1ZM7A

Crystal structure of d. melanogaster deoxyribonucleoside kinase mutant n64d in complex with dttp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
197
structure length
197
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVDLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the changed substrate specificity of Drosophila melanogaster deoxyribonucleoside kinase mutant N64D.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Deoxynucleoside kinase
total genus 77
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2005-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zm7A00
1L2TA 1YRAA 1JAHA 2IYXA 1P75A 1T0JB 3PEYA 4US2R 1L7VC 3W8RA 1UDWA 4EPWA 2Q3MA 2CLSA 1R10A 2IEZA 2BJWA 4OK6A 4ZO4A 3TGPA 1KY3A 2QP9X 1XXHA 1LB1B 4IVQA 2YYZA 2PT7A 3SDZA 4W9MC 3IDQA 1MR3F 1R0XA 5KOYA 3CIOA 2HXYA 5AUQA 1R2QA 2LKCA 4G5QA 4OI4A 3C4JA 5CLQA 3B1WA 1M6NA 3SI7A 3TW4A 2FU5C 5DN6A 1N5LA 2ZRDA 2WHXA 1TU3A 2QTVB 5TARA 1W2HA 2I3BA 2MSDB 2QL6A 3CR7A 4JBWA 1JEEA 2W2VA 3FWYA 2IYZA 2F43B 2WKRA 2WWXA 3AGPA 3HYRA 3MG9A 1HQCA 4EQ6A 1S3SA 4DIDA 3EARA 5TY0A 3UIEA 2C8VA 1PUJA 3OEHD 4URZR 1Z2CA 5FTLA 1Q0UA 4TQAA 2HF9A 1XTQA 2A2ZA 2I4IA 2V6JA 3AVQA 3NC0C 4R9UC 1Z6AA 4RD3A 3W6OA 3TVDA 4LPSA 1XTRA 1UFQA 1MO3A 3A6PC 3LH5A 3CUEF 3RHFA 3SHFA 3FTQA 2GTPA 3LW7A 1DG1G 3VR1A 3D31A 3KXKA 121PA 3OFND 1G6HA 2WZQA 1E2IA 2DPXA 2F1JA 4HDQB 5KO2A 1PLKA 4XH9B 1CR2A 1E1QA 2PL3A 4QFMA 2WMOB 4XVUA 4PO9A 5C2JB 2A3RA 2Q0HA 1VHLA 2WWIA 1XZQA 3W5IA 2XZLA 1Q3TA 1Z83A 4DXAA 5DHFA 5FFMA 1ZUIA 2KE5A 1KKMA 2P6RA 5D3MA 3B5JA 1NN3A 1KSJA 4GFDA 1GILA 5F9HA 1I4TD 2ZRBA 4C0HA 2V9PA 4TMKA 5CITA 1MABA 3LAWA 1VECA 1VIAA 3U4QB 1E0JA 4FXPA 1EFTA 4GPTA 2VHCA 3LBNA 1KO8A 4HB3A 3TRFA 2GJ9A 3R9WA 3PUVA 3Q5EA 4JLVA 1FMLA 1I2DA 1XJQA 1Z63A 1KY2A 3TQCA 2XJ4A 4HZUA 2JLVA 2A30A 4P31A 3L0PA 5EE0A 4B35A 2OFXA 1XCPA 3TKLA 2MSCB 1W5SA 2EFCB 3VNUA 4MQBA 4J0QA 1TEVA 2BVNA 4HB2A 1VCMA 3T1QA 1A82A 4LJ7A 1IN7A 2ZJ8A 2P0EA 1PLJA 4TLEA 1NG9A 3BH0A 5FUVA 2WJIA 4DBLC 2HT1A 4OI0A 3LBHA 1TF7A 3EC2A 2O8EB 1F2UB 1XP8A 2RGXA 3NXSA 1G7SA 3X1YA 4DIEA 3R9IA 5KNCA 2C9OA 2VSXA 3WYFA 4TQUS 3F0TA 3FMPB 5CLLA 2GHIA 4CW7A 1OXUA 4DLZA 2HEIA 2WAYA 3UMSA 3VMFA 3X1WA 4Q47A 2RGGA 2OXRA 2ZU6A 4AC9A 2VP2A 1KSHA 4LHWA 5BXQC 1XEXA 2ODBA 5DI3A 4Q1DA 5EXSA 1Q20A 2Q9BA 2YC4C 1TUEA 3EASA 4AK9A 3G82C 1W0KA 1XF9A 4MRSA 2A5DA 4G1UC 2UVQA 1X86B 3KUCA 3NDPA 4PPNA 4B6FA 4DKXA 3ONWA 2TMKA 3REFA 1SXJB 2EYUA 2RHMA 1B23P 1E98A 3SBEA 3NH9A 4XWAA 4B3FX 4JMPA 1RJ9B 4FMCB 1XD8A 3MRSA 4IDOA 5TXGA 4ZDKA 5AUOB 3FVQA 2WAXA 4QBFA 1AKYA 2VBCA 5M04A 2BHRA 2JATA 3I4LA 4IVRA 5L3RA 1T4GA 3C5HA 3KKNA 2AD5A 1OPXA 1QVRA 2DBYA 4PQYA 2JLQA 3RRYA 4DSOA 1GIAA 5DYIA 3S1AB 4ZCMA 1G8GA 1OH6A 4IW3B 3CONA 5BN5A 4GRAA 1QHYA 2IS1A 4M1OA 3AUXA 4Q4AA 2O0HA 2B21A 1QHHA 4Q1CA 4RKEA 3ZVRA 1H8HA 5CJPA 1DAIA 3SJAA 3GPLA 1CF4A 5DLQC 4LYHA 4S35A 3IGFA 2Z43A 1IONA 4Z51A 1ZNWA 2BBSA 4M1KA 4WA7A 4C2UA 2GBLA 2FFBA 4Q7KA 4ZV4A 1KZGB 3IO3A 4PC7A 1SKYE 3BC1A 3RC3A 1SKQA 2X19A 2QE7A 1KO1A 1NMZA 3RANA 3TBKA 1D2NA 3GFTA 4EFNA 3AV0B 1DADA 3RS0A 3UPUA 5FL3A 2HCJB 5UKDA 1RRFA 3K53A 4HLQB 4YQFA 1EXMA 3TSWA 1COWA 4ARZA 4PPFA 1GTVA 2CNWA 5HTKA 3VR4A 1J7KA 1N6IA 3RABA 1KI9A 4LHXA 1G3UA 1ONBA 2FSHA 2IHYA 1XEWX 4LUCA 4AURA 1NP6A 2IUTA 1Y63A 5DISB 3T15A 5FBRB 3CR8A 2W6ID 4UXHA 5H8WA 1II8B 3P27A 1GVNB 4OHXA 4II7A 2QQ0A 3THYA 2H8KA 3DL0A 3LA6A 2ANCA 2CL6X 1GSIA 2OG2A 3Q8XB 2JJ2D 4TLBA 1GNRA 4QJ4A 5EXTA 4HLUC 1BYIA 1BMFA 4NYJQ 1U90A 4C4PA 4BGDA 4V0KA 3QNUA 1E94E 4PC2A 4RD1A 5KUTA 4EPTA 2FEOA 4BFYA 1KK3A 5J5CA 2ECKA 4OJKA 3AKDA 5JS7A 1MRSA 2DY1A 2ZJ2A 4OK3A 1XTSA 3QXSA 3U7FB 1H8HD 3SEAA 4BLRA 4B71A 2QGNA 3ZIAA 2AX4A 4LOAA 1XD2B 3LDAA 4Q9LA 1UKYA 3UWKA 3N2EA 3NEJA 3VR3A 421PA 3KQLA 1SHZA 3ZYCA 2IYLD 1NN1A 4QBHA 1SGWA 3SJZA 4F7WA 1KNQA 2R44A 3GJ6A 2G6BA 1AS0A 1XBTA 2BMDA 4DDVA 1OFTA 3RS5A 2IYVA 5KDOA 2O8CA 1DEKA 3NBXX 1MKYA 1OHHA 2IA5A 1E99A 4MKGA 4ASUD 3CZQA 2QGZA 2ZRFA 2KI5A 2VSOA 3ZVLA 2HJGA 1KO4A 3ECCA 2G83A 3BB1A 2KSQA 1JAIA 4LBZA 2W0SA 2JJ1D 5EP1A 4MRNA 1ZUHA 2CVHA 4CEHB 2CDNA 5FL7A 3DMDA 3RWMB 5C4MA 1W0KD 3LFUA 4M1TA 2OZEA 2EU8A 3K0FA 1S0UA 3PUZA 4YDHB 3AUYA 1N25A 3UK6A 2IEYA 1GP2A 2WJYA 4A6PA 4DB2A 2GEVA 2V7QA 1N2CE 4KBFA 4Q4LA 4F38A 4QHSA 3W3ZB 4R98A 4JIMA 1VIYA 2ZSEA 3KJHA 1U2RA 3HWSA 4U02A 3LWNA 1XMIA 3GLHE 1Q44A 3TSOA 1R0YA 2GDJA 4KI0A 4Q7MB 4QBIA 2PZEA 4PPGA 1YZTA 3LQRA 4LJAA 4IOLA 4Q4HB 4BFWA 1UM8A 4CRWB 3PUYA 2H17A 1GL9B 1QG2A 2FZLA 5KDDA 2ZJAA 1F5NA 1UEIA 3QF4B 4NP6A 3LVRE 2WKPA 3BERA 4L5BA 4XSGA 3B7GA 2HLDA 4JBXA 1JB1A 4C0QC 3A1WA 4E09A 2YHSA 3U3KA 1L4YA 2BM1A 2D7CA 3NH6A 1XNJA 1XB2A 1YZLA 3AF4A 2RGNA 4IOKA 4LC0A 4CDGA 5K8UA 4RFVA 2ATXA 1TQDA 2F7SA 2PT5A 1X1SA 1ANKA 2IT1A 3R8CA 5F2EA 2XOKA 4XOIA 2SHKA 4B74A 3RRNA 2JAQA 2R6AA 5DGXA 3CO5A 1E1RA 1E4YA 3QPUA 2IWHA 4EKDA 1CLUA 3Q3JB 4E03A 5CDFE 5KU1A 4DLVA 4KFUA 1HT2E 2OCAA 1E9BA 5JSZB 3J81k 2IK8A 2O52A 2R6DA 3DPUA 4Q1AA 3AH8A 4JLKA 1GM5A 2PEZA 1GRQA 4P4TA 1VMAA 4TL8A 4FCVA 4NCNA 3I3SR 4F4CA 3RS3A 1W49A 5FOTA 4HEJA 3MMPA 4GOKA 1ZP6A 5JMTA 2VIIA 2BC9A 4OI1A 