1ZMUA

Catalytic and ubiqutin-associated domains of mark2/par-1: wild type
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
313
structure length
293
Chain Sequence
GNYRLLKTIGKGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 92
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmuA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmuA01
4BDKA 4FKTA 3K54A 2XNNA 3PE1A 4HEOA 3NVKI 4EUUA 5M4IA 3MBLA 4S32A 2E2BA 3QU0A 3SA0A 1OI9A 3IG7A 1NY3A 3ZBFA 1WGLA 3Q6WA 2VTHA 4I24A 5EI2A 5HIEA 3DPKA 3C5IA 4YHTA 5CT0A 1JKKA 3BBWA 3F82A 4QMWA 3UYTA 2ESMA 5J87A 3KK8A 5IA2A 4L45A 4ZOGA 2JY7A 4I5PA 1YXUA 2QC6A 3V8TA 2XZSA 4CG9A 2R64A 4NU1A 4PL4A 5DLSA 3ATTA 1YHWA 5CAQA 2W96B 4W4VA 4J98A 4XS2A 4DEIA 3UC4A 3OY3A 4FG7A 3N4VA 4R7IA 3C0HA 3EH9A 2R7IA 4YC8A 1ZYCA 4BGHA 3BLHA 1JKTA 3E62A 4K8AA 4WBOA 5EM5A 5LCJA 3DOGA 2J9MA 3OROA 2A2AA 4F09A 2BZHB 4IVCA 2C6OA 4F9BA 3BV3A 3ODYX 5M4FA 3QWKA 3AD4A 3LVPA 2ZMDA 3FL4A 3NW6A 3QKMA 4FNWA 3SOAA 3SXRA 1DI9A 1Z9XA 3BQCA 3P08A 4RJ7A 4CFFA 2XNOA 3DTWA 1ZYDA 2Z7SA 4TYHA 4WP2A 5IPJA 2UW4A 2DAEA 1J1BA 1KE8A 4ID7A 4XRLA 2XBAA 4NM3A 4WUAA 4F7LA 3TNWA 4EK8A 1PRYA 2DYLA 3MA3A 4O6EA 3U9NA 4ASDA 3FDNA 3EQGA 2L4FA 3QYZA 3MMPA 1H08A 3H9RA 4G3FA 4II5A 4AT3A 4CCUA 5M06A 3D7TB 3V3VA 1YRPA 2H6DA 3HUBA 4MD7E 3R7IA 1RDQE 5L8KA 5HX6A 4K1BA 4OW8A 1YXTA 4U6RA 2XM8A 2BWBA 4FTIA 2YZAA 3FUPA 2JFLA 4H1MA 2BHEA 4YZCA 1H01A 3VJOA 3C9WA 2WTVA 1O6YA 1OBDA 3GU4A 4AX8A 2CGUA 4BDEA 1DV0A 4IWQA 5FWKK 5HNIX 3ZH8A 1KE5A 3EIDA 4RQKA 2JDSA 2ZM1A 3MB6A 4BVUA 2OXXA 3PJ3A 2UW8A 4YHJA 3KXGA 2WQBA 1TQMA 5L6WL 1SVGA 4C0TA 3S1HA 4TW9A 2ZM3A 1TR8A 2ETRA 2VO3A 5H3QA 4F1TA 5IDPA 1VDLA 2OG8A 4M69A 4QNAA 4EK4A 5C8KA 3E64A 2CGVA 3QBNA 5ANGA 4DINA 4DH5A 5J79A 4KIOA 5KMLA 2OIQA 4RMZA 2PHKA 2WMWA 3A4PA 4DFZE 4YZBA 4K77A 2BALA 1ZYSA 5CU3A 1P4FA 3QHWA 2JUJA 3HP2A 4JG7A 4QYFA 2I1MA 4U5JA 3G51A 4J71A 4ZK5A 4FE2A 4YLJA 2QU6A 2PMOX 2WEIA 3EHAA 4IVBA 4X2FA 2RFSA 3TV4A 5JFVA 3F5XA 4IAAA 4OR5A 2PVMA 2R0IA 4CV8A 2OZAB 3UOLA 4HCUA 4PRJA 5JZJA 4C58A 5HI2A 2CMWA 4HYSA 4YZDA 2Z7QA 4UMPA 5ANIA 2HK5A 2ONLA 5CAVA 3PLSA 4JBVA 4Z55A 5HX8A 1UNGA 3PVUA 3GU5A 4ANSA 4IAYA 4BCIA 3DLZA 4F7JA 4FTMA 4CD0A 1LR4A 2HWJA 3BYSA 5HLWA 3LPBA 4YTHA 4TNDA 4RC2A 2XJ1A 3LFCA 2HZ0A 4G3DA 3VUTA 1IG1A 3LFBA 2UVYA 3ZFYA 4BYIA 2CKQA 4IWPA 3FEGA 4K0YA 2OKRA 3PA4A 3TXOA 3HMNA 5EYDA 1ERKA 5EI8A 4ZTSA 4RA5A 2UUEA 2PYWA 4D55A 2XEYA 5AM7A 5M51A 4FGRA 2EXCX 2YIYA 3W2SA 4YURA 4F4PA 3OCTA 4QP9A 2KNVA 4Y83A 4ZTHA 4CYIA 1JLUE 2J6MA 2XK7A 5C1QB 5I9ZA 4IACA 4CRLA 4HGLA 3CR0A 3EFWA 5BPYA 4YBJA 3LZBA 3BHTA 4EUTA 2Y4IB 1VG5A 4IDTA 5A14A 3S00A 2ZTDA 1KE7A 4FI1A 4O22A 2FUMA 3SG8A 2FH9A 3ORNA 3Q9WA 2A4LA 1YVJA 4A9TA 4HVSA 1YXSA 5I3OA 4N0SA 3GU7A 3OBGA 2L2DA 3KQ7A 4PDOA 5C27A 4CZYB 2XIXA 5BNJA 5CANA 3E46A 4MVFA 4GFMA 2EU9A 3KXZA 4IB1A 5KNJA 1IASA 5IA0A 3I5NA 2G2HA 1HQYE 4FKGA 4HZRA 4TRLA 4CT2A 2QVSE 2BZIB 3WZEA 4D5KA 4RJ4A 3RZFA 2EB2A 2XNEA 3NNXA 2F9GA 4I6QA 3CD3A 3EKNA 2REIA 3SW4A 3MY5A 2IW8A 4WG4A 4MNEB 1OZ1A 2VD5A 3G5DA 3MN3A 2OK1A 4RIYA 4P5QA 2GQGA 4PTCA 4EOQA 5HORA 5HLNA 2B1PA 1H1WA 3UPXA 3DB6A 3R9OA 2OXYA 1OL6A 3ENHA 3LAUA 3DAKA 4L53A 2R3HA 3PRFA 2BVAA 4KKGA 4MAOA 4FIEA 2WKMA 4KBCA 5J95A 5DT4A 2YM6A 1K3AA 1GZKA 4JT3A 4F9WA 4FZDB 4TWPA 1SVHA 3EJ1A 3DT1A 5B2LA 4ZZMA 1A48A 3P79A 3QRKA 4FTTA 4HCTA 4EJNA 4CKJA 1G8AA 3BLQA 4FR4A 4YC6A 4FTOA 1OUYA 3PG3A 1FMOE 5M07A 2XCKA 2XA4A 2X8IA 2XS0A 2X4ZA 4I92A 3DFCB 3IDPA 3DK7A 3LFFA 4FNXA 4FUXA 4JX3A 4L7FA 3ACKA 3VF9A 4ZTNA 4ANBA 1DO0A 2OGVA 2VWYA 3KB7A 4M8TA 3QZGA 3ZZEA 2ZV2A 4BDFA 4C62A 3MVMA 1A9UA 4FA2A 3L9NA 1VR2A 5HQ0A 1YI4A 5CALA 3AXWA 3KGAA 1U4DA 4FG9A 4OBQA 4M84A 4PPBA 3SAYA 2UW7A 3EFLA 3MV5A 4F6UA 2PUNA 3NMUF 5AUYA 1H27A 2BR1A 2VGOA 3KA0A 4MEDA 4C2WA 5LVLA 5CEIA 4CTBA 3E8CA 3CXWA 2VTRA 4MNFA 4Q5EA 4LGGA 1W0XC 4F1OA 4ZTQA 3R83A 3V5TA 4KIKA 3UJGA 1UKIA 4AZWA 5H8EA 2FSTX 4J8NA 2YCFA 1YDRE 4S34A 3JUHA 1YXVA 2QI8A 3KEXA 2BTSA 2W17A 2BKKA 1LPUA 2Y6MA 3W10A 3R9RA 2VTOA 2QOLA 4YBKA 3UE4A 1FVRA 5JGAA 5AMNA 4BY9E 4G34A 5HIDA 4ACDA 2ITPA 2R3OA 5JGDA 5FTQA 5JGBA 1JPAA 4BBMA 1MQ4A 5KKRB 5HG7A 2E9OA 4QYYA 3AOXA 5AP1A 5J8IA 4IC7A 4D0WA 1XO2B 3DZQA 4AU8A 3DBFA 4BRXA 5AAEA 4AGDA 2VWXA 5DBXA 5HGIA 4CQEA 3E88A 2YZLA 4UWYA 3LLAA 1JOWB 4KUJA 4CKIA 2X6EA 4WKQA 3THBA 5ICPA 4ACHA 5L2SA 3QGWA 4QP7A 3COMA 4FT7A 4IQ6A 4QMMA 4LL5A 4U0IA 3KC3A 4J7BA 3NYOA 3PWDA 2R0UA 2QQ7A 4GEOA 5K4IA 3QCQA 4TY1A 1B38A 3KXHA 4FK3A 4YJNA 3BQRA 5AR7A 3P78A 1BL7A 1OKVA 3I60A 4AE9A 3W33A 2YERA 1FQ1B 3V5LA 1H25A 4R7HA 2QHNA 4TKSA 2J50A 3DJ6A 4ASXA 5KMJA 3QXPA 2O25A 3DKFA 3EFKA 1WGNA 2PE1A 3COKA 2VWWA 2W1HA 1IA8A 4B7TA 4F0FA 5C26A 3I81A 5JFXA 2PULA 4ZY5A 4DBNA 3TUCA 4O0RA 5FG8A 1G4AE 4MWHA 4GFOA 4A7CA 2C3LA 2C0IA 2BRNA 5EW9A 5CX9A 5F9EA 1YOMA 4X2GA 3VUGA 3QQFA 2GFSA 5FRIA 4FKQA 5BX0A 1T6OA 3TV7A 4BKYA 4FKLA 4G6OA 1BKXA 4GV1A 4V01A 5A46A 1OKZA 5CF4A 3OT8A 2BCJA 3TIZA 5AEPA 3QQJA 4D58A 2GQRA 2I7QA 3SDJA 4EHVA 4AN2A 2W5BA 3R2YA 2AC5A 5EM6A 4AF3A 4FX3A 2IW6A 5HG9A 4AN9A 3KF4A 4I5MA 2B52A 1HJPA 