1ZMAA

Crystal structure of the bacterocin transport accessory protein from streptococcus pneumoniae
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
SNAMEQFLDNIKDLEVTTVVRAQEALDKKETATFFIGRKTCPYCRKFAGTLSGVVAETKAHIYFINSEEPSQLNDLQAFRSRYGIPTVPGFVHITDGQINVRCDSSMSAQEIKDFAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bacterocin transport accessory protein
publication title The Crystal Structure of the Bacterocin Transport Accessory Protein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 38
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zmaA00
3NOFA 3LGCA 2MBSA 2FGXA 3HJPA 3CXGA 2H66A 2RIIA 2C1YA 5L71A 1LJRA 4ZB6A 2CV4A 2ES7A 2J23A 4K2DA 4P3YB 4PX1A 3BOAA 3EVIA 3N5OA 1XFLA 4IJIA 1QFNA 2ZNMA 5J9CA 4BWSA 4TR4A 2TRCP 5D9WA 1ERTA 4OCEA 2EIRA 3LXTA 2KUCA 3CRUA 1WIKA 4OD7A 4IELA 5IOXA 2R3XA 2RUEA 2LEGA 5HR3A 2FY6A 3IOSA 3LWAA 1SYRA 5J9BA 3HD5A 2CX3A 5DQYA 1GSDA 3KGKA 4JR4A 2L4QA 4PUFC 3RPPA 1A8LA 2AAWA 1R7HA 3EC3A 2LRNA 3GA4A 2VLVA 1CQGA 2VCTA 1A2JA 4IN0A 1MTCA 3TOUA 3TGZA 2F8AA 4XTSA 4HZ2A 1GLQA 5FT3A 3D21A 2DLXA 4K6XA 3WT2A 4ZL9A 1T3BA 3QMXA 2C3QA 4JR6A 3F4TA 2V6KA 1WE0A 5DDLA 3VI5A 4TOPA 2IFQA 2AUVA 4HU7A 3WD6A 4TKYA 3DIEA 10GSA 1GULA 16GSA 5G1KA 3HKRA 5ECLB 1Q4JA 3DVXA 3VWXA 2RUFA 5D9VA 1X9SB 4TN8A 4POLA 1HD2A 4GLTA 20GSA 1IYHA 3DVWA 3GN3A 3O76A 3W8JA 2V32A 3A2WA 3IA1A 2JL4A 2FA8A 4O92A 3UARA 3M1GA 2WJUA 4MK3A 2ON5A 1OVNA 4IBPA 1MD3A 3Q18A 4L5LA 2GT6A 4EF0A 1T00A 4JZQA 3BJ5A 2FNOA 1QXHA 3KP9A 3MNGA 4KSOA 1A8YA 1OKTA 2HFDA 4MF5A 1V98A 5IM9A 5EVOA 5ID2B 5CREA 4ZL7A 3O3TA 2E0QA 1PA3A 3DGQA 5DAKB 3ZIJA 1GRXA 4K0GA 1OKDA 3L0HA 4J56E 9GSSA 4L8EA 2VL9A 5J5NA 2DMLA 4LL4B 1DE2A 3KMNA 4OMVA 4G2EA 5IPGA 3GKXA 1VRSD 4L5OA 2H75A 5G30A 3F6FA 1EOHA 3HZ8A 1PD21 4DVCA 3GYKA 3IHQA 4NMUA 1PKZA 1RQMA 1TI1A 3C73A 2V6OA 1TRWA 1XCCA 1ZCPA 1RW1A 1GTUA 3KCMA 4N11A 4TR3A 3DD3A 3LSZA 1PL1A 3FEUA 2WGRA 1SJIA 2YP6A 2C3TA 14GSA 4KUNA 1G6WA 4TR0A 2QC7A 2P5RA 4EVMA 2ON7A 1V58A 1QUWA 2KHPA 1ZYQB 4KW6A 2HYXA 2WZ9A 1K0BA 2GSRA 2YOIA 3HYPA 2GVPA 2YJHA 2GTUA 1ON4A 4ZXGA 1R26A 4NXIA 2GLRA 2I81A 3DXBA 2L5LA 5ECMB 4IJ3A 1PN9A 3EMXA 1SU9A 4AJ8A 4MJEA 3TJGA 2BJXA 4J57E 1K3OA 1F3AA 2IN3A 2WB9A 3RDWA 5HR2A 1V2AA 4IP6A 5IMCA 5F0GA 3FZ4A 3GKMA 1A23A 1UVZA 1F6MC 2B1KA 1NM3A 3QDNA 3F4RA 4GTUA 4GQCA 4YQUA 3CSJA 2C0FA 3A2XA 4F2IA 17GSA 1EEMA 1X5DA 4I5QA 2AJQB 3IC4A 2V41A 1XW6A 1HNAA 3BCIA 4K1FA 4LMVA 4NPBA 2FLSA 2XPDA 2LKUA 2PN8A 2VLUA 5ID2A 2H01A 5KEJA 3PR8A 5DAKA 4FO5A 3P7XA 5DBQA 7GSSA 1TK0B 2GSQA 3UL3A 2CVDA 5JCWA 2B5EA 5JWQB 2AB6A 1QQ2A 3APQA 6GSSA 4HQSA 1TW9A 1NSWA 1F2EA 4ECBA 6GSXA 5C00A 3CTFA 4JEDA 2H19A 3GURA 2I3YA 1FG4A 2JU5A 2I1UA 4QL7A 1URMA 3H1NA 4XS6A 4KH7A 3L9SA 2FUG2 2C8UA 3C7MA 5ECHB 4HEA2 4KGIA 4HS1A 2GZYA 2PGTA 2F51A 2GQKA 2LJRA 2F9SA 4V2LA 2HSYA 3F9UA 2ALBA 3CSHA 2H6ZA 3EWLA 4MF6A 3TJKA 2VAFA 2YV7A 2VCVA 4GSNA 4MABA 3CMIA 1W89A 3N9JA 3GTUB 2P0GA 1Q98A 2VCXA 1O6JA 2PUKC 3PINA 2C0GA 3GL3A 1WWJA 3ZFLA 2HZEA 1K3LA 1AQXA 2LS5A 2AYTA 3QR6A 3TKSA 3KIJA 2LV3A 1Z9HA 4RQRA 2XHFA 3IBHA 3S9FA 3HVSA 4KX4A 1H4OA 2O85A 2IMEA 3UIWA 4TW5A 3IAS2 4E8HA 3GV1A 1JLWA 4X43A 1TU7A 4POBA 3U6VA 5G1LA 3ZFBA 1WJKA 3NIVA 3IK7A 2DC5A 3FR3A 3UAPA 4XS4B 1ML6A 19GSA 1GTBA 2FWHA 1OE7A 1XW9A 1G7OA 4PURA 1OC8A 1ABAA 2YZUA 2CA8A 4X1UA 1KBNA 1XWGA 4TXVA 5B6MA 4WBRD 2L57A 6GSUA 4ZL8A 2VL2A 2WCIA 5HR0A 3QCPA 1UA5A 2B7KA 5ECIB 4OO4A 2DMMA 2K8SA 4QL9A 1EWXA 1SKWB 4FYBA 1USBA 2I4AA 1ZL9A 1FOVA 1J08A 1WP0A 4V2MA 1ZZYA 1O8WA 2K8VA 1T8EB 4K0NA 1U87A 2X8CA 1QGVA 1TJDA 5LNKe 2OKAA 3FRCA 2HT9A 5KN3A 4MH2A 2C0DA 2H1GA 3FW2A 3QFAC 3G7IA 3KH9A 5DQSA 1MDKA 5A4WA 5B7CA 4O32A 3GTUA 2VCZA 1A0FA 4NHWA 2WULA 3APOA 2GSSA 2XBIA 2H1DA 2K9FA 2OE1A 1YEXA 2JACA 1I5GA 1SK0A 3HVVA 3TRPA 3VURA 5G2ZA 1XZOA 4TRXA 1T7PB 3D4TA 2DBCA 3RHBA 3W6GA 5G5EA 5IMZA 1G7EA 2GZZA 1AQVA 1OC9B 3TKSE 5J41A 4GSTA 5HFGA 3KXOA 3APSA 4KNDA 3ME7A 4IS0A 2X99A 1SYXA 3G7JA 1Z7RA 2VM2A 2WDUA 4XS4A 3ERGA 3P2AA 2G2QA 4AJ6A 3UJ1A 4H86A 2H1AA 3EE2A 3QFBC 4WBJA 4F03A 1F37A 2PMTA 2IPAA 1VGLA 3WT1A 2MMAA 5F05A 4RQXA 1X0RA 1ERVA 3DMLA 4I2TA 1PKWA 2KLXA 2BMXA 2NDOA 2NTOA 3C1RA 2YWOA 1GUHA 1K0DA 5EL8A 4EDZA 2VM1A 3KP8A 1SK2A 1U88A 3U5RE 3TJFA 4I6XA 2HE3A 5GAND 2AV4A 1SL0B 1O7UA 4V1Ag 2V2GA 3O6TA 4PQ1A 3KTLA 2PPTA 3GKNA 3L9VA 1BX9A 2MBTA 4KE3A 1A2MA 3IRAA 4D73B 5B8BA 4KDXA 2YWMA 4POKA 1JZOA 1AIUA 5D93A 1AUCA 3TJBA 3LFLA 2PU9C 1THXA 4IQ1A 1SJZA 2VL3A 5ABRA 4I2UA 5JCUA 1ACVA 5JCGA 2IMKA 3E3EA 1Z6NA 2LRTA 1X9MB 4OCFA 1J0FA 2A2RA 4GXZA 3HDCA 1GH2A 4BVXA 2V1MA 1XIYA 4ECIA 5EY6A 2LUSA 1BYEA 1OC9A 3C8EA 2H71A 2H1BA 1B4QA 2KP1A 5H5QA 3CYNA 3FKFA 3DWVA 4XS1A 2JSYA 1AC1A 1J9BA 5JWRB 2YCDA 2O7KA 1GLPA 5CRGA 1JZRA 1GNEA 1SENA 5HFKA 2RLIA 1O81A 3FR6A 3WGXA 2IJYA 4MH3A 4ML1A 12GSA 2QGVA 4MZWA 4QQ7A 1F9MA 2MMNA 5D8IA 3EU4A 2TRXA 2CZ3A 1BAYA 4MPFA 4PGTA 4J2FA 1XBSA 2DIZA 1H75A 3G7YA 2IMFA 4GCIA 1K0OA 1M9BA 3J7Yk 3KZQA 4G9HA 3UVTA 5F8BA 5DJLA 2IWTA 4HJ2A 5JWOB 1M99A 3FY7A 1YF1A 2FCHA 3VWUA 2DSAA 4EDYA 3HCZA 4PQHA 3VI7A 2LTKA 3MWHA 1YKAA 4ZBDA 2CQ9A 5HR1A 1YF0A 2NPBA 3H4KA 5GSSA 1HNBA 2N5FA 2HZEB 4OFTA 2LRCA 1X5CA 4ZBAA 5J4UA 4D73A 1M9AA 4ZILA 2R2JA 1GSSA 4FYUA 1FW1A 2FWGA 2E2MA 2KOKA 5ECRB 1SJ6A 4PXOA 4WXTA 1Z3EA 1TP9A 3RHCA 2HNLA 4KSMA 4O7HA 4JE1A 1XVWA 1UC7A 1C72A 1JZDA 3I43A 2HLSA 1MEKA 4RI7A 2B7JA 1PSQA 2LJAA 2GZPA 2B3SA 1XWKA 3A2VA 3D5JA 3LJRA 5H5SA 3F3RA 3NZNA 5A4UA 3LG6A 5E59A 1F3BA 3TKPA 5DCHA 4IGJA 1G6YA 2HRFA 3QAGA 4FIWA 4HJMA 2M80A 4ID0A 1ZMAA 4XIHA 4X0XA 2FA4A 4NHZA 3M9JA 2VD1A 4FYCA 3HZ4A 1SL2B 4EE0A 1XVQA 1HNCA 5HFIA 6GSYA 1M2DA 1YY7A 2C3NA 4MCUA 5AIVA 3P8WA 3M3MA 3EYTA 1TRUA 5AGYA 1G0TA 2OA7A 2MYGA 3MSZA 5ELGA 4ML6A 2ZUPA 3LXZA 3IE3A 4MJCA 2WRTA 5D9TA 3ME8A 3BBYA 3JCML 2DJKA 2JSZA 4K9ZA 3FZ5A 1PX6A 1B9XC 5D73A 3ZVJA 4Q5RA 5ECNB 1AW9A 3PGTA 1FVJA 1Y25A 2YZHA 2K18A 2H0GA 1VF2A 4NAXA 4ECJA 5GZZB 1SL1B 1R5PA 2CAIA 2YNXA 5COHA 2L6DA 3FZAA 1O85A 3H79A 4EKZA 2C4JA 3UBKA 2H0IA 4MA9A 4NV5A 2M72A 3L78A 4IHUA 4Q5FA 2H8LA 1TXXA 4XCSA 5B6NA 4HI7A 1GUKA 4GQFA 5ECQB 1JFUA 1GUMA 1WOUA 2GGTA 3VPQA 3ZMKA 3F4SA 1YEPA 2VIMA 4AJ7A 1KEBA 3KH7A 1Z7PA 5D96A 2L4CA 3FZ9A 1BQ7A 2B6MA 4OFMA 1ERUA 4KCEA 2O89A 3ZYWA 4ZBBA 3M9KA 2CX4A 4K7OA 1FVKA 1N2AA 2IIYA 2R37A 2WS2A 3D22A 1YQ1A 2G0FA 3H93A 2H6XA 2XC2A 4ECCA 3GUSA 2NBSA 5G5FA 3DKSA 2RM5A 5DJMA 1GSUA 3HJOA 3TKRA 2C80A 13GSA 3GSSA 4HUAA 1FB6A 4E8EA 2MMOA 3F6DA 1R5AA 4PUAA 3UOMA 3V1WA 2OBKA 5IMFA 1V9WA 3Q6OA 3QD9A 2DJ1A 4MZCA 1LBKA 2HSHA 2R6KA 3IK9A 4MF7A 1U6TA 1XOBA 1SK1A 4ACSA 4MJBA 2H0HA 2O87A 5ECKB 3AY8A 2GQMA 4FH8A 4NWYA 1AXDA 4IKHA 4ZB8A 4KA0A 3GHAA 2GDRA 1Z5YE 3WYWA 2X64A 3TRXA 3GH9A 1XWAA 3GIXA 1K0AA 3OR5A 2YANA 1TK8B 2YV9A 5CAXA 5ELAA 3GFKA 2L5OA 3IXRA 2VCWA 3ZRDA 4I8BA 4OFNA 3RPNA 4ZB9A 5CO3A 3CSIA 4Z7XA 3TUEA 5ECPB 1A2LA 1XXUA 4GWRA 4Q5NA 4BWQA 4GSSA 2F8FA 4LA1A 5E4WA 3CBUA 2LJKA 1TRSA 5KN1A 4IW9A 3DEXA 3LQ7A 5G31A 1B8XA 3TKSC 1SD9A 5IMDA 4K7NA 4WR5A 3H8QA 3VFIA 4G19A 3KMOA 4V2NA 3WGDA 4DEJA 1XW5A 4OO5A 3F0IA 1B9YC 3WGEA 2EC4A 1FHEA 2H6YA 2B1LA 1S3DA 2IMDA 2VD0A 2EIQA 2E2GA 3P90A 2B5YA 2IL3A 5IO2A 3IAM2 2OBIA 1PX7A 5FHIA 1XPVA 4F82A 1NHYA 3GMFA 2QSIA 4MZBA 2K6VA 1GSFA 4HQZA 2OE0A 1JZWA 2H70A 4WF5A 1O8XA 1DSBA 3SBCA 4DSRA 6GSVA 3SWLA 1SKRB 2QKEA 2AHEA 2VL2C 5CRHA 1GP1A 4WR4A 5IO0A 2A4VA 3HA9A 1TRVA 2DJ2A 2FHEA 5CRDA 4F9ZA 5IPHA 2YJ7A 4TR1B 4EXJA 1GNWA 1TOFA 5HQPA 2H76A 8GSSA 3ZIVA 2DJJA 1O73A 3DRNA 3D6IA 2YWNA 3PH9A 3I9V2 3J7Yb 3L9UA 2R5GA 4DSSB 1T4YA 4YQVA 1GTAA 3EURA 1M7TA 3CRTA 2OJLA 4IQAA 2DIYA 1XWBA 1K0NA 4MPGA 4L0WA 4BPYA 2VLTA 3GRXA 5GSTA 4NV2A 3HXSA 1N8JA 3MDKA 1BJXA 3TJJA 3ERWA 1OC3A 2GT5A 3R2QA 3ZZXA 4ZIJA 1B4PA 1OYJA 3VLNA 2OADA 2OACA 3VPTA 1GSQA 2J9HA 1GTIA 2CVKA 3DYRA 4K7IA 1Z6MA 3VWVA 5A5KA 1JHBA 3HJMA 1V57A 1ZGNA 3IR4A 3M8NA 4KAEA 3TRQA 3ZVJD 3LORA 1PMTA 1EGRA 22GSA 3LYPA 3ZMLA 3ZLPA 4MDCA 4JRRA 1GSEA 4WEYA 4OWYA 4TXOB 1OE8A 4WKWA 3FR9A 4AF2A 2FWEA 4KB3A 4N10A 2FWFA 2MMZA 3CTGA 3RBTA 1E2YA 3M0FA 1VF1A 5DVBA 2LQQA 2N5AA 2CAQA 1MDJA 1VF4A 3C1SA 1IYIA 5C04A 2YN1A 3A3TA 2XPEA 3L4NA 4ISDA 1NHOA 4RI6A 3E0UA 5AN1A 4CDOA 2PWJA 5J3RA 3G9BA 4TR1A 1KNGA 4Q5QA 3ZITA 2F3MA 2HXKA 4XRAA 2YWIA 3W8SA 1M2AA 4I97A 3F63A 2CVBA 2OE3A 3GSTA 4BVYA 3Q19A 3KM6A 3GH6A 3US3A 5ECOB 1YKCA 5AISA 5AIXA 4DSSA 4BL7A 1EEJA 1XWCA 2VO4A 3F8UA 1U3IA 1PRXA 1YJ6A 1YZXA 2N5BA 1TK5B 2DJ0A 3LYKA 2VCQA 2X8HA 1X9WB 1TU8A 2GSTA 2GS3A 3UEMA 1BG5A 3K8NA 5ECSA 2D2ZA 1K0CA 4GF0A 3Q74A 3GL5A 5CP1A 4XHMA 2MZCA 4YAPA 4WETA 2WFCA 3E9JB 1ZOFA 4HOJA 4N30A 3I69A 5FWGA 3IV4A 3ED3A 1YDKA 3RAZA 1V40A 1WPIA 1QK8A 3ISOA 3GNJA 4BA7A 3FHKA 1EP8A 3FYGA 1LU4A 1ILOA 3KTBA 4KDUA 1E6BA 4LLRA 5F07A 5IMVA 5CYYA 2H30A 1DUGA 4TXOA 1EOGA 1R4WA 1TTZA 1TI3A 2VUPA 18GSA 2Z9SA 3KEBA 2E7PA 3BCKA 2LNTA 5GAPD 2H73A 4LMWA 1AQWA 1MD4A 2H72A 1ERWA 1ST9A 3QAVA 1K0MA 2LQOA 3EINA 1B48A 3GX8A 1AAZA 4YAVA 3A5WA 5IQYA 1DBYA 2LNSA 2HI7A 4POMA 2YPMA 4HZ4A 1UN2A 4K8MA 2IMIA 4EL1A 2PVOC 4DSQA 4N0ZA 2BTOT 3I6AA 1M0UA 4L0UA 4KDYA 5IIZA 2HRNA 2DJ3A 1S3CA 1WMJA 3TDGA 2I9HA 2VOCA 5IOWA 1XOAA 2PVQA 5DALB 1FB0A 4XRDA 4MMMA 2C0EA 4WF4A 2X8GA 1ZYEA 2RM6A 1JLVA 1KTEA 2FD3A 5F06A 3D4MA 1A0RP 1EV4A 2JZRA 5ENUA 4V1Ap 4O5RA 1EGOA 3ERFA 2JZTA 2REMA 3TCOA 5CRWA 4PQIA 4JU5A 3KJYA 3HY2A 2PERA 1K3YA 1TKDB 4KCAA 4JBBA 3ZTLA 1NW2A 2EIOA 4EO3A 1FO5A 1EP7A 2A2SA 3TKQA 2GQLA 2JZSA 5LD0A 1W4VA 5LCZA 4EC0A 4CHSA 1SD8A 5B8AA 4HU9A 4IVFA 4TVEA 2R4VA 5D9XA 11GSA 1GWCA 4MJAA 1VF3A 3KD0A 3C71A 4IP1A 4HDEA 5KN2A 6GSWA 3EU3A 4PNGA 3ZL5A 4GRFA 4F0CA 1PQNA 1A24A 1OAZA 4F0BA 1SKSB 1QMVA 1MDIA 5KN0A 3GKKA 3VWWA 5CNWA 5EPFA 2B5XA 1X5EA 1PL2A 4LL1B 2JADA 1HQOA 1M2BA 4N0VA 5DCGA 4G10A 1Y6EA 3BD2A 2KP2A 1PGTA 2P5QA 5IMAA 4YQMA 1GL8A 1CQHA 2TIRA 3TOTA 3FK8A 4CW9A 4EUYA 3VK9A 3UBLA 2NVLA 3LEFA 2IFQB 2ZCTA 3QAWA 1T1VA 2XBQA 5A4VA 2HZFA 2CT6A 4YH2A 5DALA 3UMAA 3ZREA 2LSTA 1GSYA 3F3QA 3TB2A 4RUVA 3QPMA 1EZKA 2PBJA 3HVXA 1DE1A 1WRYA 1U3AA 4MLYA 1S3AA 2L6CA 3HHVA 1I9DA 3D0ZA 4PNFA 3IPZA 1T4ZA 1TDIA 4AGSA 2P31A 2CZ2A 1EV9A 2M46A 3IDVA 4ILFA 1FAAA 3UVHA 4MP4A 6GSTA 1BEDA 1HYUA 5INYA 3GX0A 1THOA 1RK4A 3MAKA 5H5RA 3QOUA 4ULXA 2L59A 2H74A 3EMPA 2O8VB