2JJ8A 2GZHA 3BE4A 2XZOA 2ZI5A 2QMHA 2WWFA 3BIFA 3KZ1E 4PR0A 1MO5A 2GEDA 3BBPA 3T34A 4Q66C 4F4IA 1GNPA 1ZD9A 3AKYA 1NMXA 4UNQA 4ACAA 4LBWA 2PJRA 1Z07A 1SVIA 4L9SA 1W0JD 2AN9A 4LRWA 5L8VA 2V4ZA 4RZUA 1ZNYA 2QM8A 1F2TB 1OIVA 2QY9A 1U94A 4B44A 1SVKA 2GXUA 2QMEA 1N6PA 2GK6A 4KITB 3A58B 3FHCB 2IUSA 3OEHA 2A9KA 2WVJA 4Q4JA 3T5DA 2F43A 3H2YA 3CF0A 4A4DA 1KI4A 1SVLA 2PH1A 2KWIA 4IRUB 4RJLA 1AZTA 2W2TA 4V0ME 4PAQA 3TSZA 2YV5A 2IS4A 2IF2A 1D2EA 3TNFA 2V8OA 3KB1A 2ZI3A 1RYHA 3KUDA 4MUBA 4TTPA 4DUGD 3Q5DA 2IXFA 4YXWD 4WZBE 3DM5A 4HAVA 1CJUC 6Q21A 5HKKD 1P2TA 3PEUA 4LSGA 4TMXA 3ZGXA 3KTAB 2CCKA 4LBVA 3RSOA 1XXHB 1N6HA 3AF2A 4AYXA 1HTWA 1TL7C 1XEWY 3EIHA 3CRRA 1Z2AA 2XSZA 3QEJA 2HYIC 1ZCAA 5EUQB 1U8YA 4ZCLA 1IXZA 4BLTA 4TSFD 3FMOB 1W48A 3VR5A 2F1IA 1BMFD 1Z5ZA 3CX7A 5FTNA 5TVKA 3CWZA 3FHOA 3AGQA 3L0OA 2ZJ5A 1KI6A 4RFSA 4TWZA 3DKVA 5A4JA 2ZU0C 1F60A 4UNPA 3QUSA 3LRPA 2I1VB 1KI3A 2QG6A 4PSAA 1UEJA 3B78A 3CNNA 5FI0B 3N2IA 4PHTA 5LBIA 3WXMA 2JJ1A 1G64A 1ZM4A 3MJRA 4BUJA 5J4KA 2G0TA 2JIZD 3KX2A 1UBGA 4TSFA 5BW8A 2JLYA 1TAGA 1CRQA 2IL1A 4B2LA 4P3YA 2GETA 3ZS9A 4NCIA 3QI2A 3K9NA 3JVVA 2FPKA 4GP7A 5DYGA 3LY5A 4DLRA 1Z3IX 4D81A 5CJ2A 4B34A 5B58C 2PJZA 1Z22A 1QZXA 1M74A 3CZPA 1LS1A 4BZXA 3GJ5A 3BGWA 3THWB 2ZJOA 4M9XA 1XXHE 1AQUA 1FFHA 4GMDA 2PMDA 2HCBA 2QUZA 3B1VA 3CW2A 3SYKA 1P9NA 1XPOA 3AM1A 4W5JA 3HU2A 3RRZA 1E9AA 4DLTA 3MWYW 2G0NA 2GCNA 4A8JA 4DLYA 3FGNA 3FHTA 1ZAKA 3LD9A 3VKWA 3HYTA 4Q01A 4UQOA 4A92A 3N5CA 5CDFA 5B64A 2GF0A 4NHOA 1ZU5A 1GKUB 3DMNA 2QAGB 2ZI4A 1EWQA 2VTKA 3T5GA 3DO6A 2ZS8A 4LY6A 4PZLA 1UF9A 5G3YA 4N0DA 3K70C 2IS6A 3DEFA 4TZ6A 1FQJA 2VLIA 5JJKA 3KKOA 5JSZA 3LBIA 3B8HA 1WDTA 1X6VA 2EVWX 3EWSA 2BKEA 1Z47A 1TUIA 1XDBA 1NVXQ 1CRPA 1UKEA 5CB8A 3B9PA 3H1TA 2GXQA 2DR3A 3AVYA 1Q57A 1Z0JA 1XRJA 4L8GA 4BRUA 3D8BA 2NO0A 3ASZA 4MKHA 4BFUA 2V3CC 2XNDD 3A36A 3K9HA 3OIWA 2F3RA 1NIJA 5EP2A 4HAUA 1P3JA 4V0MA 3ZDQA 3KQKA 4IFBA 2XAUA 3ICEA 1OFIA 1ZIPA 2CNWD 1KK2A 4NL4H 4EIWA 3IPXA 4B6EA 3K70D 3WRYC 4JKYA 4U00A 1US8A 2CE7A 4F92B 1Q1BA 3WYGA 2VYFA 3WYAA 2AKYA 1WCV1 1H8ED 4OKSA 5KNBA 2FA9A 3CNLA 1G7RA 1AS3A 2IYRA 3ZVNA 4XD7D 4B76A 1K5DA 5LB2A 5EZ5A 1PUIA 1T8TA 2YWGA 1KDOA 2C03A 1DS6A 3WMFA 1HY3A 4V0NA 1EG7A 2YJTD 2ZVPX 821PA 2JEOA 1GFIA 2YWFA 2ZRIA 4UNSA 2ZM5A 4HUTA 2AD1A 4FWTA 3GLIB 1CXZA 3GLGB 3FFAA 4HB4A 1GWNA 1IN6A 4LWZA 4QJ3A 5GVSA 3PXGA 4LYFA 5DN6D 3THXA 1ODFA 4DJTA 2OXCA 3AVUA 2BIFA 2WIAA 3L0IB 1R0WA 4OQXA 1SXJD 4IHQA 4OQNA 2JASA 2XGJA 4BZPA 2QP4A 1G17A 3QKRA 4Q00A 4DSUA 4CEHA 3TAUA 2H92A 2F6RA 4DCSA 3CX6A 1UBFA 4RY2A 2RGBA 4E22A 2ZSFA 3E1SA 4FMBB 3DDCA 4TYYA 3V4RA 4UJ3A 2HXSA 2NG1A 3EW9A 2HV8A 3C41J 3K0AB 1YR8A 1G3MA 1ZM7A 5L3VA 4ON9A 4R2IA 5J4HA 1X8KA 2P3SA 3UXMA 1E2JA 1U9IC 2KBEA 4DCUA 3MAAC 3QKSB 3EAQA 5LPNA 2FSGA 1KK0A 3LNCA 2GNOA 2FG5A 1N5IA 2QA5A 1W2GA 1G7TA 4URXR 4CT5A 3I5YA 1GL6A 1AM4D 2PX3A 4RZ2A 4C0BA 2CL0X 3FMFA 2ZE5A 2QMUA 3RDPA 3SFVA 4WW0A 3WMEA 4DVGA 3SYNA 2YOHA 2DFTA 3HR7A 3QXJA 3K1JA 3CPJB 4HYYA 4HDOB 3D3QA 1E79A 4TL9A 4NH0A 3QPVA 1OV4A 3TR5A 1J8YF 4PXAA 2GCOB 3WP1B 2VPPA 4Q9HA 4TQ9A 2R6CA 3ZH9B 4DEXA 2HDNB 5JECA 1DBSA 3CPHA 3UANA 1G8PA 1LY1A 4Q4AB 3ZIAD 4D2IA 4R71A 2ZRAA 4G5SA 5KNDA 1ZRHA 2WOJA 4B2IA 2ZRPA 4EPRA 1N6NA 1OYYA 4D4JA 2WV9A 2ZYUX 1NLYA 2MSEB 2FMXA 1WQ1R 2QROA 3EXAA 4Q18A 2AFIE 3TR0A 5GADl 4A82A 4LV8B 3IEVA 2BMJA 3VQTA 1GDDA 1KK1A 3VFDA 2WJHA 1FNMA 4P32A 4DCVA 5C4GB 1KOFA 4IOMA 1IAQA 2OESA 4JLBA 2G9NA 3RNLA 2XSZD 3RS2A 4A2WA 1ZBDA 3PCRB 2ZRKA 2Q9AA 5JLJA 3FKQA 5KPDA 2GAAA 1KJZA 1FMJA 1OXSC 1OIWA 1YKSA 1A7JA 2WBLC 2ZRLA 521PA 4NYMQ 2CJWB 3GD7A 5HR5A 1DELA 1OKKA 2OAQ1 3FOZA 2VP6A 1S9HA 1S2MA 2EFDB 3AEZA 1E2PA 1E2NA 4O3MA 3N70A 1E69A 1DAHA 4B3DA 4DB4A 2AK3A 2IXEA 1AS2A 4PFSA 4M22A 3Q9LA 4DSNA 4JT4A 2AXPA 3AP3A 5JJIA 1TNDA 4LDJA 3AKCA 4PPQA 1R8SA 1NLFA 2C9CA 4CVNA 2Z5FA 3BB3A 5LD2C 3OIYA 1G8HA 2QPAA 1G3QA 1KGDA 4BECA 1XJCA 4TMWA 4H1UA 4XTCS 2B8WA 2ZI6A 2JDIA 1NVWQ 2QU8A 3I32A 2CCGA 1TQ6A 3L0SA 1IOZA 1RRPA 2ZTSA 4DRZA 1LW7A 1JJVA 4I1OA 3MFYA 1ZVQA 2CLDX 4TL7A 4U5XA 1EFHA 1TADA 3B1YA 1HE1C 3AQ4A 5AK0A 3KL4A 3RWOA 2WTUA 3F5FA 2C2HA 2ZQ5A 3AF1A 2D74A 4BFZA 1Z0KA 2WJGA 3ZLJA 1K6MA 2QSYA 4OK5A 3RS7A 4C0AC 2ZR0A 4HAWA 4I99A 2DFLA 2ZS9A 2VP4A 1FP7A 5EXXA 5L3QB 2YWEA 5IK2D 3A8TA 1I4DD 1BKDR 4QGGA 4PTLA 3K0CA 2Z6VA 5LB4A 1W4BA 1EESA 4E07A 1R7RA 1HQYE 5SZIA 1SVOA 2ZYTX 4JJZA 5DHAA 4JL8A 2IYSA 5FOUA 2OBLA 4Q9IA 4QL3A 2ZJZA 5G53C 2IHBA 4EFLA 1IN4A 1KIMA 3AF3A 3TVTA 5J40A 2C04A 4M9QA 3SJBA 4MRVA 3OFNA 2WKQA 5CIQA 4PHFA 4EAQA 4IEEA 3OIVA 1FUUA 1T3LA 3SE0A 4BFTA 3ADBA 5JEEA 3L2OB 5KSZA 2YKGA 4HI0E 2AXNA 1PV4A 2EWVA 2E87A 1WBBA 1CP2A 2H7VA 4EPXA 4BZQA 5AJWA 3I92A 4JLNA 2H18A 3BH7A 4KCGA 2ONJA 1M1YE 5J4LA 3U5ZB 3Q85A 4XTRA 2O8EA 1MABB 4KLNA 1N0UA 3SOPA 3THYB 2OFWA 3TUIC 1M2OB 4BLPA 3V4FA 1Z29A 3ADKA 1FOEB 3NG1A 4JJKA 4URYR 3LO5A 1JR3A 3LX8A 4KODA 4KFTA 4IFEA 1G20E 3EPHA 3P20A 1NSFA 1LFDB 3T61A 1OT3A 3B2EA 2GCOA 4G5OA 1GOTA 4LC1A 1NJGA 2ORVA 3KQUA 5JS8A 1VCIA 1VKJA 3IIKA 1TU4A 1E9DA 2VHTA 4E5UA 4JYBA 4N3NA 1GZSA 3WP0A 5C46F 2Z4RA 4ABYA 1ZD1A 1NVVR 