2W1EA 2PY3A 4JIKA 4QP6A 3BU6A 4L6QA 4OTDA 3DXNA 5DPVA 5AX9A 1VEJA 2P3GX 3LXKA 4PUZA 4PP7A 5ITAA 4QPSA 1OIYA 3VS5A 3PY0A 1Q24A 1H0VA 4O0YA 5EKOA 2JIIA 2Z02A 4JDHA 3P7AA 4O0VA 2QHOB 4NTTA 5ANOA 3U9CA 4BL1A 2VTJA 3VWAA 3EL7A 5CSHA 4R78A 5C9CA 4DEEA 4O7LA 1RE8A 3AT2A 4GJ3A 5BVFA 5F94A 5LMKA 5EW3A 1WBVA 5CEMA 4X3FB 2BRMA 4L42A 3UQFA 3BYVA 3R71A 3FMKA 3RBWA 3H10A 3UNKA 4E26A 2C4GA 3R02A 4A4OA 2OI4X 4E7WA 1VEGA 5HTIA 2F57A 3QTQA 3KXNA 2G1TA 3Q3BA 3G33A 1DAYA 3FLWA 4E3CA 2CKPA 1V0PA 1URCA 1RJBA 3M2WA 3QRTA 2OW3A 3KMWA 5LWMA 3PDTA 1SMHA 1JAMA 4FVRA 5E1SA 5IMXA 1APME 4QYHA 3F3ZA 4WRGA 4EC8A 3L9MA 4AGUA 2GFCA 3A7HA 2G2IA 2J0MB 3TNIA 4BN1A 1RQQA 4QO9A 1H28A 4H3BA 4HVHA 4YHFA 4O81A 2V7OA 4DT9A 5JRQA 4UB7A 1W7HA 2P33A 4NKSA 4YLKA 4YR8A 4O82A 1U5QA 4KRCA 3ZLYA 5HD4A 4ZS4A 3MFTA 3GLIE 2ZAZA 3UOHA 2LGCA 4EH8A 4EONA 4ZLOA 5BVOA 3FI8A 5M08A 1OPJA 2ETKA 5JT2A 3TTIA 4O6LA 5HBJA 5KMOA 3BZ3A 3RCJA 3HMIA 3QCYA 4QQJA 5GZ8A 1J1CA 5FP5A 1U54B 3UVRA 4DGGA 3HAVA 5AAFA 3TNPC 3CY2A 1VEBA 4D9TA 4IFCA 1H1QA 1JWHA 3M11A 3PIZA 3O17A 3RPYA 1MUOA 3DJ5A 4X7QA 5G6VA 5CF6A 2XK6A 5BVKA 4MTAA 3UZTA 2K0BX 1GZ8A 2XYNA 3EQRA 3L8XA 5B2MA 4GYIA 5HE2A 4XMOA 4QMZA 3QLGA 4ZIMA 4EK6A 4PL5A 3CS9A 4QYGA 4ERWA 4D2VA 3SXFA 2QOBA 2W4JA 2WMAA 1PYEA 3MJ2A 5HE0A 3NSZA 2XMYA 1BI8A 4M0YA 3PIXA 4ANNA 3QWJA 4P5ZA 4IH8A 4MXZA 3R04A 3SOCA 4AT4A 5LWNA 1XH4A 1Y8YA 5M57A 3U54A 3GLFE 2OJGA 2K9DA 3OW4A 1PMVA 4EOJA 3OEZA 2QODA 5EQPA 2BFXA 5D9HA 2JDTA 4AZTA 3GLHE 3NYNA 2BRBA 3QUEA 4OTIA 5HIBA 4G6NA 3F3WA 3VUIA 5KHWA 1F0QA 2QOQA 4NEUA 4YC3A 3WBLA 1JVPP 2VAGA 1Y6AA 2OJFE 3B8RA 1DI8A 3KXMA 2W0JA 5F1ZA 3PPJA 5IEVA 2XRUA 3ZSGA 3DY7A 3BLRA 1TVOA 4XBUA 3SRVA 3W18A 1H26A 4G31A 4E5WA 4IIRA 5HVJA 3MVJA 4DBGB 3UYSA 3BRBA 2VU3A 2ZV8A 1SVEA 3POZA 4TNBA 3GCPA 2QSFX 2R3IA 2WQOA 3F5UA 2R2PA 2IO6A 3IDCA 3TIYA 2R3FA 5A6NA 1P2AA 3HVCA 2Z8CA 2BKZA 4GT5A 2WTDA 4LI5A 4PMPA 5GJDA 3ZUVA 5C4LA 3KCFA 4RFMA 4KABA 3HX4A 3EN4A 4EZ3A 3MESA 3RNYA 3KMMA 5AV4A 2F7EE 3QL8A 5IQBA 2IVVA 2BIYA 5DG5A 2C6TA 2XNMA 4UY9A 3A7FA 2H9VA 4NZWB 3VO3A 2JAMA 5M4UA 3FI3A 3QYWA 4PNIA 5KMIA 4U3YA 3P4KA 4NW5A 3U8WA 4O0UA 4AGWA 3LCKA 3QQKA 4O7WA 1WBNA 3AD6A 3AG9A 3KCKA 3PG1A 4FTAA 4AZFA 2F2UA 4WT6A 4DFYA 3NCGA 3P7BA 2HW6A 4FKWA 3IKAA 1G5SA 5H8GA 1TKIA 2XNGA 3DJ7A 4CFXA 3W2CA 1Y57A 2IZUA 1WZYA 4RPVA 4APPA 5JQ5A 2I40A 3RVGA 3TKIA 4HGEA 4FT3A 4I1ZA 4O0WA 4C7TA 4ENXA 1H1PA 4FNYA 4FV0A 4TWCA 4KSQA 4Y72A 4BB4A 3W1FA 3WE8A 3WZKA 3COHA 2V5QA 2CDZA 3RPSA 2VTNA 4FVPA 4BHZA 3IO7A 4I3ZA 5I4NA 3R6XA 2CGWA 3JXWA 4JI9A 3MB7A 5DNRA 5HNGA 4EQMA 3NUUA 3F2RA 3LKMA 4QP4A 4R3CA 2C3KA 5CZHA 5IA3A 2IZTA 5KMKA 2XP2A 2YFXA 4FIHA 4LOOA 2RG5A 1SYKA 2G15A 5EOBA 2MGWA 2PMNX 1GNGA 3D15A 4FTQA 2VX3A 3NYXA 4GMYA 5DRBA 3QTXA 5E8SA 4BDAA 4L67A 3RKBA 4F0GA 4Y95A 2O63A 3PZHA 2C68A 3LFAA 4NM5A 2BZJA 4LOQA 4IVAA 1REJA 4GK4A 5AP7A 4DEGA 3ZO1A 2UW5A 4M12A 4MK0A 4RIXB 2ITXA 1H0WA 2VNWA 3E8NA 2XUUA 3PA3A 2JFMA 2YLEA 4XP3A 4EJ7A 2RGPA 1Q5KA 5T68A 4FUYA 1OKWA 4JOAA 4AFEA 3MPAA 5FBOA 1U59A 5HO6A 4EK5A 1HCKA 4CFMA 5A4EA 4UX9A 2F4JA 2OU7A 1F3MC 1YQJA 4I6HA 2EXMA 3UQCA 4FIJA 3GU8A 2WHBA 3PVGA 4FV6A 5FGKA 4ALWA 4JLCA 2WOTA 2UZVA 4IMYA 3A8XA 4UXQA 5HBEA 2C69A 1ATPE 2XCHA 2JP7A 1HT1E 2R7BA 3FZOA 2I0EA 5GZAA 4C8BA 5IQDA 5CVHA 3IW4A 4LG4A 3WILA 4WG3A 4U44A 2HOGA 4Q9ZA 3WIGA 5IQHA 4XG8A 3ZXZA 3N4UA 1QPJA 1NVRA 1SNXA 3CQEA 4MXCA 5FM2A 3IGGA 3UZPA 2QG7A 4KRDA 1R0PA 4XP2A 3H4JA 5CT7A 5HTCA 2J5FA 2HWOA 2WTIA 4YJUA 3D7TA 1XH5A 4JVGA 4KINA 2ZB0A 3D9VA 1C7YA 3R01A 3B2TA 4GU9A 4M13A 5DR9A 2CPKE 3AC5A 4TT7A 4KS7A 3SHEA 3LFNA 4EH7A 5LMBA 4FYOA 3G9LX 3UG2A 4LGDA 4O21A 4IAFA 4JAIA 1J3HA 2F49A 4FL3A 1URWA 2XKCA 4YO6A 4O0TA 3QCSA 3E8DA 3M42A 4YP8A 3RWPA 5FEEA 4H1JA 4XHKB 2BIKB 4AT5A 4N57A 5FD2A 1Q8WA 2UZWE 2LVNC 4O7TA 4WD5A 5CTPA 1HOWA 4RWLA 2B9JA 4E4MA 5FEQA 3EB0A 3OG7A 3U6IA 4C35A 2ZM4A 3A2CA 5AIRA 3DKOA 4RX9A 5IEXA 4WNPA 1P14A 3EQHA 3IW8A 2WZJA 4MHAA 3O0GA 3QHRA 2NRYA 3BIZA 3FBVA 3LM0A 3BKBA 1O6LA 3C50A 3HKOA 2XBJA 3MSSA 3COIA 3KL8A 4FSQA 4XV9A 5CI7A 5EOLA 2HZNA 2OXDA 3RM6A 2IW9A 4QP2A 3TG1A 4GW8A 4D2SA 4ZMFA 2XF0A 4DLIA 4AW2A 3CTJA 5M4CA 3ZLSA 3JY9A 2CSNA 3HZTA 4ZJJA 3OEFX 2OIBA 2X0GA 3WYXA 5FDPA 2PE0A 3LQ3A 3SV0A 4DH7A 4GKHA 1Q41A 4MX9A 3V5JA 4FODA 3WOWA 2OZAA 3PXKA 3CGFA 3H9OA 3Q32A 4QRCA 1J7UA 4Q7JA 4GU6A 4YPSA 3UQGA 3VHEA 2QOFA 4BIEA 3FLNC 3HRCA 3ID6C 3R8UA 1OKYA 3RK5A 1NV9A 4AG8A 3UIXA 1M17A 5FXRA 5FXQA 2XVDA 3Q5IA 4WA9A 4LL0A 4EKLA 2EB3A 4C34A 3V6SA 3E3BX 1M14A 1UU9A 4IE9A 4MBLA 2CHLA 3K9PA 2ERKA 3UP7A 5AUUA 1QL6A 3N51A 4FV4A 1FGIA 3C5UA 3FXZA 1M2QA 2X2KA 3RK9A 3MW1A 1OL7A 3CTHA 4LMNA 5AR2A 5ACKA 1E94E 2E9PA 4ACMA 4DGOA 3AT3A 3EKKA 4W4YA 1UU7A 4JDJA 5CNNA 5F20A 5AUVA 1H24A 2OFVA 3FKLA 5HVYA 4X2JA 3HDNA 2PZRA 1JBPE 1IEPA 3D2IA 3ORXA 2YM7A 4JBQA 5E8VA 2X4FA 3Q9YA 1P4OA 2A19B 2GS6A 4N70A 2I0YA 1V1KA 4ANMA 1VYWA 4JRNA 5CNOA 5DHJA 2CLXA 2PVYA 4U80A 4DTBA 4EOOA 5BMMA 2AYPA 5HEZA 3EYGA 2YITA 1ZYLA 2BDJA 1XQZA 2C1AA 3GUBA 4M66A 3ZZWA 3EQDA 1MP8A 3R00A 1H07A 3BHUA 3EN5A 4IBMA 4RSSA 