1ZMXA

Crystal structure of d. melanogaster deoxyribonucleoside kinase n64d mutant in complex with thymidine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
197
structure length
190
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVDLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the changed substrate specificity of Drosophila melanogaster deoxyribonucleoside kinase mutant N64D.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Deoxynucleoside kinase
total genus 70
structure length 190
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2005-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zmxA00
3L0OA 2DWQA 5TVKA 2FDCA 5G40A 4HB4A 1UAAA 3VKWA 2WJVA 1EFCA 1X3SA 1FL9A 2V7QD 5EXPA 4B43A 3KX2A 1XMSA 4M1MA 1Z0FA 3OHMA 3U3MA 1KY2A 4LHWA 2CDNA 2Z4RA 3VX3A 1E2LA 4IVRA 1VHLA 2WICA 1KGDA 5B57C 1EFUA 2GAAA 2CCKA 2FH5B 2QU8A 1S9HA 2WIBA 2EFDB 1SXJC 3HU2A 4WZ6A 2VHUA 4IJMA 2ODWA 2REBA 5KYKA 2G83A 2NGRA 2PEZA 1CLUA 4GOXA 4QHSA 2O0HA 5BQ5A 1P60A 1JB1A 1WDTA 5KSZA 4QL3A 5EZ5A 3GQBA 1Z07A 3ZVRA 2ZVQX 4D4MA 1GWNA 4ZIRB 4CT4B 4G1UC 1OT3A 3KTAA 1KTVA 1E2MA 1MABA 2EYUA 1NLYA 4HB2A 3LBHA 4P31A 2N1BA 2HDNB 3THWB 1ESMA 1SHZA 1PUJA 1CS4C 1A7JA 3TW4A 1SXJE 2ZR0A 4FMDF 4GOJA 4KFRA 4DT1B 5HKKA 3QF7A 1KI8A 3CBQA 2W6JA 1JPNA 2RAPA 1IY2A 2CE7A 3LW8A 2F1RA 2VL7A 2B7CA 1CR4A 2D06A 2RKOA 1EWRA 2JLYA 1MKYA 3BFXA 5IF9A 3Q3JB 3FHCB 2E9SA 5HE8A 2WWFA 2JJ8A 3MCAA 3PEVA 3RYTC 3BB1A 3IBYA 3Q85A 1XTKA 3WYGA 1XXHE 4WIAA 4DLZA 2AK2A 2HV8A 4Q1FA 2JAQA 3RWOA 2O8FA 3TLXA 3U6KA 2F1IA 4HUQB 2GK6A 2EFCB 1K5GA 2WKPA 4ZDKA 2AD1A 5JSZB 4JSTA 2QAGB 4HZIA 4TLCA 1KO7A 3QKTA 3SC3A 3MWLA 4RD4A 4EPVA 1Z06A 3PUVA 3W6NA 3U7HB 1W36D 4BQSA 2EYQA 3LFUA 4ZI2A 3THWA 2PBRA 3P27A 2ZETA 1CJKC 2FSGA 2ZRNA 3SJAA 4AURA 2REXB 2KB0A 1Z5ZA 5GVRA 3R9XA 3VNUA 1R5BA 4A2WA 1NP6A 2QMOA 1OJLA 2FPKA 3FMPB 3WBKA 4WOPA 4D2IA 4S35A 1WBDA 1TF2A 4V0NA 2XSZA 3ND9A 3THYB 4A4DA 3SBEA 3AM1A 1NMZA 2ZRIA 3QVUA 4HLDA 1HT1E 4LBVA 1Q1EA 3FGNA 4JL6A 4L4UA 5KHOC 2X77A 3U3RA 5C18A 1LNZA 3EWAA 1LV7A 4MUBA 4XOIA 5FL3A 1U8AA 3H0KA 3BH0A 3GJ0A 1AJEA 4TMWA 1GRRA 1UKVY 5JSZA 3BOSA 5FOSA 1DE0A 3ICEA 1DS6A 2GDJA 5FOVA 1I4DD 4FI3C 3L8ZA 1XMIA 4KI0A 4Q18A 4Q9KA 4PO9A 2HYIC 5KDLA 2VHQA 2RMKA 1ZC4A 1G8YA 1G16A 2F3RA 4JKYA 4J0QA 5J4HA 5LBIA 1ZM2A 5M04A 5HCIA 1D5CA 1CJVC 3WNCA 4BFXA 2CLDX 2KSQA 1Z6GA 3NH6A 3KKPA 1N2CE 4RFSB 1KHTA 1UFQA 2WPDA 4G5GA 2V9PA 4C0LA 2H92A 4RJLA 5DSZA 5DYGA 1F2UA 3OEHD 2BWJA 4CIDA 3SBDA 3PEYA 1LVGA 4Q4JA 2QSZA 3AUYA 4M9XA 2RH5A 1E2NA 2HF8A 1XD8A 2PZGA 2O0KA 4MH0R 3R8FA 1ZAKA 4NMMA 2Q9AA 5KNCA 3TSWA 1G3QA 3EIHA 3GFTA 1E4VA 2O8CA 4JLNA 5JWRA 4M0LA 1IXZA 3G82C 1E2HA 3QY0A 4DXAA 2OCYC 1TEXA 2P65A 2AX4A 2JJ1D 4HUQA 4O25A 4YONB 5FPHA 5GVSA 4JS0A 1DTSA 4FWIB 4Y0AA 4D4JA 4EKDA 1OXTA 5FPTA 2J0UA 3LVRE 4D25A 2YC4C 4MGKR 3VQTA 3OFND 5CYPA 5TV2A 4M8NE 1ZUIA 2Q0HA 2A5GA 2QPTA 4MRRA 3PEUA 3OIYA 5P21A 1LB1B 3REGA 3W6OA 1J99A 2FSFA 1AZSC 1M7GA 2ZROA 4A6PA 1NIPA 1N6LA 1GKYA 1IAQA 1Z0DA 1YR7A 1W36C 4TN1A 1TL7C 2DY1A 4PSAA 3HPQA 3OE7D 1R7RA 4G5RA 3RSLA 2OBLA 3MRSA 1R0YA 4BLSA 4FMBB 2ZE6A 3DZDA 2ZIAA 2QP9X 4KVAA 1G17A 5DE3A 4KBFA 1QHXA 3IUYA 4MDEA 3NDBB 1DARA 3V4RA 2PEYA 1VYTA 