2P5TB 2HF8A 3V00A 4NPHA 3ZZUA 3EIEA 4X8LA 3K09C 2ZITA 2ZANA 4HATA 1ZM2A 1ZC4A 4ZDIA 1E9SA 2GJ8A 4YONB 4CEJB 1KI1A 1KDPA 2NPFA 1R5OA 3O8BA 3O8RA 5F98A 1NVUQ 4M9SA 3LVQE 2A7QA 3W3AA 5A0FA 1IJFA 1YE8A 2XZPA 4NYIQ 1Z6XA 3Q72A 3D7MA 4GP6A 3IIJA 4NBSA 2RGEA 5JZVA 3QSYA 1UJ2A 2P2LA 1QHHB 2J46A 4B75A 4G0NA 3K0AA 1VPLA 3PQCA 5DNYB 4ZDWA 4AKHA 3THOA 1SXJA 1IY2A 1IBRA 2P6NA 2QENA 2N46A 3W90A 1NSTA 3QEOA 3OE7A 2NQ2C 1Q1QA 3BWDD 1GUAA 2P5SA 3EA5A 3GLFB 5C1BA 2FFQA 2ZRGA 4NYIR 3QXXA 4AG5A 5FPSA 4Z8YA 1JXMA 2E9SA 3BJIC 1Z08A 2B92A 3WBJA 2CXXA 2D2FA 3DVLA 2XNDA 2EW1A 4NYJR 1WF3A 3O8CA 1E3MA 1N0VC 5C18A 4QOSA 5HPYB 5CYPA 1V43A 3KQHA 3GLGA 4CT4B 3WRXC 5J4VA 4US1R 2FN4A 2RCNA 1HH4A 3CF6R 4TYNA 1RW4A 1T5IA 2R6FA 1IJEA 4LX0A 4Q9JA 3LLMA 5HE8A 1KTVA 5FBWB 1NN5A 3T35A 1JR6A 5DI9A 1W0JA 4KFRA 2AWNA 1AQYA 1ZNXA 3SN6A 3FE2A 2A5JA 3L82B 4A1FA 1VG9B 4JBYA 1YVDA 4Y0AA 4EJSB 1YR7A 4PQRA 3MGCA 4FINA 4B48A 2PLFA 5BWMA 4RD2A 1PVOA 1R0ZA 3UMRA 1CU1A 2N1BA 5IDVA 3G0HA 2OLKA 4PO8A 2EYQA 3QBVA 2RMKA 4JYCA 2FEMA 2JA1A 3EWAA 4QGHA 1S1CA 4P4SB 4HZUB 2ZRNA 4GT1A 3OEED 3ASYA 1YHNA 5FOVA 3IHLA 2J45A 1JPJA 2FX3A 3QVUA 3I73A 1ZINA 4A2PA 3HU1A 2L0XA 1G6OA 1CJVC 4FIDA 1JI0A 4QXAA 4OHVA 1HEIA 4FN5A 5FOXA 2AHOA 1U9IA 3TE6A 3QKUA 4O2RA 2ODWA 5JCZA 2ZSBA 4UJ5A 4LHVA 1ZUNB 1D6JA 2Q21A 3VKGA 3K0SA 3QY0A 1JQLB 2ORWA 3ZVMA 4C30A 1US8B 4LV5B 3B9QA 4NU0A 3SNHA 1XD9A 5CYOA 2WWHA 1ESNA 3RSLA 2V1UA 1M34E 1KDRA 1ZYUA 1LTQA 3MWKA 4RD6A 3BRWD 4EUNA 3NBZC 4B3XA 2ZUDA 4R2HA 1P73A 1HUQA 2OT3B 2DWQA 3P32A 2EWWA 1KI7A 2QM7A 4TTRA 3Q7PA 2NGRA 1FW6A 4OJQA 1AGPA 1WBDA 1SVMA 4HLDA 3MD0A 1E1QD 1E96A 3IEUA 3OIUA 2K5UA 4G3XA 4KU4A 2ONKA 4TYPA 4C0JA 1EWRA 4DEYA 4DWJA 3U4QA 2CVFA 1R5NA 1G18A 2Y8EA 3IQWA 2J7PA 3B13B 3NEYA 4QM7A 1T91A 2REBA 1SQ5A 1QRAA 3QKSA 4HDCA 1S1MA 1Y3AA 1E2GA 3QXCA 1R5BA 4CEIA 4YMVA 2ZJYA 3H84A 4W5HA 5IHPA 3EZFA 3L8YA 1SXJC 3ND9A 3KKMA 1Z0IA 3B1XA 4UXJA 4QG7A 2AKAB 3TIFA 4GOJA 1WE2A 2VH5R 1G19A 1AKEA 1JXOA 1FL9A 1OH8A 4DT1B 1NMYA 1XEFA 2R8RA 4WIAA 3ADCA 1ZM9A 1IXSB 1T3SA 4K8OA 3F3YA 1MOZA 4TTQA 1E9RA 4NCJA 2ZRHA 1DAEA 2WPDD 3PEVA 1Z28A 1OF1A 5LD2B 3OE7D 4X8OA 1I4LD 2WJVA 4JLJA 2F55A 4ZPXA 4URWR 4XWOA 4D26A 3CWQA 4XVQA 4JL6A 2A5GA 2IYQA 3CB4A 3IBYA 3T1VA 4ZKEA 1KI2A 4FWIB 1Q22A 4B2PA 4ZI3A 2G1KA 2PZFA 5HZHA 2VP0A 3X1XA 1E4VA 4A0RA 3GLGE 2XXAB 1COWD 2O8FA 2EQBA 4YDSA 3KKPA 2FGJA 1G4AE 4TT3D 1GL7A 4AYWA 5FPHA 4HSEA 1RE0A 3A4LA 4KAXA 3WMGA 1X3SA 4Q9KA 5E95A 3QKRB 5H68A 2J0UA 4FW9A 4FD2A 1GITA 3EPKA 2XXAA 3QENA 1KO7A 1CS4C 1IXRC 1E0KA 2BKUA 1VHTA 4UNRA 4AKEA 3NBFA 2GVDC 3X1DA 2IC5A 2WMNB 4D4LA 2PCJA 1EFCA 2RB4A 1W7AA 3BXZA 1FNNA 2IYYA 1D2MA 5FPKA 2FPMA 1KI8A 3L8ZA 2IW3A 3NHBA 4Q7JB 5TB5A 4C9BA 3C7KA 5JI2E 3H86A 1XTJA 1VYVA 1E9CA 5GJBA 4YLGA 1RRGA 1NG1A 4MUAA 1LVGA 1W47A 4DT1A 3TLXA 1JEDA 4XIGS 2B7CA 1E0AA 2FF7A 2GAOA 5BQ5A 2ZYWX 1CIPA 2DB3A 1YZUA 3KKQA 3NWJA 4RZXA 1RFLA 2R6GA 3MSXA 2GZDA 4G5RA 4NYMR 5GJVC 1DAKA 2ZUCA 2BEKA 4LJYA 4BASA 3T1TA 1ZNZA 3U3JA 4UXIA 4CEIB 5IRCD 1JPNA 2RGAA 1AIPA 5EP4A 4JVSB 4D25A 1ELOA 4PANA 1P2VA 3RS4A 3EA0A 4KBGA 2WSSA 3CRMA 2ZXUA 1NBMD 3CBQA 3FFBA 1DE0A 1SXJE 4IEIA 2E1RA 1U81A 3LXRA 4ZDJA 1S96A 3A1SA 3U6BA 2HYDA 2NMVA 1MO4A 4BFVA 2JLWA 3VNVA 1M7GA 5FH9A 3FDIA 2ZAMA 1EX7A 2FE4A 5A5GA 1T6NA 3CRW1 4MGIR 4F91B 5KTYA 3W8NA 1VG1A 2O8BB 1XU4A 4UNNA 2WICA 4XD7A 2ZRMA 3BFKA 3U3MA 3IILA 3VHLB 1AZSC 1C4OA 3OAAA 1NJFA 2RGCA 4LJ5A 3SC3A 1CBUA 2QPTA 3GEHA 5HKKA 2VF7A 5AJXA 4BFSA 3VAAA 2A5FA 2NOAA 2PMKA 2J7PD 4PC6A 3ZD7A 3GLIA 5FI1B 1NY6A 4XSHA 1XMSA 3BS4A 4A6XA 1D8TA 2ZSAA 3ZZ0A 4LJ9A 4Q03A 5SZHB 3LW8A 3R7WB 4Q4HA 5JRZA 2GEUA 3NC1C 1JBKA 1HYQA 3U3RA 3GJ7A 5G41A 4OQLA 2BMEA 3OF5A 4RFSB 3DM9B 4ILEA 3BH6A 4Q48A 3THWA 1YR9A 1E6CA 2O8BA 1RVDA 2ODNA 1G5RA 2ZS7A 4MKFA 3DKPA 5E7JA 3W34A 1UBCA 5FOSA 3NKVA 2AR7A 4ESVA 3HU3A 4TMZA 4WXPA 1A2BA 3U44A 4A36A 2JCSA 1OFUX 5ANRB 3E2IA 5F3WB 1OE0A 1D5CA 3GLFE 4BE7B 3NHAA 1YZNA 5CIWA 4TN1A 4LJ8A 4US0R 1U98A 2D2EA 3FB4A 1QHXA 3I61A 2IXGA 1DAFA 3MCAA 4QRHA 5AJVB 4WBSA 4D6PA 4NMMA 2DCUA 2ZETA 2EFGA 1G9XA 4Y0VA 1G8YA 2W58A 4V0LA 2Z83A 1SKYB 2ZREA 2AWOA 4LBYA 4RZ3A 1XX6A 4GMXA 4CZ2A 4AD8A 3K0EA 4ZI2A 3GJ3A 3QG5A 4OI2A 1F2TA 1VYTA 1D9XA 2JLRA 3CNOA 1Z6YA 1WRBA 1W4AA 2GXSA 4KXFB 3NVAA 1QG4A 4OHZA 4O25A 4DDWA 1V5WA 3MJHA 3EPJA 2FDCA 2P67A 2W0MA 3GMTA 2CL7X 1E9FA 1FZQA 1KI6B 2QEQA 4EJSC 2R2AA 2J0UB 4M1SA 4O2LA 721PA 2FFHA 2YC2C 5E7IA 2D7DA 5EE9A 2H1LA 1F6BA 1CKEA 4TMTA 2NPIA 2OSBA 1N5JA 3C5CA 4DLSA 4V0OA 4KHZA 1P9RA 2X2EA 3KB2A 4Q21A 3IQXA 1BO6A 2ZPTX 3KTAA 4FMDB 5KSYA 3UMFA 2BEJA 3SQWA 2F1RA 1Z0DA 2GJAA 4HUQA 4UKDA 5AR1A 1Z6TA 1JR3D 1GAJA 1XTKA 1NKTA 1DVRA 4ZIRA 1TPZA 4OHYA 1E79D 2D06A 1G8FA 1IN5A 3ZD6A 4M2LA 2RH5A 4KFSA 2O8FB 2J7KA 2IS2A 1DO0A 1GRNA 2DHRA 3KFVA 4OQFA 4P33A 3TUJC 2ZE6A 2JLSA 3KXIA 1ZCBA 4FI3C 4GBMA 4ITRC 5P21A 3I1FA 3EG5A 1H65A 4QGAA 3BORA 3CH5A 1JQJC 3P1JA 3MLEA 1W36B 1G5PA 1ZU4A 2VO1A 2VA8A 2C9YA 1BH2A 3UKDA 4GZLA 2DWOA 4QBGB 3K70B 1HE8B 1OHHD 3OEEA 4I4LA 1P7CA 2FSIA 4NCKA 3U7EB 3IPYA 1N6RA 5GJWC 1OFHA 2H5EA 2GJKA 1R4AA 4O0MA 3L43A 5KHOC 1A4RA 