1ZM0A

Crystal structure of the carboxyl terminal ph domain of pleckstrin to 2.1 angstroms
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
96
Chain Sequence
b'GVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pleckstrin
publication title Structure of the carboxy-terminal PH domain of pleckstrin at 2.1 Angstroms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 19
structure length 96
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zm0A00
3DXEA 5D3YA 2UZSA 2D9WA 5EFXA 1EVHA 1XD4A 1QQGA 5FI0A 1TJ6A 3TCAA 1AWEA 4HATB 5DHFB 1BAKA 2DN6A 2M14A 3ODXA 1M7RA 3U8ZA 1WGUA 5DIFB 3IVFA 3PEGA 2Z0PA 5J3YA 3FSSA 2D10A 4A6FB 1MK9B 2OTXA 2LKOA 2DKPA 2D9YA 2GCLA 5C5BA 4KAXB 2JP2A 2HE7A 4PQ0A 4KHBB 3TO1A 2AEHA 4D0NB 1OQNA 2KUPA 2R0DA 4Y94A 4Z2NA 2YS5A 3CXBB 1NU2A 1UNQA 2DHIA 3MPXA 3U7DA 1MK7B 2CODA 2M38A 1M7EA 1GC7A 2NMBA 1I7AA 2K2JA 2DA0A 1ZVRA 1XODA 2CAYA 2ELBA 5DH9B 2UZRA 1FOEA 1NI2A 4L6EA 3ODOA 1PMSA 5JHGA 4K81A 4NSWA 3N7CA 1W1GA 3AU5A 4YL8A 2VRWB 1DYNA 1V88A 4WSFA 2Q13A 3SNHA 2NZ8B 2Y7BA 3RCPA 2LULA 2J0KA 2PZ1A 3KZ1A 4BBKA 1DDMA 1U2BA 2EC1A 1NTVA 3ZVRA 2MDXA 2YVCA 2BCJA 2W2WA 1DDWA 1I2HA 2EMSA 5D3VA 2RNRB 1WG7A 5HE2A 3KSYA 1N3HA 4HAWB 5KQ4A 4HAUB 4HDQA 2YRYA 2LYDA 1EGXA 2RGNB 1X1FA 1WVHA 4WJ7A 3D8DA 2Z0QA 5DHAB 3PG7A 4Z2MB 1W1DA 5D3XA 1WGQA 1BTKA 2EJ8A 4IFSA 1KZ7A 1V5MA 1MIXA 1MAIA 1FGYA 3PVWA 5JP4A 1Q67A 3F0WA 2ZPYA 3FM8C 2OQBA 4ZRKA 3HK0A 1W1HA 3F5RA 2COFA 1KZGA 3ML4A 5HE3A 3TW1A 2CY5A 3KRWA 2IYBA 5LOPB 1IRSA 4K17A 2K2UA 1U5GA 2D4QA 5CLQB 1FB8A 4ZRJA 2ROZB 4GZUA 4HB4B 2DHJA 4HHVA 2H7EA 2FJLA 1Y5OA 1V89A 2CRFA 4DX8A 3KRXA 3TVVA 4A6FA 3UZTA 1Z87A 3PZDA 3M1IB 3SV1A 1MIZB 3ULCA 3AJ4A 1K5DB 1X86A 4A6KA 1ISNA 1TXDA 2D9ZA 3AU4A 2LG1A 3HQCA 5D3WA 2G35A 4DXAB 1H10A 1NTYA 1XR0B 4NY0A 2N23A 2P0HA 1OMWA 3PSCA 1FGZA 4CHJA 2ADZA 4GXBA 1GG3A 5KQ1A 1GC6A 2MWNB 1TQZA 4WVFB 2P0DA 2ELAA 3ZDTA 1H4RA 1ZM0A 1J19A 3ULBA 2ROVA 3PVLA 2DHKA 3MDBC 5GOWB 3CIKA 1FHXA 1X05A 3OANA 2DX1A 2RVBB 1FHWA 1DROA 2H7DA 5DI9B 1XX0A 1ZC4B 1LB1A 2R09A 5JLJB 2GS0A 3SYXA 5CLLB 2CY4A 2D9XA 2X18A 3D8FA 3PVUA 1KI1B 4TKNA 1E5WA 2GJYA 2EMTA 1P5TA 2D2QA 2I1KA 5HE1A 3PP2A 4GMVA 2D11A 3P6AA 3BJIA 3SUZA 1EF1A 2I5FA 2YT1A 1RJ2A 3WA0A 2DX5A 2W2XD 3O96A 2RSGA 2DTCA 4A5KA 4EKUA 1XKEA 2MKRA 3TFMA 2COAA 4HB0B 4IOYX 2RUKB 2YT0A 4TYZA 2KGXB 1XCGA 2COCA 3FEHA 3D8EA 2YF0A 4KVGB 2Y8FA 3X23A 1QC6A 1UNPA 2DKQA 1V61A 2V76A 3VOQA 3BINA 3G9WA 1FHOA 2DYNA 1Y19B 1P3RA 5D27A 2P8VA 2Y8GA 4K2PA 3P7ZA 1U27A 2AL6A 1DDVA 4HB2B 3LJUX 5FI1A 4HAYB 3GYOA 4H8SA 1X11A 2N0YA 2DFKA 1EAZA 4MY6A 4B6HA 2I1JA 1OY2A 2W2XC 3A8QA 4K2OA 4DX90 2KCJA 1PLSA 1V5PA 4CYEA 5C5BB 1LW3A 1UEFA 3A98B 2L2IA 4HAZB 1MKEA 1AQCA 3VIAA 3QBVB 4F7HA 1BTNA 1BWNA 5J3TA 2J0JA 3WYFB 1WJ1A 2UVMA 5LONB 1ZC3B 4A6HA 4GPTB 2QKMA 5C16A 4DBBA 1WJMA 3A8PA 2I5CA 1J0WA 3QWMA 4HB3B 4KHOA 2IFSA 2MFQA 1P6SA 4EMOA 2LOZA 1U5FA 2E2XA 2K00A 1UPQA 2YS3A 