1ZMUA

Catalytic and ubiqutin-associated domains of mark2/par-1: wild type
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
313
structure length
293
Chain Sequence
b'GNYRLLKTIGKGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 92
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmuA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmuA01
4GIHA 1UVRA 2ITZA 5I9ZA 3PSBA 1ZV1A 3P86A 4OTPA 5E1EA 4BGGA 3L8XA 4BICA 4JAIA 4ZJIA 2RFNA 5DT0A 3LM5A 3LPBA 2C4GA 2XP2A 3OUKA 1UU8A 2EJSA 1YI3A 2VTMA 4FG8A 5DFPA 3IPHA 4E93A 2YCQA 4EJ7A 3UIXA 2YABA 5CEMA 4ZTHA 1WBPA 2VNWA 2BAKA 4I1ZA 4O0XA 3VO3A 4X3JA 5J87A 2LVNC 1J1CA 3PIZA 2CCIA 3VQHA 1YDRE 3C4FA 3PTGA 4LG4A 4FIEA 4I0TA 4F9WA 2DAEA 2O8YA 4G3DA 1E1VA 1ZYLA 2ZV2A 2BKKA 2PVJA 2W99B 5IQEA 1G41A 5M44A 3IW5A 2YFXA 3I5NA 4ERWA 1ZMVA 3FQEA 3D5WA 4FIHA 5BYYA 5F1ZA 4O7SA 4II5A 3VQUA 2JEDA 3R30A 4I0RA 4DFUA 3EQPA 5DH3A 4X7QA 4X3FB 2Z7QA 4FV8A 4YURA 5F9EA 3H10A 2JKQA 3QXOA 4NM5A 4YC3A 4ZSLA 2WMBA 2UZWE 4IX6A 3UIUA 5IQDA 1OECA 1FVVA 2R3RA 3F9NA 3KMWA 4BIDA 4MF1A 4DC2A 1UNGA 4J99A 2BKZA 4S34A 5CVGA 3QRIA 4P5QA 2C5NA 3ZLXA 5L3AA 3C0IA 3KFAA 3AC4A 2X6EA 4AFJA 3CP9A 3G9LX 3L9NA 2VTRA 1PMEA 1PXJA 5D11A 3CBLA 4FKOA 2Y4IC 4QQ5A 3PWDA 4IFCA 3QTWA 2VTHA 2XIKA 3FI3A 3UTOA 2GS6A 2BRGA 4IWDA 2ZV8A 4NM0A 2QHNA 3WE8A 1WJ7A 2A0CX 4AP7A 4UMUA 4F09A 5C8MA 3ITZA 1Z5MA 3VUTA 4G2FA 3I7BA 1U59A 2A19B 4R3PA 5JFXA 1WR1B 3G0FA 4CCUA 4FKIA 4D9TA 4D2RA 4ZTSA 4CRSA 1UWHA 4BI2A 1R1WA 4Z7GA 4UV0A 5KMOA 2PULA 4GFMA 4NK9A 5IUGA 4FT3A 4S31A 2WMAA 4DAWA 5BYZA 3W8LA 1QPJA 2OOAA 4C61A 4DFZE 1JOWB 3OY3A 4CKJA 3FV8A 3ANQA 2FSLX 5EM8A 4RMZA 4HW7A 3UOJA 2OJIA 3KF7A 1WVWA 2W96B 1XH4A 3QYWA 3ZU7A 4I5PA 2QU5A 1SNXA 4C3PA 2OICA 2R7IA 4QMYA 5IA0A 1DAYA 4DE4A 1VZOA 5CZHA 5AUUA 4DTBA 4W4WA 5AR2A 4MTAA 5B0XA 4I5MA 3F5UA 2WTKB 3EIDA 3UOLA 3W2SA 1ATPE 2WELA 4G5JA 1UFZA 4QNYA 4ANOA 4EC8A 2OSCA 2GQSA 3WZUA 2CHLA 4A9RA 2QO7A 4O6EA 5F94A 4FICA 3B2TA 3DT1A 5AUWA 4G6LA 4E26A 2C6OA 4MD9E 5HTIA 4ZSGA 5AR3A 3FE3A 4EK8A 4C58A 4XMOA 4O96A 1H07A 2X7GA 2ESMA 3R6XA 1XH5A 4Y5QA 1X8BA 4KSQA 4D9UA 2W1CA 5KNJA 3S1HA 4XV1A 4AW0A 4MHAA 3R2BA 2PU8A 3Q32A 4NH1A 5FD2A 4GU6A 2C3JA 5TKDA 4EHZA 3UIBA 3MB6A 4FSZA 5CT0A 4TNBA 3D4QA 3DKGA 4FZ6A 5HD7A 3WIGA 4O21A 2R3JA 1IXSA 1PXPA 3BELA 2C3IB 4OBPA 3QU0A 4D2WA 4DBXA 2QKWB 2XA4A 4USEA 4RJ3A 4IWQA 2XK9A 3LAUA 4IX3A 5AP7A 3OFMA 3DV3A 1KE8A 3ORZA 3K9PA 3PWYA 3RZBA 4YJVA 4C2WA 2E9OA 2C3KA 3IGOA 1JVPP 3NLBA 2B9FA 4MXOA 4V04A 4X6RA 4Z7HA 2DZLA 4G3CA 1Q4LA 4L7FA 2A27A 2CLXA 4G6NA 3LFCA 4ZOGA 1Z9XA 5BVWA 4I6QA 1KOAA 3CD8A 4WKQA 4BBEA 5LXMA 3QQKA 1G8SA 4BWXA 1U54B 3UC4A 3DZQA 3GB2A 4EKKA 4EWHA 4PUZA 4GRBA 4ANQA 4JQ8A 4YO4A 5AX3A 3LJ0A 4CT2A 5HNGA 4KA3A 1DAWA 1M2RA 5HG7A 3LFAA 3LZBA 3C4EA 2B53A 2BFXA 3I4BA 3IONA 4MX9A 3GU5A 1H0WA 2C6IA 4W8DA 4GK4A 4BDIA 3FKOA 1SNUA 2W1GA 3D7TB 4QMMA 5JGDA 3H30A 3HMOA 5I4NA 3UZRA 4KIPA 2QOLA 2PZ5A 3DB6A 2YN8A 3DK3A 4O2ZA 2IZTA 4JG6A 3H0ZA 3TCPA 4EONA 5CSXA 5J1WA 2UVXA 3GU4A 4HNFA 4NTSA 4OUCA 2I0HA 2PMNX 4BDFA 1WVXA 4QTBA 4RC4A 4ACGA 5J79A 2IPXA 4DG2E 3HV5A 1Q8ZA 5FG8A 5L2QA 3WILA 5HO7A 1J7LA 5A4EA 4NSTA 3CY3A 3FMJA 4FNZA 1OPLA 3BI6A 2CCHA 3HMIA 3VUDA 2BROA 2H5XA 4MBLA 3IGGA 5FP6A 3EN7A 3OS3A 4H3BA 4L46A 3ACJA 3V3VA 4JR7A 3FYJX 3RBWA 2V22A 2O25A 1BKXA 3R00A 3TV6A 1KV2A 1OITA 3H9OA 5CF4A 3LFQA 4M8TA 5CF5A 5EH0A 5EKOA 2I1MA 3I0OA 4HYSA 5KCVA 5A46A 4ANNA 3BIZA 4AW1A 4FKSA 3PXZA 1CMKE 3SXFA 4YBJA 3LJ2A 3JVRA 3H4JA 4EK6A 4HCUA 4XS2A 3BYMA 3R7EA 2LVPC 3ORMA 3NDMA 3IOKA 4KINA 3W8QA 3ZEPA 3V5JA 1W0XC 3MH1A 4BCJA 4ALWA 3P7BA 3TDWA 4HVIA 1P4OA 2OZAB 2R3OA 5E8WA 4UB7A 2EKFA 5HX6A 2YCFA 2P55A 2YERA 3KRLA 2KULA 5BVKA 5C27A 5KMLA 5HE3A 1Q02A 2RKUA 4D2PA 4OT5A 3SX9A 4BWKA 1REJA 4XX9A 4EKLA 1XR1A 2FYSA 4LGGA 3G9NA 2ETMA 4ERKA 5HVKA 5KMIA 2JKOA 4BY9E 3H0YA 4LV8A 4UBAA 4UEUA 3WBLA 4QT1A 3AC2A 1H27A 1KYIA 1VQ1A 4DTKA 4BYIA 5J9LA 2BTRA 4HGLA 1QL6A 5EHLA 3ORTA 3COMA 3WZKA 4FT0A 4YU2A 2BAQA 3RM7A 2OFVA 2W0JA 2J6MA 2E2BA 2IW8A 4G3OA 4H1MA 5EOLA 2ZM3A 3R7UA 2JAVA 2GTNA 4I94A 4M15A 2YM4A 4Q5HA 1H1SA 4FYOA 5HHWA 3EQCA 3OCSA 2GMXA 3TTIA 5KE0A 1OVEA 3BLRA 2X9EA 1ZAOA 2PWLA 3C4WA 3GT8A 3PXKA 5DT3A 3RI1A 2QG7A 2G01A 2Z60A 4UALA 5J95A 4D4RA 2WB8A 2B7AA 2YIXA 3UZTA 3D94A 3AG9A 3EHAA 3LLTA 3E7OA 2EXMA 4TZRA 5HX8A 5K3YA 4AE6A 1MRVA 4JS8A 1OQYA 2RL5A 2O0UA 4RGJA 5CI6A 4IX4A 4C8BA 1BL7A 5HBEA 4JOAA 4F9CA 1T43A 2IW9A 2R4BA 2GS2A 5I3RA 4RJ4A 1XXHE 3VUHA 3G2FA 2LTUA 4M68A 5LWMA 4OR5A 3DKCA 1PRYA 4XG2A 2C6KA 4O6LA 5CSPA 3I81A 5J5SA 5E7RA 2BTSA 4J97A 3KQ7A 4IB5A 4IZ7A 3OT8A 2B9IA 3UPXA 2OF2A 2XYUA 5DR9A 4F65A 3QTRA 5IQFA 2RF9A 3ZSGA 1NXKA 2QVSE 3UNKA 3ZBFA 4I4EA 4DFBA 3II5A 3AGLA 4IQ6A 4WOVA 2R3NA 5AV0A 3EYGA 3ZCLA 1Q3WA 3FZ1A 4X2GA 5J8IA 1YXSA 4EOSA 2RG6A 1MRUA 2FH9A 2R3LA 4YJNA 5M53A 1PGYA 2X7OA 5KMKA 4E8AA 2UW4A 1RJBA 2VWBA 1UU7A 3R22A 3ZDUA 4IVBA 1YOJA 1JSTA 3TNWA 3CD3A 1M52A 1GZ8A 4JBQA 5CU2A 4BTMA 2BILB 4R8QA 3MW1A 3R8VA 3PJ8A 3CS9A 3U4UA 1SYKA 1R0EA 3DCVA 5A4QA 2XIYA 1H0VA 4AAAA 2DAKA 1RW8A 2JD5A 