2B7BA 3WNDA 1VCNA 4C0LA 4CYMA 1U0JA 3K0CC 2FFAA 2WOOA 4RCZA 3K8YA 1NRJB 2LCFA 1N6KA 2BM0A 1D9ZA 5K8LA 2BMFA 221PA 5JWHA 4DZZA 4LJ6A 1DOAA 2XITA 1W36C 3SS8A 2KBFA 2BCGY 4QC2A 1EGAA 1JNYA 1SZPA 2CMKA 3LQQA 3GQBA 3U61B 3A4NA 1YJ5A 2BOVA 4QHYA 2W6JD 3HP1A 1XWIA 3M1IA 4LZZA 1QBKC 1P4SA 2IF0A 2WWGA 4RSGA 4MDFA 4QHTA 3JVUA 2XTZA 1GG2A 4JKIA 2J3EA 2PLRA 3GLHA 1GRRA 3GP8A 2C96A 2R9VA 5JHHB 4AWXA 3ZS8A 4ZKDA 2X77A 5AJZA 1XCGB 4M9ZA 4B43A 2CCJA 1DO2A 4AG6A 1VDZA 5BN3A 5TMPA 1KNXA 2BJVA 4MGYR 3UWOA 2WWYA 2J0SA 4PC3A 2QT0A 1J8MF 2QQEA 1MO6A 3C8UA 4L16A 2PZGA 1W44A 3U6KA 2VP9A 1QDEA 2FH5B 1F3OA 4LYAA 1P62B 2O0JA 5K8TA 1RIFA 4JS0A 4TYWA 1TX4B 4Z54A 4P4UA 4YMTA 4URUR 1BYUA 1UDXA 2VSFA 1TMKA 2VP5A 4M21A 3ZZTA 2GZAA 4M1YA 3BB4A 2OCYC 1M8PA 2FOLA 5FBLB 3QF7A 2XB4A 3GJ4A 4MGZR 1S9DA 1KKLA 4LYJA 4ASUA 2ODEA 2J41A 4ACBA 4IJMA 4B32A 4EJSA 1DAGA 2FWRA 5DIFA 5HE9A 3CRQA 3X2SA 2V54A 4A9AA 4AIIA 2J0QA 3VKHA 2D62A 3I5XA 5L3SA 3KXLA 5ELXA 5FUYA 2WSMA 1A2KC 1S8FA 3DOFA 1N0WA 4PC1A 3WHKA 2WIBA 3PVSA 2CE2X 2XX3A 1O87A 1NF3A 1P72A 3B60A 3EIQA 2DWPA 4BFXA 1QHIA 3PJRA 1EFUA 1T3HA 3M4YA 4PQFA 5DH9A 4GDFA 1UPTA 2CK3A 5GJCA 3NDBB 1RJ9A 4M53A 2OILA 2H57A 4K46A 5FR1A 4TZ0A 4M0LA 3IO5A 4B33A 4KVGA 4TMVA 2QRNA 4URVR 3TJZA 2CEAA 2VRWA 3WHLA 4CEJA 4JLOA 3A1UA 1FP6A 4NTZA 5G40A 2ZROA 3T12A 2KJQA 5FOWA 1XD2A 4D0GA 1F48A 4DLWA 1YZGA 2RAPA 3W6NA 4B73A 3NIBA 4I1SA 2Q3HA 4AKIA 4JVMA 5FBVB 1NL3A 1NNEA 1VYUA 3BAFA 2J5XA 3I8SA 1CR0A 1WA5A 3KJEA 1GKYA 2A5YB 5TDHA 2XNSA 4BWYA 3U7GA 2EFHB 4IVPA 1UADA 1CR1A 2QP3A 4BPBA 1S3GA 3U60B 1OB2A 4IDHA 1LV7A 4RCYA 1XMVA 2WM9B 2C77A 3CH4B 3WY9A 2W2XA 1GNQA 5FUXA 1CEEA 4HAYA 4DLXA 4B3BA 2ZR7A 5EQTA 3RVBA 2JLUA 4Z8XA 3M6AA 2PX0A 8OHMA 4EPVA 1Q21A 1SVSA 3GLFA 3FKSA 1MRNA 1UKVY 2C5LA 2ZI9A 1CJKC 1RKBA 5GVRA 1E32A 4PZYA 4W5WA 4B3GA 1LNZA 4PSVA 1II8A 3CLVA 4D82A 5FBQB 4MITA 2OE2A 3B85A 1OKKD 5D3MB 3VU9B 2I1QA 1Z06A 4CGZA 1IY1A 2JLZA 3MWLA 1YZKA 4CIDA 4DC9A 4EPYA 4MYTA 4ARZB 1ZM3A 5D3QA 4YMUA 3OAAD 4L9WA 3VTKA 2X8AA 4BLSA 1NBMA 1E9EA 4R7ZA 5FPYA 4DUGA 4IDQA 4IDPA 5FPTA 1B0UA 1CJMA 4MRPA 1OB5A 1T5LA 3WNCA 4GOXA 1ESMA 3KDSE 1CR4A 1C1YA 2ERXA 4JSTA 3WNBA 3VR6A 2GXAA 1QHGA 5EE1A 3QVVA 5E4FA 2BBTA 2BBOA 2F3TA 1P2SA 2NO9A 2ERYA 4RD4A 4W7SA 1TQ2A 2NZ8A 5L3QA 2IYUA 2D3WA 3AVXA 1XZPA 1XCMA 4D0LB 1W36D 3NTUA 1IHUA 2NO1A 3LLUA 4IXNA 4QGFA 5CK5A 4BEBA 4A2QA 4EQ6B 5J4YA 3GEEA 4C7OB 5EP3A 5JWRA 2BWJA 3AVOA 4XJXA 1HURA 2XJ9A 1N5KA 4MRRA 4DCNA 3C15C 2ZEJA 3UATA 2ORIA 2A78A 1KAOA 3GJ8A 2NIPA 2QORA 4PX9A 2R65A 1E2DA 3TW8B 2IYTA 4B3CA 1N6LA 1QF9A 2VL7A 1XEXB 4WXRA 5DI3B 3SZRA 4M4SA 1C9KA 3B82A 3WBKA 3F8TA 1TTTA 1WB9A 4L4UA 2QZ4A 3MWJA 3REGA 2ZI7A 4LV6A 4XWKA 1AA9A 4A0FA 3R9XA 5IK2A 1DTSA 4AI6A 3S1AA 1P6XA 2P6UA 3U7HB 1RZ3A 1OSNA 2CLCX 4JVNA 4KO8A 3DOEA 2ZE7A 1JALA 2BV3A 3JZAA 5DSZA 5SZKB 1G3RA 3LV8A 3OZXA 2IWRA 4M8NE 2CHQA 4KYUA 1NKSA 1F2UA 3P4YA 2QNRA 3FMIA 3GFPA 2Q3FA 4A0GA 3JZMA 2AK2A 2QTHA 1N6OA 3K09A 4HAZA 1S4QA 5JJLA 5AWFC 3W6PA 1VG0B 2W00A 1G41A 4TLDA 4V02A 2Q6TA 1NLZA 1T0HB 5CK4A 4DSTA 5B30A 5JCPA 3VR2A 5BN4A 5EJEA 1VG8A 1IY0A 4MDEA 2FSFA 1EFRA 1G291 1W5TA 4PHGA 2G3YA 2PBRA 2YOFA 1OXVA 3CF2A 3R20A 2OEPA 1OW3B 2LWIA 1NVVQ 5DE3A 3I72A 3R8FA 5L3SB 1KMQA 3A4MA 2QAJA 4FCTA 5DO9A 4TL6A 2ZAOA 1JECA 1KJWA 2X2FA 4JVLA 1U0LA 5H70A 2J1LA 1O3YA 1FQKA 4C7OA 1Q12A 1YR6A 4C0SA 2YZ2A 2YINC 1G16A 3DZDA 3KQNA 4LPKA 4ERNA 1G21E 1II0A 3I62A 3O47A 2NZJA 2XEXA 3GJXC 3KJIA 2Z0MA 4A15A 2V7QD 2REXB 1EK0A 2ZUBA 3V9PA 2XTNA 1XJ0A 1ZMXA 4KSCA 1R6BX 3B6EA 4Q1BA 3K9GA 1M7HA 4BRWA 1II9A 3QPWA 3SU8A 4XVRA 1AN0A 2IYWA 4Q02A 4TT3A 2MMCA 4DHEA 1FPMA 3ZQJA 1EX6A 3ZQ6A 4D4KA 3IKJA 3QXHA 3DZ8A 2VQSA 4G01B 3CX8A 3FKSD 2HLDD 2OUKA 3SJCA 1RPZA 4WVFA 1E2HA 1QHNA 1AJEA 3EX7C 1W46A 2V55B 3SFZA 2ANBA 2RHDA 5BYJA 1N3BA 1OJLA 4FMDF 4Q1FA 4Z1MA 2FV8A 3RRMA 2WWWA 3VU9A 1G1MA 4DDTA 4C0KA 3KJGA 1E2EA 1ZC3A 4JLPA 1OIXA 1KSGA 2XB2A 3AVVA 3TAHA 2VEDA 2YNMA 4PAMA 4PHHA 2UZ3A 2GILA 4JLDA 4EDHA 4WAUA 4RVCA 4DDUA 2V1XA 3QBTA 2ZSDA 4HLCA 1DAMA 5H1YA 2C78A 4LCBA 3PITA 4MYHA 5B2ZA 3CM0A 5FL7D 4YMWA 2KB0A 1RYFA 1E2LA 2NO7A 4QNRA 3W9YA 4OBEA 1TF5A 1YRBA 2CK3D 2PEYA 4X8MA 3UG7A 1Q3HA 4JT2A 1YU9A 5AUNB 3LX5A 3Q7QA 3ND8A 2RGNC 2OLJA 4POAA 2JIZA 1P2UA 3GJ0A 5FR2A 4QKQA 1YZQA 2JDID 4NZYA 3NBYC 5E3HA 4LJ4A 1VCOA 4N1AA 4LI0A 1Q1EA 1PJRA 1BS1A 1TF2A 2O8DA 2YWHA 2O0KA 3THXB 1LF0A 4OYHA 1CULC 1CJTC 3ICQB 2ZRJA 2QN6A 4GL2A 2HUPA 2ZVQX 2YOGA 3PFIA 1U8AA 3HDTA 4V03A 4F93B 2DFNA 3PIRA 1Z6GA 1RC8A 1J99A 1L8QA 2QSZA 1X8LA 5IT5A 5JWOA 3CRVA 2H16A 4YC7A 4NE2A 1RRCA 2BDTA 2WJJA 1HT1E 1KMHA 2OFOA 1NBME 4KV9A 2C99A 3I8XA 1LF5A 3W5JA 3AB3A 3A1TA 4RD0A 5CB6A 1W1WA 4DLUA 1XMJA 1OXTA 3C14C 3A1VA 3AVPA 5FTMA 4D4MA 2ATVA 3A37A 5HCIA 5G3ZA 3TK1A 2V6IA 3AKEA 1X1RA 3PUXA 2RKOA 2F9LA 4GZMA 3EZ6A 1J90A 1SULA 5JRJA 3QG1A 1ZJ6A 2LKDA 2IUUA 1KAGA 1Z0FA 2OAP1 4M1WA 5FTKA 2IX3A 2IBMA 3P4XA 2OHFA 5JEDA 4NONA 1W4RA 4Q1EA 1NI3A 3PUWA 3TMKA 3RAPR 1E2QA 1WMSA 1XTIA 3UG6A 2Z4SA 4N0EA 2PCLA 2J0VA 3GLHB 1MV5A 2AL7A 2HT6A 1G5TA 2CJWA 3G5UA 5E7MA 4QJ5A 1HA3A 3D6TB 2OV2A 3AP2A 