chains in the Genus database with same CATH superfamily
3NOFA 3LGCA 2MBSA 2FGXA 3HJPA 3CXGA 2H66A 2RIIA 2C1YA 5L71A 1LJRA 4ZB6A 2CV4A 2ES7A 2J23A 4K2DA 4P3YB 4PX1A 3BOAA 3EVIA 3N5OA 1XFLA 4IJIA 1QFNA 2ZNMA 5J9CA 4BWSA 4TR4A 4G0IA 2TRCP 5D9WA 1ERTA 4OCEA 2EIRA 3LXTA 2KUCA 3CRUA 1WIKA 4OD7A 4IELA 5IOXA 2R3XA 2RUEA 2LEGA 5HR3A 2FY6A 3IOSA 3LWAA 1SYRA 5J9BA 3HD5A 2CX3A 5DQYA 1GSDA 3KGKA 4JR4A 2L4QA 4PUFC 3RPPA 1A8LA 2AAWA 1R7HA 3EC3A 2LRNA 3GA4A 2VLVA 1CQGA 2VCTA 1A2JA 4IN0A 4Z2RA 1MTCA 3TOUA 3TGZA 4BVYB 2F8AA 4XTSA 4HZ2A 1GLQA 5FT3A 3D21A 2DLXA 4K6XA 3WT2A 4ZL9A 4BL7B 1T3BA 3QMXA 4Z2TA 2C3QA 4JR6A 3F4TA 2V6KA 1WE0A 5DDLA 3VI5A 2QA1A 4TOPA 2IFQA 2AUVA 4HU7A 3WD6A 4TKYA 3DIEA 10GSA 1GULA 16GSA 5G1KA 3HKRA 3HVNA 5ECLB 1Q4JA 3DVXA 3VWXA 2RUFA 5D9VA 1X9SB 2R0CA 4TN8A 4POLA 1HD2A 4GLTA 20GSA 1IYHA 3DVWA 3GN3A 3O76A 3W8JA 2V32A 4CY6A 3A2WA 3IA1A 2JL4A 2FA8A 4O92A 3UARA 3M1GA 2WJUA 4MK3A 2ON5A 1OVNA 4IBPA 1MD3A 3Q18A 4L5LA 2GT6A 4EF0A 1T00A 4JZQA 3BJ5A 2FNOA 1QXHA 3KP9A 3MNGA 4KSOA 1A8YA 1OKTA 2HFDA 4MF5A 1V98A 5IM9A 5EVOA 5ID2B 5CREA 4ZL7A 3O3TA 2E0QA 1PA3A 3DGQA 2R0PA 5DAKB 3ZIJA 1GRXA 4K0GA 1OKDA 3L0HA 4J56E 9GSSA 4L8EA 2VL9A 5J5NA 2DMLA 4LL4B 1DE2A 3KMNA 4OMVA 4G2EA 5IPGA 3GKXA 1VRSD 4L5OA 2H75A 5G30A 3F6FA 1EOHA 3HZ8A 1PD21 4DVCA 3GYKA 3IHQA 4NMUA 1PKZA 1RQMA 1TI1A 3C73A 2V6OA 1TRWA 1XCCA 1ZCPA 1RW1A 1GTUA 3KCMA 4N11A 4TR3A 3DD3A 3LSZA 1PL1A 3FEUA 2WGRA 1SJIA 2YP6A 2C3TA 14GSA 4KUNA 1G6WA 4TR0A 2QC7A 2P5RA 4EVMA 2ON7A 1V58A 1QUWA 2KHPA 1ZYQB 4KW6A 2HYXA 2WZ9A 1K0BA 2GSRA 2YOIA 3HYPA 2GVPA 2YJHA 4USSA 2GTUA 1ON4A 4ZXGA 1R26A 4NXIA 2GLRA 2I81A 3DXBA 2L5LA 5ECMB 4IJ3A 1PN9A 3EMXA 1SU9A 4AJ8A 2HRAA 4MJEA 3TJGA 2BJXA 4J57E 1K3OA 1F3AA 2IN3A 2WB9A 3RDWA 5HR2A 1V2AA 4IP6A 5IMCA 5F0GA 3FZ4A 3GKMA 1A23A 4HSCX 1UVZA 1F6MC 2B1KA 1NM3A 3QDNA 3F4RA 4GTUA 4GQCA 4YQUA 3CSJA 2C0FA 4FQUA 3A2XA 4F2IA 17GSA 1EEMA 1X5DA 4I5QA 2AJQB 3IC4A 2V41A 1XW6A 1HNAA 3BCIA 4K1FA 4LMVA 4NPBA 1M3IA 2FLSA 2XPDA 2LKUA 2PN8A 2VLUA 4MNNA 5ID2A 2H01A 5KEJA 3PR8A 5DAKA 4FO5A 3P7XA 5DBQA 7GSSA 1TK0B 2GSQA 3UL3A 2CVDA 5JCWA 1PN0A 1ZYNA 2B5EA 5JWQB 2AB6A 1QQ2A 3APQA 6GSSA 4EIPA 4HQSA 1TW9A 1NSWA 1F2EA 4ECBA 6GSXA 5C00A 3CTFA 4JEDA 2H19A 3GURA 2I3YA 1FG4A 2JU5A 2I1UA 4QL7A 1URMA 3H1NA 4XS6A 4KH7A 3L9SA 2FUG2 2C8UA 3C7MA 5ECHB 4HEA2 4KGIA 4HS1A 2GZYA 2PGTA 2F51A 2GQKA 2LJRA 2F9SA 4V2LA 2HSYA 3F9UA 2ALBA 3CSHA 2H6ZA 4MF6A 3EWLA 3TJKA 2VAFA 2YV7A 2VCVA 4GSNA 4MABA 3CMIA 1W89A 3N9JA 3GTUB 2P0GA 1Q98A 2VCXA 1O6JA 2PUKC 3PINA 2C0GA 3GL3A 1WWJA 3MYDA 3ZFLA 2HZEA 1K3LA 1AQXA 2LS5A 2AYTA 3QR6A 3TKSA 3KIJA 2LV3A 1Z9HA 4RQRA 2XHFA 4Z2UA 3IBHA 3S9FA 3HVSA 4KX4A 1H4OA 2O85A 2DKIA 2IMEA 3UIWA 4TW5A 3IAS2 4E8HA 2A2PA 3GV1A 1JLWA 4X43A 1TU7A 4POBA 3U6VA 5G1LA 3ZFBA 3EPTA 1WJKA 3NIVA 3IK7A 2DC5A 3FR3A 3UAPA 4XS4B 1ML6A 3IHGA 19GSA 1GTBA 2FWHA 1OE7A 1XW9A 1G7OA 4PURA 1OC8A 1ABAA 2YZUA 2CA8A 4X1UA 1KBNA 1XWGA 4TXVA 3A5IA 5B6MA 4WBRD 2L57A 6GSUA 4ZL8A 2VL2A 2WCIA 5HR0A 3FMWA 3QCPA 1UA5A 2B7KA 5ECIB 4OO4A 2DMMA 2K8SA 4QL9A 1EWXA 1SKWB 4FYBA 1USBA 2I4AA 1ZL9A 2X4AA 1FOVA 1J08A 1WP0A 4V2MA 1ZZYA 1O8WA 2K8VA 1T8EB 4K0NA 1U87A 2X8CA 1QGVA 1TJDA 2X49A 5LNKe 2OKAA 3FRCA 2HT9A 5KN3A 4MH2A 2C0DA 2H1GA 3FW2A 3QFAC 3G7IA 3KH9A 5DQSA 1MDKA 5A4WA 5B7CA 4O32A 3GTUA 2VCZA 1A0FA 4NHWA 2WULA 3APOA 2GSSA 2XBIA 2H1DA 2K9FA 2OE1A 1YEXA 2JACA 1I5GA 1SK0A 3HVVA 3TRPA 3VURA 5G2ZA 1XZOA 4TRXA 1T7PB 3D4TA 2DBCA 3RHBA 3W6GA 5G5EA 5IMZA 4BVXB 1G7EA 2GZZA 1AQVA 1OC9B 3TKSE 5J41A 4GSTA 5HFGA 3KXOA 3APSA 4KNDA 3ME7A 4IS0A 2X99A 1SYXA 3G7JA 1Z7RA 2VM2A 2WDUA 4XS4A 3ERGA 3P2AA 2G2QA 4AJ6A 3UJ1A 4H86A 2H1AA 3EE2A 3QFBC 4WBJA 4F03A 1F37A 2PMTA 2IPAA 1VGLA 3WT1A 2MMAA 5F05A 4RQXA 1X0RA 1ERVA 3DMLA 4I2TA 1PKWA 2KLXA 2BMXA 2QA2A 2NDOA 2NTOA 3C1RA 2YWOA 1GUHA 1K0DA 5EL8A 4EDZA 4K5RA 2VM1A 3KP8A 1SK2A 1U88A 3U5RE 3TJFA 4I6XA 2HE3A 5GAND 2AV4A 1SL0B 1O7UA 4V1Ag 2V2GA 3O6TA 4PQ1A 3KTLA 2PPTA 3GKNA 3L9VA 1BX9A 2MBTA 4KE3A 4PTSA 1A2MA 3IRAA 4D73B 4G0KA 5B8BA 4KDXA 2YWMA 4POKA 1JZOA 1AIUA 5D93A 1AUCA 3TJBA 3LFLA 2PU9C 1THXA 4IQ1A 1SJZA 2VL3A 5ABRA 4I2UA 5JCUA 1ACVA 3PPUA 5JCGA 2IMKA 3E3EA 1Z6NA 2LRTA 1X9MB 4OCFA 1J0FA 2A2RA 4GXZA 1FOHA 3HDCA 1GH2A 4BVXA 2V1MA 1XIYA 4ECIA 5EY6A 2LUSA 1BYEA 1OC9A 3C8EA 2H71A 2H1BA 1B4QA 2KP1A 5H5QA 3CYNA 3FKFA 3DWVA 4XS1A 2JSYA 1AC1A 1J9BA 5JWRB 2YCDA 2O7KA 1GLPA 5CRGA 1JZRA 1GNEA 1SENA 5HFKA 2RLIA 1O81A 3FR6A 3WGXA 2IJYA 4MH3A 4ML1A 12GSA 2QGVA 2R0GA 4MZWA 4QQ7A 1F9MA 2MMNA 5D8IA 3EU4A 2TRXA 2CZ3A 1BAYA 4MPFA 4PGTA 5KOXA 4J2FA 1XBSA 2DIZA 1H75A 3G7YA 2IMFA 4GCIA 1K0OA 1M9BA 3J7Yk 3KZQA 4G9HA 3UVTA 5F8BA 5DJLA 2IWTA 4HJ2A 5JWOB 1M99A 3FY7A 1YF1A 2FCHA 3VWUA 2DSAA 4A5PA 4EDYA 3HCZA 4PQHA 3VI7A 2LTKA 3MWHA 4YKGA 1YKAA 4ZBDA 2CQ9A 4G0LA 5HR1A 1YF0A 2NPBA 2DKHA 3H4KA 5GSSA 1HNBA 2N5FA 2HZEB 4OFTA 2LRCA 1X5CA 4ZBAA 5J4UA 4D73A 1M9AA 4ZILA 2R2JA 1GSSA 4FYUA 1FW1A 2FWGA 2E2MA 1PFOA 2KOKA 5ECRB 1SJ6A 4PXOA 4WXTA 1Z3EA 1TP9A 3RHCA 2HNLA 4KSMA 4O7HA 4JE1A 1XVWA 4O5QA 1UC7A 1C72A 1JZDA 3I43A 2HLSA 1MEKA 4RI7A 2B7JA 1PSQA 2LJAA 2GZPA 2B3SA 1XWKA 3A2VA 3D5JA 3LJRA 5H5SA 3F3RA 3NZNA 5A4UA 3LG6A 5E59A 1F3BA 3TKPA 5DCHA 4IGJA 1G6YA 2HRFA 3QAGA 4FIWA 4HJMA 2M80A 4ID0A 1ZMAA 4XIHA 4X0XA 2FA4A 4NHZA 3M9JA 2VD1A 4FYCA 3HZ4A 1SL2B 4EE0A 1XVQA 1HNCA 5HFIA 6GSYA 1M2DA 1YY7A 2C3NA 4MCUA 5AIVA 3P8WA 3M3MA 3EYTA 1TRUA 5AGYA 1G0TA 2OA7A 2MYGA 3MSZA 5ELGA 4ML6A 2ZUPA 3LXZA 3IE3A 4MJCA 2WRTA 5D9TA 3ME8A 3BBYA 3JCML 2DJKA 2JSZA 4K9ZA 3FZ5A 1PX6A 1B9XC 5D73A 3ZVJA 4Q5RA 5ECNB 1AW9A 3PGTA 1FVJA 1Y25A 2YZHA 2K18A 2H0GA 1VF2A 4NAXA 4ECJA 5GZZB 1SL1B 1R5PA 2CAIA 2YNXA 5COHA 2L6DA 3FZAA 1O85A 3H79A 4EKZA 2C4JA 3UBKA 2H0IA 2A4HA 4MA9A 4NV5A 2M72A 3L78A 4IHUA 4Q5FA 2H8LA 1TXXA 4XCSA 5B6NA 4HI7A 1GUKA 4GQFA 5ECQB 1JFUA 1GUMA 1WOUA 2GGTA 3VPQA 3ZMKA 3F4SA 1YEPA 2VIMA 4AJ7A 1KEBA 3KH7A 1Z7PA 5D96A 2L4CA 3FZ9A 1BQ7A 2B6MA 4OFMA 1ERUA 4KCEA 2O89A 3ZYWA 4ZBBA 3M9KA 2CX4A 4K7OA 1FVKA 1N2AA 2IIYA 2R37A 2WS2A 3D22A 2UZ8A 1YQ1A 2G0FA 3H93A 2H6XA 2XC2A 4ECCA 3GUSA 2NBSA 5G5FA 3DKSA 2RM5A 5DJMA 1GSUA 3HJOA 3TKRA 2C80A 13GSA 3GSSA 4HUAA 1FB6A 4E8EA 2MMOA 4X4JA 3F6DA 1R5AA 4PUAA 3UOMA 3V1WA 2OBKA 5IMFA 1V9WA 3Q6OA 3QD9A 2DJ1A 4MZCA 1LBKA 2HSHA 2R6KA 3IK9A 4MF7A 1U6TA 1XOBA 1SK1A 4ACSA 4MJBA 2H0HA 2O87A 5ECKB 3AY8A 2GQMA 4FH8A 4NWYA 1AXDA 4IKHA 4ZB8A 4KA0A 3GHAA 2GDRA 1Z5YE 3WYWA 2X64A 3TRXA 3GH9A 1XWAA 3GIXA 1K0AA 3OR5A 2YANA 1TK8B 2YV9A 5CAXA 5ELAA 3GFKA 2L5OA 3IXRA 2VCWA 3ZRDA 4I8BA 4OFNA 3RPNA 4ZB9A 5CO3A 3CSIA 4Z7XA 3TUEA 5ECPB 1A2LA 1XXUA 4GWRA 4Q5NA 4BWQA 4GSSA 3R3EA 2F8FA 4LA1A 5E4WA 3CBUA 2LJKA 1TRSA 5KN1A 4IW9A 3DEXA 3LQ7A 5G31A 1B8XA 3TKSC 1SD9A 5IMDA 4K7NA 4WR5A 3H8QA 3VFIA 4G19A 3KMOA 4V2NA 3WGDA 4DEJA 1XW5A 4OO5A 3F0IA 1B9YC 3WGEA 2EC4A 1FHEA 2H6YA 2B1LA 1S3DA 2IMDA 2VD0A 2EIQA 2E2GA 3P90A 2B5YA 2IL3A 5IO2A 3IAM2 2OBIA 1PX7A 5FHIA 1XPVA 1XG8A 4F82A 1NHYA 3GMFA 2QSIA 4MZBA 2K6VA 1GSFA 4HQZA 2OE0A 1JZWA 1S3RA 2H70A 5BRTA 4CY8A 4WF5A 1O8XA 1DSBA 3SBCA 4DSRA 6GSVA 3SWLA 1SKRB 2QKEA 4ICYA 2AHEA 2VL2C 5CRHA 1GP1A 4WR4A 5IO0A 2A4VA 3HA9A 1TRVA 2DJ2A 2FHEA 5CRDA 4F9ZA 5BMUA 5IPHA 2YJ7A 4TR1B 4EXJA 1GNWA 1TOFA 5HQPA 2H76A 8GSSA 3ZIVA 2DJJA 1O73A 3DRNA 3D6IA 2YWNA 3PH9A 3I9V2 3J7Yb 3L9UA 2R5GA 4DSSB 1T4YA 4YQVA 1GTAA 3EURA 1M7TA 3CRTA 2OJLA 4IQAA 2DIYA 1XWBA 1K0NA 1M3JA 4MPGA 4L0WA 4BPYA 2VLTA 3GRXA 5GSTA 4NV2A 3HXSA 1N8JA 3MDKA 1BJXA 3TJJA 3ERWA 1OC3A 2GT5A 3R2QA 3ZZXA 4ZIJA 1B4PA 1OYJA 3VLNA 2OADA 2OACA 3VPTA 1GSQA 2J9HA 1GTIA 2CVKA 3DYRA 4K7IA 1Z6MA 3VWVA 5A5KA 1JHBA 3HJMA 1V57A 1ZGNA 3IR4A 3M8NA 4KAEA 3TRQA 3ZVJD 3LORA 1PMTA 1EGRA 22GSA 3LYPA 3ZMLA 3ZLPA 4MDCA 4JRRA 1GSEA 4WEYA 4OWYA 4TXOB 1OE8A 4WKWA 3FR9A 4AF2A 2FWEA 4K2XA 4KB3A 4N10A 2FWFA 2MMZA 3CTGA 3RBTA 1E2YA 3M0FA 1VF1A 5DVBA 2LQQA 2N5AA 2CAQA 1MDJA 1VF4A 3C1SA 1IYIA 5C04A 2YN1A 3A3TA 2XPEA 3L4NA 4ISDA 1NHOA 4RI6A 4BIKA 3E0UA 5AN1A 4CDOA 2PWJA 5J3RA 3G9BA 4TR1A 1KNGA 4Q5QA 3ZITA 2F3MA 2HXKA 4XRAA 2YWIA 3W8SA 1M2AA 4I97A 3F63A 2CVBA 2OE3A 3GSTA 4BVYA 3Q19A 5KOWA 3KM6A 3GH6A 3US3A 3MIXA 5ECOB 1YKCA 5AISA 5AIXA 4KF9A 4DSSA 4BL7A 1EEJA 1XWCA 2VO4A 3F8UA 1U3IA 1PRXA 1YJ6A 1YZXA 2N5BA 1TK5B 2DJ0A 3LYKA 2VCQA 2X8HA 1X9WB 1TU8A 2GSTA 2GS3A 3UEMA 1BG5A 3K8NA 5ECSA 2D2ZA 1K0CA 4GF0A 3CQFA 3Q74A 3GL5A 5CP1A 4XHMA 2MZCA 4YAPA 4WETA 2WFCA 3E9JB 1ZOFA 4HOJA 4N30A 3I69A 5FWGA 1ZYPA 3IV4A 3ED3A 1YDKA 3RAZA 1V40A 1WPIA 1QK8A 3ISOA 2HSMA 3GNJA 4BA7A 3FHKA 1EP8A 3FYGA 1LU4A 1ILOA 3KTBA 4KDUA 1E6BA 