1ZMUA

Catalytic and ubiqutin-associated domains of mark2/par-1: wild type
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
313
structure length
293
Chain Sequence
GNYRLLKTIGKGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 92
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmuA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmuA01
4DBGB 3F61A 3MV5A 4MD8E 4FC0A 3LE6A 3DFAA 3VBQA 3RPVA 2R3PA 2EJSA 2WEIA 1W98A 3TWJA 3UP7A 3TN8A 5IUHA 1XR1A 2O25A 3CLYA 3RHKA 1BKXA 4EZ7A 4HYSA 5JGAA 3KQ7A 2P2IA 2WQNA 4FKRA 1MUOA 4JQ7A 2WQBA 3R28A 4JDKA 4XG2A 2QI8A 3OXTA 2UW4A 4I4FA 2DZLA 4D2SA 4EOJA 4BCMA 5D41A 3GOKA 4FTMA 1YDRE 1Q97A 4O21A 3L8SA 4YP8A 3RZBA 4EH8A 3QUDA 1XQZA 4G3GA 3FI3A 4QPAA 3T9TA 4YC3A 3TV4A 3FQSA 4IB1A 5LMAA 4ZLYA 4JX3A 3SRVB 4ANBA 4IW0A 3U9CA 4GH2A 5KUPA 3DQXA 4IX6A 3BRBA 3REPA 1UV5A 2B9IA 2BDFA 2VNYA 2HZ4A 4EYJA 4AF3A 5I9WA 3D5XA 3MPTA 3V3VA 4GT3A 4AGDA 1UKIA 4OBOA 1H1RA 5IZFA 3OMVA 5BVEA 3ZRMA 5AIKA 3P78A 1KSWA 4G5JA 4JJRA 4QMLA 4D1SA 3WILA 4XOZA 4C58A 5HVKA 5L2QA 1M2QA 4ITJA 1H28A 3CBLA 4YJRA 3KB7A 2ZOQA 3PE1A 3NUYA 5DH3A 1EFUB 4DH3A 4UX9A 4EC9A 2I0HA 4JT3A 4L01A 4FYNA 2OKRA 4GFMA 1JOWB 5FP6A 3ORIA 3RMFA 3SX9A 4D58A 1S9JA 4IM2A 3L8VA 4BDIA 1WR1B 5A54A 4KABA 3QQKA 1WGLA 1PXPA 4RIOA 1WMKA 4QYHA 4HGTA 2XK7A 4FSZA 4BCGA 3AC2A 1ZMWA 2XZSA 3S4QA 2DAKA 2QU6A 3LXKA 4J71A 4KNBA 3C7QA 2HIWA 3FHRA 3LMGA 4YLLA 4UYAA 2GHMA 5JZNA 4FTRA 3QTQA 2WMRA 3ERKA 4PPCA 4RLLA 3WOWA 4E6DA 2C5NA 4DA5A 4M15A 2BWEA 5HO8A 3M1SA 5C01A 5LQFA 1U46A 4YPDA 3BE9A 4AAAA 3KF7A 5E7RA 3FLZA 5HIDA 3MH3A 4O84A 3HL7A 3AD6A 4KRDA 3EIDA 2HWOA 2C5YA 4FV3A 4ZJJA 2X8EA 4O27B 2RSVA 4O38A 5EHYA 1VZOA 2QOLA 4I6BA 3GU4A 4TYJA 4MD7E 3TNHA 3ZO3A 1A5TA 3NMUF 4BBEA 4NZWB 5IKWA 5M57A 2ITNA 2R3GA 1ZXEA 3ZYAA 4DGMA 2WMUA 3F9NA 1FVTA 3EQFA 2B53A 3QFVA 4EH3A 4WIHA 4ZSJA 1Q5KA 1WBOA 3RAWA 4EZ3A 2YM3A 1JKTA 3I79A 5HLNA 2WTWA 2C3IB 3DKCA 4K2RA 3HDMA 4S2ZA 4BIEA 1JPAA 1FMKA 3A8WA 2W99B 3FKOA 1ZYCA 2VWZA 3EKKA 3FLSA 3CQEA 4GS6A 2JDTA 5CF8A 4TTHB 4C34A 2WU6A 5D1JA 4CRLA 4DITA 3SXSA 4ZOGA 3HVCA 4YSMA 1V92A 2G2FA 5FXQA 3H3CA 4MNEA 2C30A 4EWHA 2R4BA 4YJQA 4F4PA 4QPSA 3V5TA 4XV9A 3PXYA 4ZSAA 5LVMA 2DENA 4AU8A 3OHTA 1R39A 4UXLA 1JQHA 3NPCA 4KBAA 5F1ZA 2XIYA 5FXSA 4C8BA 4ZLZA 5E8SA 5C9CA 4FIGA 4IIRA 1OBGA 4MAOA 5A4QA 4G6OA 4HEOA 3D14A 4C3PA 4ZJIA 3Q6UA 5EM8A 4QTAA 4I23A 3COMA 4IH8A 2DI0A 2E9UA 3R2BA 4MF0A 1WHCA 3VW6A 2YCQA 2Y7JA 2VWIA 4LL5A 4EK6A 3GQIA 4IX5A 3POZA 4N70A 2LVOC 4F6SA 2W1HA 4G6NA 5F20A 4C62A 5KNJA 2XNGA 3VQUA 5LXMA 3QTXA 3BIZA 4FTCA 1GO5A 3AQVA 3LJ0A 4BZOA 4QQTA 4S31A 4NT4A 4IWOA 1IXSA 3E92A 1WFCA 2VTMA 4HNFA 4I6HA 1O6LA 5C1QB 5CI6A 1W7HA 3OF0A 2PMOX 3I7BA 3PJ1A 4FGBA 4IB5A 3HUCA 4IDTA 3GVUA 2YDKA 4U43A 3UBDA 2F2CB 4GSBA 1V0BA 3PA4A 4TWCA 3PPKA 4TNDA 3F5GA 1SVGA 4USFA 3FLQA 2LBCA 3D0EA 1ZOGA 3DDQA 1OPLA 3VN9A 1WBNA 4BDJA 3UQCA 2K0BX 1GJOA 3I0OA 1JVPP 4AFJA 4ITHA 1HQYE 3PJ3A 2GNLA 5H2UA 4FSNA 2WTKC 3VQHA 4OAUC 4FG8A 5EQPA 4FSYA 2F49A 4PL4A 4ZSLA 3ODZX 3PSBA 2J50A 5TOZA 2IW9A 4RA4A 4YZDA 3OW3A 1R4GA 3V5PA 3FXWA 1OITA 2CLXA 2XK9A 4YJSA 2WZJA 4ZTLA 2AYPA 4V04A 3U87A 3LFEA 3W2SA 3QXOA 4NFMA 4FIHA 4LGGA 5HGIA 3BGQA 5JQ8A 1ZYLA 1G5SA 2NRYA 3DAKA 3R22A 1ZAOA 3R30A 3O2MA 2OXYA 4EJ7A 3FLWA 4QNAA 1CUKA 1U4DA 3SD0A 3PA5A 5LJJA 4NEUA 3FMHA 2RFNA 3MH0A 5ITAA 4L9IA 4PMPA 5F9EA 3TT0A 4O2ZA 4C3FA 5IUGA 5IQGA 4CRSA 4NM0A 3ROYA 3TZMA 3KXMA 3G6GA 4C33A 5AR3A 3LOKA 3AD4A 5KKRB 2WTVA 4BTMA 2LVAA 2VTHA 2OZOA 4PNIA 4I92A 5CI7A 4IVCA 4WG4A 5AV0A 3NX8A 5C03A 3VF8A 4CFUA 5HORA 4PL3A 4KBCA 3AOXA 2E9NA 5L3AA 5IDNA 2WD1A 1ZY5A 2OICA 4QTBA 3VS2A 2C6KA 4AN2A 4O0UA 3V8TA 1SG9A 4GT4A 4QNYA 4QT1A 4BWXA 2A19B 1P14A 2F9GA 3QU0A 3DGKA 4BDHA 4BCHA 2WTDA 1DM2A 1URWA 3KK9A 4XJ0A 3AC1A 3UMWA 4CEGA 2W5HA 1YDSE 2JDOA 3IDPA 3VS4A 4NL0A 4FTQA 2W1GA 4NSTA 4DFNA 4OTRA 1H1PA 3ETAA 3WF5A 4IZ5A 3ZM4A 4EUTA 4QMWA 5M09A 3PA3A 3EMGA 2XK6A 4J7BA 1CKIA 3D9VA 2RRUA 4G3EA 2PMNX 3NEWA 4WOVA 2VWVA 5LVLA 5TE0A 2CN5A 4XRJA 3K9OA 3CJFA 3RHXA 3FI8A 3LMIA 2UZOA 3D2KA 1RJBA 4PPBA 4QP9A 4J8NA 4E5WA 3TDVA 2A2AA 1YLAA 3LCOA 4WKQA 2PHKA 5JGBA 5LWNA 1VQ1A 1E9HA 1Q61A 3OEFX 5JK3A 4YPSA 5KE0A 4MTAA 2BDWA 1GY3A 2PVJA 5IQIA 4E26A 3DXNA 4U81A 1LP4A 2F57A 3KRRA 3IDBA 3SW4A 4TT7A 3EQHA 1M2PA 3ZSHA 4TYGA 3WIGA 5BUEA 2GSFA 4EHGA 5EKNA 2QO9A 4HVHA 5KHXA 4N4SA 3P7CA 1SZMA 4DEDA 5M4IA 5M51A 2VGPA 3Q96A 4BBMA 1SVHA 4MXCA 2R3QA 5AR2A 2XK4A 2CDZA 3MFTA 4H05A 1Z5MA 3VRYA 4EH4A 2HXQA 3TTJA 1M7QA 4OAVB 2KNZA 2NPQA 1ZZ2A 1H1WA 2OH4A 4TZRA 4EOMA 2VNWA 4FVRA 5IQCA 5K0XA 1REJA 4QMPA 4FK3A 4RJ4A 1HT2E 5IA1A 2C47A 4MQ1A 4DG3E 4RSSA 4HZSA 5I9XA 4FUXA 4YURA 1JR3E 4FKPA 4C4GA 5CNOA 4PMMA 2BTSA 3WF6A 2QO2A 2IG7A 3CY2A 2F7ZE 3CKXA 3K5VA 5EI2A 2XNPA 3ZLXA 4CFMA 4G3CA 3LXPA 2ITZA 4NM7A 2R3HA 1RQQA 2LTUA 5DYJA 3NIZA 1FOTA 3U6IA 2C4GA 4C4EA 5ICPA 4V0GA 4LL0A 4L00A 3WE8A 2UVYA 1Q24A 1WBSA 5F4NA 2PZIA 4FTOA 1CKPA 2A4LA 3GCVA 3VUMA 3N4VA 4LG4A 2QD9A 4IACA 5AX3A 3W8QA 2NNWB 3GU8A 5HO6A 3ZTXA 5IA0A 1IRKA 2GQGA 1OKYA 2XA4A 2XEYA 3VS6A 5FBOA 