3IIMA 4HZIA 3U2QA 5KSOA 1FX0B 4OL0A 3OESA 5KYKA 2QAGA 2GWHA 1ZW6A 4WZAE 1P5ZB 2OM2A 3B1ZA 5KSPA 2ZE8A 1K5GA 4GI7A 2G1JA 2AFHE 1P9WA 1G4UR 4A8JB 5F9FA 2QTFA 2VHUA 4BLOA 1BOFA 3BD9A 4C2TA 4HB0A 1LS6A 2GF9A 4NKRA 3R7WA 3T1OA 2ZIAA 3RYTC 5TV2A 3SQXA 1ZIOA 5EE3A 2J59A 3QOFA 3PENA 2DYKA 4BLQA 3IUYA 2GRJA 2J87A 2D4HA 5JHGB 1P60A 3P26A 1J70A 1NIPA 4HUQB 2GJSA 2REOA 4KJZA 4LK2A 4YXWA 4A0HA 3AVWA 4PSKA 1MH1A 1PZNA 2XOKD 4QNMA 4KSBA 1JJ7A 1OXXK 1IN8A 4ESHA 4GNKA 1KZ7B 3TQFA 1FX0A 1WP9A 1WXQA 4DCTA 3CKLA 4IKEA 3RLFA 4FMCF 3PV0A 5JBQA 4TYQA 1A1VA 2JGNA 4K81B 1ETUA 1FTSA 2BBWA 4BQSA 4ZCIA 1PLLA 3H4MA 4LGMA 1KYIA 2N42A 2FJUA 2Q9CA 1E2KA 1ZD8A 4MH0R 4EFMA 2QPOA 5FUWA 4F4JA 4ZIRB 5KPJA 3ADDA 3QE0A 2ZRCA 3BK7A 4IXMA 4Q7LA 2ZJBA 5K8IA 4MKIA 1QHSA 4KYIB 3O8DA 1T8UA 4D80A 4TLCA 1XPUA 3VX3A 2C98A 4Q4JB 2QBYB 4AKGA 5HZKA 2O8CB 5LDDC 3EC1A 2CHVA 2G77B 2F1HA 4JZKA 1VTKA 3AVTA 2W6JA 2J9RA 3RC8A 2VHQA 3EPLA 1QVAA 5EZ6B 1JR3E 4X8HA 4Z1MD 3FYHA 2CHGA 4NDZA 1K8RA 1MT0A 5EE5B 1L4UA 1R8QA 1U8ZA 3VHXA 2FGKA 5EXPA 3TH5A 4A8JC 2W6IA 5JFGA 5AUPB 3H0KA 3BOSA 2JLXA 2ZR9A 4L15A 4NCHA 2WSSD 1SHKA 1UAAA 1E2FA 1NY5A 3AF0A 4P0TA 5JI3E 4WZ6A 3SR0A 4JL5A 2B8TA 2X1VA 2OO7A 1X8JA 1IM2A 2QBYA 2NO6A 2GVZC 3AP1A 4LHZA 4JLAA 4JLMA 1SVWA 1KHTA 1UKZA 3VX4A 1AK2A 2EFEB 1Q1ZA 4PO1A 1G3IA 4I81A 2QE7D 3PG5A 3QKTA 4I1VA 1OLOA 2GESA 4PZZA 2UZIR 2GCPA 2FPLA 2OCBA 3SHWA 2ASEA 1HV8A 1TEXA 4MA4A 1DG3A 4OHWA 2UKDA 2GA8A 1FUKA 1P61B 1GKIA 3U44B 3T06B 2GBLC 1E0SA 2VF8A 1J2JA 1H8EA 4MYUA 1Z8FA 5B57C 1IQPA 2MMGA 2QAGC 3DHWC 2VHJA 4AYTA 2OBNA 2QT1A 2FNAA 2NTYC 1T9HA 1YQTA 4HAXA 3E70C 1U99A 5SZJA 2P65A 3GLIE 3KFXA 4IDNA 3U3OA 3TUZC 2W83A 4MYCA 621PA 2O5VA 1G7CA 1OH7A 2HJVA 1M7BA 2QRZA 2B6HA 1OYWA 2FZ4A 2GK7A 3SBDA 1W4CA 3EZ9A 1I2MA 2F9MA 1FTNA 4C3ZA 3HJNA 2QI9C 4MGKR 2JJ2A 3M0EA 4GSYA 1TQ4A 4IOJA 3IBGA 4OQMA 5EUMA 4B47A 1XPRA 3EZ7A 2C95A 3HPQA 4G5GA 4U7DA 2ZYVX 1EFRD 3CPEA 3IHWA 4TLAA 3ETLA 5FTJA 3PEWA 3X1ZA 2WPDA 3PR1A 4RKFA 1KDTA 1E2MA 4I1UA 1DARA 3HR8A 1OH5A 5IF9A 3EZ2A 4D0NA 3HPRA 3FPAA 4KVAA 1AGRA 2XTMA 3OHMA 1A5TA 1CTQA 2G88A 4PAOA 1XFAA 3MUFA 5J47A 3BFXA 3GCGA 2R62A 4WOPA 4JSYA 1DPFA 4YMSA 2OBMA 3K0FB 3SYLA 5KDLA 3E5HA 4AY2A 2BCJQ 5HCNA 2RGDA 1KMHB 1U0HC 1KJYA 4Q5IA 3C16C 5AJYA 1UBEA 4H1VA 4LHYA 5BYKA 1KO5A 2CBZA 3QIAA 4P4SA 1Z0AA 3QJYA 5CM8B 3GFOA 4KLZA 3GEIA 4FCWA 4M1MA 4S2EA 1E1RD 2GKSA 3QF4A 4CF7A 2QMOA 4Q19A 1NN0A 4HLUA 4H9GA 4QM6A 1BIFA 5CM9C 4BEJA 2DFKB 3LXXA 3QQ5A 1KSFX 2O8DB 3K9LA 3ZJYA 2YVUA 2OCPA 3BFVA
chains in the Genus database with same CATH superfamily
3ZNNA 1L2TA 1YRAA 3I64A 1JAHA 1N8NA 2VXYA 2PKWA 2ZUSA 1P75A 3ZDEA 5HA5A 1LPMA 4KIFA 3LCRA 3V8BA 4XARA 3LF1A 1SUEA 4S0XA 5ED0A 4DJEC 5C4IA 2GD1O 1A69A 1UDWA 1DFHA 5ALEA 1B23P 3LLVA 1N1EA 1J1IA 4YJ3F 2X1HA 4JFAA 1E5VA 4KR2A 2IEZA 1T35A 2CNKA 3Q3VA 4QFBA 4OK6A 4ADSG 5C8XA 3Q8LA 2A8YA 1KY3A 2R8YA 3NTVA 1MBZA 3FFTA 4AY4A 4P0PB 1UPBA 3SDZA 2PT7A 5AJHA 3C8HA 1ND5A 2C58A 5A03A 3NHFA 1PZXA 1R2QA 2VYVA 4MLPA 3RARA 1XAGA 4OI4A 4DR2B 5CFMA 3EJ6A 5DP2A 4EAAA 3B1WA 5KMGA 1Y3BE 1ZESA 2FU5C 3GP3A 1SUWA 3P9YA 1N5LA 2ZRDA 3VOBA 2IZ5A 3KTOA 3FCCA 2QTVB 3FTPA 1EWVA 1O2DA 4MVJM 1TECE 1N8SA 2WF9A 2W2VA 3FWYA 3AGPA 3GIDA 4EQ6A 3P2KA 3HYRA 4QOHA 3BWCA 3J81A 2CLEB 4NQZA 5IVIA 5AO9A 3VPHA 1QRRA 2C8VA 2FSVC 3TD6A 4EGCB 3ZUPA 5IJ0B 5CH8A 4BE4A 4JR1A 1BDMA 1RWWA 1XTQA 2A2ZA 2P1RA 4DWVA 3AVQA 1GZDA 3Q3GE 5T7BA 1CUBA 4L3WA 3TVDA 2J9XB 3A27A 1A3CA 4NESA 1RJFA 3LYUA 4M1ZA 4A5OA 1UFQA 1MO3A 2YJ4A 3VDXA 3LH5A 4EO7A 1JKMA 3ZTYA 1C3OA 4QFCA 4FFMA 3TFOA 3BL5A 3MYRA 1EA7A 1OWMA 1DSSG 1X8XA 3KZMA 3X2FA 2LZ0A 2XMZA 1DG1G 2IYPA 4GGOA 3VR1A 3O5AA 4HPWA 1CX9B 2CNDA 3JTEA 3KXKA 2EBWA 1AMNA 3OFND 2WZQA 1ULAA 1E2IA 3JWHA 2ASVA 4HDQB 2WKWA 1PLKA 1E1QA 1DBPA 4B3TB 2H3EA 3AUAA 5ER6A 2WMOB 4HGRA 1IDN1 2CV2A 4ES6A 1PNOA 5C2JB 5LVAA 3CKMA 2FN7A 5IC6A 1DKUA 2QUKA 1NUPA 2WABA 1JKXA 3I28A 3W5IA 4YRNA 1R4MA 3H18A 4L95C 4DV7B 1E2BA 2GK3A 3BRWA 1FVOA 3EXEA 5GP1A 5DHFA 2MINA 1C2YA 2JLCA 3ZWDA 3LCMA 4GMHA 5E6UB 3B5JA 3X43A 2PU7A 4Q4DA 5F9HA 1M83A 1W5FA 3UM9A 1I4TD 2ZRBA 5FOQA 1VKHA 2Z3VA 4Y2JA 1JP7A 2V9PA 3OFVA 3TXXA 3D2BA 3LAWA 1VIAA 5C8ZA 3OJWA 4FXPA 4M1EA 3ORYA 4XSVA 5EJ6A 2PXCA 4W5NA 4BAZA 1Z5WA 5TSDA 5A5EA 4O2AB 1YRYE 3F5QA 4R8SA 5JJCA 4U9HS 1TC2A 1ID1A 3CZ9A 3L7KA 4XI9A 1C3XA 3UJNA 3R9WA 2IV7A 1FMLA 3RYIA 3NBAA 4XEUA 1Z63A 1BN6A 3OA0A 3DZKA 4IGKA 3W5VA 3GFSA 4JI8B 4P31A 1T2NA 3L0PA 4RPJA 5ERXA 2ZUFA 2PR2A 2JIDA 3WL6A 1XCPA 1FYXA 5HQ3B 4NCBA 1W5SA 3K1AB 3R44A 3ZY2A 5G02A 2Y9PB 1F7UA 3D3EA 4J0QA 2LR0A 2B3TA 2BVNA 2LD4A 3T1QA 1A82A 1DCFA 4AZVA 4LJ7A 5JMOA 1IN7A 4BNYA 2ZJ8A 2XA9A 4RHUA 4TLEA 3BE6A 2NSYA 3BH0A 1YQUA 4KQJA 3LBHA 4P08A 2JFBA 3BG5A 3RJ9A 2RFLA 2Z2IA 3V2UA 1VI5A 2IELA 3TOVA 2RGXA 4M7RA 4LVOA 4DBVO 3X1YA 1G7SA 3EVEA 2C9OA 4C89A 3QITA 4AF8A 5DRTA 3F0TA 3KSBC 3RFXA 3O4FA 2WEKA 4FYWA 3F8SA 2H65A 1H9BA 3CGWA 4MMXB 1Z6QA 5P8WA 1VXOA 1L1FA 3X1KA 3COVA 4ETWA 4YCCA 1D1SA 5AVSA 5C7YA 3VYWA 5IM5A 2E4AA 4OXXA 2RGGA 4P54A 3C2QA 2VP2A 1U3WA 5BXQC 1XEXA 5DI3A 1R8YA 5FXMA 2Q07A 2WNIA 3P52A 2W6MA 