4KLZA 5JWOA 3ADBA 4KV9A 3P26A 1W4CA 3QKSA 3TSOA 1TU4A 1BH2A 2DFLA 5SZKB 2WBLC 1UM8A 2RGEA 2O0JA 1CKEA 4LUCA 3DDCA 3BS4A 1EK0A 1TADA 1XB2A 3GLHB 3BRWD 3K1JA 4DLTA 3GEEA 1ZUNB 1TQ6A 3X1YA 2CLSA 5FL7A 5KNBA 3GEIA 4PC6A 5GADl 5CJPA 1M8PA 3D31A 2AL7A 3PUZA 3AF0A 5HR5A 3DPUA 3EZFA 4PC7A 2CNWD 3ND8A 4PHGA 1OH5A 3JZAA 2REOA 1NN0A 4F4JA 2CHVA 2HF9A 1JPJA 1S1CA 3RS0A 1G5RA 3T5DA 3RVBA 2G1KA 1CEEA 4EFLA 3BH6A 2DWPA 3I1FA 3B1ZA 1UBCA 2IYLD 2WWYA 4LJ9A 4L9SA 1KIMA 1QG4A 2BBTA 4KBGA 2HXYA 4JLBA 4LWZA 5FPSA 3WYFA 2VP4A 4C7OA 2X8AA 1NSTA 3CM0A 4L16A 5JCZA 5KUTA 4XSHA 4UXHA 1QHIA 3U61B 4UNNA 4Q4AB 4LPKA 5HTKA 4XWAA 1RRFA 4TWZA 3FKSD 4AKGA 5TY0A 1FZQA 3PFIA 5FR1A 3AVTA 1VHTA 1G7TA 2R6DA 5L3RA 4HSEA 2A5DA 1GNRA 2ATVA 2GBLA 1IY0A 1C4OA 2FFQA 2VF7A 1KYIA 4D80A 2O8BA 1ZM3A 2G1JA 4Q4LA 2DB3A 3L0PA 2GCOA 4TQ9A 1OFTA 3FOZA 5CK5A 1UBFA 1X86B 3PCRB 5FBRB 3DEFA 1E32A 5F98A 2C95A 2ZXUA 3L8YA 4IDPA 3H86A 1G7SA 1ZJ6A 2BMDA 4URZR 4ESVA 2VQSA 3PITA 1WCV1 1HT2E 1JBKA 5CLQA 5FTKA 3K9HA 1S8FA 4MYCA 2CCJA 3VHLB 4A0GA 3WRXC 2IYVA 3K0CC 3K70B 2FFAA 4O2RA 1IN7A 4CRWB 4QGGA 3Q5EA 1XDBA 1KMHA 2BIFA 4NE2A 3SZRA 1BS1A 2I3BA 4MYUA 2JLXA 2BC9A 2IUUA 3A58B 1BYUA 1JXOA 3NBZC 4PTLA 2VP0A 1JJVA 2CXXA 3B60A 4XD7A 4YMUA 3AKEA 1XTIA 5EJEA 3H2YA 2FMXA 3NIBA 2GJKA 3B5JA 1YZNA 4ZDWA 1AKYA 4C3ZA 1TMKA 2FJUA 3MG9A 4RD3A 1GSIA 3KQLA 5IDVA 1CR0A 2OCPA 2AFIE 4D0GA 2B8WA 2CL0X 1ELOA 2OEPA 4V0LA 4ZCIA 1RE0A 3DZ8A 3X1ZA 3ZZUA 3GJXC 4HZUA 1US8B 4US1R 1KK0A 2J46A 2Z43A 4M2LA 4OQNA 1YZQA 2F1JA 4GSYA 1VG1A 2D3WA 2GXAA 2WWWA 4E5UA 5AJYA 3BB4A 2EFGA 4DEYA 3NEYA 3C7KA 3NC1C 2A2ZA 3KB2A 2GJ9A 1N6RA 2IXGA 3O8BA 2ANBA 2BV3A 4X8OA 3U6BA 4XVUA 4JVSB 2XNSA 2J9RA 3CF6R 4CEHA 4BFUA 4TL9A 2ZTSA 1MO5A 1R4AA 3C8UA 2BMJA 2ZI3A 1YR6A 4Q1BA 1WE2A 3CRVA 1N5JA 2Q9BA 4OL0A 1AQYA 3SJZA 4B32A 2O8EB 4NKRA 2VP5A 3WRYC 4OHXA 3EIEA 4TL8A 4YQFA 3PIRA 1Q0UA 4EQ6B 2H8KA 3TVDA 2A5JA 1Q57A 2CE2X 4XIGS 3IGFA 5FOXA 3L0IB 3EAQA 4LHVA 1DG1G 1E0SA 5E4FA 4IRUB 2YOHA 4IEIA 3TUZC 3LBNA 5J5CA 2MMGA 5HE9A 2PCLA 2R65A 2P5TB 3OEEA 3EZ9A 1J70A 2QA5A 2ZUDA 1JQJC 2KE5A 2ZRPA 4D0NA 2F9MA 4GT1A 5FH9A 4C2TA 2ZJBA 1XD9A 2C8VA 2J45A 4XD7D 5J40A 4QBHA 4AKIA 2O52A 4FWTA 1KI7A 3QNUA 2LCFA 1G3IA 2BJVA 1UBEA 1WMSA 1NY6A 5AJXA 4PAQA 1KI6A 5BN3A 1G4AE 2ZJ2A 2JLSA 2XNDD 4W5HA 4N0EA 4GDFA 1DOAA 4PQRA 4O3MA 3EWSA 4PPFA 1O87A 3AF4A 5DLQC 2ZRMA 1P6XA 2GTPA 3C16C 2E87A 1IN8A 1YRAA 1KDPA 4ESHA 3PV0A 3SEAA 2XNDA 2CLCX 2WWGA 1WXQA 2V55B 4Q7MB 5JRJA 1XFAA 2OO7A 4RCZA 5IK2D 2A78A 1KAGA 4TYQA 3RABA 2Z0MA 1AQUA 3HR7A 4MA4A 3KQUA 5KSPA 1OSNA 2GKSA 5DH9A 2NO1A 3WHKA 3UMSA 3U4QA 2ANCA 2VSFA 2DCUA 4LYJA 1AZTA 4DSOA 4F92B 3W9YA 3ZZTA 1P9NA 1Q21A 4JLVA 5ELXA 2QY9A 2JIZA 1I4LD 3OFNA 1W36B 4OQMA 1K6MA 5DNYB 4GBMA 2C96A 4RZXA 4B6FA 3QI2A 2RGBA 1IY1A 3C5CA 5DYIA 4R2IA 3C4JA 4P4SB 4C30A 2WWXA 4JT4A 4CEHB 4KXFB 1E0KA 2JCSA 3IKJA 4ZO4A 2FZ4A 2P3SA 2W2XA 4MGIR 2O8FB 1F6BA 1GL7A 4HLQB 2WTUA 3CWQA 4NONA 1M7HA 4LPSA 3M6AA 3CNOA 2XX3A 2O8EA 5LD2C 2IYXA 3K0AB 4LBYA 3UK6A 4F4CA 3GEHA 4NBSA 1OFIA 1FUUA 1GP2A 4W5WA 3K70C 2J0QA 3O8CA 1U9IC 3FMIA 2WJHA 3LXRA 3TQFA 4ABYA 2WMNB 1KSHA 3FVQA 3PENA 1SGWA 1TAGA 4AD8A 4QBGB 4M4SA 1N5KA 1SXJA 3MSXA 5A0FA 1S2MA 4DLVA 