4EJNA 2J59M 2XQNM 1K5GB 1RRPB 4YONA 2J0MA 4P7IA 2GCJA 2Z0OA 1ZSQA 3ODWA 2RLOA 3GYPA 1WI1A 2L1CA 4XWXA 4C0AA 3V5WA 2D9VA 1B55A 5J3QA 2QKLA 3SO6A 3DXCA 2DLWA 3QIJA 3HW2B 3NSUA 1MPHA 1U5DA 3T06A 4HAXB 5JHHA 1UNRA 4GMXB 4HDOA 4MK0A 1U29A 2YSZA 3DXDA 4F7UP 2HTHB 4KHAA 4F7GA 5HE0A 2VSZA 4HAVB 2VKIA 1SHCA 4GN1A 5KCVA 1X1GA 2DYQA 1UPRA 1PFJA 4MT7A 4ZRIA 1SGHA 2P0FA 4CHMA 3KY9A 2YS1A 2LOXA 5L81A 1FAOA 1U5EA 4PNKA 1V5UA 4IAPA 5C79A 5C6RA 1DBHA
chains in the Genus database with same CATH superfamily
3DXEA 5D3YA 2UZSA 2D9WA 5EFXA 1EVHA 1XD4A 1QQGA 5FI0A 1TJ6A 3TCAA 1AWEA 4HATB 3DCXA 5DHFB 1BAKA 2DN6A 2M14A 3ODXA 1M7RA 3U8ZA 1WGUA 5DIFB 3IVFA 2YT2A 3PEGA 2FJUB 2Z0PA 5I2SA 5J3YA 3FSSA 2D10A 4A6FB 1MK9B 2OTXA 2LKOA 2DKPA 2D9YA 2GCLA 5C5BA 4KAXB 2JP2A 2HE7A 4PQ0A 4KHBB 3TO1A 3NW8A 2GUMA 2AEHA 4D0NB 4L1RA 1OQNA 2KUPA 2R0DA 4Y94A 4Z2NA 2YS5A 3CXBB 1NU2A 1UNQA 2DHIA 3MPXA 3U7DA 4OT1A 1MK7B 2CODA 2M38A 1M7EA 1GC7A 2NMBA 1I7AA 2K2JA 2DA0A 1ZVRA 1XODA 2CAYA 2ELBA 5DH9B 2UZRA 1FOEA 1NI2A 4L6EA 3ODOA 1PMSA 5JHGA 4K81A 4NSWA 3N7CA 1W1GA 3AU5A 4YL8A 2VRWB 1DYNA 1V88A 4WSFA 2Q13A 3SNHA 2NZ8B 2Y7BA 2Z4DA 3A58A 3RCPA 2LULA 5LG4B 2J0KA 2PZ1A 3KZ1A 4BBKA 1DDMA 1U2BA 2EC1A 1ZYIA 1NTVA 2Z13A 3ZVRA 2MDXA 2YVCA 2BCJA 2W2WA 1DDWA 1I2HA 2EMSA 5D3VA 2RNRB 1WG7A 5HE2A 3KSYA 1N3HA 4HAWB 5KQ4A 4HAUB 4HDQA 2YRYA 2LYDA 1EGXA 2RGNB 1X1FA 1WVHA 4WJ7A 3D8DA 2Z0QA 5DHAB 3PG7A 4Z2MB 1W1DA 5D3XA 1WGQA 3FVCA 1BTKA 2EJ8A 4IFSA 1KZ7A 1V5MA 1MIXA 1MAIA 1FGYA 3PVWA 5JP4A 1Q67A 3F0WA 2ZPYA 3FM8C 2OQBA 4ZRKA 3HK0A 1W1HA 3F5RA 2COFA 1KZGA 5I2MA 3ML4A 5HE3A 3TW1A 2CY5A 3KRWA 2IYBA 5LOPB 1IRSA 4K17A 2K2UA 1U5GA 2D4QA 4CSQA 5CLQB 1FB8A 4ZRJA 3B77A 2ROZB 4GZUA 4QJ3B 4HB4B 2DHJA 4HHVA 2H7EA 2FJLA 1Y5OA 1V89A 2CRFA 4DX8A 3KRXA 3TVVA 4A6FA 3UZTA 1Z87A 2KIGA 3PZDA 3HSAA 3M1IB 3SV1A 1MIZB 3ULCA 3AJ4A 1K5DB 2KUQA 1X86A 4A6KA 1ISNA 4KHBA 1TXDA 2D9ZA 3AU4A 2LG1A 3HQCA 3NWDA 5D3WA 2G35A 4DXAB 1H10A 1NTYA 1XR0B 4NY0A 2N23A 2P0HA 1OMWA 3PSCA 1FGZA 4CHJA 2ADZA 4GXBA 1GG3A 5KQ1A 1GC6A 2MWNB 1TQZA 4WVFB 2P0DA 2ELAA 5IRSA 3ZDTA 1H4RA 1ZM0A 1J19A 1MI1A 3ULBA 2ROVA 3PVLA 3NWAA 2DHKA 4D6WA 3MDBC 5GOWB 3CIKA 1FHXA 1X05A 3OANA 3OHMB 2DX1A 2RVBB 1FHWA 1DROA 2H7DA 5DI9B 1XX0A 2R2YA 1ZC4B 1LB1A 2R09A 3U12A 5JLJB 2GS0A 3SYXA 5CLLB 2CY4A 2D9XA 2X18A 3D8FA 3PVUA 1KI1B 4TKNA 1E5WA 2GJYA 2EMTA 1P5TA 2D2QA 2I1KA 5HE1A 3HIEA 3PP2A 4GMVA 2D11A 3P6AA 3BJIA 3SUZA 1EF1A 2I5FA 2YT1A 2KR0A 1RJ2A 3WA0A 2DX5A 2KIEA 2W2XD 3O96A 2RSGA 2DTCA 4GOUA 4A5KA 4GNKB 4HSIA 4EKUA 1XKEA 2MKRA 3TFMA 2COAA 4HB0B 4IOYX 2RUKB 2YT0A 4TYZA 2KGXB 4OSNA 1XCGA 2COCA 3FEHA 3D8EA 2YF0A 4KVGB 2Y8FA 3X23A 1QC6A 1UNPA 2DKQA 1V61A 2V76A 3VOQA 3BINA 3G9WA 1T77A 2K49A 1FHOA 5M4YB 2DYNA 2Z59A 1Y19B 1P3RA 5D27A 2P8VA 2Y8GA 4K2PA 3P7ZA 1U27A 2AL6A 1DDVA 4HB2B 3LJUX 5FI1A 4HAYB 3GYOA 4H8SA 1X11A 2N0YA 2DFKA 1EAZA 4MY6A 4QJ5B 4B6HA 2I1JA 1OY2A 2W2XC 3A8QA 