1ZMAA

Crystal structure of the bacterocin transport accessory protein from streptococcus pneumoniae
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
SNAMEQFLDNIKDLEVTTVVRAQEALDKKETATFFIGRKTCPYCRKFAGTLSGVVAETKAHIYFINSEEPSQLNDLQAFRSRYGIPTVPGFVHITDGQINVRCDSSMSAQEIKDFAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Bacterocin Transport Accessory Protein from Streptococcus pneumoniae
rcsb
molecule keywords bacterocin transport accessory protein
molecule tags Transport protein
source organism Streptococcus pneumoniae
total genus 38
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zmaA00
6GSUA 3ERFA 4ZB9A 1TRWA 3TGZA 1MDIA 2LJAA 1JZRA 1PL2A 4IVFA 2YP6A 2L4CA 4EVMA 1QXHA 3L4NA 3IPZA 1N2AA 1B4QA 3F3QA 4PQHA 1YF1A 1H4OA 3UIWA 4HU9A 4J57E 3P2AA 3ZZXA 2GGTA 3QPMA 4QQ7A 4YAVA 3A2WA 4EUYA 4BVYA 2YZUA 4MH3A 4AGSA 1IYIA 2WCIA 1TRVA 5G5EA 2ZCTA 5JWQB 1K0NA 2AB6A 2WDUA 1AQWA 2B5EA 5ECPB 3CYNA 3P90A 4LMWA 4KSOA 1TRUA 2GSQA 3IK9A 5IMDA 1GH2A 3D21A 1GL8A 5ECRB 1PKWA 4ZL9A 5AISA 4ZL7A 3HXSA 1OKTA 5AGYA 1G7OA 4N30A 5DALA 3GYKA 2P0GA 2OE0A 5IOWA 4OFTA 2B1KA 4DSSA 4KNDA 1B48A 1B8XA 3QAGA 2GQLA 1EOGA 5ABRA 1R5PA 5G5FA 3IHQA 5F8BA 2P5RA 3D4TA 5COHA 1O6JA 2AHEA 2GVPA 2L57A 2MMOA 4IJ3A 5AIVA 1T4ZA 2FA8A 2CAIA 1GSUA 2VCVA 2K9FA 3ZMKA 3S9FA 3J7Yk 3KEBA 1OKDA 4BPYA 1EV4A 1ZYEA 1O8WA 3BCIA 4K1FA 3QFAC 1X5CA 1TW9A 5D96A 3UAPA 2QGVA 3IAM2 4ID0A 3OR5A 3Q74A 2F8FA 2FWFA 2ZUPA 4IP6A 4PNFA 3HCZA 2WGRA 6GSVA 4ZBDA 4JRRA 1A2MA 2HYXA 2H1DA 2P31A 2QSIA 1GUMA 2HNLA 2M46A 4PXOA 5CREA 3LEFA 3KGKA 3EC3A 5ECNB 4LMVA 1M2BA 5DCHA 4J2FA 4BA7A 1ZZYA 2C80A 4NV2A 1GSYA 2ALBA 3TJGA 3HVSA 1OAZA 1M9AA 1YQ1A 4ZILA 2V2GA 2B5XA 5GZZB 1SENA 3GFKA 3GTUB 1BJXA 1THXA 3QDNA 3W6GA 1THOA 4ZL8A 4D73A 5ELAA 3F8UA 2CQ9A 3EU4A 2H01A 4KB3A 3FZ9A 2LNSA 2PBJA 5HQPA 5H5RA 1GTBA 2PU9C 3TRPA 5ECIB 5A4VA 2LJRA 1OC9A 3KH9A 4F0CA 5KEJA 2ES7A 3GKKA 2YWMA 5EPFA 1SU9A 1Y25A 2K18A 5HFGA 1UA5A 4K7OA 2XBQA 4POKA 2IFQA 1U6TA 1JZDA 3PINA 5FT3A 3GIXA 4G10A 1MD4A 1Q4JA 1TTZA 4GCIA 4TXOA 1I9DA 5F06A 1F3AA 1EZKA 3M9KA 1LJRA 4XS6A 1DBYA 1DE2A 4CDOA 3HJOA 5GSSA 2B1LA 5DAKB 1F3BA 4ZB8A 4L8EA 1X9MB 1O7UA 2PVQA 1A8YA 2IMFA 1R26A 1Z6NA 4XRDA 1TRSA 1TI3A 2VLTA 4IN0A 5HFIA 1YZXA 3IDVA 1O81A 4MLYA 2R3XA 3D6IA 1GSSA 1XWCA 3L9UA 3UVTA 2WJUA 3RAZA 3ZFBA 2FA4A 4OFNA 1GTUA 4TVEA 2H0HA 2LQOA 3UBKA 2C3TA 10GSA 4JBBA 5ECQB 5IM9A 1OYJA 1HNCA 1K0AA 2IL3A 2R5GA 3KZQA 3GSTA 3KMOA 4TN8A 4WBRD 1JFUA 1A0RP 3QCPA 3HYPA 4JEDA 4ECIA 2LRTA 1T7PB 1LU4A 4FYCA 2IIYA 4N10A 4GSTA 3C7MA 3D5JA 3GMFA 4ML6A 1EEJA 3GUSA 2LSTA 3BD2A 1XFLA 3UL3A 2YJ7A 1UVZA 2GQMA 1WPIA 2VUPA 1M2DA 4Q5RA 4GSSA 2AYTA 2DJ2A 4XHMA 3L0HA 2YCDA 3VWXA 3R2QA 4RI7A 4XCSA 3TDGA 1WRYA 2DJJA 1X0RA 4MJEA 2CV4A 2AAWA 1TP9A 4L5OA 4HZ4A 2OBKA 3VLNA 3FYGA 1GRXA 3A2VA 2RLIA 3GV1A 4HJMA 2H8LA 2EIRA 1BAYA 1LBKA 2B7JA 1SJZA 4ZXGA 3UVHA 1W4VA 1PGTA 2E2GA 3ZIVA 4KUNA 2VL3A 6GSXA 2C4JA 2O85A 5G31A 3M0FA 2CVBA 3KH7A 4NV5A 4EKZA 1SL2B 2F3MA 1J0FA 4KE3A 3KIJA 4L0UA 4MZBA 3M3MA 1XWGA 3DIEA 3GL3A 4I2TA 3UOMA 1K3LA 5ECLB 4YQUA 3HJMA 4FO5A 3U5RE 1A2LA 4K8MA 1K0MA 2CAQA 5CP1A 1XWBA 1SKSB 5GSTA 2AV4A 1AUCA 3IRAA 3EMPA 1BYEA 1JLVA 5DBQA 3F4RA 2IMKA 2LNTA 4TR0A 1OC8A 3TRXA 3VWWA 3ERWA 3PH9A 2OADA 2HXKA 2GZPA 3F0IA 4NMUA 3J7Yb 3F6DA 4GXZA 5IO0A 1PRXA 3VWUA 2H72A 5CAXA 4BVXA 16GSA 2L5OA 1PA3A 3VI5A 3MSZA 1GULA 3CRTA 1SJIA 1Z3EA 3CBUA 5CRWA 1T4YA 5JCGA 1XXUA 4KCEA 1ST9A 13GSA 2NBSA 5J9BA 4ECBA 3KP9A 1VF2A 1ERUA 1EGRA 2I4AA 2F51A 1G6WA 5F0GA 3GN3A 4MF7A 4RI6A 1GUHA 4WR4A 4IHUA 5ELGA 2TRXA 1T1VA 3FHKA 3KXOA 2PUKC 3I43A 4JR4A 1OVNA 5GAND 3VK9A 4KDUA 2FCHA 5J4UA 4WKWA 3ME8A 2H0IA 3FRCA 5IMCA 1MEKA 3CXGA 2B5YA 2VCXA 5F05A 4ML1A 4H86A 1U3AA 4MZCA 4MJAA 5A5KA 4G2EA 2KOKA 3HVXA 1TI1A 4FYBA 2HZEB 4OWYA 6GSWA 2EIQA 3QAWA 2PWJA 4ISDA 2WULA 4BWSA 2YN1A 5J3RA 2IMDA 4KCAA 3H79A 1X5EA 2I1UA 2GT6A 2YNXA 1ZGNA 4IGJA 2C3NA 3HA9A 1GTIA 4RQXA 3RPNA 2HE3A 3RHBA 3K8NA 5AIXA 4MJBA 2GQKA 2GZYA 2L59A 3TOUA 2LRCA 2DMMA 1NW2A 2RM6A 1X5DA 18GSA 4EF0A 2VIMA 1WWJA 1YDKA 3QD9A 4OD7A 1HNAA 1HNBA 2E0QA 5ENUA 2LEGA 4IW9A 2HRFA 3DGQA 1A0FA 1RW1A 5E4WA 4V2MA 2VL2C 3ZMLA 1JZOA 1JZWA 3VI7A 2C0GA 3FR6A 1FB6A 3BBYA 4K0NA 1K0CA 1PSQA 5D73A 2H1BA 1GUKA 1ZL9A 1GNWA 1B9XC 3CTGA 1AC1A 3F4TA 4HOJA 1G6YA 17GSA 1K3OA 2H75A 2JZSA 2YANA 3KTBA 2O87A 4TXOB 2MMNA 3EMXA 1F2EA 5LCZA 1B4PA 4MA9A 5HR3A 1R5AA 4WF4A 1GWCA 4OFMA 3TCOA 1J9BA 5JCUA 2PPTA 4YQVA 3C1RA 4PX1A 1M7TA 2V41A 4NHWA 1O85A 2HZFA 5IMZA 5J5NA 3VFIA 4F9ZA 2H1GA 2HRNA 3G9BA 1IYHA 4EL1A 3TKPA 1I5GA 4TR1B 4LL1B 2I81A 4MDCA 1VF3A 2YWOA 4MH2A 3GH9A 3AY8A 1XWAA 2BMXA 4LA1A 2KP1A 4TXVA 3A5WA 3TKRA 4IELA 4PUAA 2D2ZA 2RUFA 1C72A 1S3AA 3US3A 1GSEA 2VOCA 1Z9HA 4MPGA 2LTKA 1RK4A 4PUFC 4KDXA 4Q5QA 2H66A 2VCZA 3FZAA 2X8GA 3MAKA 5J9CA 2FWGA 3F6FA 2A4VA 4NXIA 2LS5A 1S3DA 2YJHA 2VLVA 2GS3A 5FHIA 1V2AA 1PX6A 4BWQA 1HYUA 2FHEA 2XHFA 5DQYA 3ZVJD 22GSA 5ID2B 2OJLA 3CSIA 3EVIA 5KN1A 1TDIA 3TB2A 2CVKA 3LYKA 1AXDA 4OO4A 3IXRA 5INYA 4N0ZA 2X8CA 4IP1A 3ZLPA 2FWEA 2H6XA 4GWRA 2O89A 2F8AA 5ECHB 3N9JA 3WGDA 1GNEA 4MF5A 1YEXA 2YZHA 3DEXA 1AIUA 1AQXA 4RQRA 4QL7A 1V9WA 1NSWA 3Q19A 4I6XA 4HZ2A 1KBNA 2VAFA 2DJ0A 4PQIA 2CVDA 3UMAA 1SK0A 3P8WA 1XW9A 2O7KA 4V1Ag 3W8SA 5KN0A 4OCEA 5ECOB 3TKSE 1V98A 2N5AA 1FHEA 2MBSA 4AJ6A 1FAAA 2BJXA 1XIYA 3LFLA 2DMLA 9GSSA 1XW5A 2CT6A 2YWIA 1XZOA 2GLRA 4ECCA 2H71A 2WB9A 4POLA 1RQMA 2ON7A 2H70A 3GKXA 4GLTA 1TK8B 1OE8A 2OBIA 5CRDA 4HJ2A 3ZVJA 2V32A 3QR6A 2OE1A 4J56E 3WYWA 3JCML 3DD3A 4JZQA 3GRXA 2FNOA 2V6OA 3NOFA 4JE1A 1UC7A 3M1GA 2C0EA 2HLSA 4LLRA 1A2JA 5CO3A 4EDYA 5DJMA 1EGOA 3PGTA 1XWKA 5KN3A 3KMNA 4WF5A 2XBIA 4XS4B 4ULXA 2DJ1A 3E9JB 4XTSA 3CRUA 1DSBA 19GSA 1EP7A 2FWHA 2MMAA 1MTCA 3APOA 4DVCA 3WGXA 4ZBBA 2N5BA 4K2DA 2JSYA 2G0FA 4LL4B 3GKNA 4IQ1A 3TUEA 2CX3A 2WRTA 3GTUA 2Z9SA 4GF0A 1SYXA 5A4WA 2R6KA 2NPBA 2MYGA 2MZCA 1AW9A 3G7IA 3DYRA 3IAS2 3TKSC 5CNWA 1QUWA 3IC4A 1QQ2A 3KM6A 5LD0A 2LRNA 3W8JA 3ZFLA 4WR5A 3APSA 1PMTA 3P7XA 1G0TA 3RBTA 3KD0A 1AQVA 1ILOA 2GZZA 1EOHA 1ZMAA 3H8QA 4WEYA 2V6KA 4TR3A 4HQSA 2GSRA 5B6MA 1F9MA 1SYRA 2IJYA 3ZL5A 1FVJA 2DJKA 3LJRA 4PQ1A 3TJFA 2H19A 1M0UA 1ZYQB 3ISOA 1FO5A 4EE0A 1X9WB 1CQHA 1M9BA 2DIZA 5B8BA 5D9VA 2H6ZA 1EEMA 4RUVA 2GT5A 2VCQA 3IE3A 2VO4A 3D22A 5IMVA 2WZ9A 5DAKA 3L78A 2CX4A 2R4VA 4ZIJA 1PQNA 2X8HA 1M2AA 4ZB6A 2H30A 2DJ3A 2LJKA 2C3QA 2JU5A 1T00A 3Q18A 1K0OA 4Z7XA 5J41A 4F03A 1MDJA 4I5QA 1A23A 4AJ7A 2B7KA 2VM1A 4GSNA 1U3IA 2H76A 1H75A 2J9HA 1GSFA 1WP0A 2C1YA 1XOBA 2OE3A 4GQFA 4TRXA 5IOXA 2HI7A 2IWTA 1M99A 2FD3A 3ZYWA 4F0BA 1TOFA 4O92A 5CYYA 3ZITA 1GTAA 4HUAA 3C73A 3WGEA 2ON5A 4KSMA 2VLUA 4TOPA 2LKUA 1K0BA 3KJYA 3GL5A 2GSSA 3GSSA 2L6DA 2N5FA 1V58A 4OMVA 3TJKA 2C8UA 4XS1A 1TU8A 5DJLA 3M8NA 5DALB 1DE1A 3KCMA 2VCTA 4TKYA 3D0ZA 4MZWA 4DSSB 4DEJA 1VGLA 2A2RA 2ZNMA 3E0UA 1OE7A 3IK7A 3Q6OA 4IQAA 7GSSA 2H74A 2NVLA 3HVVA 5JWOB 5FWGA 3TJJA 4NHZA 5G1LA 3RPPA 3HHVA 4KAEA 2XPDA 1ERVA 2FY6A 4GRFA 1T8EB 4XRAA 3GX8A 3EURA 1FVKA 2RIIA 4POBA 1YKAA 2GDRA 3FR3A 1YY7A 2WFCA 3BOAA 2JZRA 2KHPA 2LUSA 1BQ7A 4FH8A 4OO5A 1K0DA 4HS1A 2CZ3A 5ECSA 4WBJA 3IBHA 1TXXA 3VWVA 2I9HA 1J08A 1F6MC 4I2UA 3VPQA 1SD9A 2J23A 2C0DA 1GSQA 3MDKA 5IQYA 1AAZA 3H93A 1GLQA 2H73A 3LYPA 1PKZA 2JACA 1ML6A 2GTUA 3E3EA 4G9HA 4I97A 4MCUA 3O3TA 5H5QA 4D73B 2IMEA 1SL1B 2PN8A 2F9SA 3DMLA 2DBCA 4TW5A 5IPHA 3U6VA 1SK1A 3G7YA 1B9YC 1OC9B 1XCCA 5JWRB 3TOTA 3IV4A 1O73A 4ACSA 1FOVA 2LV3A 14GSA 2X99A 2DC5A 2IFQB 1SK2A 1F37A 1EV9A 5EVOA 1ABAA 3FKFA 4EXJA 1USBA 4WETA 8GSSA 3L9SA 2E7PA 4HQZA 4NPBA 5DQSA 3IOSA 4TR4A 4IBPA 4X43A 2H1AA 3O6TA 1JLWA 3TRQA 5HR0A 4F2IA 3I6AA 4ECJA 4AJ8A 2OKAA 3HJPA 4O32A 4DSRA 2TIRA 3DVWA 5EL8A 3UBLA 3WD6A 3DWVA 2HSYA 3C71A 4NWYA 1E2YA 1KEBA 4YAPA 3IA1A 3KTLA 3QFBC 3ZRDA 2KLXA 4FIWA 3GH6A 1HD2A 3DKSA 1V40A 2B6MA 2HZEA 2RM5A 4V2LA 4PNGA 2YWNA 2MBTA 4JU5A 3UJ1A 1URMA 3EYTA 1KTEA 4EDZA 3FZ4A 3MWHA 2VL2A 3EINA 5G2ZA 3TKQA 1QGVA 2JSZA 3CSHA 3LQ7A 3TJBA 3LORA 3DRNA 1YKCA 2K8SA 5CRHA 1TK5B 1SL0B 3H1NA 4K6XA 5HFKA 4Q5FA 1R4WA 2DLXA 1K3YA 3APQA 4MABA 3C8EA 11GSA 2RUEA 3CTFA 6GSTA 4KGIA 4PURA 2EC4A 4MJCA 2K6VA 4IJIA 3WT2A 3ME7A 4IS0A 1Z5YE 5B8AA 1OC3A 1XVQA 2HT9A 3HY2A 4K7IA 3A2XA 6GSSA 5GAPD 1EP8A 2BTOT 1WMJA 4KX4A 6GSYA 3HD5A 5IPGA 2NDOA 5ECKB 1ERTA 4K7NA 1X9SB 1O8XA 1W89A 3FY7A 1BG5A 4O7HA 2E2MA 1TU7A 1PX7A 3ED3A 3RDWA 3GNJA 4EC0A 2FGXA 3DVXA 3F63A 1A8LA 2L4QA 2QKEA 5F07A 1U87A 2H6YA 2EIOA 1Q98A 3LG6A 1E6BA 20GSA 3IR4A 1XVWA 1Y6EA 3VPTA 1YJ6A 1XW6A 4Q5NA 4CHSA 1A24A 3N5OA 3QAVA 2IPAA 3GA4A 3FW2A 4CW9A 3CMIA 4E8HA 2L5LA 2YV9A 4N11A 4EO3A 4HU7A 5IIZA 5JCWA 3HZ8A 2A2SA 3VURA 2XPEA 2L6CA 2JZTA 4K9ZA 3KP8A 1GSDA 5EY6A 4O5RA 5ECMB 2PMTA 3EE2A 2DSAA 1VF4A 2KP2A 4TR1A 1NHYA 3PR8A 2VL9A 1YEPA 3LXZA 3I9V2 1MD3A 1WIKA 5L71A 1FB0A 3DXBA 3LGCA 4MK3A 3BJ5A 2R37A 4POMA 2M80A 4E8EA 2H0GA 4HEA2 5HR2A 3D4MA 4L0WA 4X1UA 1GP1A 5E59A 5CRGA 4XIHA 4FYUA 4KH7A 3HKRA 1Z6MA 3F3RA 5LNKe 3HZ4A 2AJQB 2M72A 2O8VB 2YV7A 3ZIJA 4DSQA 4MP4A 1KNGA 3QOUA 2YPMA 5ID2A 1GLPA 1HQOA 1YF0A 2PVOC 1PL1A 1BEDA 3UEMA 4AF2A 4PGTA 3G7JA 1VRSD 12GSA 2OACA 2IN3A 1Z7RA 2VD0A 1UN2A 5KN2A 3SWLA 2XC2A 4F82A 3L9VA 1SKWB 1TJDA 2FUG2 3RHCA 1PD21 4GQCA 1TK0B 1XPVA 4HDEA 3ZTLA 5D9TA 2CA8A 5D9XA 1T3BA 1N8JA 1BX9A 4X0XA 3QMXA 3MNGA 3GURA 4G19A 5AN1A 1QK8A 2HSHA 3C1SA 2C0FA 2R2JA 3FEUA 4KA0A 1WE0A 2P5QA 1JHBA 3I69A 2WS2A 1EWXA 4MF6A 3LXTA 3ZREA 3O76A 4MPFA 1QFNA 3GHAA 5C04A 3F9UA 4BL7A 5DVBA 3GX0A 4ZBAA 4N0VA 3M9JA 5B7CA 2TRCP 4ILFA 5IO2A 3F4SA 4IKHA 1CQGA 2GSTA 4I8BA 3TKSA 3HDCA 3A3TA 3BCKA 3NZNA 5A4UA 3EU3A 1MDKA 4NAXA 1FW1A 4KW6A 2V1MA 1SKRB 3GKMA 4XS4A 1WJKA 5IMFA 1XOAA 2JL4A 5G30A 2YOIA 2MMZA 3ERGA 1DUGA 1SD8A 4L5LA 1S3CA 1PN9A 1WOUA 4YH2A 1V57A 2I3YA 5G1KA 3FZ5A 4K0GA 1ZCPA 2VD1A 3FK8A 1ACVA 2B3SA 2PERA 5D93A 4OCFA 1FG4A 1NM3A 3LWAA 2IMIA 3V1WA 3LSZA 4V2NA 2CZ2A 3WT1A 4WXTA 2QC7A 2AUVA 2FLSA 1R7HA 4QL9A 2HFDA 2OA7A 2X64A 1XBSA 2DIYA 3NIVA 4MMMA 5C00A 2G2QA 1VF1A 2VM2A 2NTOA 3UARA 4P3YB 5IMAA 1SJ6A 3FR9A 2KUCA 2VCWA 4V1Ap 4YQMA 1NHOA 1G7EA 4KDYA 5DDLA 2K8VA 3SBCA 5D8IA 4JR6A 2LQQA 5DCGA 1ERWA 5D9WA 1Z7PA 1ZOFA 3EWLA 2JADA 4HI7A 5HR1A 5H5SA 2PGTA 1ON4A 1U88A 3H4KA 3CSJA 1TKDB 1QMVA 4GTUA 5B6NA 2REMA