3EPHA 1NI3A 1UKZA 1SKQA 3W6PA 1D2MA 4PXAA 5D3MB 2ZRBA 3LV8A 4H1UA 4JJKA 1DAIA 2O8CB 3P4YA 3X2SA 3NTUA 4OQLA 1C9KA 2ZRKA 3S1AA 1XMJA 1NLFA 1GIAA 2IYUA 1BMFA 2OXCA 2BDTA 2NMVA 1YRBA 1Z3IX 3TAHA 5JZVA 3F0TA 2OCAA 4XJXA 4AYWA 1D9XA 1WBBA 2JLVA 3AH8A 3IIJA 2JLRA 3LAWA 2BBWA 3LNCA 3OE7A 4PR0A 3SN6A 2XTNA 5L3SB 2IHYA 4NP6A 2IWRA 4AC9A 1P72A 3GLFE 2HXSA 2ZRCA 4QHTA 3QVVA 1GDDA 1S3GA 1SXJB 4LBZA 4Z51A 4QBFA 1N6PA 3GCGA 3WY9A 1V5WA 1TEVA 1P73A 1XEFA 2YZ2A 2RHDA 5G53C 1VCIA 3KUCA 4B73A 4TLBA 4KYIB 2DYKA 4OK5A 1YU9A 1NMYA 3B1WA 5CM9C 4HAUA 3T12A 2ZRDA 5EE3A 1XBTA 1XRJA 5AUPB 4FMDB 1CF4A 1E2EA 1NBMA 1T4GA 4LSGA 3HDTA 1PZNA 3CO5A 2ZS7A 4EFNA 1ZM4A 5H8WA 4P4SA 2W83A 4BASA 2HT6A 3IHLA 3QBTA 4BWYA 2GF0A 2FX3A 2ZJ8A 4ZKEA 3A8TA 2YJTD 1ESNA 3GLFA 4EPRA 5L3SA 1ONBA 1UPTA 2ZSFA 1KAOA 4B3DA 3VNVA 1DO0A 2YHSA 3GLHA 3FFAA 1AN0A 3I5YA 2J0UB 2Q3HA 1FMJA 2CMKA 5BYJA 5FOTA 2A9KA 2OILA 1P9RA 4KVGA 5CB8A 1UBGA 3TUIC 4I4LA 3VFDA 3R9WA 3FKSA 1NN5A 2V7QA 3GFPA 5DI9A 1S3SA 2LKDA 3NHBA 4TL6A 1KO5A 4GRAA 2EW1A 2GF9A 1L2TA 5SZIA 4BFZA 3I62A 3IDQA 4A2PA 221PA 4G01B 3IBGA 4NYMQ 1E3MA 5LB4A 2CJWA 4D26A 5E7IA 1DEKA 3QBVA 5D3MA 2FFHA 3PXGA 5BN4A 3MWJA 3K53A 2GZHA 1RW4A 5F2EA 3EZ6A 4JLMA 5AJZA 4R71A 3GLFB 5TXGA 3I3SR 2FGJA 4OQXA 5JLJA 3EPLA 1E1RD 2ORVA 4MYTA 4N3NA 1W4RA 1ZIOA 4GMDA 2H57A 4AIIA 4BECA 2B6HA 4QGFA 3RRNA 2HEIA 3PJRA 2X2EA 1NVWQ 2CL6X 121PA 2QP4A 2WWHA 5FUVA 2YOGA 4ARZB 2HLDD 1G6OA 1SVSA 3N5CA 4DBLC 1Q20A 5DN6D 1SVOA 4UNRA 2IHBA 5LDDC 3AKDA 3LVQE 2QN6A 4DJTA 5B64A 1F2UB 3DL0A 2OV2A 4NCHA 5EXXA 1JQLB 1S4QA 5FTMA 1UJ2A 3NKVA 5JEDA 2HUPA 4A36A 5EUMA 2BHRA 2PZFA 3AVVA 5L3QA 1ZD9A 4WXPA 3JVVA 2WSSD 2QRZA 4QNRA 1FPMA 1G3MA 4LDJA 1Z2AA 1II0A 2QMHA 1YR9A 1M2OB 2ZJZA 4MRSA 2O8DA 1SQ5A 1ZCAA 3RRYA 4JIMA 2GJSA 3QPUA 4CEJA 3UXMA 5B2ZA 3RNLA 4A2QA 2D7DA 4BLRA 3CLVA 1UF9A 1XPRA 4CYMA 5KOYA 1XX6A 1YKSA 3GJ5A 2YNMA 2C04A 2ZJAA 3JVUA 3I61A 4DB4A 4QGHA 1VDZA 1OE0A 2WOOA 4IDNA 1EFRA 1JR3A 3HR8A 3A1TA 3U3JA 1E0JA 4BLTA 5EUQB 4BZQA 621PA 1QRAA 3IPXA 2GJ8A 2O5VA 2G0TA 1MV5A 3Q7PA 4Q21A 1RC8A 1NJGA 2IA5A 2J7PD 3I73A 4NDZA 4Q9JA 3TAUA 1GFIA 4LHYA 4NCIA 5KO2A 2VSOA 2FV8A 2ONJA 1KK2A 4PAOA 2FU5C 3TH5A 4F91B 1XTRA 4HLUC 4JL5A 3RS7A 2HCJB 1E9SA 3PQCA 1DADA 1IONA 2GBLC 3T1VA 2IYZA 2QENA 1E2PA 3FDIA 1E79A 2Q3MA 3RS3A 2JASA 2GILA 3ZS9A 2VIIA 4YMVA 3QKSB 4A8JC 3WXMA 4OK6A 2FZLA 1RVDA 2GCNA 4ASUD 1JR3E 1GNQA 1NSFA 3I72A 2V1XA 1Z2CA 4LJAA 5TB5A 2HCBA 1ZD1A 3ZJYA 4DUGD 3WBJA 3ZD7A 4DIEA 1O3YA 4KSCA 1LS1A 4BGDA 2PCJA 4P4TA 4A92A 3X1XA 2IK8A 4DLRA 4W5JA 1ZNZA 5BWMA 2XGJA 2VSXA 1HY3A 2JGNA 3ICQB 2G0NA 3E70C 4IDQA 4B34A 4TYYA 1E2DA 2R2AA 2R44A 1SULA 4IDOA 3AF1A 3K70D 1QVAA 2QORA 2C9CA 2V6JA 2ZRGA 1FP6A 3SYKA 3UMRA 3U3KA 4PO8A 1JALA 1KKMA 3IIMA 3K09C 1E6CA 1G19A 2NO9A 1HURA 2VH5R 4WZBE 4FINA 4GP7A 1KSFX 2BBSA 2IUTA 4IOJA 2QPAA 2ZYUX 1BO6A 1QDEA 1ZVQA 4ASUA 4N0DA 4I1OA 1IBRA 1GVNB 2PT7A 1UKYA 1H8EA 3AVWA 4IFBA 1QVRA 1N25A 2C5LA 5GJCA 4A8JB 3FHTA 1T8UA 3A1SA 3AP3A 4BEJA 3P4XA 2IX3A 5CJ2A 3B1YA 4N1AA 1PLJA 4JLKA 3LWNA 2VO1A 2BVNA 4PSVA 5E7JA 1AGPA 3WP1B 1OV4A 1N6IA 4OBEA 2V54A 2KBEA 1KNQA 4FMCF 3L43A 4ACAA 2LWIA 3EPKA 1IJEA 2FWRA 4L8GA 2AN9A 4HAYA 1FUKA 1NJFA 3UWOA 