3KY2A 3BBTB 3GQLA 2XIRA 3SC1A 3U87A 4M7IA 2JITA 4BTKA 3PSDA 4D2WA 5EHYA 1P3QQ 3E87A 3HV4A 3QALE 2KTYA 4AZSA 4CLIA 3SVVA 3ZM9A 4R1VA 4NK9A 4F99A 5M53A 3PLAE 2FO0A 2VZ6A 4BKJA 2C30A 2GS2A 4R3RA 2PMIA 4LRJA 3FWQA 2ITQA 3DGKA 1R0EA 3Q04A 5FUTA 2BILB 4CTCA 5IF1A 2VO7A 2IZSA 3NLBA 2DAGA 4MNEA 3UMXA 4EBVA 3TEIA 3BPRA 3KXXA 4DFBA 3DKCA 4IB0A 2WTKC 5L2QA 3FZPA 1BX6A 4U97A 3R7VA 5HKMA 4NW6A 5KO1A 3MFRA 4L00A 3QA0A 3CC6A 4CFNA 1U5RA 2PE2A 4NKAA 3U4UA 4E6DA 3D4QA 4EOSA 5ETFA 1H1SA 2HZ4A 5A9UA 3C4WA 3FKNA 3MPTA 3KU2A 5EH0A 4G17A 3MI9A 5BYZA 4QMYA 1ZRZA 4NJ3A 4NL0A 3KF7A 4ZLYA 4CLJA 4YNOA 5AM6A 4CT1A 2L4EA 4HYIA 4W4WA 2ITWA 3AC2A 5IQEA 2O0UA 4CYJA 3RTPA 2W1ZA 4I41A 1JKSA 3MFSA 4CGAA 1TQPA 3PIYA 4U81A 4IVDA 4MQ1A 5ETAA 5EM7A 1H1RA 2C5VA 2B4SB 3O96A 4FEQA 4KB8A 3V6RA 5M44A 4TYJA 3R9HA 2LVPC 1IA9A 4PDYA 3FLZA 4UN0C 3FC2A 4GT4A 4L7SA 5EFQA 3O8PA 4JDIA 4F63A 5I9VA 5LOHA 4J1RA 3QRIA 2YIQA 1ZOGA 4JR3A 3TCPA 5GIOE 4HVIA 4X2NA 5KZ0A 5HO8A 4ZS0A 4ITHA 4DCAA 3KN5A 3Q4CA 1IM2A 5HTBA 3RPRA 3KRLA 5DH3A 4ZTRA 4JBPA 4F7NA 2HXQA 3E5AA 2R3GA 5AR3A 4AOJA 3S0OA 4XYFA 5AUXA 2PZPA 2Z60A 4MD9E 3BYMA 3I7BA 4FKUA 4OTPA 2OZOA 3JY0A 2UVZA 3K3JA 2QG5A 5FDXA 3T3VA 3QQUA 3JVRA 3CLYA 3FSKA 2ETMA 4ZJIA 4BI0A 4EH6A 4HVGA 5AA8A 5IMEA 2FGIA 4BGGA 1OIRA 2EKKA 2IN6A 2R3LA 3I0QA 4HCVA 4R1YA 3P0MA 3MIYA 4TWNA 3W8QA 4EOPA 3VN9A 4E93A 3V8SA 5EM8A 5JEBA 5L6OA 3C1XA 3V5WA 3ZSIA 4IC8A 5LXMA 1NV8A 5JFSA 4XG6A 4EH9A 3CKWA 3CBLA 4KIQA 4IW0A 4ANLA 3NEWA 3DXQA 1CKPA 3LW0A 1R1WA 4EQUA 3AMBA 3TUDA 5TF9A 3LMIA 2HENA 2NPQA 4GVAA 4L44A 4OTWA 4BZNA 4P7EA 3HNGA 4F6SA 3NNUA 3ETAA 4I23A 1XB2B 1GY3A 2Y4IC 3CTQA 4RWIA 4YNEA 3DBCA 3W16A 4A06A 5IDNA 2UZNA 5AWMA 2J0KA 2MR9A 1WMKA 4AOIA 4DF3A 2Q83A 4DLJA 2QURA 2R3RA 2WAJA 4K18A 3A99A 3CPCA 4E1ZA 1NT2A 4XG7A 3DAJA 4A4LA 3PXRA 4QTAA 4HZSA 3UO4A 3VUMA 3IK3A 2W7XA 4TYIA 5CYIA 4F2LA 1LEZA 1Q97A 3OXIA 3D83A 3FMEA 1YOLA 4DEDA 3R63A 2DWBA 2YAAA 5DR2A 3CY3A 3R8MA 4CEGA 3HV3A 4PTGA 3A7GA 1GAGA 4FSWA 2XNPA 2ITZA 3IW7A 4Y5HA 4NCTA 3I79A 3LFQA 4RC3A 3R7OA 4HGTA 1VEKA 3F6XA 3TJDA 3DV3A 3BHVA 3UBDA 1KE6A 3IOPA 4AN3A 4K2RA 4FTUA 1FBNA 2B9FA 5DWRA 4QPAA 3N9XA 4FTLA 2GNHA 4YU2A 4RWJA 1YLAA 3R22A 2VTIA 4RVMA 3MY0A 3RAKA 4YTFA 5I9XA 5DOSA 4FEWA 4D4VA 3NW7A 4F65A 5C8MA 4CFUA 1KWPA 3PY1A 1H00A 1DM2A 2DHYA 4XLVA 4UZDA 4OAVB 3PP1A 1KOBA 4OGRA 4I6BA 2OO8X 3C4CA 4FSUA 1GZNA 1T45A 2ITUA 3DU8A 3VS1A 5HE1A 3LCVB 5E8ZA 2YDKA 3PJ8A 2WPAA 3ZLXA 3OHTA 1KE9A 4OTGA 1HT2E 3FI4A 2ZDUA 2ITTA 2XNBA 3GCVA 5HG8A 2VRXA 3E21A 1OPLA 2YEXA 3BU3A 4AAAA 3G2FA 2XYUA 4QMPA 2JY8A 3VS0A 4YMJA 5J1VA 4PMMA 3B89A 5CENA 2E9VA 2ITYA 3A7IA 3I7CA 2VTLA 5ANDA 4IANA 3FL5A 4X3FA 4UEUA 3R9NA 4FZAB 3FPQA 4M69B 3F61A 3RPOA 4FSYA 4JJRA 4PQNA 2Q0NA 1V92A 3EQBA 4PX6A 3W2OA 2VTAA 3HGKA 3FZSA 4U79A 3RHKA 3ULZA 2C3JA 2ONLC 4LMUA 3U4WA 3WARA 1XR1A 4FOCA 4M68A 4BBEA 3BHHA 3ZTXA 1LEWA 1H4LA 5LVPA 1FVVA 2J5EA 4ENYA 4ALUA 5IA1A 4XX9A 2QONA 5AV1A 3FMNA 4BDGA 4YPDA 2YIXA 3BYOA 2UZEA 2Y0AA 4YSJA 4PF4A 1W8CA 1CM8A 5CF5A 4ANOA 3QC4A 1OKSA 2GNGA 3QF9A 4I4FA 1W98A 1ZMWA 2FA2A 1Q3WA 2JBPA 5CS6A 4O1OA 3PTGA 3QC9A 4TL0A 4IB5A 4FZFB 2B0QA 4KA3A 2XH5A 4L68A 4V04A 2PVHA 3LJ1A 3D5VA 4YTCA 5KKRC 3Q60A 2VTTA 2EUFB 2P55A 2W4OA 3AMAA 3CE3A 3F3VA 3ANRA 3ORLA 3R7GA 4L43A 4EOLA 3TI1A 2GQSA 3BE9A 4S33A 3SG9A 4BTMA 3NRMA 1U54A 2PVFA 5EDRA 5IQGA 3QLFA 3O23A 4GG5A 3PSBA 3HDMA 4F9CA 3FHRA 1I44A 2JDVA 2ITVA 4BKZA 4R77A 2W05A 4HVDA 1A06A 4U43A 3GEQA 2XIZA 1REKA 2C6LA 1CSNA 3Q9XA 4UYNA 3UVQA 4EOMA 4USEA 1NW1A 1OL1A 4U41A 5ACBC 4KSPA 3I5ZA 4XLIA 1Y8GA 3OTVA 4IB3A 4XCUA 4AOTA 2MJ5B 4FV3A 2QOKA 3FMHA 4JXFA 4A9UA 4OBOA 3SKCA 2B9HA 2R3MA 2OJIA 3DBEA 3LLTA 1AIPC 2LVQD 4QMSA 1OIQA 4O7RA 4N4SA 4UMTA 1M7QA 3PSCA 4IJPA 1W82A 3QFVA 3HRFA 4NCTC 4DFUA 4GYGA 3T9TA 3VNTA 4CG8A 5IISA 2R3JA 1VYZA 4FTKA 3ZSHA 3E3PA 3GOPA 3G9NA 3HV6A 4ANQA 4C4GA 2VX1A 2JKMA 2JGZA 2GTNA 5JRSA 3UIMA 4LV5A 2XB7A 3OWKA 3ZC6A 3WI6A 4Z7GA 4EHEA 1FOTA 5BUJA 4TN6A 4HNIA 3EFJA 1CMKE 3SXSA 1AQ1A 3VS6A 3NDMA 5AP6A 2O64A 4FZ6A 4U3ZA 4RVTA 3U6HA 1PXJA 3FC1X 3LM5A 4DTKA 2QOOA 3DKGA 4ZZOA 5BUEA 3LMGA 2E9UA 2UW9A 2BHHA 4YJOA 5DGZA 2EJSA 4FBXA 3U51A 5KUPA 3EQCA 1WBPA 3OOMA 4XRJA 4BZOA 4IZAA 4RC4A 3ZRKA 4D4YA 1GZOA 2RF9A 4BIDA 2OICA 1J7LA 3LQ5A 4FC0A 5HD7A 3NGAA 1XBAA 3HP5A 3RP9A 3HAMA 4DH1A 5CAOA 3AQVA 3FE3A 3Q5ZA 2CN8A 2P2HA 4QMTA 2BPMA 2J90A 5K5XA 4GH2A 3ZEPA 3FQEA 4UWCA 3FKOA 1R39A 4WSQA 3RWQA 1ZZ2A 1XH9A 5TKDA 3E92A 3IDBA 2J0LA 2X2MA 1DO2A 2W9FB 1OVEA 3VS7A 2KNZA 3ZUTA 1GO5A 3POOA 3WF8A 5IU2A 5JN2A 3O2MA 4M14A 4E6QA 4DBXA 3E7VA 1VQ1A 4LV8A 4ZTLA 4NM7A 5AV3A 3UMWA 5J7BA 3QTIA 3GT8A 3BU5A 2OSCA 2OLCA 2CKEA 3H0ZA 4BDIA 2XIKA 2V0DA 4PMTA 1Q8TA 5BMSA 2PUPA 4EC9A 4LUDA 3OD6X 3UGCA 4D4SA 4QTEA 4AA5A 4O27B 2R5TA 5AV2A 5AP3A 1WVYA 5DIAA 4X6QC 4MWIA 2WOUA 2BDFA 4R8QA 5BVDA 3Q53A 4P4CA 3PXZA 2VTQA 5E7RA 4DFLA 3NUPA 4DC2A 3FPMA 3OWLA 3GENA 3S3IA 2VX0A 4E6CA 2RL5A 5JI2E 3HEGA 3CJFA 2R3PA 1QMZA 1ZY4A 3FLSA 1T43A 3R8ZA 4IAIA 1BVSA 3ENMA 4L3PA 4ACGA 4DYMA 4ZJVA 2UZTA 3DK6A 4H39A 1UNLA 4XOYA 