chains in the Genus database with same CATH superfamily
6GSUA 3ERFA 4ZB9A 1TRWA 3TGZA 1MDIA 2LJAA 1JZRA 1PL2A 4IVFA 2YP6A 2L4CA 4EVMA 1QXHA 3L4NA 3IPZA 1N2AA 1B4QA 3F3QA 4PQHA 1YF1A 1H4OA 3UIWA 4HU9A 4J57E 3P2AA 3ZZXA 2GGTA 3QPMA 4QQ7A 4YAVA 3A2WA 4EUYA 4BVYA 2YZUA 4MH3A 4AGSA 1IYIA 2WCIA 1TRVA 5G5EA 2ZCTA 5JWQB 1K0NA 2AB6A 2WDUA 1AQWA 4ICYA 2B5EA 5ECPB 3CYNA 3P90A 4LMWA 4KSOA 1TRUA 2GSQA 3IK9A 5IMDA 1GH2A 3D21A 1GL8A 5ECRB 1PKWA 4ZL9A 5AISA 4ZL7A 3HXSA 1OKTA 5AGYA 1G7OA 4N30A 5DALA 3GYKA 2P0GA 2OE0A 5IOWA 4OFTA 2B1KA 4DSSA 4KNDA 1B48A 1B8XA 3QAGA 2GQLA 1EOGA 5ABRA 1R5PA 5G5FA 3IHQA 5F8BA 2P5RA 3D4TA 5COHA 1O6JA 2AHEA 2GVPA 2L57A 2MMOA 4IJ3A 5AIVA 1T4ZA 2FA8A 2CAIA 1GSUA 2VCVA 2K9FA 3ZMKA 3S9FA 3J7Yk 3KEBA 1OKDA 4BPYA 1EV4A 1ZYEA 1O8WA 3BCIA 4K1FA 3QFAC 1X5CA 1TW9A 5D96A 3UAPA 1PFOA 2QGVA 3IAM2 4ID0A 3OR5A 3Q74A 2F8FA 2FWFA 2ZUPA 4IP6A 4PNFA 3HCZA 2WGRA 6GSVA 4ZBDA 4JRRA 1A2MA 2HYXA 2H1DA 2P31A 2QSIA 1GUMA 2HNLA 2M46A 4PXOA 5CREA 4BIKA 3LEFA 3KGKA 3EC3A 5ECNB 4LMVA 1M2BA 2DKHA 5DCHA 4J2FA 4BA7A 1ZZYA 2C80A 4NV2A 1GSYA 2ALBA 3TJGA 3HVSA 1OAZA 1M9AA 1YQ1A 4ZILA 2V2GA 2B5XA 5GZZB 4Z2UA 1SENA 3GFKA 3GTUB 1BJXA 1THXA 3QDNA 1FOHA 3W6GA 1THOA 4ZL8A 4D73A 5ELAA 3F8UA 2CQ9A 3EU4A 2H01A 4KB3A 3FZ9A 2LNSA 2PBJA 5HQPA 5H5RA 1GTBA 2PU9C 3TRPA 5ECIB 5A4VA 2HSMA 2LJRA 1OC9A 3KH9A 4F0CA 5KEJA 2ES7A 3GKKA 2YWMA 5EPFA 1SU9A 1Y25A 2K18A 5HFGA 1UA5A 4K7OA 2XBQA 4POKA 2IFQA 1U6TA 1JZDA 1M3JA 3PINA 5FT3A 3GIXA 4G10A 1MD4A 1Q4JA 1TTZA 4GCIA 4TXOA 1I9DA 5F06A 1F3AA 1EZKA 3M9KA 1LJRA 4XS6A 1DBYA 1DE2A 4CDOA 3HJOA 5GSSA 2B1LA 5DAKB 1F3BA 4ZB8A 4L8EA 1X9MB 1O7UA 2PVQA 1A8YA 2IMFA 1R26A 1Z6NA 4XRDA 1TRSA 1TI3A 2VLTA 4IN0A 5HFIA 1YZXA 3IDVA 1O81A 4MLYA 2R3XA 3D6IA 1GSSA 1XWCA 3L9UA 3UVTA 2WJUA 3RAZA 4O5QA 3ZFBA 2FA4A 4OFNA 1GTUA 4TVEA 2H0HA 2LQOA 3UBKA 2C3TA 10GSA 2R0GA 4JBBA 5ECQB 5IM9A 1OYJA 1HNCA 1K0AA 2IL3A 2R5GA 3KZQA 3GSTA 3KMOA 4TN8A 4WBRD 1JFUA 1A0RP 3QCPA 3HYPA 4JEDA 4ECIA 2LRTA 1T7PB 4K5RA 1LU4A 4FYCA 2IIYA 4N10A 4GSTA 3C7MA 3D5JA 3GMFA 4ML6A 1EEJA 3GUSA 2LSTA 3BD2A 1XFLA 3UL3A 2YJ7A 1UVZA 2GQMA 1WPIA 2VUPA 1M2DA 4Q5RA 4GSSA 2AYTA 2DJ2A 4XHMA 3L0HA 2YCDA 3VWXA 3R2QA 4RI7A 4XCSA 3TDGA 1WRYA 2DJJA 1X0RA 4MJEA 2CV4A 2AAWA 1TP9A 4L5OA 4HZ4A 3A5IA 2OBKA 3VLNA 3FYGA 1GRXA 3A2VA 2RLIA 3EPTA 4HSCX 3GV1A 4HJMA 2H8LA 2EIRA 1BAYA 1LBKA 2B7JA 1SJZA 4ZXGA 3UVHA 3HVNA 1W4VA 1PGTA 2E2GA 3ZIVA 4KUNA 2VL3A 6GSXA 4CY6A 2C4JA 2O85A 5G31A 3M0FA 3LW9A 2CVBA 3KH7A 4NV5A 4G0KA 4EKZA 1SL2B 2F3MA 1J0FA 4KE3A 3KIJA 4L0UA 4MZBA 3M3MA 1XWGA 3DIEA 3GL3A 4I2TA 3UOMA 1K3LA 5ECLB 4YQUA 3HJMA 4FO5A 4G0IA 3U5RE 1A2LA 4K8MA 1K0MA 2CAQA 5CP1A 1XWBA 1SKSB 5GSTA 4G0LA 2AV4A 1AUCA 3IRAA 3EMPA 1BYEA 1JLVA 5DBQA 3F4RA 2IMKA 2LNTA 4TR0A 1OC8A 3TRXA 3VWWA 3ERWA 3PH9A 2OADA 2HXKA 2GZPA 3F0IA 4NMUA 3J7Yb 3F6DA 4GXZA 5IO0A 1PRXA 3VWUA 2H72A 5CAXA 4BVXA 16GSA 2L5OA 1PA3A 3VI5A 3MSZA 1GULA 3CRTA 1SJIA 1Z3EA 3CBUA 5CRWA 1T4YA 4A5PA 5JCGA 1XXUA 4KCEA 1ST9A 13GSA 2NBSA 5J9BA 4ECBA 3KP9A 1VF2A 1ERUA 1EGRA 2I4AA 2F51A 1G6WA 5F0GA 3GN3A 4MF7A 4RI6A 1GUHA 4WR4A 4IHUA 5ELGA 2TRXA 1T1VA 3FHKA 3KXOA 2PUKC 3I43A 4JR4A 1OVNA 5GAND 3VK9A 4KDUA 2FCHA 5J4UA 4WKWA 3ME8A 2H0IA 3FRCA 5IMCA 1MEKA 3CXGA 2B5YA 2VCXA 4K2XA 5F05A 4ML1A 4H86A 1U3AA 4MZCA 4MJAA 5A5KA 4G2EA 2KOKA 3HVXA 1TI1A 4FYBA 2HZEB 4OWYA 6GSWA 2EIQA 3QAWA 2PWJA 4ISDA 2WULA 4BWSA 2YN1A 5J3RA 2IMDA 4KCAA 3H79A 1X5EA 2I1UA 2GT6A 2YNXA 1ZGNA 4IGJA 2C3NA 3HA9A 1GTIA 4RQXA 3RPNA 2HE3A 3RHBA 3K8NA 5AIXA 4MJBA 2GQKA 2GZYA 2L59A 3TOUA 2LRCA 2DMMA 1NW2A 2RM6A 1X5DA 18GSA 4EF0A 2VIMA 1WWJA 1YDKA 3QD9A 4OD7A 1HNAA 1HNBA 2E0QA 5ENUA 2LEGA 4IW9A 2HRFA 3DGQA 1A0FA 1RW1A 5E4WA 4V2MA 2VL2C 3ZMLA 1JZOA 1JZWA 3VI7A 2C0GA 3FR6A 1FB6A 3BBYA 4K0NA 1K0CA 1PSQA 5D73A 2H1BA 1GUKA 1ZL9A 1GNWA 1B9XC 3CTGA 1AC1A 3F4TA 4HOJA 1G6YA 17GSA 1K3OA 2H75A 2JZSA 2YANA 3KTBA 2O87A 4TXOB 2MMNA 3EMXA 1F2EA 5LCZA 1B4PA 4MA9A 5HR3A 1R5AA 4WF4A 1GWCA 4OFMA 3TCOA 1J9BA 5JCUA 2PPTA 4YQVA 3C1RA 4PX1A 1M7TA 2V41A 4NHWA 1O85A 1XG8A 2HZFA 5IMZA 5J5NA 3VFIA 4F9ZA 2H1GA 2UZ8A 2HRNA 3G9BA 1IYHA 4EL1A 3TKPA 1I5GA 4TR1B 4X4JA 4LL1B 2I81A 4MDCA 1VF3A 2YWOA 4MH2A 3GH9A 3AY8A 1XWAA 2BMXA 4EIPA 4LA1A 2KP1A 4TXVA 3A5WA 3TKRA 4IELA 4PUAA 2D2ZA 2RUFA 1C72A 1S3AA 3US3A 1GSEA 2VOCA 1Z9HA 4MPGA 2LTKA 1RK4A 3IHGA 5BRTA 4PUFC 4KDXA 4Q5QA 2H66A 2VCZA 3FZAA 2X8GA 3MAKA 5J9CA 2FWGA 3F6FA 2A4VA 4NXIA 2LS5A 1S3DA 2YJHA 2VLVA 4PTSA 2GS3A 5FHIA 1V2AA 1PX6A 4BWQA 1HYUA 2FHEA 2XHFA 5DQYA 3ZVJD 22GSA 5ID2B 2OJLA 5KOXA 3CSIA 3EVIA 5KN1A 1TDIA 3TB2A 2CVKA 3LYKA 1AXDA 4OO4A 3IXRA 5INYA 4N0ZA 2X8CA 4IP1A 3ZLPA 2FWEA 2HRKA 2H6XA 4GWRA 2O89A 2F8AA 5ECHB 3N9JA 3WGDA 1GNEA 4MF5A 1YEXA 2YZHA 3DEXA 1AIUA 1AQXA 4RQRA 4QL7A 1V9WA 1NSWA 3Q19A 4I6XA 4HZ2A 1KBNA 2VAFA 2DJ0A 4PQIA 2CVDA 3UMAA 1SK0A 3P8WA 1XW9A 2O7KA 4V1Ag 3W8SA 5KN0A 4OCEA 5ECOB 3TKSE 1V98A 2N5AA 3FMWA 1FHEA 2MBSA 4AJ6A 1FAAA 2BJXA 1XIYA 3LFLA 2DMLA 3MIXA 4YKGA 9GSSA 1XW5A 2CT6A 2YWIA 1XZOA 2GLRA 4ECCA 2H71A 2WB9A 4POLA 1RQMA 2ON7A 2H70A 3GKXA 4GLTA 1TK8B 1OE8A 2OBIA 5CRDA 4BL7B 4HJ2A 3ZVJA 2V32A 3QR6A 4Z2TA 2OE1A 4J56E 3WYWA 3JCML 3DD3A 4JZQA 3GRXA 2FNOA 2V6OA 3NOFA 4JE1A 1UC7A 3M1GA 2C0EA 2HLSA 4LLRA 1A2JA 5CO3A 4EDYA 5DJMA 1EGOA 3PGTA 1XWKA 5KN3A 3KMNA 4WF5A 2XBIA 4XS4B 4ULXA 2DJ1A 3E9JB 4XTSA 3CRUA 1DSBA 19GSA 1EP7A 3MYDA 2FWHA 2MMAA 1MTCA 3APOA 4DVCA 3WGXA 4ZBBA 2N5BA 4K2DA 2JSYA 2G0FA 4LL4B 3GKNA 4IQ1A 3TUEA 2CX3A 2WRTA 3GTUA 2Z9SA 4GF0A 1SYXA 5A4WA 2R6KA 2HRAA 2NPBA 2MYGA 2MZCA 1AW9A 3G7IA 4BVXB 3DYRA 3IAS2 3TKSC 5CNWA 1QUWA 3IC4A 1QQ2A 3KM6A 5LD0A 2LRNA 3W8JA 3ZFLA 4WR5A 3APSA 1PMTA 3P7XA 2A2PA 1G0TA 3RBTA 3CQFA 3KD0A 1AQVA 1ILOA 2R0CA 2GZZA 1EOHA 1ZMAA 3H8QA 4WEYA 2V6KA 4TR3A 4HQSA 2GSRA 5B6MA 1F9MA 1SYRA 2IJYA 3ZL5A 1FVJA 2DJKA 3LJRA 4PQ1A 3TJFA 2H19A 1M0UA 3IC8A 1ZYQB 3ISOA 1FO5A 4EE0A 1X9WB 1CQHA 1M9BA 2DIZA 5B8BA 5D9VA 2H6ZA 1EEMA 4RUVA 2GT5A 2VCQA 5KOWA 3IE3A 2VO4A 3D22A 5IMVA 2WZ9A 5DAKA 3L78A 2CX4A 2R4VA 4ZIJA 1PQNA 2X8HA 1M2AA 4ZB6A 2H30A 2DJ3A 2LJKA 2C3QA 2JU5A 1T00A 3Q18A 1K0OA 4Z7XA 5J41A 4F03A 1MDJA 4I5QA 1A23A 4AJ7A 2B7KA 2VM1A 4GSNA 1U3IA 2H76A 1H75A 4Z2RA 1M3IA 2J9HA 1GSFA 1WP0A 2C1YA 4USSA 1XOBA 2OE3A 4BVYB 4GQFA 4TRXA 5IOXA 2HI7A 2IWTA 1M99A 2FD3A 3ZYWA 4F0BA 1TOFA 4O92A 5CYYA 3ZITA 1GTAA 4HUAA 3C73A 3WGEA 2ON5A 4KSMA 2VLUA 4TOPA 2LKUA 1K0BA 3KJYA 3GL5A 2GSSA 3GSSA 2L6DA 2N5FA 1V58A 4OMVA 3TJKA 2C8UA 4XS1A 1TU8A 5DJLA 3M8NA 5DALB 1DE1A 3KCMA 2VCTA 4TKYA 3D0ZA 4MZWA 4DSSB 4DEJA 1VGLA 3R3EA 2A2RA 2ZNMA 3E0UA 1OE7A 3IK7A 3Q6OA 4IQAA 7GSSA 2H74A 2NVLA 4FQUA 3HVVA 5JWOB 5FWGA 3TJJA 4NHZA 5G1LA 3RPPA 3HHVA 3PPUA 4KAEA 2XPDA 1ERVA 2FY6A 4GRFA 1T8EB 4K5SA 4XRAA 3GX8A 3EURA 1FVKA 2RIIA 4POBA 1YKAA 2GDRA 3FR3A 1YY7A 2WFCA 3BOAA 2JZRA 2KHPA 2LUSA 4MNNA 1BQ7A 4FH8A 4OO5A 1K0DA 4HS1A 2CZ3A 5ECSA 4WBJA 3IBHA 1TXXA 3VWVA 2I9HA 1J08A 1F6MC 4I2UA 3VPQA 1SD9A 2J23A 2C0DA 1GSQA 3MDKA 5IQYA 1AAZA 3H93A 1GLQA 2H73A 3LYPA 1PKZA 2JACA 1ML6A 2GTUA 3E3EA 4G9HA 4I97A 4MCUA 3O3TA 5H5QA 4D73B 2IMEA 1SL1B 2PN8A 2F9SA 5BMUA 3DMLA 2DBCA 4TW5A 5IPHA 3U6VA 1SK1A 3G7YA 1B9YC 1OC9B 1XCCA 5JWRB 3TOTA 3IV4A 1O73A 4ACSA 1FOVA 2LV3A 14GSA 2X99A 2DC5A 2IFQB 1SK2A 1F37A 1EV9A 5EVOA 1ABAA 3FKFA 4EXJA 1USBA 4WETA 8GSSA 3L9SA 1PN0A 4KF9A 2E7PA 4HQZA 4NPBA 5DQSA 3IOSA 4TR4A 4IBPA 4X43A 2H1AA 3O6TA 1S3RA 1JLWA 3TRQA 5HR0A 4F2IA 3I6AA 4ECJA 4AJ8A 2OKAA 3HJPA 4O32A 4DSRA 2TIRA 3DVWA 5EL8A 3UBLA 3WD6A 3DWVA 2HSYA 3C71A 4NWYA 1E2YA 1KEBA 4YAPA 3IA1A 3KTLA 2QA1A 3QFBC 3ZRDA 2KLXA 4FIWA 3GH6A 1HD2A 3DKSA 1V40A 2B6MA 2HZEA 2RM5A 4V2LA 4PNGA 2YWNA 2MBTA 4JU5A 3UJ1A 1URMA 3EYTA 1KTEA 4EDZA 3FZ4A 3MWHA 2VL2A 3EINA 5G2ZA 3TKQA 1QGVA 2JSZA 3CSHA 3LQ7A 3TJBA 3LORA 3DRNA 1YKCA 2K8SA 5CRHA 1TK5B 1SL0B 3H1NA 2X4AA 4K6XA 5HFKA 4Q5FA 1R4WA 2DLXA 1K3YA 3APQA 4MABA 3C8EA 11GSA 2RUEA 3CTFA 6GSTA 4KGIA 4PURA 2EC4A 4MJCA 2K6VA 4IJIA 3WT2A 3ME7A 4IS0A 1Z5YE 5B8AA 1OC3A 1XVQA 2HT9A 2DKIA 3HY2A 4K7IA 3A2XA 6GSSA 5GAPD 1EP8A 2BTOT 1WMJA 4KX4A 6GSYA 3HD5A 5IPGA 2NDOA 5ECKB 1ERTA 4K7NA 1X9SB 1O8XA 1W89A 3FY7A 1BG5A 4O7HA 2E2MA 1TU7A 1PX7A 3ED3A 3RDWA 3GNJA 4EC0A 2FGXA 3DVXA 3F63A 1A8LA 2L4QA 2QKEA 5F07A 1U87A 2H6YA 2EIOA 1Q98A 3LG6A 1E6BA 20GSA 3IR4A 1XVWA 1Y6EA 3VPTA 1YJ6A 1XW6A 4Q5NA 4CHSA 1A24A 3N5OA 3QAVA 2IPAA 3GA4A 3FW2A 1ZYPA 4CW9A 3CMIA 4E8HA 2L5LA 2YV9A 4N11A 4EO3A 4HU7A 5IIZA 5JCWA 3HZ8A 2A2SA 4CY8A 3VURA 2XPEA 2L6CA 2JZTA 4K9ZA 3KP8A 1GSDA 5EY6A 4O5RA 5ECMB 4EIQA 