2B3TA 3E7VA 3KXGA 4P4CA 1QMZA 4X3FC 5CXHA 3K5VA 3C50A 3O71A 3TACA 4AG8A 4FODA 4GS6A 3L1SA 4XUFA 2KNZA 4HPTE 4UMPA 2XK6A 2YZAA 5EYMA 5A4TA 1M14A 2ZYBA 2HIWA 2W4JA 4FI1A 4CQEA 1GY3A 2L4EA 1ZOHA 3U54A 3KCFA 5BUIA 3TNIA 3WE4A 2XB7A 3MY1A 4M12A 4EH2A 2PMOX 1IAHA 3A62A 2ITQA 4BN1A 3AD5A 3R73A 3N9XA 2JFLA 2FB8A 3ZUUA 3UE4A 1DM2A 4L52A 5K5XA 3MSSA 4Q9SA 3BYSA 4CT1A 3PVUA 5EYKA 4FX3A 5KZ0A 4FF8A 4YLLA 2BDWA 3ZH8A 1Y8YA 3DDQA 5D7AA 3RGFA 3Q2JA 3KULA 4L42A 4BTJA 4F7NA 4F08A 2JZ0A 3QRJA 4I6BA 2YCRA 3PRIA 2HXLA 4FV3A 4R7IA 3F66A 3IDCA 4EUTA 4FL2A 1C7YA 3W16A 4NIFA 5M4FA 2PL0A 4LMNA 5HU3A 2VTNA 3DAJA 4EOIA 2WMTA 1WGLA 4J8MA 4CFUA 4NU1A 4W4VA 5GZAA 1GO5A 4KD1A 3VS6A 4NT4A 1DV0A 4YJPA 2K0BX 5KUPA 2QOKA 2XKEA 3Q9WA 4M69A 4XBUA 5HU9A 4QD6A 2MROB 1OL7A 4YHTA 2OIDA 4I6HA 4FG9A 2ITPA 5E91A 5FGKA 4C4FA 5BVFA 4XYFA 3FBVA 4AXAA 3CEKA 4NWMA 4GL9A 4FT9A 3VVHA 3O8PA 3VS5A 3VUKA 3NIEA 1KWPA 4RBLA 2WTKC 3CQEA 4RIWB 4CRLA 4D28A 3RMFA 4DLJA 4TL0A 5JT2A 1Y6AA 1KOBA 1ZOGA 3VUIA 3HVCA 5FEDA 3I5ZA 2IZRA 4TYHB 2G2IA 3WZEA 1XQZA 5AR5A 4AX8A 3FXZA 3NUAA 2VTTA 3BPRA 3R1NA 3KXZA 2WOTA 4GCJA 2QCSA 1YDSE 2V5QA 4RA4A 1WZYA 4TWCA 1J1BA 4HZSA 1OMWA 5LJJA 5IQBA 3SOCA 4RRVA 5EYDA 2P0CA 3D2IA 3PYYA 1LPUA 1U5QA 3KXXA 4NFMA 3Q04A 3KN6A 4W4YA 1IM2A 2C6TA 3BLHA 3QF9A 1T6OA 1SVHA 3KU2A 4KKEA 3UO5A 5M4IA 5CQUA 4ZZNA 3LCKA 3RJCA 3Q2MA 4JIAA 4EJNA 3E63A 3UP7A 4WSQA 4UWBA 3UP2A 4AN9A 2VO0A 2DKLA 1P3QQ 2PMIA 2UZBA 3FMHA 4OTGA 4PL4A 5EW9A 5LWNA 1ZYSA 3HEGA 3P1AA 3ZLSA 4FZ7A 4D2VA 3ROYA 2KHHA 3KN5A 4QMUA 1Q97A 4RZVA 4JL9A 3AC1A 2DUVA 5FEEA 3V8SA 5IDNA 3FRHA 2XVDA 2J0MB 5IZFA 3V5TA 3HUBA 5E8TA 2PVYA 4ANLA 3RZFA 2WO6A 5HD4A 4H39A 4R3RA 3QTSA 5TR6A 2Z2WA 4EH6A 2UW9A 5H2UA 4XV2A 1FBNA 4PP7A 4ASZA 3ORPA 2QQ7A 5I9XA 3H3CA 3PJ2A 2ERKA 5FTOA 2XIXA 1V92A 5M56A 4EH5A 2BZJA 5HVJA 4N57A 2RSVA 1ZMWA 2G2FA 4QQJA 3MH0A 4S33A 2EUFB 2L4FA 5CENA 3TUCA 3U6HA 4FUYA 4E5AX 3PRFA 4KKGA 3TJCA 1YWNA 1SMHA 4EOPA 3SAYA 2C30A 3GP0A 5LCKA 4FSUA 2XEYA 3NCZA 4O1PA 3G90X 3R28A 4CTBA 1T45A 5ACKA 5FM3A 3UMXA 5ANOA 2UW5A 3GCQA 5ACBC 3LKMA 3IHPA 4WNOA 2CGVA 1IG1A 2JY6B 4TWNA 3GLHE 3AC8A 1OIQA 5CU4A 4HYHA 2C6MA 4X2KA 3DFCB 5AP3A 2LAVA 5HTCA 3O2MA 1OIUA 2J0JA 3OWPA 5FBOA 1JKSA 1FPUA 3I60A 3KRJA 2HWOA 5E8YA 3VS2A 2QHMA 3L9PA 2NRUA 1GZNA 4UYAA 4KBKA 4AOJA 3MFRA 3ULZA 4XG6A 3NMUF 4F7LA 3N4VA 3TTJA 4FTIA 3D5XA 3TKIA 3OW4A 4AT5A 2RGPA 5E8ZA 3ZO3A 4D58A 4NCTC 1DI8A 4MVFA 4IM0A 2Z02A 2FSOX 3QXPA 2I7QA 3PDTA 1H1RA 3RPRA 3HUCA 3PA3A 4X2FA 2YDJA 2B52A 3E8EA 3LCTA 4P2KA 1ZRZA 1RE8A 3GCVA 2EU9A 4IAFA 4L68A 2QR7A 2R3IA 5T3QA 5HZNA 5AAEA 4TWPA 3ZFMA 4U43A 4ZSAA 2IW6A 4BZDA 2PE1A 5BVDA 5HBJA 1L3RE 3AC3A 3EN5A 4GK2A 4K1BA 2W4KA 1APME 3C9WA 2OXDA 3CPCA 3GXLA 2E9PA 4IB1A 4G3EA 4AZEA 1F0QA 3QA0A 4W9WA 4GUEA 2X81A 1MUOA 5IMXA 4BCIA 4G9CA 5CAQA 1FMOE 3W2QA 4F0GA 3QWJA 4F1TA 2WTJA 2WQEA 4QMXA 3TM0A 3O96A 5FUTA 2Y8OA 3LM0A 2C47A 2XJ1A 4LYNA 2YIRA 1PKDA 2LVQD 3ZFYA 4GFOA 3N4UA 2WEVA 4OTFA 3IW7A 5AUVA 4K6ZA 3NUXA 3MWUA 3FQHA 5BMMA 3T8OA 4W4XA 4QYFA 3M42A 3SRVB 5IQGA 3PPKA 4MBIA 1M7QA 3GC9A 4IEBA 3UO4A 1PY5A 2GU8A 4QMVA 4QMNA 4RWIA 3NVKI 4GG7A 1JBPE 5GJFA 2XEZA 5A6OA 1ERKA 3GU8A 1G8AA 4GSBA 3QCSA 4J71A 4C4JA 3FMLA 4CFMA 4R5SA 2OJJA 3LFFA 4CZUA 5FXRA 4J7BA 4IB3A 5LMBA 4JI9A 4C34A 4Y95A 5FM2A 2RIOA 3G6GA 4QP9A 3TN8A 4F70A 2PPQA 2XZSA 4JRVA 3DXPA 3EFLA 3LVPA 4I24A 4OBQA 2B1PA 5EI2A 2X7FA 2EB2A 4PDSA 3LMGA 3ZM9A 1JSUA 3GC7A 3TI1A 3TV7A 4YSJA 2JAMA 1H08A 4AOTA 3P4KA 3BU3A 4A9YA 4EQUA 1KV1A 3ZHPC 1TQPA 2PVKA 3HYHA 4RZWA 3GFEA 4Z9LA 4APPA 2C0IA 3R1YA 5IG1A 2Y6MA 1JAMA 2CNQA 3UNZA 4EOOA 5LVNA 1P2AA 3EH9A 3COKA 1XBAA 2BWEA 2UZDA 1YXVA 4EUUA 5H8EA 3FRIA 3C4CA 2R3HA 3KY2A 4PL3A 4B7TA 1WAKA 5EFQA 4LUDA 3HGKA 4V0GA 5L8JA 3RWPA 2X1NA 1RQQA 3DLSA 3D5VA 3Q6WA 1F3MC 4Y5HA 5DBXA 4BTKA 2C6LA 3LQ8A 3PJ1A 3R0TA 3TZ8A 5HNBA 1GZOA 4DH8A 5AP6A 4BRXA 4K33A 3PSCA 3CPBA 5GZ8A 4MD7E 5AV1A 4EK3A 3VS7A 1OL1A 5K9IA 3M11A 4L7SA 1PYXA 3I7CA 3LXLA 3GNIB 2I40A 4AZVA 5IISA 5CVHA 3HAMA 3AXWA 4OAVB 5AP5A 1LP4A 5DRDA 5IEYA 4BBMA 4IVAA 3EQFA 3V5WA 1NV8A 3ACKA 3C4ZA 3QD0A 3TZMA 4E73A 2CKQA 3KREA 4DEIA 5TT7A 3MTFA 3POZA 5L6WL 4Z55A 3R02A 4HVSA 5AADA 4FIJA 3FKLA 2PZRA 3FHIA 3JXWA 4JBOA 3EN9A 1JKLA 3NSZA 4FKTA 4MXXA 2HK5A 4F6WA 5IEVA 3ODZX 5CANA 2ITVA 4GUBA 4RX9A 3Q5ZA 4GIIA 4MH7A 5A4LA 4YLKA 3DY7A 4BI1A 4RVTA 2EKKA 3CLYA 5ETIA 3PXRA 4QTCA 5ICPA 5EHYA 5ITAA 3TIZA 4XP0A 2PK9A 1R78A 1O6LA 4CMUA 4D2TA 5H8GA 5B2MA 2W9ZB 3NYXA 3KGAA 2HELA 4NEUA 5HO8A 2VX0A 4BKZA 5LMKA 1PXMA 2A1AB 4YHFA 2XNOA 2QI8A 3MIAA 3HMMA 4O86A 3SC1A 4JDKA 5JK3A 3R7GA 2JDRA 3R8MA 5JN2A 5M08A 4ALVA 3UOHA 1UV5A 3LCDA 3QBNA 3CJFA 1YHWA 1ZOEA 1Q61A 3MV5A 2AUHA 3JUHA 1OGUA 1WGNA 4ACMA 3BZ3A 5L4QA 3POOA 5I9WA 3KF4A 2UUEA 4U79A 2XK4A 2BRMA 3F3UA 4F9BA 4ANSA 4DGLC 3VF8A 4JAJA 2IG7A 2GDOA 5TOZA 1OL2A 2ZAZA 3CE3A 3K9OA 2QOFA 4FTUA 4PMSA 4KIKA 4YJOA 1H00A 4JDIA 5D7VA 5ETAA 4ZLYA 4EORA 4YTFA 3LFEA 4GYGA 4LUEA 2C6EA 3DBCA 4FEUA 1H8FA 2KTYA 4PPCA 1DO2A 3R63A 1S9JA 4ZZOA 3BU5A 4FC0A 4E4MA 4YMJA 2PSQA 3B2WA 2ZTCA 