3E8NA 4FZFB 4BL1A 3CTJA 3G2FA 1FINA 4FKGA 2H9VA 4JR3A 4P5ZA 4YO4A 1SNUA 2IO6A 2CGWA 3K3JA 2V22A 1T45A 2PZRA 4MX9A 2UVXA 3LFDA 2PUPA 1T6OA 4QTEA 3NCGA 2O64A 4RVTA 4MQ2A 1IAHA 4KKHA 5IQAA 5IEVA 4AX8A 2DHYA 4YTFA 3FXXA 2PVYA 4O0WA 3POOA 3IDCA 2L2DA 2X81A 3PXQA 3QD2B 3KY2A 1WJ7A 4KINA 3GXLA 4IADA 3BYUA 4P5QA 2E2BA 1VDLA 3ZONA 4ASXA 3R8ZA 2CKOA 1WGNA 4QMMA 4J96A 1YRPA 4UV0A 2VTJA 3BYOA 3VS0A 3ZUTA 3MN3A 3SOCA 5K5XA 3LMHA 2BRGA 4RIXB 2IN6A 5EM5A 3SLSA 4FNXA 2XK8A 4AE9A 1WVYA 3DTCA 3O17A 1V0OA 3SHEA 3LJ2A 3R00A 1BVSA 3JY0A 4QPMA 3UZRA 4UN2B 2JY7A 4AUAA 2Q0BA 4IAFA 4I21A 3VBTA 4CNHA 5LVOA 3AMYA 5JN2A 2LVQD 4WBBB 1KV1A 2BRBA 3KN5A 1TVOA 3C9WA 5CWZA 1T43A 2GTMA 5K4IA 2ETRA 2R7BA 3QCXA 2OGVA 4BGGA 3BKBA 4JX7A 4E1ZA 1OKSA 3HZTA 3NYNA 2YISA 5HI2A 3D7TB 2VWYA 3AC4A 4O7NA 2HZNA 3HNGA 4XYFA 4EOPA 4X2NA 3LQ8A 3OROA 5DRDA 4O7WA 4YHJA 4DYMA 3WZKA 4BB4A 2UZEA 1XH8A 3BHVA 4AZVA 5HU3A 4NM5A 1YXSA 2QU5A 1X8BA 2YJSA 1XO2B 1UWJA 1Q99A 1UWHA 2UZUE 3LFQA 3M11A 2OBJA 4K77A 4BYIA 4C0TA 4Z55A 2VO0A 3LQ5A 4TWPA 1GIJA 5EM7A 3E3BX 2XB7A 4EONA 2CCHA 4RA5A 4E93A 4R3CA 2BILB 3UIBA 4YTCA 3FZSA 2YACA 2YERA 3OG7A 5CZIA 5HNGA 4Y83A 5IA2A 3ZRLA 3L9NA 5BUJA 1CKJA 1GOLA 1H01A 4EQUA 1YKRA 3V04A 3PXZA 3HGKA 5G6VA 4MXAA 4D2VA 4F1OA 4LUEA 2VTPA 5I0BA 4UXQA 4ACMA 4U79A 3BZ3A 2W96B 2Y6OA 4WBOA 2W4OA 4I22A 5AP5A 1M17A 3CQUA 3QALE 4M66A 2ETMA 3E8DA 3PG1A 1BMKA 3R7EA 3S3IA 4BZNA 5ANOA 2VTTA 3CPCA 1W83A 2G3QA 5FM2A 3GI3A 1CDKA 2P4IA 2XKDA 3HV5A 3BHHA 1ND4A 4FV4A 3QYWA 3C13A 3FMEA 4YNOA 4XG4A 3JYAA 1XJDA 3CP9A 3EQDA 4YNEA 3BLRA 4S32A 5J1WA 5IQHA 1TQPA 3QA0A 4NCTA 3F5XA 2AC5A 3A61A 4GKHA 1PW2A 3H0ZA 3DKOA 2YM4A 4I0TA 4WRSA 1J7UA 2VZ6A 4O7VA 2GTNA 3I81A 4R3PA 4DGOA 3UYSA 3DPKA 1QMZA 4FNZA 4A9TA 3HMIA 4U45A 4G3FA 3L9PA 3R01A 2QODA 3SXRA 3IOKA 2RGPA 1WCCA 4ZIMA 3AXWA 3IW8A 2UW8A 4K9YA 5HG9A 2C1AA 1QPJA 3KMUA 2C3KA 4MBJA 4ZXTA 3KCKA 4JDIA 4L7SA 5CU2A 4EK8A 3B8QA 3SVVA 3VO3A 3VRZA 4AZTA 4FA2A 4DBNA 1PY5A 1GZNA 2IVTA 2Y4PA 4FKQA 4G9CA 4AW1A 4GT5A 5IISA 1KE7A 3QLFA 1B6CB 2UZVA 3DU8A 3CCNA 3W33A 5EI8A 3TJCA 3A7GA 3Q32A 4JAJA 4P90A 2EU9A 4I3ZA 4AN3A 1ERKA 2XJ1A 2BALA 3HMMA 2CNUA 4GCJA 1ZYJA 1YOMA 4IVAA 4AGCA 4EC8A 4QP8A 2WMSA 3C4EA 2YCFA 4F9AA 2G01A 4U8ZA 1DI9A 2C0OA 3EYHA 4EI4A 3Q4CA 2BDJA 4GUBA 2YM7A 3W2OA 2XM8A 4TW9A 5BYZA 4OBPA 4R6VA 5I3RA 2BAKA 2G1TA 1Z9XA 2MR9A 3EFLA 1OIUA 4FTKA 5HE0A 1WVXA 3N4TA 2QHMA 5DVRA 5FGKA 3A62A 5GJFA 2PUUA 2UV2A 4IB3A 4W8EA 4CVAA 4N57A 4OT5A 5I9VA 1QPEA 1XBCA 3KVXA 3MB7A 1F5QA 1U5RA 2OXDA 2RFDA 3FJQE 2QOKA 2JIUA 3BYMA 3IO7A 2X8DA 2XUUA 3NUSA 5T68A 2FH9A 4CD0A 3P4KA 1LR4A 4RC2A 4H1JA 3KA0A 4AA0A 5DIAA 4AFEA 1J1BA 4EYMA 5HBEA 4XG3A 3FQEA 1VEJA 2V55A 3R9HA 4GIHA 4JXFA 4O0VA 3TNIA 1LEWA 3ORKA 1O6YA 3DK3A 4DFLA 3HRCA 2RG6A 3Q3BA 5KZ0A 2ZDUA 3EZVA 3FC2A 2WOUA 3DNDA 4QOXA 5IA3A 1IA9A 2P33A 5GINE 3DBCA 3ID6C 3C0GA 5CNNA 3EL8A 2JY8A 2J2IB 3NW7A 4EOLA 5IQFA 2C5XA 5ANIA 2CWBA 3PPZA 1KE9A 2C5VA 2AUHA 3W16A 3K54A 4QMSA 2ITUA 2QURA 4X3JA 5AUUA 2W1FA 5CSWA 4PY1A 3Q9XA 4DE4A 4L6QA 4BWKA 3NSZA 3NNXA 4FZ7A 2GQSA 3TUBA 3RPOA 4DTKA 3G0FA 3QC9A 4FIFA 4K8AA 4ZZOA 4MH7A 2YM6A 3GT8A 3OP5A 3MFSA 4IWDA 2KTYA 2WMTA 3DKGA 1MQ4A 3THBA 2P2HA 5GNKA 1CM8A 4ZZMA 3QQUA 5KBQA 2Z7SA 4S30A 5M06A 3AGLA 3TCPA 2FB8A 4FKSA 5DR2A 3F3TA 2QOFA 4O22A 3O8UA 4C2WA 2VTNA 4R7HA 4AQCA 4V0GB 2QVSE 4D1ZA 2CGUA 3RPYA 1OUKA 4K11A 3KEXA 4UWBA 2OF2A 2BRHA 5KHWA 1CTPE 3IONA 4FKTA 1OL1A 4PPAA 3B2WA 3WF7A 2W1CA 5L6WL 1ZWSA 3V5JA 2X2KA 4FKLA 3C4XA 2W1IA 3TZ8A 2JFMA 4QP3A 5CT7A 3T3UA 5BVNA 1YHSA 5EW9A 3MWUA 2ITVA 2YIYA 4JG6A 4IQ6A 3A99A 2UW5A 2UZNA 1Q62A 2QG7A 3W8LA 4RVLA 5ANKA 3MIYA 5JRQA 5KKRC 2YCRA 2WTCA 3NVKI 3I6UA 4EK3A 3N51A 3V01A 3RWQA 3QRIA 1XH4A 3R7GA 3D2IA 4KIKA 5HICA 4BWPA 3LFCA 4D9UA 2R0UA 4OTHA 1YDTE 3RTPA 3MB6A 3NZ0A 3UGCA 3PTGA 5FWKK 4G17A 2OFVA 3QQLA 5EK7A 4ANOA 1SVEA 2UVZA 3FMJA 2YDIA 5CU3A 4WSYA 4X6RA 4D0WA 4TN6A 3EWHA 2C69A 4D5HA 1KE6A 3NDMA 2QOCA 3QZIA 4XX9A 3R63A 1PXOA 3TNPC 4CQGA 4ENXA 4E5AX 5E4HA 4BN1A 2GPHA 2JD5A 5FTGA 2DAGA 4M7IA 4WRGA 4D28A 3DFCB 2EB2A 5AV3A 1C7YA 4YBJA 4L53A 3RNYA 3NLBA 3GCSA 3IKAA 4E6AA 3ZH8A 3BGZA 5CTPA 2O8YA 1AGWA 1MN3A 3GBZA 3PZHA 2PVKA 3NRMA 5L8JA 5L8KA 3WBLA 1JSUA 3F5UA 5M53A 3UNJA 3FPQA 4ZSGA 2HOGA 4QQJA 5ACBC 4RIWA 3RPRA 2ESMA 4QRCA 5AP3A 1CSNA 1TQMA 1YWRA 4LOQA 5LCKA 3ZSGA 4CKRA 4HGSA 5CALA 5EW3A 2FSOX 5J5TA 1PXKA 3LCVB 1YVJA 5CAQA 2CKEA 5HBJA 4LMNA 2QSFX 1GZKA 1PXNA 3QTUA 4X3FA 3UDBA 3UJGA 5JFSA 1A06A 3ORTA 4NIFA 5JFXA 1IFYA 2WOTA 5GJDA 2QQ7A 5CAVA 3WF8A 2REIA 5CY3A 1JSTA 2PE0A 2O0UA 2VTAA 3UODA 4F7JA 3ZC5A 3EKNA 4FTUA 4FGRA 5HG7A 3RKBA 4AP7A 4DH8A 4JG7A 2BIKB 3S1HA 1P3QQ 5CQWA 3D5UA 5CXHA 3H30A 5J9ZA 4C59A 4KAOA 5M07A 2JITA 4ZS0A 4L3PA 3WYYA 3EL7A 3QZFA 4DINA 1MRYA 1YOLA 4X21A 2HW6A 1J7LA 5I4NA 3S0OA 3UZTA 1JAMA 5D12A 3BX5A 2FO0A 3U8WA 5L4QA 5LCJA 5IDPA 2OG8A 4X2FA 4CTCA 4FYOA 4H3BA 5HZNA 3UOJA 4D9TA 4FEUA 3LXLA 3MI9A 4JDHA 4UN0C 4M0ZA 2F4JA 3R9DA 2PE1A 4TY1A 4O86A 4ZZNA 3F2AA 3I0QA 1TR8A 1HCLA 3MJ2A 5J7HA 2JKKA 2WIPA 2QOHA 3ALOA 