2PMTA 3EE2A 2DSAA 1VF4A 2KP2A 4TR1A 1NHYA 3PR8A 2VL9A 1YEPA 3LXZA 3I9V2 1MD3A 1WIKA 5L71A 1FB0A 3DXBA 3LGCA 4MK3A 3BJ5A 2R37A 4POMA 2M80A 4E8EA 2H0GA 4HEA2 5HR2A 3D4MA 4L0WA 4X1UA 1GP1A 5E59A 5CRGA 4XIHA 4FYUA 4KH7A 3HKRA 1Z6MA 3F3RA 5LNKe 3HZ4A 2AJQB 2M72A 2O8VB 2YV7A 3ZIJA 4DSQA 4MP4A 2A4HA 1KNGA 3QOUA 2YPMA 5ID2A 1GLPA 1HQOA 1YF0A 2PVOC 1PL1A 1BEDA 3UEMA 4AF2A 4PGTA 3G7JA 1VRSD 12GSA 2OACA 2IN3A 1Z7RA 2VD0A 1UN2A 5KN2A 3SWLA 2XC2A 4F82A 3L9VA 1SKWB 1TJDA 2FUG2 3RHCA 1PD21 4GQCA 1TK0B 1XPVA 4HDEA 3ZTLA 5D9TA 2CA8A 5D9XA 1T3BA 1N8JA 1BX9A 4X0XA 4YKFA 3QMXA 3MNGA 3GURA 4G19A 5AN1A 1QK8A 2HSHA 3C1SA 2C0FA 2R2JA 3FEUA 4KA0A 1WE0A 2P5QA 1JHBA 3I69A 2WS2A 1EWXA 4MF6A 3LXTA 3ZREA 3O76A 4MPFA 1QFNA 3GHAA 5C04A 3F9UA 4BL7A 5DVBA 3GX0A 4ZBAA 4N0VA 3M9JA 5B7CA 2TRCP 4ILFA 5IO2A 3F4SA 4IKHA 1CQGA 2GSTA 4I8BA 3TKSA 3HDCA 3A3TA 3BCKA 3NZNA 5A4UA 3EU3A 1MDKA 4NAXA 1FW1A 4KW6A 2V1MA 1SKRB 3GKMA 4XS4A 1WJKA 5IMFA 1XOAA 2JL4A 5G30A 2YOIA 2MMZA 3ERGA 1DUGA 1SD8A 2X49A 4L5LA 1S3CA 1PN9A 2QA2A 1WOUA 4YH2A 1V57A 2I3YA 5G1KA 3FZ5A 4K0GA 1ZCPA 2VD1A 3FK8A 1ACVA 2B3SA 2PERA 2R0PA 5D93A 4OCFA 1FG4A 1NM3A 3LWAA 4O5UA 2IMIA 3V1WA 3LSZA 4V2NA 2CZ2A 3WT1A 4WXTA 2QC7A 2AUVA 2FLSA 1R7HA 4QL9A 1ZYNA 2HFDA 2OA7A 2X64A 1XBSA 2DIYA 3NIVA 4MMMA 5C00A 2G2QA 1VF1A 2VM2A 2NTOA 3UARA 4P3YB 5IMAA 1SJ6A 3FR9A 2KUCA 2VCWA 4V1Ap 4YQMA 1NHOA 1G7EA 4KDYA 5DDLA 2K8VA 3SBCA 5D8IA 4JR6A 2LQQA 5DCGA 1ERWA 5D9WA 1Z7PA 1ZOFA 3EWLA 2JADA 4HI7A 5HR1A 5H5SA 2PGTA 1ON4A 1U88A 3H4KA 3CSJA 1TKDB 1QMVA 4GTUA 5B6NA 2REMA
chains in the Genus database with same CATH topology
6GSUA 3ERFA 4ZB9A 1TRWA 3TGZA 1MDIA 2LJAA 1JZRA 1PL2A 4IVFA 2YP6A 2L4CA 4EVMA 1QXHA 3L4NA 3IPZA 1N2AA 1B4QA 3F3QA 4PQHA 1YF1A 1H4OA 3UIWA 4HU9A 4J57E 3P2AA 3ZZXA 2GGTA 3QPMA 4QQ7A 4YAVA 3A2WA 4EUYA 4BVYA 2YZUA 4MH3A 4AGSA 1IYIA 2WCIA 1TRVA 5G5EA 2ZCTA 5JWQB 1K0NA 2AB6A 2WDUA 1AQWA 4ICYA 2B5EA 5ECPB 3CYNA 3P90A 4LMWA 4KSOA 1TRUA 2GSQA 3IK9A 5IMDA 1GH2A 3D21A 1GL8A 5ECRB 1PKWA 4ZL9A 5AISA 4ZL7A 3HXSA 1OKTA 5AGYA 1G7OA 4N30A 5DALA 3GYKA 2P0GA 2OE0A 5IOWA 4OFTA 2B1KA 4DSSA 4KNDA 1B48A 1B8XA 3QAGA 2GQLA 1EOGA 5ABRA 1R5PA 5G5FA 3IHQA 5F8BA 2P5RA 3D4TA 5COHA 1O6JA 2AHEA 2GVPA 2L57A 2MMOA 4IJ3A 5AIVA 1T4ZA 2FA8A 2CAIA 1GSUA 2VCVA 2K9FA 3ZMKA 3S9FA 3J7Yk 3KEBA 1OKDA 4BPYA 1EV4A 1ZYEA 1O8WA 3BCIA 4K1FA 3QFAC 1X5CA 1TW9A 5D96A 3UAPA 2QGVA 3IAM2 4ID0A 3OR5A 3Q74A 2F8FA 2FWFA 2ZUPA 4IP6A 4PNFA 3HCZA 2WGRA 6GSVA 4ZBDA 4JRRA 1A2MA 2HYXA 2H1DA 2P31A 2QSIA 1GUMA 2HNLA 2M46A 4PXOA 5CREA 3LEFA 3KGKA 3EC3A 5ECNB 4LMVA 1M2BA 2DKHA 5DCHA 4J2FA 4BA7A 1ZZYA 2C80A 4NV2A 1GSYA 2ALBA 3TJGA 3HVSA 1OAZA 1M9AA 1YQ1A 4ZILA 2V2GA 2B5XA 5GZZB 4Z2UA 1SENA 3GFKA 3GTUB 1BJXA 1THXA 3QDNA 1FOHA 3W6GA 1THOA 4ZL8A 4D73A 5ELAA 3F8UA 2CQ9A 3EU4A 2H01A 4KB3A 3FZ9A 2LNSA 2PBJA 5HQPA 5H5RA 1GTBA 2PU9C 3TRPA 5ECIB 5A4VA 2HSMA 2LJRA 1OC9A 3KH9A 4F0CA 5KEJA 2ES7A 3GKKA 2YWMA 5EPFA 1SU9A 1Y25A 2K18A 5HFGA 1UA5A 4K7OA 2XBQA 4POKA 2IFQA 1U6TA 1JZDA 3PINA 5FT3A 3GIXA 4G10A 1MD4A 1Q4JA 1TTZA 4GCIA 4TXOA 1I9DA 5F06A 1F3AA 1EZKA 3M9KA 1LJRA 4XS6A 1DBYA 1DE2A 4CDOA 3HJOA 5GSSA 2B1LA 5DAKB 1F3BA 4ZB8A 4L8EA 1X9MB 1O7UA 2PVQA 1A8YA 2IMFA 1R26A 1Z6NA 4XRDA 1TRSA 1TI3A 2VLTA 4IN0A 5HFIA 1YZXA 3IDVA 1O81A 4MLYA 2R3XA 3D6IA 1GSSA 1XWCA 3L9UA 3UVTA 2WJUA 3RAZA 4O5QA 3ZFBA 2FA4A 4OFNA 1GTUA 4TVEA 2H0HA 2LQOA 3UBKA 2C3TA 10GSA 2R0GA 4JBBA 5ECQB 5IM9A 1OYJA 1HNCA 1K0AA 2IL3A 2R5GA 3KZQA 3GSTA 3KMOA 4TN8A 4WBRD 1JFUA 1A0RP 3QCPA 3HYPA 4JEDA 4ECIA 2LRTA 1T7PB 4K5RA 1LU4A 4FYCA 2IIYA 4N10A 4GSTA 3C7MA 3D5JA 3GMFA 4ML6A 1EEJA 3GUSA 2LSTA 3BD2A 1XFLA 3UL3A 2YJ7A 1UVZA 2GQMA 1WPIA 2VUPA 1M2DA 4Q5RA 4GSSA 2AYTA 2DJ2A 4XHMA 3L0HA 2YCDA 3VWXA 3R2QA 4RI7A 4XCSA 3TDGA 1WRYA 2DJJA 1X0RA 4MJEA 2CV4A 2AAWA 1TP9A 4L5OA 4HZ4A 3A5IA 2OBKA 3VLNA 3FYGA 1GRXA 3A2VA 2RLIA 3EPTA 3GV1A 4HJMA 2H8LA 2EIRA 1BAYA 1LBKA 2B7JA 1SJZA 4ZXGA 3UVHA 1W4VA 1PGTA 2E2GA 3ZIVA 4KUNA 2VL3A 6GSXA 4CY6A 2C4JA 2O85A 5G31A 3M0FA 3LW9A 2CVBA 3KH7A 4NV5A 4G0KA 4EKZA 1SL2B 2F3MA 1J0FA 4KE3A 3KIJA 4L0UA 4MZBA 3M3MA 1XWGA 3DIEA 3GL3A 4I2TA 3UOMA 1K3LA 5ECLB 4YQUA 3HJMA 4FO5A 4G0IA 3U5RE 1A2LA 4K8MA 1K0MA 2CAQA 5CP1A 1XWBA 1SKSB 5GSTA 4G0LA 2AV4A 1AUCA 3IRAA 3EMPA 1BYEA 1JLVA 5DBQA 3F4RA 2IMKA 2LNTA 4TR0A 1OC8A 3TRXA 3VWWA 3ERWA 3PH9A 2OADA 2HXKA 2GZPA 3F0IA 4NMUA 3J7Yb 3F6DA 4GXZA 5IO0A 1PRXA 3VWUA 2H72A 5CAXA 4BVXA 16GSA 2L5OA 1PA3A 3VI5A 3MSZA 1GULA 3CRTA 1SJIA 1Z3EA 3CBUA 5CRWA 1T4YA 4A5PA 5JCGA 1XXUA 4KCEA 1ST9A 13GSA 2NBSA 5J9BA 4ECBA 3KP9A 1VF2A 1ERUA 1EGRA 2I4AA 2F51A 1G6WA 5F0GA 3GN3A 4MF7A 4RI6A 1GUHA 4WR4A 4IHUA 5ELGA 2TRXA 1T1VA 3FHKA 3KXOA 2PUKC 3I43A 4JR4A 1OVNA 5GAND 3VK9A 4KDUA 2FCHA 5J4UA 4WKWA 3ME8A 2H0IA 3FRCA 5IMCA 1MEKA 3CXGA 2B5YA 2VCXA 4K2XA 5F05A 4ML1A 4H86A 1U3AA 4MZCA 4MJAA 5A5KA 4G2EA 2KOKA 3HVXA 1TI1A 4FYBA 2HZEB 4OWYA 6GSWA 2EIQA 3QAWA 2PWJA 4ISDA 2WULA 4BWSA 2YN1A 5J3RA 2IMDA 4KCAA 3H79A 1X5EA 2I1UA 2GT6A 2YNXA 1ZGNA 4IGJA 2C3NA 3HA9A 1GTIA 4RQXA 3RPNA 2HE3A 3RHBA 3K8NA 5AIXA 4MJBA 2GQKA 2GZYA 2L59A 3TOUA 2LRCA 2DMMA 1NW2A 2RM6A 1X5DA 18GSA 4EF0A 2VIMA 1WWJA 1YDKA 3QD9A 4OD7A 1HNAA 1HNBA 2E0QA 5ENUA 2LEGA 4IW9A 2HRFA 3DGQA 1A0FA 1RW1A 5E4WA 4V2MA 2VL2C 3ZMLA 1JZOA 1JZWA 3VI7A 2C0GA 3FR6A 1FB6A 3BBYA 4K0NA 1K0CA 1PSQA 5D73A 2H1BA 1GUKA 1ZL9A 1GNWA 1B9XC 3CTGA 1AC1A 3F4TA 4HOJA 1G6YA 17GSA 1K3OA 2H75A 2JZSA 2YANA 3KTBA 2O87A 4TXOB 2MMNA 3EMXA 1F2EA 5LCZA 1B4PA 4MA9A 5HR3A 1R5AA 4WF4A 1GWCA 4OFMA 3TCOA 1J9BA 5JCUA 2PPTA 4YQVA 3C1RA 4PX1A 1M7TA 2V41A 4NHWA 1O85A 2HZFA 5IMZA 5J5NA 3VFIA 4F9ZA 2H1GA 2UZ8A 2HRNA 3G9BA 1IYHA 4EL1A 3TKPA 1I5GA 4TR1B 4X4JA 4LL1B 2I81A 4MDCA 1VF3A 2YWOA 4MH2A 3GH9A 3AY8A 1XWAA 2BMXA 4EIPA 4LA1A 2KP1A 4TXVA 3A5WA 3TKRA 4IELA 4PUAA 2D2ZA 2RUFA 1C72A 1S3AA 3US3A 1GSEA 2VOCA 1Z9HA 4MPGA 2LTKA 1RK4A 3IHGA 5BRTA 4PUFC 4KDXA 4Q5QA 2H66A 2VCZA 3FZAA 2X8GA 3MAKA 5J9CA 2FWGA 3F6FA 2A4VA 4NXIA 2LS5A 1S3DA 2YJHA 2VLVA 4PTSA 2GS3A 5FHIA 1V2AA 1PX6A 4BWQA 1HYUA 2FHEA 2XHFA 5DQYA 3ZVJD 22GSA 5ID2B 2OJLA 5KOXA 3CSIA 3EVIA 5KN1A 1TDIA 3TB2A 2CVKA 3LYKA 1AXDA 4OO4A 3IXRA 5INYA 4N0ZA 2X8CA 4IP1A 3ZLPA 2FWEA 2HRKA 2H6XA 4GWRA 2O89A 2F8AA 5ECHB 3N9JA 3WGDA 1GNEA 4MF5A 1YEXA 2YZHA 3DEXA 1AIUA 1AQXA 4RQRA 4QL7A 1V9WA 1NSWA 3Q19A 4I6XA 4HZ2A 1KBNA 2VAFA 2DJ0A 4PQIA 2CVDA 3UMAA 1SK0A 3P8WA 1XW9A 2O7KA 4V1Ag 3W8SA 5KN0A 4OCEA 5ECOB 3TKSE 1V98A 2N5AA 3FMWA 1FHEA 2MBSA 4AJ6A 1FAAA 2BJXA 1XIYA 3LFLA 2DMLA 3MIXA 4YKGA 9GSSA 1XW5A 2CT6A 2YWIA 1XZOA 2GLRA 4ECCA 2H71A 2WB9A 4POLA 1RQMA 2ON7A 2H70A 3GKXA 4GLTA 1TK8B 1OE8A 2OBIA 5CRDA 4BL7B 4HJ2A 3ZVJA 2V32A 3QR6A 4Z2TA 2OE1A 4J56E 3WYWA 3JCML 3DD3A 4JZQA 3GRXA 2FNOA 2V6OA 3NOFA 4JE1A 1UC7A 3M1GA 2C0EA 2HLSA 4LLRA 1A2JA 5CO3A 4EDYA 5DJMA 1EGOA 3PGTA 1XWKA 5KN3A 3KMNA 4WF5A 2XBIA 4XS4B 4ULXA 2DJ1A 3E9JB 4XTSA 3CRUA 1DSBA 19GSA 1EP7A 3MYDA 2FWHA 2MMAA 1MTCA 3APOA 4DVCA 3WGXA 4ZBBA 2N5BA 4K2DA 2JSYA 2G0FA 4LL4B 3GKNA 4IQ1A 3TUEA 2CX3A 2WRTA 3GTUA 2Z9SA 4GF0A 1SYXA 5A4WA 2R6KA 2HRAA 2NPBA 2MYGA 2MZCA 1AW9A 3G7IA 4BVXB 3DYRA 3IAS2 3TKSC 5CNWA 1QUWA 3IC4A 1QQ2A 3KM6A 5LD0A 2LRNA 3W8JA 3ZFLA 4WR5A 3APSA 1PMTA 3P7XA 2A2PA 1G0TA 3RBTA 3KD0A 1AQVA 1ILOA 2R0CA 2GZZA 1EOHA 1ZMAA 3H8QA 4WEYA 2V6KA 4TR3A 4HQSA 2GSRA 5B6MA 1F9MA 1SYRA 2IJYA 3ZL5A 1FVJA 2DJKA 3LJRA 4PQ1A 3TJFA 2H19A 1M0UA 3IC8A 1ZYQB 3ISOA 1FO5A 4EE0A 1X9WB 1CQHA 1M9BA 2DIZA 5B8BA 5D9VA 2H6ZA 1EEMA 4RUVA 2GT5A 2VCQA 5KOWA 3IE3A 2VO4A 3D22A 5IMVA 2WZ9A 5DAKA 3L78A 2CX4A 2R4VA 4ZIJA 1PQNA 2X8HA 1M2AA 4ZB6A 2H30A 2DJ3A 2LJKA 2C3QA 2JU5A 1T00A 3Q18A 1K0OA 4Z7XA 5J41A 4F03A 1MDJA 4I5QA 1A23A 4AJ7A 2B7KA 2VM1A 4GSNA 1U3IA 2H76A 1H75A 4Z2RA 2J9HA 1GSFA 1WP0A 2C1YA 4USSA 1XOBA 2OE3A 4BVYB 4GQFA 4TRXA 5IOXA 2HI7A 2IWTA 1M99A 2FD3A 3ZYWA 4F0BA 1TOFA 4O92A 5CYYA 3ZITA 1GTAA 4HUAA 3C73A 3WGEA 2ON5A 4KSMA 2VLUA 4TOPA 2LKUA 1K0BA 3KJYA 3GL5A 2GSSA 3GSSA 2L6DA 2N5FA 1V58A 4OMVA 3TJKA 2C8UA 4XS1A 1TU8A 5DJLA 3M8NA 5DALB 1DE1A 3KCMA 2VCTA 4TKYA 3D0ZA 4MZWA 4DSSB 4DEJA 1VGLA 3R3EA 2A2RA 2ZNMA 3E0UA 1OE7A 3IK7A 3Q6OA 4IQAA 7GSSA 2H74A 2NVLA 4FQUA 3HVVA 5JWOB 5FWGA 3TJJA 4NHZA 5G1LA 3RPPA 3HHVA 3PPUA 4KAEA 2XPDA 1ERVA 2FY6A 4GRFA 1T8EB 4K5SA 4XRAA 3GX8A 3EURA 1FVKA 2RIIA 4POBA 1YKAA 2GDRA 3FR3A 1YY7A 2WFCA 3BOAA 2JZRA 2KHPA 2LUSA 4MNNA 1BQ7A 4FH8A 4OO5A 1K0DA 4HS1A 2CZ3A 5ECSA 4WBJA 3IBHA 1TXXA 3VWVA 2I9HA 1J08A 1F6MC 4I2UA 3VPQA 1SD9A 2J23A 2C0DA 1GSQA 3MDKA 5IQYA 1AAZA 3H93A 1GLQA 2H73A 3LYPA 1PKZA 2JACA 1ML6A 2GTUA 3E3EA 4G9HA 4I97A 4MCUA 3O3TA 5H5QA 4D73B 2IMEA 1SL1B 2PN8A 2F9SA 5BMUA 3DMLA 2DBCA 4TW5A 5IPHA 3U6VA 1SK1A 3G7YA 1B9YC 1OC9B 1XCCA 5JWRB 3TOTA 3IV4A 1O73A 4ACSA 1FOVA 2LV3A 14GSA 2X99A 2DC5A 2IFQB 1SK2A 1F37A 1EV9A 5EVOA 1ABAA 3FKFA 4EXJA 1USBA 4WETA 8GSSA 3L9SA 1PN0A 4KF9A 2E7PA 4HQZA 4NPBA 5DQSA 3IOSA 4TR4A 4IBPA 4X43A 2H1AA 3O6TA 1JLWA 3TRQA 5HR0A 4F2IA 3I6AA 4ECJA 4AJ8A 2OKAA 3HJPA 4O32A 4DSRA 2TIRA 3DVWA 5EL8A 3UBLA 3WD6A 3DWVA 2HSYA 3C71A 4NWYA 1E2YA 1KEBA 4YAPA 3IA1A 3KTLA 2QA1A 3QFBC 3ZRDA 2KLXA 4FIWA 3GH6A 1HD2A 3DKSA 1V40A 2B6MA 2HZEA 2RM5A 4V2LA 4PNGA 2YWNA 2MBTA 4JU5A 3UJ1A 1URMA 3EYTA 1KTEA 4EDZA 3FZ4A 3MWHA 2VL2A 3EINA 5G2ZA 3TKQA 1QGVA 2JSZA 3CSHA 3LQ7A 3TJBA 3LORA 3DRNA 1YKCA 2K8SA 5CRHA 1TK5B 1SL0B 3H1NA 2X4AA 4K6XA 5HFKA 4Q5FA 1R4WA 2DLXA 1K3YA 