3FZOA 2ZMCA 3IW8A 3AT4A 3VW8A 2WPAA 1U5RA 2GNJA 3QC4A 4QP6A 5DN3A 4PDOA 3AMAA 2X8DA 1W8CA 5AMNA 4CG9A 2OU7A 5EM6A 4XLIA 4E4XA 5CEOA 3DBDA 2JKMA 3RPSA 5IQAA 4ZXTA 3DKOA 1VDLA 2CN8A 2F57A 4U6RA 5IH4A 4DN5A 3CSVA 3F3ZA 4IM2A 4A07A 4N0SA 2MR9A 4DH3A 2GHLA 2REIA 4F1OA 5A6NA 3PXFA 4CEGA 2PYWA 4IZYA 3FUPA 4EZ5A 3HDMA 2WAJA 1HCKA 3LCSA 1IASA 2ZM4A 4U45A 2YAAA 4DGOA 1Q8TA 2VWXA 3DKFA 2C1AA 2AC5A 1SZMA 4FKJA 1FQ1B 5TO8A 3N4TA 4KBAA 4BDKA 4C57A 3HP5A 3SW7A 3NYOA 2XKCA 4X0MA 4RVMA 5BUJA 3UQGA 5HLPA 1Q8YA 4FZFB 4O22A 4B8LA 2YACA 4TYEA 3HNGA 5EDQA 5BMSA 5HE2A 5E90A 3LJ1A 1O9UA 2CSNA 3C13A 4EYJA 4KS8A 4OW8A 5IQCA 2BCJA 3R2YA 1K3AA 3KA0A 4FTNA 4A9UA 4XH6A 2WHBA 2LGCA 3MY0A 3NYVA 4OGRA 3D83A 4C36A 3NR9A 2WTVA 4FVPA 4FYNA 1VEKA 2JDOA 3QX4A 5AUYA 1ZY5A 3ZRMA 3BBTB 4R77A 1VG5A 4WNMA 1ZMUA 2BRHA 3PZHA 3OG7A 3W2OA 3EQHA 5GINE 4MBJA 4WT6A 4FZDB 4DG3E 3CQWA 1ZARA 3UMWA 3PG3A 2W1HA 3ZZEA 2ITOA 4BI0A 3BHVA 3BGPA 4DBNA 1K9AA 2G1TA 3AD4A 5CSVA 4ZK5A 1LEZA 3ZEWA 4ZJVA 5K0XA 2QONA 2QNJA 4JLCA 2QLUA 4M13A 1PMUA 3QKLA 2R5TA 5AEPA 5JGBA 4BC6A 4EH8A 5A14A 4EHEA 3UVRA 2YEXA 4KWPA 5KBRA 4HNIA 3ZLWA 3BYVA 2JDSA 2W17A 4I41A 4DITA 4FTJA 4CTCA 4J95A 2XUUA 3I79A 4U97A 5EKNA 2JY5A 3ZLYA 4Y85A 4FV1A 2GCDA 5CI7A 3CGFA 3FC1X 2GNGA 5FQDC 3UG1A 3HV4A 1PF8A 2IN6A 2DWBA 2XM9A 4F63A 5CF8A 3FSFA 4WP2A 5EOBA 2WU7A 4X21A 3Q60A 3FQSA 4M14A 1OM1A 2F49A 3ZONA 2W06A 3HKOA 5IU2A 2W5HA 5EDRA 3WIKA 1OUYA 4OTIA 4QP8A 3VS1A 4IXPA 4YTHA 4BTFA 2G15A 4WG4A 3MVHA 2VTQA 4QMTA 1QZEA 2AC3A 3JYAA 1OL6A 3PA4A 4FOBA 4GV1A 4OT6A 4RX8A 2C69A 4PY1A 3WF9A 4FIIA 2XYNA 2HY81 3BQCA 5LOHA 4YZDA 5IH6A 1CKJA 3PXYA 3SXSA 3ZYAA 3E87A 3GI3A 4AS0A 4ZTRA 4IAKA 3R71A 3F7WA 4ZS0A 4FSMA 4E1ZA 3QLFA 3ZO2A 5LMAA 3QZFA 1GZKA 5H9BA 4YSMA 1WBVA 3VULA 1JLUE 2DYLA 3F5XA 3EQBA 3FLZA 2VWVA 5B7VA 2OBJA 2R3KA 4FV9A 3BWJA 5E8SA 1KE6A 3GLFE 4GVJA 4AQCA 2Y4PA 4EOLA 4HVHA 3NNUA 1TKIA 2PZIA 2V7OA 1WCCA 2BUJA 4EOKA 3OHTA 5HIEA 4ENYA 3FPQA 4QQTA 1VEGA 2QODA 4IIRA 1O6KA 4JDHA 5DEYA 2Q0NA 4A4OA 5A9UA 2GPHA 1ZYCA 1OAIA 4GK3A 5AV2A 3EN6A 5DEWA 4KAOA 2YDKA 2XNBA 3SLSA 4L53A 2ACXA 4IAIA 3PIYA 4O7YA 4IH8A 4L00A 4EOQA 4I21A 2R2PA 4WIHA 3DU8A 5L2TA 4WBBB 5CU0A 3LMIA 4NKSA 5HG9A 1JSVA 4ACHA 4X2JA 3QWKA 3QTUA 4GH2A 2QOOA 3EQDA 4BCOA 3QRTA 3L9LA 3P78A 4YHJA 5HI2A 4CYIA 4D55A 4F1MA 4YTIA 4DCAA 3U87A 4KS7A 3T6PA 4CV9A 1PYEA 3FI8A 2R9SA 2Y7JA 2BIKB 2UZNA 1HQYE 1CDKA 3DJ6A 3QRUA 5KMJA 4Y73A 3E21A 2BZIB 3QUDA 4BCGA 5BYLA 4WA9A 2XS0A 3GQLA 2JUJA 5ANJA 1YXXA 3R8PA 1S9IA 4FOCA 2Q83A 1V1KA 3R8ZA 1XJDA 4G17A 4D5HA 3E92A 3A7FA 4L67A 4U3YA 1HJPA 5C9CA 4BCKA 3NCGA 4IZAA 3FSKA 4BDAA 3R8LA 4AN2A 1XH6A 5JI2E 2QSFX 3HP2A 4G3FA 4AWIA 5E4HA 2J50A 3SKCA 4DFXE 2V62A 2HXQA 5DE2A 3LFSA 3WF7A 4EK5A 4N70A 3MVMA 1T46A 4Y72A 4CXAA 5EQYA 4FTRA 1M17A 2VZ6A 4YR8A 5HLNA 4C37A 1JWHA 2YM5A 3FI2A 3IW4A 2QHOB 3DS6A 4QRCA 1AQ1A 3FMKA 5FDPA 3SHEA 3CTJA 2LVOC 5ANGA 2O2UA 3H9RA 2VX3A 3GCPA 3NEWA 5CALA 4LL0A 2JGZA 3OT3A 4J96A 5E1SA 4AT4A 3O51A 3E8CA 1GAGA 5KKRB 5I3OA 5BVEA 4CZYB 2YA9A 3EMGA 4LOPA 1JQHA 1M2QA 3QZGA 3E8DA 5IEXA 5K4IA 2V7AA 3G51A 3R7YA 4D5KA 4MYGA 3ATSA 2J0KA 2CGXA 3OXIA 5BVNA 3U51A 4O7ZA 3O23A 2MJ5B 3T3UA 2Z7LA 4IJ9A 3QGYA 4YGAA 2ZDTA 3ENHA 1SG9A 4ZSEA 4M84A 4YTCA 3Q52A 4QMZA 4QYYA 4DEHA 3QGWA 4K77A 3NUSA 1MP8A 4GEWA 2YJSA 3PUPA 3DJ7A 5IKWA 3SG8A 1Q8WA 3PA5A 4XRLA 4DT9A 3PFQA 3FY2A 3VBXA 1ZZLA 3RAWA 4CSVA 4BKJA 3GFWA 3LQ3A 4R7BA 3EQIA 4QNAA 4FNWA 2ERZE 3IOPA 2DENA 1JNKA 2DQ7X 1ZZ2A 2WEIA 1O6YA 3Q96A 5AUXA 5IF1A 5EYCA 3W55A 3CQUA 4MQ2A 4OTHA 4U41A 4O7WA 2XNMA 2PUIA 5CQWA 1QPCA 3FAAA 4Y8DA 3AMBA 1J3HA 3LFDA 3OOGA 1VEBA 4RJ6A 1XH7A 4QPSA 3VRYA 5I9UA 4FKUA 4E5BA 5KBQA 3O7LD 4CKIA 4GT5A 4F6SA 4GG5A 4N6ZA 3UC3A 4EH3A 1R39A 2Y9QA 2B54A 3IKAA 1WHCA 3TL8A 4GJ3A 4QO9A 3TJDA 4K9YA 3ZXTA 1TQIA 4KRDA 4GYIA 4DEAA 4R78A 4O7RA 2CMWA 1H24A 3DNEA 2NRYA 1HT1E 1GNGA 4O0VA 5C26A 3R7OA 5EM5A 3LIJA 3S2PA 4BHZA 4M3QA 4IAZA 1OB3A 3P23A 4AZFA 3RTPA 5C01A 4FBXA 2J9MA 2UZEA 4H3QA 3JY9A 4U5JA 3GU6A 1UA2A 3KK8A 3ZXZA 4H1JA 2UV2A 4BDGA 4PDYA 2XJ0A 4UY9A 1WBNA 2W05A 3EOCA 3HL7A 4CFNA 3PJCA 1YDTE 3VF9A 3VRZA 4WUNA 2HCKA 3ZRLA 5J7HA 3WI6A 5DI1A 5HIBA 4RIXA 4GW8A 4GT4A 5AAGA 1DO0A 5JKGA 1ZYJA 4FV6A 2R0UA 4DEDA 5L8LA 2QC6A 4IC8A 5J1VA 3IG7A 2P2IA 5CNOA 4CV8A 3TEIA 2Y6OA 2WU6A 4L6QA 2C1BA 2DHYA 5EI8A 3QTQA 4FEVA 2YLEA 5EDPA 4TPTA 4YPDA 4XBRA 3NPCA 5CSWA 2CGUA 4F0FA 4F0IA 3RWQA 3OBJA 3QTIA 2F7ZE 4Q9ZA 5ANKA 1R0PA 1Y6BA 2ZV9A 3FMEA 4AUAA 4NM7A 2ZB1A 3F2RA 2EVAA 3WYYA 2PZYA 2XMYA 3SV0A 3MFTA 4OBOA 1JKKA 2UVYA 4EHVA 3ET7A 3R9OA 1PW2A 4QYGA 5G6VA 2WXVA 4DFYA 3NUPA 3FXWA 3PY1A 3L8PA 4K8AA 3GU7A 5JH6A 4DH1A 1BX6A 4BYJA 3DFAA 5KX8A 3GBZA 3FKNA 3FLQA 2F4JA 2PVMA 3ATTA 1RDQE 2DI0A 1OBDA 2W1FA 3R83A 2OZOA 4GU9A 4RIOA 3MIYA 5HCYA 4DLIA 5KO1A 3SA0A 5J7BA 4ITHA 3OP5A 3R9RA 3EJ1A 3LXPA 3OXZA 1ZLTA 1VYZA 4DG0E 2J0LA 3A61A 3VN9A 4AGCA 4UMRA 4HYIA 1U4DA 3KULB 4MQ1A 4QP2A 5M51A 5GIOE 3EKKA 3THBA 3MJ2A 2WMRA 2HOGA 2CP8A 2FVDA 4FT7A 4ITIA 4JNWA 3P0MA 3OW3A 3RPOA 2YZLA 4JBVA 5DG5A 4F7JA 2G9XA 