4BX8A 2ORYA 4NABA 1CDOA 1WXWA 3G82C 1U6IA 1W0KA 3MGKA 5I7SA 1E1NA 1JT2A 3ZXSA 4BMZA 2A5DA 3BXOA 2UVQA 1FXSA 1M8KA 4G1UC 4RORA 2BJHA 4NDNE 4D4IA 2C4KA 4BU0A 1IMOA 3SC2A 5LNK6 2RHMA 4PEVA 1WVMA 3IQFA 1HFKA 5JPIA 4XWAA 4B3FX 3EGIA 4EWLA 2V74B 1XD8A 4ZA2A 4ROSA 4Z9BA 5ALJA 4E6EA 2Q4DA 2OGUA 1ZN2A 1Y6RA 3ZI0A 2H2GA 1AKYA 2C5AA 2X76A 1D2AA 3OCXA 3IKTA 3I4LA 2IKSA 2HREA 3WFZA 1NJ5A 2IVFA 2DBYA 1OPXA 1WUKS 4KUHA 1VRCA 2X9VA 3O90A 3QKWA 1Y8QB 4O2AA 4X85A 2AH5A 1FRQA 3S1AB 3GJRA 3O94A 4G9BA 4ZCMA 1HMPA 4IW3B 4GRDA 1VA4A 3D1JA 3G6KA 4D3SA 1MOSA 2OZLA 5K3SA 3PTLA 1NW9B 5JSYA 1YBAA 3IE1A 3U13A 2ZKIA 2B21A 4KWEA 3FW1A 4PE5B 1N32B 1I5RA 4Q1CA 1H8HA 3SJAA 1FF9A 1SQ6A 4BNDB 1MC8A 1V35A 3H9BA 4DM4A 3RUDA 5K1ZA 2O06A 2Z43A 3OURA 3V1NA 4MQ4A 2A59A 1IONA 2AUTA 4Z51A 1YMVA 2BBSA 4C2UA 2FFBA 4MR7A 1KZGB 1ABEA 1NMZA 4LXXA 1NYLA 4P81A 2JKVA 5IAEA 3RANA 3IQIX 3UXYA 1RXWA 3HA3A 1QQ5A 2Z30A 3TZHA 4LRTB 4UM8B 5K3CA 3DHEA 4RJIA 3S28A 1JIVA 3HADA 4D0RA 3FPLA 4JJ4A 1E4OA 3LIPA 4HLQB 1W9MA 4YQFA 1TM1E 3LWZA 2X4IA 5FUQA 4KFCA 1COWA 1B3BA 4LDPA 2FZ5A 1GTVA 5H80A 1N6IA 4KQEA 1JQ3A 1NGSA 1ORWA 2APJA 1IATA 2Z08A 3OU7A 5IJ0A 2NUTA 4RHYA 1SUIA 1ZEMA 1XEWX 1VKNA 1K3TA 2WZCA 3G8AA 3TYXA 1YJQA 2H9IA 3EVTA 3H05A 2X9GA 2H48A 2RG7A 2XWPA 2BTEA 2PFSA 2B5WA 2Z8XA 4UXHA 1U0EA 1II8B 3GBVA 4M0CA 4II7A 4BATA 1SOUA 2H8KA 4JHXA 4XD2A 3DL0A 1P5FA 2B61A 4OLHA 2ANCA 2CL6X 1GSIA 2YJZA 4ZT5A 1EZ4A 3U1BA 1KMCA 2JJ2D 3GJQA 4FX2A 1JA9A 4TLBA 1BCSB 4QJ4A 2WTAA 5CXUA 3V1YA 4RVUA 1TOAA 3P9ZA 1DV1A 2HJSA 3HMQA 4NYJQ 3VC2A 3I52A 3UCFA 3WK8A 3CT4A 3QNUA 1E94E 4PC2A 4RD1A 5SYNA 5U4XA 1HWYA 3R7NA 3FUTA 2DLNA 1U5BB 3A1CA 3PZRA 1XDUA 4OJKA 5EJMA 4AWAA 1MRSA 4P93A 2DY1A 4NG5A 5EIAA 2ZJ2A 4DLPA 4P98A 4EZBA 3U7FB 2WNHA 1Z8NA 4GXRA 3BFPA 2BLLA 2D5AA 3SEAA 3MQ2A 3MT0A 3W1EA 1YA4A 3OTGA 3LUHA 3TLMA 3ZE9A 3ILYA 4LOAA 4DV2B 1XD2B 2GO7A 3D5TA 3LDAA 1UKYA 3DBOB 3ZGOA 2IYFA 4TQGA 2VAVA 3VR3A 1HI9A 1UFRA 2KX7A 2PWYA 2XKBA 3O4JA 3S5JA 2B9EA 2PGDA 1VL6A 2IYLD 3MIZA 4TV8B 1DINA 3STTA 1SGWA 3VPFA 4G0VA 1KNQA 3MGAA 1M1YB 2CHUA 5GV8A 4DDVA 5ILGA 2D2IA 4NJMB 1C0EA 5KDOA 4MCHA 4DDMA 1SA0B 4U0JA 4BV8A 1DEKA 5AHOA 4DGSA 2ECQA 5J63A 4EI8A 4LYDA 1UJ5A 4MVCA 1XA4A 3RC1A 2O4UX 4ZDIA 2BHTA 4Q1VA 4MUFA 1I7PA 3VNBA 2PUEA 2QGZA 4RF4A 4RW0A 4DV0B 2C5EA 1AGYA 3AR7A 3ECCA 3JQGA 3BB1A 2DOKA 1JAIA 2W0SA 3M2TA 3DZBA 4EO4A 3QBEA 2CDNA 3PL5A 3TM5A 1RM5A 4BKUA 1DRWA 1GZUA 1NATA 3DV0A 3K1YA 3S2EA 2OZEA 2EU8A 3JV7A 4YDHB 2CY0A 2M32A 3AUYA 3HO1A 2ERCA 1JYEA 2IEYA 4K03A 3FDZB 3UMMA 2V6BA 3CUYA 4TS3A 4DB2A 5LWHA 5LKRA 3W2HA 4Q4LA 4P3NA 1CT9A 4HQKA 4N5NA 1GXSA 4JK3A 1T4CB 4JB0A 3S2IA 2PGXA 3JAKB 5C8YF 2HBZA 2WJZB 1TCUA 3QW4B 4OHMA 3KZNA 1FTQA 1U2RA 4U02A 4OM7A 1I9CA 1PR5A 1VJDA 2EIXA 4G24A 5EIHA 3TSOA 1R0YA 2GDJA 4KI0A 3HFGA 1X74A 2PZEA 5BSVA 1YZTA 3IDAA 1DAPA 4YQZA 2MR5A 1NBWB 4BFWA 4KXNA 1I24A 1XUOA 3DOIA 3PUYA 5ILOA 4JXXA 4ZU6X 4V1CA 1APBA 3NXKA 1SY7A 3U0VA 3LUAA 3GLTA 2CMFA 1QG2A 2XODA 2FZLA 1FUEA 5KDDA 3D8HA 2JH9A 2AZMA 4MV7A 4HGZA 1T29A 2QU7A 2ZJAA 2YIMA 1J1ZA 2V9ZA 3PUHA 1XTBA 2DQSA 3L1VA 2WKPA 1V16A 1ICIA 1IEXA 2AA3A 3GDHA 4KAFA 3W2IA 1RLUA 2YNMD 4BFCA 4NJEA 4EJFA 1UBLS 1FUIA 3DG9A 1O8BA 2F3UA 3GT4A 2W6QA 4D9FA 1NTRA 3O3MB 4DCGA 4F5WA 2WD9A 5K5EA 3SXUB 2QLLA 1ZH8A 2Y9MB 3AXTA 4X7PA 4TWJA 4ZT4A 4YV7A 5MFZA 1K98A 3AF4A 1Y98A 2OPBA 4OF4A 2UYGA 3QJGA 2Q45A 4MP6A 4R3UC 4RFVA 4F2GA 1B8VA 1TQDA 4OJMX 1DKQA 4MI3A 4CV3A 2PT5A 3B52X 2BGUA 3PZBA 4Q15A 3NKFA 4EVIA 3M6FA 3BGIA 3IVAA 4NK4A 4XOIA 5J5AA 3VZRA 2JIPA 1PSZA 1J2YA 1D4AA 1SEPA 1OUMA 2JAQA 3RRNA 1NM5A 2A0XA 4NOKA 4WN3A 3HBJA 3KPYA 4O29A 1QYWA 2IWHA 1MXFA 3RI3A 5KU1A 3BQNB 3HEBA 4G84A 4LI3X 3MQ4A 4KQHA 3PYLA 1E9BA 3UPDA 3LLSA 3DPUA 2O52A 1B8PA 1ZJ4A 4Q1AA 4B6SA 3J81k 1JBQA 3DAGA 3IUPA 1N5DA 2HSGA 1GRQA 2P2DA 2XIJA 3GV0A 4MVJP 4P4TA 4RMHA 4RTKA 3O6VA 2UYOA 1LSUA 4CDRA 1W49A 1Z36A 5FOTA 1XHEA 2PMBA 2YN4A 3MMPA 3ETDA 4LRUA 1TM7E 5JBNA 5K01A 4KIUA 3GN2A 3EGXB 2BC9A 4NZOA 3IH5A 1G8KA 5FWXA 1B6SA 1A5ZA 1M54A 2D6FA 2GZHA 2XZOA 3MYYA 3AB8A 3K9QO 4QU5A 1YC2A 4PR0A 1Y4DE 2O6HA 1A9RA 3NPMA 5COQA 1LRKA 5HDQA 5LXTA 4RTRA 2C7BA 1ZD9A 3PNYA 4GMGA 3QWAA 3AKYA 3WGJA 4UNQA 4WKOA 5AVQA 1HYBA 1P80A 2XD9A 3CC8A 4QUHA 4V0SA 2OHHA 2BGIA 4HY3A 5L8VA 3FD8A 5CD1A 3E8MA 3AR2A 2V4ZA 1FDUA 2Q0SA 3G9TA 3WQHA 2QY9A 2FWAA 1TRKA 1SVKA 2VJMB 3M70A 1KYTA 1MVLA 3PQ4A 3EDOA 4L4XA 3A58B 3OEHA 5EJ4A 4BMPB 2A9KA 1L3BA 3LFTA 2F43A 3SG0A 3WLPA 4NEHB 1NWHA 3A9CA 4IRUB 3TSZA 1OI2A 4LNUA 5EEHA 3RSFA 3U49A 4E0BA 2EJVA 1PWHA 1IM5A 1Z4NA 1SJ9A 1R27A 2IS4A 3T3HA 1D2EA 1AT1A 3G1WA 3IQHX 3TNFA 2X9LA 3ITKA 3KB1A 2ZI3A 4JGBA 3IUJA 3FUCA 2ZIFA 4PGGA 4DUGD 2AW3A 3ABQB 3DM5A 4S1PA 1OZHA 4I5FA 4P4GA 1ZO8A 3ZDRA 4IV0A 2CFRA 2NO4A 6Q21A 5HKKD 1P2TA 3EVZA 2XH8A 3BWYA 3L6CA 4LSGA 5IDYA 3F97A 4PBRA 4UU1A 3KTAB 4EB6B 1NVFA 3AF2A 4RESA 3DTYA 1OZFA 4EFDA 3DWFA 4JT9A 4XCXA 2ONZA 3RTEA 1M2VA 1PS8A 5DRYA 3O9MA 3C8DA 3RTDA 5EUQB 1U8YA 3WL7A 4N8EA 2AOUA 3H65A 1RZRA 3A6ZA 4TSFD 5ALTA 4GXQA 3T5TA 1W48A 3V6LA 3VZDA 1P2DA 2F1IA 5FTNA 2IQ5A 4KXUA 3SQOA 3CWZA 2X2PA 3VH3A 4F2HA 