4KWPA 5EDPA 5F95A 3A60A 5KMMA 4BWPA 4G3GA 2QR8A 2ZB1A 5ETIA 5GJFA 5I9YA 3QA8A 1KV1A 2UW3A 5CU6A 4OT6A 4RIXA 5IQFA 4XOZA 4MD8E 1OITA 3MDYA 4FSRA 4FKOA 3R7UA 3CEKA 1OMWA 1ZAOA 4O0SA 2EWAA 4RIWA 2YWVA 5A4CA 2XKFA 3EQFA 5J9LA 2IZRA 2Z7LA 2WMRA 5L4QA 2PPQA 3RI1A 1IFYA 5CQUA 4X3JA 3LJ0A 1K2PA 4HNFA 5I5ZA 4BWKA 2OJ9A 2CJMA 1PKDA 4EQCA 2XIYA 3JVSA 5AAGA 1AD5A 5H9BA 2VTSA 3BGPA 4ERKA 4R7BA 4BCKA 5CSWA 4FKJA 5IA5A 2W5HA 4KKHA 2CNVA 5TE0A 1E9HA 4JR7A 5JH6A 1ZLTA 3QQGA 1Q8UA 4YGAA 4LQMA 1KOAA 3ANQA 2WB8A 1SNUA 3AC1A 3V5PA 4JG8A 3NCZA 4IZYA 3FMLA 4EH2A 1BI7A 4WOVA 4I20A 4M0ZA 3R1SA 3F3TA 3EQIA 5CEOA 5LQFA 3PFQA 4FSNA 4FIGA 3DLSA 4FKVA 1O6KA 3JR1A 2Y9QA 3SGCA 2OH0E 4AW1A 3DXPA 2OH4A 3TDWA 3MVHA 4PNKA 3PY3A 4Z16A 3BELA 3FMJA 2O3PA 1PJKA 3ITZA 4BDJA 3F92A 1Q4LA 5DN3A 3ZXTA 2OOBA 4YTIA 3TZMA 3VAPA 4L9IA 3GFWA 2OFUA 3VBXA 3OCGA 2JKQA 4J52A 4K11A 4MCVA 4RT7A 3F2AA 2J2IB 4EHGA 4RX8A 4NJDA 4FEUA 1G3IA 5LMKC 4RX5A 4FT0A 1OECA 4HJOA 4K33A 4HOKA 3BWJA 3MYGA 5IH4A 2XKDA 1L8TA 3KULB 3AT4A 4Y85A 4F0IA 2GMXA 4L3LA 4YJQA 4Y73A 4DEHA 2Y8OA 4Y46A 3KRJA 3L8SA 4OTHA 4FKSA 2C1BA 3JYAA 2YIWA 4C4FA 2X7GA 3ORPA 2CN5A 3F5GA 3O50A 4D4RA 5EKNA 2PZIA 5F4NA 2UV2A 5CI6A 3S4QA 4MF1A 5HU3A 3V04A 3F66A 3FI2A 4E20A 2W1CA 3Q9ZA 1BUHA 4ONAA 4S2ZA 4Y8DA 5IG1A 4BCFA 2XK9A 4YJTA 5E1EA 3U6JA 5CVFA 4KD1A 2PVJA 3BV2A 2QKWB 4UXLA 3WZUA 2W4KA 4GIHA 4QMLA 4G5JA 3T8OA 1R4GA 5DFLA 3FMDA 5DI1A 2FB8A 3DNEA 5DVRA 2ITNA 2X6DA 4PPCA 4RA4A 2GU8A 4ASEA 5AFVA 1PXIA 2GSFA 1WAKA 2HZIA 3C0IA 3OC1A 3T6PA 2F2CB 4B4LA 2O2UA 1F5QA 3FXXA 3PJCA 2Z7RA 4R5YA 3IW5A 3S2PA 4CQGA 5AR5A 1J91A 2W99B 4KIPA 2RFNA 3BX5A 4M3QA 4JQ7A 1UNHA 1UU3A 2J0IA 2GPHA 4XJ0A 2ZTCA 5DA3A 4JDKA 2WMBA 4X21A 1IR3A 4AA0A 3F7WA 3FSFA 3MFUA 1BLXA 4BFMA 4EH4A 3QTZA 2UW0A 3LQ8A 4O96A 3UVPA 2QCSA 1XXHE 2GHMA 2P0CA 5D7VA 5EYKA 5HU9A 4HYUA 3LMHA 3LE6A 3K3IA 4QMVA 4TPTA 3GC9A 4O83A 4FTCA 4AW0A 4FTNA 3L9PA 3PWYA 3GU6A 4L3JA 3DFAA 3O8TA 4C4IA 5L6PA 2H5XA 5EYCA 2VTMA 4FSZA 4XBRA 4FGBA 4FK6A 4BCHA 2VWZA 2B7AA 4PP9A 4TZRA 4EHZA 1GIIA 3W2RA 4E5BA 3CQUA 3LCTA 2X1NA 5TO8A 2KHHA 1VZOA 5DE2A 3GGFA 2VWUA 3GXLA 3KREA 5HHWA 2IVUA 1O9UA 1WBSA 2DKLA 3GLGE 4D1ZA 2WMXA 4BTJA 3NUNA 5AUTA 3ALNA 1Z5MA 4OTQA 3O8UA 5KE0A 4MYGA 4JQ8A 2G9XA 2VUWA 2W1GA 1OL5A 5BYLA 3SLSA 3VULA 4HPTE 4FV1A 4OAUC 2QO9A 2YN8A 3E63A 4I5CA 4DH8A 5IQIA 4RVKA 4WG5A 2WNTA 3KN6A 1YDSE 4B9DA 5KHXA 2WU7A 3WF6A 4EH5A 5BVNA 4J97A 5KMNA 4WSYA 4PDPA 4YJPA 1YWRA 3HA8A 2JNHA 4KBAA 2G2FA 4ZSAA 4F08A 1I09A 4BIBA 3LXPA 4U8ZA 3R0TA 3W2PA 4BICA 3TWJA 2YISA 5KX8A 4DT8A 3R7YA 3KKVA 4AZEA 4FEVA 1FMKA 2UZUE 2WMVA 1IRKA 1BYGA 3O51A 2VWIA 2UZDA 5FTOA 5HLPA 2BAJA 2E9NA 5AA9A 4C61A 1HCLA 2C6MA 1S9IA 3G6HA 2R3KA 1PYXA 3Q96A 5GJGA 4AFJA 2PU8A 1QCFA 4GSBA 4LGHA 4O7SA 3NX8A 5IQAA 5I3RA 4GRBA 4D9UA 2QKRA 1CUKA 2VTPA 4I4EA 3UPZA 4CMTA 5C8NA 5AUWA 3OW3A 4EL9A 4YJRA 2BRGA 3S95A 4CKRA 1SG9A 2W06A 2XM9A 3IGOA 4TTHB 3EYHA 3RAWA 3NUAA 4G3EA 4IX4A 2JAVA 4OLIA 1YHSA 2UW6A 4MBIA 5GHVA 4DA5A 3OMVA 3HV7A 3K2LA 4FF8A 4O2ZA 4LRMA 4RWKA 1Y6BA 2IWIA 3Q2MA 5CLPA 2YHVA 3WZDA 4IWDA 4O7VA 4QP8A 3KFAA 3QTUA 5LVOA 2A0CX 4MQ2A 5J9ZA 2PUIA 3ORMA 3R1YA 4RBLA 3RJCA 3ORZA 3PRIA 4BCPA 2ZDTA 4FTRA 4D1XA 3ZBXA 3H3CA 4TXCA 2LTUA 3R28A 4AACA 4QD6A 3F5PA 5DYJA 3HV5A 3PJ1A 4CMOA 4BDBA 4O7NA 3G0EA 4ACCA 3ATSA 3F2NA 3TL8A 2WQMA 5FM3A 5LVMA 2CLQA 3QKKA 3GC7A 3QTWA 4C59A 2WQNA 3EQPA 3L1SA 2IG7A 4MF0A 2B55A 3BI6A 3C4EA 4XG2A 2IVSA 5B0XA 4RQVA 4ZLZA 3LCSA 3BGQA 4BR3A 1J7IA 3Q4ZA 4BCMA 3UOKA 1OBGA 2RFDA 3FLYA 2CP8A 4R5SA 2NO3A 3DAEA 2B9IA 3NYVA 4QTBA 5GZ9A 4GIIA 3OZ6A 3W8LA 4J8MA 1ZYJA 2QHMA 3OWPA 3AC4A 4G9CA 4F6WA 1XBBA 4YO4A 1M2RA 5ETCA 5ANKA 4ZXTA 3FJQE 1UU8A 1S9JA 3ZOSA 4Y5QA 2H8HA 1ZMUA 3TT0A 3R7EA 3FYJX 4XH6A 2F7ZE 3EN6A 2EKFA 4JS8A 5I9UA 3RK7A 4BCQA 3VBTA 3OP5A 1WVXA 3FV8A 3LFEA 4H58A 4E4XA 2JIUA 4DFNA 1NVSA 3H30A 2JZ0A 1ZY5A 3R21A 3ET7A 5A6OA 5DT0A 2LBCA 4PDSA 2CNUA 2WD1A 3LCOA 3Q2JA 4QP1A 3G90X 2OBJA 4QMOA 4U42A 3VQHA 3FQSA 5K0XA 3VJNA 4EOIA 5IA4A 2PVNA 4GJ2A 4RFZA 1GJOA 4WUNA 5K3YA 3TJCA 4BWXA 1T46A 2C6EA 3TZ7A 3FY2A 3CJGA 4EZ5A 4ARKA 5K9IA 4FNZA 2I0VA 2CNQA 3IOKA 2QNJA 2HAKA 3DDQA 4JIAA 5IUGA 4AZVA 1R78A 1JNKA 3GC8A 4ZZNA 4D1SA 3HL7A 3LXLA 2WIHA 2HY81 4X2KA 4CXAA 3BHYA 3RALA 4USFA 4XEYA 3ZRLA 3OUKA 4B0GA 3TN8A 4EYMA 1OGUA 3KMUA 4V0GB 5TOZA 4O84A 3NZ0A 5L3AA 2QOHA 3DK3A 3ERKA 3QUDA 2WTKB 4IHPA 1UKHA 2C5YA 3P86A 3HLLA 4QT1A 2JDRA 2RSVA 4XG4A 3A4OX 3BCEA 4IM3A 4DG0E 1M7NA 2C47A 2DS1A 2CCIA 3ZHPC 3NVMB 2DAIA 4ZMEA 2DQ7X 1PGYA 2QLQA 5AUZA 3EN7A 1IXSA 1ZZLA 1RW8A 3WF7A 4BC6A 2RFEA 1JSTA 4EWHA 5EQEA 4IM2A 4X6RA 5AP0A 2HWPA 4NFNA 1XJDA 5DT3A 3EOCA 2ZOQA 4E6AA 4JQEA 5EW8A 2BRHA 5CXZA 4WNOA 2GHGA 4C33A 3QZFA 2JC6A 4S31A 4DGMA 4U45A 4DTAA 4XUFA 4MKCA 4CV9A 3BYUA 2CGXA 4FIIA 4HW7A 5JFWA 3GP0A 2XJ0A 1E1VA 1PXNA 3QZIA 5IUHA 3ZLWA 5CF8A 4G16A 3UZRA 2WXVA 4G2FA 1UWHA 4F7SA 2ZYBA 2FSLX 2R3QA 3A62A 4F70A 1UWJA 3AGLA 2I0HA 4X0MA 5FXSA 3LHJA 4JNWA 5FP6A 4RJ8A 1YI6A 4TWOA 4AQCA 1K9AA 4KAOA 4RG0A 2PK9A 3I1AA 2FSMX 3KRXA 3QGYA 3P23A 