3APQA 4MABA 3C8EA 11GSA 2RUEA 3CTFA 6GSTA 4KGIA 4PURA 2EC4A 4MJCA 2K6VA 4IJIA 3WT2A 3ME7A 4IS0A 1Z5YE 5B8AA 1OC3A 1XVQA 2HT9A 2DKIA 3HY2A 4K7IA 3A2XA 6GSSA 5GAPD 1EP8A 2BTOT 1WMJA 4KX4A 6GSYA 3HD5A 5IPGA 2NDOA 5ECKB 1ERTA 4K7NA 1X9SB 1O8XA 1W89A 3FY7A 1BG5A 4O7HA 2E2MA 1TU7A 1PX7A 3ED3A 3RDWA 3GNJA 4EC0A 2FGXA 3DVXA 3F63A 1A8LA 2L4QA 2QKEA 5F07A 1U87A 2H6YA 2EIOA 1Q98A 3LG6A 1E6BA 20GSA 3IR4A 1XVWA 1Y6EA 3VPTA 1YJ6A 1XW6A 4Q5NA 4CHSA 1A24A 3N5OA 3QAVA 2IPAA 3GA4A 3FW2A 1ZYPA 4CW9A 3CMIA 4E8HA 2L5LA 2YV9A 4N11A 4EO3A 4HU7A 5IIZA 5JCWA 3HZ8A 2A2SA 4CY8A 3VURA 2XPEA 2L6CA 2JZTA 4K9ZA 3KP8A 1GSDA 5EY6A 4O5RA 5ECMB 4EIQA 2PMTA 3EE2A 2DSAA 1VF4A 2KP2A 4TR1A 1NHYA 3PR8A 2VL9A 1YEPA 3LXZA 3I9V2 1MD3A 1WIKA 5L71A 1FB0A 3DXBA 3LGCA 4MK3A 3BJ5A 2R37A 4POMA 2M80A 4E8EA 2H0GA 4HEA2 5HR2A 3D4MA 4L0WA 4X1UA 1GP1A 5E59A 5CRGA 4XIHA 4FYUA 4KH7A 3HKRA 1Z6MA 3F3RA 5LNKe 3HZ4A 2AJQB 2M72A 2O8VB 2YV7A 3ZIJA 4DSQA 4MP4A 2A4HA 1KNGA 3QOUA 2YPMA 5ID2A 1GLPA 1HQOA 1YF0A 2PVOC 1PL1A 1BEDA 3UEMA 4AF2A 4PGTA 3G7JA 1VRSD 12GSA 2OACA 2IN3A 1Z7RA 2VD0A 1UN2A 5KN2A 3SWLA 2XC2A 4F82A 3L9VA 1SKWB 1TJDA 2FUG2 3RHCA 1PD21 4GQCA 1TK0B 1XPVA 4HDEA 3ZTLA 5D9TA 2CA8A 5D9XA 1T3BA 1N8JA 1BX9A 4X0XA 4YKFA 3QMXA 3MNGA 3GURA 4G19A 5AN1A 1QK8A 2HSHA 3C1SA 2C0FA 2R2JA 3FEUA 4KA0A 1WE0A 2P5QA 1JHBA 3I69A 2WS2A 1EWXA 4MF6A 3LXTA 3ZREA 3O76A 4MPFA 1QFNA 3GHAA 5C04A 3F9UA 4BL7A 5DVBA 3GX0A 4ZBAA 4N0VA 3M9JA 5B7CA 2TRCP 4ILFA 5IO2A 3F4SA 4IKHA 1CQGA 2GSTA 4I8BA 3TKSA 3HDCA 3A3TA 3BCKA 3NZNA 5A4UA 3EU3A 1MDKA 4NAXA 1FW1A 4KW6A 2V1MA 1SKRB 3GKMA 4XS4A 1WJKA 5IMFA 1XOAA 2JL4A 5G30A 2YOIA 2MMZA 3ERGA 1DUGA 1SD8A 2X49A 4L5LA 1S3CA 1PN9A 2QA2A 1WOUA 4YH2A 1V57A 2I3YA 5G1KA 3FZ5A 4K0GA 1ZCPA 2VD1A 3FK8A 1ACVA 2B3SA 2PERA 2R0PA 5D93A 4OCFA 1FG4A 1NM3A 3LWAA 4O5UA 2IMIA 3V1WA 3LSZA 4V2NA 2CZ2A 3WT1A 4WXTA 2QC7A 2AUVA 2FLSA 1R7HA 4QL9A 1ZYNA 2HFDA 2OA7A 2X64A 1XBSA 2DIYA 3NIVA 4MMMA 5C00A 2G2QA 1VF1A 2VM2A 2NTOA 3UARA 4P3YB 5IMAA 1SJ6A 3FR9A 2KUCA 2VCWA 4V1Ap 4YQMA 1NHOA 1G7EA 4KDYA 5DDLA 2K8VA 3SBCA 5D8IA 4JR6A 2LQQA 5DCGA 1ERWA 5D9WA 1Z7PA 1ZOFA 3EWLA 2JADA 4HI7A 5HR1A 5H5SA 2PGTA 1ON4A 1U88A 3H4KA 3CSJA 1TKDB 1QMVA 4GTUA 5B6NA 2REMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSU A;  3ERF A;  4ZB9 A;  1TRW A;  3TGZ A;  1MDI A;  2LJA A;  1JZR A;  1PL2 A;  4IVF A;  2YP6 A;  2L4C A;  4EVM A;  1QXH A;  3L4N A;  3IPZ A;  1N2A A;  1B4Q A;  3F3Q A;  4PQH A;  1YF1 A;  1H4O A;  3UIW A;  4HU9 A;  4J57 E;  3P2A A;  3ZZX A;  2GGT A;  3QPM A;  4QQ7 A;  4YAV A;  3A2W A;  4EUY A;  4BVY A;  2YZU A;  4MH3 A;  4AGS A;  1IYI A;  2WCI A;  1TRV A;  5G5E A;  2ZCT A;  5JWQ B;  1K0N A;  2AB6 A;  2WDU A;  1AQW A;  2B5E A;  5ECP B;  3CYN A;  3P90 A;  4LMW A;  4KSO A;  1TRU A;  2GSQ A;  3IK9 A;  5IMD A;  1GH2 A;  3D21 A;  1GL8 A;  5ECR B;  1PKW A;  4ZL9 A;  5AIS A;  4ZL7 A;  3HXS A;  1OKT A;  5AGY A;  1G7O A;  4N30 A;  5DAL A;  3GYK A;  2P0G A;  2OE0 A;  5IOW A;  4OFT A;  2B1K A;  4DSS A;  4KND A;  1B48 A;  1B8X A;  3QAG A;  2GQL A;  1EOG A;  5ABR A;  1R5P A;  5G5F A;  3IHQ A;  5F8B A;  2P5R A;  3D4T A;  5COH A;  1O6J A;  2AHE A;  2GVP A;  2L57 A;  2MMO A;  4IJ3 A;  5AIV A;  1T4Z A;  2FA8 A;  2CAI A;  1GSU A;  2VCV A;  2K9F A;  3ZMK A;  3S9F A;  3J7Y k;  3KEB A;  1OKD A;  4BPY A;  1EV4 A;  1ZYE A;  1O8W A;  3BCI A;  4K1F A;  3QFA C;  1X5C A;  1TW9 A;  5D96 A;  3UAP A;  2QGV A;  3IAM 2;  4ID0 A;  3OR5 A;  3Q74 A;  2F8F A;  2FWF A;  2ZUP A;  4IP6 A;  4PNF A;  3HCZ A;  2WGR A;  6GSV A;  4ZBD A;  4JRR A;  1A2M A;  2HYX A;  2H1D A;  2P31 A;  2QSI A;  1GUM A;  2HNL A;  2M46 A;  4PXO A;  5CRE A;  3LEF A;  3KGK A;  3EC3 A;  5ECN B;  4LMV A;  1M2B A;  5DCH A;  4J2F A;  4BA7 A;  1ZZY A;  2C80 A;  4NV2 A;  1GSY A;  2ALB A;  3TJG A;  3HVS A;  1OAZ A;  1M9A A;  1YQ1 A;  4ZIL A;  2V2G A;  2B5X A;  5GZZ B;  1SEN A;  3GFK A;  3GTU B;  1BJX A;  1THX A;  3QDN A;  3W6G A;  1THO A;  4ZL8 A;  4D73 A;  5ELA A;  3F8U A;  2CQ9 A;  3EU4 A;  2H01 A;  4KB3 A;  3FZ9 A;  2LNS A;  2PBJ A;  5HQP A;  5H5R A;  1GTB A;  2PU9 C;  3TRP A;  5ECI B;  5A4V A;  2LJR A;  1OC9 A;  3KH9 A;  4F0C A;  5KEJ A;  2ES7 A;  3GKK A;  2YWM A;  5EPF A;  1SU9 A;  1Y25 A;  2K18 A;  5HFG A;  1UA5 A;  4K7O A;  2XBQ A;  4POK A;  2IFQ A;  1U6T A;  1JZD A;  3PIN A;  5FT3 A;  3GIX A;  4G10 A;  1MD4 A;  1Q4J A;  1TTZ A;  4GCI A;  4TXO A;  1I9D A;  5F06 A;  1F3A A;  1EZK A;  3M9K A;  1LJR A;  4XS6 A;  1DBY A;  1DE2 A;  4CDO A;  3HJO A;  5GSS A;  2B1L A;  5DAK B;  1F3B A;  4ZB8 A;  4L8E A;  1X9M B;  1O7U A;  2PVQ A;  1A8Y A;  2IMF A;  1R26 A;  1Z6N A;  4XRD A;  1TRS A;  1TI3 A;  2VLT A;  4IN0 A;  5HFI A;  1YZX A;  3IDV A;  1O81 A;  4MLY A;  2R3X A;  3D6I A;  1GSS A;  1XWC A;  3L9U A;  3UVT A;  2WJU A;  3RAZ A;  3ZFB A;  2FA4 A;  4OFN A;  1GTU A;  4TVE A;  2H0H A;  2LQO A;  3UBK A;  2C3T A;  10GS A;  4JBB A;  5ECQ B;  5IM9 A;  1OYJ A;  1HNC A;  1K0A A;  2IL3 A;  2R5G A;  3KZQ A;  3GST A;  3KMO A;  4TN8 A;  4WBR D;  1JFU A;  1A0R P;  3QCP A;  3HYP A;  4JED A;  4ECI A;  2LRT A;  1T7P B;  1LU4 A;  4FYC A;  2IIY A;  4N10 A;  4GST A;  3C7M A;  3D5J A;  3GMF A;  4ML6 A;  1EEJ A;  3GUS A;  2LST A;  3BD2 A;  1XFL A;  3UL3 A;  2YJ7 A;  1UVZ A;  2GQM A;  1WPI A;  2VUP A;  1M2D A;  4Q5R A;  4GSS A;  2AYT A;  2DJ2 A;  4XHM A;  3L0H A;  2YCD A;  3VWX A;  3R2Q A;  4RI7 A;  4XCS A;  3TDG A;  1WRY A;  2DJJ A;  1X0R A;  4MJE A;  2CV4 A;  2AAW A;  1TP9 A;  4L5O A;  4HZ4 A;  2OBK A;  3VLN A;  3FYG A;  1GRX A;  3A2V A;  2RLI A;  3GV1 A;  4HJM A;  2H8L A;  2EIR A;  1BAY A;  1LBK A;  2B7J A;  1SJZ A;  4ZXG A;  3UVH A;  1W4V A;  1PGT A;  2E2G A;  3ZIV A;  4KUN A;  2VL3 A;  6GSX A;  2C4J A;  2O85 A;  5G31 A;  3M0F A;  2CVB A;  3KH7 A;  4NV5 A;  4EKZ A;  1SL2 B;  2F3M A;  1J0F A;  4KE3 A;  3KIJ A;  4L0U A;  4MZB A;  3M3M A;  1XWG A;  3DIE A;  3GL3 A;  4I2T A;  3UOM A;  1K3L A;  5ECL B;  4YQU A;  3HJM A;  4FO5 A;  3U5R E;  1A2L A;  4K8M A;  1K0M A;  2CAQ A;  5CP1 A;  1XWB A;  1SKS B;  5GST A;  2AV4 A;  1AUC A;  3IRA A;  3EMP A;  1BYE A;  1JLV A;  5DBQ A;  3F4R A;  2IMK A;  2LNT A;  4TR0 A;  1OC8 A;  3TRX A;  3VWW A;  3ERW A;  3PH9 A;  2OAD A;  2HXK A;  2GZP A;  3F0I A;  4NMU A;  3J7Y b;  3F6D A;  4GXZ A;  5IO0 A;  1PRX A;  3VWU A;  2H72 A;  5CAX A;  4BVX A;  16GS A;  2L5O A;  1PA3 A;  3VI5 A;  3MSZ A;  1GUL A;  3CRT A;  1SJI A;  1Z3E A;  3CBU A;  5CRW A;  1T4Y A;  5JCG A;  1XXU A;  4KCE A;  1ST9 A;  13GS A;  2NBS A;  5J9B A;  4ECB A;  3KP9 A;  1VF2 A;  1ERU A;  1EGR A;  2I4A A;  2F51 A;  1G6W A;  5F0G A;  3GN3 A;  4MF7 A;  4RI6 A;  1GUH A;  4WR4 A;  4IHU A;  5ELG A;  2TRX A;  1T1V A;  3FHK A;  3KXO A;  2PUK C;  3I43 A;  4JR4 A;  1OVN A;  5GAN D;  3VK9 A;  4KDU A;  2FCH A;  5J4U A;  4WKW A;  3ME8 A;  2H0I A;  3FRC A;  5IMC A;  1MEK A;  3CXG A;  2B5Y A;  2VCX A;  5F05 A;  4ML1 A;  4H86 A;  1U3A A;  4MZC A;  4MJA A;  5A5K A;  4G2E A;  2KOK A;  3HVX A;  1TI1 A;  4FYB A;  2HZE B;  4OWY A;  6GSW A;  2EIQ A;  3QAW A;  2PWJ A;  4ISD A;  2WUL A;  4BWS A;  2YN1 A;  5J3R A;  2IMD A;  4KCA A;  3H79 A;  1X5E A;  2I1U A;  2GT6 A;  2YNX A;  1ZGN A;  4IGJ A;  2C3N A;  3HA9 A;  1GTI A;  4RQX A;  3RPN A;  2HE3 A;  3RHB A;  3K8N A;  5AIX A;  4MJB A;  2GQK A;  2GZY A;  2L59 A;  3TOU A;  2LRC A;  2DMM A;  1NW2 A;  2RM6 A;  1X5D A;  18GS A;  4EF0 A;  2VIM A;  1WWJ A;  1YDK A;  3QD9 A;  4OD7 A;  1HNA A;  1HNB A;  2E0Q A;  5ENU A;  2LEG A;  4IW9 A;  2HRF A;  3DGQ A;  1A0F A;  1RW1 A;  5E4W A;  4V2M A;  2VL2 C;  3ZML A;  1JZO A;  1JZW A;  3VI7 A;  2C0G A;  3FR6 A;  1FB6 A;  3BBY A;  4K0N A;  1K0C A;  1PSQ A;  5D73 A;  2H1B A;  1GUK A;  1ZL9 A;  1GNW A;  1B9X C;  3CTG A;  1AC1 A;  3F4T A;  4HOJ A;  1G6Y A;  17GS A;  1K3O A;  2H75 A;  2JZS A;  2YAN A;  3KTB A;  2O87 A;  4TXO B;  2MMN A;  3EMX A;  1F2E A;  5LCZ A;  1B4P A;  4MA9 A;  5HR3 A;  1R5A A;  4WF4 A;  1GWC A;  4OFM A;  3TCO A;  1J9B A;  5JCU A;  2PPT A;  4YQV A;  3C1R A;  4PX1 A;  1M7T A;  2V41 A;  4NHW A;  1O85 A;  2HZF A;  5IMZ A;  5J5N A;  3VFI A;  4F9Z A;  2H1G A;  2HRN A;  3G9B A;  1IYH A;  4EL1 A;  3TKP A;  1I5G A;  4TR1 B;  4LL1 B;  2I81 A;  4MDC A;  1VF3 A;  2YWO A;  4MH2 A;  3GH9 A;  3AY8 A;  1XWA A;  2BMX A;  4LA1 A;  2KP1 A;  4TXV A;  3A5W A;  3TKR A;  4IEL A;  4PUA A;  2D2Z A;  2RUF A;  1C72 A;  1S3A A;  3US3 A;  1GSE A;  2VOC A;  1Z9H A;  4MPG A;  2LTK A;  1RK4 A;  4PUF C;  4KDX A;  4Q5Q A;  2H66 A;  2VCZ A;  3FZA A;  2X8G A;  3MAK A;  5J9C A;  2FWG A;  3F6F A;  2A4V A;  4NXI A;  2LS5 A;  1S3D A;  2YJH A;  2VLV A;  2GS3 A;  5FHI A;  1V2A A;  1PX6 A;  4BWQ A;  1HYU A;  2FHE A;  2XHF A;  5DQY A;  3ZVJ D;  22GS A;  5ID2 B;  2OJL A;  3CSI A;  3EVI A;  5KN1 A;  1TDI A;  3TB2 A;  2CVK A;  3LYK A;  1AXD A;  4OO4 A;  3IXR A;  5INY A;  4N0Z A;  2X8C A;  4IP1 A;  3ZLP A;  2FWE A;  2H6X A;  4GWR A;  2O89 A;  2F8A A;  5ECH B;  3N9J A;  3WGD A;  1GNE A;  4MF5 A;  1YEX A;  2YZH A;  3DEX A;  1AIU A;  1AQX A;  4RQR A;  4QL7 A;  1V9W A;  1NSW A;  3Q19 A;  4I6X A;  4HZ2 A;  1KBN A;  2VAF A;  2DJ0 A;  4PQI A;  2CVD A;  3UMA A;  1SK0 A;  3P8W A;  1XW9 A;  2O7K A;  4V1A g;  3W8S A;  5KN0 A;  4OCE A;  5ECO B;  3TKS E;  1V98 A;  2N5A A;  1FHE A;  2MBS A;  4AJ6 A;  1FAA A;  2BJX A;  1XIY A;  3LFL A;  2DML A;  9GSS A;  1XW5 A;  2CT6 A;  2YWI A;  1XZO A;  2GLR A;  4ECC A;  2H71 A;  2WB9 A;  4POL A;  1RQM A;  2ON7 A;  2H70 A;  3GKX A;  4GLT A;  1TK8 B;  1OE8 A;  2OBI A;  5CRD A;  4HJ2 A;  3ZVJ A;  2V32 A;  3QR6 A;  2OE1 A;  4J56 E;  3WYW A;  3JCM L;  3DD3 A;  4JZQ A;  3GRX A;  2FNO A;  2V6O A;  3NOF A;  4JE1 A;  1UC7 A;  3M1G A;  2C0E A;  2HLS A;  4LLR A;  1A2J A;  5CO3 A;  4EDY A;  5DJM A;  1EGO A;  3PGT A;  1XWK A;  5KN3 A;  3KMN A;  4WF5 A;  2XBI A;  4XS4 B;  4ULX A;  2DJ1 A;  3E9J B;  4XTS A;  3CRU A;  1DSB A;  19GS A;  1EP7 A;  2FWH A;  2MMA A;  1MTC A;  3APO A;  4DVC A;  3WGX A;  4ZBB A;  2N5B A;  4K2D A;  2JSY A;  2G0F A;  4LL4 B;  3GKN A;  4IQ1 A;  3TUE A;  2CX3 A;  2WRT A;  3GTU A;  2Z9S A;  4GF0 A;  1SYX A;  5A4W A;  2R6K A;  2NPB A;  2MYG A;  2MZC A;  1AW9 A;  3G7I A;  3DYR A;  3IAS 2;  3TKS C;  5CNW A;  1QUW A;  3IC4 A;  1QQ2 A;  3KM6 A;  5LD0 A;  2LRN A;  3W8J A;  3ZFL A;  4WR5 A;  3APS A;  1PMT A;  3P7X A;  1G0T A;  3RBT A;  3KD0 A;  1AQV A;  1ILO A;  2GZZ A;  1EOH A;  1ZMA A;  3H8Q A;  4WEY A;  2V6K A;  4TR3 A;  4HQS A;  2GSR A;  5B6M A;  1F9M A;  1SYR A;  2IJY A;  3ZL5 A;  1FVJ A;  2DJK A;  3LJR A;  4PQ1 A;  3TJF A;  2H19 A;  1M0U A;  1ZYQ B;  3ISO A;  1FO5 A;  4EE0 A;  1X9W B;  1CQH A;  1M9B A;  2DIZ A;  5B8B A;  5D9V A;  2H6Z A;  1EEM A;  4RUV A;  2GT5 A;  2VCQ A;  3IE3 A;  2VO4 A;  3D22 A;  5IMV A;  2WZ9 A;  5DAK A;  3L78 A;  2CX4 A;  2R4V A;  4ZIJ A;  1PQN A;  2X8H A;  1M2A A;  4ZB6 A;  2H30 A;  2DJ3 A;  2LJK A;  2C3Q A;  2JU5 A;  1T00 A;  3Q18 A;  1K0O A;  4Z7X A;  5J41 A;  4F03 A;  1MDJ A;  4I5Q A;  1A23 A;  4AJ7 A;  2B7K A;  2VM1 A;  4GSN A;  1U3I A;  2H76 A;  1H75 A;  2J9H A;  1GSF A;  1WP0 A;  2C1Y A;  1XOB A;  2OE3 A;  4GQF A;  4TRX A;  5IOX A;  2HI7 A;  2IWT A;  1M99 A;  2FD3 A;  3ZYW A;  4F0B A;  1TOF A;  4O92 A;  5CYY A;  3ZIT A;  1GTA A;  4HUA A;  3C73 A;  3WGE A;  2ON5 A;  4KSM A;  2VLU A;  4TOP A;  2LKU A;  1K0B A;  3KJY A;  3GL5 A;  2GSS A;  3GSS A;  2L6D A;  2N5F A;  1V58 A;  4OMV A;  3TJK A;  2C8U A;  4XS1 A;  1TU8 A;  5DJL A;  3M8N A;  5DAL B;  1DE1 A;  3KCM A;  2VCT A;  4TKY A;  3D0Z A;  4MZW A;  4DSS B;  4DEJ A;  1VGL A;  2A2R A;  2ZNM A;  3E0U A;  1OE7 A;  3IK7 A;  3Q6O A;  4IQA A;  7GSS A;  2H74 A;  2NVL A;  3HVV A;  5JWO B;  5FWG A;  3TJJ A;  4NHZ A;  5G1L A;  3RPP A;  3HHV A;  4KAE A;  2XPD A;  1ERV A;  2FY6 A;  4GRF A;  1T8E B;  4XRA A;  3GX8 A;  3EUR A;  1FVK A;  2RII A;  4POB A;  1YKA A;  2GDR A;  3FR3 A;  1YY7 A;  2WFC A;  3BOA A;  2JZR A;  2KHP A;  2LUS A;  1BQ7 A;  4FH8 A;  4OO5 A;  1K0D A;  4HS1 A;  2CZ3 A;  5ECS A;  4WBJ A;  3IBH A;  1TXX A;  3VWV A;  2I9H A;  1J08 A;  1F6M C;  4I2U A;  3VPQ A;  1SD9 A;  2J23 A;  2C0D A;  1GSQ A;  3MDK A;  5IQY A;  1AAZ A;  3H93 A;  1GLQ A;  2H73 A;  3LYP A;  1PKZ A;  2JAC A;  1ML6 A;  2GTU A;  3E3E A;  4G9H A;  4I97 A;  4MCU A;  3O3T A;  5H5Q A;  4D73 B;  2IME A;  1SL1 B;  2PN8 A;  2F9S A;  3DML A;  2DBC A;  4TW5 A;  5IPH A;  3U6V A;  1SK1 A;  3G7Y A;  1B9Y C;  1OC9 B;  1XCC A;  5JWR B;  3TOT A;  3IV4 A;  1O73 A;  4ACS A;  1FOV A;  2LV3 A;  14GS A;  2X99 A;  2DC5 A;  2IFQ B;  1SK2 A;  1F37 A;  1EV9 A;  5EVO A;  1ABA A;  3FKF A;  4EXJ A;  1USB A;  4WET A;  8GSS A;  3L9S A;  2E7P A;  4HQZ A;  4NPB A;  5DQS A;  3IOS A;  4TR4 A;  4IBP A;  4X43 A;  2H1A A;  3O6T A;  1JLW A;  3TRQ A;  5HR0 A;  4F2I A;  3I6A A;  4ECJ A;  4AJ8 A;  2OKA A;  3HJP A;  4O32 A;  4DSR A;  2TIR A;  3DVW A;  5EL8 A;  3UBL A;  3WD6 A;  3DWV A;  2HSY A;  3C71 A;  4NWY A;  1E2Y A;  1KEB A;  4YAP A;  3IA1 A;  3KTL A;  3QFB C;  3ZRD A;  2KLX A;  4FIW A;  3GH6 A;  1HD2 A;  3DKS A;  1V40 A;  2B6M A;  2HZE A;  2RM5 A;  4V2L A;  4PNG A;  2YWN A;  2MBT A;  4JU5 A;  3UJ1 A;  1URM A;  3EYT A;  1KTE A;  4EDZ A;  3FZ4 A;  3MWH A;  2VL2 A;  3EIN A;  5G2Z A;  3TKQ A;  1QGV A;  2JSZ A;  3CSH A;  3LQ7 A;  3TJB A;  3LOR A;  3DRN A;  1YKC A;  2K8S A;  5CRH A;  1TK5 B;  1SL0 B;  3H1N A;  4K6X A;  5HFK A;  4Q5F A;  1R4W A;  2DLX A;  1K3Y A;  3APQ A;  4MAB A;  3C8E A;  11GS A;  2RUE A;  3CTF A;  6GST A;  4KGI A;  4PUR A;  2EC4 A;  4MJC A;  2K6V A;  4IJI A;  3WT2 A;  3ME7 A;  4IS0 A;  1Z5Y E;  5B8A A;  1OC3 A;  1XVQ A;  2HT9 A;  3HY2 A;  4K7I A;  3A2X A;  6GSS A;  5GAP D;  1EP8 A;  2BTO T;  1WMJ A;  4KX4 A;  6GSY A;  3HD5 A;  5IPG A;  2NDO A;  5ECK B;  1ERT A;  4K7N A;  1X9S B;  1O8X A;  1W89 A;  3FY7 A;  1BG5 A;  4O7H A;  2E2M A;  1TU7 A;  1PX7 A;  3ED3 A;  3RDW A;  3GNJ A;  4EC0 A;  2FGX A;  3DVX A;  3F63 A;  1A8L A;  2L4Q A;  2QKE A;  5F07 A;  1U87 A;  2H6Y A;  2EIO A;  1Q98 A;  3LG6 A;  1E6B A;  20GS A;  3IR4 A;  1XVW A;  1Y6E A;  3VPT A;  1YJ6 A;  1XW6 A;  4Q5N A;  4CHS A;  1A24 A;  3N5O A;  3QAV A;  2IPA A;  3GA4 A;  3FW2 A;  4CW9 A;  3CMI A;  4E8H A;  2L5L A;  2YV9 A;  4N11 A;  4EO3 A;  4HU7 A;  5IIZ A;  5JCW A;  3HZ8 A;  2A2S A;  3VUR A;  2XPE A;  2L6C A;  2JZT A;  4K9Z A;  3KP8 A;  1GSD A;  5EY6 A;  4O5R A;  5ECM B;  2PMT A;  3EE2 A;  2DSA A;  1VF4 A;  2KP2 A;  4TR1 A;  1NHY A;  3PR8 A;  2VL9 A;  1YEP A;  3LXZ A;  3I9V 2;  1MD3 A;  1WIK A;  5L71 A;  1FB0 A;  3DXB A;  3LGC A;  4MK3 A;  3BJ5 A;  2R37 A;  4POM A;  2M80 A;  4E8E A;  2H0G A;  4HEA 2;  5HR2 A;  3D4M A;  4L0W A;  4X1U A;  1GP1 A;  5E59 A;  5CRG A;  4XIH A;  4FYU A;  4KH7 A;  3HKR A;  1Z6M A;  3F3R A;  5LNK e;  3HZ4 A;  2AJQ B;  2M72 A;  2O8V B;  2YV7 A;  3ZIJ A;  4DSQ A;  4MP4 A;  1KNG A;  3QOU A;  2YPM A;  5ID2 A;  1GLP A;  1HQO A;  1YF0 A;  2PVO C;  1PL1 A;  1BED A;  3UEM A;  4AF2 A;  4PGT A;  3G7J A;  1VRS D;  12GS A;  2OAC A;  2IN3 A;  1Z7R A;  2VD0 A;  1UN2 A;  5KN2 A;  3SWL A;  2XC2 A;  4F82 A;  3L9V A;  1SKW B;  1TJD A;  2FUG 2;  3RHC A;  1PD2 1;  4GQC A;  1TK0 B;  1XPV A;  4HDE A;  3ZTL A;  5D9T A;  2CA8 A;  5D9X A;  1T3B A;  1N8J A;  1BX9 A;  4X0X A;  3QMX A;  3MNG A;  3GUR A;  4G19 A;  5AN1 A;  1QK8 A;  2HSH A;  3C1S A;  2C0F A;  2R2J A;  3FEU A;  4KA0 A;  1WE0 A;  2P5Q A;  1JHB A;  3I69 A;  2WS2 A;  1EWX A;  4MF6 A;  3LXT A;  3ZRE A;  3O76 A;  4MPF A;  1QFN A;  3GHA A;  5C04 A;  3F9U A;  4BL7 A;  5DVB A;  3GX0 A;  4ZBA A;  4N0V A;  3M9J A;  5B7C A;  2TRC P;  4ILF A;  5IO2 A;  3F4S A;  4IKH A;  1CQG A;  2GST A;  4I8B A;  3TKS A;  3HDC A;  3A3T A;  3BCK A;  3NZN A;  5A4U A;  3EU3 A;  1MDK A;  4NAX A;  1FW1 A;  4KW6 A;  2V1M A;  1SKR B;  3GKM A;  4XS4 A;  1WJK A;  5IMF A;  1XOA A;  2JL4 A;  5G30 A;  2YOI A;  2MMZ A;  3ERG A;  1DUG A;  1SD8 A;  4L5L A;  1S3C A;  1PN9 A;  1WOU A;  4YH2 A;  1V57 A;  2I3Y A;  5G1K A;  3FZ5 A;  4K0G A;  1ZCP A;  2VD1 A;  3FK8 A;  1ACV A;  2B3S A;  2PER A;  5D93 A;  4OCF A;  1FG4 A;  1NM3 A;  3LWA A;  2IMI A;  3V1W A;  3LSZ A;  4V2N A;  2CZ2 A;  3WT1 A;  4WXT A;  2QC7 A;  2AUV A;  2FLS A;  1R7H A;  4QL9 A;  2HFD A;  2OA7 A;  2X64 A;  1XBS A;  2DIY A;  3NIV A;  4MMM A;  5C00 A;  2G2Q A;  1VF1 A;  2VM2 A;  2NTO A;  3UAR A;  4P3Y B;  5IMA A;  1SJ6 A;  3FR9 A;  2KUC A;  2VCW A;  4V1A p;  4YQM A;  1NHO A;  1G7E A;  4KDY A;  5DDL A;  2K8V A;  3SBC A;  5D8I A;  4JR6 A;  2LQQ A;  5DCG A;  1ERW A;  5D9W A;  1Z7P A;  1ZOF A;  3EWL A;  2JAD A;  4HI7 A;  5HR1 A;  5H5S A;  2PGT A;  1ON4 A;  1U88 A;  3H4K A;  3CSJ A;  1TKD B;  1QMV A;  4GTU A;  5B6N A;  2REM A; 
#chains in the Genus database with same CATH topology
 6GSU A;  3ERF A;  4ZB9 A;  1TRW A;  3TGZ A;  1MDI A;  2LJA A;  1JZR A;  1PL2 A;  4IVF A;  2YP6 A;  2L4C A;  4EVM A;  1QXH A;  3L4N A;  3IPZ A;  1N2A A;  1B4Q A;  3F3Q A;  4PQH A;  1YF1 A;  1H4O A;  3UIW A;  4HU9 A;  4J57 E;  3P2A A;  3ZZX A;  2GGT A;  3QPM A;  4QQ7 A;  4YAV A;  3A2W A;  4EUY A;  4BVY A;  2YZU A;  4MH3 A;  4AGS A;  1IYI A;  2WCI A;  1TRV A;  5G5E A;  2ZCT A;  5JWQ B;  1K0N A;  2AB6 A;  2WDU A;  1AQW A;  4ICY A;  2B5E A;  5ECP B;  3CYN A;  3P90 A;  4LMW A;  4KSO A;  1TRU A;  2GSQ A;  3IK9 A;  5IMD A;  1GH2 A;  3D21 A;  1GL8 A;  5ECR B;  1PKW A;  4ZL9 A;  5AIS A;  4ZL7 A;  3HXS A;  1OKT A;  5AGY A;  1G7O A;  4N30 A;  5DAL A;  3GYK A;  2P0G A;  2OE0 A;  5IOW A;  4OFT A;  2B1K A;  4DSS A;  4KND A;  1B48 A;  1B8X A;  3QAG A;  2GQL A;  1EOG A;  5ABR A;  1R5P A;  5G5F A;  3IHQ A;  5F8B A;  2P5R A;  3D4T A;  5COH A;  1O6J A;  2AHE A;  2GVP A;  2L57 A;  2MMO A;  4IJ3 A;  5AIV A;  1T4Z A;  2FA8 A;  2CAI A;  1GSU A;  2VCV A;  2K9F A;  3ZMK A;  3S9F A;  3J7Y k;  3KEB A;  1OKD A;  4BPY A;  1EV4 A;  1ZYE A;  1O8W A;  3BCI A;  4K1F A;  3QFA C;  1X5C A;  1TW9 A;  5D96 A;  3UAP A;  1PFO A;  2QGV A;  3IAM 2;  4ID0 A;  3OR5 A;  3Q74 A;  2F8F A;  2FWF A;  2ZUP A;  4IP6 A;  4PNF A;  3HCZ A;  2WGR A;  6GSV A;  4ZBD A;  4JRR A;  1A2M A;  2HYX A;  2H1D A;  2P31 A;  2QSI A;  1GUM A;  2HNL A;  2M46 A;  4PXO A;  5CRE A;  4BIK A;  3LEF A;  3KGK A;  3EC3 A;  5ECN B;  4LMV A;  1M2B A;  2DKH A;  5DCH A;  4J2F A;  4BA7 A;  1ZZY A;  2C80 A;  4NV2 A;  1GSY A;  2ALB A;  3TJG A;  3HVS A;  1OAZ A;  1M9A A;  1YQ1 A;  4ZIL A;  2V2G A;  2B5X A;  5GZZ B;  4Z2U A;  1SEN A;  3GFK A;  3GTU B;  1BJX A;  1THX A;  3QDN A;  1FOH A;  3W6G A;  1THO A;  4ZL8 A;  4D73 A;  5ELA A;  3F8U A;  2CQ9 A;  3EU4 A;  2H01 A;  4KB3 A;  3FZ9 A;  2LNS A;  2PBJ A;  5HQP A;  5H5R A;  1GTB A;  2PU9 C;  3TRP A;  5ECI B;  5A4V A;  2HSM A;  2LJR A;  1OC9 A;  3KH9 A;  4F0C A;  5KEJ A;  2ES7 A;  3GKK A;  2YWM A;  5EPF A;  1SU9 A;  1Y25 A;  2K18 A;  5HFG A;  1UA5 A;  4K7O A;  2XBQ A;  4POK A;  2IFQ A;  1U6T A;  1JZD A;  1M3J A;  3PIN A;  5FT3 A;  3GIX A;  4G10 A;  1MD4 A;  1Q4J A;  1TTZ A;  4GCI A;  4TXO A;  1I9D A;  5F06 A;  1F3A A;  1EZK A;  3M9K A;  1LJR A;  4XS6 A;  1DBY A;  1DE2 A;  4CDO A;  3HJO A;  5GSS A;  2B1L A;  5DAK B;  1F3B A;  4ZB8 A;  4L8E A;  1X9M B;  1O7U A;  2PVQ A;  1A8Y A;  2IMF A;  1R26 A;  1Z6N A;  4XRD A;  1TRS A;  1TI3 A;  2VLT A;  4IN0 A;  5HFI A;  1YZX A;  3IDV A;  1O81 A;  4MLY A;  2R3X A;  3D6I A;  1GSS A;  1XWC A;  3L9U A;  3UVT A;  2WJU A;  3RAZ A;  4O5Q A;  3ZFB A;  2FA4 A;  4OFN A;  1GTU A;  4TVE A;  2H0H A;  2LQO A;  3UBK A;  2C3T A;  10GS A;  2R0G A;  4JBB A;  5ECQ B;  5IM9 A;  1OYJ A;  1HNC A;  1K0A A;  2IL3 A;  2R5G A;  3KZQ A;  3GST A;  3KMO A;  4TN8 A;  4WBR D;  1JFU A;  1A0R P;  3QCP A;  3HYP A;  4JED A;  4ECI A;  2LRT A;  1T7P B;  4K5R A;  1LU4 A;  4FYC A;  2IIY A;  4N10 A;  4GST A;  3C7M A;  3D5J A;  3GMF A;  4ML6 A;  1EEJ A;  3GUS A;  2LST A;  3BD2 A;  1XFL A;  3UL3 A;  2YJ7 A;  1UVZ A;  2GQM A;  1WPI A;  2VUP A;  1M2D A;  4Q5R A;  4GSS A;  2AYT A;  2DJ2 A;  4XHM A;  3L0H A;  2YCD A;  3VWX A;  3R2Q A;  4RI7 A;  4XCS A;  3TDG A;  1WRY A;  2DJJ A;  1X0R A;  4MJE A;  2CV4 A;  2AAW A;  1TP9 A;  4L5O A;  4HZ4 A;  3A5I A;  2OBK A;  3VLN A;  3FYG A;  1GRX A;  3A2V A;  2RLI A;  3EPT A;  4HSC X;  3GV1 A;  4HJM A;  2H8L A;  2EIR A;  1BAY A;  1LBK A;  2B7J A;  1SJZ A;  4ZXG A;  3UVH A;  3HVN A;  1W4V A;  1PGT A;  2E2G A;  3ZIV A;  4KUN A;  2VL3 A;  6GSX A;  4CY6 A;  2C4J A;  2O85 A;  5G31 A;  3M0F A;  3LW9 A;  2CVB A;  3KH7 A;  4NV5 A;  4G0K A;  4EKZ A;  1SL2 B;  2F3M A;  1J0F A;  4KE3 A;  3KIJ A;  4L0U A;  4MZB A;  3M3M A;  1XWG A;  3DIE A;  3GL3 A;  4I2T A;  3UOM A;  1K3L A;  5ECL B;  4YQU A;  3HJM A;  4FO5 A;  4G0I A;  3U5R E;  1A2L A;  4K8M A;  1K0M A;  2CAQ A;  5CP1 A;  1XWB A;  1SKS B;  5GST A;  4G0L A;  2AV4 A;  1AUC A;  3IRA A;  3EMP A;  1BYE A;  1JLV A;  5DBQ A;  3F4R A;  2IMK A;  2LNT A;  4TR0 A;  1OC8 A;  3TRX A;  3VWW A;  3ERW A;  3PH9 A;  2OAD A;  2HXK A;  2GZP A;  3F0I A;  4NMU A;  3J7Y b;  3F6D A;  4GXZ A;  5IO0 A;  1PRX A;  3VWU A;  2H72 A;  5CAX A;  4BVX A;  16GS A;  2L5O A;  1PA3 A;  3VI5 A;  3MSZ A;  1GUL A;  3CRT A;  1SJI A;  1Z3E A;  3CBU A;  5CRW A;  1T4Y A;  4A5P A;  5JCG A;  1XXU A;  4KCE A;  1ST9 A;  13GS A;  2NBS A;  5J9B A;  4ECB A;  3KP9 A;  1VF2 A;  1ERU A;  1EGR A;  2I4A A;  2F51 A;  1G6W A;  5F0G A;  3GN3 A;  4MF7 A;  4RI6 A;  1GUH A;  4WR4 A;  4IHU A;  5ELG A;  2TRX A;  1T1V A;  3FHK A;  3KXO A;  2PUK C;  3I43 A;  4JR4 A;  1OVN A;  5GAN D;  3VK9 A;  4KDU A;  2FCH A;  5J4U A;  4WKW A;  3ME8 A;  2H0I A;  3FRC A;  5IMC A;  1MEK A;  3CXG A;  2B5Y A;  2VCX A;  4K2X A;  5F05 A;  4ML1 A;  4H86 A;  1U3A A;  4MZC A;  4MJA A;  5A5K A;  4G2E A;  2KOK A;  3HVX A;  1TI1 A;  4FYB A;  2HZE B;  4OWY A;  6GSW A;  2EIQ A;  3QAW A;  2PWJ A;  4ISD A;  2WUL A;  4BWS A;  2YN1 A;  5J3R A;  2IMD A;  4KCA A;  3H79 A;  1X5E A;  2I1U A;  2GT6 A;  2YNX A;  1ZGN A;  4IGJ A;  2C3N A;  3HA9 A;  1GTI A;  4RQX A;  3RPN A;  2HE3 A;  3RHB A;  3K8N A;  5AIX A;  4MJB A;  2GQK A;  2GZY A;  2L59 A;  3TOU A;  2LRC A;  2DMM A;  1NW2 A;  2RM6 A;  1X5D A;  18GS A;  4EF0 A;  2VIM A;  1WWJ A;  1YDK A;  3QD9 A;  4OD7 A;  1HNA A;  1HNB A;  2E0Q A;  5ENU A;  2LEG A;  4IW9 A;  2HRF A;  3DGQ A;  1A0F A;  1RW1 A;  5E4W A;  4V2M A;  2VL2 C;  3ZML A;  1JZO A;  1JZW A;  3VI7 A;  2C0G A;  3FR6 A;  1FB6 A;  3BBY A;  4K0N A;  1K0C A;  1PSQ A;  5D73 A;  2H1B A;  1GUK A;  1ZL9 A;  1GNW A;  1B9X C;  3CTG A;  1AC1 A;  3F4T A;  4HOJ A;  1G6Y A;  17GS A;  1K3O A;  2H75 A;  2JZS A;  2YAN A;  3KTB A;  2O87 A;  4TXO B;  2MMN A;  3EMX A;  1F2E A;  5LCZ A;  1B4P A;  4MA9 A;  5HR3 A;  1R5A A;  4WF4 A;  1GWC A;  4OFM A;  3TCO A;  1J9B A;  5JCU A;  2PPT A;  4YQV A;  3C1R A;  4PX1 A;  1M7T A;  2V41 A;  4NHW A;  1O85 A;  1XG8 A;  2HZF A;  5IMZ A;  5J5N A;  3VFI A;  4F9Z A;  2H1G A;  2UZ8 A;  2HRN A;  3G9B A;  1IYH A;  4EL1 A;  3TKP A;  1I5G A;  4TR1 B;  4X4J A;  4LL1 B;  2I81 A;  4MDC A;  1VF3 A;  2YWO A;  4MH2 A;  3GH9 A;  3AY8 A;  1XWA A;  2BMX A;  4EIP A;  4LA1 A;  2KP1 A;  4TXV A;  3A5W A;  3TKR A;  4IEL A;  4PUA A;  2D2Z A;  2RUF A;  1C72 A;  1S3A A;  3US3 A;  1GSE A;  2VOC A;  1Z9H A;  4MPG A;  2LTK A;  1RK4 A;  3IHG A;  5BRT A;  4PUF C;  4KDX A;  4Q5Q A;  2H66 A;  2VCZ A;  3FZA A;  2X8G A;  3MAK A;  5J9C A;  2FWG A;  3F6F A;  2A4V A;  4NXI A;  2LS5 A;  1S3D A;  2YJH A;  2VLV A;  4PTS A;  2GS3 A;  5FHI A;  1V2A A;  1PX6 A;  4BWQ A;  1HYU A;  2FHE A;  2XHF A;  5DQY A;  3ZVJ D;  22GS A;  5ID2 B;  2OJL A;  5KOX A;  3CSI A;  3EVI A;  5KN1 A;  1TDI A;  3TB2 A;  2CVK A;  3LYK A;  1AXD A;  4OO4 A;  3IXR A;  5INY A;  4N0Z A;  2X8C A;  4IP1 A;  3ZLP A;  2FWE A;  2HRK A;  2H6X A;  4GWR A;  2O89 A;  2F8A A;  5ECH B;  3N9J A;  3WGD A;  1GNE A;  4MF5 A;  1YEX A;  2YZH A;  3DEX A;  1AIU A;  1AQX A;  4RQR A;  4QL7 A;  1V9W A;  1NSW A;  3Q19 A;  4I6X A;  4HZ2 A;  1KBN A;  2VAF A;  2DJ0 A;  4PQI A;  2CVD A;  3UMA A;  1SK0 A;  3P8W A;  1XW9 A;  2O7K A;  4V1A g;  3W8S A;  5KN0 A;  4OCE A;  5ECO B;  3TKS E;  1V98 A;  2N5A A;  3FMW A;  1FHE A;  2MBS A;  4AJ6 A;  1FAA A;  2BJX A;  1XIY A;  3LFL A;  2DML A;  3MIX A;  4YKG A;  9GSS A;  1XW5 A;  2CT6 A;  2YWI A;  1XZO A;  2GLR A;  4ECC A;  2H71 A;  2WB9 A;  4POL A;  1RQM A;  2ON7 A;  2H70 A;  3GKX A;  4GLT A;  1TK8 B;  1OE8 A;  2OBI A;  5CRD A;  4BL7 B;  4HJ2 A;  3ZVJ A;  2V32 A;  3QR6 A;  4Z2T A;  2OE1 A;  4J56 E;  3WYW A;  3JCM L;  3DD3 A;  4JZQ A;  3GRX A;  2FNO A;  2V6O A;  3NOF A;  4JE1 A;  1UC7 A;  3M1G A;  2C0E A;  2HLS A;  4LLR A;  1A2J A;  5CO3 A;  4EDY A;  5DJM A;  1EGO A;  3PGT A;  1XWK A;  5KN3 A;  3KMN A;  4WF5 A;  2XBI A;  4XS4 B;  4ULX A;  2DJ1 A;  3E9J B;  4XTS A;  3CRU A;  1DSB A;  19GS A;  1EP7 A;  3MYD A;  2FWH A;  2MMA A;  1MTC A;  3APO A;  4DVC A;  3WGX A;  4ZBB A;  2N5B A;  4K2D A;  2JSY A;  2G0F A;  4LL4 B;  3GKN A;  4IQ1 A;  3TUE A;  2CX3 A;  2WRT A;  3GTU A;  2Z9S A;  4GF0 A;  1SYX A;  5A4W A;  2R6K A;  2HRA A;  2NPB A;  2MYG A;  2MZC A;  1AW9 A;  3G7I A;  4BVX B;  3DYR A;  3IAS 2;  3TKS C;  5CNW A;  1QUW A;  3IC4 A;  1QQ2 A;  3KM6 A;  5LD0 A;  2LRN A;  3W8J A;  3ZFL A;  4WR5 A;  3APS A;  1PMT A;  3P7X A;  2A2P A;  1G0T A;  3RBT A;  3CQF A;  3KD0 A;  1AQV A;  1ILO A;  2R0C A;  2GZZ A;  1EOH A;  1ZMA A;  3H8Q A;  4WEY A;  2V6K A;  4TR3 A;  4HQS A;  2GSR A;  5B6M A;  1F9M A;  1SYR A;  2IJY A;  3ZL5 A;  1FVJ A;  2DJK A;  3LJR A;  4PQ1 A;  3TJF A;  2H19 A;  1M0U A;  3IC8 A;  1ZYQ B;  3ISO A;  1FO5 A;  4EE0 A;  1X9W B;  1CQH A;  1M9B A;  2DIZ A;  5B8B A;  5D9V A;  2H6Z A;  1EEM A;  4RUV A;  2GT5 A;  2VCQ A;  5KOW A;  3IE3 A;  2VO4 A;  3D22 A;  5IMV A;  2WZ9 A;  5DAK A;  3L78 A;  2CX4 A;  2R4V A;  4ZIJ A;  1PQN A;  2X8H A;  1M2A A;  4ZB6 A;  2H30 A;  2DJ3 A;  2LJK A;  2C3Q A;  2JU5 A;  1T00 A;  3Q18 A;  1K0O A;  4Z7X A;  5J41 A;  4F03 A;  1MDJ A;  4I5Q A;  1A23 A;  4AJ7 A;  2B7K A;  2VM1 A;  4GSN A;  1U3I A;  2H76 A;  1H75 A;  4Z2R A;  1M3I A;  2J9H A;  1GSF A;  1WP0 A;  2C1Y A;  4USS A;  1XOB A;  2OE3 A;  4BVY B;  4GQF A;  4TRX A;  5IOX A;  2HI7 A;  2IWT A;  1M99 A;  2FD3 A;  3ZYW A;  4F0B A;  1TOF A;  4O92 A;  5CYY A;  3ZIT A;  1GTA A;  4HUA A;  3C73 A;  3WGE A;  2ON5 A;  4KSM A;  2VLU A;  4TOP A;  2LKU A;  1K0B A;  3KJY A;  3GL5 A;  2GSS A;  3GSS A;  2L6D A;  2N5F A;  1V58 A;  4OMV A;  3TJK A;  2C8U A;  4XS1 A;  1TU8 A;  5DJL A;  3M8N A;  5DAL B;  1DE1 A;  3KCM A;  2VCT A;  4TKY A;  3D0Z A;  4MZW A;  4DSS B;  4DEJ A;  1VGL A;  3R3E A;  2A2R A;  2ZNM A;  3E0U A;  1OE7 A;  3IK7 A;  3Q6O A;  4IQA A;  7GSS A;  2H74 A;  2NVL A;  4FQU A;  3HVV A;  5JWO B;  5FWG A;  3TJJ A;  4NHZ A;  5G1L A;  3RPP A;  3HHV A;  3PPU A;  4KAE A;  2XPD A;  1ERV A;  2FY6 A;  4GRF A;  1T8E B;  4K5S A;  4XRA A;  3GX8 A;  3EUR A;  1FVK A;  2RII A;  4POB A;  1YKA A;  2GDR A;  3FR3 A;  1YY7 A;  2WFC A;  3BOA A;  2JZR A;  2KHP A;  2LUS A;  4MNN A;  1BQ7 A;  4FH8 A;  4OO5 A;  1K0D A;  4HS1 A;  2CZ3 A;  5ECS A;  4WBJ A;  3IBH A;  1TXX A;  3VWV A;  2I9H A;  1J08 A;  1F6M C;  4I2U A;  3VPQ A;  1SD9 A;  2J23 A;  2C0D A;  1GSQ A;  3MDK A;  5IQY A;  1AAZ A;  3H93 A;  1GLQ A;  2H73 A;  3LYP A;  1PKZ A;  2JAC A;  1ML6 A;  2GTU A;  3E3E A;  4G9H A;  4I97 A;  4MCU A;  3O3T A;  5H5Q A;  4D73 B;  2IME A;  1SL1 B;  2PN8 A;  2F9S A;  5BMU A;  3DML A;  2DBC A;  4TW5 A;  5IPH A;  3U6V A;  1SK1 A;  3G7Y A;  1B9Y C;  1OC9 B;  1XCC A;  5JWR B;  3TOT A;  3IV4 A;  1O73 A;  4ACS A;  1FOV A;  2LV3 A;  14GS A;  2X99 A;  2DC5 A;  2IFQ B;  1SK2 A;  1F37 A;  1EV9 A;  5EVO A;  1ABA A;  3FKF A;  4EXJ A;  1USB A;  4WET A;  8GSS A;  3L9S A;  1PN0 A;  4KF9 A;  2E7P A;  4HQZ A;  4NPB A;  5DQS A;  3IOS A;  4TR4 A;  4IBP A;  4X43 A;  2H1A A;  3O6T A;  1S3R A;  1JLW A;  3TRQ A;  5HR0 A;  4F2I A;  3I6A A;  4ECJ A;  4AJ8 A;  2OKA A;  3HJP A;  4O32 A;  4DSR A;  2TIR A;  3DVW A;  5EL8 A;  3UBL A;  3WD6 A;  3DWV A;  2HSY A;  3C71 A;  4NWY A;  1E2Y A;  1KEB A;  4YAP A;  3IA1 A;  3KTL A;  2QA1 A;  3QFB C;  3ZRD A;  2KLX A;  4FIW A;  3GH6 A;  1HD2 A;  3DKS A;  1V40 A;  2B6M A;  2HZE A;  2RM5 A;  4V2L A;  4PNG A;  2YWN A;  2MBT