4J1RA 1GNGA 1W82A 3M2WA 4JDJA 3II5A 2J7TA 4JIAA 3BYSA 5HEZA 3KN6A 5EHLA 4YLKA 1PMEA 3OCSA 4RVMA 4BCFA 3ULZA 1FGIA 3MIAA 4YJOA 3MA6A 3MH1A 2QNJA 3MVLA 5HCYA 3NGAA 5AP6A 4G3DA 1E1VA 4FV5A 5DT4A 3UO4A 3FL4A 5ANDA 5DI1A 4RRVA 1DV0A 4CZTA 1UKHA 2XRUA 3DXPA 3H0YA 2PL0A 2DS1A 3R6XA 4FSMA 5DT3A 2Z60A 1M52A 4BYJA 3O8PA 4PTGA 4A06A 2YJRA 4X0MA 4GKIA 1ZY4A 4S34A 4L3LA 5AAEA 3AC8A 5K0KA 3F7WA 1W8CA 1L3RE 2C6TA 1B39A 4ERWA 2VX0A 4ZK5A 5JKGA 5FBNC 2HY0A 1OB3A 2J0KA 2VO3A 2X1NA 4C4HA 5HG5A 2VTSA 3E5AA 1K9AA 3KK8A 4F70A 1JLUE 3UYTA 3PIYA 4AA5A 3H4JA 1H24A 4F6UA 2OO9A 2Z8CA 3KF4A 4PTCA 3A7JA 4O1OA 2JIIA 3ULIA 5C4KA 4IVBA 2IZTA 1Q4LA 3VVHA 3PIXA 3TNWA 3P7BA 3TDWA 2ITYA 3LZBA 1Q8YA 3ODYX 4MVFA 3VW8A 5KMLA 3AC3A 1OM1A 4JR7A 3VBYA 2QONA 4FV6A 2MROB 4TL0A 3FKLA 4QMOA 5BUIA 3SG8A 2Z7LA 3P1AA 3DZOA 4MWIA 5LWMA 2YLEA 1ZMVA 1R1WA 4L3JA 4PP9A 4O1PA 5AX9A 3F7ZA 4DH7A 1EH4A 4R1VA 5BMMA 4IAKA 5FEDA 1G41A 1HCKA 2WU7A 4BTKA 4GEOA 4ZP5A 2R2PA 4NU1A 4DCEA 2HELA 4AZWA 3IW7A 5J95A 3R02A 1URCA 4ZY4A 4O81A 3F92A 4NTTA 5BVDA 2XP2A 2ZV8A 3GU6A 4XG7A 5CX9A 4NKAA 3QHRA 1U5QA 4D2WA 3OY1A 1W84A 3CJGA 3FLNC 3LFBA 4ZSEA 3ZHPC 3C0HA 4QQ5A 3TG1A 3C51A 2XS0A 2XCHA 3O0GA 3QQGA 4GYGA 4RJ8A 1T46A 3HV3A 2RKUA 3AGMA 3AMAA 4CFNA 3ORPA 4WG3A 4C4IA 5EW8A 4FL1A 1NVQA 4AW5A 2C3LA 2GNIA 2XYNA 4EH7A 1NXKA 3OS3A 2IVSA 1OAIA 1KOBA 4IC7A 4DEGA 4PP7A 2XJ2A 3EZRA 3QKKA 3I7CA 3LLTA 3QXPA 2BVAA 5HIBA 3PFQA 3WZUA 3HLLA 2P0CA 4Y73A 3VBXA 4O7YA 4C3RA 5CANA 3PYYA 3O51A 3KXZA 4L46A 3KKVA 4CMTA 3Q9ZA 4KIOA 1BLXA 2XYUA 3OFMA 4R78A 3PSDA 1RDQE 4UWCA 4IBMA 5IH6A 2A1AB 2XMYA 4RPVA 4BC6A 2NRUA 2H5XA 4CXAA 3Q5ZA 3UTOA 4A4OA 4BI0A 4W8DA 1NV9A 2GFCA 3QKMA 2G2IA 5EYKA 5A4EA 3E3PA 4I93A 3SW7A 1KE5A 3IG7A 3JS2A 2XBJA 3OUNB 4XMOA 1E1XA 5LMKA 5LOHA 4TYEA 4MD9E 3NUNA 4EZ5A 3QTZA 2GS2A 4YGAA 3UVPA 3COHA 3I1AA 4TWOA 2YLFA 3A4OX 3MGYA 3BPRA 5HLPA 4FV8A 4EH5A 5AR8A 5CEOA 3JPVA 2CNQA 3BELA 3C4FA 1GZOA 4UZHA 2YFXA 2WMAA 3QX4A 4Y5HA 4E4NA 1YHVA 3R7IA 1I09A 4PTEA 3FPMA 3Q60A 4Q5EA 4WNKA 2H34A 2PULA 3ZM9A 5AM6A 5AUYA 5IA4A 4BIBA 2J0JA 1YOJA 3PVBA 4Y95A 4Z7HA 3UQGA 2XNMA 5E8YA 3ZOSA 3LCDA 2JP7A 1PMVA 4F9BA 1OIYA 4RFZA 3ZO1A 4I4EA 2O65A 3HP5A 3A60A 2JIVA 3ZLWA 2OWBA 3BEGA 2ZJWA 3TZ7A 2BZHB 4QMYA 1ZYDA 4C4JA 5JH6A 4F0GA 2W05A 3HECA 3HA8A 4G34A 4NKSA 4YJVA 2C0IA 5JQ5A 2GQRA 4CCUA 4FIEA 3PLAE 4RQVA 2KHHA 3HKOA 1TQIA 4PDSA 4WP2A 3LFSA 3IHPA 3ZUUA 3PJ2A 4IC8A 4U7ZA 2VV9A 3UC3A 4EOSA 3TXOA 3Q4UA 4YLJA 2J0IA 3VBWA 5CEPA 3G5DA 2C6DA 3U54A 2VGOA 3BI6A 3R8LA 3QAME 5CAOA 3KCFA 3UP2A 1Q8ZA 2JY6B 5HESA 4HPTE 5DHJA 4A9UA 2WAJA 2PVLA 3GU7A 1WBPA 4TWNA 5L6PA 1XH7A 2VTQA 2OW3A 1RE8A 4PX6A 5DA3A 3D5WA 2LVNC 4WSQA 4CCBA 4Y72A 3RCDA 1PXMA 3AC5A 2LAVA 3GLGE 2W06A 4A9SA 4DG2E 5ETCA 5K3YA 2B3TA 5DBXA 1FQ1B 1XBBA 3OBGA 4F0IA 2YWPA 1NA7A 4BDFA 4FEVA 3QBNA 2ZMDA 4J98A 4XLIA 3KXNA 5K9IA 4RIWB 2DQ7X 2FYSA 4QP2A 4BDEA 2YZLA 3IW5A 5FRIA 4L45A 2OOBA 3OT3A 4RZVA 4JIKA 4H39A 2C1BA 3C0IA 5HQ0A 3UO5A 3R8VA 2WTIA 4PRJA 4LFIA 2JLDA 2JFLA 4X3FB 1H07A 3A7HA 3IQ7A 1Q3WA 3VIDA 5EDQA 3BQRA 4NIFB 5LMBA 2X7GA 2P55A 1H1SA 3HMPA 3NYXA 2B7AA 3D83A 3NYOA 3AMBA 5CEKA 1H25A 2YM5A 5H3QA 5HTBA 3D94A 2OI4X 3QTIA 4JQ8A 2JAVA 2QR8A 3DK7A 4AOJA 1UVRA 2KULA 2UW6A 3ZXTA 4CGAA 1M14A 5T3QA 1DS5A 3LCUA 1JNKA 4GFGA 5KX8A 2HAKA 4FX3A 2RIOA 3MY1A 4BDDA 4B4LA 2OIDA 2XJ0A 1K3AA 3W1FA 4OTPA 5HVYA 5AUZA 2XH5A 3CS9A 2XCKA 4FODA 4YHTA 4GMYA 2JDVA 1J1CA 1XWSA 4FSRA 4LOOA 4U3ZA 3ZDIA 5M4UA 4QO9A 5FM3A 5IUIA 4MF1A 4LI5A 5HBHA 4FIIA 4A7CA 5CSPA 5AR5A 3QTSA 3DJ5A 4AW0A 3ZZEA 1HJPA 1NV8A 4TKSA 4CYJA 4YSJA 4CV9A 1OGUA 4XP3A 2WNTA 3MYGA 4O7LA 4FUYA 1MRUA 3V6RA 4E5BA 4XV1A 4ZTMA 1OUYA 3PY3A 5DEWA 4CZUA 3KREA 3O50A 4FNWA 4IZ7A 3VUKA 1V1KA 3I4BA 1AIPC 3CIKA 2BUJA 1IG1A 2JC6A 4U44A 1SM2A 3SAYA 3UNKA 3RGFA 3RZFA 2HXLA 1NVSA 4MXYA 3WIKA 4ZMEA 2PZ5A 3FC1X 1DO2A 3P7AA 4F64A 3EN6A 4Z7GA 4O2PA 2VN9A 4D5KA 4H3QA 4FI1A 3OCBA 3OD6X 3DBQA 2UZTA 4FV9A 3F69A 4PWNA 4OGRA 3U6JA 4UBAA 3JR1A 3FI4A 2IJMA 3MMPA 4IXPA 4FKIA 3IPHA 5CVFA 4QMVA 4EH9A 2X0GA 4DTBA 2I1MA 1Q3DA 2B4SB 3FUPA 2IZUA 2QLUA 4BDCA 4USEA 3BLQA 4XOYA 3FBVA 5TKDA 4D4YA 5DEYA 3VAPA 3HEGA 4ZS4A 3NAYA 3D5VA 4IB0A 3RAIA 2C0TA 3FRIA 3MY0A 2UZWE 3EYGA 3DKFA 5ANJA 4BZDA 4RWJA 5KMOA 4F2LA 2WQMA 2PUNA 3BEAA 3DXQA 4D1XA 2DNAA 3AT3A 4M68A 4RWIA 4UMUA 2OK1A 2QCSA 2Z2WA 4OTGA 4AZEA 4IX4A 4BCQA 3E7VA 4XG9A 5DGZA 3DBEA 1FBNA 4GJ3A 3OWLA 4PDPA 4MNEB 3SQQA 5J87A 3RNIA 3MESA 2HY81 4C37A 3SXFA 3VS3A 3DAEA 3NAXA 3UIXA 1REKA 2VWXA 1TKIA 4QP7A 1YI3A 5DOSA 5EYCA 5CF5A 2BFYA 1ATPE 2PVHA 5IF1A 1XKKA 4HW7A 3GQLA 5BVKA 4DEAA 5GIPE 3U55A 3PJCA 5JI2E 4IZAA 3CGOA 4FL3A 4RZWA 3ZUVA 1XB2B 5KMIA 4ALVA 1P5EA 4OTFA 4FVPA 4LGHA 5CU0A 3A7FA 4C4FA 4TXCA 1AD5A 3KRLA 4W4XA 4FL2A 4CG8A 4I5MA 1PXLA 3HRFA 1IA8A 1SYKA 4UMQA 4BRXA 2WMWA 4CSVA 5A3XA 4BI2A 2ITWA 5DNRA 2VO6A 4FT9A 3O7LD 3QCSA 4GK4A 4Z9LA 4DEHA 3LQ3A 2C3JA 2J9MA 3KRWA 4O7SA 2PYWA 1YHWA 3GB2A 5M4CA 4CYIA 3C4WA 4ZJVA 2E9PA 4GG5A 5FUTA 3ZO2A 3MVHA 1PJKA 5DFLA 2V62A 2X8IA 4MCVA 5I9UA 4CKJA 3HRBA 1O6KA 3PRIA 1FGKA 