4BCNA 3TUBA 4RLLA 3ZDUA 2H34A 2WEVA 5CVGA 3R1NA 3FLQA 2VNYA 5CQWA 4AGCA 5IQCA 5HO7A 5I9WA 3D0EA 2LAVA 1V0OA 3OCSA 3L8PA 2KULA 2X2LA 1Q02A 5FQDC 3AGMA 3UIUA 3ZO3A 1OL2A 2GDOA 2HXLA 4YUQA 5E9EA 5L8LA 2RRUA 4MXXA 4NIFA 4FSMA 1PXPA 3VUHA 4HPUE 2WQEA 4LOPA 4DN5A 2WTCA 4I94A 4CRSA 3DCVA 4BCGA 3R30A 4PL3A 1M52A 3WZJA 4AE6A 5AIKA 4DGNA 5HE3A 3ZONA 3PVBA 3WE4A 4EZ7A 1F4IA 3A61A 5CEPA 5C01A 3SX9A 4FSTA 3D94A 4QMQA 1PMEA 3DB8A 4BYJA 3NAXA 5EI6A 2C6KA 4RX7A 2XKEA 1OB3A 1DAWA 3DTCA 2C6DA 2RIOA 3II5A 2C3IB 1MN3A 1XKKA 3HMPA 3OWJA 4ALVA 1UVRA 4G5PA 3NPCA 4B99A 3NAYA 3SD0A 4AA4A 4O38A 2YDIA 3R8VA 4ORKA 5A4LA 2DENA 1JSVA 1XBCA 3DNDA 2UVXA 4B6LA 3O7LD 3OS3A 3ZUUA 3R9DA 5AX3A 3PYYA 4NSTA 3UO5A 4UMRA 1W84A 1PXKA 3QQLA 2ERZE 2X9FA 3ZO4A 5B7VA 1YW2A 4FKIA 2QO7A 4TYHB 4IEBA 5CAUA 4USDA 4GVJA 2BDWA 4FV7A 4BZDA 3N4TA 1A5TA 3PJ2A 5FBNC 4CZUA 4XV2A 5DEWA 2YM5A 2WIPA 3PXQA 1CTPE 3QRJA 4MH7A 3OF0A 4LUEA 5JKGA 1G8SA 3TZ8A 3FHIA 4XNEA 3CD8A 4GUEA 3VBYA 2YIRA 4RRVA 3VUKA 4C4EA 3MGYA 4W8EA 5IKWA 2DUVA 3UODA 1WCCA 1ZV1A 5HZNA 4WIHA 2GNJA 3GFEA 2JBOA 3BWFA 5JSMA 2QR7A 4RLKA 2QU5A 4JG6A 4UMUA 3R1QA 4F9AA 2WTJA 4YZMA 4NM0A 2DI0A 3E7OA 3UNJA 1PMUA 4BCJA 3LJ2A 1Q62A 4XV3A 5EK7A 5M55A 4NIFB 4ZSGA 4BBFA 3AC3A 3NR9A 5E4HA 2VV9A 3V01A 3GVUA 4APCA 3HMOA 2RG6A 4PTEA 1PXOA 2Y6OA 4QQCA 2WO6A 4B8MA 4O86A 4OT5A 3FZRA 4EWQA 1WBOA 4FZ7A 2GS7A 4NFMA 3HYHA 4DCEA 4EYJA 3Q4TA 2W1IA 4P90A 5E90A 2BTRA 5T3QA 4QPMA 4GUBA 2OWBA 1PW2A 1TQIA 2QOCA 3QX4A 3ROYA 3D5UA 1E1XA 5HESA 3UP2A 1OUKA 3KVWA 3PZEA 3BBZA 4GG7A 4QP3A 4QTCA 4YZ9A 4G3CA 4FKRA 3ODZX 2GTMA 3SW7A 5DMZA 2V7AA 5K5NA 2PUUA 2UZLA 4C4HA 1NVQA 3DA6A 3QD4A 4UN2B 2J51A 2O5KA 1LUFA 1Q8YA 2JD5A 3AC8A 2W5AA 2YM3A 3L8VA 4KS8A 3OT3A 2I6LA 2QOIA 3O7LB 3OCBA 3G6GA 5JK3A 1AGWA 2YJRA 4KKEA 2V22A 5J7HA 1QPCA 2KNAA 3RINA 3CSVA 3VUDA 2DNAA 2NRUA 3NIEA 2GCDA 4FG8A 4I0SA 2PSQA 4IAZA 4Z7HA 2PWLA 4MXAA 5IH5A 2IVTA 4GEWA 3HA6A 5LJJA 3MTLA 4FEXA 4DG2E 4WO5A 3REPA 4M97A 3ZFMA 2J7TA 3W32A 3E8EA 5LARA 1PMNA 5JMSA 4GKIA 1MQBA 3LIJA 1FINA 5H2UA 2XK4A 3PXYA 4IX3A 5LMAA 2YWPA 4U7ZA 2BZKB 5FLFA 4CFVA 3C0GA 3GOKA 4FIFA 4FT5A 2OOAA 2OF4A 1XH8A 2QD9A 3BGZA 3CQWA 4Q9SA 5EG3A 5B2KA 2WELA 1WR1B 4FT9A 1JQHA 4FKPA 4L52A 2DAKA 2O65A 3UNZA 4E5AX 3GNIB 4J95A 1QPEA 3D7ZA 3P5KA 5BVEA 3VS2A 3R8LA 3ZU7A 4IX6A 1X8BA 4QYEA 3BEAA 3VC4A 3VHKA 1OAIA 3LFDA 2VO6A 2V55A 2OO9A 3MY1A 5CY3A 3I6WA 3NUYA 5FEDA 1DS5A 1NXKA 5JZNA 5A3XA 1ZXEA 1U46A 1OPKA 3E93A 1FPUA 4I93A 3FZ1A 3MIAA 4AUAA 4U9AA 2BAQA 2MROB 5AP4A 3ZC5A 3BEGA 4DEBA 1BL6A 3V8WA 2OJJA 1YKRA 1W83A 2OIDA 2PZ5A 3MS9A 4MXYA 3T3UA 4UBAA 2X39A 3IW6A 3HRBA 4N6ZA 4NWMA 3RZBA 3UG1A 1OQYA 5GNKA 4CZTA 5A54A 3FZTA 4H3PA 4RZWA 4AS0A 4M15A 4B8LA 3LCDA 3F88A 3SQQA 5GIPE 5AP2A 4JAJA 2PVLA 2R3NA 3M1SA 5IUIA 3VS4A 2HCKA 2BUJA 3L9LA 4C36A 4RZVA 2VWVA 4ZP5A 4UZHA 3PVWA 2GNLA 5T6KA 4E4LA 2LVAA 4DFXE 4GCJA 4EI4A 1EH4A 1XHAA 3LXNA 2XK8A 3ZMMA 4EH3A 4RIYB 4BCOA 3TV6A 1IAHA 2WMQA 5E8WA 4IX5A 4QQTA 5A4TA 3PPKA 3ORTA 4GS6A 2QO2A 5D1JA 3IS5A 5EHLA 4D28A 4ITIA 2ZV9A 2LVOC 2QLUA 3JS2A 5CU2A 3TACA 5AADA 1M2PA 3NIZA 3IPHA 1L3RE 3TKUA 3TZ9A 5J1WA 3MWUA 2F7XE 1PY5A 1YOJA 1Y91A 4HGSA 4TYGA 4WBBB 4QMUA 3QD0A 3VS3A 5FTGA 3UTOA 4AW5A 2JY6B 3ZFXA 5E8XA 3IECA 5JQ8A 3DBDA 4NT4A 3W2QA 4RFYA 4EKKA 3GC0A 2R4BA 5HBHA 3VBWA 4W4XA 4C3RA 4X3FC 3QXOA 4R3PA 1YI3A 1MRUA 3C4ZA 3D5WA 5AR4A 1NA7A 1YHVA 3MH3A 2DAMA 3C7QA 3KULA 2YCRA 3EN9A 1WBTA 4BDDA 4D5HA 3G15A 1ZMVA 1Q3DA 2B3TA 2J0JA 3R2BA 3K5VA 4CSVA 5CWZA 4BF2A 2GNFA 2WGJA 4MXOA 2YM4A 4C2VA 4CMUA 1YWNA 3JPVA 4WNKA 2OF2A 5EDQA 1YXXA 3D14A 3Q6UA 3QX2A 3H0YA 4IM0A 2PZYA 4ZAUA 2JKKA 3ZEWA 3ZS5A 3AD5A 2FYSA 2RKUA 4WHZA 3WYYA 4E4NA 4ZEGA 5D10A 4F9YA 3KRRA 1G41A 4KIKB 4MBJA 2WU6A 4BGQA 4JBOA 2H96A 2Q0BA 2R9SA 3C51A 4FL2A 1OTRA 1B6CB 5A4QA 3RHXA 5KBQA 5L2TA 4IZ7A 3QTSA 3RGFA 4LM5A 4DE4A 1H8FA 3QCXA 2ZVAA 3NWWA 3ULIA 3FXWA 3HECA 2AC3A 5EYMA 3TTJA 2HYYA 5AV0A 5IZFA 4GT3A 3VRZA 3WF5A 2YAKA 4UALA 1UFZA 4IJ9A 4UV0A 5HNBA 4J99A 1ND4A 3NUSA 5K0KA 3TKHA 3EL8A 4FV9A 3FYKX 5J5SA 2CKOA 1CKIA 3LFSA 4A07A 3IQ7A 1Q61A 3CCNA 2VO0A 2DZLA 2FVDA 2YDJA 3MH0A 5D7AA 2NNWB 3DQWA 2XJ2A 2JY5A 3MPMA 4PMSA 5E8UA 2HIWA 4H3QA 3VIDA 4C02A 4UMQA 3GB2A 3OFMA 5AJQA 5E92A 1V0BA 3PE2A 4BDHA 4BI1A 3QD2B 1GIJA 1Q8ZA 3CGOA 3EZVA 4IWOA 1IAJA 4YJVA 2C6IA 4DEAA 4EEVA 4FYNA 3R73A 2YACA 4RIOA 2C0OA 1ZOHA 2J4ZA 3QQHA 4ITJA 3KRWA 3A7JA 1EFUB 3OBJA 4NYEA 3UC3A 2GNIA 5HCZA 1PXMA 1PF8A 3TDVA 4IDVA 2VWBA 4Z9LA 2BMCA 3AMYA 3LOKA 4V05A 3CKXA 2WMUA 3ALOA 3NNWA 4D2PA 3DQXA 2O8YA 5I0BA 1WHCA 2PVKA 3KK9A 4R71A 3QKLA 3RAHA 5IH6A 2AUHA 1P5EA 4O91A 4CCBA 1XH6A 5L2WA 1YDTE 4N6YA 3ZO2A 2X81A 3KVXA 4L01A 3K5UA 4RVLA 3EWHA 5HCYA 4ZY6A 1SM2A 4D2TA 3RCDA 4ZSJA 3DS6A 3RPVA 3PXFA 4S30A 4KBKA 5AP5A 4F1MA 4XV1A 3MJ1A 4C3FA 4FTJA 3QD3A 3VBQA 4ZSLA 3W55A 2FSOX 5DFPA 4C38A 3RAIA 2ZJWA 4RJ3A 5E91A 4O7YA 3CPBA 3ZCLA 2BWEA 1UV5A 5D11A 4D2RA 3VVHA 4IZ5A 2HW7A 4QTDA 4OBPA 5HG5A 3F69A 4NH1A 5LCKA 4EK3A 4WNMA 5KBRA 5C4KA 5L8JA 2B54A 5M09A 3PP0A 4ZY4A 4R6VA 2YABA 3RMFA 5TR6A 4UWBA 