1RJGA 1AQNA 1OTHA 3FWNA 3OTIA 3GVCA 1Y33E 1F60A 5IDXA 4MUXA 2UU9B 5MFPA 1KBOA 3F5MA 3RRJA 1Q5PA 3DYIA 4QAJA 5KCMA 3TTUA 1KIAA 1EG2A 5BNTA 4FQ8A 5A3RA 3ROGA 2RBGA 1UEJA 4PSAA 4BB9A 2PN1A 1H1LA 3EYAA 5C35A 2O1WA 4HX5A 4TSFA 1WBJB 3PYMA 1WZ2A 4B2LA 2IL1A 2QRUA 3RD5A 1WNFA 3ZS9A 3LNTA 1HYHA 2R7LA 1VSQA 3QI2A 3K1ZA 3K9NA 2AN1A 5IXJA 1RLMA 3HM9A 3JVVA 2FPKA 4GP7A 5G0WA 4KHPB 1K7XB 3HR4A 3OC6A 2A14A 4BVFA 5JD4A 4ROTA 2ZJ7A 1NXWA 2PJZA 2BFMA 1NYQA 2NT4A 2EEZA 3KOYA 5I51A 4CM7A 3THWB 2PUAA 1T5DX 2H29A 2VDQB 4BB0A 1Q7CA 2HCBA 2YQ5A 5K51A 3GWZA 3DMTA 3JU3A 1TW3A 4FZVA 4W5JA 3NRBA 3RRZA 1XPOA 3MWYW 1YB4A 3WX0A 2D8AA 4CQLB 3MHTA 3WK5A 2B30A 4LZAA 1B73A 2IEAA 3B12A 4OLFA 1ZAKA 3OOYA 3E9RA 1SM4A 3K5WA 3L6EA 1Z7EA 1FU8A 3VKWA 4ZGWA 3TQSA 4NHOA 1UPFA 3DMNA 4S3MA 4W1PA 1V5IA 2ATIA 2A67A 3DA8A 4RK7A 4L9RA 1Y1TA 2B8JA 4MICA 5COAA 2PSDA 2B4KA 3VNSA 3P2IA 2OYRA 1AUOA 5CT8A 1OVMA 1UF9A 4FFLA 1OBCA 4N0DA 3FYCA 3WIVA 3K70C 2BD0A 1Z5UA 4MZDA 1VBMA 3UMBA 5JJKA 3KKOA 2NTEA 3VKFA 4AZWA 4CQMB 1N2IA 4ITUA 1MLDA 2BT4A 3P0RA 2OCDA 5EZYB 1SZJG 2VH2A 4E14A 1CRPA 3KZCA 2ZJFA 2DPLA 5CB8A 5AICA 3D1LA 5FNVF 2BFPA 2PBFA 2GXQA 5CDTA 2CV1A 3D2AA 2I4OA 4IM7A 1DKRA 1E4EA 2X41A 1EGVB 1VI2A 1KMMA 4XM0A 3ZC3A 4D8TA 4MV6A 2XYGA 3NLLA 3QV2A 3K9HA 3WWZA 4EKYA 3CLTD 3MJ4A 2PHZA 3NHKA 2PE5A 2H31A 3TLAA 4JDPA 2JI7A 2DM6A 1TO1E 1P3JA 4ZO6A 3ZDQA 7ADHA 1U7OA 3HDJA 4IFBA 2XAUA 3AOEC 3RU9A 1J42A 1OFIA 4TM8A 6LDHA 3VR4D 4WESA 3OPMA 1KK2A 3I39X 4NL4H 4MS4B 3EQZA 2AOTA 4IS3A 4MWTA 4RETA 4EKNB 1WU8A 4JKYA 2SKEA 2CE7A 4U2DA 2PSEA 4BTVA 1Q1BA 3GMIA 4YLYA 4EI7A 3WYGA 4F84A 5DF1A 4CMJA 1IHXA 2AS0A 2EKPA 3WYAA 1GZ5A 1H8ED 2V3WA 4JEUA 1XZKA 2FA9A 1EB8A 2FP4A 1AS3A 1RLJA 2IYRA 4GI1A 4YV0A 5KNLA 1WW2A 4U8GA 4B76A 2FFJA 2G5GX 4DEVA 1T9DA 1PJZA 1QXSA 1YQWA 4ZXPA 2JHFA 2X0FA 2RDMA 3WMFA 4OBXA 3OQOA 2PL1A 2YJTD 4OU5A 4QRIA 3U0BA 3NM5A 2ZM5A 4JT8A 5A1JA 2MT9A 4ZYUA 3GLIB 5T6MA 4PRKA 1PR0A 1QH8B 4ZVNA 4HB4A 3IL2A 5AESA 5HF5A 3PXGA 1YIOA 4R05A 4DJTA 5FIUA 2I4TA 2D0DA 3L0IB 4OQXA 2ARKA 4IHQA 2Q0QA 3SHVA 2QP4A 2RI1A 4FFBA 3KCQA 3L18A 4Q00A 4DWOA 4E3WA 5BSEA 1VZ3A 3ESBA 3FMGA 1ZIYA 4HPJB 4PFKA 5AVVA 1ARZA 3PS9A 1VL8A 4RPGA 3WQQA 2Y27A 2CF6A 5U4QA 1LPSA 3K4HA 4BVGA 3DEHA 1MC1A 4TYYA 4IS2A 3BSSA 4K9SA 3EW7A 2VHYA 3GL9A 4QOGA 2PPLA 5E7QA 3ZWMA 1NNI1 1G3MA 1RWNA 4C7MA 2JBHA 3NU1A 4MDHA 1CB7A 5E0KB 5J4HA 3UXMA 3WGYA 5KTNA 4OSPA 3M2PA 4YREA 3OUZA 1YZYA 2H8GA 2YBDA 3OOSA 2GNOA 4ARUA 3C3PA 1FLVA 1M34A 4FN4A 4ERXA 3DJYA 3LQKA 3VR5D 1J97A 1G7TA 2Z2YA 2DBRA 5C0OE 4HNVA 1ZIXA 1GUFA 5D3ZA 1J8VA 4DSZA 5IHXA 3N0TA 3I5YA 1GL6A 1AM4D 2YYAA 1MRZA 3D1VA 4C0BA 3WMEA 4UHCA 3SFVA 2BFNA 3VSEA 4BV9A 1K92A 4AX4A 1T1JA 3HKBB 2I2XB 3M4ZA 1Z62A 2F3QA 4N7BA 4YCLA 5DTIA 4XYLA 2QMYA 2YN0A 2GSWA 4TL9A 3K6SA 1OV4A 3K15A 4G8CA 2PMFA 3GDFA 2PL9A 2XRFA 5E8RA 5B2EA 3UTDA 2CVQA 4N6GA 3DOHA 2HDNB 3QWHA 5ITSA 2PFKA 4KMSA 3CPHA 4HDKA 4LVNA 2XYPA 3T3EA 3KVRA 3DD5A 4MWDA 3TCNA 1B00A 3E84A 3FM9A 1W5EA 4EPRA 5IWCA 3FSGA 1W581 4I9NA 1K4KA 3B89A 3OWOA 1DU4A 1NLYA 1WQ1R 3LKBA 3GD5A 2WU0A 4K6OA 3BAZA 1TM3E 1E20A 2WUDA 4LIPD 3CA8A 4WBSA 5BV7A 1TRHA 4CTOA 4P32A 2FQXA 3GT0A 5AW7A 4C29A 1KOFA 3H2HA 1V3QE 4EG7A 2VJCA 2OESA 1UK8A 4AJ4A 1ZJWA 3RS2A 2XSZD 3K0KA 4DJAA 4C03A 3GA5A 1SG0A 4OM8A 3FKQA 4OP2A 3LU1A 1P1FA 2GAAA 1YKSA 4I9FA 5IN4A 3GRZA 3T52A 5KPDA 1O5IA 1JXQA 4GXTA 1EFVB 2E82A 5E1DA 3RUEA 3UCEA 4C0XA 3I9LA 3T38A 4Q3LA 1TA0A 1JXAA 2OAQ1 2OC9A 3FOZA 4KK3A 3S70A 2EFDB 2POQX 2XGMA 1PQPA 1E2PA 1U0GA 5LZ5A 4UPDA 4G0UA 5IYZA 1SOMA 2IZ7A 2Y0EA 1DAHA 1HNNA 5EMKA 3IT2A 4QQRA 3RSHA 3RSSA 1PKXA 2IIBA 3ZI7A 1Z4IA 4R0MA 1IH8A 1ZSNA 4AJKA 5JXIA 4B6OA 3OZAA 2ECOA 3ZHRA 1J9EA 4RIGA 2CWWA 3TOCA 4BO5A 1WJGA 4DSNA 3OE5A 1XVLA 3DDWA 1QRUA 3PQ5A 1NFQA 4KX5A 2QV0A 4X1OA 2C7OA 3ZTTA 3AP3A 5JJIA 1N5RA 4LDJA 3CLTC 4PPQA 3T5PA 1KVSA 2WFZA 4RIHA 1NLFA 2IUYA 2PZMA 4QU8A 1YMUA 3BB3A 2I55A 3LPNA 3G89A 2R7KA 3AU8A 3P9XA 4BKRA 4YUWA 1G8HA 2HHHB 2OHGA 3KZKA 2EX4A 3E7WA 3PC3A 4G25A 5BN1A 4XTCS 4PYQA 3C1OA 4FGWA 1GR1A 2A9VA 1NVWQ 2QU8A 5K20A 1JDBC 3I32A 5GM1A 3F6PA 4JJIA 1MQSA 1X15A 4QBTA 1R0KA 1IOZA 1UMBA 1XLVA 5BWCA 1LW7A 4LFBB 3OETA 4I1OA 3MFYA 4P80A 4MV4A 3WB9A 4F6CA 2CLDX 3SHQA 4U5XA 5GZ3A 5KOHB 1EFHA 4HFJA 3OY2A 3H2IA 2YRWA 1FVHA 1B26A 3W8FA 5FUMA 3F5FA 4R5HA 3AF1A 5DN9A 1F2DA 1Z0KA 3QFSA 1E7WA 1P7VA 4M46A 2QSYA 4EARA 3ZLJA 2PRKA 3PXAA 3UUEA 3HKCB 2ZR0A 4HAWA 4I99A 4ZP1A 2ZS9A 2D13A 5F1PA 2VP4A 5IBPA 2YWEA 1TZCA 2F9FA 4DIMA 5D8DA 5A71A 4PTLA 4G0XA 4PBSA 2OV1A 3K0CA 3K8OE 4MA5A 4OA5A 5DLDA 2Z6VA 2FWJA 3MLBA 3ZDBA 1P31A 3Q98A 3PDCA 4C0WA 5EZYF 5CA0B 1EESA 5SZIA 1NONA 4RVNA 5FOUA 2FZGA 2OOKA 4JL8A 4EB3A 2XUKA 3ANTA 3ECAA 5LA6B 4BKOA 1C0KA 1OI3A 1JWLA 4CL2A 1ZVKA 2RHHA 3SNKA 5J40A 3O4IA 2LE0A 4OIFA 3J7TA 1XLUA 3WS7A 2EZTA 5CIQA 4C3VA 3OIVA 3CEPB 1NW8A 3SE0A 5JQGF 5JEEA 1VIDA 2XPCA 3IXMA 3FWZA 4KXQA 3SX4A 5BSTA 4NMWA 1IZ8A 5BSGA 2VHXA 4CLOA 1CP2A 3S8MA 3FOFC 4YASA 4BZQA 3QMWA 4PZ0A 3U5ZB 1R4NA 2ONJA 3VR0A 4EUSA 3H3FA 2WA2A 3H0EA 3THYB 4AAYA 5T4BA 5TMEA 4LHSA 4ARVA 1AURA 4ML3A 3GIWA 4UREA 2H2AA 