4NIFB 1OI9A 4RPVA 5AP1A 3U4WA 5JMSA 2MGWA 4IX5A 4NFNA 3FPMA 5IDPA 2VUWA 4UMQA 3R7IA 4FEWA 3F2NA 3F3WA 4RFYA 1YVJA 3DBFA 5EQPA 2G2HA 5L6PA 3GOPA 2CKOA 5DR6A 3TUBA 3O8TA 4QPMA 2WZJA 4ORKA 3COIA 3ETAA 4M69B 3ZC6A 1DS5A 1W84A 2X8IA 4LRKA 4MKCA 2WQBA 4FTOA 3REPA 5AV3A 4JR3A 4BDBA 3A7GA 1WIVA 1R4GA 3AD6A 2PVLA 4XNEA 3BE2A 3QUEA 4C3FA 5CF6A 4CMTA 4O82A 5FTQA 1TR8A 2BDFA 1F4IA 3I0QA 3I6UA 3PG1A 4H05A 4XHKB 2XM8A 2R0IA 5D10A 3DTCA 1Q99A 2C5OA 2UZUE 3A4PA 3L9MA 2W1IA 3P9JA 4FT5A 4KRCA 5CEQA 4E20A 5I9YA 5LARA 2HZNA 2BZKB 1IEPA 2BPMA 1GIHA 4EEVA 5G1XA 5CAOA 5M07A 3W32A 2SRCA 3OUNB 5JFSA 3AMYA 5AR8A 3SW4A 3KC3A 4AFEA 2DAGA 2RFSA 4AW5A 4O0UA 5EQEA 3TNHA 3BYOA 3AQVA 4ACCA 4BCPA 2JDTA 3F2AA 4M7IA 5H3QA 3RCJA 3UNJA 5M09A 3QQHA 4LRMA 5ETCA 5IH5A 4O0YA 4IACA 3VC4A 2QLQA 4NUSA 3OOMA 4CVAA 5T68A 5BNJA 2FO0A 3H9FA 3QFVA 4FL1A 1E1XA 3I6WA 1FINA 3U9CA 3OBGA 4ENXA 4FV5A 4G9RA 2HAKA 1W98A 3FZTA 4O27B 4X6QC 3V5LA 2B0QA 4H58A 3TKUA 1URCA 4RSSA 1TTEA 3VBYA 4D0WA 2K9DA 4HEOA 4ZSJA 2XNEA 2VRXA 4PL5A 4NL0A 3PE1A 4I4FA 5ANEA 2HZ4A 4L9IA 1TVOA 4XP3A 3QQUA 1FMKA 4RJ7A 2IVTA 2F7XE 2XNNA 4TT7A 4W8EA 2EXCX 3COHA 4YJSA 4ZTMA 4IAAA 5D41A 4C4EA 5LQFA 3GCSA 4FL3A 3CIKA 3WF5A 3E8NA 4C0TA 4PMMA 3D14A 5HGIA 1G3IA 3ZUTA 2IVUA 3BKBA 4BFMA 4BR3A 3DBQA 3OTVA 1HOWA 4FV7A 4O0SA 5KHWA 4KUJA 4AT3A 2OJ9A 2WNTA 4GT3A 5CNNA 3Q5IA 3S00A 5FXSA 2PVNA 3F5GA 3PY0A 4L3JA 2IWIA 4BDDA 3BBZA 4QOXA 3F82A 2CPKE 3DZOA 4QMLA 3A4OX 4CGAA 4E5WA 3QL8A 3GC0A 4YJUA 4DEBA 2HY0A 1VEJA 3TIYA 4S30A 4P7EA 4XLVA 4HJOA 3MPTA 5FXQA 4EZ7A 3D9VA 2YWVA 3G6HA 2YM6A 2BFYA 3K5UA 4DH7A 4RFZA 1OKWA 5K4JA 3DAKA 1YXUA 4UMTA 5HE0A 3V01A 5HO6A 2YWPA 2CN5A 3V8TA 1KSWA 3UOKA 4RIYA 1Q3DA 2QO9A 4FGBA 1OKSA 3K54A 3R1SA 2ITTA 2BVAA 3EFJA 4MNEA 5EM7A 4IFGA 3FMDA 2GHMA 3F69A 2HZIA 3NIZA 3TNQB 4AA0A 1SM2A 1BYGA 2VV9A 3PPJA 4OLIA 3V5QA 4IWOA 5JRQA 4BVUA 5D1JA 1YRPA 3PVWA 4BIEA 3NWWA 3VJOA 2C3LA 1BL6A 3HV7A 4XOYA 4YZNA 5IA2A 2QOIA 5KKRC 3MN3A 4FSNA 4J1RA 4D2SA 2FUMA 1V0PA 5FLFA 4H3PA 4IDTA 2X39A 3QKKA 4LFIA 5AV4A 3D7ZA 4QMOA 4BDHA 4CZTA 5CS6A 3VS4A 4C4GA 3OMVA 1LUFA 3QCYA 4F7SA 2ZVAA 1WBSA 1MRYA 5A3XA 2VWWA 2CLQA 2LVAA 3FI4A 3CGOA 3QQGA 2WMQA 3C5IA 2QO2A 3F3TA 2C0TA 1OL5A 1OKVA 3F3VA 2GQGA 3C4XA 3EYHA 4JT3A 4MCVA 2PVRA 4QP4A 4YNOA 4JG7A 4AZWA 4U8ZA 1OPJA 2OJGA 2J5EA 1BI8A 3BCEA 5HORA 2GSFA 3DXQA 4TW9A 4PDPA 4IJPA 1OIYA 4F9AA 3MDYA 3NRMA 5GHVA 5FDXA 4YJRA 1IRKA 2F7EE 5C03A 2HWJA 1WMKA 2IO6A 3F88A 1URWA 4F2LA 3FEGA 2CNUA 2OI4X 3MPAA 2BWBA 5E8VA 5B2LA 2JIVA 1YHVA 4U44A 5FRIA 4C2VA 4P90A 1MQBA 4KIOA 4NW6A 5CYIA 2QU6A 3MVJA 3L8VA 3Q9ZA 4UWCA 5DIAA 4TYGA 4YJTA 4WG5A 4BGQA 4RC3A 3F5PA 3C0GA 5ANDA 4OAUC 1YQJA 2VTPA 4H36A 3WYXA 3QKMA 5BQ0A 1H1PA 1PXOA 3IO7A 2YISA 2FGIA 3R8UA 2JZ1A 4DFLA 4K0YA 3Q53A 4N6YA 4U42A 5HQ0A 4DTAA 2KNAA 5GJDA 4M0ZA 4ANMA 3MBLA 1OUKA 1H26A 3FLNC 4MXZA 5GNKA 3LHJA 4CYJA 4X3FA 3QZHA 2PZPA 5CAPA 2I0EA 5JGAA 2OGVA 3P7CA 2C0OA 3BV2A 4I3ZA 4AF3A 4AOIA 3OD6X 4FKRA 4G34A 4WRSA 4ZTNA 5GZ9A 1H01A 4ALUA 5I0BA 4BHNA 4UWYA 5HICA 5BPYA 4JQ7A 3LCVB 3ROCA 4ZEGA 4DEGA 3C1XA 2VWZA 2QR8A 2W4OA 2YJRA 4FKVA 4BL1A 3ZO4A 2VTIA 2ITNA 5LVLA 1NV9A 4C38A 1OBGA 2ITXA 3A8XA 4QQCA 4RC2A 3HA8A 5AP4A 1XH9A 2YAKA 3UVPA 2IZSA 4TKSA 3WZDA 2V55A 1KE9A 2DS1A 4XP2A 3R7VA 1A5TA 4HCVA 3LFNA 2X2LA 4EOMA 2XRUA 4V0GB 4NW5A 2GHGA 4WNPA 2GNFA 5AR4A 1E9HA 2HYYA 4UN2B 1QCFA 5CX9A 4TTHB 1MN3A 4ONAA 3U9NA 5M4CA 4RJ5A 4B8MA 4ZZMA 3DJ5A 4J52A 4EI4A 2VO6A 1B6CB 3HRBA 3NGAA 4JJRA 4YNEA 5ETFA 4FV4A 1XHAA 5AWMA 4BB4A 1V0OA 5DA3A 4IWPA 1CUKA 1HCLA 4ASXA 3KXMA 2ZB0A 2YIYA 2CWBA 2JP7A 4AGUA 4ARKA 4IANA 4U80A 2DAIA 2JIUA 2VWYA 3L8SA 4YC8A 1I09A 2GS7A 3CKWA 4EQMA 3OEZA 3TZ7A 1A06A 2VTOA 4USFA 5DVRA 4FNXA 3ZBXA 5JZJA 3OF0A 3BQRA 3PSDA 4YZBA 1SVEA 2CDZA 5AIRA 1H1QA 4JX7A 1G3NA 4G3GA 1WFCA 4LI5A 4ZIMA 1PXIA 5HVYA 4WRGA 3R9HA 3VUGA 4EK4A 1YOMA 5CAVA 3MS9A 4QP1A 2GNIA 3ZTXA 5IMEA 2J5FA 4WO5A 5DPVA 4XEYA 3BE9A 3MA6A 2JKKA 4XG7A 3UYTA 3UZPA 5F95A 3R9DA 2PVFA 3JVSA 4BCQA 1MQ4A 2ZDUA 4KB8A 1YKRA 4AZTA 3FZSA 3LQ5A 4PMTA 3QHRA 4BDCA 4HGSA 3RPYA 2FSMX 4E6CA 4ZY6A 3PLSA 3SXRA 3SVVA 4PRJA 4YC6A 4TN6A 3T9IA 2WIHA 2J4ZA 4I6FA 4DYMA 3ZO1A 2XIZA 5F20A 1NW1A 3HLLA 1AD5A 2E9VA 3RM6A 3ZS5A 4R5YA 3E64A 2VTSA 2HWPA 2QURA 2YM3A 4MXCA 3SDJA 4EH9A 3B8QA 4DCEA 2PE0A 4O81A 4UXLA 1J91A 3OWKA 1FVRA 2ZJWA 4RT7A 2X8EA 2IVSA 1OTRA 2BALA 4HCTA 5F4NA 4FVQA 3DLZA 3HX4A 1PMVA 4KIKB 4V05A 1K2PA 3RCDA 3W10A 1FOTA 1P14A 4OTQA 4OTWA 5LCJA 3U55A 2V0DA 4QTAA 4CMOA 4C4HA 5HEZA 3FLWA 2OO8X 3QD4A 4ZY5A 4QP7A 2OOBA 1H28A 3P7AA 3PY3A 4RLKA 3GLGE 4PV0A 4FA2A 4RA5A 1ZY4A 4L3LA 1FVTA 2WTWA 3IDPA 4PF4A 5JRSA 4I20A 2CKPA 3T3VA 3BX5A 4F64A 3B8RA 1LR4A 4EH7A 4PQNA 5C8NA 4IE9A 3MJ1A 1U54A 3R21A 4EOJA 3TUDA 2QOQA 1F5QA 1G4AE 4DF3A 3OWLA 3S4QA 1OPKA 1PJKA 4R1VA 4WUAA 3E46A 3RK5A 4A7CA 4F6UA 5KHXA 4ZMFA 2J90A 4R7HA 4PNKA 1G5SA 3V6SA 5IA4A 1VYWA 4FIGA 2QOCA 3NNWA 2JLDA 1YOLA 4JVGA 4PTCA 2VTAA 5FBNC 3ZC5A 4B4LA 3N51A 3F61A 1WBOA 3NNXA 2XK3A 3D7TA 2BAJA 2XF0A 1HT2E 3DNDA 4G16A 4MAOA 4AW2A 4D1XA 5JSMA 2RRUA 