4K2OA 4DX90 2KCJA 1PLSA 1V5PA 4CYEA 5C5BB 1LW3A 1UEFA 3A98B 2L2IA 4HAZB 1MKEA 1AQCA 3VIAA 3QBVB 4F7HA 2RRFA 1BTNA 4QXAB 1BWNA 5J3TA 2J0JA 3WYFB 1WJ1A 2UVMA 5LONB 1ZC3B 4A6HA 4GPTB 2QKMA 4QJ4B 2ZKMX 5C16A 2Z14A 4DBBA 1WJMA 3A8PA 2I5CA 1J0WA 3QWMA 4HB3B 4DIXA 4KHOA 2IFSA 2MFQA 1P6SA 4EMOA 2LOZA 1U5FA 2E2XA 2K00A 1UPQA 2YS3A 4EJNA 2J59M 2XQNM 1K5GB 1RRPB 4YONA 2NBVA 3NWFA 2J0MA 4P7IA 2GCJA 2Z0OA 1ZSQA 3ODWA 2RLOA 3GYPA 1WI1A 2L1CA 4XWXA 4C0AA 3V5WA 2D9VA 1B55A 5J3QA 2QKLA 3SO6A 3DXCA 2DLWA 3QIJA 3HW2B 3NSUA 1MPHA 1U5DA 3T06A 2K8EA 4HAXB 5JHHA 1UNRA 4GMXB 4HDOA 4MK0A 1U29A 2YSZA 3DXDA 4F7UP 2HTHB 4KHAA 4F7GA 5HE0A 2VSZA 4HAVB 2VKIA 1SHCA 4GN1A 5KCVA 1X1GA 2DYQA 1UPRA 1PFJA 4MT7A 4ZRIA 1SGHA 2P0FA 4CHMA 3KY9A 2YS1A 2LOXA 5L81A 1FAOA 1U5EA 4PNKA 1V5UA 4IAPA 5C79A 5C6RA 1DBHA
chains in the Genus database with same CATH topology
3DXEA 5D3YA 2UZSA 2D9WA 5EFXA 1EVHA 1XD4A 1QQGA 5FI0A 1TJ6A 3TCAA 1AWEA 4HATB 5DHFB 1BAKA 2DN6A 2M14A 3ODXA 1M7RA 3U8ZA 1WGUA 5DIFB 3IVFA 3PEGA 2Z0PA 5J3YA 3FSSA 2D10A 4A6FB 1MK9B 2OTXA 2LKOA 2DKPA 2D9YA 2GCLA 5C5BA 4KAXB 2JP2A 2HE7A 4PQ0A 4KHBB 3TO1A 2AEHA 4D0NB 1OQNA 2KUPA 2R0DA 4Y94A 4Z2NA 2YS5A 3CXBB 1NU2A 1UNQA 2DHIA 3MPXA 3U7DA 1MK7B 2CODA 2M38A 1M7EA 1GC7A 2NMBA 1I7AA 2K2JA 2DA0A 1ZVRA 1XODA 2CAYA 2ELBA 5DH9B 2UZRA 1FOEA 1NI2A 4L6EA 3ODOA 1PMSA 5JHGA 4K81A 4NSWA 3N7CA 1W1GA 3AU5A 4YL8A 2VRWB 1DYNA 1V88A 4WSFA 2Q13A 3SNHA 2NZ8B 2Y7BA 3RCPA 2LULA 2J0KA 2PZ1A 3KZ1A 4BBKA 1DDMA 1U2BA 2EC1A 1NTVA 3ZVRA 2MDXA 2YVCA 2BCJA 2W2WA 1DDWA 1I2HA 2EMSA 5D3VA 2RNRB 1WG7A 5HE2A 3KSYA 1N3HA 4HAWB 5KQ4A 4HAUB 4HDQA 2YRYA 2LYDA 1EGXA 2RGNB 1X1FA 1WVHA 4WJ7A 3D8DA 2Z0QA 5DHAB 3PG7A 4Z2MB 1W1DA 5D3XA 1WGQA 1BTKA 2EJ8A 4IFSA 1KZ7A 1V5MA 1MIXA 1MAIA 1FGYA 3PVWA 5JP4A 1Q67A 3F0WA 2ZPYA 3FM8C 2OQBA 4ZRKA 3HK0A 1W1HA 3F5RA 2COFA 1KZGA 3ML4A 5HE3A 3TW1A 2CY5A 3KRWA 2IYBA 5LOPB 1IRSA 4K17A 2K2UA 1U5GA 2D4QA 5CLQB 1FB8A 4ZRJA 2ROZB 4GZUA 4HB4B 2DHJA 4HHVA 2H7EA 2FJLA 1Y5OA 1V89A 2CRFA 4DX8A 3KRXA 3TVVA 4A6FA 3UZTA 1Z87A 3PZDA 3M1IB 3SV1A 1MIZB 3ULCA 3AJ4A 1K5DB 1X86A 4A6KA 1ISNA 1TXDA 2D9ZA 3AU4A 2LG1A 3HQCA 5D3WA 2G35A 4DXAB 1H10A 1NTYA 1XR0B 4NY0A 2N23A 2P0HA 1OMWA 3PSCA 1FGZA 4CHJA 2ADZA 4GXBA 1GG3A 5KQ1A 1GC6A 2MWNB 1TQZA 4WVFB 2P0DA 2ELAA 3ZDTA 1H4RA 1ZM0A 1J19A 3ULBA 2ROVA 3PVLA 2DHKA 3MDBC 5GOWB 3CIKA 1FHXA 1X05A 3OANA 2DX1A 2RVBB 1FHWA 1DROA 2H7DA 5DI9B 1XX0A 1ZC4B 1LB1A 2R09A 5JLJB 2GS0A 3SYXA 5CLLB 2CY4A 2D9XA 2X18A 3D8FA 3PVUA 1KI1B 4TKNA 1E5WA 2GJYA 2EMTA 1P5TA 2D2QA 2I1KA 5HE1A 3PP2A 4GMVA 2D11A 3P6AA 3BJIA 3SUZA 1EF1A 2I5FA 2YT1A 1RJ2A 3WA0A 2DX5A 2W2XD 3O96A 2RSGA 2DTCA 4A5KA 4EKUA 1XKEA 2MKRA 3TFMA 2COAA 4HB0B 4IOYX 2RUKB 2YT0A 4TYZA 2KGXB 1XCGA 2COCA 3FEHA 3D8EA 2YF0A 4KVGB 2Y8FA 3X23A 1QC6A 1UNPA 2DKQA 1V61A 2V76A 3VOQA 3BINA 3G9WA 1FHOA 2DYNA 1Y19B 1P3RA 5D27A 2P8VA 2Y8GA 4K2PA 3P7ZA 1U27A 2AL6A 1DDVA 4HB2B 