1MRVA 4NUSA 2VGPA 3G0FA 5ANEA 3U55A 3FY0A 4RJ6A 4F64A 1WFCA 2SRCA 3NS9A 4DHFA 2EVAA 2A27A 4TYEA 3V5QA 3UDBA 3VRYA 3TM0A 5GINE 3I4BA 2BAKA 3ELJA 3R8PA 3QRUA 3VQUA 4I0RA 2VN9A 2WTWA 4OUCA 3B8QA 3ZYAA 2PMLX 3D2KA 4IADA 5EHOA 5DR6A 2Y7JA 2JKOA 2Y4PA 4OTFA 1KV2A 2G3QA 5M56A 1YWVA 4JL9A 3ORIA 4DGLC 3P1AA 1BMKA 4Q5HA 4QOXA 4EOKA 4FVQA 4W9WA 1JSUA 3NUXA 2CCHA 5CSPA 3MTFA 4FICA 5DEYA 5H8BA 3WF9A 2UZOA 2W1FA 4GL9A 5D12A 4EORA 4I6FA 4A9RA 4G9RA 3UIBA 2C5NA 3OOGA 2C5XA 5E8TA 4L46A 5C03A 1GIHA 4Q2AA 2JZ1A 1ZARA 3HMMA 4I21A 1VJYA 2X9EA 3DBQA 4PY1A 3GCUA 4YJSA 4QMNA 5L2IA 4K6ZA 3GI3A 3MA6A 2G01A 3MH2A 3OXTA 1PXLA 2X8DA 5CEQA 3OXZA 3OY1A 5CASA 5TT7A 3MVLA 5BYYA 1FGKA 2PTKA 3QAME 5D41A 3GQIA 1R3CA 3PUPA 3F9NA 3P7CA 2W9ZB 4QQ5A 2WFYA 2B53A 2C0TA 3PA5A 3CP9A 2BFYA 2IJMA 2PVRA 4QNYA 4K9YA 4DAWA 5CEKA 5BQ0A 4EBWA 2ZV7A 3B2WA 1STCE 2ITOA 4ZSEA 5BUIA 2X7OA 2JLDA 5KZIA 3T9IA 4YZNA 3V51A 5HCXA 2V62A 3ACJA 4XG3A 2BROA 2ZMCA 4YLLA 1B39A 3GBZA 4QMXA 1CKJA 4BTFA 1QZEA 4JRVA 4P2KA 5BVWA 3RM7A 5E8YA 3A8WA 4DH3A 4L8MA 4W8DA 3ZM4A 4OTRA 3Q4UA 4FV2A 5HOAA 4RIWB 2UZBA 4H05A 4LFIA 1GOLA 2HY0A 5G1XA 3RNIA 4RJ5A 3WIKA 4O2PA 5J9YA 5K4JA 1JR3E 4M67A 3MH1A 5AR8A 4C3PA 3UOJA 4CNHA 3VBVA 2CWBA 2A1AB 3D5XA 2EXEA 3EMGA 3I0OA 2YA9A 4I5HA 4J96A 4FMQA 4UYAA 2P4IA 3QUPA 5ANJA 3FRHA 1CDKA 2JDOA 2X8EA 3QTRA 5HICA 4I0TA 4C4JA 5CSXA 4CFWA 3OVVA 1XH7A 3H9FA 4C57A 1JKLA 2JIVA 1LP4A 3CIKA 4G3OA 2NP8A 3PPZA 4PV0A 2IPXA 3NNVA 4KNBA 4RGJA 4A9SA 3Q52A 3UO6A 4GFGA 4BI2A 5CZIA 3TNHA 1QPDA 2YJSA 3QZHA 4IAKA 3VF8A 1OM1A 4PPAA 1WVWA 5DRDA 4FL1A 4HYHA 3SRVB 3VW6A 4AP7A 4DITA 4ZTMA 2XK3A 4G6LA 1KYIA 2XEZA 3OUNB 4V0GA 2PL0A 4D0XA 3P9JA 3O71A 2YLFA 1Q99A 4JX7A 3C13A 3C4FA 4XG9A 3ROCA 5CAPA 2WMSA 1ZOEA 1MRYA 3LCUA 1UA2A 1ZWSA 4WRSA 3I6UA 5CU4A 2YCQA 4LRKA 5CSVA 3VW8A 4G1WA 3IHPA 5IEYA 4A4XA 2Z2WA 4IXPA 3DDPA 4W9XA 3DZOA 2ACXA 3FQHA 4YSMA 1G3NA 3FAAA 3F3UA 3ORKA 3ZRMA 4O1PA 5EQYA 4O7ZA 1SZMA 4FOBA 4AXAA 1TTEA 4O0XA 3F7ZA 1PHKA 1WBWA 4NTSA 4Z3VA 4FV5A 4E8AA 3OTUA 3BE2A 5HVKA 3GCSA 4AWIA 4GK2A 3ZDIA 4IFGA 4BDCA 4ASZA 2X7FA 2P2IA 2XRWA 4PWNA 2W1DA 1PKGA 4FV8A 4U40A 3K9OA 1WIVA 3FRIA 4F1IA 5CU0A 2C5OA 4BHNA 4LYNA 5CXHA 3FMMA 4I22A 5LVNA 2WMTA 1FVTA 2YM8A 1XWSA 4C37A 3NW5A 5KCVA 4H36A 4XP0A 2HELA 3GCQA 3HUCA 3C4XA 4E73A 1WJ7A 3EZRA 1Z57A 2GHLA 3IONA 2JEDA 4DG3E 3TNQB 5J5TA 1KSWA 4CVAA 4J53A 2YCSA 4GK3A 4A9YA 1KUTA 1OIUA
chains in the Genus database with same CATH superfamily
4FKTA 3KS4A 2XNNA 3PE1A 4IIWA 3NVKI 4S32A 3V76A 4LJ7A 5HIEA 3Q6WA 2VTHA 5CT0A 4QMWA 3BBWA 2ESMA 5J87A 3FYCA 4J98A 4DEIA 3OY3A 3N4VA 4R7IA 3EH9A 1ZYCA 4BGHA 1TDZA 3OROA 2A2AA 4F09A 2BZHB 2C6OA 3ODYX 3FL4A 3BQCA 2M5ZA 2XNOA 3DTWA 5IPJA 2DAEA 4ID7A 1KE8A 4NM3A 4WUAA 2DYLA 3FDNA 3QYZA 4LV7A 1H08A 3H9RA 4II5A 2H6DA 3R7IA 1RDQE 5L8KA 4K1BA 4OW8A 4LF8M 2JFLA 1H01A 3C9WA 4BDEA 4IWQA 3VLFB 3ZH8A 3MB6A 2OXXA 5L6WL 1SVGA 1TR8A 5C8KA 3E64A 4DH5A 5J79A 4KIOA 3RE8A 2OIQA 4RMZA 5KMLA 2BALA 2GQFA 2QU6A 2PMOX 2WEIA 4IVBA 4X2FA 3F5XA 4IAAA 2R0IA 2XFSA 3UOLA 4HYSA 4YZDA 1LTMA 3FUVA 4ANSA 3GU5A 4BCIA 3DLZA 4FTMA 4CD0A 2HWJA 3BYSA 2XJ1A 3LFCA 3PA4A 1ERKA 2XEYA 2EXCX 4CYIA 2KNVA 4ZTHA 5C1QB 4IACA 1VDDA 4YBJA 5A14A 2ZTDA 4A9TA 4B7GA 4CZYB 2A5YB 4N0SA 3GU7A 2L2DA 3KQ7A 5BNJA 2XIXA 4BLCA 1D2NA 4IB1A 5KNJA 2G2HA 4FKGA 1R7RA 4RJ4A 2IW8A 1OZ1A 2VD5A 3MN3A 2OK1A 2GQGA 5HLNA 2OXYA 3ENHA 4L53A 3GLGB 4JT3A 4FZDB 4HCTA 4FTTA 3JR5A 1G8AA 3PG3A 1FMOE 2VQFM 4ZTNA 4DHJA 2OGVA 2VWYA 4BDFA 2ZV2A 3KGAA 1U4DA 4F6UA 4M84A 3MV5A 3FTEA 1H27A 4MEDA 3CXWA 1W0XC 4F1OA 4ZTQA 4KIKA 1UKIA 2FSTX 2YCFA 1YXVA 2Y6MA 2DWMA 5JGAA 1FVRA 1EIJA 4KO8A 3U60A 1JPAA 1MQ4A 5HG7A 4QYYA 4IC7A 2I7PA 4BRXA 1Q3CA 5DBXA 3LQQA 4CKIA 3THBA 5ICPA 4ACHA 3QGWA 3COMA 2QQ7A 3KXHA 3BQRA 5AR7A 3W33A 1XC8A 3V5LA 2J50A 5KMJA 3SFZA 3EFKA 4F0FA 5C26A 1IA8A 4ZY5A 1TDHA 5F9EA 2BRNA 3QQFA 2GFSA 3L29A 1L2CA 5BX0A 4G6OA 5A46A 5AEPA 2GQRA 4AN2A 3R2YA 4AF3A 2IW6A 5C1BA 2X4AA 1HJPA 2PY3A 4CHTB 3DXNA 4JI8M 3LXKA 4PUZA 4PP7A 1OIYA 3P7AA 2KEBA 2QHOB 1VLRA 4R78A 2O01F 5CSHA 4DEEA 5LMKA 5EW3A 4X3FB 3UQFA 3BYVA 3FMKA 3UNKA 4A4OA 3I04M 4E7WA 1VEGA 3G33A 4E3CA 1V0PA 1TGUA 2OW3A 3PDTA 1SMHA 1JAMA 5IMXA 4RF0A 2GFCA 2J0MB 4P17A 4QO9A 4H3BA 4YHFA 2P33A 4YLKA 5HD4A 4EH8A 3BL7A 2C96A 5M08A 1OPJA 4O6LA 4LF4M 3QCYA 5FP5A 3UVRA 4DGGA 1H1QA 3VKHA 3O17A 2XYNA 4GYIA 4EK6A 4PL5A 3CS9A 3SXFA 2XMYA 1BI8A 4M0YA 3PIXA 1XH4A 4DDIA 2K9DA 2BFXA 3QUEA 4OTIA 4G6NA 1F0QA 3M0EA 1DI8A 3PPJA 3DY7A 1TVOA 3UYSA 5FXQA 1SVEA 2WQOA 3HVCA 2Z8CA 4GT5A 4PMPA 3KMMA 2F7EE 4DV4M 3A7FA 3QYWA 4PNIA 2ZAOA 3P4KA 4O0UA 1WBNA 3AD6A 4FTAA 4FKWA 2X0OA 2XNGA 1QAOA 1Y57A 3JAMS 4C7TA 4ENXA 4FV0A 4Y72A 4BB4A 3WE8A 2V5QA 2H1RA 3W0OA 2CE7A 2VTNA 4FVPA 4I3ZA 5I4NA 2CGWA 1NNUC 1QVRA 4FCWA 3NUUA 3LKMA 5IA3A 1AUAA 5KMKA 2YFXA 2G15A 2MGWA 1GNGA 3NYXA 4GMYA 5DRBA 3QTXA 4BDAA 3GO8A 4F0GA 3PZHA 3LFAA 5AP7A 4M12A 4MK0A 2ITXA 3HJSA 3TWLA 2XUUA 2JFMA 4EJ7A 5T68A 4FUYA 4UX9A 5HO6A 5A4EA 1HCKA 1YQJA 1HNZM 2WHBA 4JLCA 4UXQA 5HBEA 2C69A 2XCHA 5GZAA 4U44A 5IQHA 