1GIJA 3QZIA 5CU3A 2R3GA 3V5PA 2RFEA 1OKZA 3LMHA 3QHWA 4RVKA 2PUUA 4FSYA 4XG8A 4UX9A 1IFYA 3BV3A 4FUXA 5J9ZA 1IAJA 4CFWA 1H4LA 4FK6A 4EH4A 3U6JA 3K2LA 3OY1A 3MI9A 2YIWA 4FSWA 4L01A 2HW7A 4O7LA 4G31A 1KE5A 2L2DA 4WBOA 4ID7A 3ENMA 4BCNA 2XCKA 3RHKA 2X4ZA 3GC8A 5FP5A 4JRNA 4L44A 2UZVA 4FG7A 5AM6A 3BYUA 2O63A 2BIYA 2RG5A 2W1ZA 4UZDA 4LOQA 3ID6C 1IA9A 3GGFA 2VO7A 3ZSHA 2WMWA 4A9TA 2XNGA 5JQ8A 3FXXA 3OCTA 2E9NA 4QMWA 4RQKA 4R71A 4LV5A 5CWZA 1H1WA 3HA6A 3DQWA 2WTDA 3BGZA 2ITWA 3A8WA 5E8XA 5JEBA 3EQRA 4I23A 4MK0A 3R9NA 3LFBA 4U7ZA 3ERKA 2UZOA 4U40A 4KKHA 2JITA 2F2CB 1IA8A 1I44A 3F92A 3ZZWA 2PTKA 4A4XA 4KIQA 2JY7A 1VJYA 5D9HA 2XJ2A 3IS5A 3BU6A 4NCTA 3KRRA 4XRJA 4QYHA 5CEIA 3ZMMA 4J98A 3EFKA 1YHSA 4AGDA 4S2ZA 2OW3A 3FLSA 3NUNA 2VGOA 3AT3A 4TYIA 4BIBA 3EKNA 2OZAA 4E6DA 4E3CA 2B55A 1M7NA 4W9XA 1H25A 3NAXA 5K5NA 3CTQA 3W2CA 4E6QA 3S0OA 4DT8A 3KL8A 2CGWA 4QP3A 3HECA 5DHJA 3R1QA 4ZTQA 1L8TA 4FIFA 4BDEA 1XH8A 4MEDA 3KVWA 4O38A 5CSHA 2IZUA 3DK7A 2EWAA 2VAGA 4FKPA 2OO9A 2PHKA 3OCBA 5JFVA 2VGPA 4XV9A 4M67A 4L8MA 2W5AA 5AUZA 3CJGA 3QYZA 5KZIA 4ZY4A 3QQLA 3PPZA 4QYEA 4EZ3A 3DTWA 2XRWA 1XKKA 1NVQA 4MXAA 3Q4TA 3D5UA 3QALE 2B9JA 3OZ6A 5M4UA 4NTTA 4DGNA 1Q5KA 5L8KA 4IM3A 4FSQA 2VWIA 4HGEA 4EYMA 2Z8CA 3T9TA 3EL8A 3IW6A 5C4LA 3LOKA 4LM5A 4YO6A 4D4SA 3ORNA 1M2PA 4AU8A 3W2PA 4I93A 4JBPA 2X9FA 4QMPA 4RLLA 4AN3A 3MH2A 2JC6A 2B9HA 3KVXA 2R3PA 1GIIA 3BBWA 4IMYA 1PHKA 4BDJA 4FE2A 2PUPA 4O91A 3RAKA 2GTMA 3LE6A 2OH4A 3RK7A 5HLWA 5DFLA 3VS0A 4ZMEA 4EBVA 5TF9A 4MXYA 4WNKA 3RALA 3IQ7A 1KE7A 1Y91A 2BMCA 2JDVA 1GJOA 4FTLA 3V8WA 4FV0A 3VBTA 1CKIA 4HZRA 5IUHA 2CNVA 3HV3A 4DINA 5CY3A 4B6LA 4CLIA 2Z7SA 3W1FA 4F99A 3FC2A 3RK9A 2PY3A 3KEXA 3O50A 2UW6A 4AE9A 3GENA 5DMZA 1YWRA 3QTZA 3DQXA 4PPAA 4D1SA 4CFFA 5BX0A 1WBTA 5C1QB 3UYSA 2OJFE 1BI7A 4LRJA 3PJ3A 4GKIA 4HYUA 1CM8A 4U81A 3ALNA 3FL5A 3QC9A 4YJQA 3QLGA 4F9YA 2WGJA 2WKMA 1EH4A 3QCXA 3BEAA 3VWAA 4XCUA 5AA9A 4YUQA 4O7VA 1ZYDA 4DEEA 2J7TA 1AGWA 2W9FB 2DAMA 5HESA 4BZOA 1REKA 4JX3A 3KXHA 4G6OA 5EI6A 5IA5A 3PP1A 3S3IA 1CTPE 3ZFXA 4BF2A 5M06A 3FHRA 5J5TA 4B99A 3ZUVA 3V6RA 3O0GA 5FWKK 2ONLC 2QOHA 4UXQA 4D1ZA 2BZHB 2O65A 3K3JA 3D0EA 4R1YA 3LW0A 4A06A 5BUEA 4YZCA 3BGQA 3FMNA 1YW2A 2YHVA 3RVGA 5I5ZA 5L2WA 4CG8A 4ZTLA 3RAIA 2O64A 2H34A 2OWBA 4LQMA 2R3FA 3ZSIA 4GKHA 3BHUA 3QRKA 2J51A 3CY2A 3UQFA 1Q41A 2QOBA 3BEGA 2XH5A 2ZOQA 3QTXA 4WG3A 3C5UA 2I0YA 3UODA 5L2IA 4FTTA 4K11A 5CT7A 4EWQA 2BRBA 4FSRA 2G3QA 3VBVA 4ZAUA 3G33A 3R01A 4R3CA 1YXTA 3A99A 3FWQA 2NNWB 4RFMA 3P08A 1P5EA 3G0EA 3ULIA 2W1EA 3F7ZA 3ZDIA 1W7HA 4WD5A 4MD8E 3KKVA 2WMUA 2HZ0A 3GOKA 3NZ0A 3OVVA 4DBGB 1ZXEA 2FA2A 4J8NA 4YBKA 4FTCA 4RWJA 5IA1A 1SVGA 3Q9YA 3LLAA 4DA5A 1PMNA 3OROA 4WHZA 4DFNA 4O83A 1XBBA 2P2HA 3DXNA 3E93A 2BR1A 4G1WA 3RNIA 2X2KA 3E88A 3UJGA 4BKYA 1LEWA 2J2IB 3VJNA 5DOSA 2YLFA 3HMNA 3NW5A 4NZWB 4XV3A 4Z3VA 3WZJA 3RNYA 2JBPA 2WQOA 4QTEA 4CNHA 5E92A 1PXLA 3PP0A 1NVRA 1IR3A 2A4LA 3O7LB 5EK7A 2VX1A 4AACA 5HNIX 5HTBA 1J7UA 1PKGA 4PWNA 4YPSA 4HGTA 3UBDA 3FY0A 1Q24A 2C5VA 3V04A 3IDBA 3VAPA 3OCGA 3P5KA 2JNHA 4IVDA 3DAEA 4RX7A 2XKFA 4IHPA 2CKEA 2R64A 3UPZA 2Y0AA 5ANIA 3NW7A 4NJ3A 4RIWA 3DOGA 3DPKA 2ETKA 1XO2B 3TDVA 3ORXA 4NJDA 3EQGA 2XKDA 2JIIA 1UNLA 4ACDA 4RVLA 4DGMA 3NX8A 4IVCA 2IVVA 1Z57A 2AYPA 4GJ2A 5KMNA 4MF0A 4TYHA 3FLYA 2GNHA 5IQIA 4MWIA 3ZM4A 2EXEA 4RQVA 5AA8A 3TZ9A 5LMKC 2J0IA 3OTUA 3V51A 3EZRA 3HMPA 4FVRA 4F1IA 5CXZA 4IADA 3NW6A 2GFSA 4CLJA 3GEQA 4E6AA 5K0KA 2XNPA 2YIQA 4LMUA 4R6VA 4E4LA 2YM8A 4O84A 3VBWA 4XG3A 2QKRA 2ZV7A 3KCKA 3NUUA 4D4VA 3UQCA 4UYNA 5E8UA 2OKRA 2YCSA 3C51A 3CCNA 4C4IA 4XG9A 3FL4A 3ALOA 4PPBA 4BCMA 3DA6A 4UZHA 3ORIA 2R7BA 3PLAE 2VWUA 3QQJA 4TNDA 3NAYA 3SD0A 2UVZA 2UW0A 3MH3A 3G5DA 3EB0A 2DNAA 1B39A 3VNTA 3F6XA 5LVOA 1B38A 4L43A 3TT0A 2NPQA 4F4PA 1U46A 2BRNA 2ITUA 4ANBA 4EQCA 3PIXA 2XIRA 1QPDA 4V01A 4ZLOA 3NUYA 3NNVA 4RWKA 4USDA 3BHYA 3QA8A 4M97A 5CU6A 2R3QA 5EW8A 3BWFA 4CD0A 2JFMA 2VTLA 5D12A 4C7TA 4HVGA 2PE2A 4LGDA 2WQMA 3BRBA 3MYGA 4I22A 5A54A 4J53A 1BVSA 4IW0A 5AP0A 4NYEA 2VNYA 2H8HA 4ITJA 2KNVA 4U0IA 2F2UA 4IAYA 2YM7A 1UKHA 5GJGA 3IK3A 3KK9A 3NVMB 1R3CA 2Y4IB 4PNIA 5LVMA 1JKTA 4C35A 4YZMA 4DGGA 4ZLZA 1W82A 2X0GA 4JDJA 3KRWA 4E4NA 2FSTX 2X2MA 4AGWA 1DI9A 2WIPA 4RIXB 5CEKA 4C59A 3CXWA 1W83A 5DNRA 4FEXA 3BHHA 1PXNA 3WOWA 1UU9A 1Y57A 3E62A 3TNPC 3A7HA 4TRLA 5T6KA 2E9UA 4A9SA 4FK3A 4PMPA 3WF6A 2OXXA 2RFDA 4PTEA 1BUHA 2B4SB 2YDIA 3R04A 3CR0A 1UNHA 5C8KA 1CSNA 5J9YA 1FGKA 4TYJA 3UO6A 4JG8A 3GCUA 4OTRA 5HOAA 3MVLA 4X2NA 3LCOA 3VHEA 4TXCA 1WBWA 1OIRA 3MFUA 3MESA 3W18A 5B2KA 2W1DA 2BHEA 3ANRA 3KB7A 2P4IA 4EL9A 2OG8A 3RKBA 5JQ5A 3VHKA 4YLJA 5IQHA 2BDJA 4QTDA 3WARA 2C5XA 2WTIA 2GFCA 3PE2A 5CTPA 2I6LA 4KSPA 3A2CA 1Q8UA 4FTMA 3MA3A 5AR7A 4ASDA 3MFSA 3UIMA 1AIPC 2NP8A 3QD2B 3FYKX 1KUTA 1STCE 2ITYA 4TY1A 2ZMDA 4FKQA 1P4FA 4IDVA 3AT2A 3UGCA 3D15A 3RPVA 4HPUE 4O2PA 4BWPA 5I9VA 4ZS4A 5BVOA 4FKWA 2UW3A 4IZ5A 5IUIA 4HOKA 3DBEA 5L2SA 3HRCA 4U3ZA 2XK8A 4TWOA 4LGHA 4B9DA 2C68A 3MY5A 4FTAA 4RJ8A 4GFGA 2X4FA 3K3IA 1NA7A 5CASA 3QX2A 3RINA 