4QYEA 4U97A 5CEQA 1QPCA 5J5SA 3TEIA 1G4AE 3TTIA 3SRVA 5KMNA 1QL6A 3C1XA 4QMXA 4JLCA 3BBWA 5EH0A 3WF9A 1L8TA 3EN4A 2YM8A 2CKQA 2HZIA 3CPBA 2XKFA 4EORA 4RLKA 2FSTX 4I5HA 2Y8OA 2IWIA 4P4CA 4IEBA 4DFZE 1OL6A 2BHHA 4L52A 4GV1A 4IZYA 4ANSA 5JFVA 3DJ6A 5ETIA 1OZ1A 3GC8A 1VEGA 1OMWA 4HGLA 2PMIA 3DA6A 4U40A 5CSXA 4R5SA 2IVUA 4GJ2A 5HCXA 3SA0A 3P79A 5AR4A 3UVQA 2XIZA 3HAMA 3DBFA 4NJDA 5L2WA 2J6MA 4ZMFA 3BHYA 3KXGA 4L8MA 5B2LA 3ALNA 3DY7A 4F63A 4CMOA 1OPJA 4P7EA 5JGDA 1PXIA 2V7AA 4D2RA 4EOKA 5H8EA 3EN5A 3MVMA 4L42A 4C61A 3BWJA 3QL8A 2GFSA 3QZHA 4HJOA 4IX3A 2JKMA 4UY9A 4XLVA 4XS2A 5HKMA 3RM6A 4BKYA 4Z3VA 5FEEA 3TL8A 2I40A 1I44A 4FVQA 4ZTHA 4U5JA 3E63A 4HYUA 3VHEA 2PK9A 4G1WA 4ANLA 3FSKA 3ENHA 1F4IA 3VBVA 3KULA 3VS7A 3WE4A 3O8TA 3QWKA 3LM0A 4LM5A 2I7QA 4IANA 3R04A 5TR6A 3VULA 3PE2A 3E21A 4LRKA 2FVDA 2I0EA 2QHNA 2UZBA 3P86A 2VTIA 3PIZA 5AWMA 4EH6A 3W10A 2X9FA 4F65A 2IW8A 5FTOA 1WIVA 4F08A 5DE2A 5E92A 1R0EA 3AT2A 3C4CA 2OOAA 4JG8A 5CS6A 5CSHA 2X7FA 2O63A 1RW8A 3P23A 3PG3A 2CCIA 4NJ3A 4TRLA 3Q53A 4D4VA 4J97A 4DLJA 1LPUA 3MFRA 4R8QA 1ZV1A 4I6QA 4JL9A 3F3UA 2R9SA 3PP0A 3PXKA 5LARA 3VUDA 4CV8A 3PY1A 2BIYA 4A4LA 5A4LA 4CFXA 4C2VA 2JDSA 1PHKA 2YABA 3I5NA 4ANMA 3QD3A 4OUCA 1OTRA 3RINA 4F9YA 3EFJA 1IAJA 2R3OA 4KBKA 3JUHA 1HT1E 1H00A 3IGGA 5L2IA 2FSLX 5IH4A 1GIIA 4RG0A 3WZEA 4TYIA 5HO7A 4BR3A 4U0IA 4TPTA 1H8FA 5IH5A 5JMSA 4QQCA 1ZYSA 4KRCA 4I24A 3FKNA 2JBPA 4D2TA 2R3NA 5C8KA 4DH1A 4BHZA 5F94A 3ZC6A 3LW0A 4GFOA 2GNGA 5AV4A 4IM0A 1AQ1A 5J9LA 4AGUA 3NW6A 3IW4A 4C38A 4A4XA 5HNIX 3A4PA 4O0XA 4FNYA 4L43A 5FEQA 3R8UA 3PDTA 3MPAA 4DT8A 2OJJA 4G3OA 3EJ1A 2R3RA 4FT7A 4XHKB 5HD4A 2ONLA 2X2MA 5CSVA 2BHEA 3DZQA 5AJQA 3C4ZA 4BTJA 4KWPA 4E4XA 2JDRA 3QF9A 2Y9QA 3DBDA 2O3PA 3PZEA 3GC9A 2GCDA 3F6XA 3OCGA 2ETKA 5T6KA 3SKCA 1R0PA 2W1DA 4XV3A 4HPUE 3U6HA 5A4TA 4LOPA 5AA8A 2SRCA 2GNHA 2UW7A 3HA6A 5G1XA 3ZXZA 2YA9A 5IQDA 3OW4A 3MBLA 3C50A 2B52A 1F0QA 3IOPA 4H3PA 5CAUA 5D11A 3GC0A 3KFAA 4YC6A 2JUJA 3F5PA 3BU6A 4RWKA 5HE2A 3SG9A 1YXXA 5ACKA 4QP6A 2PZPA 3ELJA 1NY3A 1Y6AA 2DAEA 1BYGA 2R64A 1VR2A 1PYEA 3QC4A 3UOHA 1JKLA 4IWQA 2XK3A 2ZVAA 3W2PA 3LLAA 4FV2A 2VTRA 4AZSA 5C8MA 4FZ6A 4WD5A 2QC6A 4QMQA 5ETAA 4EQMA 3ZLYA 2W7XA 3K3IA 4FKWA 4UYNA 4EOOA 4AW2A 4M69A 2WHBA 4EEVA 2PTKA 5E91A 2L4EA 3HMNA 2B0QA 4HVGA 3LFFA 3F82A 4FSUA 5DG5A 3NWWA 5AAFA 4BY9E 2W4JA 3R2YA 5A14A 3GC7A 5FDPA 2B9JA 4JRVA 4FEQA 3VJNA 4BCIA 3E7OA 3G33A 4TYHA 4UWYA 5E8VA 4O83A 4W9XA 4U41A 4QMUA 2VX1A 2X9EA 2CPKE 3GLFE 3W2CA 4HCVA 1A48A 1H4LA 3LCTA 2GNFA 2WEVA 4MNFA 4I41A 3TJDA 3NNUA 2ZYBA 4LRMA 3W55A 2OJ9A 3W2QA 4D0XA 4HVSA 2QG5A 3QGYA 4O91A 3V8WA 3ENMA 2IZSA 5EYDA 5ANEA 4HCUA 1Q8WA 4MBIA 4AWIA 3H9OA 2PVNA 3MDYA 3BGPA 3F88A 4M14A 3ANQA 3TV7A 5L8LA 1Q02A 3ZDUA 2BZKB 5AV2A 4HYHA 2G15A 4FV7A 4FTNA 5A6NA 5BMSA 3PSCA 1F3MC 3OTUA 4MKCA 1JKKA 3CY3A 4O0SA 4ZTNA 5HHWA 3HP2A 2PWLA 3QRTA 3IW6A 2OFUA 4WA9A 4L68A 5EQEA 1OL5A 4RFMA 2EXCX 3VWAA 4BGHA 3ATTA 5AP7A 4BCJA 2OJGA 3GU5A 3JVSA 4N6YA 2QOOA 2J5FA 4EWQA 2UZLA 3CC6A 2B55A 4GIIA 4I0RA 1PGYA 3OCTA 3FL5A 2O5KA 4U42A 4C7TA 4FZAB 4PNKA 1XH9A 4ITIA 3R8PA 4EUUA 4EBVA 4CG9A 3IK3A 1BI8A 1OVEA 4FSTA 4FTJA 1PF8A 1VJYA 3FE3A 3EH9A 1ZOHA 3G90X 4R77A 5HTIA 4X3FC 1JSVA 3PWYA 1OKWA 4EKLA 5BQ0A 5KBRA 2Z02A 5CENA 3QUPA 3W2RA 5TT7A 3S95A 5KZIA 1Z57A 4IAZA 4M12A 4DTAA 3UPXA 3DOGA 2CHLA 2DYLA 2VU3A 3MS9A 3L9LA 4XUFA 4Q9ZA 1Q41A 2ERKA 3T6PA 1WVWA 5HU9A 3FZRA 4L7FA 4B8MA 1Y8GA 2W9FB 4GRBA 1ZZLA 3A7IA 4Z16A 4AXAA 4I5CA 3GGFA 2W4KA 3RJCA 3GNIB 4H1MA 5BVOA 3RK7A 4OT6A 3KMWA 5BVFA 4XEYA 3FAAA 3ZSIA 3KC3A 2QKRA 3R1NA 4L44A 4W4VA 2O2UA 4K18A 5IA5A 2DAMA 4GVAA 4OLIA 3LCKA 3MY5A 4QTDA 1BL7A 3ZRKA 1B38A 1H27A 2R3JA 4ACGA 2OF4A 3E8CA 5GIOE 1DI8A 1ZMUA 4RWLA 2ZMCA 5J8IA 2W5AA 4OTIA 4IAYA 2XVDA 2C68A 4YU2A 4O0RA 3B2TA 1KV2A 1YWNA 4C02A 4NUSA 1YXTA 3VJOA 2BZJA 4NTSA 1WAKA 5DWRA 4RGJA 3R7OA 3UG2A 2BR1A 3UPZA 4IVDA 4UZDA 1IASA 3NR9A 2WMVA 2BTRA 3QUEA 4BI1A 2A27A 5I5ZA 2Q0NA 2J5EA 5JEBA 5CXZA 3EB0A 4ACDA 1NVRA 3BBTB 3E46A 3SDJA 3U4WA 4KSQA 2YWVA 3OC1A 3FLYA 3QGWA 3V8SA 1KUTA 3F3VA 2HWJA 3DV3A 4FTIA 2OO8X 1V0PA 5DPVA 4FTLA 5CU4A 1APME 2GMXA 3LXNA 4U9AA 3VHKA 5IQEA 5J9YA 4YZ9A 4BHNA 4WNPA 5AAGA 4W9WA 1KOAA 1Y8YA 2R3IA 3PLSA 2ZM3A 2JZ0A 1JBPE 5AR7A 4YMJA 4XCUA 3FMDA 2VTLA 3ZCLA 4BGQA 4LV5A 5CEMA 2UUEA 4JI9A 3LPBA 3G6HA 5GJGA 3FXZA 3F2NA 2QOQA 5A9UA 3CR0A 3E8EA 3KULB 1WZYA 5E8ZA 2Z7QA 3E87A 5CT0A 2BAQA 1BX6A 3PWDA 4MYGA 4ASEA 4FV0A 2UZDA 2ZM1A 5CLPA 2CGVA 4KIPA 4DG0E 4MHAA 4GK3A 4E4LA 4FEXA 2XNBA 2VO7A 2AC3A 4AS0A 1ZARA 2XIXA 4GK2A 5AFVA 4DFYA 4Y5QA 4ANNA 3L8XA 3IS5A 3KL8A 4EOQA 3U4UA 4DCAA 2EKKA 4O0YA 3E88A 2C6MA 1UNLA 2C6IA 1XBAA 1YW2A 4R5YA 4RIXA 3G0EA 1WBVA 3U51A 4RJ5A 2PVRA 3BV2A 3COIA 4IAAA 1VEBA 4AT4A 3F3WA 2ACXA 5HX8A 2PZYA 2PUIA 3RWPA 2LVPC 3BLHA 3F3ZA 3QKLA 1J91A 3D4QA 4II5A 1PKGA 4RJ3A 4KS8A 4XBUA 3TIYA 4FG7A 3MA3A 1H1QA 5EDRA 4M84A 4WO5A 1UU8A 4CFFA 3OWJA 3RPSA 3ACJA 3RP9A 2V7OA 5AV1A 3D7TA 3Q52A 4JBVA 1FPUA 4FMQA 5TF9A 3CXWA 2JGZA 5B2KA 4E6QA 3QCQA 3WYXA 4Y46A 2FA2A 3H10A 