3LJUX 5FI1A 4HAYB 3GYOA 4H8SA 1X11A 2N0YA 2DFKA 1EAZA 4MY6A 4B6HA 2I1JA 1OY2A 2W2XC 3A8QA 4K2OA 4DX90 2KCJA 1PLSA 1V5PA 4CYEA 5C5BB 1LW3A 1UEFA 3A98B 2L2IA 4HAZB 1MKEA 1AQCA 3VIAA 3QBVB 4F7HA 1BTNA 1BWNA 5J3TA 2J0JA 3WYFB 1WJ1A 2UVMA 5LONB 1ZC3B 4A6HA 4GPTB 2QKMA 5C16A 4DBBA 1WJMA 3A8PA 2I5CA 1J0WA 3QWMA 4HB3B 4KHOA 2IFSA 2MFQA 1P6SA 4EMOA 2LOZA 1U5FA 2E2XA 2K00A 1UPQA 2YS3A 4EJNA 2J59M 2XQNM 1K5GB 1RRPB 4YONA 2J0MA 4P7IA 2GCJA 2Z0OA 1ZSQA 3ODWA 2RLOA 3GYPA 1WI1A 2L1CA 4XWXA 4C0AA 3V5WA 2D9VA 1B55A 5J3QA 2QKLA 3SO6A 3DXCA 2DLWA 3QIJA 3HW2B 3NSUA 1MPHA 1U5DA 3T06A 4HAXB 5JHHA 1UNRA 4GMXB 4HDOA 4MK0A 1U29A 2YSZA 3DXDA 4F7UP 2HTHB 4KHAA 4F7GA 5HE0A 2VSZA 4HAVB 2VKIA 1SHCA 4GN1A 5KCVA 1X1GA 2DYQA 1UPRA 1PFJA 4MT7A 4ZRIA 1SGHA 2P0FA 4CHMA 3KY9A 2YS1A 2LOXA 5L81A 1FAOA 1U5EA 4PNKA 1V5UA 4IAPA 5C79A 5C6RA 1DBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXE A;  5D3Y A;  2UZS A;  2D9W A;  5EFX A;  1EVH A;  1XD4 A;  1QQG A;  5FI0 A;  1TJ6 A;  3TCA A;  1AWE A;  4HAT B;  5DHF B;  1BAK A;  2DN6 A;  2M14 A;  3ODX A;  1M7R A;  3U8Z A;  1WGU A;  5DIF B;  3IVF A;  3PEG A;  2Z0P A;  5J3Y A;  3FSS A;  2D10 A;  4A6F B;  1MK9 B;  2OTX A;  2LKO A;  2DKP A;  2D9Y A;  2GCL A;  5C5B A;  4KAX B;  2JP2 A;  2HE7 A;  4PQ0 A;  4KHB B;  3TO1 A;  2AEH A;  4D0N B;  1OQN A;  2KUP A;  2R0D A;  4Y94 A;  4Z2N A;  2YS5 A;  3CXB B;  1NU2 A;  1UNQ A;  2DHI A;  3MPX A;  3U7D A;  1MK7 B;  2COD A;  2M38 A;  1M7E A;  1GC7 A;  2NMB A;  1I7A A;  2K2J A;  2DA0 A;  1ZVR A;  1XOD A;  2CAY A;  2ELB A;  5DH9 B;  2UZR A;  1FOE A;  1NI2 A;  4L6E A;  3ODO A;  1PMS A;  5JHG A;  4K81 A;  4NSW A;  3N7C A;  1W1G A;  3AU5 A;  4YL8 A;  2VRW B;  1DYN A;  1V88 A;  4WSF A;  2Q13 A;  3SNH A;  2NZ8 B;  2Y7B A;  3RCP A;  2LUL A;  2J0K A;  2PZ1 A;  3KZ1 A;  4BBK A;  1DDM A;  1U2B A;  2EC1 A;  1NTV A;  3ZVR A;  2MDX A;  2YVC A;  2BCJ A;  2W2W A;  1DDW A;  1I2H A;  2EMS A;  5D3V A;  2RNR B;  1WG7 A;  5HE2 A;  3KSY A;  1N3H A;  4HAW B;  5KQ4 A;  4HAU B;  4HDQ A;  2YRY A;  2LYD A;  1EGX A;  2RGN B;  1X1F A;  1WVH A;  4WJ7 A;  3D8D A;  2Z0Q A;  5DHA B;  3PG7 A;  4Z2M B;  1W1D A;  5D3X A;  1WGQ A;  1BTK A;  2EJ8 A;  4IFS A;  1KZ7 A;  1V5M A;  1MIX A;  1MAI A;  1FGY A;  3PVW A;  5JP4 A;  1Q67 A;  3F0W A;  2ZPY A;  3FM8 C;  2OQB A;  4ZRK A;  3HK0 A;  1W1H A;  3F5R A;  2COF A;  1KZG A;  3ML4 A;  5HE3 A;  3TW1 A;  2CY5 A;  3KRW A;  2IYB A;  5LOP B;  1IRS A;  4K17 A;  2K2U A;  1U5G A;  2D4Q A;  5CLQ B;  1FB8 A;  4ZRJ A;  2ROZ B;  4GZU A;  4HB4 B;  2DHJ A;  4HHV A;  2H7E A;  2FJL A;  1Y5O A;  1V89 A;  2CRF A;  4DX8 A;  3KRX A;  3TVV A;  4A6F A;  3UZT A;  1Z87 A;  3PZD A;  3M1I B;  3SV1 A;  1MIZ B;  3ULC A;  3AJ4 A;  1K5D B;  1X86 A;  4A6K A;  1ISN A;  1TXD A;  2D9Z A;  3AU4 A;  2LG1 A;  3HQC A;  5D3W A;  2G35 A;  4DXA B;  1H10 A;  1NTY A;  1XR0 B;  4NY0 A;  2N23 A;  2P0H A;  1OMW A;  3PSC A;  1FGZ A;  4CHJ A;  2ADZ A;  4GXB A;  1GG3 A;  5KQ1 A;  1GC6 A;  2MWN B;  1TQZ A;  4WVF B;  2P0D A;  2ELA A;  3ZDT A;  1H4R A;  1ZM0 A;  1J19 A;  3ULB A;  2ROV A;  3PVL A;  2DHK A;  3MDB C;  5GOW B;  3CIK A;  1FHX A;  1X05 A;  3OAN A;  2DX1 A;  2RVB B;  1FHW A;  1DRO A;  2H7D A;  5DI9 B;  1XX0 A;  1ZC4 B;  1LB1 A;  2R09 A;  5JLJ B;  2GS0 A;  3SYX A;  5CLL B;  2CY4 A;  2D9X A;  2X18 A;  3D8F A;  3PVU A;  1KI1 B;  4TKN A;  1E5W A;  2GJY A;  2EMT A;  1P5T A;  2D2Q A;  2I1K A;  5HE1 A;  3PP2 A;  4GMV A;  2D11 A;  3P6A A;  3BJI A;  3SUZ A;  1EF1 A;  2I5F A;  2YT1 A;  1RJ2 A;  3WA0 A;  2DX5 A;  2W2X D;  3O96 A;  2RSG A;  2DTC A;  4A5K A;  4EKU A;  1XKE A;  2MKR A;  3TFM A;  2COA A;  4HB0 B;  4IOY X;  2RUK B;  2YT0 A;  4TYZ A;  2KGX B;  1XCG A;  2COC A;  3FEH A;  3D8E A;  2YF0 A;  4KVG B;  2Y8F A;  3X23 A;  1QC6 A;  1UNP A;  2DKQ A;  1V61 A;  2V76 A;  3VOQ A;  3BIN A;  3G9W A;  1FHO A;  2DYN A;  1Y19 B;  1P3R A;  5D27 A;  2P8V A;  2Y8G A;  4K2P A;  3P7Z A;  1U27 A;  2AL6 A;  1DDV A;  4HB2 B;  3LJU X;  5FI1 A;  4HAY B;  3GYO A;  4H8S A;  1X11 A;  2N0Y A;  2DFK A;  1EAZ A;  4MY6 A;  4B6H A;  2I1J A;  1OY2 A;  2W2X C;  3A8Q A;  4K2O A;  4DX9 0;  2KCJ A;  1PLS A;  1V5P A;  4CYE A;  5C5B B;  1LW3 A;  1UEF A;  3A98 B;  2L2I A;  4HAZ B;  1MKE A;  1AQC A;  3VIA A;  3QBV B;  4F7H A;  1BTN A;  1BWN A;  5J3T A;  2J0J A;  3WYF B;  1WJ1 A;  2UVM A;  5LON B;  1ZC3 B;  4A6H A;  4GPT B;  2QKM A;  5C16 A;  4DBB A;  1WJM A;  3A8P A;  2I5C A;  1J0W A;  3QWM A;  4HB3 B;  4KHO A;  2IFS A;  2MFQ A;  1P6S A;  4EMO A;  2LOZ A;  1U5F A;  2E2X A;  2K00 A;  1UPQ A;  2YS3 A;  4EJN A;  2J59 M;  2XQN M;  1K5G B;  1RRP B;  4YON A;  2J0M A;  4P7I A;  2GCJ A;  2Z0O A;  1ZSQ A;  3ODW A;  2RLO A;  3GYP A;  1WI1 A;  2L1C A;  4XWX A;  4C0A A;  3V5W A;  2D9V A;  1B55 A;  5J3Q A;  2QKL A;  3SO6 A;  3DXC A;  2DLW A;  3QIJ A;  3HW2 B;  3NSU A;  1MPH A;  1U5D A;  3T06 A;  4HAX B;  5JHH A;  1UNR A;  4GMX B;  4HDO A;  4MK0 A;  1U29 A;  2YSZ A;  3DXD A;  4F7U P;  2HTH B;  4KHA A;  4F7G A;  5HE0 A;  2VSZ A;  4HAV B;  2VKI A;  1SHC A;  4GN1 A;  5KCV A;  1X1G A;  2DYQ A;  1UPR A;  1PFJ A;  4MT7 A;  4ZRI A;  1SGH A;  2P0F A;  4CHM A;  3KY9 A;  2YS1 A;  2LOX A;  5L81 A;  1FAO A;  1U5E A;  4PNK A;  1V5U A;  4IAP A;  5C79 A;  5C6R A;  1DBH A; 
#chains in the Genus database with same CATH topology
 3DXE A;  5D3Y A;  2UZS A;  2D9W A;  5EFX A;  1EVH A;  1XD4 A;  1QQG A;  5FI0 A;  1TJ6 A;  3TCA A;  1AWE A;  4HAT B;  3DCX A;  5DHF B;  1BAK A;  2DN6 A;  2M14 A;  3ODX A;  1M7R A;  3U8Z A;  1WGU A;  5DIF B;  3IVF A;  2YT2 A;  3PEG A;  2FJU B;  2Z0P A;  5I2S A;  5J3Y A;  3FSS A;  2D10 A;  4A6F B;  1MK9 B;  2OTX A;  2LKO A;  2DKP A;  2D9Y A;  2GCL A;  5C5B A;  4KAX B;  2JP2 A;  2HE7 A;  4PQ0 A;  4KHB B;  3TO1 A;  3NW8 A;  2GUM A;  2AEH A;  4D0N B;  4L1R A;  1OQN A;  2KUP A;  2R0D A;  4Y94 A;  4Z2N A;  