2NO3A 2OH0E 5LVPA 5CVFA 4FZAB 4CQGA 2EB3A 4O7TA 3PXQA 3IECA 2PVHA 3EZVA 4KABA 1YLAA 4ASEA 4BCHA 2PMLX 5KMMA 4XOZA 3TG1A 1OZ1A 3MGYA 2QG5A 3ORLA 2H9VA 2VTJA 3A7JA 2JBOA 4GMYA 2VD5A 2WMSA 3HRFA 4U9AA 4Y46A 3QUPA 5HCZA 3G15A 1NT2A 2H6DA 1Q62A 2IJMA 2WMVA 4CKRA 5M57A 2WD1A 4QPAA 2WOUA 5TE0A 5C4KA 4E7WA 3GQIA 4LOOA 3DK6A 5DWRA 3QCQA 1UWJA 3RAHA 2LBCA 3PZEA 4FMQA 3U8WA 2ETRA 4QMQA 4C3RA 2GQRA 4I5HA 2BHHA 4WSYA 2OIBA 1YWVA 4FEQA 4K18A 5AM7A 3FDNA 4N4SA 3AOXA 2HENA 3OWJA 1FGIA 5HCXA 4GVAA 3TKHA 4BGHA 3W33A 3VBQA 4PX6A 1UU3A 3VUMA 5DR2A 5AFVA 4BZNA 3SRVA 2H96A 2OF4A 2OXYA 3CC6A 3HV6A 4D0XA 4JQEA 4FKGA 2VO3A 3DDPA 3PVGA 3BHTA 5H8BA 5AAFA 3OC1A 5JFWA 3MB7A 4O0RA 1EFUB 3UVQA 3WF8A 4IC7A 4LL5A 4B0GA 3Q4UA 1JR3E 3LCUA 4Z16A 5AP2A 4O0WA 3C0HA 2WMXA 4PTGA 5CZIA 4IBMA 4XG4A 3ODYX 5IA3A 3GLIE 2P33A 4NM3A 1BLXA 4A4LA 2Q0BA 2WFYA 1V0BA 2O5KA 4DH5A 4FNYA 3VW6A 3EWHA 3E5AA 3AC5A 3OXTA 4YZ9A 3DGKA 2OLCA 4Y83A 4RWLA 2Z7RA 5AJQA 5EG3A 2XBAA 5M55A 1CKPA 1BMKA 3A7IA 3E3BX 5JZNA 4KNBA 5HG8A 4D4YA 1A9UA 3LXKA 4K2RA 4AA4A 3C7QA 3Q4CA 3E3PA 3JPVA 3MTLA 5EW3A 4C33A 3JY0A 5L6OA 5DYJA 2VN9A 3Q4ZA 3O17A 3JS2A 4FSTA 3D2KA 5AUTA 4MNFA 3LXNA 3HAVA 2OIQA 2UZLA 3RP9A 1XBCA 5CAUA 4C02A 1NY3A 2W5BA 2R3MA 2WQNA 5CEPA 3P79A 3MMPA 3ELJA 4RG0A 2OFUA 3KRXA 1WVYA 5DLSA 3GVUA 2QD9A 2UW7A 1NVSA 4I92A 3U6IA 1XB2B 4FR4A 4I0SA 3M2WA 3O8UA 5CLPA 1YI6A 2ZM1A 1Y8GA 4IB0A 3I1AA 3RHXA 2OK1A 4O1OA 1PXKA 5HIDA 4FV2A 4DHFA 3Q3BA 3TWJA 2HW6A 3OEFX 4AZSA 2PUNA 1JPAA 2O3PA 4APCA 4C62A 3FZPA 1YI4A 4NKAA 4QMSA 3GUBA 3ORKA 3QD3A 2P3GX 4ZP5A 2GNLA 5HE1A 3TXOA 5E9EA 4EHGA 2WTCA 2ONLA 3NYNA 4PP9A 4CFVA 2JY8A 3Q6UA 4MWHA 4FTQA 3HDNA 5HBHA 3EFWA 1QPEA 2XBJA 3UDBA 3ZRKA 3CTHA 2F9GA 4YP8A 5HKMA 5AIKA 4AA5A 3SGCA 4FGRA 2YITA 3A60A 1E94E 5GIPE 2CJMA 3VS3A 4HVDA 1XWSA 3M1SA 5HG5A 1GOLA 2UW8A 3FMMA 5DGZA 3TV4A 2C5YA 3FJQE 4JIKA 3EN4A 3SOAA 3W2RA 4BBFA 4UN0C 1ND4A 4EBWA 1UKIA 3CKXA 4CFXA 3DB8A 4M0YA 3ZOSA 4RIYB 4I5CA 4RX5A 4Q5EA 4BCFA 5IPJA 4ZJJA 2ZTDA 4OTDA 5A4CA 3KXNA 4MNEB 2UZTA 3SG9A 4EC9A 4FTKA 4Q7JA 4L3PA 4Q2AA 4S32A 3PVBA 5AX9A 3FZRA 3EL7A 4CCBA 4KBCA 3BLQA 3AGMA 3VIDA 2XK7A 3B89A 4G5PA 4P5ZA 3HZTA 3KMUA 5DT4A 5FEQA 1A48A 4FKLA 2W7XA 4XJ0A 3JR1A 1J7IA 2I0VA 5FTGA 2A2AA 4L45A 4O7NA 1VR2A 3NS9A 3UG2A 5EHOA 3S95A 1ZWSA 3QQFA 3SQQA 2C6DA 2XCHA 4M66A 2VU3A 4O0TA 3MPMA 5DRBA 2X6DA 4JXFA 4GEOA 3KMMA 1OKYA 3QAME 1TQMA 3Q9XA
chains in the Genus database with same CATH superfamily
4GIHA 3PSBA 3IG8A 2C4GA 2EJSA 4FG8A 2YCQA 3UIXA 2YABA 4ZTHA 1WBPA 3VO3A 1J1CA 3PTGA 4FIEA 2W99B 1XWIA 2YFXA 4IBCA 2V1UA 1OIPA 3FQEA 4D80A 5F1ZA 4O7SA 4II5A 3VQUA 3R30A 4I0RA 1IY1A 2Z7QA 4FV8A 5F9EA 3H10A 3QXOA 4ZSLA 2UUAM 1OECA 2R3RA 2C5NA 2VTRA 3AOEC 3CBLA 3SC3A 3FI3A 4NM0A 1WJ7A 3VUTA 1N36M 4CCUA 3AKZA 2KZSA 1R1WA 4UV0A 4NK9A 5IUGA 4FT3A 2OOAA 4C61A 1TF0B 4CKJA 3FV8A 3ANQA 4HW7A 2W96B 4AG6A 3ZU7A 4QMYA 1DAYA 4DE4A 1VZOA 2Z4SA 5AR2A 4MTAA 5B0XA 3W2SA 4ANOA 2CHLA 2QO7A 4O6EA 4JI5M 3DT1A 4E26A 1H07A 2LXEA 4LCBA 1YE9A 5EP4A 2DWNA 2C3JA 2F5PA 4FSZA 5HD7A 4FZ6A 3WIGA 2R3JA 1PXPA 2LH0A 4D2WA 2QKWB 2XA4A 1I4WA 3LAUA 4IX3A 3IGOA 1JVPP 2B9FA 4MXOA 2DZLA 2A27A 4G6NA 3LFCA 5BVWA 1V34A 1KOAA 2OQ4A 4BWXA 1W2DA 4PUZA 5AX3A 3LJ0A 5HNGA 2X4AA 2BFXA 3GU5A 1H0WA 4QMMA 1ZQ9A 3UZRA 4LJ4A 2QOLA 3DK3A 5J1WA 4JG6A 4OUCA 2PMNX 4RC4A 4ACGA 4DG2E 5FG8A 5HO7A 1GKIA 3CY3A 1OPLA 3HMIA 3IGGA 4H3BA 4JR7A 2O25A 3LFQA 1NJGA 3I0OA 3U6CA 4I5SA 3H4JA 2LVPC 3IOKA 5HE3A 1Q02A 4EKLA 1XR1A 3G9NA 4ERKA 5KMIA 2JKOA 3HU1A 2EO2A 1QL6A 4FT0A 3RM7A 2J6MA 5EOLA 2JAVA 1N78A 3TTIA 1NW1A 3PXKA 2PWLA 3GT8A 5DT3A 1IN8A 2QG7A 2G01A 4G6ZA 3LLTA 3E7OA 5HX8A 5CI6A 3KSJA 5HBEA 4JOAA 2IW9A 2GS2A 5I3RA 4RJ4A 1XXHE 3G2FA 4M68A 2C6KA 4O6LA 1Z5BA 3I81A 5J5SA 3KQ7A 4IB5A 4IZ7A 5DR9A 3ZSGA 1NXKA 3SMPA 4DFBA 3FZ1A 5J8IA 2R62A 4EOSA 2FH9A 4YJNA 2X7OA 2VWBA 1YOJA 3CF2A 2BILB 4R8QA 3U4UA 3D8LA 2XIYA 1H0VA 3E7VA 3KXGA 3K5VA 3TACA 3O71A 4FODA 4GS6A 3L1SA 4HPTE 2YZAA 4FI1A 2ZYBA 2W4JA 4CQEA 2FNAA 3U54A 3WE4A 4EH2A 2PMOX 2KDLA 3N9XA 2JFLA 1DM2A 3MSSA 4Q9SA 3BYSA 4FX3A 4YLLA 3ZH8A 2E5LM 4F08A 2HXLA 4FV3A 2V1CA 5HU3A 3DAJA 2WMTA 4J8MA 4NU1A 4W4VA 3HJQA 5GZAA 2EA0A 3B7ZA 2K0BX 3M0EA 3VDPA 4RF0A 5HU9A 2ITPA 5FGKA 4C4FA 3CEKA 4NWMA 1L1ZA 4B7GA 4FT9A 4GL9A 1KWPA 4RBLA 3CQEA 4D28A 1Y6AA 1ZOGA 2IZRA 4AX8A 5AR5A 5EXTA 3KXZA 2WOTA 4TWCA 1J1BA 2P0CA 3PYYA 1LPUA 4NFMA 3KN6A 3BLHA 3QF9A 1T6OA 3UO5A 3RJCA 4JIAA 3E63A 4UWBA 5LWNA 4NRVA 3KN5A 1Q97A 4RZVA 4IBIA 3QTSA 5TR6A 5I9XA 3H3CA 3PJ2A 5M56A 2BZJA 1JR3D 2L4FA 5CENA 3TUCA 4E5AX 4EOPA 2XGNA 1T45A 5ANOA 3LKMA 2BNKA 1IG1A 2JY6B 5A4QA 1OIQA 5CU4A 4CGYB 2C6MA 4HYHA 3I01M 5FBOA 1JKSA 1FPUA 5E8YA 3VS2A 3L9PA 2NRUA 3OW4A 2RGPA 1DI8A 4MVFA 4R7GA 3RPRA 3PA3A 2YDJA 2B52A 3E8EA 1ZRZA 4IAFA 5T3QA 2EU9A 2R3IA 5HZNA 4BZDA 2W4KA 2OXDA 3GXLA 3L28A 3QA0A 4I8OA 4G9CA 3EIEA 4LDTA 4F1TA 3O96A 2Y8OA 2LVQD 3ZFYA 3N4UA 4QHSA 2WEVA 3FQHA 4W4XA 4QYFA 4LF6M 3M42A 3UO4A 1PY5A 2XEZA 1DGGA 3FMLA 4L78A 4CFMA 2OJJA 4CZUA 2RIOA 2PPQA 3FTCA 2QQ8A 3TV7A 1KV1A 3HYHA 