1B0AA 3SCZA 4Z4IA 2AJBA 4X24A 4MWOA 3AEQA 3TOZA 4ZTZB 1DQNA 4D96A 4IFEA 1VCHA 3PE3A 2X3YA 3P20A 3DCIA 3ZQUA 3EPHA 2BI8A 4J0KA 5A0VA 4J7UA 4RVHA 2HQOA 4L0QA 4CKCB 1NJGA 2O2ZA 4FFDA 1R3UA 3ASVA 4C1NA 4W5OA 3LHSA 4LQCA 1BCRB 4OH1A 1EJ2A 1T1IA 1TU4A 5AI5A 1JQKA 1PFVA 3HZOA 5DM4A 5BN5B 5LLTA 2R8OA 2XF2A 2H1HA 4RBNA 4QEZA 4JYBA 3RHTA 1WCXA 3LTNC 4H7FA 2GMWA 1FCJA 2FR0A 2Y1GA 2C9BA 1I01A 2RK4A 3PC6A 4ABYA 1ZD1A 2AFHA 4MW2A 4P34A 5CFPA 5KJ1A 2P5TB 2HF8A 5DNUA 1WKCA 4X8LA 1B42A 2ZITA 2ZANA 1OLXB 2G9VA 2GOYA 1RPTA 2H6EA 1KPHA 3HYSA 4CEJB 2C61A 2FAXA 4FFWA 5F98A 4O4IA 4MHOA 4Q4CA 1NVUQ 4D6XA 3L5OA 3VGPA 5MN4A 4M9SA 4FCCA 3LVQE 1E5DA 4G41A 1Z6XA 4JP8A 2CW5A 1NVKA 4C4SA 1TUBB 3NETA 2ZCVA 5DGIA 2A1UB 1QHHB 2HDHA 5JZVA 3L6DA 1L1QA 1Z5OA 3K0AA 1HFWA 4CFSA 3THOA 1SXJA 3B9BA 2QENA 3DPSA 3ROQA 1O6ZA 2N46A 3N59A 4LQDA 1NQAO 3UV3A 5KZMB 1VFNA 5IVKA 3OBIA 2HB6A 3JAWA 2F3SA 1L4FA 3BWDD 2P5SA 3EA5A 1MTZA 3ETHA 2XA2A 2I2WA 5C1BA 2GEKA 4JQSA 2CMDA 16PKA 3VSAA 4OA8A 2UZAA 1JXMA 1XL0A 2AFIB 3TQIA 3L7OA 1RXSA 3QMMA 3DVLA 2PKQO 2QJTA 5D01A 1QYIA 2XNDA 3RVRA 4AXBA 4CM5A 4ZOLF 1J0EA 1N0VC 3DAHA 4LN1A 4CMAA 4D3XA 4D42A 1YA8A 4LW8A 2J08A 1T0IA 3PL1A 3SVTA 3TLKA 1R1DA 4CT4B 2C1ZA 2VNSA 3JD0A 5J4VA 5IBCA 1VI6A 4RZQA 1RQNA 1SRRA 1TM4E 1FSZA 3PHLA 3EQ6A 1C9EA 2VDLB 4LRQA 4ENQA 1T5IA 5CLJA 1YE5A 1U28C 3ED1A 1WV0A 5LLSA 5HE8A 2V9CA 4DE5A 2FLVA 3T35A 4YFYA 3MCVA 5DI9A 3WSWA 3VO1A 1AQYA 2GARA 3G2QA 4JCCA 3NKLA 5EIBD 2F90A 3FE2A 3QIVA 3SPXA 2A5JA 3VV2A 5J2UF 2YW9A 2FUKA 4QSMA 1YVDA 2P62A 4BVEA 4KSYA 1ZVVA 2BRUA 2DETA 4I50F 2DCMA 2MJLA 3DOJA 3V8EA 2OD9A 3MPOA 4Y2UA 4QDJA 3NRCA 3JYLA 4RD2A 2WVHA 4E31A 5IVPA 3R9XB 1W4LA 2N1BA 5IDVA 4BQRA 4G97A 1GPYA 2EYQA 2JA1A 1PHPA 4KBYA 3QFFA 3PGVA 3IE0A 2PLNA 3GLUA 4HZUB 1UC4B 4H7EA 5TGDA 1XI2A 1KOLA 3NPAA 3OEED 2RC6A 4GO1A 4XJTA 5GV7A 2OVFA 1YHNA 4JIGA 1QONA 2IYNA 3L84A 3IUMA 3O26A 5FOVA 2I2CA 3H99A 3ZBUA 2V7XA 2FX3A 3SHOA 4H18A 3QVUA 3I73A 1SVUA 1DXOA 1U9JA 2XQGA 3U17A 5JJBA 1CJVC 4YRAA 2QG9A 2FUCA 4QXAA 3QE4A 3N2YA 1HEIA 2BKAA 2CXPA 1A0OA 1H4TA 4FN5A 4KNVA 2QDXA 5K2MA 4DC1A 5DXJA 1F20A 3T9DA 2ODWA 3NGXA 3TE6A 3EUFA 2ZSBA 3FCXA 2YMPA 4Q12A 2QD2A 2QZ9A 2CKDA 3EMDA 1M1XB 1A71A 3DE0X 1DKNA 3PPXA 3PXCX 3ZVMA 4LV5B 4JYAB 1M76A 1PR6A 2PUHA 1XD9A 5CYOA 3SNHA 1MQAA 4NNOA 2MSNA 1ZYUA 1O9HA 3V33A 1CSEE 1NT2A 4K2AA 4B3XA 1GTRA 2UXCB 1ISJA 3WHPA 1HUQA 1Q84A 2DWQA 2QJOA 4MLCA 3W79A 3ZZMA 1RTTA 5LZ4A 4GX5A 4MS3B 5EINA 1LPOA 1IB6A 1ZRNA 2H2FA 1ZN8A 4R8MA 3AHDA 1WBDA 5EL0A 1SVMA 3U4GA 4HLDA 3KJXA 3LDHA 3MD0A 4KYTA 4CIYA 4OAOA 3VR2D 3OIUA 4HGPA 1NVAA 4KU4A 2ONKA 4TYPA 1HRDA 3KV3O 4U7JA 4BNVA 4BCDA 3WJ7A 4C0JA 4DEYA 5C5EA 3WWOA 1UOEA 1ZOSA 2EDCA 1NW5A 1G18A 2FPPA 2Y8EA 2VHVA 2J7PA 1W8DA 3KHKA 3NEYA 5DULA 4DMHA 1YC5A 4ER3A 1XRRA 4QM7A 1MF7A 1T91A 1Z15A 3D6AA 4DIOA 3D4IA 1IY9A 1HDYA 1ZL0A 1E8DA 1QRAA 4N01A 1TVCA 3HDVA 1FFEA 4RY9A 3ZDYB 5EHQA 1R5BA 2C2WA 3SDSA 2AGVA 4CU5A 1QIEA 2H2HA 3UJ8A 5B7GA 1NU6A 3B7WA 4B5KA 1AUVA 3IAS6 4X1KB 3RREA 3EZFA 3KKMA 5ELLA 5A3SA 1CS0A 5AXBA 2B5OA 3QU7A 2YS6A 4QG7A 1KAMA 3TIFA 1MENA 3QBJA 5AFSA 1VPEA 2BR4A 2FVYA 1FL9A 3FYDA 5E2BA 1NMYA 5I9IA 1NV9A 2R8RA 1Y42X 3NOXA 1ZM9A 4WIAA 3U7QA 1TLLA 1YS2X 4I19A 3GRAA 3BHJA 4MQFB 5C7LO 2R00A 5L53A 1EWYA 1SC9A 4RMJA 4CM4A 4I3FA 1I6LA 3GZNA 1I4EB 2WKSA 2CXQA 2JKYA 3HJTA 3PT5A 3QYAA 3WK7A 4BKPA 2P8SA 1AKMA 1ZK0A 2Z3WA 1PFUA 2WJVA 3NAMA 4W6ZA 4ZPXA 5LD2B 4Z4EA 3FGZA 4URWR 5F4ZA 4AMUA 2X1MA 3MMNA 3L05A 2X5KO 4J4BA 4N03A 4XVQA 4YP7A 3RVSA 3W3AD 3NHMA 2IYQA 3T1VA 5TQ0A 1HQKA 4FWIB 1LC3A 1DIOB 3V1UA 4B2PA 4C4XA 1LDEA 4OKIA 4ZI3A 4DHWA 3FPHA 3IP5A 3X1XA 1SKUA 5AW4A 3GLGE 1HDIA 3DLHA 2O8FA 1T36B 3PPIA 3CUVA 4JR2A 1KF0A 2PKQP 4UPVA 4H6XA 3UAVA 1AO0A 2CGEA 2FGJA 2Q41A 2B82A 4OG2A 1LCIA 5DSXA 3E9MA 1NM5C 4I1RA 4AYWA 1JKIA 3LGAA 2J0EA 1RJEA 3S44A 3H11A 2DE0X 3E9DA 5E95A 5EXEA 1MMFB 5H68A 5IP5A 3VSDA 4BGEA 4FW9A 1HK7A 3RFFA 1WOYA 4RTSA 2WTMA 1M1ZA 4CM8B 1TJ3A 4PVCA 3U16A 2QUAA 2P9HA 2YRXA 1ZGJA 1QYDA 3QENA 3PDWA 4L3VA 4LSZA 1CS4C 2XUDA 5EHIA 3RASA 3SF8A 3ZGNA 1GG5A 2GVDC 3NBFA 5F1KA 5FWDA 5B3KA 7MDHA 1MUUA 1EFCA 2PCJA 1R9GA 2EWMA 1V48A 5ALHA 1JQBA 1D2MA 3IBCA 5D5QA 1NBAA 5JASA 1SXHA 3NHBA 3QYPA 3AM5A 3PXXA 1I3LA 1Y5LA 3AFIA 2O2GA 2H00A 1P91A 1JEOA 2ZIEA 3RIYA 5FA8A 4D45A 3H1BA 1XNRB 4BV2A 2XWSA 1R00A 2UUPA 1UCFA 4UAGA 4BMVA 5GAJA 3VSBA 3G2NA 1QBGA 5AM5A 1E0AA 1OPRA 5JT1A 2DB3A 2WHRA 1UWLA 2WJAA 4QUKA 1CY1A 4ZAYA 1N5OX 3WIBA 3KKQA 1OH7A 3GLIA 1RFLA 2R6GA 3OD1A 2GZDA 4JHLA 5GJVC 1XMOB 1DAKA 4YTEA 2BEKA 4UBJA 1FBTA 2R11A 2O5RA 3AFHA 4KDFA 4UXIA 5JMWA 5IRCD 5DP1A 4J9UE 2PAAA 3WWDA 2J5BA 1B14A 2WG2A 4L85A 2LRHA 5DX0A 3TIGA 3TZCA 2A33A 1XDWA 4I66A 4S1WA 1E92A 4HYQA 3ZJUA 5ALLA 3CRMA 4DCOA 3F8WA 1NBMD 3JATB 1A9XA 4N5LA 5G4KB 3U6BA 1MO4A 3MINA 2PUTA 4H0NA 2O6LA 2AOTB 1VKOA 3A3NA 4DW8A 2JLWA 1OWLA 3OD5A 3HXTA 4IIYA 4HN2A 2Q5OA 2HDWA 2PH5A 3FDIA 5C1IA 4HVAA 5A5GA 5A4AA 1AZWA 1T6NA 2WF8A 3CRW1 5KTYA 1VPDA 2VPWA 4TPKA 3SS7X 4ND8B 1QKKA 2REQB 3HBLA 4UNNA 3RGWS 1KC1A 4IZ6A 4IIHA 1U5AA 3R3XA 3DNMA 4CJXA 3HCDA 1C4OA 1XT6A 1CQWA