1SNXA 4MXCA 3IGGA 2QG7A 4XP2A 3H4JA 3R01A 3SHEA 4TT7A 3TWMA 3J27B 4O21A 4JAIA 2F49A 4FL3A 1URWA 3E8DA 4YP8A 4N57A 1Q8WA 4WD5A 3EB0A 3DKOA 4RX9A 3IW8A 2WZJA 3QHRA 3FBVA 3L2AA 4XV9A 3KL8A 2HZNA 4GW8A 2XF0A 1N33M 5FDPA 3WYXA 2X0GA 4DH7A 4MX9A 3V5JA 3WOWA 1PJSA 4YPSA 3FLNC 2XVDA 2EB3A 3AOEA 2CHLA 3K9PA 3UP7A 3FXZA 2IF8A 1OL7A 4LMNA 5AR2A 1E94E 2E9PA 5F20A 5AUVA 2OFVA 5HVYA 3FKLA 4X2JA 1JBPE 4JBQA 5E8VA 2YM7A 1VYWA 5CNOA 5DHJA 2ZAMA 3UGJA 2YITA 2BDJA 4M66A 3GUBA 3BHUA 3GQLA 4CLIA 1P3QQ 4AZSA 4NK9A 5M53A 2C30A 2PMIA 1R0EA 4CTCA 2VO7A 3NLBA 3TQSA 2DAGA 3UMXA 3TEIA 4DFBA 5HKMA 4CFNA 4NKAA 3U4UA 3D4QA 5ETFA 5A9UA 3FKNA 4G17A 3MI9A 5BYZA 4CLJA 5AM6A 4CYJA 3RTPA 1TQPA 4MQ1A 1H1RA 1DGHA 3O96A 4KB8A 3R9HA 4UN0C 4L7SA 4J1RA 3QRIA 5GIOE 4HVIA 4ZS0A 2CHGA 3KN5A 4G4OA 3RPRA 4AOJA 4XYFA 3K92A 5AUXA 4DR6M 2PZPA 2Z60A 4MD9E 3BYMA 4AQYM 2UVZA 3K3JA 3FSKA 4HVGA 2FGIA 1OIRA 2IN6A 4HCVA 3P0MA 2A98A 5E4HA 5EM8A 3C1XA 5LXMA 3DXQA 3LW0A 5TF9A 4JI3M 2NPQA 3U6CA 4P7EA 1XB2B 4RWIA 5AWMA 2J0KA 3CPCA 3PXRA 4HZSA 3VUMA 2W7XA 4LJ5A 4LF5M 1Q97A 3OXIA 3D83A 2DWBA 1GAGA 2ITZA 4Y5HA 4NCTA 3I79A 4RC3A 3F6XA 2ERCA 3BHVA 1N75A 3N9XA 3R22A 3MY0A 4YTFA 3WHKA 5C8MA 4CFUA 1H00A 4UZDA 3PP1A 4IBFA 3C4CA 5E8ZA 3OHTA 4MGIE 3FI4A 3GCVA 5HG8A 2FOIC 2XH9A 3BU3A 3G2FA 1IN4A 4QMPA 4YMJA 2E9VA 3I7CA 2VTLA 3R9NA 4FZAB 4FSYA 4JJRA 4PQNA 2XALA 3FZSA 2R46A 2C3JA 4BBEA 3U4WA 5LVPA 1LEWA 2XSZD 1FVVA 4CJ6A 4BDGA 2Y0AA 4YSJA 4PF4A 2GNGA 3QF9A 4I4FA 1ZMWA 5CS6A 4AG5A 2PVHA 3Q60A 1U54A 3PSBA 4F9CA 2C9CA 1A06A 3GEQA 1OL1A 4KSPA 3I5ZA 4XLIA 2QOKA 2R3MA 2L7IA 2LVQD 4N4SA 4UMTA 3QFVA 4GYGA 3T9TA 4QDEA 3E3PA 2VX1A 3UIMA 2XB7A 3OWKA 3ZC6A 4Z7GA 4EHEA 4TN6A 3EFJA 1AQ1A 4FZ6A 4U3ZA 4RVTA 1PXJA 3FC1X 3U6SA 4DTKA 4D81A 5BUEA 2BHHA 5DGZA 4FBXA 1GZOA 4FC0A 4XBOA 3FE3A 4QMTA 2BPMA 1GL7A 2DVWB 2EO2A 4UWCA 1R39A 3RWQA 1ZZ2A 2W9FB 1J5EM 3O2MA 3BU5A 4GKKM 4BDIA 2XIKA 4EC9A 4LUDA 2F5SA 5AP3A 4P4CA 2OQ4A 4DC2A 3S3IA 2VX0A 2UXDM 4L3PA 4ACGA 4XOYA 3A60A 2ZB1A 3QA8A 1V33A 4MD8E 4FSRA 3MDYA 2Y21A 2YWVA 1E32A 2IZRA 2PPQA 4X3JA 1K2PA 2CJMA 3JVSA 4WURA 4REZA 2W5HA 1E9HA 1SNUA 3V5PA 4WOVA 3R1SA 3EQIA 5LQFA 3DLSA 3SGCA 3JR1A 3GRUA 4LGMA 4AW1A 2OH4A 2R18A 3TZMA 3VAPA 2OFUA 3A98B 3F2AA 3HY5A 1OECA 3AT4A 4L3LA 2XEPA 5FTKA 3L8SA 4C4FA 3ORPA 3F5GA 3O50A 2UV2A 3S4QA 3ZC7B 4S2ZA 2XK9A 4YJTA 2QKWB 2W4KA 2LNHC 4G5JA 3T8OA 2DWLA 2FB8A 4ASEA 4PPCA 2GU8A 1Z5CA 4NSOB 4DR3M 5AR5A 1J91A 1UNHA 2ZTCA 4AA0A 4JDKA 2WMBA 3MFUA 4EH4A 2P0CA 5EYKA 3LMHA 4O83A 2VDBB 4FTNA 4DUZM 2VTMA 4FSZA 4XBRA 4FGBA 4PP9A 4Z6YA 2B7AA 4EHZA 3W2RA 4E5BA 2X1NA 2WSCF 5DE2A 3GLGE 1Z5MA 4OTQA 3O8UA 5KE0A 4NOOB 4JQ8A 2G9XA 4MYGA 2W1GA 5BYLA 3VULA 2YN8A 4I5CA 3KN6A 2CRUA 2WU7A 3WF6A 4EH5A 5BVNA 4YJPA 3HA8A 2JNHA 4BIBA 3W2PA 3TWJA 5KX8A 3U61A 3R7YA 2L6OA 1IRKA 1D0LA 2VWIA 2UZDA 3UZUA 1S9IA 3G6HA 2R3KA 5GJGA 2PU8A 3PNVA 4AKGA 5I3RA 2VTPA 3UPZA 4YJRA 4CKRA 2XM9A 4TTHB 1YHSA 5GHVA 1Y6BA 2YHVA 2K6BA 3QTUA 4BB9A 3R1YA 4FTRA 4LY6A 3H3CA 3CF6E 3HV5A 4BDBA 4ACCA 3TL8A 5FM3A 3QKKA 3QTWA 3EQPA 3L1SA 1PM5A 2B55A 3BI6A 4XG2A 4ZLZA 3BGQA 2RFDA 2NO3A 4QTBA 4GIIA 3W8LA 2LHCA 3AC4A 4G9CA 4F6WA 5ANKA 1S9JA 3ZOSA 4NRWA 3TT0A 1ZMUA 2F7ZE 4JS8A 4BCQA 3VBTA 1NVSA 5A6OA 3Q2JA 2WD1A 2OBJA 3FQSA 4EOIA 5IA4A 3FUWA 2DZNB 2QNJA 3TWKA 3AJIB 3DDQA 5IUGA 4ZZNA 4CXAA 3LXLA 4X2KA 2HY81 4XEYA 3ZRLA 1JR3A 4B0GA 3TN8A 1OGUA 3NZ0A 3P86A 4DG0E 1M7NA 2C47A 2DS1A 3GLHB 1IXSA 4BC6A 2RFEA 4NFNA 4E6AA 4JQEA 4QHSA 3QZFA 2CGXA 4HW7A 1E1VA 5IUHA 2WXVA 4F7SA 2ZYBA 2R3QA 3A62A 3AGLA 4X0MA 5FXSA 1YI6A 4KAOA 2PK9A 4BCNA 4RLLA 3ZDUA 3R1NA 3FLQA 1NHGC 5CQWA 2LAVA 3UIUA 3AGMA 3ZO3A 5E9EA 5L8LA 2ZFYA 4GMQA 5KPTA 2Z7JA 4PL3A 4AE6A 5A2QS 3ZONA 3WE4A 1PMEA 3DB8A 3NAXA 4RX7A 1OB3A 1DAWA 3II5A 1MN3A 4ALVA 3SD0A 3R8VA 4B6LA 2EA0A 1L8QA 3O7LD 3R9DA 4NSTA 3QQLA 1Z5AA 2X9FA 3ZO4A 5B7VA 1YW2A 4G4QA 4IEBA 4BZDA 3PJ2A 4CZUA 3PXQA 3OF0A 3TZ8A 3MGYA 5HZNA 2UUAM 3BWFA 4RLKA 2QU5A 2WTJA 4NM0A 3V01A 3GVUA 3HMOA 1PXOA 4B8MA 4EWQA 4FZ7A 2I7NA 4DCEA 5T3QA 4GUBA 2OWBA 3D5UA 3KVWA 4QP3A 4YZ9A 3HU3A 4FKRA 2V7AA 1OJLA 1NVQA 2JD5A 3AC8A 3B74A 2W5AA 3G6GA 5J7HA 4G4NA 4FG8A 2PSQA 2PWLA 2IVTA 4WO5A 3REPA 4M97A 3W32A 1PJTA 4GKIA 3PXYA 4U7ZA 5FLFA 5EG3A 4FIFA 3CQWA 5B2KA 1JQHA 2O65A 4FWHA 5BVEA 3VS2A 3ZU7A 3R8LA 4IX6A 3BEAA 3MY1A 3NUYA 1U46A 3E4RA 1FPUA 4MB7A 2MROB 5AP4A 3BEGA 2OJJA 3W0LB 4N6ZA 4CZTA 3FZTA 4AS0A 3LCDA 3HHWA 2BUJA 2VWVA 3PVWA 4GCJA 2ZBKB 1XHAA 3LXNA 2XK8A 4QQTA 2QPAA 3IPHA 3TKUA 4AW5A 2JY6B 3IECA 3DBDA 4NT4A 4RFYA 4F78A 2R4BA 5HBHA 4W4XA 1MRUA 2P5TA 2DAMA 3C7QA 5DNYA 3R2BA 5CWZA 4BF2A 4CMUA 2OF2A 1YXXA 2R65A 3HU1A 3AD5A 4ZEGA 2BJWA 5D10A 2WU6A 4BGQA 4JBOA 2Q0BA 1L8TA 1OTRA 3QCXA 2HYYA 4GT3A 1ND4A 3FYKX 4DV1M 4A07A 2CV1A 2DZLA 2YDJA 3DQWA 4PMSA 4C02A 5E26A 3CGOA 2E5LM 1V34A 1IAJA 4DEAA 1HQCA 2YACA 5TT7A 2C0OA 4NYEA 4ITJA 3KRWA 1EFUB 4AI6A 2GNIA 2LWXA 5HCZA 2VWBA 4Z9LA 4V05A 3ALOA 2O8YA 3KK9A 5IH6A 2X81A 3EWHA 5EQTA 4ZSJA 5EJCA 4F1MA 4XV1A 4RJ3A 5E91A 2BWEA 5D11A 3VVHA 4IZ5A 4QTDA 4LF9M 4NH1A 5LCKA 