4LLRA 5F07A 5IMVA 5CYYA 2H30A 1DUGA 4TXOA 1EOGA 1R4WA 1TTZA 2HRKA 1TI3A 2VUPA 18GSA 2Z9SA 3KEBA 2E7PA 3BCKA 2LNTA 5GAPD 2H73A 4LMWA 1AQWA 1MD4A 2H72A 1ERWA 1ST9A 3QAVA 1K0MA 2LQOA 3EINA 1B48A 3GX8A 1AAZA 4YAVA 3A5WA 5IQYA 1DBYA 2LNSA 2HI7A 4O5UA 4POMA 2YPMA 4HZ4A 1UN2A 4K8MA 2IMIA 4EL1A 2PVOC 4DSQA 4N0ZA 2BTOT 3I6AA 1M0UA 4L0UA 4KDYA 5IIZA 2HRNA 2DJ3A 1S3CA 1WMJA 3TDGA 2I9HA 2VOCA 5IOWA 1XOAA 2PVQA 1FB0A 5DALB 4XRDA 4MMMA 2C0EA 4WF4A 2X8GA 1ZYEA 2RM6A 1JLVA 1KTEA 2FD3A 5F06A 3D4MA 1A0RP 1EV4A 2JZRA 5ENUA 4V1Ap 4O5RA 1EGOA 3ERFA 2JZTA 2REMA 3TCOA 5CRWA 4PQIA 4JU5A 3KJYA 3HY2A 2PERA 1K3YA 1TKDB 4EIQA 4KCAA 4JBBA 3ZTLA 1NW2A 2EIOA 4EO3A 1FO5A 1EP7A 2A2SA 3TKQA 2GQLA 2JZSA 5LD0A 1W4VA 5LCZA 4EC0A 4CHSA 1SD8A 5B8AA 4HU9A 4IVFA 4TVEA 3IC8A 2R4VA 5D9XA 11GSA 1GWCA 4MJAA 1VF3A 3KD0A 3C71A 4IP1A 4HDEA 5KN2A 6GSWA 3EU3A 4PNGA 3ZL5A 4GRFA 4F0CA 1PQNA 1A24A 1OAZA 4F0BA 1SKSB 1QMVA 1MDIA 5KN0A 3GKKA 3VWWA 5CNWA 5EPFA 2B5XA 1X5EA 1PL2A 4LL1B 2JADA 1HQOA 1M2BA 4K5SA 4N0VA 5DCGA 4G10A 1Y6EA 4YKFA 3BD2A 2KP2A 1PGTA 2P5QA 5IMAA 4YQMA 1GL8A 1CQHA 2TIRA 3TOTA 3FK8A 4CW9A 4EUYA 3VK9A 3UBLA 2NVLA 3LEFA 2IFQB 2ZCTA 3LW9A 3QAWA 1T1VA 2XBQA 5A4VA 2HZFA 2CT6A 4YH2A 5DALA 3UMAA 3ZREA 2LSTA 1GSYA 3F3QA 3TB2A 4RUVA 3QPMA 1EZKA 2PBJA 3HVXA 1DE1A 1WRYA 1U3AA 4MLYA 1S3AA 2L6CA 3HHVA 1I9DA 3D0ZA 4PNFA 3IPZA 1T4ZA 1TDIA 4AGSA 2P31A 2CZ2A 1EV9A 2M46A 3IDVA 4ILFA 1FAAA 3UVHA 4MP4A 6GSTA 1BEDA 1HYUA 5INYA 3GX0A 1THOA 1RK4A 3MAKA 5H5RA 3QOUA 4ULXA 2L59A 2H74A 3EMPA 2O8VB
chains in the Genus database with same CATH topology
3NOFA 3LGCA 2MBSA 2FGXA 3HJPA 3CXGA 2H66A 2RIIA 2C1YA 5L71A 1LJRA 4ZB6A 2CV4A 2ES7A 2J23A 4K2DA 4P3YB 4PX1A 3BOAA 3EVIA 3N5OA 1XFLA 4IJIA 1QFNA 2ZNMA 5J9CA 4BWSA 4TR4A 4G0IA 2TRCP 5D9WA 1ERTA 4OCEA 2EIRA 3LXTA 2KUCA 3CRUA 1WIKA 4OD7A 4IELA 5IOXA 2R3XA 2RUEA 2LEGA 5HR3A 2FY6A 3IOSA 3LWAA 1SYRA 5J9BA 3HD5A 2CX3A 5DQYA 1GSDA 3KGKA 4JR4A 2L4QA 4PUFC 3RPPA 1A8LA 2AAWA 1R7HA 3EC3A 2LRNA 3GA4A 2VLVA 1CQGA 2VCTA 1A2JA 4IN0A 4Z2RA 1MTCA 3TOUA 3TGZA 4BVYB 2F8AA 4XTSA 4HZ2A 1GLQA 5FT3A 3D21A 2DLXA 4K6XA 3WT2A 4ZL9A 4BL7B 1T3BA 3QMXA 4Z2TA 2C3QA 4JR6A 3F4TA 2V6KA 1WE0A 5DDLA 3VI5A 2QA1A 4TOPA 2IFQA 2AUVA 4HU7A 3WD6A 4TKYA 3DIEA 10GSA 1GULA 16GSA 5G1KA 3HKRA 5ECLB 1Q4JA 3DVXA 3VWXA 2RUFA 5D9VA 1X9SB 2R0CA 4TN8A 4POLA 1HD2A 4GLTA 20GSA 1IYHA 3DVWA 3GN3A 3O76A 3W8JA 2V32A 4CY6A 3A2WA 3IA1A 2JL4A 2FA8A 4O92A 3UARA 3M1GA 2WJUA 4MK3A 2ON5A 1OVNA 4IBPA 1MD3A 3Q18A 4L5LA 2GT6A 4EF0A 1T00A 4JZQA 3BJ5A 2FNOA 1QXHA 3KP9A 3MNGA 4KSOA 1A8YA 1OKTA 2HFDA 4MF5A 1V98A 5IM9A 5EVOA 5ID2B 5CREA 4ZL7A 3O3TA 2E0QA 1PA3A 3DGQA 2R0PA 5DAKB 3ZIJA 1GRXA 4K0GA 1OKDA 3L0HA 4J56E 9GSSA 4L8EA 2VL9A 5J5NA 2DMLA 4LL4B 1DE2A 3KMNA 4OMVA 4G2EA 5IPGA 3GKXA 1VRSD 4L5OA 2H75A 5G30A 3F6FA 1EOHA 3HZ8A 1PD21 4DVCA 3GYKA 3IHQA 4NMUA 1PKZA 1RQMA 1TI1A 3C73A 2V6OA 1TRWA 1XCCA 1ZCPA 1RW1A 1GTUA 3KCMA 4N11A 4TR3A 3DD3A 3LSZA 1PL1A 3FEUA 2WGRA 1SJIA 2YP6A 2C3TA 14GSA 4KUNA 1G6WA 4TR0A 2QC7A 2P5RA 4EVMA 2ON7A 1V58A 1QUWA 2KHPA 1ZYQB 4KW6A 2HYXA 2WZ9A 1K0BA 2GSRA 2YOIA 3HYPA 2GVPA 2YJHA 4USSA 2GTUA 1ON4A 4ZXGA 1R26A 4NXIA 2GLRA 2I81A 3DXBA 2L5LA 5ECMB 4IJ3A 1PN9A 3EMXA 1SU9A 4AJ8A 2HRAA 4MJEA 3TJGA 2BJXA 4J57E 1K3OA 1F3AA 2IN3A 2WB9A 3RDWA 5HR2A 1V2AA 4IP6A 5IMCA 5F0GA 3FZ4A 3GKMA 1A23A 1UVZA 1F6MC 2B1KA 1NM3A 3QDNA 3F4RA 4GTUA 4GQCA 4YQUA 3CSJA 2C0FA 4FQUA 3A2XA 4F2IA 17GSA 1EEMA 1X5DA 4I5QA 2AJQB 3IC4A 2V41A 1XW6A 1HNAA 3BCIA 4K1FA 4LMVA 4NPBA 2FLSA 2XPDA 2LKUA 2PN8A 2VLUA 4MNNA 5ID2A 2H01A 5KEJA 3PR8A 5DAKA 4FO5A 3P7XA 5DBQA 7GSSA 1TK0B 2GSQA 3UL3A 2CVDA 5JCWA 1PN0A 1ZYNA 2B5EA 5JWQB 2AB6A 1QQ2A 3APQA 6GSSA 4EIPA 4HQSA 1TW9A 1NSWA 1F2EA 4ECBA 6GSXA 5C00A 3CTFA 4JEDA 2H19A 3GURA 2I3YA 1FG4A 2JU5A 2I1UA 4QL7A 1URMA 3H1NA 4XS6A 4KH7A 3L9SA 2FUG2 2C8UA 3C7MA 5ECHB 4HEA2 4KGIA 4HS1A 2GZYA 2PGTA 2F51A 2GQKA 2LJRA 2F9SA 4V2LA 2HSYA 3F9UA 2ALBA 3CSHA 2H6ZA 4MF6A 3EWLA 3TJKA 2VAFA 2YV7A 2VCVA 4GSNA 4MABA 3CMIA 1W89A 3N9JA 3GTUB 2P0GA 1Q98A 2VCXA 1O6JA 2PUKC 3PINA 2C0GA 3GL3A 1WWJA 3MYDA 3ZFLA 2HZEA 1K3LA 1AQXA 2LS5A 2AYTA 3QR6A 3TKSA 3KIJA 2LV3A 1Z9HA 4RQRA 2XHFA 4Z2UA 3IBHA 3S9FA 3HVSA 4KX4A 1H4OA 2O85A 2DKIA 2IMEA 3UIWA 4TW5A 3IAS2 4E8HA 2A2PA 3GV1A 1JLWA 4X43A 1TU7A 4POBA 3U6VA 5G1LA 3ZFBA 3EPTA 1WJKA 3NIVA 3IK7A 2DC5A 3FR3A 3UAPA 4XS4B 1ML6A 3IHGA 19GSA 1GTBA 2FWHA 1OE7A 1XW9A 1G7OA 4PURA 1OC8A 1ABAA 2YZUA 2CA8A 4X1UA 1KBNA 1XWGA 4TXVA 3A5IA 5B6MA 4WBRD 2L57A 6GSUA 4ZL8A 2VL2A 2WCIA 5HR0A 3FMWA 3QCPA 1UA5A 2B7KA 5ECIB 4OO4A 2DMMA 2K8SA 4QL9A 1EWXA 1SKWB 4FYBA 1USBA 2I4AA 1ZL9A 2X4AA 1FOVA 1J08A 1WP0A 4V2MA 1ZZYA 1O8WA 2K8VA 1T8EB 4K0NA 1U87A 2X8CA 1QGVA 1TJDA 2X49A 5LNKe 2OKAA 3FRCA 2HT9A 5KN3A 4MH2A 2C0DA 2H1GA 3FW2A 3QFAC 3G7IA 3KH9A 5DQSA 1MDKA 5A4WA 5B7CA 4O32A 3GTUA 2VCZA 1A0FA 4NHWA 2WULA 3APOA 2GSSA 2XBIA 2H1DA 2K9FA 2OE1A 1YEXA 2JACA 1I5GA 1SK0A 3HVVA 3TRPA 3VURA 5G2ZA 1XZOA 4TRXA 1T7PB 3D4TA 2DBCA 3RHBA 3W6GA 5G5EA 5IMZA 4BVXB 1G7EA 2GZZA 1AQVA 1OC9B 3TKSE 5J41A 4GSTA 5HFGA 3KXOA 3APSA 4KNDA 3ME7A 4IS0A 2X99A 1SYXA 3G7JA 1Z7RA 2VM2A 2WDUA 4XS4A 3ERGA 3P2AA 2G2QA 4AJ6A 3UJ1A 4H86A 2H1AA 3EE2A 3QFBC 4WBJA 4F03A 1F37A 2PMTA 2IPAA 1VGLA 3WT1A 2MMAA 5F05A 4RQXA 1X0RA 1ERVA 3DMLA 4I2TA 1PKWA 2KLXA 2BMXA 2QA2A 2NDOA 2NTOA 3C1RA 2YWOA 1GUHA 1K0DA 5EL8A 4EDZA 4K5RA 2VM1A 3KP8A 1SK2A 1U88A 3U5RE 3TJFA 4I6XA 2HE3A 5GAND 2AV4A 1SL0B 1O7UA 4V1Ag 2V2GA 3O6TA 4PQ1A 3KTLA 2PPTA 3GKNA 3L9VA 1BX9A 2MBTA 4KE3A 4PTSA 1A2MA 3IRAA 4D73B 4G0KA 5B8BA 4KDXA 2YWMA 4POKA 1JZOA 1AIUA 5D93A 1AUCA 3TJBA 3LFLA 2PU9C 1THXA 4IQ1A 1SJZA 2VL3A 5ABRA 4I2UA 5JCUA 1ACVA 3PPUA 5JCGA 2IMKA 3E3EA 1Z6NA 2LRTA 1X9MB 4OCFA 1J0FA 2A2RA 4GXZA 1FOHA 3HDCA 1GH2A 4BVXA 2V1MA 1XIYA 4ECIA 5EY6A 2LUSA 1BYEA 1OC9A 3C8EA 2H71A 2H1BA 1B4QA 2KP1A 5H5QA 3CYNA 3FKFA 3DWVA 4XS1A 2JSYA 1AC1A 1J9BA 5JWRB 2YCDA 2O7KA 1GLPA 5CRGA 1JZRA 1GNEA 1SENA 5HFKA 2RLIA 1O81A 3FR6A 3WGXA 2IJYA 4MH3A 4ML1A 12GSA 2QGVA 2R0GA 4MZWA 4QQ7A 1F9MA 2MMNA 5D8IA 3EU4A 2TRXA 2CZ3A 1BAYA 4MPFA 4PGTA 5KOXA 4J2FA 1XBSA 2DIZA 1H75A 3G7YA 2IMFA 4GCIA 1K0OA 1M9BA 3J7Yk 3KZQA 4G9HA 3UVTA 5F8BA 5DJLA 2IWTA 4HJ2A 5JWOB 1M99A 3FY7A 1YF1A 2FCHA 3VWUA 2DSAA 4A5PA 4EDYA 3HCZA 4PQHA 3VI7A 2LTKA 3MWHA 4YKGA 1YKAA 4ZBDA 2CQ9A 4G0LA 5HR1A 1YF0A 2NPBA 2DKHA 3H4KA 5GSSA 1HNBA 2N5FA 2HZEB 4OFTA 2LRCA 1X5CA 4ZBAA 5J4UA 4D73A 1M9AA 4ZILA 2R2JA 1GSSA 4FYUA 1FW1A 2FWGA 2E2MA 2KOKA 5ECRB 1SJ6A 4PXOA 4WXTA 1Z3EA 1TP9A 3RHCA 2HNLA 4KSMA 4O7HA 4JE1A 1XVWA 4O5QA 1UC7A 1C72A 1JZDA 3I43A 2HLSA 1MEKA 4RI7A 2B7JA 1PSQA 2LJAA 2GZPA 2B3SA 1XWKA 3A2VA 3D5JA 3LJRA 5H5SA 3F3RA 3NZNA 5A4UA 3LG6A 5E59A 1F3BA 3TKPA 5DCHA 4IGJA 1G6YA 2HRFA 3QAGA 4FIWA 4HJMA 2M80A 4ID0A 1ZMAA 4XIHA 4X0XA 2FA4A 4NHZA 3M9JA 2VD1A 4FYCA 3HZ4A 1SL2B 4EE0A 1XVQA 1HNCA 5HFIA 6GSYA 1M2DA 1YY7A 2C3NA 4MCUA 5AIVA 3P8WA 3M3MA 3EYTA 1TRUA 5AGYA 1G0TA 2OA7A 2MYGA 3MSZA 5ELGA 4ML6A 2ZUPA 3LXZA 3IE3A 4MJCA 2WRTA 5D9TA 3ME8A 3BBYA 3JCML 2DJKA 2JSZA 4K9ZA 3FZ5A 1PX6A 1B9XC 5D73A 3ZVJA 4Q5RA 5ECNB 1AW9A 3PGTA 1FVJA 1Y25A 2YZHA 2K18A 2H0GA 1VF2A 4NAXA 4ECJA 5GZZB 1SL1B 1R5PA 2CAIA 2YNXA 5COHA 2L6DA 3FZAA 1O85A 3H79A 4EKZA 2C4JA 3UBKA 2H0IA 2A4HA 4MA9A 4NV5A 2M72A 3L78A 4IHUA 4Q5FA 2H8LA 1TXXA 4XCSA 5B6NA 4HI7A 1GUKA 4GQFA 5ECQB 1JFUA 1GUMA 1WOUA 2GGTA 3VPQA 3ZMKA 3F4SA 1YEPA 2VIMA 4AJ7A 1KEBA 3KH7A 1Z7PA 5D96A 2L4CA 3FZ9A 1BQ7A 2B6MA 4OFMA 1ERUA 4KCEA 2O89A 3ZYWA 4ZBBA 3M9KA 2CX4A 4K7OA 1FVKA 1N2AA 2IIYA 2R37A 2WS2A 3D22A 2UZ8A 1YQ1A 2G0FA 3H93A 2H6XA 2XC2A 4ECCA 3GUSA 2NBSA 5G5FA 3DKSA 2RM5A 5DJMA 1GSUA 3HJOA 3TKRA 2C80A 13GSA 3GSSA 4HUAA 1FB6A 4E8EA 2MMOA 4X4JA 3F6DA 1R5AA 4PUAA 3UOMA 3V1WA 2OBKA 5IMFA 1V9WA 3Q6OA 3QD9A 2DJ1A 4MZCA 1LBKA 2HSHA 2R6KA 3IK9A 4MF7A 1U6TA 1XOBA 1SK1A 4ACSA 4MJBA 2H0HA 2O87A 5ECKB 3AY8A 2GQMA 4FH8A 4NWYA 1AXDA 4IKHA 4ZB8A 4KA0A 3GHAA 2GDRA 1Z5YE 3WYWA 2X64A 3TRXA 3GH9A 1XWAA 3GIXA 1K0AA 3OR5A 2YANA 1TK8B 2YV9A 5CAXA 5ELAA 3GFKA 2L5OA 3IXRA 2VCWA 3ZRDA 4I8BA 4OFNA 3RPNA 4ZB9A 5CO3A 3CSIA 4Z7XA 3TUEA 5ECPB 1A2LA 1XXUA 4GWRA 4Q5NA 4BWQA 4GSSA 3R3EA 2F8FA 4LA1A 5E4WA 3CBUA 2LJKA 1TRSA 5KN1A 4IW9A 3DEXA 3LQ7A 5G31A 1B8XA 3TKSC 1SD9A 5IMDA 4K7NA 4WR5A 3H8QA 3VFIA 4G19A 3KMOA 4V2NA 3WGDA 4DEJA 1XW5A 4OO5A 3F0IA 1B9YC 3WGEA 2EC4A 1FHEA 2H6YA 2B1LA 1S3DA 2IMDA 2VD0A 2EIQA 2E2GA 3P90A 2B5YA 2IL3A 5IO2A 3IAM2 2OBIA 1PX7A 5FHIA 1XPVA 4F82A 1NHYA 3GMFA 2QSIA 4MZBA 2K6VA 1GSFA 4HQZA 2OE0A 1JZWA 5BRTA 2H70A 4CY8A 4WF5A 1O8XA 1DSBA 3SBCA 4DSRA 6GSVA 3SWLA 1SKRB 2QKEA 4ICYA 2AHEA 2VL2C 5CRHA 1GP1A 4WR4A 5IO0A 2A4VA 3HA9A 1TRVA 2DJ2A 2FHEA 5CRDA 4F9ZA 5BMUA 5IPHA 2YJ7A 4TR1B 4EXJA 1GNWA 1TOFA 5HQPA 2H76A 8GSSA 3ZIVA 2DJJA 1O73A 3DRNA 3D6IA 2YWNA 3PH9A 3I9V2 3J7Yb 3L9UA 2R5GA 4DSSB 1T4YA 4YQVA 1GTAA 3EURA 1M7TA 3CRTA 2OJLA 4IQAA 2DIYA 1XWBA 1K0NA 4MPGA 4L0WA 4BPYA 2VLTA 3GRXA 5GSTA 4NV2A 3HXSA 1N8JA 3MDKA 1BJXA 3TJJA 3ERWA 1OC3A 2GT5A 3R2QA 3ZZXA 4ZIJA 1B4PA 1OYJA 3VLNA 2OADA 2OACA 3VPTA 1GSQA 2J9HA 1GTIA 2CVKA 3DYRA 4K7IA 1Z6MA 3VWVA 5A5KA 1JHBA 3HJMA 1V57A 1ZGNA 3IR4A 3M8NA 4KAEA 3TRQA 3ZVJD 3LORA 1PMTA 1EGRA 22GSA 3LYPA 3ZMLA 3ZLPA 4MDCA 4JRRA 1GSEA 4WEYA 4OWYA 4TXOB 1OE8A 4WKWA 3FR9A 4AF2A 2FWEA 4K2XA 4KB3A 4N10A 2FWFA 2MMZA 3CTGA 3RBTA 1E2YA 3M0FA 1VF1A 5DVBA 2LQQA 2N5AA 2CAQA 1MDJA 