4APPA 3GFEA 5H37D 2Y6MA 1NY6A 4EOOA 5E26A 3EH9A 1IY2A 2BWEA 2UZDA 5H8EA 3C4CA 4B7TA 5L8JA 3LQ8A 3TZ8A 3PSCA 3CPBA 2X0OA 5GZ8A 5AV1A 4FVMA 3U6EA 4L7SA 5CVHA 3HAMA 4GC5A 3AXWA 4OAVB 4JI3M 4D82A 4F78A 4BBMA 1KFVA 1NV8A 3C4ZA 4E73A 3KREA 3HKPA 5TT7A 4HVSA 1NO1A 3FHIA 4MB7A 2HK5A 3ODZX 5CANA 4GIIA 2LWXA 3DY7A 4XP0A 2PK9A 4CMUA 4D2TA 3KGAA 4GC9A 2VX0A 4O86A 1UV5A 3A46A 3MV5A 3JUHA 1OGUA 1WGNA 3BZ3A 3POOA 5I9WA 3HU2A 2XK4A 4ANSA 2BJWA 3TM0A 2QOFA 4ZLYA 4KIKA 4JDIA 3LQRA 1H8FA 4ZZOA 2DHRA 4YMJA 4FC0A 3FZOA 3IW8A 2WPAA 1U5RA 3AMAA 1W8CA 5EM6A 4XLIA 5CEOA 3RPSA 5IQAA 4ZXTA 3DKOA 1VDLA 2MR9A 2GHLA 4F1OA 5A6NA 4CEGA 3HDMA 2WAJA 3LCSA 4U45A 2C1AA 4FKJA 4O4FA 4KBAA 5BUJA 4B7FA 1IN5A 3HNGA 1O9UA 4EYJA 4OW8A 2QPAA 3R2YA 4A9UA 3KA0A 3NYVA 3MY0A 4C36A 3NR9A 2WTVA 2JDOA 5AUYA 1ZY5A 4R77A 3EQHA 3DZDA 4FZDB 3PG3A 4CHTB 2W1HA 3BHVA 4DBNA 1K9AA 2NQ8C 2G1TA 5CSVA 2RGOA 4ZK5A 2QONA 2QLUA 1HNXM 5JGBA 4EHEA 2JDSA 4J95A 3I79A 4Y85A 3JAMS 4JN6A 2DWBA 4WP2A 2WU7A 2I7PA 4M14A 3WIKA 1OUYA 4OTIA 5E6JA 4IXPA 3VS1A 2Z3XA 2G15A 4OT6A 2C69A 4PY1A 2HY81 1CKJA 3PXYA 3F7WA 3QLFA 1GZKA 1OGYA 4FCWA 3FLZA 5EXPA 5B7VA 3BWJA 1QDTA 2V7OA 1WCCA 4QQTA 2QODA 4JDHA 2Z7JA 4A4OA 3EN6A 4X66M 4I21A 2R2PA 4WIHA 3DU8A 4NKSA 2UU9M 3TWLA 4X2JA 2J7OA 3QWKA 3EQDA 4BCOA 5HI2A 4YHJA 4CYIA 1PYEA 2R9SA 2Y7JA 4MM3B 2R18A 4BCGA 2XS0A 5ANJA 2JUJA 2R6FA 3R8PA 2CHGA 3A7FA 3NCGA 4IBDA 1XH6A 5E4HA 5DE2A 4EK5A 4N70A 1T46A 4Y72A 5EQYA 4C37A 3I04M 1JWHA 2QHOB 5FDPA 5CALA 4LL0A 4GHAA 2JGZA 3OT3A 4AT4A 3E8CA 1GAGA 1G8KA 5BVEA 4LOPA 1JQHA 3QZGA 2ZAMA 2CGXA 3OXIA 3DFZA 4O7ZA 2MJ5B 3QGYA 1I94M 1SG9A 4M84A 4QYYA 3QGWA 2YJSA 5IKWA 2JA2A 3PA5A 3FY2A 3LQ3A 1ZZLA 3GFWA 3M7GA 4QNAA 4FNWA 2XSZA 2DENA 5AUXA 3W55A 4O7WA 4Y8DA 3AMBA 3OOGA 1XH7A 3SAVA 5I9UA 3FUUA 4GG5A 4N6ZA 3UC3A 1R39A 2Y9QA 2B54A 3TL8A 3TJDA 1TQIA 4O7RA 1GNGA 3S2PA 4M3QA 3RTPA 5C01A 2J9MA 2UZEA 4U5JA 2UV2A 4BDGA 4UY9A 4GW8A 2QC6A 4IC8A 5J1VA 3IG7A 4CV8A 2YLEA 4TPTA 3NPCA 4F0FA 4DHJA 3RWQA 3OBJA 1R0PA 3FMEA 2C98A 3SV0A 4OBOA 4EHVA 1PW2A 1PJJA 3FXWA 3PY1A 3DFAA 3GBZA 3FKNA 3ATTA 2W1FA 4DLIA 2D7HA 5HCYA 5J7BA 3R9RA 3OXZA 4DG0E 3A61A 1U4DA 5M51A 5GIOE 3W2OA 2HOGA 2CP8A 2FVDA 3OW3A 1QYRA 4RPVA 3U4WA 5AP1A 4UMQA 3R7IA 3F2NA 3F3WA 4JI6M 1YVJA 2G2HA 3GOPA 3COIA 4LRKA 1R7RA 5ITUA 5LMUM 3A7GA 2R46A 1R4GA 3AD6A 5FTQA 1F4IA 3PG1A 2XM8A 2R0IA 5D10A 2UZUE 3L9MA 3P9JA 2W1IA 5LARA 3UZUA 5ITQA 4EEVA 5M07A 2SRCA 4DR2M 4AFEA 3FTFA 2YNMD 5EQEA 4B7HA 4M7IA 4ITQA 3QQHA 4O0YA 2QLQA 3OOMA 5BNJA 3H9FA 4FL1A 3FZTA 2B0QA 1URCA 2K9DA 2HCBA 4I4FA 5ANEA 2HZ4A 1TVOA 2BJVA 3QQUA 1NNUC 3LQQA 2XNNA 4W8EA 4IAAA 5LQFA 4PMMA 4MGYE 2IVUA 3DBQA 4I6LA 4KUJA 2WNTA 3Q5IA 3S00A 5FXSA 2PVNA 3PY0A 4L3JA 2IWIA 3F82A 4E5WA 3QL8A 4DEBA 3TIYA 3GRRA 3K8ZA 5FXQA 2YM6A 4DV3M 4DH7A 4OX9M 5HO6A 3V8TA 1KSWA 1OKSA 3R1SA 2ITTA 1MU5A 2BVAA 4L6V6 2XF3A 5EM7A 2GHMA 3F69A 3PPJA 4IWOA 5JRQA 4XOYA 1BL6A 4YZNA 2PULA 1V0PA 2X39A 3D7ZA 4QMOA 4C4GA 4F7SA 2ZVAA 5IWAM 2CLQA 3FI4A 2WMQA 4YNOA 4JT3A 3EYHA 4QP4A 4JG7A 1BI8A 4F9AA 5FDXA 4YJRA 1URWA 3FEGA 5E8VA 1YHVA 4U44A 4C2VA 1MQBA 5CYIA 3Q9ZA 1S3SA 3HZJA 4YJTA 4WG5A 4BGQA 3F5PA 3C0GA 5ANDA 2VTPA 1YSYA 2FGIA 4DFLA 5HQ0A 4DTAA 2KNAA 4M0ZA 1H26A 5GNKA 3LHJA 4X3FA 2OGVA 4I3ZA 4AF3A 4ZTNA 5I0BA 5GZ9A 3K1JA 4B3TM 4BHNA 4UWYA 5BPYA 2YJRA 2VTIA 2ITNA 2ITXA 4QQCA 2YAKA 2V55A 1KE9A 4XP2A 2XRUA 5M4CA 1QCFA 3U9NA 3GRVA 2M5ZA 4EI4A 2VO6A 4JJRA 5AWMA 1CUKA 2ZB0A 2YIYA 2VQFM 4ARKA 3L8SA 4EQMA 1I09A 2GS7A 3CKWA 3TZ7A 5HVYA 1IQPA 5IMEA 5DPVA 3BE9A 3MA6A 1J7KA 3UYTA 3UZPA 3JVSA 1MQ4A 4KB8A 3KS8A 4PMTA 4ZY6A 4YC6A 2WIHA 2J4ZA 4I6FA 4DYMA 5F20A 3ZS5A 4DCEA 4UXLA 3U6LA 4RT7A 2ZJWA 1OTRA 4FVQA 4LGMA 4KIKB 4V05A 3RCDA 4IBBA 4OTQA 5LCJA 4CMOA 4C4HA 3FLWA 2OO8X 4QP7A 3P7AA 4RLKA 2APLA 4FA2A 4RA5A 4DV0M 4I20A 3MJ1A 3TUDA 1F5QA 1G4AE 3OWLA 3S4QA 1PJKA 4R1VA 5KHXA 2XF0A 3DNDA 1HT2E 5JSMA 1GIJA 1E9SA 3V5PA 1LTMA 1OKZA 4DV7M 3LMHA 4RVKA 4UX9A 3BV3A 3KP0E 4FUXA 5J9ZA 4EH4A 3K2LA 3OY1A 4FSWA 4O7LA 4G31A 4WBOA 4ID7A 4BCNA 2XCKA 4NXMM 2UZVA 4FG7A 2RG5A 3ID6C 4LOQA 3GGFA 2WMWA 3FXXA 4RQKA 4R71A 1K3WA 3A8WA 4IBKA 3LFBA 4KKHA 5D9HA 2XJ2A 3KRRA 3EFKA 2OW3A 2VGOA 3AT3A 4BIBA 2OZAA 4E3CA 4E6QA 2CV0A 4O38A 3DK7A 2OO9A 5JFVA 4M67A 4ZY4A 4EZ3A 3DTWA 2XRWA 3Q4TA 4NTTA 4DGNA 2J5YA 4EYMA 3T9TA 3IW6A 4YO6A 3ORNA 4RLLA 3BBWA 1PHKA 4FE2A 4EBVA 3IQ7A 1Y91A 4FTLA 5EQTA 2FS1A 3HV3A 1FJGM 4DINA 5CY3A 5DYIA 4F99A 3FC2A 3QTZA 5FLXS 3W0MA 1WBTA 4LRJA 2Y0TA 2ERCA 3ALNA 3QLGA 3QCXA 1TH4A 4XCUA 4O7VA 4YUQA 3KFUG 1ZYDA 4DEEA 1AGWA 2DAMA 4BZOA 5IA5A 3PP1A 3S3IA 5M06A 4D1ZA 3K3JA 4R1YA 3D0EA 3FMNA 1YW2A 2YHVA 5L2WA 2O64A 1Q3CA 3ZSIA 5DNYA 3BHUA 2J51A 3QTXA 3C5UA 3RFWA 4EWQA 4FSRA 2G3QA 5EJCA 4JI1M 3VLFB 4ZAUA 1YXTA 4RFMA 1P5EA 3F7ZA 2XZUA 3FKEA 1OAOC 3GOKA 3OVVA 1ZXEA 4J8NA 3OROA 4WHZA 4DFNA 3DXNA 3UJGA 1LEWA 1QDRA 3PP0A 1IR3A 1J7UA 2VX1A 5HTBA 3U6OA 4RX7A 2DZNB 4RIWA 2ETKA 2JIIA 4TYHA 5IQIA 3ZM4A 3TZ9A 2J0IA 3EZRA 3HMPA 4AXDA 4IADA 4CLJA 4E6AA 5K0KA 4LMUA 3HHZA 3C51A 3FUTA 3QQJA 1Z59A 3NAYA 