3QHWA 4RX7A 4C35A 4PQNA 4KB8A 4DAWA 3MTLA 4PDOA 4LUDA 4UALA 3SC1A 4DEEA 5HE3A 3RM7A 3MFUA 5C27A 4FZDB 5AEPA 4HYIA 3T3VA 3D15A 4BDKA 5IG1A 4IFGA 4IWPA 4K33A 5F95A 2OU7A 4PMTA 4FKVA 4DHFA 4EK5A 3DB6A 1H0VA 3DNEA 1LEZA 1O9UA 4FKOA 4GVJA 2YIXA 4AGWA 4BDAA 4D4SA 4Q5HA 5KMKA 3LIJA 1P4OA 3R9NA 5DN3A 2BZIB 2ZM4A 3CD8A 3A2CA 3BU3A 2YAAA 3FMLA 3HUBA 1OI9A 4DLIA 3Q9WA 5L6OA 2OH0E 5HG8A 2CLQA 4R71A 2WXVA 4QMNA 3EQIA 3OOGA 2XBAA 1U59A 4IM3A 3MJ1A 5M44A 4M0YA 3EHAA 2C5OA 4FE2A 2XRWA 3FZ1A 3QYZA 3ZU7A 5LMKC 3OY3A 2JKQA 4J8MA 4I20A 1IR3A 3GP0A 3HV7A 2XKCA 4P2KA 1XHAA 4I6FA 3Q2JA 5JT2A 4IMYA 2ZV2A 2JBOA 3ZLSA 2WMBA 3ITZA 3RCJA 4UMPA 2XNEA 1UNHA 2WMQA 1VYZA 5B7VA 4M3QA 3JY9A 3FEGA 3PVUA 5AADA 2ZB0A 2EKFA 3EFKA 4QMZA 3QQHA 4R7IA 5EHOA 4OR5A 5EI6A 4O0TA 3IECA 4XRLA 1Y91A 3OWKA 2HWPA 4FOBA 4M69B 3VUHA 3FY0A 4YJTA 3T8OA 2XNOA 2X39A 1BI7A 3R21A 5E1EA 1KWPA 2X4ZA 1UNGA 3M42A 4G16A 5C8NA 4S33A 4TYHB 1KYIA 4CFVA 2WKMA 4WNMA 3H9RA 2CP8A 4ONAA 4CZYB 2PSQA 3FI2A 3OUKA 5BVWA 4KIKB 4O96A 2GDOA 4G31A 4N6ZA 5M55A 2PY3A 3TV6A 4D55A 5IEYA 3ORXA 3GLIE 3CTHA 3BCEA 1PMNA 1OIQA 4F7SA 3R0TA 4ZEGA 3ET7A 3R7UA 3UVRA 2YCSA 2OZAA 3V5LA 1P2AA 3CQWA 4EHZA 4WT6A 4DBXA 3WARA 2ITQA 1HOWA 2BFXA 3G9NA 3WZJA 2R3LA 5L2SA 4FBXA 3GENA 3WI6A 3R83A 5IEXA 4AOIA 3RBWA 1OKVA 4ZTQA 2CSNA 3ZFYA 4ALUA 4FTAA 3PY0A 4QP1A 3UMXA 2B54A 4AA4A 5KMJA 4DFUA 3QCYA 2WTJA 4ID7A 2XEZA 4A9RA 1H08A 5FG8A 2WFYA 4F99A 2PVMA 3W32A 2WMXA 2VUWA 5IMEA 2CNVA 3QD0A 5M08A 4GUEA 4AT3A 3B89A 4YZCA 3PPJA 5DT0A 3BBZA 5HX6A 5HE1A 3TACA 5GHVA 2UW9A 2X6EA 2CKPA 2A0CX 4YZMA 2HZ0A 3RALA 3G15A 4BDBA 4ZY5A 5H8GA 3Q9YA 1XH5A 2DUVA 4N0SA 4Y8DA 3ZZWA 1BUHA 4ACHA 3QRKA 5A6OA 5AUWA 4O7ZA 1U54A 2YIWA 3ANRA 3LFNA 3UIMA 2ITPA 5TO8A 2HENA 2WQOA 4EH2A 4E20A 3PP1A 3AT4A 3UNZA 4CMUA 2X7OA 3R7YA 2VRXA 3GOPA 3QQFA 5EOBA 3FV8A 3FY2A 4FSWA 4BF2A 1G8SA 2YN8A 1WBTA 5CYIA 2PU8A 4XG8A 3TM0A 2WQEA 3DK6A 4H36A 5CF6A 4YJNA 5FDXA 5E8XA 2ITXA 3V5QA 1VYWA 2XIRA 4KSPA 4WNOA 4B7TA 4J99A 3KXXA 5I3OA 2V0DA 4BCPA 2WGJA 4BKZA 3L1SA 2UW0A 3TKIA 2QHOB 4BTFA 4CT2A 2VWWA 4GG7A 3VS5A 4ARKA 4G5PA 2OJIA 3NUXA 4XP0A 2H8HA 1YXUA 5CF4A 2GHLA 3DCVA 3HV6A 5EFQA 4AOTA 3MH2A 4BICA 2ZB1A 4FG9A 3DLZA 3EN9A 3EN7A 4QD6A 3VS1A 5GZ8A 1Y57A 3FZTA 1TTEA 2ZTDA 3QA8A 4LQMA 4QTCA 3ZO4A 4XV2A 3RAKA 3K9PA 3TZ9A 3P9JA 3TUCA 5FD2A 5E90A 5CVHA 3V6SA 5AP0A 3ZBFA 3KVWA 4NK9A 1WBWA 2R5TA 3QTWA 2ZV9A 3FYJX 4YR8A 1OQYA 4PF4A 2PE2A 1OL2A 2V5QA 4FT0A 1OBDA 2PVFA 5I9YA 3R9RA 3COKA 1YI6A 3QTRA 3N4UA 1YI4A 1BL6A 1QCFA 3N9XA 5EKOA 2J0LA 3LVPA 5CASA 5D7AA 3GCQA 2YDJA 3ATSA 4J95A 3QZGA 3UOLA 2ITTA 2B9HA 4BCNA 5HLWA 4YJPA 4ALWA 4WG5A 4EJNA 2W0JA 3W18A 2ZV7A 3SGCA 2RFSA 3KGAA 1DAYA 5IQBA 2F2UA 2Y4IC 1NT2A 2FUMA 3Q4TA 3JVRA 3DAJA 4LV8A 3CGFA 3RAHA 3ZBXA 5BX0A 3C5IA 3PXRA 4IFCA 4YZBA 4BVUA 4HOKA 3K2LA 3PUPA 4IJPA 4F7NA 4Q7JA 4F9WA 2VD5A 5AA9A 2BCJA 1FMOE 2C6OA 3HMOA 4FKUA 2QLQA 4LGDA 2G9XA 3TI1A 1KE8A 4MWHA 3V5WA 2UW3A 4MXXA 2P3GX 4QYGA 4GEWA 1VG5A 4OTQA 4BDGA 3OOMA 5J79A 3NYVA 3MSSA 3R8MA 2OSCA 3RK5A 3NVMB 4HVIA 5HCZA 5FLFA 3FRHA 4ANQA 3O7LB 2OLCA 4W4YA 3KRXA 3O96A 4JBQA 3E93A 4NH1A 3SV0A 4AN9A 5J1VA 2WO6A 2X2LA 4OTDA 4J52A 4U80A 3A8XA 5H9BA 4BIDA 4EL9A 3HAVA 1UA2A 4LRJA 3UE4A 4XH6A 5JFWA 4GU6A 2W1EA 4G2FA 1FVVA 3MPMA 4PV0A 5BYYA 3IGOA 2ITOA 4E7WA 3BYVA 5AP1A 1CMKE 4XP2A 4RIYA 5HD7A 3LKMA 3FMMA 1OIRA 2FGIA 4B99A 1SNXA 3ACKA 2OIBA 4JRNA 4MEDA 3DJ7A 3QD4A 5DFPA 1VEKA 2DKLA 2IZRA 3RK9A 3Q4ZA 3VUGA 2EXEA 4PL5A 5C26A 3OVVA 4G6LA 5JZJA 1G8AA 3GUBA 3I60A 5EQYA 4M67A 4RX9A 4XBRA 4YHFA 4KD1A 4GW8A 3TKHA 4YZNA 2GNJA 4CKIA 4FICA 4I1ZA 3R71A 4AE6A 4FEWA 3QWJA 4FR4A 4JBPA 2I0YA 3UG1A 4I5PA 4C36A 5CQUA 1MRVA 3UZPA 2YIQA 4OW8A 4DH5A 3G9LX 3FMKA 4AZFA 4B9DA 1UU9A 3UC4A 2VWUA 2RFEA 3NUAA 1YQJA 4K0YA 4YJUA 3CSVA 3ROCA 3DT1A 3GLHE 2ZDTA 4F1IA 2EUFB 4RVKA 4ERKA 2F7EE 4PUZA 2NO3A 4GU9A 5DRBA 4BKJA 4WUNA 5FTQA 3ZEPA 4BCOA 2IPXA 2XKEA 4RJ7A 4E6CA 4DGNA 5IPJA 2X4FA 4EK4A 4RT7A 4KKEA 4FKJA 4X2JA 3VUTA 4NCTC 4H58A 5K5NA 4E4MA 3OTVA 4LYNA 3QLGA 1FVRA 1R3CA 5E8UA 3NNWA 4BBFA 4MK0A 3HYHA 2PPQA 2LGCA 3I5ZA 3EQBA 4ENYA 5JSMA 5M4FA 1DAWA 2F7XE 2XF0A 3BHTA 3FHIA 4R3RA 3MW1A 4RQKA 1ZOEA 4V01A 4DN5A 2EVAA 5B0XA 1PYXA 2MGWA 2HK5A 2WB8A 3EQGA 3JXWA 4BCKA 2J51A 2KNAA 3Q5IA 4IHPA 2KNVA 4YO6A 5HVJA 3TNQB 2BMCA 4CLIA 4HVDA 3BU5A 5C4LA 3TKUA 3DLSA 3K5UA 4EHVA 1H0WA 2WTKB 4E73A 4NW6A 1PKDA 4CFWA 3ZEWA 3CD3A 4XG6A 2OIQA 2C6LA 4Q9SA 4ASZA 3FSFA 5KMMA 3T9IA 3AG9A 5AP2A 4U6RA 4A9YA 4D2PA 2B1PA 3O23A 3F2RA 5A46A 4DC2A 4ORKA 4GYIA 4YBKA 3FWQA 2Z7RA 4ZY6A 4W4WA 4RC3A 4FIJA 4NFNA 4F1MA 2BPMA 2J0MB 4C57A 2QR7A 4Q2AA 4QYFA 1J3HA 3BWFA 3OEZA 4DGGA 4MXZA 4IDVA 3LHJA 3ZS5A 4IAIA 3HDNA 5AIRA 5K4JA 4GL9A 2BROA 4EOIA 3BE2A 1ZLTA 1YWVA 2GS6A 3NUUA 5CVGA 4AG8A 2W9ZB 4FTTA 2X6DA 4HCTA 2OZAB 4KS7A 1W0XC 3P08A 3LFAA 3VC4A 4EQCA 3PRFA 4JS8A 4FOCA 5E9EA 3HX4A 3DB8A 2E9VA 4KIQA 3BQCA 2MJ5B 5CAPA 3ORLA 3NNVA 5JRSA 2JZ1A 4M97A 4F7LA 4CLJA 3TIZA 3ZFMA 4E8AA 4ZAUA 4YUQA 5HNBA 2J90A 2YIRA 3KMMA 5EOLA 2IVVA 1UU7A 2CMWA 5B2MA 4J53A 5AP4A 2ZAZA 