1VF4A 3C1SA 1IYIA 5C04A 2YN1A 3A3TA 2XPEA 3L4NA 4ISDA 1NHOA 4RI6A 3E0UA 5AN1A 4CDOA 2PWJA 5J3RA 3G9BA 4TR1A 1KNGA 4Q5QA 3ZITA 2F3MA 2HXKA 4XRAA 2YWIA 3W8SA 1M2AA 4I97A 3F63A 2CVBA 2OE3A 3GSTA 4BVYA 3Q19A 5KOWA 3KM6A 3GH6A 3US3A 3MIXA 5ECOB 1YKCA 5AISA 5AIXA 4KF9A 4DSSA 4BL7A 1EEJA 1XWCA 2VO4A 3F8UA 1U3IA 1PRXA 1YJ6A 1YZXA 2N5BA 1TK5B 2DJ0A 3LYKA 2VCQA 2X8HA 1X9WB 1TU8A 2GSTA 2GS3A 3UEMA 1BG5A 3K8NA 5ECSA 2D2ZA 1K0CA 4GF0A 3Q74A 3GL5A 5CP1A 4XHMA 2MZCA 4YAPA 4WETA 2WFCA 3E9JB 1ZOFA 4HOJA 4N30A 3I69A 5FWGA 1ZYPA 3IV4A 3ED3A 1YDKA 3RAZA 1V40A 1WPIA 1QK8A 3ISOA 2HSMA 3GNJA 4BA7A 3FHKA 1EP8A 3FYGA 1LU4A 1ILOA 3KTBA 4KDUA 1E6BA 4LLRA 5F07A 5IMVA 5CYYA 2H30A 1DUGA 4TXOA 1EOGA 1R4WA 1TTZA 2HRKA 1TI3A 2VUPA 18GSA 2Z9SA 3KEBA 2E7PA 3BCKA 2LNTA 5GAPD 2H73A 4LMWA 1AQWA 1MD4A 2H72A 1ERWA 1ST9A 3QAVA 1K0MA 2LQOA 3EINA 1B48A 3GX8A 1AAZA 4YAVA 3A5WA 5IQYA 1DBYA 2LNSA 2HI7A 4O5UA 4POMA 2YPMA 4HZ4A 1UN2A 4K8MA 2IMIA 4EL1A 2PVOC 4DSQA 4N0ZA 2BTOT 3I6AA 1M0UA 4L0UA 4KDYA 5IIZA 2HRNA 2DJ3A 1S3CA 1WMJA 3TDGA 2I9HA 2VOCA 5IOWA 1XOAA 2PVQA 1FB0A 5DALB 4XRDA 4MMMA 2C0EA 4WF4A 2X8GA 1ZYEA 2RM6A 1JLVA 1KTEA 2FD3A 5F06A 3D4MA 1A0RP 1EV4A 2JZRA 5ENUA 4V1Ap 4O5RA 1EGOA 3ERFA 2JZTA 2REMA 3TCOA 5CRWA 4PQIA 4JU5A 3KJYA 3HY2A 2PERA 1K3YA 1TKDB 4EIQA 4KCAA 4JBBA 3ZTLA 1NW2A 2EIOA 4EO3A 1FO5A 1EP7A 2A2SA 3TKQA 2GQLA 2JZSA 5LD0A 1W4VA 5LCZA 4EC0A 4CHSA 1SD8A 5B8AA 4HU9A 4IVFA 4TVEA 3IC8A 2R4VA 5D9XA 11GSA 1GWCA 4MJAA 1VF3A 3KD0A 3C71A 4IP1A 4HDEA 5KN2A 6GSWA 3EU3A 4PNGA 3ZL5A 4GRFA 4F0CA 1PQNA 1A24A 1OAZA 4F0BA 1SKSB 1QMVA 1MDIA 5KN0A 3GKKA 3VWWA 5CNWA 5EPFA 2B5XA 1X5EA 1PL2A 4LL1B 2JADA 1HQOA 1M2BA 4K5SA 4N0VA 5DCGA 4G10A 1Y6EA 4YKFA 3BD2A 2KP2A 1PGTA 2P5QA 5IMAA 4YQMA 1GL8A 1CQHA 2TIRA 3TOTA 3FK8A 4CW9A 4EUYA 3VK9A 3UBLA 2NVLA 3LEFA 2IFQB 2ZCTA 3LW9A 3QAWA 1T1VA 2XBQA 5A4VA 2HZFA 2CT6A 4YH2A 5DALA 3UMAA 3ZREA 2LSTA 1GSYA 3F3QA 3TB2A 4RUVA 3QPMA 1EZKA 2PBJA 3HVXA 1DE1A 1WRYA 1U3AA 4MLYA 1S3AA 2L6CA 3HHVA 1I9DA 3D0ZA 4PNFA 3IPZA 1T4ZA 1TDIA 4AGSA 2P31A 2CZ2A 1EV9A 2M46A 3IDVA 4ILFA 1FAAA 3UVHA 4MP4A 6GSTA 1BEDA 1HYUA 5INYA 3GX0A 1THOA 1RK4A 3MAKA 5H5RA 3QOUA 4ULXA 2L59A 2H74A 3EMPA 2O8VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOF A;  3LGC A;  2MBS A;  2FGX A;  3HJP A;  3CXG A;  2H66 A;  2RII A;  2C1Y A;  5L71 A;  1LJR A;  4ZB6 A;  2CV4 A;  2ES7 A;  2J23 A;  4K2D A;  4P3Y B;  4PX1 A;  3BOA A;  3EVI A;  3N5O A;  1XFL A;  4IJI A;  1QFN A;  2ZNM A;  5J9C A;  4BWS A;  4TR4 A;  2TRC P;  5D9W A;  1ERT A;  4OCE A;  2EIR A;  3LXT A;  2KUC A;  3CRU A;  1WIK A;  4OD7 A;  4IEL A;  5IOX A;  2R3X A;  2RUE A;  2LEG A;  5HR3 A;  2FY6 A;  3IOS A;  3LWA A;  1SYR A;  5J9B A;  3HD5 A;  2CX3 A;  5DQY A;  1GSD A;  3KGK A;  4JR4 A;  2L4Q A;  4PUF C;  3RPP A;  1A8L A;  2AAW A;  1R7H A;  3EC3 A;  2LRN A;  3GA4 A;  2VLV A;  1CQG A;  2VCT A;  1A2J A;  4IN0 A;  1MTC A;  3TOU A;  3TGZ A;  2F8A A;  4XTS A;  4HZ2 A;  1GLQ A;  5FT3 A;  3D21 A;  2DLX A;  4K6X A;  3WT2 A;  4ZL9 A;  1T3B A;  3QMX A;  2C3Q A;  4JR6 A;  3F4T A;  2V6K A;  1WE0 A;  5DDL A;  3VI5 A;  4TOP A;  2IFQ A;  2AUV A;  4HU7 A;  3WD6 A;  4TKY A;  3DIE A;  10GS A;  1GUL A;  16GS A;  5G1K A;  3HKR A;  5ECL B;  1Q4J A;  3DVX A;  3VWX A;  2RUF A;  5D9V A;  1X9S B;  4TN8 A;  4POL A;  1HD2 A;  4GLT A;  20GS A;  1IYH A;  3DVW A;  3GN3 A;  3O76 A;  3W8J A;  2V32 A;  3A2W A;  3IA1 A;  2JL4 A;  2FA8 A;  4O92 A;  3UAR A;  3M1G A;  2WJU A;  4MK3 A;  2ON5 A;  1OVN A;  4IBP A;  1MD3 A;  3Q18 A;  4L5L A;  2GT6 A;  4EF0 A;  1T00 A;  4JZQ A;  3BJ5 A;  2FNO A;  1QXH A;  3KP9 A;  3MNG A;  4KSO A;  1A8Y A;  1OKT A;  2HFD A;  4MF5 A;  1V98 A;  5IM9 A;  5EVO A;  5ID2 B;  5CRE A;  4ZL7 A;  3O3T A;  2E0Q A;  1PA3 A;  3DGQ A;  5DAK B;  3ZIJ A;  1GRX A;  4K0G A;  1OKD A;  3L0H A;  4J56 E;  9GSS A;  4L8E A;  2VL9 A;  5J5N A;  2DML A;  4LL4 B;  1DE2 A;  3KMN A;  4OMV A;  4G2E A;  5IPG A;  3GKX A;  1VRS D;  4L5O A;  2H75 A;  5G30 A;  3F6F A;  1EOH A;  3HZ8 A;  1PD2 1;  4DVC A;  3GYK A;  3IHQ A;  4NMU A;  1PKZ A;  1RQM A;  1TI1 A;  3C73 A;  2V6O A;  1TRW A;  1XCC A;  1ZCP A;  1RW1 A;  1GTU A;  3KCM A;  4N11 A;  4TR3 A;  3DD3 A;  3LSZ A;  1PL1 A;  3FEU A;  2WGR A;  1SJI A;  2YP6 A;  2C3T A;  14GS A;  4KUN A;  1G6W A;  4TR0 A;  2QC7 A;  2P5R A;  4EVM A;  2ON7 A;  1V58 A;  1QUW A;  2KHP A;  1ZYQ B;  4KW6 A;  2HYX A;  2WZ9 A;  1K0B A;  2GSR A;  2YOI A;  3HYP A;  2GVP A;  2YJH A;  2GTU A;  1ON4 A;  4ZXG A;  1R26 A;  4NXI A;  2GLR A;  2I81 A;  3DXB A;  2L5L A;  5ECM B;  4IJ3 A;  1PN9 A;  3EMX A;  1SU9 A;  4AJ8 A;  4MJE A;  3TJG A;  2BJX A;  4J57 E;  1K3O A;  1F3A A;  2IN3 A;  2WB9 A;  3RDW A;  5HR2 A;  1V2A A;  4IP6 A;  5IMC A;  5F0G A;  3FZ4 A;  3GKM A;  1A23 A;  1UVZ A;  1F6M C;  2B1K A;  1NM3 A;  3QDN A;  3F4R A;  4GTU A;  4GQC A;  4YQU A;  3CSJ A;  2C0F A;  3A2X A;  4F2I A;  17GS A;  1EEM A;  1X5D A;  4I5Q A;  2AJQ B;  3IC4 A;  2V41 A;  1XW6 A;  1HNA A;  3BCI A;  4K1F A;  4LMV A;  4NPB A;  2FLS A;  2XPD A;  2LKU A;  2PN8 A;  2VLU A;  5ID2 A;  2H01 A;  5KEJ A;  3PR8 A;  5DAK A;  4FO5 A;  3P7X A;  5DBQ A;  7GSS A;  1TK0 B;  2GSQ A;  3UL3 A;  2CVD A;  5JCW A;  2B5E A;  5JWQ B;  2AB6 A;  1QQ2 A;  3APQ A;  6GSS A;  4HQS A;  1TW9 A;  1NSW A;  1F2E A;  4ECB A;  6GSX A;  5C00 A;  3CTF A;  4JED A;  2H19 A;  3GUR A;  2I3Y A;  1FG4 A;  2JU5 A;  2I1U A;  4QL7 A;  1URM A;  3H1N A;  4XS6 A;  4KH7 A;  3L9S A;  2FUG 2;  2C8U A;  3C7M A;  5ECH B;  4HEA 2;  4KGI A;  4HS1 A;  2GZY A;  2PGT A;  2F51 A;  2GQK A;  2LJR A;  2F9S A;  4V2L A;  2HSY A;  3F9U A;  2ALB A;  3CSH A;  2H6Z A;  3EWL A;  4MF6 A;  3TJK A;  2VAF A;  2YV7 A;  2VCV A;  4GSN A;  4MAB A;  3CMI A;  1W89 A;  3N9J A;  3GTU B;  2P0G A;  1Q98 A;  2VCX A;  1O6J A;  2PUK C;  3PIN A;  2C0G A;  3GL3 A;  1WWJ A;  3ZFL A;  2HZE A;  1K3L A;  1AQX A;  2LS5 A;  2AYT A;  3QR6 A;  3TKS A;  3KIJ A;  2LV3 A;  1Z9H A;  4RQR A;  2XHF A;  3IBH A;  3S9F A;  3HVS A;  4KX4 A;  1H4O A;  2O85 A;  2IME A;  3UIW A;  4TW5 A;  3IAS 2;  4E8H A;  3GV1 A;  1JLW A;  4X43 A;  1TU7 A;  4POB A;  3U6V A;  5G1L A;  3ZFB A;  1WJK A;  3NIV A;  3IK7 A;  2DC5 A;  3FR3 A;  3UAP A;  4XS4 B;  1ML6 A;  19GS A;  1GTB A;  2FWH A;  1OE7 A;  1XW9 A;  1G7O A;  4PUR A;  1OC8 A;  1ABA A;  2YZU A;  2CA8 A;  4X1U A;  1KBN A;  1XWG A;  4TXV A;  5B6M A;  4WBR D;  2L57 A;  6GSU A;  4ZL8 A;  2VL2 A;  2WCI A;  5HR0 A;  3QCP A;  1UA5 A;  2B7K A;  5ECI B;  4OO4 A;  2DMM A;  2K8S A;  4QL9 A;  1EWX A;  1SKW B;  4FYB A;  1USB A;  2I4A A;  1ZL9 A;  1FOV A;  1J08 A;  1WP0 A;  4V2M A;  1ZZY A;  1O8W A;  2K8V A;  1T8E B;  4K0N A;  1U87 A;  2X8C A;  1QGV A;  1TJD A;  5LNK e;  2OKA A;  3FRC A;  2HT9 A;  5KN3 A;  4MH2 A;  2C0D A;  2H1G A;  3FW2 A;  3QFA C;  3G7I A;  3KH9 A;  5DQS A;  1MDK A;  5A4W A;  5B7C A;  4O32 A;  3GTU A;  2VCZ A;  1A0F A;  4NHW A;  2WUL A;  3APO A;  2GSS A;  2XBI A;  2H1D A;  2K9F A;  2OE1 A;  1YEX A;  2JAC A;  1I5G A;  1SK0 A;  3HVV A;  3TRP A;  3VUR A;  5G2Z A;  1XZO A;  4TRX A;  1T7P B;  3D4T A;  2DBC A;  3RHB A;  3W6G A;  5G5E A;  5IMZ A;  1G7E A;  2GZZ A;  1AQV A;  1OC9 B;  3TKS E;  5J41 A;  4GST A;  5HFG A;  3KXO A;  3APS A;  4KND A;  3ME7 A;  4IS0 A;  2X99 A;  1SYX A;  3G7J A;  1Z7R A;  2VM2 A;  2WDU A;  4XS4 A;  3ERG A;  3P2A A;  2G2Q A;  4AJ6 A;  3UJ1 A;  4H86 A;  2H1A A;  3EE2 A;  3QFB C;  4WBJ A;  4F03 A;  1F37 A;  2PMT A;  2IPA A;  1VGL A;  3WT1 A;  2MMA A;  5F05 A;  4RQX A;  1X0R A;  1ERV A;  3DML A;  4I2T A;  1PKW A;  2KLX A;  2BMX A;  2NDO A;  2NTO A;  3C1R A;  2YWO A;  1GUH A;  1K0D A;  5EL8 A;  4EDZ A;  2VM1 A;  3KP8 A;  1SK2 A;  1U88 A;  3U5R E;  3TJF A;  4I6X A;  2HE3 A;  5GAN D;  2AV4 A;  1SL0 B;  1O7U A;  4V1A g;  2V2G A;  3O6T A;  4PQ1 A;  3KTL A;  2PPT A;  3GKN A;  3L9V A;  1BX9 A;  2MBT A;  4KE3 A;  1A2M A;  3IRA A;  4D73 B;  5B8B A;  4KDX A;  2YWM A;  4POK A;  1JZO A;  1AIU A;  5D93 A;  1AUC A;  3TJB A;  3LFL A;  2PU9 C;  1THX A;  4IQ1 A;  1SJZ A;  2VL3 A;  5ABR A;  4I2U A;  5JCU A;  1ACV A;  5JCG A;  2IMK A;  3E3E A;  1Z6N A;  2LRT A;  1X9M B;  4OCF A;  1J0F A;  2A2R A;  4GXZ A;  3HDC A;  1GH2 A;  4BVX A;  2V1M A;  1XIY A;  4ECI A;  5EY6 A;  2LUS A;  1BYE A;  1OC9 A;  3C8E A;  2H71 A;  2H1B A;  1B4Q A;  2KP1 A;  5H5Q A;  3CYN A;  3FKF A;  3DWV A;  4XS1 A;  2JSY A;  1AC1 A;  1J9B A;  5JWR B;  2YCD A;  2O7K A;  1GLP A;  5CRG A;  1JZR A;  1GNE A;  1SEN A;  5HFK A;  2RLI A;  1O81 A;  3FR6 A;  3WGX A;  2IJY A;  4MH3 A;  4ML1 A;  12GS A;  2QGV A;  4MZW A;  4QQ7 A;  1F9M A;  2MMN A;  5D8I A;  3EU4 A;  2TRX A;  2CZ3 A;  1BAY A;  4MPF A;  4PGT A;  4J2F A;  1XBS A;  2DIZ A;  1H75 A;  3G7Y A;  2IMF A;  4GCI A;  1K0O A;  1M9B A;  3J7Y k;  3KZQ A;  4G9H A;  3UVT A;  5F8B A;  5DJL A;  2IWT A;  4HJ2 A;  5JWO B;  1M99 A;  3FY7 A;  1YF1 A;  2FCH A;  3VWU A;  2DSA A;  4EDY A;  3HCZ A;  4PQH A;  3VI7 A;  2LTK A;  3MWH A;  1YKA A;  4ZBD A;  2CQ9 A;  5HR1 A;  1YF0 A;  2NPB A;  3H4K A;  5GSS A;  1HNB A;  2N5F A;  2HZE B;  4OFT A;  2LRC A;  1X5C A;  4ZBA A;  5J4U A;  4D73 A;  1M9A A;  4ZIL A;  2R2J A;  1GSS A;  4FYU A;  1FW1 A;  2FWG A;  2E2M A;  2KOK A;  5ECR B;  1SJ6 A;  4PXO A;  4WXT A;  1Z3E A;  1TP9 A;  3RHC A;  2HNL A;  4KSM A;  4O7H A;  4JE1 A;  1XVW A;  1UC7 A;  1C72 A;  1JZD A;  3I43 