;  3MDB C;  3AU5 A;  3T06 A;  1P6S A;  1WI1 A;  3N7C A;  2GCJ A;  2J0J A;  1I2H A;  1MIZ B;  3VIA A;  4A6F A;  3P7Z A;  1MIX A;  1H10 A;  2DKP A;  2D9V A;  2CRF A;  4Z2N A;  2RVB B;  2COF A;  1Y19 B;  4HDQ A;  3TCA A;  3F0W A;  2E2X A;  3PG7 A;  1XOD A;  3SV1 A;  1XD4 A;  3ODW A;  2Z0Q A;  3QWM A;  1UNP A;  2DKQ A;  5DIF B;  1P5T A;  2KUP A;  2V76 A;  3RCP A;  2K2J A;  4KVG B;  4Y94 A;  1XCG A;  1EF1 A;  2NZ8 B;  3LJU X;  2DN6 A;  2RNR B;  2MFQ A;  4K81 A;  2EMT A;  4EJN A;  3BIN A;  2Z0O A;  1FHX A;  1UNQ A;  1J0W A;  4HAU B;  3PVW A;  3AJ4 A;  4B6H A;  4CYE A;  2D9X A;  2COA A;  2GS0 A;  1K5G B;  2D9Z A;  3F5R A;  3VOQ A;  1BWN A;  1QQG A;  4IAP A;  2P0D A;  4MT7 A;  4YL8 A;  2D4Q A;  1U5G A;  4IFS A;  3WA0 A;  2N23 A;  5HE0 A;  1OMW A;  1XKE A;  1M7R A;  4HAV B;  5C6R A;  1KI1 B;  2ZPY A;  1DRO A;  1EVH A;  1UNR A;  5DHA B;  4F7H A;  1FAO A;  1SGH A;  5DHF B;  2IYB A;  5D3X A;  4GPT B;  1V5M A;  5J3Q A;  2AL6 A;  2H7E A;  1FHO A;  2M38 A;  1Z87 A;  2R0D A;  1FGY A;  3ODO A;  1FB8 A;  2I5F A;  1LB1 A;  4A6K A;  3TVV A;  1BAK A;  2VSZ A;  2W2X C;  2FJL A;  1BTN A;  4L6E A;  2P8V A;  4EKU A;  5D27 A;  4KHA A;  1X11 A;  5HE1 A;  2Z0P A;  3TFM A;  4ZRI A;  2LOZ A;  2YS5 A;  2G35 A;  1TJ6 A;  2Y8F A;  1AWE A;  4TYZ A;  2L2I A;  3U8Z A;  2Y7B A;  2ELB A;  4GXB A;  2LG1 A;  1U5D A;  5LOP B;  2D9W A;  2DHI A;  2CY5 A;  4KHB B;  4WSF A;  5J3Y A;  4F7U P;  2W2W A;  2R09 A;  3GYP A;  3DXC A;  3PSC A;  1ZSQ A;  4HB0 B;  3QBV B;  1EGX A;  2DHK A;  2YS1 A;  3NSU A;  1U5F A;  1V61 A;  2VRW B;  1NTY A;  4GZU A;  4HAT B;  2MKR A;  2L1C A;  4IOY X;  1DBH A;  2DTC A;  3CXB B;  4DX9 0;  3PVU A;  4PQ0 A;  4KHO A;  1GG3 A;  2YVC A;  2JP2 A;  2LOX A;  3ZVR A;  2I1J A;  2D2Q A;  2NMB A;  2MWN B;  1V5P A;  4HB3 B;  3G9W A;  1WG7 A;  3DXE A;  3WYF B;  5JHG A;  1BTK A;  4MY6 A;  2RUK B;  3V5W A;  5C79 A;  2N0Y A;  2YRY A;  1Y5O A;  3KY9 A;  5D3Y A;  2P0F A;  5C5B A;  4PNK A;  1V5U A;  4K2O A;  4P7I A;  3FSS A;  2ADZ A;  2VKI A;  3D8F A;  2DYQ A;  1TXD A;  2XQN M;  2ROV A;  1WGQ A;  4KAX B;  3QIJ A;  1GC6 A;  1N3H A;  2DA0 A;  3PEG A;  2UZS A;  2X18 A;  3KSY A;  1J19 A;  1B55 A;  5FI1 A;  5HE3 A;  1NU2 A;  4F7G A;  5FI0 A;  3M1I B;  1EAZ A;  1X05 A;  2J59 M;  1Q67 A;  3P6A A;  4HB4 B;  4WVF B;  1U5E A;  5KQ1 A;  1IRS A;  4HHV A;  1MAI A;  4DBB A;  3PVL A;  4Z2M B;  1RJ2 A;  1K5D B;  1PMS A;  3HW2 B;  4GN1 A;  2DYN A;  2K00 A;  2K2U A;  1TQZ A;  2ELA A;  4A6H A;  4GMV A;  2W2X D;  3FM8 C;  3FEH A;  2BCJ A;  1MK7 B;  2P0H A;  4HAZ B;  5DH9 B;  4HAX B;  2RLO A;  2H7D A;  3TO1 A;  1X86 A;  5LON B;  3AU4 A;  5GOW B;  4CHJ A;  2UVM A;  1W1H A;  3GYO A;  3HQC A;  2MDX A;  4ZRJ A;  4BBK A;  2CAY A;  1RRP B;  5C16 A;  2Y8G A;  1ZC4 B;  1KZ7 A;  4CHM A;  1QC6 A;  1U27 A;  2LYD A;  2CY4 A;  1DYN A;  3SO6 A;  3BJI A;  2GCL A;  5JP4 A;  1SHC A;  1NI2 A;  5DI9 B;  2DHJ A;  2OQB A;  1I7A A;  3UZT A;  3U7D A;  2UZR A;  4A6F B;  2YF0 A;  5HE2 A;  2PZ1 A;  3A98 B;  1FGZ A;  5EFX A;  2RSG A;  3OAN A;  5L81 A;  2COD A;  1P3R A;  2QKM A;  3CIK A;  1E5W A;  1XR0 B;  2D10 A;  2OTX A;  2LUL A;  5JLJ B;  1DDV A;  2EMS A;  4NSW A;  1WJM A;  2IFS A;  2LKO A;  4HAY B;  4C0A A;  4K2P A;  1DDM A;  3MPX A;  1W1D A;  3ML4 A;  2RGN B;  3PZD A;  3ULB A;  5D3W A;  2EJ8 A;  1W1G A;  1UEF A;  4HDO A;  2ROZ B;  1MK9 B;  4MK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...