A;  4JU5 A;  3UJ1 A;  1URM A;  3EYT A;  1KTE A;  4EDZ A;  3FZ4 A;  3MWH A;  2VL2 A;  3EIN A;  5G2Z A;  3TKQ A;  1QGV A;  2JSZ A;  3CSH A;  3LQ7 A;  3TJB A;  3LOR A;  3DRN A;  1YKC A;  2K8S A;  5CRH A;  1TK5 B;  1SL0 B;  3H1N A;  2X4A A;  4K6X A;  5HFK A;  4Q5F A;  1R4W A;  2DLX A;  1K3Y A;  3APQ A;  4MAB A;  3C8E A;  11GS A;  2RUE A;  3CTF A;  6GST A;  4KGI A;  4PUR A;  2EC4 A;  4MJC A;  2K6V A;  4IJI A;  3WT2 A;  3ME7 A;  4IS0 A;  1Z5Y E;  5B8A A;  1OC3 A;  1XVQ A;  2HT9 A;  2DKI A;  3HY2 A;  4K7I A;  3A2X A;  6GSS A;  5GAP D;  1EP8 A;  2BTO T;  1WMJ A;  4KX4 A;  6GSY A;  3HD5 A;  5IPG A;  2NDO A;  5ECK B;  1ERT A;  4K7N A;  1X9S B;  1O8X A;  1W89 A;  3FY7 A;  1BG5 A;  4O7H A;  2E2M A;  1TU7 A;  1PX7 A;  3ED3 A;  3RDW A;  3GNJ A;  4EC0 A;  2FGX A;  3DVX A;  3F63 A;  1A8L A;  2L4Q A;  2QKE A;  5F07 A;  1U87 A;  2H6Y A;  2EIO A;  1Q98 A;  3LG6 A;  1E6B A;  20GS A;  3IR4 A;  1XVW A;  1Y6E A;  3VPT A;  1YJ6 A;  1XW6 A;  4Q5N A;  4CHS A;  1A24 A;  3N5O A;  3QAV A;  2IPA A;  3GA4 A;  3FW2 A;  1ZYP A;  4CW9 A;  3CMI A;  4E8H A;  2L5L A;  2YV9 A;  4N11 A;  4EO3 A;  4HU7 A;  5IIZ A;  5JCW A;  3HZ8 A;  2A2S A;  4CY8 A;  3VUR A;  2XPE A;  2L6C A;  2JZT A;  4K9Z A;  3KP8 A;  1GSD A;  5EY6 A;  4O5R A;  5ECM B;  4EIQ A;  2PMT A;  3EE2 A;  2DSA A;  1VF4 A;  2KP2 A;  4TR1 A;  1NHY A;  3PR8 A;  2VL9 A;  1YEP A;  3LXZ A;  3I9V 2;  1MD3 A;  1WIK A;  5L71 A;  1FB0 A;  3DXB A;  3LGC A;  4MK3 A;  3BJ5 A;  2R37 A;  4POM A;  2M80 A;  4E8E A;  2H0G A;  4HEA 2;  5HR2 A;  3D4M A;  4L0W A;  4X1U A;  1GP1 A;  5E59 A;  5CRG A;  4XIH A;  4FYU A;  4KH7 A;  3HKR A;  1Z6M A;  3F3R A;  5LNK e;  3HZ4 A;  2AJQ B;  2M72 A;  2O8V B;  2YV7 A;  3ZIJ A;  4DSQ A;  4MP4 A;  2A4H A;  1KNG A;  3QOU A;  2YPM A;  5ID2 A;  1GLP A;  1HQO A;  1YF0 A;  2PVO C;  1PL1 A;  1BED A;  3UEM A;  4AF2 A;  4PGT A;  3G7J A;  1VRS D;  12GS A;  2OAC A;  2IN3 A;  1Z7R A;  2VD0 A;  1UN2 A;  5KN2 A;  3SWL A;  2XC2 A;  4F82 A;  3L9V A;  1SKW B;  1TJD A;  2FUG 2;  3RHC A;  1PD2 1;  4GQC A;  1TK0 B;  1XPV A;  4HDE A;  3ZTL A;  5D9T A;  2CA8 A;  5D9X A;  1T3B A;  1N8J A;  1BX9 A;  4X0X A;  4YKF A;  3QMX A;  3MNG A;  3GUR A;  4G19 A;  5AN1 A;  1QK8 A;  2HSH A;  3C1S A;  2C0F A;  2R2J A;  3FEU A;  4KA0 A;  1WE0 A;  2P5Q A;  1JHB A;  3I69 A;  2WS2 A;  1EWX A;  4MF6 A;  3LXT A;  3ZRE A;  3O76 A;  4MPF A;  1QFN A;  3GHA A;  5C04 A;  3F9U A;  4BL7 A;  5DVB A;  3GX0 A;  4ZBA A;  4N0V A;  3M9J A;  5B7C A;  2TRC P;  4ILF A;  5IO2 A;  3F4S A;  4IKH A;  1CQG A;  2GST A;  4I8B A;  3TKS A;  3HDC A;  3A3T A;  3BCK A;  3NZN A;  5A4U A;  3EU3 A;  1MDK A;  4NAX A;  1FW1 A;  4KW6 A;  2V1M A;  1SKR B;  3GKM A;  4XS4 A;  1WJK A;  5IMF A;  1XOA A;  2JL4 A;  5G30 A;  2YOI A;  2MMZ A;  3ERG A;  1DUG A;  1SD8 A;  2X49 A;  4L5L A;  1S3C A;  1PN9 A;  2QA2 A;  1WOU A;  4YH2 A;  1V57 A;  2I3Y A;  5G1K A;  3FZ5 A;  4K0G A;  1ZCP A;  2VD1 A;  3FK8 A;  1ACV A;  2B3S A;  2PER A;  2R0P A;  5D93 A;  4OCF A;  1FG4 A;  1NM3 A;  3LWA A;  4O5U A;  2IMI A;  3V1W A;  3LSZ A;  4V2N A;  2CZ2 A;  3WT1 A;  4WXT A;  2QC7 A;  2AUV A;  2FLS A;  1R7H A;  4QL9 A;  1ZYN A;  2HFD A;  2OA7 A;  2X64 A;  1XBS A;  2DIY A;  3NIV A;  4MMM A;  5C00 A;  2G2Q A;  1VF1 A;  2VM2 A;  2NTO A;  3UAR A;  4P3Y B;  5IMA A;  1SJ6 A;  3FR9 A;  2KUC A;  2VCW A;  4V1A p;  4YQM A;  1NHO A;  1G7E A;  4KDY A;  5DDL A;  2K8V A;  3SBC A;  5D8I A;  4JR6 A;  2LQQ A;  5DCG A;  1ERW A;  5D9W A;  1Z7P A;  1ZOF A;  3EWL A;  2JAD A;  4HI7 A;  5HR1 A;  5H5S A;  2PGT A;  1ON4 A;  1U88 A;  3H4K A;  3CSJ A;  1TKD B;  1QMV A;  4GTU A;  5B6N A;  2REM A; 
#chains in the Genus database with same CATH homology
 6GSU A;  3ERF A;  4ZB9 A;  1TRW A;  3TGZ A;  1MDI A;  2LJA A;  1JZR A;  1PL2 A;  4IVF A;  2YP6 A;  2L4C A;  4EVM A;  1QXH A;  3L4N A;  3IPZ A;  1N2A A;  1B4Q A;  3F3Q A;  4PQH A;  1YF1 A;  1H4O A;  3UIW A;  4HU9 A;  4J57 E;  3P2A A;  3ZZX A;  2GGT A;  3QPM A;  4QQ7 A;  4YAV A;  3A2W A;  4EUY A;  4BVY A;  2YZU A;  4MH3 A;  4AGS A;  1IYI A;  2WCI A;  1TRV A;  5G5E A;  2ZCT A;  5JWQ B;  1K0N A;  2AB6 A;  2WDU A;  1AQW A;  4ICY A;  2B5E A;  5ECP B;  3CYN A;  3P90 A;  4LMW A;  4KSO A;  1TRU A;  2GSQ A;  3IK9 A;  5IMD A;  1GH2 A;  3D21 A;  1GL8 A;  5ECR B;  1PKW A;  4ZL9 A;  5AIS A;  4ZL7 A;  3HXS A;  1OKT A;  5AGY A;  1G7O A;  4N30 A;  5DAL A;  3GYK A;  2P0G A;  2OE0 A;  5IOW A;  4OFT A;  2B1K A;  4DSS A;  4KND A;  1B48 A;  1B8X A;  3QAG A;  2GQL A;  1EOG A;  5ABR A;  1R5P A;  5G5F A;  3IHQ A;  5F8B A;  2P5R A;  3D4T A;  5COH A;  1O6J A;  2AHE A;  2GVP A;  2L57 A;  2MMO A;  4IJ3 A;  5AIV A;  1T4Z A;  2FA8 A;  2CAI A;  1GSU A;  2VCV A;  2K9F A;  3ZMK A;  3S9F A;  3J7Y k;  3KEB A;  1OKD A;  4BPY A;  1EV4 A;  1ZYE A;  1O8W A;  3BCI A;  4K1F A;  3QFA C;  1X5C A;  1TW9 A;  5D96 A;  3UAP A;  2QGV A;  3IAM 2;  4ID0 A;  3OR5 A;  3Q74 A;  2F8F A;  2FWF A;  2ZUP A;  4IP6 A;  4PNF A;  3HCZ A;  2WGR A;  6GSV A;  4ZBD A;  4JRR A;  1A2M A;  2HYX A;  2H1D A;  2P31 A;  2QSI A;  1GUM A;  2HNL A;  2M46 A;  4PXO A;  5CRE A;  3LEF A;  3KGK A;  3EC3 A;  5ECN B;  4LMV A;  1M2B A;  2DKH A;  5DCH A;  4J2F A;  4BA7 A;  1ZZY A;  2C80 A;  4NV2 A;  1GSY A;  2ALB A;  3TJG A;  3HVS A;  1OAZ A;  1M9A A;  1YQ1 A;  4ZIL A;  2V2G A;  2B5X A;  5GZZ B;  4Z2U A;  1SEN A;  3GFK A;  3GTU B;  1BJX A;  1THX A;  3QDN A;  1FOH A;  3W6G A;  1THO A;  4ZL8 A;  4D73 A;  5ELA A;  3F8U A;  2CQ9 A;  3EU4 A;  2H01 A;  4KB3 A;  3FZ9 A;  2LNS A;  2PBJ A;  5HQP A;  5H5R A;  1GTB A;  2PU9 C;  3TRP A;  5ECI B;  5A4V A;  2HSM A;  2LJR A;  1OC9 A;  3KH9 A;  4F0C A;  5KEJ A;  2ES7 A;  3GKK A;  2YWM A;  5EPF A;  1SU9 A;  1Y25 A;  2K18 A;  5HFG A;  1UA5 A;  4K7O A;  2XBQ A;  4POK A;  2IFQ A;  1U6T A;  1JZD A;  3PIN A;  5FT3 A;  3GIX A;  4G10 A;  1MD4 A;  1Q4J A;  1TTZ A;  4GCI A;  4TXO A;  1I9D A;  5F06 A;  1F3A A;  1EZK A;  3M9K A;  1LJR A;  4XS6 A;  1DBY A;  1DE2 A;  4CDO A;  3HJO A;  5GSS A;  2B1L A;  5DAK B;  1F3B A;  4ZB8 A;  4L8E A;  1X9M B;  1O7U A;  2PVQ A;  1A8Y A;  2IMF A;  1R26 A;  1Z6N A;  4XRD A;  1TRS A;  1TI3 A;  2VLT A;  4IN0 A;  5HFI A;  1YZX A;  3IDV A;  1O81 A;  4MLY A;  2R3X A;  3D6I A;  1GSS A;  1XWC A;  3L9U A;  3UVT A;  2WJU A;  3RAZ A;  4O5Q A;  3ZFB A;  2FA4 A;  4OFN A;  1GTU A;  4TVE A;  2H0H A;  2LQO A;  3UBK A;  2C3T A;  10GS A;  2R0G A;  4JBB A;  5ECQ B;  5IM9 A;  1OYJ A;  1HNC A;  1K0A A;  2IL3 A;  2R5G A;  3KZQ A;  3GST A;  3KMO A;  4TN8 A;  4WBR D;  1JFU A;  1A0R P;  3QCP A;  3HYP A;  4JED A;  4ECI A;  2LRT A;  1T7P B;  4K5R A;  1LU4 A;  4FYC A;  2IIY A;  4N10 A;  4GST A;  3C7M A;  3D5J A;  3GMF A;  4ML6 A;  1EEJ A;  3GUS A;  2LST A;  3BD2 A;  1XFL A;  3UL3 A;  2YJ7 A;  1UVZ A;  2GQM A;  1WPI A;  2VUP A;  1M2D A;  4Q5R A;  4GSS A;  2AYT A;  2DJ2 A;  4XHM A;  3L0H A;  2YCD A;  3VWX A;  3R2Q A;  4RI7 A;  4XCS A;  3TDG A;  1WRY A;  2DJJ A;  1X0R A;  4MJE A;  2CV4 A;  2AAW A;  1TP9 A;  4L5O A;  4HZ4 A;  3A5I A;  2OBK A;  3VLN A;  3FYG A;  1GRX A;  3A2V A;  2RLI A;  3EPT A;  3GV1 A;  4HJM A;  2H8L A;  2EIR A;  1BAY A;  1LBK A;  2B7J A;  1SJZ A;  4ZXG A;  3UVH A;  1W4V A;  1PGT A;  2E2G A;  3ZIV A;  4KUN A;  2VL3 A;  6GSX A;  4CY6 A;  2C4J A;  2O85 A;  5G31 A;  3M0F A;  3LW9 A;  2CVB A;  3KH7 A;  4NV5 A;  4G0K A;  4EKZ A;  1SL2 B;  2F3M A;  1J0F A;  4KE3 A;  3KIJ A;  4L0U A;  4MZB A;  3M3M A;  1XWG A;  3DIE A;  3GL3 A;  4I2T A;  3UOM A;  1K3L A;  5ECL B;  4YQU A;  3HJM A;  4FO5 A;  4G0I A;  3U5R E;  1A2L A;  4K8M A;  1K0M A;  2CAQ A;  5CP1 A;  1XWB A;  1SKS B;  5GST A;  4G0L A;  2AV4 A;  1AUC A;  3IRA A;  3EMP A;  1BYE A;  1JLV A;  5DBQ A;  3F4R A;  2IMK A;  2LNT A;  4TR0 A;  1OC8 A;  3TRX A;  3VWW A;  3ERW A;  3PH9 A;  2OAD A;  2HXK A;  2GZP A;  3F0I A;  4NMU A;  3J7Y b;  3F6D A;  4GXZ A;  5IO0 A;  1PRX A;  3VWU A;  2H72 A;  5CAX A;  4BVX A;  16GS A;  2L5O A;  1PA3 A;  3VI5 A;  3MSZ A;  1GUL A;  3CRT A;  1SJI A;  1Z3E A;  3CBU A;  5CRW A;  1T4Y A;  4A5P A;  5JCG A;  1XXU A;  4KCE A;  1ST9 A;  13GS A;  2NBS A;  5J9B A;  4ECB A;  3KP9 A;  1VF2 A;  1ERU A;  1EGR A;  2I4A A;  2F51 A;  1G6W A;  5F0G A;  3GN3 A;  4MF7 A;  4RI6 A;  1GUH A;  4WR4 A;  4IHU A;  5ELG A;  2TRX A;  1T1V A;  3FHK A;  3KXO A;  2PUK C;  3I43 A;  4JR4 A;  1OVN A;  5GAN D;  3VK9 A;  4KDU A;  2FCH A;  5J4U A;  4WKW A;  3ME8 A;  2H0I A;  3FRC A;  5IMC A;  1MEK A;  3CXG A;  2B5Y A;  2VCX A;  4K2X A;  5F05 A;  4ML1 A;  4H86 A;  1U3A A;  4MZC A;  4MJA A;  5A5K A;  4G2E A;  2KOK A;  3HVX A;  1TI1 A;  4FYB A;  2HZE B;  4OWY A;  6GSW A;  2EIQ A;  3QAW A;  2PWJ A;  4ISD A;  2WUL A;  4BWS A;  2YN1 A;  5J3R A;  2IMD A;  4KCA A;  3H79 A;  1X5E A;  2I1U A;  2GT6 A;  2YNX A;  1ZGN A;  4IGJ A;  2C3N A;  3HA9 A;  1GTI A;  4RQX A;  3RPN A;  2HE3 A;  3RHB A;  3K8N A;  5AIX A;  4MJB A;  2GQK A;  2GZY A;  2L59 A;  3TOU A;  2LRC A;  2DMM A;  1NW2 A;  2RM6 A;  1X5D A;  18GS A;  4EF0 A;  2VIM A;  1WWJ A;  1YDK A;  3QD9 A;  4OD7 A;  1HNA A;  1HNB A;  2E0Q A;  5ENU A;  2LEG A;  4IW9 A;  2HRF A;  3DGQ A;  1A0F A;  1RW1 A;  5E4W A;  4V2M A;  2VL2 C;  3ZML A;  1JZO A;  1JZW A;  3VI7 A;  2C0G A;  3FR6 A;  1FB6 A;  3BBY A;  4K0N A;  1K0C A;  1PSQ A;  5D73 A;  2H1B A;  1GUK A;  1ZL9 A;  1GNW A;  1B9X C;  3CTG A;  1AC1 A;  3F4T A;  