A;  2HLS A;  1MEK A;  4RI7 A;  2B7J A;  1PSQ A;  2LJA A;  2GZP A;  2B3S A;  1XWK A;  3A2V A;  3D5J A;  3LJR A;  5H5S A;  3F3R A;  3NZN A;  5A4U A;  3LG6 A;  5E59 A;  1F3B A;  3TKP A;  5DCH A;  4IGJ A;  1G6Y A;  2HRF A;  3QAG A;  4FIW A;  4HJM A;  2M80 A;  4ID0 A;  1ZMA A;  4XIH A;  4X0X A;  2FA4 A;  4NHZ A;  3M9J A;  2VD1 A;  4FYC A;  3HZ4 A;  1SL2 B;  4EE0 A;  1XVQ A;  1HNC A;  5HFI A;  6GSY A;  1M2D A;  1YY7 A;  2C3N A;  4MCU A;  5AIV A;  3P8W A;  3M3M A;  3EYT A;  1TRU A;  5AGY A;  1G0T A;  2OA7 A;  2MYG A;  3MSZ A;  5ELG A;  4ML6 A;  2ZUP A;  3LXZ A;  3IE3 A;  4MJC A;  2WRT A;  5D9T A;  3ME8 A;  3BBY A;  3JCM L;  2DJK A;  2JSZ A;  4K9Z A;  3FZ5 A;  1PX6 A;  1B9X C;  5D73 A;  3ZVJ A;  4Q5R A;  5ECN B;  1AW9 A;  3PGT A;  1FVJ A;  1Y25 A;  2YZH A;  2K18 A;  2H0G A;  1VF2 A;  4NAX A;  4ECJ A;  5GZZ B;  1SL1 B;  1R5P A;  2CAI A;  2YNX A;  5COH A;  2L6D A;  3FZA A;  1O85 A;  3H79 A;  4EKZ A;  2C4J A;  3UBK A;  2H0I A;  4MA9 A;  4NV5 A;  2M72 A;  3L78 A;  4IHU A;  4Q5F A;  2H8L A;  1TXX A;  4XCS A;  5B6N A;  4HI7 A;  1GUK A;  4GQF A;  5ECQ B;  1JFU A;  1GUM A;  1WOU A;  2GGT A;  3VPQ A;  3ZMK A;  3F4S A;  1YEP A;  2VIM A;  4AJ7 A;  1KEB A;  3KH7 A;  1Z7P A;  5D96 A;  2L4C A;  3FZ9 A;  1BQ7 A;  2B6M A;  4OFM A;  1ERU A;  4KCE A;  2O89 A;  3ZYW A;  4ZBB A;  3M9K A;  2CX4 A;  4K7O A;  1FVK A;  1N2A A;  2IIY A;  2R37 A;  2WS2 A;  3D22 A;  1YQ1 A;  2G0F A;  3H93 A;  2H6X A;  2XC2 A;  4ECC A;  3GUS A;  2NBS A;  5G5F A;  3DKS A;  2RM5 A;  5DJM A;  1GSU A;  3HJO A;  3TKR A;  2C80 A;  13GS A;  3GSS A;  4HUA A;  1FB6 A;  4E8E A;  2MMO A;  3F6D A;  1R5A A;  4PUA A;  3UOM A;  3V1W A;  2OBK A;  5IMF A;  1V9W A;  3Q6O A;  3QD9 A;  2DJ1 A;  4MZC A;  1LBK A;  2HSH A;  2R6K A;  3IK9 A;  4MF7 A;  1U6T A;  1XOB A;  1SK1 A;  4ACS A;  4MJB A;  2H0H A;  2O87 A;  5ECK B;  3AY8 A;  2GQM A;  4FH8 A;  4NWY A;  1AXD A;  4IKH A;  4ZB8 A;  4KA0 A;  3GHA A;  2GDR A;  1Z5Y E;  3WYW A;  2X64 A;  3TRX A;  3GH9 A;  1XWA A;  3GIX A;  1K0A A;  3OR5 A;  2YAN A;  1TK8 B;  2YV9 A;  5CAX A;  5ELA A;  3GFK A;  2L5O A;  3IXR A;  2VCW A;  3ZRD A;  4I8B A;  4OFN A;  3RPN A;  4ZB9 A;  5CO3 A;  3CSI A;  4Z7X A;  3TUE A;  5ECP B;  1A2L A;  1XXU A;  4GWR A;  4Q5N A;  4BWQ A;  4GSS A;  2F8F A;  4LA1 A;  5E4W A;  3CBU A;  2LJK A;  1TRS A;  5KN1 A;  4IW9 A;  3DEX A;  3LQ7 A;  5G31 A;  1B8X A;  3TKS C;  1SD9 A;  5IMD A;  4K7N A;  4WR5 A;  3H8Q A;  3VFI A;  4G19 A;  3KMO A;  4V2N A;  3WGD A;  4DEJ A;  1XW5 A;  4OO5 A;  3F0I A;  1B9Y C;  3WGE A;  2EC4 A;  1FHE A;  2H6Y A;  2B1L A;  1S3D A;  2IMD A;  2VD0 A;  2EIQ A;  2E2G A;  3P90 A;  2B5Y A;  2IL3 A;  5IO2 A;  3IAM 2;  2OBI A;  1PX7 A;  5FHI A;  1XPV A;  4F82 A;  1NHY A;  3GMF A;  2QSI A;  4MZB A;  2K6V A;  1GSF A;  4HQZ A;  2OE0 A;  1JZW A;  2H70 A;  4WF5 A;  1O8X A;  1DSB A;  3SBC A;  4DSR A;  6GSV A;  3SWL A;  1SKR B;  2QKE A;  2AHE A;  2VL2 C;  5CRH A;  1GP1 A;  4WR4 A;  5IO0 A;  2A4V A;  3HA9 A;  1TRV A;  2DJ2 A;  2FHE A;  5CRD A;  4F9Z A;  5IPH A;  2YJ7 A;  4TR1 B;  4EXJ A;  1GNW A;  1TOF A;  5HQP A;  2H76 A;  8GSS A;  3ZIV A;  2DJJ A;  1O73 A;  3DRN A;  3D6I A;  2YWN A;  3PH9 A;  3I9V 2;  3J7Y b;  3L9U A;  2R5G A;  4DSS B;  1T4Y A;  4YQV A;  1GTA A;  3EUR A;  1M7T A;  3CRT A;  2OJL A;  4IQA A;  2DIY A;  1XWB A;  1K0N A;  4MPG A;  4L0W A;  4BPY A;  2VLT A;  3GRX A;  5GST A;  4NV2 A;  3HXS A;  1N8J A;  3MDK A;  1BJX A;  3TJJ A;  3ERW A;  1OC3 A;  2GT5 A;  3R2Q A;  3ZZX A;  4ZIJ A;  1B4P A;  1OYJ A;  3VLN A;  2OAD A;  2OAC A;  3VPT A;  1GSQ A;  2J9H A;  1GTI A;  2CVK A;  3DYR A;  4K7I A;  1Z6M A;  3VWV A;  5A5K A;  1JHB A;  3HJM A;  1V57 A;  1ZGN A;  3IR4 A;  3M8N A;  4KAE A;  3TRQ A;  3ZVJ D;  3LOR A;  1PMT A;  1EGR A;  22GS A;  3LYP A;  3ZML A;  3ZLP A;  4MDC A;  4JRR A;  1GSE A;  4WEY A;  4OWY A;  4TXO B;  1OE8 A;  4WKW A;  3FR9 A;  4AF2 A;  2FWE A;  4KB3 A;  4N10 A;  2FWF A;  2MMZ A;  3CTG A;  3RBT A;  1E2Y A;  3M0F A;  1VF1 A;  5DVB A;  2LQQ A;  2N5A A;  2CAQ A;  1MDJ A;  1VF4 A;  3C1S A;  1IYI A;  5C04 A;  2YN1 A;  3A3T A;  2XPE A;  3L4N A;  4ISD A;  1NHO A;  4RI6 A;  3E0U A;  5AN1 A;  4CDO A;  2PWJ A;  5J3R A;  3G9B A;  4TR1 A;  1KNG A;  4Q5Q A;  3ZIT A;  2F3M A;  2HXK A;  4XRA A;  2YWI A;  3W8S A;  1M2A A;  4I97 A;  3F63 A;  2CVB A;  2OE3 A;  3GST A;  4BVY A;  3Q19 A;  3KM6 A;  3GH6 A;  3US3 A;  5ECO B;  1YKC A;  5AIS A;  5AIX A;  4DSS A;  4BL7 A;  1EEJ A;  1XWC A;  2VO4 A;  3F8U A;  1U3I A;  1PRX A;  1YJ6 A;  1YZX A;  2N5B A;  1TK5 B;  2DJ0 A;  3LYK A;  2VCQ A;  2X8H A;  1X9W B;  1TU8 A;  2GST A;  2GS3 A;  3UEM A;  1BG5 A;  3K8N A;  5ECS A;  2D2Z A;  1K0C A;  4GF0 A;  3Q74 A;  3GL5 A;  5CP1 A;  4XHM A;  2MZC A;  4YAP A;  4WET A;  2WFC A;  3E9J B;  1ZOF A;  4HOJ A;  4N30 A;  3I69 A;  5FWG A;  3IV4 A;  3ED3 A;  1YDK A;  3RAZ A;  1V40 A;  1WPI A;  1QK8 A;  3ISO A;  3GNJ A;  4BA7 A;  3FHK A;  1EP8 A;  3FYG A;  1LU4 A;  1ILO A;  3KTB A;  4KDU A;  1E6B A;  4LLR A;  5F07 A;  5IMV A;  5CYY A;  2H30 A;  1DUG A;  4TXO A;  1EOG A;  1R4W A;  1TTZ A;  1TI3 A;  2VUP A;  18GS A;  2Z9S A;  3KEB A;  2E7P A;  3BCK A;  2LNT A;  5GAP D;  2H73 A;  4LMW A;  1AQW A;  1MD4 A;  2H72 A;  1ERW A;  1ST9 A;  3QAV A;  1K0M A;  2LQO A;  3EIN A;  1B48 A;  3GX8 A;  1AAZ A;  4YAV A;  3A5W A;  5IQY A;  1DBY A;  2LNS A;  2HI7 A;  4POM A;  2YPM A;  4HZ4 A;  1UN2 A;  4K8M A;  2IMI A;  4EL1 A;  2PVO C;  4DSQ A;  4N0Z A;  2BTO T;  3I6A A;  1M0U A;  4L0U A;  4KDY A;  5IIZ A;  2HRN A;  2DJ3 A;  1S3C A;  1WMJ A;  3TDG A;  2I9H A;  2VOC A;  5IOW A;  1XOA A;  2PVQ A;  5DAL B;  1FB0 A;  4XRD A;  4MMM A;  2C0E A;  4WF4 A;  2X8G A;  1ZYE A;  2RM6 A;  1JLV A;  1KTE A;  2FD3 A;  5F06 A;  3D4M A;  1A0R P;  1EV4 A;  2JZR A;  5ENU A;  4V1A p;  4O5R A;  1EGO A;  3ERF A;  2JZT A;  2REM A;  3TCO A;  5CRW A;  4PQI A;  4JU5 A;  3KJY A;  3HY2 A;  2PER A;  1K3Y A;  1TKD B;  4KCA A;  4JBB A;  3ZTL A;  1NW2 A;  2EIO A;  4EO3 A;  1FO5 A;  1EP7 A;  2A2S A;  3TKQ A;  2GQL A;  2JZS A;  5LD0 A;  1W4V A;  5LCZ A;  4EC0 A;  4CHS A;  1SD8 A;  5B8A A;  4HU9 A;  4IVF A;  4TVE A;  2R4V A;  5D9X A;  11GS A;  1GWC A;  4MJA A;  1VF3 A;  3KD0 A;  3C71 A;  4IP1 A;  4HDE A;  5KN2 A;  6GSW A;  3EU3 A;  4PNG A;  3ZL5 A;  4GRF A;  4F0C A;  1PQN A;  1A24 A;  1OAZ A;  4F0B A;  1SKS B;  1QMV A;  1MDI A;  5KN0 A;  3GKK A;  3VWW A;  5CNW A;  5EPF A;  2B5X A;  1X5E A;  1PL2 A;  4LL1 B;  2JAD A;  1HQO A;  1M2B A;  4N0V A;  5DCG A;  4G10 A;  1Y6E A;  3BD2 A;  2KP2 A;  1PGT A;  2P5Q A;  5IMA A;  4YQM A;  1GL8 A;  1CQH A;  2TIR A;  3TOT A;  3FK8 A;  4CW9 A;  4EUY A;  3VK9 A;  3UBL A;  2NVL A;  3LEF A;  2IFQ B;  2ZCT A;  3QAW A;  1T1V A;  2XBQ A;  5A4V A;  2HZF A;  2CT6 A;  4YH2 A;  5DAL A;  3UMA A;  3ZRE A;  2LST A;  1GSY A;  3F3Q A;  3TB2 A;  4RUV A;  3QPM A;  1EZK A;  2PBJ A;  3HVX A;  1DE1 A;  1WRY A;  1U3A A;  4MLY A;  1S3A A;  2L6C A;  3HHV A;  1I9D A;  3D0Z A;  4PNF A;  3IPZ A;  1T4Z A;  1TDI A;  4AGS A;  2P31 A;  2CZ2 A;  1EV9 A;  2M46 A;  3IDV A;  4ILF A;  1FAA A;  3UVH A;  4MP4 A;  6GST A;  1BED A;  1HYU A;  5INY A;  3GX0 A;  1THO A;  1RK4 A;  3MAK A;  5H5R A;  3QOU A;  4ULX A;  2L59 A;  2H74 A;  3EMP A;  2O8V B; 
#chains in the Genus database with same CATH topology
 3NOF A;  3LGC A;  2MBS A;  2FGX A;  3HJP A;  3CXG A;  2H66 A;  2RII A;  2C1Y A;  5L71 A;  1LJR A;  4ZB6 A;  2CV4 A;  2ES7 A;  2J23 A;  4K2D A;  4P3Y B;  4PX1 A;  3BOA A;  3EVI A;  3N5O A;  1XFL A;  4IJI A;  1QFN A;  2ZNM A;  5J9C A;  4BWS A;  4TR4 A;  4G0I A;  2TRC P;  5D9W A;  1ERT A;  4OCE A;  2EIR A;  3LXT A;  2KUC A;  3CRU A;  1WIK A;  4OD7 A;  4IEL A;  5IOX A;  2R3X A;  2RUE A;  2LEG A;  5HR3 A;  2FY6 A;  3IOS A;  3LWA A;  1SYR A;  5J9B A;  3HD5 A;  2CX3 A;  5DQY A;  1GSD A;  3KGK A;  4JR4 A;  2L4Q A;  4PUF C;  3RPP A;  1A8L A;  2AAW A;  1R7H A;  3EC3 A;  2LRN A;  3GA4 A;  2VLV A;  1CQG A;  2VCT A;  1A2J A;  4IN0 A;  4Z2R A;  1MTC A;  3TOU A;  3TGZ A;  4BVY B;  2F8A A;  4XTS A;  4HZ2 A;  1GLQ A;  5FT3 A;  3D21 A;  2DLX A;  4K6X A;  3WT2 A;  4ZL9 A;  4BL7 B;  1T3B A;  3QMX A;  4Z2T A;  2C3Q A;  4JR6 A;  3F4T A;  2V6K A;  1WE0 A;  5DDL A;  3VI5 A;  2QA1 A;  4TOP A;  2IFQ A;  2AUV A;  4HU7 A;  3WD6 A;  4TKY A;  3DIE A;  10GS A;  1GUL A;  16GS A;  5G1K A;  3HKR A;  3HVN A;  5ECL B;  1Q4J A;  3DVX A;  3VWX A;  2RUF A;  5D9V A;  1X9S B;  2R0C A;  4TN8 A;  4POL A;  1HD2 A;  4GLT A;  20GS A;  1IYH A;  3DVW A;  3GN3 A;  3O76 A;  3W8J A;  2V32 A;  4CY6 A;  3A2W A;  3IA1 A;  2JL4 A;  2FA8 A;  4O92 A;  3UAR A;  3M1G A;  2WJU A;  4MK3 A;  2ON5 A;  1OVN A;  4IBP A;  1MD3 A;  3Q18 A;  4L5L A;  2GT6 A;  4EF0 A;  1T00 A;  4JZQ A;  3BJ5 A;  2FNO A;  1QXH A;  3KP9 A;  3MNG A;  4KSO A;  1A8Y A;  1OKT A;  2HFD A;  4MF5 A;  1V98 A;  5IM9 A;  5EVO A;  5ID2 B;  5CRE A;  4ZL7 A;  3O3T A;  2E0Q A;  1PA3 A;  3DGQ A;  2R0P A;  5DAK B;  3ZIJ A;  1GRX A;  4K0G A;  1OKD A;  3L0H A;  4J56 E;  9GSS A;  4L8E A;  2VL9 A;  5J5N A;  2DML A;  4LL4 B;  1DE2 A;  3KMN A;  4OMV A;  4G2E A;  5IPG A;  3GKX A;  1VRS D;  4L5O A;  2H75 A;  5G30 A;  3F6F A;  1EOH A;  3HZ8 A;  1PD2 1;  4DVC A;  3GYK A;  3IHQ A;  4NMU A;  1PKZ A;  1RQM A;  1TI1 A;  3C73 A;  2V6O A;  1TRW A;  1XCC A;  1ZCP A;  1RW1 A;  1GTU A;  3KCM A;  4N11 