2ZI5A 1IN4A 1T8TA 4K8OA 1DG3A 1E2IA 2V4ZA 1E9BA 1HEIA 3EC1A 2ZSBA 5SZJA 1EFTA 2WVJA 4QM7A 1VPLA 2QAGA 2LKCA 1U0LA 2W6JD 4BLOA 5JI2E 4LHZA 4TZ6A 4TL7A 1AIPA 4R98A 3I5XA 1Q3HA 1G7RA 1R6BX 3BAFA 1ZRHA 2QP3A 4KSBA 1GRQA 1CU1A 3QEJA 1NVVQ 2QG6A 4LJ8A 1VMAA 1RJ9B 4JBXA 1GKUB 5G41A 3LH5A 3IHWA 2HT1A 3CWZA 2GEVA 1FNMA 3PVSA 5F3WB 1T6NA 1UADA 2YV5A 3QKRA 4L15A 4WW0A 2J41A 3RAPR 4LRWA 3K0AA 4NZYA 4DCTA 2XZOA 1XEXB 2C78A 2OESA 5ANRB 1DAGA 4B35A 2IL1A 2L0XA 1SVLA 4G5QA 4NCKA 4WAUA 2GRJA 3Q72A 5FTJA 1Z47A 1HH4A 2WSMA 1KI4A 1COWA 1RRGA 5EQTA 2YKGA 4C0BA 2IT1A 2CK3D 3C14C 1E1QD 4F38A 4KFUA 2WJJA 1AKEA 1G5TA 3MUFA 1KJYA 4I99A 4DLSA 1D9ZA 4F4IA 1DAHA 2ODEA 4WZAE 4DZZA 1VG8A 4LZZA 5HZKA 4PHTA 3FMFA 1KOFA 1TUEA 3X1DA 2WM9B 3VMFA 1W5SA 3B2EA 1CJMA 1FX0A 2JLWA 2ECKA 3OF5A 3ZQ6A 5FUXA 3R20A 2RHMA 3BERA 1GZSA 2PH1A 2F9LA 3RC3A 5B58C 1E9RA 3GJ7A 4YDHB 4IDHA 4DDVA 3QKRB 2P2LA 3WNBA 2VTKA 4HYYA 1ZYUA 4CVNA 3EA5A 3KKMA 2P67A 2F6RA 2A5YB 4TZ0A 1J90A 3I8XA 2PLRA 1LW7A 2AFHE 5AWFC 4F93B 4BFSA 5LPNA 4G3XA 2AKYA 1U2RA 1DAKA 2QROA 4YDSA 3VR4A 2A5FA 1KZGB 3TW8B 2IF0A 1ANKA 2KI5A 4LBWA 5KDOA 2C99A 2GWHA 5JEEA 4MKIA 1EFHA 1NNEA 3CR7A 3U3OA 1T5IA 1J8MF 2NPIA 1F48A 2NO7A 3OAAA 2BOVA 2H18A 3LQQA 4HB0A 3U5ZB 1W47A 2F43B 5CK4A 3K9GA 4XTCS 2GETA 5AJVB 2XTZA 1KSGA 4POAA 2VHTA 2DFTA 4LYFA 2ZANA 3FPAA 1WQ1R 4MQBA 4Z8YA 4B48A 4BRWA 2IS2A 1FW6A 4QHYA 5H1YA 4LC0A 3RLFA 5C1BA 5FBLB 4NYJQ 4URYR 2ZU6A 1FOEB 4V03A 4QRHA 3GLHE 3LX5A 3MWKA 5F9FA 3UANA 5CB6A 3CF2A 1XPOA 1HE1C 2Y8EA 1E2JA 3BFKA 4JL8A 2QM7A 1SKYB 3K09A 5DN6A 4XWOA 3D7MA 1FNNA 4URVR 1FFHA 4LOAA 1AGRA 1D8TA 2RCNA 4A9AA 2J59A 4V0MA 1HE8B 3TVTA 3EIQA 5J4KA 4M9QA 3NC0C 1ETUA 1QHYA 2NG1A 2FF7A 2FE4A 1CR2A 2ZPTX 3MJHA 3HYRA 2XB2A 2V6IA 3ZDQA 4DLYA 4Q48A 3MAAC 3VKGA 1XNJA 2F7SA 4OHYA 1M7BA 3CKLA 4P4UA 1YZTA 4IEEA 3IEVA 2C9YA 3AVPA 1KI9A 5HKKD 2ATXA 4XH9B 4TT3A 3GPLA 4RKFA 5JWHA 5FOWA 1GTVA 1TF7A 2GVDC 2R6CA 2DR3A 4JJZA 2H5EA 5GJWC 4TMXA 3NH9A 2OT3B 4B2LA 3GLGE 4HAWA 3KKOA 5E7MA 5F9HA 2BMFA 4DEXA 1U0JA 1Q44A 1II8A 4LV8B 6Q21A 3AF3A 1SVIA 4AYTA 1CTQA 2D4HA 3CNLA 4DIDA 1Z6TA 5J4YA 1H8HD 1IJFA 4JLAA 1CRQA 4W9MC 3SHFA 3W8NA 1F3OA 1XXHB 5J4VA 1NY5A 4OHZA 2JJ2A 5GJVC 4PX9A 5HCNA 5LD2B 3E2IA 3RRZA 2XJ4A 1CJUC 1IXSB 1FQKA 2XB4A 4DUGA 4AKEA 4I1VA 2IC5A 3H4MA 2AXPA 4U5XA 2F43A 1COWD 2HJGA 1FP7A 3CPJB 3B78A 4B3CA 2GHIA 2YWHA 3GLIA 2OFXA 3EZ2A 2O8BB 4LYHA 4CDGA 3J81k 2IXFA 4RKEA 1ZM9A 3VHXA 2QT0A 3KQKA 1W0KA 2KWIA 5JS8A 5CITA 2WIAA 1UDXA 4QOSA 2IYWA 5UKDA 4GZLA 2WJYA 3ZLJA 3T15A 4BZPA 3UPUA 3BORA 1A4RA 1XCPA 1AS3A 4I1UA 3U7EB 2GZAA 2PX0A 4LI0A 2BM1A 3AF2A 4DC9A 4M9ZA 3KFXA 1KI3A 4PZYA 4HDOB 4IOMA 3U60B 5GJBA 5EE5B 4A0RA 4RY2A 3GJ4A 4Q7JB 4EJSB 3DKPA 1F5NA 5KSYA 3CZPA 2FEMA 4QNMA 4IHQA 4RD6A 1VG9B 4B44A 4JYCA 3DMDA 1G21E 1Q3TA 1E94E 3GLIE 4FW9A 4C7OB 4B74A 2ODNA 1T91A 2OG2A 3NBYC 5TARA 4DSTA 1L8QA 2PMDA 2J0SA 1GUAA 2ZRHA 1OIWA 2ORIA 1XTJA 1ZIPA 4DCUA 3NHAA 1U98A 2W6IA 2V3CC 5C2JB 3RANA 1GOTA 3ZVNA 3TR5A 3W3ZB 5L3VA 2VHJA 3SR0A 1D2EA 1MABB 1W0KD 2P6RA 3AVOA 4ZCLA 4KAXA 5EE0A 3HP1A 1VTKA 1IM2A 1T5LA 3B13B 2QMEA 1YJ5A 1HQCA 3D3QA 2PX3A 2BCGY 3WMGA 4M1WA 1E9EA 5AK0A 4DT1A 2FN4A 3ASZA 4EDHA 2IWHA 1PJRA 4KU4A 