4HOJ A;  1G6Y A;  17GS A;  1K3O A;  2H75 A;  2JZS A;  2YAN A;  3KTB A;  2O87 A;  4TXO B;  2MMN A;  3EMX A;  1F2E A;  5LCZ A;  1B4P A;  4MA9 A;  5HR3 A;  1R5A A;  4WF4 A;  1GWC A;  4OFM A;  3TCO A;  1J9B A;  5JCU A;  2PPT A;  4YQV A;  3C1R A;  4PX1 A;  1M7T A;  2V41 A;  4NHW A;  1O85 A;  2HZF A;  5IMZ A;  5J5N A;  3VFI A;  4F9Z A;  2H1G A;  2UZ8 A;  2HRN A;  3G9B A;  1IYH A;  4EL1 A;  3TKP A;  1I5G A;  4TR1 B;  4X4J A;  4LL1 B;  2I81 A;  4MDC A;  1VF3 A;  2YWO A;  4MH2 A;  3GH9 A;  3AY8 A;  1XWA A;  2BMX A;  4EIP A;  4LA1 A;  2KP1 A;  4TXV A;  3A5W A;  3TKR A;  4IEL A;  4PUA A;  2D2Z A;  2RUF A;  1C72 A;  1S3A A;  3US3 A;  1GSE A;  2VOC A;  1Z9H A;  4MPG A;  2LTK A;  1RK4 A;  3IHG A;  5BRT A;  4PUF C;  4KDX A;  4Q5Q A;  2H66 A;  2VCZ A;  3FZA A;  2X8G A;  3MAK A;  5J9C A;  2FWG A;  3F6F A;  2A4V A;  4NXI A;  2LS5 A;  1S3D A;  2YJH A;  2VLV A;  4PTS A;  2GS3 A;  5FHI A;  1V2A A;  1PX6 A;  4BWQ A;  1HYU A;  2FHE A;  2XHF A;  5DQY A;  3ZVJ D;  22GS A;  5ID2 B;  2OJL A;  5KOX A;  3CSI A;  3EVI A;  5KN1 A;  1TDI A;  3TB2 A;  2CVK A;  3LYK A;  1AXD A;  4OO4 A;  3IXR A;  5INY A;  4N0Z A;  2X8C A;  4IP1 A;  3ZLP A;  2FWE A;  2HRK A;  2H6X A;  4GWR A;  2O89 A;  2F8A A;  5ECH B;  3N9J A;  3WGD A;  1GNE A;  4MF5 A;  1YEX A;  2YZH A;  3DEX A;  1AIU A;  1AQX A;  4RQR A;  4QL7 A;  1V9W A;  1NSW A;  3Q19 A;  4I6X A;  4HZ2 A;  1KBN A;  2VAF A;  2DJ0 A;  4PQI A;  2CVD A;  3UMA A;  1SK0 A;  3P8W A;  1XW9 A;  2O7K A;  4V1A g;  3W8S A;  5KN0 A;  4OCE A;  5ECO B;  3TKS E;  1V98 A;  2N5A A;  3FMW A;  1FHE A;  2MBS A;  4AJ6 A;  1FAA A;  2BJX A;  1XIY A;  3LFL A;  2DML A;  3MIX A;  4YKG A;  9GSS A;  1XW5 A;  2CT6 A;  2YWI A;  1XZO A;  2GLR A;  4ECC A;  2H71 A;  2WB9 A;  4POL A;  1RQM A;  2ON7 A;  2H70 A;  3GKX A;  4GLT A;  1TK8 B;  1OE8 A;  2OBI A;  5CRD A;  4BL7 B;  4HJ2 A;  3ZVJ A;  2V32 A;  3QR6 A;  4Z2T A;  2OE1 A;  4J56 E;  3WYW A;  3JCM L;  3DD3 A;  4JZQ A;  3GRX A;  2FNO A;  2V6O A;  3NOF A;  4JE1 A;  1UC7 A;  3M1G A;  2C0E A;  2HLS A;  4LLR A;  1A2J A;  5CO3 A;  4EDY A;  5DJM A;  1EGO A;  3PGT A;  1XWK A;  5KN3 A;  3KMN A;  4WF5 A;  2XBI A;  4XS4 B;  4ULX A;  2DJ1 A;  3E9J B;  4XTS A;  3CRU A;  1DSB A;  19GS A;  1EP7 A;  3MYD A;  2FWH A;  2MMA A;  1MTC A;  3APO A;  4DVC A;  3WGX A;  4ZBB A;  2N5B A;  4K2D A;  2JSY A;  2G0F A;  4LL4 B;  3GKN A;  4IQ1 A;  3TUE A;  2CX3 A;  2WRT A;  3GTU A;  2Z9S A;  4GF0 A;  1SYX A;  5A4W A;  2R6K A;  2HRA A;  2NPB A;  2MYG A;  2MZC A;  1AW9 A;  3G7I A;  4BVX B;  3DYR A;  3IAS 2;  3TKS C;  5CNW A;  1QUW A;  3IC4 A;  1QQ2 A;  3KM6 A;  5LD0 A;  2LRN A;  3W8J A;  3ZFL A;  4WR5 A;  3APS A;  1PMT A;  3P7X A;  2A2P A;  1G0T A;  3RBT A;  3KD0 A;  1AQV A;  1ILO A;  2R0C A;  2GZZ A;  1EOH A;  1ZMA A;  3H8Q A;  4WEY A;  2V6K A;  4TR3 A;  4HQS A;  2GSR A;  5B6M A;  1F9M A;  1SYR A;  2IJY A;  3ZL5 A;  1FVJ A;  2DJK A;  3LJR A;  4PQ1 A;  3TJF A;  2H19 A;  1M0U A;  3IC8 A;  1ZYQ B;  3ISO A;  1FO5 A;  4EE0 A;  1X9W B;  1CQH A;  1M9B A;  2DIZ A;  5B8B A;  5D9V A;  2H6Z A;  1EEM A;  4RUV A;  2GT5 A;  2VCQ A;  5KOW A;  3IE3 A;  2VO4 A;  3D22 A;  5IMV A;  2WZ9 A;  5DAK A;  3L78 A;  2CX4 A;  2R4V A;  4ZIJ A;  1PQN A;  2X8H A;  1M2A A;  4ZB6 A;  2H30 A;  2DJ3 A;  2LJK A;  2C3Q A;  2JU5 A;  1T00 A;  3Q18 A;  1K0O A;  4Z7X A;  5J41 A;  4F03 A;  1MDJ A;  4I5Q A;  1A23 A;  4AJ7 A;  2B7K A;  2VM1 A;  4GSN A;  1U3I A;  2H76 A;  1H75 A;  4Z2R A;  2J9H A;  1GSF A;  1WP0 A;  2C1Y A;  4USS A;  1XOB A;  2OE3 A;  4BVY B;  4GQF A;  4TRX A;  5IOX A;  2HI7 A;  2IWT A;  1M99 A;  2FD3 A;  3ZYW A;  4F0B A;  1TOF A;  4O92 A;  5CYY A;  3ZIT A;  1GTA A;  4HUA A;  3C73 A;  3WGE A;  2ON5 A;  4KSM A;  2VLU A;  4TOP A;  2LKU A;  1K0B A;  3KJY A;  3GL5 A;  2GSS A;  3GSS A;  2L6D A;  2N5F A;  1V58 A;  4OMV A;  3TJK A;  2C8U A;  4XS1 A;  1TU8 A;  5DJL A;  3M8N A;  5DAL B;  1DE1 A;  3KCM A;  2VCT A;  4TKY A;  3D0Z A;  4MZW A;  4DSS B;  4DEJ A;  1VGL A;  3R3E A;  2A2R A;  2ZNM A;  3E0U A;  1OE7 A;  3IK7 A;  3Q6O A;  4IQA A;  7GSS A;  2H74 A;  2NVL A;  4FQU A;  3HVV A;  5JWO B;  5FWG A;  3TJJ A;  4NHZ A;  5G1L A;  3RPP A;  3HHV A;  3PPU A;  4KAE A;  2XPD A;  1ERV A;  2FY6 A;  4GRF A;  1T8E B;  4K5S A;  4XRA A;  3GX8 A;  3EUR A;  1FVK A;  2RII A;  4POB A;  1YKA A;  2GDR A;  3FR3 A;  1YY7 A;  2WFC A;  3BOA A;  2JZR A;  2KHP A;  2LUS A;  4MNN A;  1BQ7 A;  4FH8 A;  4OO5 A;  1K0D A;  4HS1 A;  2CZ3 A;  5ECS A;  4WBJ A;  3IBH A;  1TXX A;  3VWV A;  2I9H A;  1J08 A;  1F6M C;  4I2U A;  3VPQ A;  1SD9 A;  2J23 A;  2C0D A;  1GSQ A;  3MDK A;  5IQY A;  1AAZ A;  3H93 A;  1GLQ A;  2H73 A;  3LYP A;  1PKZ A;  2JAC A;  1ML6 A;  2GTU A;  3E3E A;  4G9H A;  4I97 A;  4MCU A;  3O3T A;  5H5Q A;  4D73 B;  2IME A;  1SL1 B;  2PN8 A;  2F9S A;  5BMU A;  3DML A;  2DBC A;  4TW5 A;  5IPH A;  3U6V A;  1SK1 A;  3G7Y A;  1B9Y C;  1OC9 B;  1XCC A;  5JWR B;  3TOT A;  3IV4 A;  1O73 A;  4ACS A;  1FOV A;  2LV3 A;  14GS A;  2X99 A;  2DC5 A;  2IFQ B;  1SK2 A;  1F37 A;  1EV9 A;  5EVO A;  1ABA A;  3FKF A;  4EXJ A;  1USB A;  4WET A;  8GSS A;  3L9S A;  1PN0 A;  4KF9 A;  2E7P A;  4HQZ A;  4NPB A;  5DQS A;  3IOS A;  4TR4 A;  4IBP A;  4X43 A;  2H1A A;  3O6T A;  1JLW A;  3TRQ A;  5HR0 A;  4F2I A;  3I6A A;  4ECJ A;  4AJ8 A;  2OKA A;  3HJP A;  4O32 A;  4DSR A;  2TIR A;  3DVW A;  5EL8 A;  3UBL A;  3WD6 A;  3DWV A;  2HSY A;  3C71 A;  4NWY A;  1E2Y A;  1KEB A;  4YAP A;  3IA1 A;  3KTL A;  2QA1 A;  3QFB C;  3ZRD A;  2KLX A;  4FIW A;  3GH6 A;  1HD2 A;  3DKS A;  1V40 A;  2B6M A;  2HZE A;  2RM5 A;  4V2L A;  4PNG A;  2YWN A;  2MBT A;  4JU5 A;  3UJ1 A;  1URM A;  3EYT A;  1KTE A;  4EDZ A;  3FZ4 A;  3MWH A;  2VL2 A;  3EIN A;  5G2Z A;  3TKQ A;  1QGV A;  2JSZ A;  3CSH A;  3LQ7 A;  3TJB A;  3LOR A;  3DRN A;  1YKC A;  2K8S A;  5CRH A;  1TK5 B;  1SL0 B;  3H1N A;  2X4A A;  4K6X A;  5HFK A;  4Q5F A;  1R4W A;  2DLX A;  1K3Y A;  3APQ A;  4MAB A;  3C8E A;  11GS A;  2RUE A;  3CTF A;  6GST A;  4KGI A;  4PUR A;  2EC4 A;  4MJC A;  2K6V A;  4IJI A;  3WT2 A;  3ME7 A;  4IS0 A;  1Z5Y E;  5B8A A;  1OC3 A;  1XVQ A;  2HT9 A;  2DKI A;  3HY2 A;  4K7I A;  3A2X A;  6GSS A;  5GAP D;  1EP8 A;  2BTO T;  1WMJ A;  4KX4 A;  6GSY A;  3HD5 A;  5IPG A;  2NDO A;  5ECK B;  1ERT A;  4K7N A;  1X9S B;  1O8X A;  1W89 A;  3FY7 A;  1BG5 A;  4O7H A;  2E2M A;  1TU7 A;  1PX7 A;  3ED3 A;  3RDW A;  3GNJ A;  4EC0 A;  2FGX A;  3DVX A;  3F63 A;  1A8L A;  2L4Q A;  2QKE A;  5F07 A;  1U87 A;  2H6Y A;  2EIO A;  1Q98 A;  3LG6 A;  1E6B A;  20GS A;  3IR4 A;  1XVW A;  1Y6E A;  3VPT A;  1YJ6 A;  1XW6 A;  4Q5N A;  4CHS A;  1A24 A;  3N5O A;  3QAV A;  2IPA A;  3GA4 A;  3FW2 A;  1ZYP A;  4CW9 A;  3CMI A;  4E8H A;  2L5L A;  2YV9 A;  4N11 A;  4EO3 A;  4HU7 A;  5IIZ A;  5JCW A;  3HZ8 A;  2A2S A;  4CY8 A;  3VUR A;  2XPE A;  2L6C A;  2JZT A;  4K9Z A;  3KP8 A;  1GSD A;  5EY6 A;  4O5R A;  5ECM B;  4EIQ A;  2PMT A;  3EE2 A;  2DSA A;  1VF4 A;  2KP2 A;  4TR1 A;  1NHY A;  3PR8 A;  2VL9 A;  1YEP A;  3LXZ A;  3I9V 2;  1MD3 A;  1WIK A;  5L71 A;  1FB0 A;  3DXB A;  3LGC A;  4MK3 A;  3BJ5 A;  2R37 A;  4POM A;  2M80 A;  4E8E A;  2H0G A;  4HEA 2;  5HR2 A;  3D4M A;  4L0W A;  4X1U A;  1GP1 A;  5E59 A;  5CRG A;  4XIH A;  4FYU A;  4KH7 A;  3HKR A;  1Z6M A;  3F3R A;  5LNK e;  3HZ4 A;  2AJQ B;  2M72 A;  2O8V B;  2YV7 A;  3ZIJ A;  4DSQ A;  4MP4 A;  2A4H A;  1KNG A;  3QOU A;  2YPM A;  5ID2 A;  1GLP A;  1HQO A;  1YF0 A;  2PVO C;  1PL1 A;  1BED A;  3UEM A;  4AF2 A;  4PGT A;  3G7J A;  1VRS D;  12GS A;  2OAC A;  2IN3 A;  1Z7R A;  2VD0 A;  1UN2 A;  5KN2 A;  3SWL A;  2XC2 A;  4F82 A;  3L9V A;  1SKW B;  1TJD A;  2FUG 2;  3RHC A;  1PD2 1;  4GQC A;  1TK0 B;  1XPV A;  4HDE A;  3ZTL A;  5D9T A;  2CA8 A;  5D9X A;  1T3B A;  1N8J A;  1BX9 A;  4X0X A;  4YKF A;  3QMX A;  3MNG A;  3GUR A;  4G19 A;  5AN1 A;  1QK8 A;  2HSH A;  3C1S A;  2C0F A;  2R2J A;  3FEU A;  4KA0 A;  1WE0 A;  2P5Q A;  1JHB A;  3I69 A;  2WS2 A;  1EWX A;  4MF6 A;  3LXT A;  3ZRE A;  3O76 A;  4MPF A;  1QFN A;  3GHA A;  5C04 A;  3F9U A;  4BL7 A;  5DVB A;  3GX0 A;  4ZBA A;  4N0V A;  3M9J A;  5B7C A;  2TRC P;  4ILF A;  5IO2 A;  3F4S A;  4IKH A;  1CQG A;  2GST A;  4I8B A;  3TKS A;  3HDC A;  3A3T A;  3BCK A;  3NZN A;  5A4U A;  3EU3 A;  1MDK A;  4NAX A;  1FW1 A;  4KW6 A;  2V1M A;  1SKR B;  3GKM A;  4XS4 A;  1WJK A;  5IMF A;  1XOA A;  2JL4 A;  5G30 A;  2YOI A;  2MMZ A;  3ERG A;  1DUG A;  1SD8 A;  2X49 A;  4L5L A;  1S3C A;  1PN9 A;  2QA2 A;  1WOU A;  4YH2 A;  1V57 A;  2I3Y A;  5G1K A;  3FZ5 A;  4K0G A;  1ZCP A;  2VD1 A;  3FK8 A;  1ACV A;  2B3S A;  2PER A;  2R0P A;  5D93 A;  4OCF A;  1FG4 A;  1NM3 A;  3LWA A;  4O5U A;  2IMI A;  3V1W A;  3LSZ A;  4V2N A;  2CZ2 A;  3WT1 A;  4WXT A;  2QC7 A;  2AUV A;  2FLS A;  1R7H A;  4QL9 A;  1ZYN A;  2HFD A;  2OA7 A;  2X64 A;  1XBS A;  2DIY A;  3NIV A;  4MMM A;  5C00 A;  2G2Q A;  1VF1 A;  2VM2 A;  2NTO A;  3UAR A;  4P3Y B;  5IMA A;  1SJ6 A;  3FR9 A;  2KUC A;  2VCW A;  4V1A p;  4YQM A;  1NHO A;  1G7E A;  4KDY A;  5DDL A;  2K8V A;  3SBC A;  5D8I A;  4JR6 A;  2LQQ A;  5DCG A;  1ERW A;  5D9W A;  1Z7P A;  1ZOF A;  3EWL A;  2JAD A;  4HI7 A;  5HR1 A;  5H5S A;  2PGT A;  1ON4 A;  1U88 A;  3H4K A;  3CSJ A;  1TKD B;  1QMV A;  4GTU A;  5B6N A;  2REM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...