4RMZA 5EYMA 3B8RA 5H8BA 3BV3A 1GIHA 4E3CA 2RL5A 4HGEA 1STCE 5L2TA 3KXHA 3NW5A 4ZTSA 2VAGA 3QQJA 3CKWA 2R7IA 5BPYA 5KCVA 5I9ZA 4MXOA 2EXMA 3LM5A 4JQEA 1K2PA 1ZRZA 3QRJA 1OKZA 2C6EA 4JAIA 4AACA 4R7BA 4AT5A 1YXVA 2QOBA 4G9RA 2GU8A 2WIHA 4UMRA 5DMZA 2GHGA 3R1QA 2HYYA 2QO7A 4UMTA 3Q04A 4X2GA 2W1ZA 4KUJA 1NW1A 2ERZE 2R0IA 1P4FA 3FYKX 2EB3A 1UFZA 4R1YA 2W17A 5CU6A 3V51A 3ZMMA 1U54B 4HZRA 5M56A 3CEKA 2JKOA 4CQEA 4A07A 1SMHA 2NP8A 3NS9A 5E8TA 4NM3A 2XM9A 2BAJA 2XNNA 2OXXA 4DEIA 2H6DA 4CT1A 2K9DA 2JEDA 3SOAA 3VF9A 4M8TA 2BKZA 5HIEA 4YTHA 2ONLC 1OL7A 2CGXA 5LVPA 5IU2A 2YZAA 5DR9A 2RF9A 5ANGA 4PDYA 3Q2MA 3FZPA 2Q83A 1QZEA 3O71A 2BRMA 4UEUA 2BWBA 4YTIA 3VNTA 4ASDA 5J7BA 1G3IA 4RX8A 1PMUA 5D9HA 2OJFE 2CN8A 2L4FA 4LMUA 2DAIA 4APCA 3D7ZA 5CZHA 3RI1A 3U9NA 2HW7A 4O6EA 3L9MA 3P5KA 2YITA 3GFWA 3LAUA 1R78A 3BHUA 3LCSA 5D10A 4BFMA 4NYEA 1M7NA 2W5BA 3GEQA 4RFYA 3PJ8A 4FT3A 1OECA 4QYYA 4X6QC 1Y6BA 4RBLA 4ZLOA 2GS7A 2VX3A 5HOAA 1OPKA 4EHEA 5LVNA 4L67A 4B0GA 3R1YA 3WZDA 4PMSA 3TUDA 3S2PA 1XXHE 4EKKA 4DEBA 3QRUA 4KA3A 2CJMA 2R3MA 3R9OA 5D7VA 2Y6MA 1H26A 3CE3A 2FSMX 1GZ8A 3AD5A 3DDPA 3DTWA 4K6ZA 3R1SA 4WUAA 5AMNA 3FZOA 3EOCA 3UIUA 1MP8A 2H96A 2JNHA 3OBJA 3CTQA 5CEIA 1XH6A 3KU2A 3P0MA 3HV4A 3F66A 2QOIA 3EQRA 4Y85A 2YHVA 4I0SA 4F09A 4D4RA 3NIEA 4I94A 5E8WA 3RVGA 1IEPA 2DWBA 3QX2A 4TNBA 5DLSA 1A9UA 2JAMA 4JOAA 4DF3A 3FQHA 3ORNA 3Q6WA 2VTOA 5EDPA 4DGLC 1JWHA 3DQWA 3UO6A 4IE9A 3ORZA 2XIKA 4YC8A 3ZFXA 3UQFA 3KRJA 3PVWA 2Y4IB 2HCKA 1LUFA 1PXJA 3I6WA 3MVJA 4IJ9A 4OTWA 4FF8A 1JKSA 4APPA 3G51A 4HNIA 3PVGA 4USDA 1J7IA 4MBLA 1G3NA 2R3FA 3FMNA 2B9FA 3NCZA 4EBWA 2BRNA 4B6LA 5EM6A 1MQBA 3GCPA 4DT9A 4UB7A 5FQDC 2R3KA 4O82A 4RX5A 1GAGA 4XNEA 2YEXA 1DO0A 4O7TA 4F1TA 3EQPA 2YAKA 5AUTA 5BYLA 2BKKA 4U3YA 5AUVA 2EWAA 3OZ6A 2VWBA 3MTFA 1QPDA 3UOKA 4NWMA 5FXRA 3S00A 4F9CA 1M2RA 2I6LA 1IM2A 2J4ZA 3C5UA 4FSQA 2ZTCA 4F0FA 3GFEA 5AUXA 4NW5A 2I0VA 5AM7A 4OBQA 2PMLX 2G2HA 1Q8TA 3OT8A 4K1BA 4FV1A 4ZTRA 4FT5A 3L8PA 5DR6A 5GZ9A 2Y0AA 4V05A 4WHZA 5ETFA 3EFWA 2E9OA 3OWPA 4JBOA 4B8LA 4JVGA 3H9FA 5A4CA 5GZAA 4F6WA 2WELA 1S9IA 3E62A 4O7RA 3OXZA 5E1SA 2RG5A 3EQCA 4RIYB 1Q8UA 4X7QA 4ACCA 4DFXE 3GCUA 3R73A 4O6LA 3R7VA 3DS6A 2QKWB 3FDNA 3OXIA 5BNJA 3ORMA 4QMTA 5IMXA 2IW6A 5KO1A 1UU3A 2JY5A 4RJ6A 5FP5A 3E64A 4RC4A 4M13A 3PXFA 1E94E 4KKGA 4QP4A 5EG3A 3VUIA 4X2KA 4JNWA 2WPAA 1PRYA 3LJ1A 4DFBA 4FK6A 4CTBA 3NUPA 5HTCA
chains in the Genus database with same CATH superfamily
4DBGB 3F61A 5EQTA 3MV5A 3RPVA 2R3PA 2WEIA 3CLYA 4HYSA 4FWGA 3U6MA 4NC6A 4YHHM 2WQNA 3R28A 4JDKA 2UW4A 2DZLA 4BCMA 4EH8A 1XQZA 4G3GA 3T9TA 4YC3A 4IB1A 4GH2A 2BDFA 2VNYA 3SATA 1R6BX 4AF3A 5I9WA 4GT3A 4AGDA 1H1RA 5IZFA 3OMVA 3ZRMA 3P78A 4QMLA 4ITJA 3NUYA 5DH3A 1EFUB 1NHWC 4GFMA 4GC9A 1S9JA 1WMKA 2XK7A 2XZSA 3S4QA 2DAKA 2QU6A 3FHRA 3LMGA 2GHMA 2WMRA 5HO8A 2BWEA 3M1SA 5LQFA 3KF7A 5HIDA 4O84A 3AD6A 4ZJJA 2X8EA 5EHYA 4I6BA 3TQSA 3ZO3A 2ITNA 1FVTA 4JV5M 4ZSJA 4BIEA 3A8WA 1N77A 2VWZA 3D8BA 4TTHB 2WU6A 5D1JA 2XH9A 3HVCA 2R4BA 4QEBA 4UXLA 1JQHA 4KBAA 4C8BA 5E8SA 4FIGA 1OBGA 4HEOA 1G59A 4QTAA 4I23A 4MF0A 4EK6A 2XNGA 5LXMA 1GO5A 4S31A 1PJJA 4IWOA 3E92A 2ZAOA 3OF0A 4U43A 2YDKA 4TNDA 2LBCA 3DDQA 1OPLA 3L28A 3SYLA 1GJOA 3I0OA 1HQYE 3PJ3A 2GNLA 2WTKC 3VQHA 4OAUC 4FSYA 4PL4A 4ZSLA 3PSBA 2IW9A 3V5PA 4LJAA 2WZJA 2AYPA 4V04A 3U87A 2UXCM 4FIHA 5JQ8A 3BGQA 2G8LA 3O2MA 2OXYA 3FLWA 1U4DA 3SD0A 3PA5A 3SMPA 4PMPA 5F9EA 4O2ZA 5IQGA 4NM0A 4FVMA 2W82A 4C33A 3LOKA 4BTMA 4WG4A 1Z5AA 3V8TA 1SG9A 4GT4A 4QNYA 4BWXA 3DGKA 4BDHA 4XJ0A 3AC1A 3VS4A 4DFNA 3ETAA 3ZM4A 4EUTA 3PA3A 4J7BA 5TE0A 2PMNX 4GITA 2VWVA 3GQ3A 2UZOA 1RJBA 4PPBA 3LCOA 5LWNA 1GY3A 5IQIA 3DXNA 4D80A 3SW4A 4TT7A 1N34M 2GSFA 5KHXA 3P7CA 5M4IA 2VGPA 2R3QA 3MFTA 2YR0A 1ZZ2A 1RU3A 3FUVA 4EOMA 2VNWA 4QMPA 4YURA 1JR3E 2BTSA 2QO2A 3LXPA 2CE7A 3U6LA 1CKPA 3N4VA 2NNWB 5IA0A 1IRKA 4BL1A 1FINA 4YO4A 2H9VA 1SNUA 3K3JA 3IG5A 2PZRA 2UVXA 3RGPA 2V1CA 4KKHA 5IQAA 3LQRA 3QD2B 3KY2A 3GXLA 4IADA 3BYUA 2E2BA 1VDLA 1YRPA 4UV0A 2VTJA 3SOCA 3LMHA 4AE9A 1WVYA 3SHEA 3LJ2A 2JY7A 4AUAA 4IAFA 4IJFA 5JN2A 2LVQD 1KV1A 1TVOA 5CWZA 2ETRA 2R7BA 3BKBA 1T3TA 3D7TB 4O7NA 2HZNA 3OROA 2L09A 3WZKA 4BB4A 4AZVA 3TL4X 2YJSA 4BYIA 4E4MA 1UWHA 4TWPA 3E3BX 4R3CA 2YACA 3ZRLA 1SXJB 4D2VA 1IXSB 3GLGB 3T1YM 4M66A 3E8DA 3S3IA 4BZNA 5ANOA 2G3QA 1CDKA 4MGHA 1XJDA 3BLRA 1QDTA 4MGKE 2YM4A 4WRSA 3I81A 1J7KA 2QODA 2UW8A 3KMUA 2C3KA 3FUWA 3VO3A 1PY5A 2IVTA 4FKQA 3QLFA 1B6CB 3W33A 3TJCA 4P90A 4GCJA 4U8ZA 3Q4CA 2BDJA 4GHLA 2XM8A 2G1TA 4FTKA 5DVRA 5FGKA 3A62A 5I9VA 1XBCA 1F5QA 3FJQE 2FH9A 1LR4A 4AA0A 2V55A 4O0VA 1LEWA 3ORKA 1O6YA 3DK3A 1KSFX 2WOUA 4LDTA 3ID6C 2JY8A 5IQFA 5ANIA 2CWBA 3PPZA 1KE9A 2ITUA 4X3JA 4FIFA 3W0NA 4ZZOA 4MH7A 2KTYA 3DKGA 1MQ4A 4ZZMA 3AGLA 3TCPA 2QVSE 4JI3M 5KHWA 2W1CA 2X2KA 3T3UA 1YHSA 4JG6A 2R62A 3A99A 2UW5A 2UZNA 1Q62A 3W8LA 1XH4A 3R7GA 5HICA 3LFCA 4D9UA 1YDTE 3UGCA 3QQLA 5EK7A 4ANOA 3NDMA 3TNPC 4E5AX 4BN1A 2RGHA 2GPHA 2EB2A 5AV3A 3NLBA 3ZH8A 3BGZA 5L8KA 5L8JA 1JSUA 3F5UA 3UNJA 3RPRA 4QQJA 4QRCA 1TQMA 4HGSA 