2YS5 A;  3CXB B;  1NU2 A;  1UNQ A;  2DHI A;  3MPX A;  3U7D A;  4OT1 A;  1MK7 B;  2COD A;  2M38 A;  1M7E A;  1GC7 A;  2NMB A;  1I7A A;  2K2J A;  2DA0 A;  1ZVR A;  1XOD A;  2CAY A;  2ELB A;  5DH9 B;  2UZR A;  1FOE A;  1NI2 A;  4L6E A;  3ODO A;  1PMS A;  5JHG A;  4K81 A;  4NSW A;  3N7C A;  1W1G A;  3AU5 A;  4YL8 A;  2VRW B;  1DYN A;  1V88 A;  4WSF A;  2Q13 A;  3SNH A;  2NZ8 B;  2Y7B A;  2Z4D A;  3A58 A;  3RCP A;  2LUL A;  5LG4 B;  2J0K A;  2PZ1 A;  3KZ1 A;  4BBK A;  1DDM A;  1U2B A;  2EC1 A;  1ZYI A;  1NTV A;  2Z13 A;  3ZVR A;  2MDX A;  2YVC A;  2BCJ A;  2W2W A;  1DDW A;  1I2H A;  2EMS A;  5D3V A;  2RNR B;  1WG7 A;  5HE2 A;  3KSY A;  1N3H A;  4HAW B;  5KQ4 A;  4HAU B;  4HDQ A;  2YRY A;  2LYD A;  1EGX A;  2RGN B;  1X1F A;  1WVH A;  4WJ7 A;  3D8D A;  2Z0Q A;  5DHA B;  3PG7 A;  4Z2M B;  1W1D A;  5D3X A;  1WGQ A;  3FVC A;  1BTK A;  2EJ8 A;  4IFS A;  1KZ7 A;  1V5M A;  1MIX A;  1MAI A;  1FGY A;  3PVW A;  5JP4 A;  1Q67 A;  3F0W A;  2ZPY A;  3FM8 C;  2OQB A;  4ZRK A;  3HK0 A;  1W1H A;  3F5R A;  2COF A;  1KZG A;  5I2M A;  3ML4 A;  5HE3 A;  3TW1 A;  2CY5 A;  3KRW A;  2IYB A;  5LOP B;  1IRS A;  4K17 A;  2K2U A;  1U5G A;  2D4Q A;  4CSQ A;  5CLQ B;  1FB8 A;  4ZRJ A;  3B77 A;  2ROZ B;  4GZU A;  4QJ3 B;  4HB4 B;  2DHJ A;  4HHV A;  2H7E A;  2FJL A;  1Y5O A;  1V89 A;  2CRF A;  4DX8 A;  3KRX A;  3TVV A;  4A6F A;  3UZT A;  1Z87 A;  2KIG A;  3PZD A;  3HSA A;  3M1I B;  3SV1 A;  1MIZ B;  3ULC A;  3AJ4 A;  1K5D B;  2KUQ A;  1X86 A;  4A6K A;  1ISN A;  4KHB A;  1TXD A;  2D9Z A;  3AU4 A;  2LG1 A;  3HQC A;  3NWD A;  5D3W A;  2G35 A;  4DXA B;  1H10 A;  1NTY A;  1XR0 B;  4NY0 A;  2N23 A;  2P0H A;  1OMW A;  3PSC A;  1FGZ A;  4CHJ A;  2ADZ A;  4GXB A;  1GG3 A;  5KQ1 A;  1GC6 A;  2MWN B;  1TQZ A;  4WVF B;  2P0D A;  2ELA A;  5IRS A;  3ZDT A;  1H4R A;  1ZM0 A;  1J19 A;  1MI1 A;  3ULB A;  2ROV A;  3PVL A;  3NWA A;  2DHK A;  4D6W A;  3MDB C;  5GOW B;  3CIK A;  1FHX A;  1X05 A;  3OAN A;  3OHM B;  2DX1 A;  2RVB B;  1FHW A;  1DRO A;  2H7D A;  5DI9 B;  1XX0 A;  2R2Y A;  1ZC4 B;  1LB1 A;  2R09 A;  3U12 A;  5JLJ B;  2GS0 A;  3SYX A;  5CLL B;  2CY4 A;  2D9X A;  2X18 A;  3D8F A;  3PVU A;  1KI1 B;  4TKN A;  1E5W A;  2GJY A;  2EMT A;  1P5T A;  2D2Q A;  2I1K A;  5HE1 A;  3HIE A;  3PP2 A;  4GMV A;  2D11 A;  3P6A A;  3BJI A;  3SUZ A;  1EF1 A;  2I5F A;  2YT1 A;  2KR0 A;  1RJ2 A;  3WA0 A;  2DX5 A;  2KIE A;  2W2X D;  3O96 A;  2RSG A;  2DTC A;  4GOU A;  4A5K A;  4GNK B;  4HSI A;  4EKU A;  1XKE A;  2MKR A;  3TFM A;  2COA A;  4HB0 B;  4IOY X;  2RUK B;  2YT0 A;  4TYZ A;  2KGX B;  4OSN A;  1XCG A;  2COC A;  3FEH A;  3D8E A;  2YF0 A;  4KVG B;  2Y8F A;  3X23 A;  1QC6 A;  1UNP A;  2DKQ A;  1V61 A;  2V76 A;  3VOQ A;  3BIN A;  3G9W A;  1T77 A;  2K49 A;  1FHO A;  5M4Y B;  2DYN A;  2Z59 A;  1Y19 B;  1P3R A;  5D27 A;  2P8V A;  2Y8G A;  4K2P A;  3P7Z A;  1U27 A;  2AL6 A;  1DDV A;  4HB2 B;  