1PV4A 1WRBA 4KYUA 3CZQA 2Z5FA 4QFMA 1VECA 2J3EA 1XMVA 3LBIA 3QEOA 5KU1A 1OKKD 2ZVPX 4AG5A 2IS6A 1S9DA 3TUJC 4NYIR 5TMPA 4PANA 2QBYB 3M0EA 5K8UA 1T0HB 5H68A 1Z8FA 4DSUA 1SVWA 2HYDA 3C5HA 3HU1A 4B3XA 1G5PA 3AGQA 3EW9A 1G8PA 2JEOA 1M74A 3UG6A 2ZRAA 5AUNB 3I92A 4BFYA 4QM6A 1BOFA 4URXR 4MRPA 1LF0A 1P3JA 3IPYA 1RRPA 4PAMA 2WKRA 3SDZA 2CHQA 2QM8A 4UNPA 5FBQB 4XTRA 2IBMA 1OB2A 1MO4A 1EX6A 1OLOA 2OLJA 3QXJA 4M1YA 4TLEA 4TT3D 5G3ZA 1RIFA 3Q5DA 1W48A 2W00A 4AK9A 3KJGA 2QTFA 4JLPA 1SXJD 5DHAA 4HDQB 4M1OA 2OM2A 1P4SA 3OZXA 2Q9CA 3K8YA 3GJ3A 1F2TB 4Q7LA 1CXZA 2Z6VA 5FOUA 3ZIAA 4HLUA 3THYA 3QG5A 4PPNA 1MH1A 1Z29A 5CDFE 4RD0A 4ZPXA 1OH6A 4V02A 1G18A 4PPQA 1E1QA 4U00A 3O8RA 1T3LA 2IUSA 4I81A 4DDWA 1A2BA 2FGKA 1NBMD 2J7PA 1XTSA 1GNPA 2QZ4A 3NXSA 4URUR 4R9UC 4QBIA 2F1HA 1XEWX 2QAGC 1FMLA 4UXIA 3CH4B 2BKEA 3CPEA 3IIKA 3OEED 5FTLA 3TR0A 2TMKA 2Z83A 4X8HA 4B71A 3I8SA 2QI9C 4RCYA 2R9VA 4EQ6A 2R6FA 4PQYA 4CF7A 2DBYA 3KQHA 1G3RA 3KZ1E 3G5UA 4FMCB 1NRJB 3GJ6A 4LJYA 1EG7A 2Z4SA 2GESA 2C2HA 3IO5A 4Q4JB 1ZINA 3SE0A 3GD7A 5FPYA 4TQUS 1M6NA 1W2GA 3A4MA 3K9NA 3WMFA 1HYQA 2RGDA 4KCGA 1YZLA 1CJTC 3IEUA 5CYOA 4ITRC 3PUWA 1U0HC 1IQPA 1NG1A 1Z0AA 3B6EA 2NPFA 1RPZA 1ZCBA 2NO0A 2FG5A 2ZYWX 1KJZA 1NBME 4MKFA 4DLWA 1OB5A 1KKLA 4LJ4A 1J2JA 1JXMA 1YZKA 1MRNA 4D4KA 4ZIRA 2XJ9A 3AP2A 3BD9A 1EESA 3UKDA 3B7GA 3MLEA 3T61A 3CX6A 4TYWA 1R8QA 2B21A 1Q22A 2EWWA 4B3GA 4C0KA 4NCNA 3TBKA 2G3YA 2QT1A 4HAXA 4P33A 2J0VA 1JAIA 2YWGA 2OCBA 2QSYA 3N70A 1OHHA 1R0XA 2CL7X 4IXNA 2OE2A 2OLKA 2MSDB 3OESA 1GL9B 4L5BA 3CNNA 2VBCA 4Z54A 4PC3A 4OI0A 2FSHA 3IILA 2ZS9A 4FIDA 1L4YA 1WB9A 2GZDA 2BJWA 1G41A 3M1IA 1XF9A 4QG7A 4Z8XA 3SFVA 2PT5A 4QJ5A 2ZE7A 1OPXA 1Z6AA 4AKHA 4M22A 5JJKA 3IQXA 5EE1A 3NBXX 3HU3A 1QHSA 3TSZA 5JJLA 3RRMA 1P2VA 1UKEA 4IKEA 3RDPA 1RRCA 3EX7C 3WMEA 2W2TA 3KB1A 2QGNA 4TQAA 4A8JA 3ADCA 3ZYCA 4Q4HB 4Q9LA 1IN5A 4G0NA 3KTAB 5FBVB 2VYFA 5CIQA 1OXSC 3B9QA 3ZVLA 3AV0B 4YXWA 4JYBA 4QJ4A 1KDRA 1Z6XA 1NLZA 3AVUA 3BE4A 2PJRA 2UKDA 2QE7A 3D6TB 5FR2A 2EQBA 4D6PA 3R7WA 3CX7A 3BC1A 1IXRC 4LJ5A 2ZJOA 1SZPA 2VP2A 5E95A 1XZQA 4A6XA 4GPTA 3DMNA 1XCGB 4V0ME 3OIUA 2OHFA 5BN5A 3V4FA 1MOZA 1W5TA 2R6GA 2ZAOA 1LY1A 1NVXQ 5CDFA 4A0FA 2AKAB 4F7WA 4D4LA 3A1VA 4JSYA 4D82A 4DB2A 4UQOA 4PQFA 1PLKA 3QXHA 2W2VA 5DGXA 3KJHA 4AG6A 4ZCMA 2EVWX 1YQTA 3QXCA 4ZKDA 3JZMA 3QG1A 2A30A 4DCSA 4QC2A 4LX0A 3IO3A 5LB2A 2ASEA 4LV6A 4LV5B 3LXXA 3GMTA 2GEUA 1CULC 3PR1A 2AK3A 1QZXA 1AA9A 1ZMXA 1BMFD 3QQ5A 1R0ZA 4HAZA 2BEKA 4Q1CA 2XTMA 3TKLA 4BEBA 4Q01A 2MMCA 3ZIAD 3TRFA 3OIWA 2ZQ5A 4FCTA 721PA 4MUAA 2XXAA 1CRPA 5AJWA 2F55A 5FBWB 2VPPA 2WPDD 2YWFA 4JZKA 1U8YA 3VR2A 4IOKA 2CJWB 1ZNYA 4B2IA 3R9IA 3U2QA 1MT0A 2QTHA 1UEJA 2ORWA 3OIVA 1U9IA 1N6OA 2IXEA 2PZEA 4OJQA 5K8TA 2Q3FA 1HV8A 2OAP1 4TYPA 4OQFA 1FX0B 1XD2A 3NEJA 4GFDA 4RZ3A 4P3YA 1G8HA 4TLDA 2K5UA 3SNHA 3W8RA 4DRZA 2W58A 5EP4A 4TTPA 3RWMB 4OK3A 3NBFA 4C4PA 3WNDA 1N0VC 2VRWA 1JECA 4ACBA 1WF3A 1Q1QA 4MYHA 4DKXA 4QKQA 5J4LA 4G5OA 2HLDA 1ODFA 1L7VC 5AUQA 3TMKA 2BCJQ 3DOEA 2ZJYA 4D81A 1Z0JA 3UATA 5KNDA 3BFVA 3REFA 3VU9B 3RC8A 1G8FA 2QTVB 3K0EA 1D2NA 3M4YA 1E1RA 3SHWA 3RS4A 1UEIA 4HZUB 2HJVA 2R6AA 4CZ2A 4MGZR 1QG2A 5L3QB 1JI0A 2ZM5A 1XTQA 4QGAA 1X6VA 5HPYB 