5CAQA 2CKEA 4LMNA 4OVZB 3UDBA 4I4LA 3ORTA 4GH9A 1IFYA 5GJDA 2REIA 2O0UA 5HG7A 3H30A 3PNYA 4X21A 4O4EA 2FO0A 4X2FA 4FYOA 4H3BA 4FEUA 4UN0C 4O86A 2PE1A 2WIPA 4YJNA 4J1RA 1W82A 4JDJA 2J7TA 3KN6A 4BCFA 3ULZA 1FGIA 1E1VA 1TH4A 3UO4A 2Y21A 3FL4A 4GC5A 4FSMA 3FYDA 4M9ZA 3F7WA 1DGHB 1B39A 2VX0A 2FOIC 1OB3A 2J0KA 2VTSA 3HJ8A 1NO1A 3UYTA 2Z8CA 3A7JA 5C4KA 4IVBA 3PIXA 5BUIA 4TL0A 4QMOA 3P1AA 3DZOA 1R1WA 5AX9A 4BTKA 4GEOA 4ZP5A 2R2PA 4ZY4A 2HELA 5J95A 1URCA 3F92A 2XP2A 4D2WA 4ZSEA 1V34A 4QQ5A 2XCHA 3QQGA 2OQ4A 3ORPA 2GNIA 4DEGA 4PP7A 2XJ2A 3EZRA 3QXPA 1N78A 3WZUA 4C3RA 2XARA 3PYYA 3O51A 1I94M 4CMTA 4RPVA 3Q5ZA 3UTOA 4A4OA 1NV9A 5A4EA 3E3PA 2XBJA 1E1XA 4TYEA 3QTZA 2KDLA 2YLFA 3BPRA 5HLPA 4FV8A 5AR8A 3JPVA 1D0MA 3C4FA 1GZOA 2YFXA 1YHVA 4REZA 3FPMA 5AUYA 5IA4A 4JI6M 4Y95A 3UQGA 3SC3A 5E8YA 3LCDA 2Z4RA 2JP7A 3HP5A 3A60A 3ZLWA 2OWBA 3BEGA 2BZHB 4C4JA 4RQVA 4AXDA 4PDSA 3ZUUA 3AKZA 3Q4UA 5CEPA 3G5DA 2C6DA 3U54A 2JY6B 4HPTE 4A9UA 1WBPA 5L6PA 4PCZA 2VTQA 4PX6A 3D5WA 4WSQA 1PXMA 5K3YA 3QBNA 4J98A 2YZLA 4KHPM 4RZVA 4H39A 2C1BA 1MX0A 3KXEC 5EDQA 3BQRA 4NIFB 2GQFA 2B7AA 5H3QA 2OI4X 4JQ8A 2KULA 4CGAA 4LF9M 3LCUA 1JNKA 4GFGA 5KX8A 2RIOA 1K3AA 5HVYA 4FODA 4YHTA 5M4UA 3KOYE 1J1CA 4U3ZA 2G5GX 4LI5A 4A7CA 5AR5A 3QTSA 3DJ5A 1NV8A 4CV9A 2WNTA 4E5BA 3KREA 3O50A 4FNWA 4IZ7A 1AIPC 2BUJA 3SAYA 2HXLA 4ZMEA 2PZ5A 3GLHA 1DO2A 4F64A 4D5KA 4H3QA 4FI1A 1IY0A 3U6JA 3LVVA 3FI4A 4IXPA 2X0GA 4NOOB 3FUPA 4BDCA 3VAPA 3HEGA 3NAYA 3D5VA 4IB0A 3RAIA 4F2LA 2PUNA 3BEAA 2X4AA 4M68A 4OTGA 3SYKA 3A46A 3DBEA 4GJ3A 3OWLA 4MNEB 2R45A 3MESA 1XWIA 5DOSA 1YI3A 5IF1A 4HW7A 4DR6M 5ITYA 3ZUVA 3U6CA 4OTFA 4CG8A 1SYKA 2WMWA 5A3XA 2VO6A 4GK4A 4Z9LA 2C3JA 1YHWA 5DFLA 2FE8A 2X8IA 4EIWA 4U97A 5CEQA 1QPCA 4QMXA 1L8TA 3EN4A 2YM8A 2Y8OA 4P4CA 4IEBA 2BHHA 4ANSA 5JFVA 1OZ1A 3GC8A 4U40A 5CSXA 2VF7A 3UVQA 4L8MA 4CMOA 1OPJA 2KZUA 4D2RA 4EOKA 4MUQA 3QL8A 2GFSA 1DGBA 4BKYA 4XS2A 2JKMA 4UY9A 1DGFA 3AOEC 1I44A 4FVQA 4U5JA 3E63A 4HYUA 3VHEA 3ENHA 1F4IA 4JI4M 3GPYA 3LM0A 1J09A 2ZANA 2I7QA 3PE2A 3TMOA 2QHNA 2DVWB 3W10A 5FTOA 1WIVA 3P23A 1RW8A 3PG3A 4J97A 4EH6A 4JL9A 2BIYA 4A4LA 3I5NA 3QWLA 4ANMA 4OUCA 2QENA 4LY6A 5L2IA 2FSLX 5IH4A 1GIIA 4RG0A 4TYIA 2R3NA 5C8KA 4X62M 4CISA 4BHZA 5F94A 3LW0A 3BXWA 5AV4A 3NW6A 5HNIX 3A4PA 4O0XA 2R3RA 2FH0A 2ONLA 2X2MA 5CSVA 3C4ZA 2Y9QA 1NHGC 2O3PA 3HY5A 4FWHA 5A4TA 3BOSA 3AFHA 2GNHA 1Z59A 5G1XA 5IQDA 2B52A 3IOPA 4H3PA 5CAUA 4YC6A 3BU6A 4GHAA 1Y6AA 2DAEA 1BYGA 1PYEA 3W2PA 2VTRA 5C8MA 3ZLYA 4FKWA 1NSFA 5E91A 3HMNA 3NWWA 5AAFA 5FDPA 4DV4M 2B9JA 4JRVA 3VJNA 4BCIA 4TYHA 4UWYA 4O83A 4QMUA 3W2CA 3NNUA 3V8WA 3ENMA 2IZSA 1Q8WA 1IN5A 4M14A 3BGPA 5BMSA 1F3MC 3OTUA 4O0SA 5HHWA 2PWLA 3QRTA 4L68A 2EXCX 1L1TA 4EWQA 2J5FA 2UZLA 3CC6A 3OCTA 3FL5A 4C7TA 4EUUA 4EBVA 3IK3A 4FTJA 4X3FC 1JSVA 3PWYA 5CENA 3QUPA 3W2RA 1Z57A 4M12A 2CHLA 2VU3A 4NXMM 5HU9A 3FZRA 1ZZLA 3GGFA 2W4KA 4H1MA 4OT6A 3C58A 4XEYA 4OLIA 3LCKA 3MY5A 3ZRKA 1H27A 5GIOE 1DI8A 1ZMUA 2W5AA 4YU2A 2BJVA 2C68A 4Y28F 1YXTA 2BZJA 5DWRA 3R7OA 2BR1A 4UZDA 1IASA 5DYIA 3QUEA 3HHZA 2Q0NA 4ACDA 3BBTB 3FLYA 3QGWA 3RGSA 2HWJA 4FTIA 5DPVA 2X49A 1ST4A 3VHKA 5E6JA 4YZ9A 1KOAA 2R3IA 3PLSA 2JZ0A 4XCUA 3FMDA 3ZCLA 4BGQA 4LV5A 2UUEA 3G6HA 3FXZA 5A9UA 3CR0A 3KULB 1WZYA 5E8ZA 2Z7QA 3E87A 2BAQA 4MYGA 3K1JA 4AQKA 4KIPA 4DG0E 4MHAA 1OIPA 2XNBA 1HR0M 5IZ7D 1ZARA 4AS0A 4DFYA 4Y5QA 2C6MA 1OAOC 1WBVA 2PVRA 3BV2A 3F3WA 2ACXA 2PZYA 1J91A 4KS8A 2J7OA 1H1QA 1UU8A 3RPSA 2V7OA 3D7TA 2JGZA 5B2KA 4LJ4A 3WYXA 4Y46A 3QHWA 4RX7A 3ZCBB 4DEEA 5AEPA 2HCBA 4K33A 2Z7JA 1XNQM 4PMTA 4FKVA 5KMKA 3CD8A 3A2CA 3Q9WA 2WXVA 1U59A 1SXJA 1PJQA 4M0YA 3FZ1A 2JKQA 3GP0A 1XHAA 3Q2JA 2WMBA 2XNEA 3JR4A 3FEGA 4FJVA 4R7IA 5EHOA 3IECA 4WW0A 4XRLA 4FOBA 2XNOA 1BI7A 2X4ZA 4CFVA 2WKMA 3H9RA 4ONAA 4O96A 4D55A 2MH8A 4N6ZA 2PY3A 5M55A 3TV6A 4XK8F 3R0TA 4ZEGA 2YCSA 4EHZA 4WT6A 4DBXA 1HOWA 3WZJA 5L2SA 1TGUA 2XEZA 5FG8A 2VUWA 4GUEA 4AT3A 1NY5A 5HX6A 1W5TA 2UW9A 2A0CX 3G15A 3GPPA 4Y8DA 1U54A 4NSRA 3GOPA 2YN8A 2M60A 5E8XA 2XIRA 4KSPA 4L8RC 4WNOA 3KXXA 2X0OA 3L1SA 4BTFA 4GG7A 3VS5A 2OJIA 4XP0A 2H8HA 1YXUA 3DCVA 3EN9A 5GZ8A 3KP0E 2ZTDA 1WXQA 4L16A 4LQMA 3TUCA 3V6SA 3FYJX 3R9RA 1OL2A 2PVFA 1QAOA 1BL6A 3LVPA 5CASA 5D7AA 2YDJA 1V33A 4GRIA 4YJPA 4ALWA 4WG5A 3SGCA 2ZV7A 5BX0A 3DAJA 1TDZA 4QDEA 4HOKA 2C6OA 4LGDA 2QLQA 4MWHA 3V5WA 5J79A 2D7GA 2OSCA 3KRXA 5J1VA 2X2LA 4J52A 5H9BA 3UE4A 4GU6A 1FVVA 2ITOA 4AXCA 4XP2A 1OIRA 4B3TM 2I7PA 1PM5A 3VUGA 1G8AA 4G6LA 5EQYA 2CV0A 2VQEM 3TKHA 3R71A 3VLFB 4FR4A 4OVZA 4K0YA 2FS1A 2ZDTA 2EUFB 2NO3A 4WUNA 3ZEPA 4RJ7A 2X4FA 3VUTA 4H58A 5FTMA 5E8UA 4MK0A 4IJEA 3I5ZA 5M4FA 3BHTA 3FHIA 3MW1A 2MGWA 2WB8A 4BCKA 2KNAA 3Q5IA 4IHPA 3BU5A 3K5UA 4E73A 3ZEWA 3AG9A 5AP2A 2B1PA 5A46A 4YBKA 3FWQA 4FIJA 4QYFA 4IDVA 3ZS5A 1SXJD 4IAIA 5K4JA 4EOIA 3BE2A 2GS6A 4CJ6A 2X6DA 4HCTA 2OZAB 4KS7A 1W0XC 5E9EA 4FOCA 3DB8A 4KIQA 2MJ5B 3ORLA 4CLJA 4YUQA 2YIRA 5EOLA 2IVVA 2CMWA 4J53A 5EYMA 1STCE 4P17A 4ZTSA 4MXOA 3LM5A 4JAIA 4AACA 2QOBA 2WIHA 4KUJA 4X2GA 2EB3A 2W17A 5CU6A 3V51A 3ZMMA 2JKOA 