3LJU X;  5FI1 A;  4HAY B;  3GYO A;  4H8S A;  1X11 A;  2N0Y A;  2DFK A;  1EAZ A;  4MY6 A;  4QJ5 B;  4B6H A;  2I1J A;  1OY2 A;  2W2X C;  3A8Q A;  4K2O A;  4DX9 0;  2KCJ A;  1PLS A;  1V5P A;  4CYE A;  5C5B B;  1LW3 A;  1UEF A;  3A98 B;  2L2I A;  4HAZ B;  1MKE A;  1AQC A;  3VIA A;  3QBV B;  4F7H A;  2RRF A;  1BTN A;  4QXA B;  1BWN A;  5J3T A;  2J0J A;  3WYF B;  1WJ1 A;  2UVM A;  5LON B;  1ZC3 B;  4A6H A;  4GPT B;  2QKM A;  4QJ4 B;  2ZKM X;  5C16 A;  2Z14 A;  4DBB A;  1WJM A;  3A8P A;  2I5C A;  1J0W A;  3QWM A;  4HB3 B;  4DIX A;  4KHO A;  2IFS A;  2MFQ A;  1P6S A;  4EMO A;  2LOZ A;  1U5F A;  2E2X A;  2K00 A;  1UPQ A;  2YS3 A;  4EJN A;  2J59 M;  2XQN M;  1K5G B;  1RRP B;  4YON A;  2NBV A;  3NWF A;  2J0M A;  4P7I A;  2GCJ A;  2Z0O A;  1ZSQ A;  3ODW A;  2RLO A;  3GYP A;  1WI1 A;  2L1C A;  4XWX A;  4C0A A;  3V5W A;  2D9V A;  1B55 A;  5J3Q A;  2QKL A;  3SO6 A;  3DXC A;  2DLW A;  3QIJ A;  3HW2 B;  3NSU A;  1MPH A;  1U5D A;  3T06 A;  2K8E A;  4HAX B;  5JHH A;  1UNR A;  4GMX B;  4HDO A;  4MK0 A;  1U29 A;  2YSZ A;  3DXD A;  4F7U P;  2HTH B;  4KHA A;  4F7G A;  5HE0 A;  2VSZ A;  4HAV B;  2VKI A;  1SHC A;  4GN1 A;  5KCV A;  1X1G A;  2DYQ A;  1UPR A;  1PFJ A;  4MT7 A;  4ZRI A;  1SGH A;  2P0F A;  4CHM A;  3KY9 A;  2YS1 A;  2LOX A;  5L81 A;  1FAO A;  1U5E A;  4PNK A;  1V5U A;  4IAP A;  5C79 A;  5C6R A;  1DBH A; 
#chains in the Genus database with same CATH homology
 3DXE A;  5D3Y A;  2UZS A;  2D9W A;  5EFX A;  1EVH A;  1XD4 A;  1QQG A;  5FI0 A;  1TJ6 A;  3TCA A;  1AWE A;  4HAT B;  5DHF B;  1BAK A;  2DN6 A;  2M14 A;  3ODX A;  1M7R A;  3U8Z A;  1WGU A;  5DIF B;  3IVF A;  3PEG A;  2Z0P A;  5J3Y A;  3FSS A;  2D10 A;  4A6F B;  1MK9 B;  2OTX A;  2LKO A;  2DKP A;  2D9Y A;  2GCL A;  5C5B A;  4KAX B;  2JP2 A;  2HE7 A;  4PQ0 A;  4KHB B;  3TO1 A;  2AEH A;  4D0N B;  1OQN A;  2KUP A;  2R0D A;  4Y94 A;  4Z2N A;  2YS5 A;  3CXB B;  1NU2 A;  1UNQ A;  2DHI A;  3MPX A;  3U7D A;  1MK7 B;  2COD A;  2M38 A;  1M7E A;  1GC7 A;  2NMB A;  1I7A A;  2K2J A;  2DA0 A;  1ZVR A;  1XOD A;  2CAY A;  2ELB A;  5DH9 B;  2UZR A;  1FOE A;  1NI2 A;  4L6E A;  3ODO A;  1PMS A;  5JHG A;  4K81 A;  4NSW A;  3N7C A;  1W1G A;  3AU5 A;  4YL8 A;  2VRW B;  1DYN A;  1V88 A;  4WSF A;  2Q13 A;  3SNH A;  2NZ8 B;  2Y7B A;  3RCP A;  2LUL A;  2J0K A;  2PZ1 A;  3KZ1 A;  4BBK A;  1DDM A;  1U2B A;  2EC1 A;  1NTV A;  3ZVR A;  2MDX A;  2YVC A;  2BCJ A;  2W2W A;  1DDW A;  1I2H A;  2EMS A;  5D3V A;  2RNR B;  1WG7 A;  5HE2 A;  3KSY A;  1N3H A;  4HAW B;  5KQ4 A;  4HAU B;  4HDQ A;  2YRY A;  2LYD A;  1EGX A;  2RGN B;  1X1F A;  1WVH A;  4WJ7 A;  3D8D A;  2Z0Q A;  5DHA B;  3PG7 A;  4Z2M B;  1W1D A;  5D3X A;  1WGQ A;  1BTK A;  2EJ8 A;  4IFS A;  1KZ7 A;  1V5M A;  1MIX A;  1MAI A;  1FGY A;  3PVW A;  5JP4 A;  1Q67 A;  3F0W A;  2ZPY A;  3FM8 C;  2OQB A;  4ZRK A;  3HK0 A;  1W1H A;  3F5R A;  2COF A;  1KZG A;  3ML4 A;  