3WYAA 3R7WB 1NMXA 3D8BA 2JIZD 2ZSAA 2EU8A 1AM4D 1GAJA 4HDCA 4YC7A 4Y0VA 2G9NA 3DKVA 4ERNA 3KKNA 2WMOB 2F3TA 4RD2A 1OYWA 3AP1A 1A2KC 1XXHA 4RSGA 3VR3A 4B76A 3L82B 1K8RA 1KZ7B 2ZS8A 3KFVA 3RS5A 4DDTA 2QGZA 4US2R 5JFGA 1E9FA 2P6NA 1BIFA 2V1UA 1DELA 4PSKA 1KMQA 4O2LA 1ZD8A 1VKJA 4B33A 3AVQA 3QXSA 3A36A 3WHLA 1L4UA 2BMEA 1Q1BA 4BFTA 5JHGB 4LGMA 2WKQA 2ZYVX 2JATA 1U94A 2ZEJA 3W90A 2G77B 2FPLA 5DHFA 3LX8A 3O8DA 1EXMA 4BE7B 1QHNA 1Z0KA 2ZI9A 1HTWA 3LD9A 1PLLA 3F3YA 5JHHB 3E1SA 3U7GA 4EPTA 1T3SA 3KXLA 4JBYA 1I4TD 1A1VA 4EJSC 4UJ3A 1E2GA 4LYAA 5EP2A 1Z83A 3TK1A 2I1VB 2VLIA 2P6UA 4E07A 4GMXA 4OHWA 3ZVMA 2PLFA 2WSSA 3A4LA 2X1VA 1X1RA 2H16A 1W7AA 1OXXK 3N2IA 4NH0A 1XCMA 3KDSE 5J47A 1W2HA 2GJAA 2C77A 3E5HA 1TNDA 3FMOB 1DBSA 2XEXA 4JKIA 3SS8A 1N5LA 4KITB 4AI6A 3QE0A 3QOFA 5FI1B 4BLQA 1XD2B 2DHRA 2XOKA 4HI0E 5BW8A 421PA 3FE2A 1CP2A 2GXQA 1TQ2A 3BGWA 1E98A 4KODA 1P62B 1E99A 1W44A 2ZRFA 3LLUA 4OI2A 4DVGA 3KXIA 4OYHA 4DCNA 2R8RA 2JLQA 1I2DA 1I2MA 2ZSDA 5EXTA 3VR1A 4C2UA 1XJCA 4L9WA 4ZDIA 2AWNA 2VF8A 3Q7QA 1PUIA 2KJQA 4PHFA 1OHHD 3WP0A 4Q9IA 2GAOA 4WA7A 1KO8A 1EWQA 1G20E 4KFTA 2CNWA 4C0QC 1W0JA 1ZU4A 4O0MA 1E0AA 1ZC3A 3A6PC 1SHKA 3SQWA 4IVQA 2NIPA 2IEYA 3DM5A 5AR1A 4CEIB 1ZU5A 2PMKA 2W6ID 1NN1A 8OHMA 1TX4B 3NG1A 3ZQJA 3HWSA 3AVYA 3BJIC 1LS6A 2QBYA 4W7SA 1D6JA 1J7KA 2N46A 3TQCA 1KY3A 1R2QA 5JCPA 2NOAA 2ONKA 2YOFA 2OUKA 3GLIB 3T06B 2Q6TA 3DVLA 1BKDR 4GOKA 3PG5A 1KI2A 1VIAA 2ODBA 4LJ6A 1E2QA 1OFHA 2ZAMA 4V0OA 2CVHA 2RGAA 4RVCA 2FPMA 2XZPA 4GNKA 2QMUA 4RZUA 3T1OA 1VG0B 1B23P 4EPYA 4R7ZA 4XVRA 3TIFA 2C9OA 1R8SA 3RS2A 3T5GA 2VA8A 2EFEB 4K46A 4BZXA 3T1TA 1RZ3A 1US8A 1VCNA 1N0UA 2DWOA 2OFOA 3P32A 3AKCA 4NYJR 3SJCA 1CR1A 3AUXA 1TTTA 4MDFA 2RGXA 1T9HA 4IW3B 4QJ3A 2ERYA 4C0JA 5B30A 4EJSA 3EPJA 4PC2A 2IS1A 4JLJA 4AYXA 1P7CA 2DPXA 3THOA 5A4JA 2H1LA 1G7CA 3QPWA 2WZQA 2WAXA 5DI3B 4ZDJA 2QPOA 1R5OA 2ZYTX 1G4UR 2IF2A 3L2OB 3ADDA 4JMPA 1ZNWA 1S1MA 3ETLA 4G5SA 4M1KA 4CGZA 3KL4A 2QE7D 2GA8A 3H84A 1XWIA 2CEAA 2G6BA 1G1MA 2C03A 4JVMA 1GITA 1U81A 2AXNA 1N0WA 1X8KA 2D7CA 2J7KA 2WHXA 3C15C 5G3YA 3AVXA 2J5XA 1ZBDA 5IK2A 2D62A 3P1JA 1X8JA 1OYYA 3DO6A 1YVDA 3SFZA 3QF4A 4YMSA 3B9PA 1Z28A 3DOFA 4MRVA 4JVLA 2A7QA 1HA3A 1OW3B 1JEDA 1LF5A 1G64A 4LJ7A 1MO3A 1K5DA 3BBPA 2WWIA 2P0EA 3I4LA 2X2FA 2IYYA 4DLXA 2H7VA 3O47A 2I1QA 1TPZA 4E22A 3U44A 2GNOA 3ECCA 5DI3A 2ZITA 3T1QA 2VP9A 1XPUA 4FN5A 1E9DA 5D3QA 3GLGB 4DWJA 1IOZA 5K8LA 4WVFA 5C4MA 1GILA 5E3HA 2ZI6A 2OSBA 4M1SA 1WP9A 2BBOA 3B8HA 1DO2A 4CEIA 3ZS8A 1P2UA 2QEQA 4UNQA 3B1VA 2QQ0A 1KK1A 1YZUA 1F60A 1QHGA 1W0JD 3AEZA 3MD0A 4C0HA 1P75A 4EPWA 2GXUA 1N6KA 1NVUQ 2PJZA 3QF4B 4B3BA 2OAQ1 5HZHA 1Z63A 3TNFA 4TMZA 4TTRA 2WV9A 3K9LA 3KJIA 3TGPA 4B75A 3QPVA 1NVVR 4RD1A 4E09A 1RJ9A 1FTSA 1P2TA 3BB3A 3MWYW 2CK3A 2AHOA 2UZ3A 2VP6A 4KO8A 1TF5A 2JJ2D 3G0HA 2XOKD 1NKTA 5DIFA 1ZP6A 1SKYE 4EAQA 2AWOA 2YWEA 1G6HA 3KUDA 2ZI4A 3U4QB 2A3RA 1DAEA 1H65A 4V0KA 3EC2A 1Q12A 1ZNXA 2ZRLA 3FYHA 4II7A 5JECA 1U99A 1RFLA 3UIEA 1ZW6A 1QHHA 3LQRA 4UKDA 4WXRA 3GFOA 4BPBA 1TQDA 3W34A 3CX8A 4TSFA 1WA5A 1Y3AA 3ADKA 2D2EA 3IQWA 1NG9A 1OFUX 1BYIA 1FQJA 5CIWA 4KLNA 5DO9A 1G291 3EXAA 4NL4H 4WBSA 3LRPA 4EUNA 4AY2A 4A15A 2IYTA 3DHWC 4X8LA 1KI6B 