4NM3A 2XNNA 2OXXA 4DEIA 2H6DA 4CT1A 2JEDA 5LVPA 5DR9A 3U6PA 3TWMA 1G3IA 5D9HA 1PMUA 2CN8A 1XMOM 2HW7A 3U9NA 3BHUA 2R4JA 2W5BA 4IBBA 4FT3A 1OECA 4QYYA 2VX3A 4B0GA 3R1YA 3WZDA 3S2PA 3R9OA 3Q8XA 3CE3A 5AMNA 3EOCA 2V6ZM 3HV4A 3UK6A 4I94A 1R5LA 3QX2A 2DWBA 5DLSA 2R44A 3FQHA 3Q6WA 3C9PA 2HCKA 1LUFA 1PXJA 1JKSA 4APPA 3P5JC 4DT9A 5FQDC 2YEXA 1DO0A 1IBLM 2J4ZA 1Q8TA 3OT8A 4FV1A 4FT5A 4WHZA 5A4CA 5GZAA 2WELA 2L7IA 1S9IA 4O7RA 1Q8UA 3DS6A 3FDNA 5IMXA 5KO1A 4QMTA 5EG3A 2WPAA 4FK6A 1MU5A 1TH3A 2R4EA 3LE6A 3DFAA 1IN6A 2EJSA 3UP7A 1W98A 1BKXA 1MUOA 4JQ7A 4I4FA 4YP8A 4O21A 3L8SA 3RZBA 3QUDA 5LMAA 4LGYA 4ZLYA 3GRYA 4IW0A 5KUPA 3DQXA 4IX6A 3REPA 5ITQA 3MPTA 3VFDA 5AIKA 1KSWA 1J5EM 5HVKA 4FW9A 4EC9A 4JT3A 4FYNA 1JOWB 3ORIA 4IM2A 3L8VA 1WGLA 4QYHA 4HGTA 4FSZA 1ZMWA 4KNBA 4YLLA 2HIWA 4FTRA 3QTQA 4DA5A 3I51A 5C01A 1U46A 3BE9A 3UJNA 4KRDA 2RSVA 3B74A 1VZOA 1A5TA 5M57A 5IKWA 1ZXEA 3ZYAA 2WMUA 3B7ZA 4WIHA 1WBOA 1JKTA 5HLNA 2WTWA 2C3IB 3HDMA 4LFAM 1FMKA 1ZYCA 3EKKA 4ZOGA 4MNEA 2C30A 4YJQA 4L78A 3OHTA 1R39A 4ZLZA 5FXSA 5A4QA 3D14A 3Q6UA 2XFSA 3COMA 1R2YA 2Y7JA 4LL5A 3GQIA 3POZA 2LVOC 5F20A 3QTXA 4FTCA 3LJ0A 3AQVA 4BZOA 5CI6A 2QBYA 1OJLA 1W7HA 3I7BA 3UBDA 4IB5A 3HUCA 4GSBA 4USFA 5IT9S 5EXSA 3D0EA 4BDJA 3UQCA 2RKOA 5EQPA 3ODZX 4B08A 3FXWA 2XK9A 4YJSA 3LFEA 4LGGA 4IBIA 4EJ7A 1CUKA 5LJJA 3FMHA 4C3FA 1YUBA 3KXMA 5AR3A 4OW0A 2WTVA 4PNIA 5AV0A 3NX8A 5C03A 3VF8A 4PL3A 4KBCA 3AOXA 2E9NA 5L3AA 4MM3B 1R7RA 2A19B 4BCHA 1URWA 3UMWA 4NL0A 2WSFF 2W1GA 1H1PA 4IZ5A 2XK6A 4QHTA 2CHQA 3FI8A 3D2KA 1X37A 3TDVA 2A2AA 1VQ1A 5JK3A 3KSJA 4PDGA 2F57A 3KRRA 3IDBA 3EQHA 1M2PA 5EKNA 4HVHA 4N4SA 3Q96A 4BBMA 4MXCA 5AR2A 4H05A 4EH4A 2KNZA 2NPQA 3FTFA 5IQCA 1HT2E 4RSSA 4HZSA 2IG7A 3CY2A 3CKXA 4CFMA 2XNPA 4G3CA 4NM7A 2LTUA 5KPTA 1FOTA 4C4EA 5ICPA 4V0GA 4LL0A 3WE8A 1Q24A 1WBSA 4FTOA 3W8QA 3GU8A 3VS6A 2XEYA 1OKYA 2XA4A 3MK6A 5FBOA 3E8NA 3G2FA 2CGWA 4O4CA 2V22A 1T45A 2PUPA 4QTEA 4NXNM 1IAHA 5IEVA 4HLQA 2UXBM 3POOA 4KINA 2CKOA 3R8ZA 3ZUTA 3BYOA 5ITRA 3MN3A 3SAWA 2QP9X 2IN6A 5EM5A 2XK8A 4B7GA 3R00A 4QPMA 1BVSA 3JY0A 3UZRA 3OTOM 2BRBA 2C5RA 4JX7A 3HZTA 3NYNA 2YISA 4DR1M 3AC4A 4EOPA 5DRDA 4YHJA 3BHVA 4NM5A 1X8BA 4K77A 1XO2B 2DZNB 2OBJA 3MHVC 2VO0A 4RA5A 3UIBA 4YTCA 3FZSA 2YERA 3CF0A 2N35A 1GOLA 1YKRA 3V04A 3PXZA 2VTPA 5I0BA 1C1KA 4AAYA 3BZ3A 2Y6OA 5AP5A 1BMKA 3R7EA 3CPCA 3HV5A 3C13A 3FMEA 4XG4A 3JYAA 1TQPA 5LMUM 3F5XA 4GKHA 3H0ZA 3DKOA 1J7UA 2VZ6A 2GTNA 3DPKA 4FNZA 3HMIA 4U45A 4QOZC 3L9PA 1WCCA 3AXWA 3IW8A 5HG9A 1GJSA 4ZXTA 3SVVA 4AZTA 4FA2A 2Y4PA 3DU8A 3Q32A 4I3ZA 1ERKA 1ZYJA 1YOMA 4QP8A 4F9AA 1L1ZA 4EI4A 2C96A 2YM7A 3W2OA 5I3RA 2BAKA 1Z9XA 1OIUA 5HE0A 3GLFA 5GJFA 4N57A 4OT5A 4LJ9A 3MB7A 2RFDA 2OXDA 2JIUA 2FNAA 4RC2A 4AFEA 5HBEA 4GIPA 4DR5M 3R9HA 4GIHA 4DFLA 3FC2A 3EZVA 3DNDA 4QOXA 5IA3A 1IA9A 5GINE 3T1HM 3DBCA 3C0GA 3EL8A 2J2IB 2C5XA 1S3SA 2EO2A 2C5VA 2KXEA 2AUHA 4QMSA 2W1FA 4PY1A 3Q9XA 3NNXA 4FZ7A 3G0FA 2YM6A 3NBXX 3GT8A 3OP5A 5KBQA 2Z7SA 4FKSA 5DR2A 3F3TA 4C2WA 4R7HA 2KW0A 2CGUA 2CEAA 1OUKA 3KEXA 2BRHA 4FKTA 4PT5A 2QCUA 3QYEA 3C4XA 2JFMA 3GRUA 3MWUA 2QG7A 4RVLA 5ANKA 3MIYA 2YCRA 3I6UA 4EK3A 3V01A 3QRIA 4BWPA 2R0UA 3RTPA 3ZH9B 1SVEA 2UVZA 5CU3A 1KE6A 3QZIA 3R63A 5KQDA 5E4HA 4CQGA 5FTGA 4M7IA 4D28A 1C7YA 3RNYA 3IKAA 5CTPA 2O8YA 3GBZA 2L6OA 4R7GA 4JI8M 3WBLA 3FPQA 4RIWA 2ESMA 1CSNA 4AKHA 1YWRA 5EW3A 2FSOX 1PXKA 5HBJA 2QSFX 1GZKA 5JFXA 5CY3A 1JSTA 2VTAA 2EUCA 4F7JA 3ZC5A 3EKNA 4FTUA 1P3QQ 3D5UA 5M07A 4L3PA 3QZFA 1MRYA 1J7LA 1JB0F 3UZTA 5L4QA 5IDPA 3UOJA 4B3RM 3LXLA 4JDHA 3F2AA 1TR8A 1HCLA 1E9SA 2EA0A 3ALOA 4AFJA 5EHLA 4YLKA 4P16A 4RVMA 2V1UA 4YJOA 5HCYA 3MA6A 3MH1A 5AP6A 1G71A 4G3DA 1DV0A 4CZTA 3H0YA 3KOZE 3R6XA 5DT3A 2Z60A 3O8PA 4LF5M 4A06A 2YJRA 4X0MA 1ZY4A 4S34A 5AAEA 3KOXE 4ZK5A 2X1NA 5HG5A 3E5AA 3KK8A 3PIYA 3H4JA 2OO9A 4PTCA 1Z6TA 3TNWA 3P7BA 3TDWA 2ITYA 3LZBA 4MVFA 1Q3CA 4JR7A 4FV6A 2Z7LA 5LWMA 4L3JA 4O1PA 4R1VA 2DWZB 4NU1A 2J5YA 4O81A 3R02A 3ILKA 4G6ZA 5CX9A 1U5QA 3OY1A 3C0HA 3HV3A 5EW8A 4EH7A 2XYNA 4D82A 4DV0M 1KOBA 1N32M 3QKKA 2XF3A 2BVAA 5CANA 3OFMA 4R78A 4IBMA 5IH6A 2F5SA 4BC6A 4W8DA 3SMSA 2G2IA 1KE5A 3IG7A 3JS2A 5LMKA 4MD9E 2GS2A 1PJTA 3UZUA 4EH5A 2CNQA 3QX4A 4Y5HA 3R7IA 3Q60A 4WNKA 4PD2A 5AM6A 3ZM9A 1YOJA 3PVBA 3ZOSA 4D81A 1PMVA 3TZ7A 4QMYA 2W05A 4NKSA 5JQ5A 2GQRA 4YJVA 2C0IA 3PLAE 3HKOA 1TQIA 3LFSA 3PJ2A 4U7ZA 4DDIA 2J0IA 3R8LA 3QAME 5HESA 1GL6A 2WAJA 1RE8A 3RCDA 3AC5A 2LAVA 4A9SA 3GLGE 4LCBA 2B3TA 4FEVA 1NA7A 4BDFA 4XLIA 2DQ7X 4BBAA 5FRIA 3OT3A 4JIKA 2AQXA 1GLNA 3A7HA 4KT0F 1PRBA 2P55A 3NYXA 3D83A 1H25A 2YM5A 5HTBA 4LZZA 4AOJA 1L8QA 1UVRA 2UW6A 3ZXTA 3QAUA 4FX3A 5JI3E 4CGYB 2XJ0A 5AUZA 1R2ZA 2JDVA 4LOOA 5HBHA 3HJSA 4CYJA 4TKSA 1OGUA 4FUYA 4ZTMA 1OUYA 3PY3A 4CZUA 3I4BA 3CIKA 1IG1A 2JC6A 4U44A 3HU2A 3RZFA 1NVSA 4MXYA 3WIKA 4Z7GA 2VN9A 2H1RA 3OCBA 3DBQA 2UZTA 1GABA 4PWNA 4OGRA 3MMPA 4FKIA 5CVFA 4QMVA 4EH9A 5ITXA 2YFQA 1Q3DA 4D4YA 3FRIA 2UZWE 4IX4A 4XG9A 5DGZA 4PDPA 2VDBB 5J87A 4GMQA 3NAXA 2KEBA 2A98A 3UIXA 4LV7A 1REKA 2BFYA 5GIPE 3U55A 3PJCA 5JI2E 3CGOA