A;  4TR3 A;  3DD3 A;  3LSZ A;  1PL1 A;  3FEU A;  2WGR A;  1SJI A;  2YP6 A;  2C3T A;  14GS A;  4KUN A;  1G6W A;  4TR0 A;  2QC7 A;  2P5R A;  4EVM A;  2ON7 A;  1V58 A;  1QUW A;  2KHP A;  1ZYQ B;  4KW6 A;  2HYX A;  2WZ9 A;  1K0B A;  2GSR A;  2YOI A;  3HYP A;  2GVP A;  2YJH A;  4USS A;  2GTU A;  1ON4 A;  4ZXG A;  1R26 A;  4NXI A;  2GLR A;  2I81 A;  3DXB A;  2L5L A;  5ECM B;  4IJ3 A;  1PN9 A;  3EMX A;  1SU9 A;  4AJ8 A;  2HRA A;  4MJE A;  3TJG A;  2BJX A;  4J57 E;  1K3O A;  1F3A A;  2IN3 A;  2WB9 A;  3RDW A;  5HR2 A;  1V2A A;  4IP6 A;  5IMC A;  5F0G A;  3FZ4 A;  3GKM A;  1A23 A;  4HSC X;  1UVZ A;  1F6M C;  2B1K A;  1NM3 A;  3QDN A;  3F4R A;  4GTU A;  4GQC A;  4YQU A;  3CSJ A;  2C0F A;  4FQU A;  3A2X A;  4F2I A;  17GS A;  1EEM A;  1X5D A;  4I5Q A;  2AJQ B;  3IC4 A;  2V41 A;  1XW6 A;  1HNA A;  3BCI A;  4K1F A;  4LMV A;  4NPB A;  1M3I A;  2FLS A;  2XPD A;  2LKU A;  2PN8 A;  2VLU A;  4MNN A;  5ID2 A;  2H01 A;  5KEJ A;  3PR8 A;  5DAK A;  4FO5 A;  3P7X A;  5DBQ A;  7GSS A;  1TK0 B;  2GSQ A;  3UL3 A;  2CVD A;  5JCW A;  1PN0 A;  1ZYN A;  2B5E A;  5JWQ B;  2AB6 A;  1QQ2 A;  3APQ A;  6GSS A;  4EIP A;  4HQS A;  1TW9 A;  1NSW A;  1F2E A;  4ECB A;  6GSX A;  5C00 A;  3CTF A;  4JED A;  2H19 A;  3GUR A;  2I3Y A;  1FG4 A;  2JU5 A;  2I1U A;  4QL7 A;  1URM A;  3H1N A;  4XS6 A;  4KH7 A;  3L9S A;  2FUG 2;  2C8U A;  3C7M A;  5ECH B;  4HEA 2;  4KGI A;  4HS1 A;  2GZY A;  2PGT A;  2F51 A;  2GQK A;  2LJR A;  2F9S A;  4V2L A;  2HSY A;  3F9U A;  2ALB A;  3CSH A;  2H6Z A;  4MF6 A;  3EWL A;  3TJK A;  2VAF A;  2YV7 A;  2VCV A;  4GSN A;  4MAB A;  3CMI A;  1W89 A;  3N9J A;  3GTU B;  2P0G A;  1Q98 A;  2VCX A;  1O6J A;  2PUK C;  3PIN A;  2C0G A;  3GL3 A;  1WWJ A;  3MYD A;  3ZFL A;  2HZE A;  1K3L A;  1AQX A;  2LS5 A;  2AYT A;  3QR6 A;  3TKS A;  3KIJ A;  2LV3 A;  1Z9H A;  4RQR A;  2XHF A;  4Z2U A;  3IBH A;  3S9F A;  3HVS A;  4KX4 A;  1H4O A;  2O85 A;  2DKI A;  2IME A;  3UIW A;  4TW5 A;  3IAS 2;  4E8H A;  2A2P A;  3GV1 A;  1JLW A;  4X43 A;  1TU7 A;  4POB A;  3U6V A;  5G1L A;  3ZFB A;  3EPT A;  1WJK A;  3NIV A;  3IK7 A;  2DC5 A;  3FR3 A;  3UAP A;  4XS4 B;  1ML6 A;  3IHG A;  19GS A;  1GTB A;  2FWH A;  1OE7 A;  1XW9 A;  1G7O A;  4PUR A;  1OC8 A;  1ABA A;  2YZU A;  2CA8 A;  4X1U A;  1KBN A;  1XWG A;  4TXV A;  3A5I A;  5B6M A;  4WBR D;  2L57 A;  6GSU A;  4ZL8 A;  2VL2 A;  2WCI A;  5HR0 A;  3FMW A;  3QCP A;  1UA5 A;  2B7K A;  5ECI B;  4OO4 A;  2DMM A;  2K8S A;  4QL9 A;  1EWX A;  1SKW B;  4FYB A;  1USB A;  2I4A A;  1ZL9 A;  2X4A A;  1FOV A;  1J08 A;  1WP0 A;  4V2M A;  1ZZY A;  1O8W A;  2K8V A;  1T8E B;  4K0N A;  1U87 A;  2X8C A;  1QGV A;  1TJD A;  2X49 A;  5LNK e;  2OKA A;  3FRC A;  2HT9 A;  5KN3 A;  4MH2 A;  2C0D A;  2H1G A;  3FW2 A;  3QFA C;  3G7I A;  3KH9 A;  5DQS A;  1MDK A;  5A4W A;  5B7C A;  4O32 A;  3GTU A;  2VCZ A;  1A0F A;  4NHW A;  2WUL A;  3APO A;  2GSS A;  2XBI A;  2H1D A;  2K9F A;  2OE1 A;  1YEX A;  2JAC A;  1I5G A;  1SK0 A;  3HVV A;  3TRP A;  3VUR A;  5G2Z A;  1XZO A;  4TRX A;  1T7P B;  3D4T A;  2DBC A;  3RHB A;  3W6G A;  5G5E A;  5IMZ A;  4BVX B;  1G7E A;  2GZZ A;  1AQV A;  1OC9 B;  3TKS E;  5J41 A;  4GST A;  5HFG A;  3KXO A;  3APS A;  4KND A;  3ME7 A;  4IS0 A;  2X99 A;  1SYX A;  3G7J A;  1Z7R A;  2VM2 A;  2WDU A;  4XS4 A;  3ERG A;  3P2A A;  2G2Q A;  4AJ6 A;  3UJ1 A;  4H86 A;  2H1A A;  3EE2 A;  3QFB C;  4WBJ A;  4F03 A;  1F37 A;  2PMT A;  2IPA A;  1VGL A;  3WT1 A;  2MMA A;  5F05 A;  4RQX A;  1X0R A;  1ERV A;  3DML A;  4I2T A;  1PKW A;  2KLX A;  2BMX A;  2QA2 A;  2NDO A;  2NTO A;  3C1R A;  2YWO A;  1GUH A;  1K0D A;  5EL8 A;  4EDZ A;  4K5R A;  2VM1 A;  3KP8 A;  1SK2 A;  1U88 A;  3U5R E;  3TJF A;  4I6X A;  2HE3 A;  5GAN D;  2AV4 A;  1SL0 B;  1O7U A;  4V1A g;  2V2G A;  3O6T A;  4PQ1 A;  3KTL A;  2PPT A;  3GKN A;  3L9V A;  1BX9 A;  2MBT A;  4KE3 A;  4PTS A;  1A2M A;  3IRA A;  4D73 B;  4G0K A;  5B8B A;  4KDX A;  2YWM A;  4POK A;  1JZO A;  1AIU A;  5D93 A;  1AUC A;  3TJB A;  3LFL A;  2PU9 C;  1THX A;  4IQ1 A;  1SJZ A;  2VL3 A;  5ABR A;  4I2U A;  5JCU A;  1ACV A;  3PPU A;  5JCG A;  2IMK A;  3E3E A;  1Z6N A;  2LRT A;  1X9M B;  4OCF A;  1J0F A;  2A2R A;  4GXZ A;  1FOH A;  3HDC A;  1GH2 A;  4BVX A;  2V1M A;  1XIY A;  4ECI A;  5EY6 A;  2LUS A;  1BYE A;  1OC9 A;  3C8E A;  2H71 A;  2H1B A;  1B4Q A;  2KP1 A;  5H5Q A;  3CYN A;  3FKF A;  3DWV A;  4XS1 A;  2JSY A;  1AC1 A;  1J9B A;  5JWR B;  2YCD A;  2O7K A;  1GLP A;  5CRG A;  1JZR A;  1GNE A;  1SEN A;  5HFK A;  2RLI A;  1O81 A;  3FR6 A;  3WGX A;  2IJY A;  4MH3 A;  4ML1 A;  12GS A;  2QGV A;  2R0G A;  4MZW A;  4QQ7 A;  1F9M A;  2MMN A;  5D8I A;  3EU4 A;  2TRX A;  2CZ3 A;  1BAY A;  4MPF A;  4PGT A;  5KOX A;  4J2F A;  1XBS A;  2DIZ A;  1H75 A;  3G7Y A;  2IMF A;  4GCI A;  1K0O A;  1M9B A;  3J7Y k;  3KZQ A;  4G9H A;  3UVT A;  5F8B A;  5DJL A;  2IWT A;  4HJ2 A;  5JWO B;  1M99 A;  3FY7 A;  1YF1 A;  2FCH A;  3VWU A;  2DSA A;  4A5P A;  4EDY A;  3HCZ A;  4PQH A;  3VI7 A;  2LTK A;  3MWH A;  4YKG A;  1YKA A;  4ZBD A;  2CQ9 A;  4G0L A;  5HR1 A;  1YF0 A;  2NPB A;  2DKH A;  3H4K A;  5GSS A;  1HNB A;  2N5F A;  2HZE B;  4OFT A;  2LRC A;  1X5C A;  4ZBA A;  5J4U A;  4D73 A;  1M9A A;  4ZIL A;  2R2J A;  1GSS A;  4FYU A;  1FW1 A;  2FWG A;  2E2M A;  1PFO A;  2KOK A;  5ECR B;  1SJ6 A;  4PXO A;  4WXT A;  1Z3E A;  1TP9 A;  3RHC A;  2HNL A;  4KSM A;  4O7H A;  4JE1 A;  1XVW A;  4O5Q A;  1UC7 A;  1C72 A;  1JZD A;  3I43 A;  2HLS A;  1MEK A;  4RI7 A;  2B7J A;  1PSQ A;  2LJA A;  2GZP A;  2B3S A;  1XWK A;  3A2V A;  3D5J A;  3LJR A;  5H5S A;  3F3R A;  3NZN A;  5A4U A;  3LG6 A;  5E59 A;  1F3B A;  3TKP A;  5DCH A;  4IGJ A;  1G6Y A;  2HRF A;  3QAG A;  4FIW A;  4HJM A;  2M80 A;  4ID0 A;  1ZMA A;  4XIH A;  4X0X A;  2FA4 A;  4NHZ A;  3M9J A;  2VD1 A;  4FYC A;  3HZ4 A;  1SL2 B;  4EE0 A;  1XVQ A;  1HNC A;  5HFI A;  6GSY A;  1M2D A;  1YY7 A;  2C3N A;  4MCU A;  5AIV A;  3P8W A;  3M3M A;  3EYT A;  1TRU A;  5AGY A;  1G0T A;  2OA7 A;  2MYG A;  3MSZ A;  5ELG A;  4ML6 A;  2ZUP A;  3LXZ A;  3IE3 A;  4MJC A;  2WRT A;  5D9T A;  3ME8 A;  3BBY A;  3JCM L;  2DJK A;  2JSZ A;  4K9Z A;  3FZ5 A;  1PX6 A;  1B9X C;  5D73 A;  3ZVJ A;  4Q5R A;  5ECN B;  1AW9 A;  3PGT A;  1FVJ A;  1Y25 A;  2YZH A;  2K18 A;  2H0G A;  1VF2 A;  4NAX A;  4ECJ A;  5GZZ B;  1SL1 B;  1R5P A;  2CAI A;  2YNX A;  5COH A;  2L6D A;  3FZA A;  1O85 A;  3H79 A;  4EKZ A;  2C4J A;  3UBK A;  2H0I A;  2A4H A;  4MA9 A;  4NV5 A;  2M72 A;  3L78 A;  4IHU A;  4Q5F A;  2H8L A;  1TXX A;  4XCS A;  5B6N A;  4HI7 A;  1GUK A;  4GQF A;  5ECQ B;  1JFU A;  1GUM A;  1WOU A;  2GGT A;  3VPQ A;  3ZMK A;  3F4S A;  1YEP A;  2VIM A;  4AJ7 A;  1KEB A;  3KH7 A;  1Z7P A;  5D96 A;  2L4C A;  3FZ9 A;  1BQ7 A;  2B6M A;  4OFM A;  1ERU A;  4KCE A;  2O89 A;  3ZYW A;  4ZBB A;  3M9K A;  2CX4 A;  4K7O A;  1FVK A;  1N2A A;  2IIY A;  2R37 A;  2WS2 A;  3D22 A;  2UZ8 A;  1YQ1 A;  2G0F A;  3H93 A;  2H6X A;  2XC2 A;  4ECC A;  3GUS A;  2NBS A;  5G5F A;  3DKS A;  2RM5 A;  5DJM A;  1GSU A;  3HJO A;  3TKR A;  2C80 A;  13GS A;  3GSS A;  4HUA A;  1FB6 A;  4E8E A;  2MMO A;  4X4J A;  3F6D A;  1R5A A;  4PUA A;  3UOM A;  3V1W A;  2OBK A;  5IMF A;  1V9W A;  3Q6O A;  3QD9 A;  2DJ1 A;  4MZC A;  1LBK A;  2HSH A;  2R6K A;  3IK9 A;  4MF7 A;  1U6T A;  1XOB A;  1SK1 A;  4ACS A;  4MJB A;  2H0H A;  2O87 A;  5ECK B;  3AY8 A;  2GQM A;  4FH8 A;  4NWY A;  1AXD A;  4IKH A;  4ZB8 A;  4KA0 A;  3GHA A;  2GDR A;  1Z5Y E;  3WYW A;  2X64 A;  3TRX A;  3GH9 A;  1XWA A;  3GIX A;  1K0A A;  3OR5 A;  2YAN A;  1TK8 B;  2YV9 A;  5CAX A;  5ELA A;  3GFK A;  2L5O A;  3IXR A;  2VCW A;  3ZRD A;  4I8B A;  4OFN A;  3RPN A;  4ZB9 A;  5CO3 A;  3CSI A;  4Z7X A;  3TUE A;  5ECP B;  1A2L A;  1XXU A;  4GWR A;  4Q5N A;  4BWQ A;  4GSS A;  3R3E A;  2F8F A;  4LA1 A;  5E4W A;  3CBU A;  2LJK A;  1TRS A;  5KN1 A;  4IW9 A;  3DEX A;  3LQ7 A;  5G31 A;  1B8X A;  3TKS C;  1SD9 A;  5IMD A;  4K7N A;  4WR5 A;  3H8Q A;  3VFI A;  4G19 A;  3KMO A;  4V2N A;  3WGD A;  4DEJ A;  1XW5 A;  4OO5 A;  3F0I A;  1B9Y C;  3WGE A;  2EC4 A;  1FHE A;  2H6Y A;  2B1L A;  1S3D A;  2IMD A;  2VD0 A;  2EIQ A;  2E2G A;  3P90 A;  2B5Y A;  2IL3 A;  5IO2 A;  3IAM 2;  2OBI A;  1PX7 A;  5FHI A;  1XPV A;  1XG8 A;  4F82 A;  1NHY A;  3GMF A;  2QSI A;  4MZB A;  2K6V A;  1GSF A;  4HQZ A;  2OE0 A;  1JZW A;  1S3R A;  2H70 A;  5BRT A;  4CY8 A;  4WF5 A;  1O8X A;  1DSB A;  3SBC A;  4DSR A;  6GSV A;  3SWL A;  1SKR B;  2QKE A;  4ICY A;  2AHE A;  2VL2 C;  5CRH A;  1GP1 A;  4WR4 A;  5IO0 A;  2A4V A;  3HA9 A;  1TRV A;  2DJ2 A;  2FHE A;  5CRD A;  4F9Z A;  5BMU A;  5IPH A;  2YJ7 A;  4TR1 B;  4EXJ A;  1GNW A;  1TOF A;  5HQP A;  2H76 A;  8GSS A;  3ZIV A;  2DJJ A;  1O73 A;  3DRN A;  3D6I A;  2YWN A;  3PH9 A;  3I9V 2;  3J7Y b;  3L9U A;  2R5G A;  4DSS B;  1T4Y A;  4YQV A;  1GTA A;  3EUR A;  1M7T A;  3CRT A;  2OJL A;  4IQA A;  2DIY A;  1XWB A;  1K0N A;  1M3J A;  4MPG A;  4L0W A;  4BPY A;  2VLT A;  3GRX A;  5GST A;  4NV2 A;  3HXS A;  1N8J A;  3MDK A;  1BJX A;  3TJJ A;  3ERW A;  1OC3 A;  2GT5 A;  3R2Q A;  3ZZX A;  4ZIJ A;  1B4P A;  1OYJ A;  3VLN A;  2OAD A;  2OAC A;  3VPT A;  1GSQ A;  2J9H A;  1GTI A;  2CVK A;  3DYR A;  4K7I A;  1Z6M A;  3VWV A;  5A5K A;  1JHB A;  3HJM A;  1V57 A;  1ZGN A;  3IR4 A;  3M8N A;  4KAE A;  3TRQ A;  3ZVJ D;  3LOR A;  1PMT A;  1EGR A;  22GS A;  3LYP A;  3ZML A;  3ZLP A;  4MDC A;  4JRR A;  1GSE A;  4WEY A;  4OWY A;  4TXO B;  1OE8 A;  4WKW A;  3FR9 A;  4AF2 A;  2FWE A;  4K2X A;  4KB3 A;  4N10 A;  2FWF A;  2MMZ A;  3CTG A;  3RBT A;  1E2Y A;  3M0F A;  1VF1 A;  5DVB A;  2LQQ A;  2N5A A;  2CAQ A;  1MDJ A;  1VF4 A;  3C1S A;  1IYI A;  5C04 A;  2YN1 A;  3A3T A;  2XPE A;  3L4N A;  4ISD A;  1NHO A;  4RI6 A;  4BIK A;  3E0U A;  5AN1 A;  4CDO A;  2PWJ A;  5J3R A;  3G9B A;  4TR1 A;  1KNG A;  4Q5Q A;  3ZIT A;  2F3M A;  2HXK A;  4XRA A;  2YWI A;  3W8S A;  1M2A A;  4I97 A;  3F63 A;  2CVB A;  2OE3 A;  3GST A;  4BVY A;  3Q19 A;  5KOW A;  3KM6 A;  3GH6 A;  3US3 A;  3MIX A;  5ECO B;  1YKC A;  5AIS A;  5AIX A;  4KF9 A;  4DSS A;  4BL7 A;  1EEJ A;  1XWC A;  2VO4 A;  3F8U A;  1U3I A;  1PRX A;  1YJ6 A;  1YZX A;  2N5B A;  1TK5 B;  2DJ0 A;  3LYK A;  2VCQ A;  2X8H A;  1X9W B;  1TU8 A;  2GST A;  2GS3 A;  3UEM A;  1BG5 A;  3K8N A;  5ECS A;  2D2Z A;  1K0C A;  4GF0 A;  3CQF A;  3Q74 A;  3GL5 A;  5CP1 A;  4XHM A;  2MZC A;  4YAP A;  4WET A;  2WFC A;  3E9J B;  1ZOF A;  4HOJ A;  4N30 A;  3I69 A;  5FWG A;  1ZYP A;  3IV4 A;  3ED3 A;  1YDK A;  3RAZ A;  1V40 A;  1WPI A;  1QK8 A;  3ISO A;  2HSM A;  3GNJ A;  4BA7 A;  3FHK A;  1EP8 A;  3FYG A;  1LU4 A;  1ILO A;  3KTB A;  4KDU A;  1E6B A;  4LLR A;  5F07 A;  5IMV A;  5CYY A;  2H30 A;  1DUG A;  4TXO A;  1EOG A;  1R4W A;  1TTZ A;  2HRK A;  1TI3 A;  2VUP A;  18GS A;  2Z9S A;  3KEB A;  2E7P A;  3BCK A;  2LNT A;  5GAP D;  2H73 A;  4LMW A;  1AQW A;  1MD4 A;  2H72 A;  1ERW A;  1ST9 A;  3QAV A;  1K0M A;  2LQO A;  3EIN A;  1B48 A;  3GX8 A;  1AAZ A;  4YAV A;  3A5W A;  5IQY A;  1DBY A;  2LNS A;  2HI7 A;  4O5U A;  4POM A;  2YPM A;  4HZ4 A;  1UN2 A;  4K8M A;  2IMI A;  4EL1 A;  2PVO C;  4DSQ A;  4N0Z A;  2BTO T;  3I6A A;  1M0U A;  4L0U A;  4KDY A;  5IIZ A;  2HRN A;  2DJ3 A;  1S3C A;  1WMJ A;  3TDG A;  2I9H A;  2VOC A;  5IOW A;  1XOA A;  2PVQ A;  1FB0 A;  5DAL B;  4XRD A;  4MMM A;  2C0E A;  4WF4 A;  2X8G A;  1ZYE A;  2RM6 A;  1JLV A;  1KTE A;  2FD3 A;  5F06 A;  3D4M A;  1A0R P;  1EV4 A;  2JZR A;  5ENU A;  4V1A p;  4O5R A;  1EGO A;  3ERF A;  2JZT A;  2REM A;  3TCO A;  5CRW A;  4PQI A;  4JU5 A;  3KJY A;  3HY2 A;  2PER A;  1K3Y A;  1TKD B;  4EIQ A;  4KCA A;  4JBB A;  3ZTL A;  1NW2 A;  2EIO A;  4EO3 A;  1FO5 A;  1EP7 A;  2A2S A;  3TKQ A;  2GQL A;  2JZS A;  5LD0 A;  1W4V A;  5LCZ A;  4EC0 A;  4CHS A;  1SD8 A;  5B8A A;  4HU9 A;  4IVF A;  4TVE A;  3IC8 A;  2R4V A;  5D9X A;  11GS A;  1GWC A;  4MJA A;  1VF3 A;  3KD0 A;  3C71 A;  4IP1 A;  4HDE A;  5KN2 A;  6GSW A;  3EU3 A;  4PNG A;  3ZL5 A;  4GRF A;  4F0C A;  1PQN A;  1A24 A;  1OAZ A;  4F0B A;  1SKS B;  1QMV A;  1MDI A;  5KN0 A;  3GKK A;  3VWW A;  5CNW A;  5EPF A;  2B5X A;  1X5E A;  1PL2 A;  4LL1 B;  2JAD A;  1HQO A;  1M2B A;  4K5S A;  4N0V A;  5DCG A;  4G10 A;  1Y6E A;  4YKF A;  3BD2 A;  2KP2 A;  1PGT A;  2P5Q A;  5IMA A;  4YQM A;  1GL8 A;  1CQH A;  2TIR A;  3TOT A;  3FK8 A;  4CW9 A;  4EUY A;  3VK9 A;  3UBL A;  2NVL A;  3LEF A;  2IFQ B;  2ZCT A;  3LW9 A;  3QAW A;  1T1V A;  2XBQ A;  5A4V A;  2HZF A;  2CT6 A;  4YH2 A;  5DAL A;  3UMA A;  3ZRE A;  2LST A;  1GSY A;  3F3Q A;  3TB2 A;  4RUV A;  3QPM A;  1EZK A;  2PBJ A;  3HVX A;  1DE1 A;  1WRY A;  1U3A A;  4MLY A;  1S3A A;  2L6C A;  3HHV A;  1I9D A;  3D0Z A;  4PNF A;  3IPZ A;  1T4Z A;  1TDI A;  4AGS A;  2P31 A;  2CZ2 A;  1EV9 A;  2M46 A;  3IDV A;  4ILF A;  1FAA A;  3UVH A;  4MP4 A;  6GST A;  1BED A;  1HYU A;  5INY A;  3GX0 A;  1THO A;  1RK4 A;  3MAK A;  5H5R A;  3QOU A;  4ULX A;  2L59 A;  2H74 A;  3EMP A;  2O8V B; 
#chains in the Genus database with same CATH homology
 3NOF A;  3LGC A;  2MBS A;  2FGX A;  3HJP A;  3CXG A;  2H66 A;  2RII A;  2C1Y A;  5L71 A;  1LJR A;  4ZB6 A;  2CV4 A;  2ES7 A;  2J23 A;  4K2D A;  4P3Y B;  4PX1 A;  3BOA A;  3EVI A;  3N5O A;  1XFL A;  4IJI A;  1QFN A;  2ZNM A;  5J9C A;  4BWS A;  4TR4 A;  4G0I A;  2TRC P;  5D9W A;  1ERT A;  4OCE A;  2EIR A;  3LXT A;  2KUC A;  3CRU A;  1WIK A;  4OD7 A;  4IEL A;  5IOX A;  2R3X A;  2RUE A;  2LEG A;  5HR3 A;  2FY6 A;  3IOS A;  3LWA A;  1SYR A;  5J9B A;  3HD5 A;  2CX3 A;  5DQY A;  1GSD A;  3KGK A;  4JR4 A;  2L4Q A;  4PUF C;  3RPP A;  1A8L A;  2AAW A;  1R7H A;  3EC3 A;  2LRN A;  3GA4 A;  2VLV A;  1CQG A;  2VCT A;  1A2J A;  4IN0 A;  4Z2R A;  1MTC A;  3TOU A;  3TGZ A;  4BVY B;  2F8A A;  4XTS A;  4HZ2 A;  1GLQ A;  5FT3 A;  3D21 A;  2DLX A;  4K6X A;  3WT2 A;  4ZL9 A;  4BL7 B;  1T3B A;  3QMX A;  4Z2T A;  2C3Q A;  4JR6 A;  3F4T A;  2V6K A;  1WE0 A;  5DDL A;  3VI5 A;  2QA1 A;  4TOP A;  2IFQ A;  2AUV A;  4HU7 A;  3WD6 A;  4TKY A;  3DIE A;  10GS A;  1GUL A;  16GS A;  5G1K A;  3HKR A;  5ECL B;  1Q4J A;  3DVX A;  3VWX A;  2RUF A;  5D9V A;  1X9S B;  2R0C A;  4TN8 A;  4POL A;  1HD2 A;  4GLT A;  20GS A;  1IYH A;  3DVW A;  3GN3 A;  3O76 A;  3W8J A;  2V32 A;  4CY6 A;  3A2W A;  3IA1 A;  2JL4 A;  2FA8 A;  4O92 A;  3UAR A;  3M1G A;  2WJU A;  4MK3 A;  2ON5 A;  1OVN A;  4IBP A;  1MD3 A;  3Q18 A;  4L5L A;  2GT6 A;  4EF0 A;  1T00 A;  4JZQ A;  3BJ5 A;  2FNO A;  1QXH A;  3KP9 A;  3MNG A;  4KSO A;  1A8Y A;  1OKT A;  2HFD A;  4MF5 A;  1V98 A;  5IM9 A;  5EVO A;  5ID2 B;  5CRE A;  4ZL7 A;  3O3T A;  2E0Q A;  1PA3 A;  3DGQ A;  2R0P A;  5DAK B;  3ZIJ A;  1GRX A;  4K0G A;  1OKD A;  3L0H A;  4J56 E;  9GSS A;  4L8E A;  2VL9 A;  5J5N A;  2DML A;  4LL4 B;  1DE2 A;  3KMN A;  4OMV A;  4G2E A;  5IPG A;  3GKX A;  1VRS D;  4L5O A;  2H75 A;  5G30 A;  3F6F A;  1EOH A;  3HZ8 A;  1PD2 1;  4DVC A;  3GYK A;  3IHQ A;  4NMU A;  1PKZ A;  1RQM A;  1TI1 A;  3C73 A;  2V6O A;  1TRW A;  1XCC A;  1ZCP A;  1RW1 A;  1GTU A;  3KCM A;  4N11 A;  4TR3 A;  3DD3 A;  3LSZ A;  1PL1 A;  3FEU A;  2WGR A;  1SJI A;  2YP6 A;  2C3T A;  14GS A;  4KUN A;  1G6W A;  4TR0 A;  2QC7 A;  2P5R A;  4EVM A;  2ON7 A;  1V58 A;  1QUW A;  2KHP A;  1ZYQ B;  4KW6 A;  2HYX A;  2WZ9 A;  1K0B A;  2GSR A;  2YOI A;  3HYP A;  2GVP A;  2YJH A;  4USS A;  2GTU A;  1ON4 A;  4ZXG A;  1R26 A;  4NXI A;  2GLR A;  2I81 A;  3DXB A;  2L5L A;  5ECM B;  4IJ3 A;  1PN9 A;  3EMX A;  1SU9 A;  4AJ8 A;  2HRA A;  4MJE A;  3TJG A;  2BJX A;  4J57 E;  1K3O A;  1F3A A;  2IN3 A;  2WB9 A;  3RDW A;  5HR2 A;  1V2A A;  4IP6 A;  5IMC A;  5F0G A;  3FZ4 A;  3GKM A;  1A23 A;  1UVZ A;  1F6M C;  2B1K A;  1NM3 A;  3QDN A;  3F4R A;  4GTU A;  4GQC A;  4YQU A;  3CSJ A;  2C0F A;  4FQU A;  3A2X A;  4F2I A;  17GS A;  1EEM A;  1X5D A;  4I5Q A;  2AJQ B;  3IC4 A;  2V41 A;  1XW6 A;  1HNA A;  3BCI A;  4K1F A;  4LMV A;  4NPB A;  2FLS A;  2XPD A;  2LKU A;  2PN8 A;  2VLU A;  4MNN A;  5ID2 A;  2H01 A;  5KEJ A;  3PR8 A;  5DAK A;  4FO5 A;  3P7X A;  5DBQ A;  7GSS A;  1TK0 B;  2GSQ A;  3UL3 A;  2CVD A;  5JCW A;  1PN0 A;  1ZYN A;  2B5E A;  5JWQ B;  2AB6 A;  1QQ2 A;  3APQ A;  6GSS A;  4EIP A;  4HQS A;  1TW9 A;  1NSW A;  1F2E A;  4ECB A;  6GSX A;  5C00 A;  3CTF A;  4JED A;  2H19 A;  3GUR A;  2I3Y A;  1FG4 A;  2JU5 A;  2I1U A;  4QL7 A;  1URM A;  3H1N A;  4XS6 A;  4KH7 A;  3L9S A;  2FUG 2;  2C8U A;  3C7M A;  5ECH B;  4HEA 2;  4KGI A;  4HS1 A;  2GZY A;  2PGT A;  2F51 A;  2GQK A;  2LJR A;  2F9S A;  4V2L A;  2HSY A;  3F9U A;  2ALB A;  3CSH A;  2H6Z A;  4MF6 A;  3EWL A;  3TJK A;  2VAF A;  2YV7 A;  2VCV A;  4GSN A;  4MAB A;  3CMI A;  1W89 A;  3N9J A;  3GTU B;  2P0G A;  1Q98 A;  2VCX A;  1O6J A;  2PUK C;  3PIN A;  2C0G A;  3GL3 A;  1WWJ A;  3MYD A;  3ZFL A;  2HZE A;  1K3L A;  1AQX A;  2LS5 A;  2AYT A;  3QR6 A;  3TKS A;  3KIJ A;  2LV3 A;  1Z9H A;  4RQR A;  2XHF A;  4Z2U A;  3IBH A;  3S9F A;  3HVS A;  4KX4 A;  1H4O A;  2O85 A;  2DKI A;  2IME A;  3UIW A;  4TW5 A;  3IAS 2;  4E8H A;  2A2P A;  3GV1 A;  1JLW A;  4X43 A;  1TU7 A;  4POB A;  3U6V A;  5G1L A;  3ZFB A;  3EPT A;  1WJK A;  3NIV A;  3IK7 A;  2DC5 A;  3FR3 A;  3UAP A;  4XS4 B;  1ML6 A;  3IHG A;  19GS A;  1GTB A;  2FWH A;  1OE7 A;  1XW9 A;  1G7O A;  4PUR A;  1OC8 A;  1ABA A;  2YZU A;  2CA8 A;  4X1U A;  1KBN A;  1XWG A;  4TXV A;  3A5I A;  5B6M A;  4WBR D;  2L57 A;  6GSU A;  4ZL8 A;  2VL2 A;  2WCI A;  5HR0 A;  3FMW A;  3QCP A;  1UA5 A;  2B7K A;  5ECI B;  4OO4 A;  2DMM A;  2K8S A;  4QL9 A;  1EWX A;  1SKW B;  4FYB A;  1USB A;  2I4A A;  1ZL9 A;  2X4A A;  1FOV A;  1J08 A;  1WP0 A;  4V2M A;  1ZZY A;  1O8W A;  2K8V A;  1T8E B;  4K0N A;  1U87 A;  2X8C A;  1QGV A;  1TJD A;  2X49 A;  5LNK e;  2OKA A;  3FRC A;  2HT9 A;  5KN3 A;  4MH2 A;  2C0D A;  2H1G A;  3FW2 A;  3QFA C;  3G7I A;  3KH9 A;  5DQS A;  1MDK A;  5A4W A;  5B7C A;  4O32 A;  3GTU A;  2VCZ A;  1A0F A;  4NHW A;  2WUL A;  3APO A;  2GSS A;  2XBI A;  2H1D A;  2K9F A;  2OE1 A;  1YEX A;  2JAC A;  1I5G A;  1SK0 A;  3HVV A;  3TRP A;  3VUR A;  5G2Z A;  1XZO A;  4TRX A;  1T7P B;  3D4T A;  2DBC A;  3RHB A;  3W6G A;  5G5E A;  5IMZ A;  4BVX B;  1G7E A;  2GZZ A;  1AQV A;  1OC9 B;  3TKS E;  5J41 A;  4GST A;  5HFG A;  3KXO A;  3APS A;  4KND A;  3ME7 A;  4IS0 A;  2X99 A;  1SYX A;  3G7J A;  1Z7R A;  2VM2 A;  2WDU A;  4XS4 A;  3ERG A;  3P2A A;  2G2Q A;  4AJ6 A;  3UJ1 A;  4H86 A;  2H1A A;  3EE2 A;  3QFB C;  4WBJ A;  4F03 A;  1F37 A;  2PMT A;  2IPA A;  1VGL A;  3WT1 A;  2MMA A;  5F05 A;  4RQX A;  1X0R A;  1ERV A;  3DML A;  4I2T A;  1PKW A;  2KLX A;  2BMX A;  2QA2 A;  2NDO A;  2NTO A;  3C1R A;  2YWO A;  1GUH A;  1K0D A;  5EL8 