3OAAD 2H17A 2OZEA 3K0CA 2IYQA 3ZZ0A 2ZRJA 2GEDA 5JS7A 2ZSEA 2YINC 3BIFA 2GCPA 3A1UA 1E9AA 3R8CA 1G9XA 3MMPA 2OBMA 3ZGXA 3VAAA 1MO6A 2UZIR 4FCVA 2JJ1A 1E2FA 1GKIA 5FPKA 3BH7A 3F8TA 3I32A 5JMTA 2NZJA 3A37A 5KSOA 3LW7A 2NQ2C 5C4GB 3P20A 4Q9HA 5JRZA 1R5NA 3VR6A 1E69A 4M9SA 4UJ5A 2SHKA 2WJIA 1QF9A 4GZMA 3CR8A 3F5FA 3Q8XB 4ZI3A 4ON9A 4Q1DA 2ZUBA 2B92A 2PL3A 2W0SA 3CRW1 2IEZA 1VYUA 3QXXA 5EXSA 1CBUA 821PA 3C41J 1GM5A 2G88A 4NPHA 2RGNC 2O8DB 3CONA 5FUWA 4YMWA 3T35A 2NZ8A 4XVQA 4B6EA 3S1AB 3ZD6A 4TMVA 1SVMA 4NTZA 1KO4A 1LTQA 4QXAA 4P0TA 3W5IA 4ILEA 3PUYA 4LK2A 1KDTA 3EG5A 4Q03A 1RYFA 3CIOA 1M1YE 4YXWD 2FEOA 4LY6A 3CF0A 2IS4A 1JAHA 4Q1EA 1KNXA 4BRUA 2ZU0C 3CRRA 3DM9B 3GJ8A 1OIVA 4CW7A 1H8HA 4NCJA 1E9CA 4GI7A 1W4BA 2GVZC 3CB4A 3VKHA 3PUXA 1X1SA 3BK7A 3QIAA 1OXUA 3KKQA 1OH8A 1XEWY 4Q1AA 1OIXA 3EASA 3SYLA 3SU8A 3QUSA 2YVUA 3NDPA 3LA6A 3MJRA 2QNRA 2XXAB 3BWDD 4EIWA 1B0UA 5EE9A 4MITA 4KHZA 3U7FB 1HQYE 1CIPA 4ZV4A 1W4AA 4FXPA 1M34E 1QHHB 1OKKA 3H1TA 4B3FX 3PEWA 5JBQA 3LDAA 4PFSA 5JI3E 2QUZA 3UWKA 4KJZA 1VCOA 3V9PA 2XITA 5TDHA 1A5TA 3FFBA 3CW2A 1KJWA 2BKUA 3FTQA 1E79D 3QJYA 4I1SA 4A0HA 4Z1MA 4Q4HA 1P5ZB 2ZI7A 1P61B 3V00A 2GK7A 5FL7D 3HJNA 1U90A 4C9BA 3UMFA 1V43A 4RFSA 2CBZA 1FTNA 4IFEA 5BYKA 4IVPA 2N42A 4IXMA 4NU0A 3SI7A 4BFVA 2JLUA 1YHNA 4HUTA 1KK3A 3RHFA 4GP6A 3N2EA 3VU9A 1NF3A 1S96A 4GL2A 2WOJA 4NHOA 3VX4A 1NL3A 4M21A 1DVRA 1NKSA 3FWYA 4DHEA 2UVQA 5CM8B 2DFNA 3A4NA 2WAYA 5SZHB 1H8ED 4Q19A 2X19A 4Q5IA 1II9A 1ZM7A 2JA1A 1GG2A 3THXA 2QQEA 5KPDA 1DPFA 1JR6A 1Y63A 2B7BA 2IW3A 2RB4A 2P5SA 3QENA 3LO5A 2CVFA 4LCBA 4RZ2A 1C1YA 2ERXA 4H1VA 4PC1A 2W0MA 4PZZA 4JVNA 4LC1A 2XZLA 2DFKB 2ZE8A 1N6NA 2RGGA 4FCWA 4U7DA 1Z22A 2VEDA 1XU4A 4HLCA 1T3HA 5FTNA 2WJGA 4ARZA 1IN6A 2Q21A 1E2KA 3VR5A 2MSEB 3LY5A 3MFYA 4OI4A 4YLGA 4Q02A 4PHHA 4OHVA 3BXZA 2OFWA 2ZE5A 1E4YA 4OKSA 2FFBA 4Q7KA 4MKHA 3MGCA 2AR7A 1Q1ZA 3B82A 3CRMA 4M1TA 1GL6A 4B2PA 3SOPA 1P2SA 2I4IA 4TMKA 1G8GA 4XSGA 1RKBA 2E1RA 1AS0A 4HATA 1QBKC 2ZREA 4D0LB 3THXB 1UDWA 4FD2A 1NIJA 1TUIA 2B8TA 2NTYC 3B1XA 1KO1A 1XJQA 3NVAA 2JLZA 1JJ7A 4JT2A 4E03A 1OF1A 4HAVA 5EP1A 4Z1MD 4A82A 1PVOA 4TMTA 2ZUCA 3EA0A 4URWR 1W46A 4TLAA 2GXSA 5AUOB 2KBFA 4JBWA 5JJIA 3OEHA 4OJKA 4KFSA 5IHPA 2QL6A 3FHOA 4AWXA 2BM0A 1IHUA 4HEJA 3K0SA 1KI1A 3T34A 3W5JA 1RYHA 1VIYA 1DAFA 1XZPA 4TTQA 1KDOA 5BXQC 3AQ4A 3L0SA 4S2EA 4US0R 1SVKA 5EZ6B 1R10A 2CHGA 1HUQA 3B85A 1XEXA 3ASYA 4BLPA 1TQ4A 1AS2A 5EP3A 2RGCA 521PA 2RGNA 1E96A 1F2TA 2CCGA 2R62A 5FUYA 1Z08A 2MSCB 3QSYA 5H70A 1MRSA 1DAMA 1G3UA 1P9WA 1EFRD 1JR3D 1N3BA 1S0UA 3CUEF 4X8MA 3X1WA 5IRCD 1GRNA 3KQNA 3K0FB 4JLOA 3AB3A 1XJ0A 2FNAA 5DISB 2ZJ5A 4OI1A 1W49A 5KPJA 3AGPA 5L8VA 3GP8A 1KMHB 4BFWA 4HB3A 4NYMR 4A1FA 1NN3A 1Z6YA 5FFMA 2OXRA 4MGYR 2YC2C 2IYSA 2AD5A 1JEEA 1N6HA 1YZGA 3SYNA 1AK2A 1JNYA 3VTKA 1R0WA 3EARA 4Q66C 3EZ7A 4IOLA 4P32A 4C0SA 2C98A 4MKGA 1X8LA 4PO1A 2XSZD 4H9GA 2FOLA 4Q4AA 4TSFD 5KTYA 4UNSA 4MRNA 4CEJB 2EFHB 3HPRA 1VYVA 1EX7A 2IYRA 2XAUA 2QRNA 2V8OA 2ZR7A 4JLDA 3SQXA 4XWKA 3CPHA 3FKQA 4Q00A 3ZH9B 4CT5A 3TE6A 3CRQA 1EGAA 3FB4A 4UXJA 2VHCA 3UG7A 3RSOA 3LLMA 1ZUHA 4C0AC 1YR8A 1LFDB 4LHXA 2GCOB 1W1WA 5CLLA 4EFMA 3KJEA 2QAJA 1N5IA 3W3AA 2D2FA 3SJBA 1II8B 5K8IA 3U44B 2D74A 2NO6A 2YYZA 3AKYA 3HYTA 3K0FA 4DDUA 1Z0IA 2J1LA 2J87A 4DLUA 3GLGA 4DSNA 1TU3A 3ONWA 5IT5A 2FA9A 1OXVA 5FI0B 3CH5A 4BUJA 3QKUA 1MR3F 4M53A 4YMTA 3KXKA 5C46F 4R2HA 3Q9LA 2FSIA 4EPXA 4TYNA 4U02A 1OH7A 1J8YF 2OBNA 3A1WA 4K81B 5A5GA 1A82A 2EWVA 4DCVA 4PZLA 4PPGA 1KSJA 1U8ZA 4RFVA 1YE8A 3TJZA 2BEJA 1T0JB 4Q47A 3NWJA 2ZR9A 4B47A 2JDID 2JDIA 4NYIQ 1XP8A 5KDDA 1VCMA