4WNMA 4LFBM 5M09A 4R6VA 4F64A 3NS9A 2EVAA 2A27A 3VRYA 3TM0A 3I4BA 1MX0A 3IG8A 4I0RA 4L4UA 3B8QA 3D2KA 4IADA 2MH8A 4OTFA 4I81A 5EP2A 1K3XA 4GKJM 1BMKA 4Q5HA 4AW4A 3MTFA 4EORA 2C5XA 4L46A 1GIHA 1VJYA 2X9EA 4YJSA 3OXTA 2G01A 1PXLA 3GQIA 1DGGA 1TFFA 3PA5A 3ZM9A 2PVRA 2IJMA 4ZSEA 2J7OA 2R44A 1XWIA 5HCXA 2ZMCA 3AKJA 1CKJA 4BTFA 4DH3A 3RM7A 4P2KA 1NO1A 3SBJA 3GRVA 4L8MA 3ZM4A 5HOAA 2UZBA 1GOLA 5G1XA 4RJ5A 3GLIA 5K4JA 3SMPA 2A1AB 3D5XA 2EXEA 2YA9A 4J96A 4FMQA 3PFYA 4UYAA 3FRHA 2JDOA 5HICA 3OVVA 1XH7A 3H9FA 3NNVA 4KNBA 3Q52A 4BI2A 3QZHA 5DRDA 4HYHA 4AP7A 2XK3A 3OUNB 1IY1A 4V0GA 4FJVA 2PL0A 3P9JA 3C13A 5CU4A 4WRSA 5CSVA 3VW8A 3IHPA 5IEYA 4A4XA 2ACXA 3ORKA 1SZMA 4AXAA 2CUZA 4O0XA 4IBIA 1WBWA 3W0RA 4L6V6 5HVKA 3ZDIA 4U40A 3K9OA 4F1IA 4LYNA 2O5RA 5KCVA 1WJ7A 2JEDA 4D80A 4J53A 3JR4A 1JB0F 4EUUA 3MBLA 3QU0A 4AKHA 1WGLA 2QENA 4YHTA 1JKKA 3UYTA 3B7NA 5IA2A 5BPVA 2JY7A 2XZSA 4PL4A 3ATTA 1YHWA 5CAQA 2W96B 3UC4A 4FG7A 2DZOB 1JKTA 4K8AA 4WBOA 4F9BA 5M4FA 3LVPA 4HL4A 3SOAA 1DI9A 1Z9XA 4RJ7A 3P08A 4CFFA 1ZYDA 1J1BA 4F7LA 3MA3A 3U9NA 4YHHM 4AT3A 3D7TB 1YRPA 4M0WA 3LVVA 2BWBA 4KODA 3FUPA 5EXXA 4YZCA 1IBLM 2WTVA 2CGUA 5HNIX 3EIDA 2ZM1A 4YHJA 2WQBA 1TQMA 3S1HA 2ZM3A 2ETRA 2AQXA 2LH0A 4QNAA 2CGVA 4DINA 2PHKA 4K77A 1ZYSA 3L26A 3QHWA 5IZ7D 2I1MA 4ZK5A 4YLJA 4OR5A 3TYKA 2OZAB 4HCUA 5JZJA 4C58A 2Z7QA 5CAVA 5HX8A 4F7JA 4IAYA 4YTHA 4RC2A 1IG1A 3LFBA 2UVYA 3ZFYA 4IWPA 3FEGA 2UUEA 2PYWA 4D55A 2YIYA 4YURA 4F4PA 4Y83A 1JLUE 2XK7A 4OVZA 3K8ZA 3LZBA 3DOAA 2LXEA 3Q9WA 1XXHB 5CANA 2EU9A 3QAUA 5IA0A 3I5NA 4TRLA 2QVSE 4D5KA 3RZFA 4I6QA 4WG4A 4MNEB 4BJJB 4PTCA 2B1PA 2X49A 1H1WA 3DB6A 3R9OA 3LAUA 3DAKA 4MAOA 4DR5M 2YM6A 1K3AA 4F9WA 1SVHA 3DT1A 4ZZMA 1A48A 3P79A 4EJNA 3W0QA 4FR4A 4YC6A 2XS0A 2X4ZA 2VIIA 2FE8A 4JX3A 4ANBA 1DO0A 4C62A 1A9UA 3L9NA 1VR2A 5HQ0A 4RNAA 4OBQA 4PPBA 3NMUF 2BR1A 2VGOA 3KA0A 5LVLA 3E8CA 4Q5EA 2XARA 5H8EA 4S34A 3JUHA 1IBMM 4MGYE 4JI5M 3W10A 4YBKA 3UE4A 4G34A 1NJFA 5HIDA 4GITA 5JGDA 5JGBA 3AOXA 3DZQA 4AU8A 2XZUA 5AAEA 5HGIA 4CQEA 3LLAA 1JOWB 2X6EA 4WKQA 4QP7A 4IQ6A 4J7BA 3W0NA 5K4IA 3QCQA 4FK3A 4YJNA 3P78A 2APLA 1H25A 4R7HA 4ASXA 3DKFA 2PE1A 4B7TA 3I81A 2PULA 2KW0A 4GFOA 4X2GA 3VUGA 5FRIA 4FKQA 4BKYA 1XNQM 3TIZA 2I7QA 3SDJA 5HG9A 4X66M 2FH0A 3UDTA 1VEJA 2P3GX 4MGKE 4QPSA 1Q24A 4O0YA 5EKOA 2JIIA 2Z02A 4JDHA 4NTTA 1L1TA 5ANOA 3I01M 5C9CA 5CEMA 2BRMA 4L42A 3R71A 3GP1A 5HTIA 4I6LA 3KXNA 5LWMA 3QRTA 3KMWA 5E1SA 4QYHA 3L9MA 2G2IA 3TNIA 1RQQA 1H6UA 4DV7M 4HVHA 5JRQA 4O82A 4NKSA 1U5QA 4KRCA 4ZS4A 3SAWA 3VONA 3MFTA 3UOHA 3FI8A 1J1CA 4D9TA 1JWHA 4X7QA 4M9SA 5BVKA 3UZTA 3EQRA 5B2MA 5HE2A 4QYGA 2QOBA 2W4JA 2WMAA 2BJVA 2NYAA 3MJ2A 4IH8A 4KHPM 3P5JC 2OJGA 3OW4A 1PMVA 4EOJA 5EQPA 3GLHE 3F3WA 5KHWA 1I94M 2QOQA 4NEUA 4YC3A 2VAGA 2OJFE 3B8RA 2W0JA 3ZSGA 3BLRA 3SRVA 4XBUA 1H26A 4G31A 4E5WA 4IIRA 3IG5A 5HVJA 4TNBA 2QSFX 3IDCA 3F5UA 2IO6A 3J80S 1P2AA 4LI5A 4KABA 3MESA 5IQBA 2IVVA 2XNMA 4UY9A 4NZWB 3ZQJA 4EIWA 3LCKA 3PG1A 2F2UA 4WT6A 3NCGA 1G5SA 2I40A 3RVGA 4O0WA 4KSQA 4EQMA 3R6XA 5DNRA 5HNGA 4QP4A 2IZTA 1SYKA 5EOBA 4FTQA 5E8SA 2M60A 4L67A 4NM5A 4LOQA 4IVAA 3M7GA 2UW5A 4RIXB 3E8NA 2YLEA 2RGPA 1OKWA 4AFEA 3MPAA 2F4JA 2OU7A 1F3MC 1DGFA 3UQCA 3GU8A 5FGKA 2UZVA 4C8BA 4FVMA 5CVHA 4LG4A 3N4UA 1OAOC 2WTIA 4KINA 3D9VA 3B2TA 5DR9A 4EH7A 5FTLA 5LMBA 4FYOA 4LGDA 4IAFA 1J3HA 2DWNA 4AG6A 3RWPA 4JI7M 2BIKB 4DDGA 2UZWE 1HOWA 4E4MA 5FEQA 3OG7A 1P14A 3BIZA 3BKBA 1Z5BA 1FJGM 3C50A 3HKOA 2XBJA 3MSSA 4FSQA 5CI7A 4D2SA 2OXDA 4QP2A 4DLIA 3ZLSA 3OEFX 4FODA 3PXKA 3Q32A 3VHEA 4BIEA 3RK5A 1OKYA 1NV9A 4AG8A 3UIXA 1N36M 3Q5IA 1UU9A 4FV4A 3HJQA 4ACMA 4DGOA 3EKKA 5CNNA 3PXGA 1H24A 3CF2A 4JI0M 2PZRA 3D2IA 2X4FA 3Q9YA 1P4OA 2A19B 2GS6A 1V1KA 2CLXA 2PVYA 4U80A 5BMMA 5HEZA 3EYGA 3EN5A 4IBMA 4D2WA 2XIRA 2JITA 4BTKA 2KTYA 4R1VA 3SC3A 3PLAE 4BKJA 2QBYB 4DV3M 4R3RA 3FWQA 3DGKA 4EBVA 3BXWA 3BPRA 1BX6A 4KT0F 4L00A 3QA0A 3CC6A 1H1SA 5FTMA 4NL0A 4YNOA 4HYIA 4W4WA 3AC2A 2O0UA 1JKSA 5ETAA 1EE8A 5EM7A 4TYJA 3FC2A 5EFQA 4F63A 5LOHA 4JDIA 5HTBA 4DR1M 3E5AA 2R3GA 4L78A 5AR3A 4FKUA 2QG5A 5FDXA 3QQUA 3JVRA 4ZJIA 4BI0A 2R3LA 2EKKA 3GPPA 3V8SA 3VK7A 3V5WA 3SASA 4KIQA 3T1YM 3AMBA 4GVAA 4BZNA 2KZUA 4LDTA 3HNGA 4F6SA 3NNUA 1GY3A 3E9SA 3W16A 3DBCA 4M0DA 1WMKA 2Q83A 2QURA 2R3RA 4K18A 4E1ZA 4A4LA 3UO4A 4F2LA 1LEZA 5DR2A 2YAAA 3R8MA 1KE6A 4QPAA 2GNHA 1YLAA 4FEWA 1KFVA 1DM2A 4OGRA 4FSUA 3VS1A 1OFIA 3LCVB 2WPAA 2ITTA 3GPXA 2VRXA 1GJTA 1OPLA 3B89A 5CENA 3A7IA 4IANA 4UEUA 3RPOA 4PX6A 1Z6TA 3HGKA 4U79A 3ULZA 3RHKA 2ONLC 1XR1A 4FW9A 4YPDA 2YIXA 1W8CA 1W98A 4O1OA 3PTGA 3QC9A 3LJ1A 3D5VA 4YTCA 5KKRC 4NIFB 4L43A 3CE3A 3ORLA 3R7GA 4EOLA 1C1KA 4BTMA 2PVFA 5EDRA 5IQGA 3O23A 3HDMA 3FHRA 1I44A 2JDVA 4EOMA 3Q9XA 5ACBC 1ZQ9A 4XCUA 4AOTA 3LMMA 4JXFA 4A9UA 4OBOA 3SKCA 4QMSA 4NCTC 3HRFA 4CG8A 5IISA 4ANQA 2ZANA 2JGZA 1FOTA 4HNIA 3NDMA 5ITXA 4CISA 2QOOA 3LMGA 2UW9A 3U51A 5KUPA 4XRJA 4BZOA 4RC4A 3H4MA 4BIDA 3LQ5A 5HD7A 4O4FA 3HP5A 3HAMA 2CN8A 2P2HA 3MHVC 3FQEA 4WSQA 2J0LA 3VS7A 3ZUTA 3E7VA 1VQ1A 2YQZA 4LV8A 4NM7A 5AV3A 3QTIA