3SD0A 2UW0A 1B38A 3TT0A 4LF7M 2BRNA 3U6PA 4CD0A 3QA8A 5CU6A 2VTLA 4AQKA 2WQMA 3BRBA 4I22A 1BVSA 5AP0A 2F2UA 4IAYA 1UKHA 5GJGA 1R3CA 2X0GA 4JDJA 3U6QA 4AGWA 1DI9A 2WIPA 3KIOC 4C59A 4LF4M 4ANRA 3WOWA 1UU9A 4PMPA 2OXXA 2RFDA 4PTEA 3CR0A 5C8KA 3UO6A 1JR3A 4JG8A 5HOAA 4X2NA 3VHEA 1OIRA 4DR6M 2P4IA 4EL9A 5JQ5A 3GLIA 4YLJA 2C5XA 3PE2A 3A2CA 1SXJA 3UIMA 4QOZC 1AIPC 3U6DA 4FKQA 1P4FA 3AT2A 4G4NA 3D15A 3RPVA 3VK8A 4FTAA 1NA7A 3QX2A 5LVPA 2NO3A 2OH0E 1C1KA 4KABA 1YLAA 2PMLX 4GMYA 3ORLA 2QG5A 4U9AA 2JBOA 3HRFA 4Y46A 4XK8F 4QPAA 2WOUA 4M0DA 5DWRA 3QCQA 1UWJA 3PZEA 2GQRA 4C3RA 4WSYA 1KSFX 5C1BA 4GVAA 3TKHA 3W33A 3VBQA 4PX6A 2OXYA 4D0XA 5AAFA 5JFWA 4LL5A 1JR3E 3LCUA 5AP2A 1H6UA 3GLIE 3J27B 4NM3A 4A4LA 2Q0BA 1SXJE 4DH5A 3OXTA 3E5AA 4Y83A 2Z7RA 3E3BX 4KNBA 3LXKA 3C7QA 3Q4CA 3JPVA 3JY0A 3Q4ZA 3JS2A 1WVYA 3GVUA 4I92A 1XB2B 4I0SA 3M2WA 1IBKM 1Y8GA 2ZM1A 4O1OA 1PXKA 4I4LA 1JPAA 3FZPA 4NKAA 4ZP5A 5HE1A 4FTQA 4FGRA 2CJMA 1XWSA 3M1SA 3TV4A 2UW8A 5DGZA 1ND4A 3SMSA 4GKJM 2L09A 2UZTA 4S32A 4L3PA 3EL7A 3GPXA 4P16A 3BLQA 2XK7A 1RU3A 5DT4A 5FEQA 1A48A 5FTGA 4L45A 4O7NA 3NS9A 3UG2A 5EHOA 3S95A 1ZWSA 3QQFA 2Z4RA 1UVRA 4OTPA 4JAIA 4MUQA 5DFPA 3IPHA 4E93A 5CEMA 4O0XA 2CCIA 3VQHA 4I0TA 2DAEA 2PVJA 3IW5A 1ZMVA 3D5WA 2HKJA 4FIHA 5BYYA 4DFUA 4X3FB 4M9ZA 2WMBA 2UZWE 1FNNA 1UNGA 2BKZA 1PRBA 3L9NA 1PMEA 1PXJA 3A45A 2Y4IC 3SAUA 4DHIB 3QTWA 2VTHA 3UTOA 4HLQA 4IWDA 2ZV8A 3E9SA 4F09A 5C8MA 3I7BA 4R3PA 2A19B 3G0FA 4FKIA 4D2RA 4ZTSA 4DR7M 4BI2A 4Z7GA 5KMOA 4GFMA 2KA6B 4S31A 3W8LA 1QPJA 3OY3A 5EM8A 2QU5A 2XAOA 5KQDA 5CZHA 4DTBA 4W4WA 4I5MA 2WTKB 1ATPE 2WELA 1UFZA 4QNYA 3J7AS 4A9RA 3B2TA 4G6LA 2C6OA 4MD9E 4EK8A 3SHFA 2ESMA 3R6XA 4KSQA 4IJFA 4MHAA 3Q32A 4NH1A 5TKDA 3MB6A 5CT0A 1IXSA 2C3IB 4OBPA 4DBXA 4RJ3A 4IWQA 3DV3A 3ORZA 3PWYA 4YJVA 2E9OA 4X6RA 1Q4LA 2M60A 3CD8A 4BBEA 5LXMA 3GB2A 4YO4A 4JQ8A 4KA3A 1DAWA 3LFAA 3LZBA 2B53A 4GK4A 5JGDA 3HMOA 4KIPA 2PZ5A 3R9XB 3H0ZA 4QDEA 5CSXA 2UVXA 4HNFA 2I0HA 2IPXA 5J79A 1WVXA 4QTBA 3HV5A 1Q8ZA 5L2QA 1J7LA 5A4EA 2RGHA 3BI6A 3EN7A 4L46A 3V3VA 3TV6A 1OITA 5CF4A 4M8TA 5CF5A 2DXIA 4FKSA 3PXZA 3LJ2A 3JVRA 4HCUA 4XS2A 3R7EA 3W8QA 4ALWA 3TDWA 2OZAB 5E8WA 2C9OA 4UB7A 2EKFA 1MJGM 2YERA 3KRLA 5BVKA 3SX9A 1REJA 2ETMA 5HVKA 1R2ZA 5DYGA 4DTKA 1VQ1A 4O4DA 3COMA 1XMMA 4JI7M 2GTNA 4M15A 2YM4A 4FYOA 1OJLA 5HHWA 2GMXA 4UALA 5J95A 3UZTA 3EHAA 2J7NA 2Y20A 4TZRA 5K3YA 3DOAA 4IX4A 4C8BA 1T43A 3JR5A 3VUHA 5LWMA 1N75A 1L2CA 1PRYA 4F65A 5IQFA 2QVSE 3II5A 2R3NA 3EYGA 4X2GA 1MRUA 5M53A 3W0FA 4E8AA 1JSTA 4JBQA 1M52A 3UGJA 2KXEA 3MW1A 1R0EA 3DCVA 1RW8A 5CXHA 4AG8A 5EYMA 1GY3A 4LF9M 1ZOHA 1K82A 2XB7A 4M12A 1IAHA 3ZUUA 5K5XA 4FF8A 2BDWA 3RGFA 3DDQA 3Q2JA 3KULA 4F7NA 2JZ0A 2YCRA 4FL2A 1C7YA 4CFUA 4KD1A 4NT4A 5KUPA 2QOKA 2XKEA 4NSRA 4I6HA 5E91A 5BVFA 4KHPM 1HNWM 3O8PA 3VUKA 5JT2A 4RIWB 4TL0A 3VUIA 3HVCA 1L8QA 3GLHA 4TYHB 3FXZA 3NUAA 4HZSA 5IQBA 4RRVA 5EYDA 3KXXA 2UUCM 3Q04A 4W4YA 2C6TA 2XFTA 5CQUA 3LCKA 2D7GA 3UP7A 3FMHA 4PL4A 5EW9A 3PFIA 3HEGA 4CIZA 2DUVA 3V8SA 3FRHA 5IZFA 3V5TA 5E8TA 2PVYA 2WO6A 4R3RA 3NFFB 3GPYA 3HX3A 2UW9A 5H2UA 1FBNA 3ORPA 4EH5A 5HVJA 3MH0A 2EUFB 3TJCA 1SMHA 2C30A 2XEYA 5FM3A 3UMXA 2UW5A 5ACBC 1Z6TA 3GLHE 2LAVA 3DFCB 3GLIB 5HTCA 3OWPA 2J0JA 1SXJB 3KRJA 2HWOA 3UJNA 1GZNA 4KBKA 3MFRA 3NMUF 1ORYB 3TTJA 4AT5A 3PDTA 4IM0A 2I7QA 3HUCA 4X2FA 3GRUA 5AAEA 4ZSAA 4U43A 2IW6A 2PE1A 3B7NA 4IJEA 2E9PA 4IB1A 4G3EA 4BCIA 5CAQA 3W2QA 4FCTA 3QWJA 2WQEA 2XJ1A 2YIRA 1PKDA 4GFOA 4OTFA 3GC9A 1LV7A 4GG7A 5A6OA 3GU8A 3SHGB 4J7BA 5LMBA 4C34A 5FM2A 4F70A 4QP9A 3TN8A 3DXPA 1T3TA 2B1PA 5EI2A 3LMGA 4AOTA 4EQUA 4A9YA 4RZWA 5IG1A 4Z9LA 1JAMA 4LUDA 5DBXA 3D5VA 1F3MC 2C6LA 5HNBA 1GZOA 5AP6A 5K9IA 3I7CA 2I40A 4AZVA 5IISA 5DRDA 3TZMA 1L2DA 4Z55A 2PZRA 4FKTA 4DDGA 2ITVA 4GUBA 3AJIB 5A4LA 4YLKA 2EKKA 4QTCA 5ITAA 3TIZA 1R78A 1O6LA 3LVVA 3NYXA 4NEUA 5LMKA 4YHFA 2XNOA 2QI8A 3HMMA 3SC1A 5JK3A 5JN2A 4ALVA 4OW0A 3LCDA 1YHWA 1Q61A 4DGLC 4JAJA 5TOZA 2ZAZA 4FTUA 3CE3A 1H00A 4EORA 4LUEA 2C6EA 2KTYA 1DO2A 3BU5A 4E4MA 2ZTCA 2ZMCA 3AT4A 3VW8A 2GNJA 5DN3A 2X8DA 5AMNA 4E4XA 1XMOM 5IH4A 3CSVA 3VKGA 4IM2A 4A07A 4N0SA 4DH3A 4FWDA 2PYWA 1DGFA 1HCKA 1Q8TA 4BDKA 3NYOA 5HLPA 4FZFB 3HY5A 5E90A 2CSNA 4KS8A 5IQCA 2BCJA 4FTNA 3BOSA 4FYNA 3ZRMA 4FW9A 3BBTB 3GLFA 1VG5A 4O4BB 3CQWA 3UMWA 2ITOA 3AD4A 1LEZA 5ITYA 3QKLA 2R5TA 5AEPA 2DZOB 4BC6A 4EH8A 3UVRA 4CTCA 2KZUA 2GCDA 3CGFA 2GNGA 1W5SA 2WSFF 5CF8A 3FSFA 1OM1A 2F49A 3ZONA 3HKOA 4YTHA 4QMTA 4K0KM 1QZEA 2N35A 3PA4A 2XYNA 5LOHA 4JI8M 4IAKA 4ZS0A 1PJQA 5LMAA 5H9BA 3GQ3A 1JLUE 3VULA 2DYLA 2VDBB 2R3KA 1KE6A 2AHMA 1IXSB 3GLFE 4HVHA 3NNUA 4EOKA 3OHTA 4ENYA 3FPQA 4IIRA 1O6KA 2Q0NA 2GPHA 2YDKA 2ACXA 4L00A 4EOQA 4WBBB 1JSVA 3QTUA 4GH2A 3P78A 4DCAA 3U87A 3T6PA 2Q83A 4LJ9A 3E92A 1TH3A 1HJPA 5C9CA 4BCKA 3R8LA 3THGA 5JI2E 2J50A 3SKCA 4DFXE 3MVMA 3KP1E 4FTRA 2VZ6A 3FI2A 3DS6A 1QUSA 5F3WA 3CTJA 3H9RA 2VX3A 3NEWA 4J96A 5KKRB 5I3OA 4CZYB 2YA9A 3E8DA 3G51A 5BVNA 3U51A 3O23A 3HGIA 4IJ9A 4YGAA 4YTCA 4ZSEA 2YFQA 4K77A 3PUPA 4DT9A 3PFQA 4BKJA 1JNKA 4FWHA 5EYCA