A;  4EDZ A;  4K5R A;  2VM1 A;  3KP8 A;  1SK2 A;  1U88 A;  3U5R E;  3TJF A;  4I6X A;  2HE3 A;  5GAN D;  2AV4 A;  1SL0 B;  1O7U A;  4V1A g;  2V2G A;  3O6T A;  4PQ1 A;  3KTL A;  2PPT A;  3GKN A;  3L9V A;  1BX9 A;  2MBT A;  4KE3 A;  4PTS A;  1A2M A;  3IRA A;  4D73 B;  4G0K A;  5B8B A;  4KDX A;  2YWM A;  4POK A;  1JZO A;  1AIU A;  5D93 A;  1AUC A;  3TJB A;  3LFL A;  2PU9 C;  1THX A;  4IQ1 A;  1SJZ A;  2VL3 A;  5ABR A;  4I2U A;  5JCU A;  1ACV A;  3PPU A;  5JCG A;  2IMK A;  3E3E A;  1Z6N A;  2LRT A;  1X9M B;  4OCF A;  1J0F A;  2A2R A;  4GXZ A;  1FOH A;  3HDC A;  1GH2 A;  4BVX A;  2V1M A;  1XIY A;  4ECI A;  5EY6 A;  2LUS A;  1BYE A;  1OC9 A;  3C8E A;  2H71 A;  2H1B A;  1B4Q A;  2KP1 A;  5H5Q A;  3CYN A;  3FKF A;  3DWV A;  4XS1 A;  2JSY A;  1AC1 A;  1J9B A;  5JWR B;  2YCD A;  2O7K A;  1GLP A;  5CRG A;  1JZR A;  1GNE A;  1SEN A;  5HFK A;  2RLI A;  1O81 A;  3FR6 A;  3WGX A;  2IJY A;  4MH3 A;  4ML1 A;  12GS A;  2QGV A;  2R0G A;  4MZW A;  4QQ7 A;  1F9M A;  2MMN A;  5D8I A;  3EU4 A;  2TRX A;  2CZ3 A;  1BAY A;  4MPF A;  4PGT A;  5KOX A;  4J2F A;  1XBS A;  2DIZ A;  1H75 A;  3G7Y A;  2IMF A;  4GCI A;  1K0O A;  1M9B A;  3J7Y k;  3KZQ A;  4G9H A;  3UVT A;  5F8B A;  5DJL A;  2IWT A;  4HJ2 A;  5JWO B;  1M99 A;  3FY7 A;  1YF1 A;  2FCH A;  3VWU A;  2DSA A;  4A5P A;  4EDY A;  3HCZ A;  4PQH A;  3VI7 A;  2LTK A;  3MWH A;  4YKG A;  1YKA A;  4ZBD A;  2CQ9 A;  4G0L A;  5HR1 A;  1YF0 A;  2NPB A;  2DKH A;  3H4K A;  5GSS A;  1HNB A;  2N5F A;  2HZE B;  4OFT A;  2LRC A;  1X5C A;  4ZBA A;  5J4U A;  4D73 A;  1M9A A;  4ZIL A;  2R2J A;  1GSS A;  4FYU A;  1FW1 A;  2FWG A;  2E2M A;  2KOK A;  5ECR B;  1SJ6 A;  4PXO A;  4WXT A;  1Z3E A;  1TP9 A;  3RHC A;  2HNL A;  4KSM A;  4O7H A;  4JE1 A;  1XVW A;  4O5Q A;  1UC7 A;  1C72 A;  1JZD A;  3I43 A;  2HLS A;  1MEK A;  4RI7 A;  2B7J A;  1PSQ A;  2LJA A;  2GZP A;  2B3S A;  1XWK A;  3A2V A;  3D5J A;  3LJR A;  5H5S A;  3F3R A;  3NZN A;  5A4U A;  3LG6 A;  5E59 A;  1F3B A;  3TKP A;  5DCH A;  4IGJ A;  1G6Y A;  2HRF A;  3QAG A;  4FIW A;  4HJM A;  2M80 A;  4ID0 A;  1ZMA A;  4XIH A;  4X0X A;  2FA4 A;  4NHZ A;  3M9J A;  2VD1 A;  4FYC A;  3HZ4 A;  1SL2 B;  4EE0 A;  1XVQ A;  1HNC A;  5HFI A;  6GSY A;  1M2D A;  1YY7 A;  2C3N A;  4MCU A;  5AIV A;  3P8W A;  3M3M A;  3EYT A;  1TRU A;  5AGY A;  1G0T A;  2OA7 A;  2MYG A;  3MSZ A;  5ELG A;  4ML6 A;  2ZUP A;  3LXZ A;  3IE3 A;  4MJC A;  2WRT A;  5D9T A;  3ME8 A;  3BBY A;  3JCM L;  2DJK A;  2JSZ A;  4K9Z A;  3FZ5 A;  1PX6 A;  1B9X C;  5D73 A;  3ZVJ A;  4Q5R A;  5ECN B;  1AW9 A;  3PGT A;  1FVJ A;  1Y25 A;  2YZH A;  2K18 A;  2H0G A;  1VF2 A;  4NAX A;  4ECJ A;  5GZZ B;  1SL1 B;  1R5P A;  2CAI A;  2YNX A;  5COH A;  2L6D A;  3FZA A;  1O85 A;  3H79 A;  4EKZ A;  2C4J A;  3UBK A;  2H0I A;  2A4H A;  4MA9 A;  4NV5 A;  2M72 A;  3L78 A;  4IHU A;  4Q5F A;  2H8L A;  1TXX A;  4XCS A;  5B6N A;  4HI7 A;  1GUK A;  4GQF A;  5ECQ B;  1JFU A;  1GUM A;  1WOU A;  2GGT A;  3VPQ A;  3ZMK A;  3F4S A;  1YEP A;  2VIM A;  4AJ7 A;  1KEB A;  3KH7 A;  1Z7P A;  5D96 A;  2L4C A;  3FZ9 A;  1BQ7 A;  2B6M A;  4OFM A;  1ERU A;  4KCE A;  2O89 A;  3ZYW A;  4ZBB A;  3M9K A;  2CX4 A;  4K7O A;  1FVK A;  1N2A A;  2IIY A;  2R37 A;  2WS2 A;  3D22 A;  2UZ8 A;  1YQ1 A;  2G0F A;  3H93 A;  2H6X A;  2XC2 A;  4ECC A;  3GUS A;  2NBS A;  5G5F A;  3DKS A;  2RM5 A;  5DJM A;  1GSU A;  3HJO A;  3TKR A;  2C80 A;  13GS A;  3GSS A;  4HUA A;  1FB6 A;  4E8E A;  2MMO A;  4X4J A;  3F6D A;  1R5A A;  4PUA A;  3UOM A;  3V1W A;  2OBK A;  5IMF A;  1V9W A;  3Q6O A;  3QD9 A;  2DJ1 A;  4MZC A;  1LBK A;  2HSH A;  2R6K A;  3IK9 A;  4MF7 A;  1U6T A;  1XOB A;  1SK1 A;  4ACS A;  4MJB A;  2H0H A;  2O87 A;  5ECK B;  3AY8 A;  2GQM A;  4FH8 A;  4NWY A;  1AXD A;  4IKH A;  4ZB8 A;  4KA0 A;  3GHA A;  2GDR A;  1Z5Y E;  3WYW A;  2X64 A;  3TRX A;  3GH9 A;  1XWA A;  3GIX A;  1K0A A;  3OR5 A;  2YAN A;  1TK8 B;  2YV9 A;  5CAX A;  5ELA A;  3GFK A;  2L5O A;  3IXR A;  2VCW A;  3ZRD A;  4I8B A;  4OFN A;  3RPN A;  4ZB9 A;  5CO3 A;  3CSI A;  4Z7X A;  3TUE A;  5ECP B;  1A2L A;  1XXU A;  4GWR A;  4Q5N A;  4BWQ A;  4GSS A;  3R3E A;  2F8F A;  4LA1 A;  5E4W A;  3CBU A;  2LJK A;  1TRS A;  5KN1 A;  4IW9 A;  3DEX A;  3LQ7 A;  5G31 A;  1B8X A;  3TKS C;  1SD9 A;  5IMD A;  4K7N A;  4WR5 A;  3H8Q A;  3VFI A;  4G19 A;  3KMO A;  4V2N A;  3WGD A;  4DEJ A;  1XW5 A;  4OO5 A;  3F0I A;  1B9Y C;  3WGE A;  2EC4 A;  1FHE A;  2H6Y A;  2B1L A;  1S3D A;  2IMD A;  2VD0 A;  2EIQ A;  2E2G A;  3P90 A;  2B5Y A;  2IL3 A;  5IO2 A;  3IAM 2;  2OBI A;  1PX7 A;  5FHI A;  1XPV A;  4F82 A;  1NHY A;  3GMF A;  2QSI A;  4MZB A;  2K6V A;  1GSF A;  4HQZ A;  2OE0 A;  1JZW A;  5BRT A;  2H70 A;  4CY8 A;  4WF5 A;  1O8X A;  1DSB A;  3SBC A;  4DSR A;  6GSV A;  3SWL A;  1SKR B;  2QKE A;  4ICY A;  2AHE A;  2VL2 C;  5CRH A;  1GP1 A;  4WR4 A;  5IO0 A;  2A4V A;  3HA9 A;  1TRV A;  2DJ2 A;  2FHE A;  5CRD A;  4F9Z A;  5BMU A;  5IPH A;  2YJ7 A;  4TR1 B;  4EXJ A;  1GNW A;  1TOF A;  5HQP A;  2H76 A;  8GSS A;  3ZIV A;  2DJJ A;  1O73 A;  3DRN A;  3D6I A;  2YWN A;  3PH9 A;  3I9V 2;  3J7Y b;  3L9U A;  2R5G A;  4DSS B;  1T4Y A;  4YQV A;  1GTA A;  3EUR A;  1M7T A;  3CRT A;  2OJL A;  4IQA A;  2DIY A;  1XWB A;  1K0N A;  4MPG A;  4L0W A;  4BPY A;  2VLT A;  3GRX A;  5GST A;  4NV2 A;  3HXS A;  1N8J A;  3MDK A;  1BJX A;  3TJJ A;  3ERW A;  1OC3 A;  2GT5 A;  3R2Q A;  3ZZX A;  4ZIJ A;  1B4P A;  1OYJ A;  3VLN A;  2OAD A;  2OAC A;  3VPT A;  1GSQ A;  2J9H A;  1GTI A;  2CVK A;  3DYR A;  4K7I A;  1Z6M A;  3VWV A;  5A5K A;  1JHB A;  3HJM A;  1V57 A;  1ZGN A;  3IR4 A;  3M8N A;  4KAE A;  3TRQ A;  3ZVJ D;  3LOR A;  1PMT A;  1EGR A;  22GS A;  3LYP A;  3ZML A;  3ZLP A;  4MDC A;  4JRR A;  1GSE A;  4WEY A;  4OWY A;  4TXO B;  1OE8 A;  4WKW A;  3FR9 A;  4AF2 A;  2FWE A;  4K2X A;  4KB3 A;  4N10 A;  2FWF A;  2MMZ A;  3CTG A;  3RBT A;  1E2Y A;  3M0F A;  1VF1 A;  5DVB A;  2LQQ A;  2N5A A;  2CAQ A;  1MDJ A;  1VF4 A;  3C1S A;  1IYI A;  5C04 A;  2YN1 A;  3A3T A;  2XPE A;  3L4N A;  4ISD A;  1NHO A;  4RI6 A;  3E0U A;  5AN1 A;  4CDO A;  2PWJ A;  5J3R A;  3G9B A;  4TR1 A;  1KNG A;  4Q5Q A;  3ZIT A;  2F3M A;  2HXK A;  4XRA A;  2YWI A;  3W8S A;  1M2A A;  4I97 A;  3F63 A;  2CVB A;  2OE3 A;  3GST A;  4BVY A;  3Q19 A;  5KOW A;  3KM6 A;  3GH6 A;  3US3 A;  3MIX A;  5ECO B;  1YKC A;  5AIS A;  5AIX A;  4KF9 A;  4DSS A;  4BL7 A;  1EEJ A;  1XWC A;  2VO4 A;  3F8U A;  1U3I A;  1PRX A;  1YJ6 A;  1YZX A;  2N5B A;  1TK5 B;  2DJ0 A;  3LYK A;  2VCQ A;  2X8H A;  1X9W B;  1TU8 A;  2GST A;  2GS3 A;  3UEM A;  1BG5 A;  3K8N A;  5ECS A;  2D2Z A;  1K0C A;  4GF0 A;  3Q74 A;  3GL5 A;  5CP1 A;  4XHM A;  2MZC A;  4YAP A;  4WET A;  2WFC A;  3E9J B;  1ZOF A;  4HOJ A;  4N30 A;  3I69 A;  5FWG A;  1ZYP A;  3IV4 A;  3ED3 A;  1YDK A;  3RAZ A;  1V40 A;  1WPI A;  1QK8 A;  3ISO A;  2HSM A;  3GNJ A;  4BA7 A;  3FHK A;  1EP8 A;  3FYG A;  1LU4 A;  1ILO A;  3KTB A;  4KDU A;  1E6B A;  4LLR A;  5F07 A;  5IMV A;  5CYY A;  2H30 A;  1DUG A;  4TXO A;  1EOG A;  1R4W A;  1TTZ A;  2HRK A;  1TI3 A;  2VUP A;  18GS A;  2Z9S A;  3KEB A;  2E7P A;  3BCK A;  2LNT A;  5GAP D;  2H73 A;  4LMW A;  1AQW A;  1MD4 A;  2H72 A;  1ERW A;  1ST9 A;  3QAV A;  1K0M A;  2LQO A;  3EIN A;  1B48 A;  3GX8 A;  1AAZ A;  4YAV A;  3A5W A;  5IQY A;  1DBY A;  2LNS A;  2HI7 A;  4O5U A;  4POM A;  2YPM A;  4HZ4 A;  1UN2 A;  4K8M A;  2IMI A;  4EL1 A;  2PVO C;  4DSQ A;  4N0Z A;  2BTO T;  3I6A A;  1M0U A;  4L0U A;  4KDY A;  5IIZ A;  2HRN A;  2DJ3 A;  1S3C A;  1WMJ A;  3TDG A;  2I9H A;  2VOC A;  5IOW A;  1XOA A;  2PVQ A;  1FB0 A;  5DAL B;  4XRD A;  4MMM A;  2C0E A;  4WF4 A;  2X8G A;  1ZYE A;  2RM6 A;  1JLV A;  1KTE A;  2FD3 A;  5F06 A;  3D4M A;  1A0R P;  1EV4 A;  2JZR A;  5ENU A;  4V1A p;  4O5R A;  1EGO A;  3ERF A;  2JZT A;  2REM A;  3TCO A;  5CRW A;  4PQI A;  4JU5 A;  3KJY A;  3HY2 A;  2PER A;  1K3Y A;  1TKD B;  4EIQ A;  4KCA A;  4JBB A;  3ZTL A;  1NW2 A;  2EIO A;  4EO3 A;  1FO5 A;  1EP7 A;  2A2S A;  3TKQ A;  2GQL A;  2JZS A;  5LD0 A;  1W4V A;  5LCZ A;  4EC0 A;  4CHS A;  1SD8 A;  5B8A A;  4HU9 A;  4IVF A;  4TVE A;  3IC8 A;  2R4V A;  5D9X A;  11GS A;  1GWC A;  4MJA A;  1VF3 A;  3KD0 A;  3C71 A;  4IP1 A;  4HDE A;  5KN2 A;  6GSW A;  3EU3 A;  4PNG A;  3ZL5 A;  4GRF A;  4F0C A;  1PQN A;  1A24 A;  1OAZ A;  4F0B A;  1SKS B;  1QMV A;  1MDI A;  5KN0 A;  3GKK A;  3VWW A;  5CNW A;  5EPF A;  2B5X A;  1X5E A;  1PL2 A;  4LL1 B;  2JAD A;  1HQO A;  1M2B A;  4K5S A;  4N0V A;  5DCG A;  4G10 A;  1Y6E A;  4YKF A;  3BD2 A;  2KP2 A;  1PGT A;  2P5Q A;  5IMA A;  4YQM A;  1GL8 A;  1CQH A;  2TIR A;  3TOT A;  3FK8 A;  4CW9 A;  4EUY A;  3VK9 A;  3UBL A;  2NVL A;  3LEF A;  2IFQ B;  2ZCT A;  3LW9 A;  3QAW A;  1T1V A;  2XBQ A;  5A4V A;  2HZF A;  2CT6 A;  4YH2 A;  5DAL A;  3UMA A;  3ZRE A;  2LST A;  1GSY A;  3F3Q A;  3TB2 A;  4RUV A;  3QPM A;  1EZK A;  2PBJ A;  3HVX A;  1DE1 A;  1WRY A;  1U3A A;  4MLY A;  1S3A A;  2L6C A;  3HHV A;  1I9D A;  3D0Z A;  4PNF A;  3IPZ A;  1T4Z A;  1TDI A;  4AGS A;  2P31 A;  2CZ2 A;  1EV9 A;  2M46 A;  3IDV A;  4ILF A;  1FAA A;  3UVH A;  4MP4 A;  6GST A;  1BED A;  1HYU A;  5INY A;  3GX0 A;  1THO A;  1RK4 A;  3MAK A;  5H5R A;  3QOU A;  4ULX A;  2L59 A;  2H74 A;  3EMP A;  2O8V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...