5HE3 A;  3TW1 A;  2CY5 A;  3KRW A;  2IYB A;  5LOP B;  1IRS A;  4K17 A;  2K2U A;  1U5G A;  2D4Q A;  5CLQ B;  1FB8 A;  4ZRJ A;  2ROZ B;  4GZU A;  4HB4 B;  2DHJ A;  4HHV A;  2H7E A;  2FJL A;  1Y5O A;  1V89 A;  2CRF A;  4DX8 A;  3KRX A;  3TVV A;  4A6F A;  3UZT A;  1Z87 A;  3PZD A;  3M1I B;  3SV1 A;  1MIZ B;  3ULC A;  3AJ4 A;  1K5D B;  1X86 A;  4A6K A;  1ISN A;  1TXD A;  2D9Z A;  3AU4 A;  2LG1 A;  3HQC A;  5D3W A;  2G35 A;  4DXA B;  1H10 A;  1NTY A;  1XR0 B;  4NY0 A;  2N23 A;  2P0H A;  1OMW A;  3PSC A;  1FGZ A;  4CHJ A;  2ADZ A;  4GXB A;  1GG3 A;  5KQ1 A;  1GC6 A;  2MWN B;  1TQZ A;  4WVF B;  2P0D A;  2ELA A;  3ZDT A;  1H4R A;  1ZM0 A;  1J19 A;  3ULB A;  2ROV A;  3PVL A;  2DHK A;  3MDB C;  5GOW B;  3CIK A;  1FHX A;  1X05 A;  3OAN A;  2DX1 A;  2RVB B;  1FHW A;  1DRO A;  2H7D A;  5DI9 B;  1XX0 A;  1ZC4 B;  1LB1 A;  2R09 A;  5JLJ B;  2GS0 A;  3SYX A;  5CLL B;  2CY4 A;  2D9X A;  2X18 A;  3D8F A;  3PVU A;  1KI1 B;  4TKN A;  1E5W A;  2GJY A;  2EMT A;  1P5T A;  2D2Q A;  2I1K A;  5HE1 A;  3PP2 A;  4GMV A;  2D11 A;  3P6A A;  3BJI A;  3SUZ A;  1EF1 A;  2I5F A;  2YT1 A;  1RJ2 A;  3WA0 A;  2DX5 A;  2W2X D;  3O96 A;  2RSG A;  2DTC A;  4A5K A;  4EKU A;  1XKE A;  2MKR A;  3TFM A;  2COA A;  4HB0 B;  4IOY X;  2RUK B;  2YT0 A;  4TYZ A;  2KGX B;  1XCG A;  2COC A;  3FEH A;  3D8E A;  2YF0 A;  4KVG B;  2Y8F A;  3X23 A;  1QC6 A;  1UNP A;  2DKQ A;  1V61 A;  2V76 A;  3VOQ A;  3BIN A;  3G9W A;  1FHO A;  2DYN A;  1Y19 B;  1P3R A;  5D27 A;  2P8V A;  2Y8G A;  4K2P A;  3P7Z A;  1U27 A;  2AL6 A;  1DDV A;  4HB2 B;  3LJU X;  5FI1 A;  4HAY B;  3GYO A;  4H8S A;  1X11 A;  2N0Y A;  2DFK A;  1EAZ A;  4MY6 A;  4B6H A;  2I1J A;  1OY2 A;  2W2X C;  3A8Q A;  4K2O A;  4DX9 0;  2KCJ A;  1PLS A;  1V5P A;  4CYE A;  5C5B B;  1LW3 A;  1UEF A;  3A98 B;  2L2I A;  4HAZ B;  1MKE A;  1AQC A;  3VIA A;  3QBV B;  4F7H A;  1BTN A;  1BWN A;  5J3T A;  2J0J A;  3WYF B;  1WJ1 A;  2UVM A;  5LON B;  1ZC3 B;  4A6H A;  4GPT B;  2QKM A;  5C16 A;  4DBB A;  1WJM A;  3A8P A;  2I5C A;  1J0W A;  3QWM A;  4HB3 B;  4KHO A;  2IFS A;  2MFQ A;  1P6S A;  4EMO A;  2LOZ A;  1U5F A;  2E2X A;  2K00 A;  1UPQ A;  2YS3 A;  4EJN A;  2J59 M;  2XQN M;  1K5G B;  1RRP B;  4YON A;  2J0M A;  4P7I A;  2GCJ A;  2Z0O A;  1ZSQ A;  3ODW A;  2RLO A;  3GYP A;  1WI1 A;  2L1C A;  4XWX A;  4C0A A;  3V5W A;  2D9V A;  1B55 A;  5J3Q A;  2QKL A;  3SO6 A;  3DXC A;  2DLW A;  3QIJ A;  3HW2 B;  3NSU A;  1MPH A;  1U5D A;  3T06 A;  4HAX B;  5JHH A;  1UNR A;  4GMX B;  4HDO A;  4MK0 A;  1U29 A;  2YSZ A;  3DXD A;  4F7U P;  2HTH B;  4KHA A;  4F7G A;  5HE0 A;  2VSZ A;  4HAV B;  2VKI A;  1SHC A;  4GN1 A;  5KCV A;  1X1G A;  2DYQ A;  1UPR A;  1PFJ A;  4MT7 A;  4ZRI A;  1SGH A;  2P0F A;  4CHM A;  3KY9 A;  2YS1 A;  2LOX A;  5L81 A;  1FAO A;  1U5E A;  4PNK A;  1V5U A;  4IAP A;  5C79 A;  5C6R A;  1DBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...