chains in the Genus database with same CATH superfamily
3L0OA 5TVKA 4YHBA 3A04A 4ZVTA 1BU5A 3FSGA 2LIPA 3LYLA 2YS6A 4L72A 3OHSX 4AG3A 5IXJA 1QO7A 3ROXA 3TI7A 1EFCA 1FBNA 2R48A 3FWPA 3HGMA 5JOQA 1PQWA 1M2GA 3ABZA 3CVUA 1UEXC 3UHPA 4DA7A 1GCAA 1TM5E 4GKVA 4GVXA 2WJZB 4LYGA 2F4NA 4KK4A 3U3MA 2GBPA 3I5AA 1EFDN 1U7PA 4LHWA 4HP8A 1XPJA 1P7YA 1KGDA 1GUBA 2PYIA 1EFAA 4XQ0A 1VE5A 1SD5A 2ODPA 2CCKA 3C85A 2FH5B 1X3LA 1K92A 2QU8A 4TTAA 2VJBA 3K1TA 1SC3A 1Z4IA 5CXSA 4ZN6A 5JARA 5KYYA 1DEAA 2G83A 3DF7A 3JQ7B 4FYVA 4OQ4A 4S1PA 4PW0A 5EJ7A 2CFOA 3K15A 4CUZA 4W5QA 1C3LA 5DU2A 2PUAA 1L9XA 1OI2A 3OOSA 5JSKA 3PFNA 3NWOA 4E1BA 5KYGA 3F90A 2O0HA 1YTUA 5CVJA 4E1VA 3ASUA 3HLTA 1MJHA 5AESA 1P60A 4ZQGA 4UUBA 4HEA6 4QL3A 3QTBA 5EZ5A 1UOEA 3I2KA 2ZVQX 1Z37A 3H97A 4FUTA 4ZIRB 2Q5LA 2VYNA 4PYMA 2IUFA 1LFAA 5LYJB 4PZAA 3FNBA 2JD0A 4BO4A 1EDOA 4X6LA 4X00A 1NQWA 2V7GA 1L5ZA 1ZGBA 1ESMA 1HDOA 4EY8A 1QIJA 4G0MA 3TW4A 3UK1A 5JMWA 4H3HB 4LRUA 1TKCA 2ZR0A 2R6JA 4MUYA 4GOJA 4MP6A 3I09A 4R81A 5HKKA 4CKYA 2W6JA 2RAPA 1K8QA 1JQ5A 3L0ZA 4WKPA 1WABA 4BQEA 1DCTA 2VL7A 4U7GA 2JLYA 1MKYA 4GGPA 3VR5H 3M1YA 3Q3JB 1VRVA 1ULHA 2HPAA 4ETMA 5IF9A 2IZZA 3WZMA 3I6YA 2WWFA 2ZTLA 2JJ8A 3HABA 3MCAA 3OECA 5JD5A 3HCWA 1WZUA 2MIIA 1SEPA 5F1PA 3SCZA 5F1OA 1YTLA 5EWMA 2HV8A 4G0XA 1H9AA 4GVPA 4XFJA 5C7YA 2F1IA 2YXNA 4P81A 5H9VA 3BTUA 2CV0A 1QDUA 4BUCA 2UXCB 2FPIA 1TCAA 2AD1A 4IV8A 3V1LA 4ZDKA 5JS1A 3KOMA 2B82A 1CFJA 1U4SA 3VH2A 2OWEA 4Z4QA 5E9JA 1FRZA 3HMQA 2A94A 4RD4A 3P19A 5E4YA 3EF3A 2Q6OA 3IKLA 3TS1A 4EFDA 3U7HB 4M60A 2FMKA 4ZI2A 1W36D 3ENZA 2QXYA 1UWLA 4Z0TA 4HQFA 3FOBA 5JSZA 5CGQB 5BR7A 2H1SA 5K7SA 6ABPA 2FUG1 1STOA 5H80A 3SJAA 4AURA 6YASA 1R6TA 1MB3A 3ICVA 1KBOA 5GVRA 3HA5A 1L5VA 5JH7A 3VNUA 1R5BA 3O3MB 5F33A 1NP6A 2FPKA 3R3SA 4NPCA 4S35A 2VUIB 2HSDA 1EGVB 1L5MA 3M89A 3ND9A 3P9NA 3THYB 2VRNA 4HLDA 3QVUA 1Q1EA 4NFYA 4DQKA 2BPOA 2X77A 1C3OB 2PX8A 5AYVA 3Q8KA 5D5PA 3FNEA 1DWPA 1LV7A 1P0FA 2LCIA 2OHXA 1CUIA 3KFLA 3I6QA 3GDFA 5FYDA 3A06A 1AQLA 1TEHA 4P80A 1AD2A 1DQSA 3DEIA 3GAAA 5K0JA 1TW3A 2QTGA 1CS0B 4Y6RA 4KREA 1RJWA 2QQGA 2GDJA 3N8HA 4LWOA 5FOVA 2P4SA 3ZHXA 4ZMBA 1C1DB 1NVMB 1KGSA 2Q2OA 2R8XA 3IT0A 1E1CA 4IO1A 4EY3A 4XM1A 5C4IA 4MWEA 5J1SB 2ZUEA 4IXDA 5KDLA 2COKA 2X1HA 4LDZA 2RMKA 4BJ6A 1L5KA 1G8YA 1G16A 5J4HA 5AKXA 5LBIA 4MS4A 1H2ZA 3VPBA 2HPVA 1SXPA 1FXWA 1A8PA 1MTOA 2M98A 5ELLA 2G4CA 3WNCA 2ECQA 2KSQA 1RZRA 1Z6GA 1I0LA 4MPDA 3KKPA 1A98A 4GX5A 3TQIA 2EP5A 4AJOA 4H3SA 2V0NA 1ORHA 4YAWA 1UFQA 1KA9H 1ZKMA 1U2SA 2FX5A 5IFKA 2H92A 2NUPB 3UPTA 4I6JA 3IAEA 3GH1A 3KT6A 2JBAB 1K88A 3GLRA 4E31A 5KOHB 1CUBA 2HIAA 3KKEA 3SBDA 4CIDA 4UFOA 4MJ7A 5BSTA 1QE5A 3TM4A 2HF8A 4MWSA 1Z2DA 3DC2A 5JYCA 2CZCA 4NABA 4EOGA 5L40A 4MH0R 1RHRA 1K06A 1G3QA 3EIHA 5C52B 2E82A 2I78A 3GFTA 3W3AH 2DUMA 2P6OA 4TRRA 2WJ6A 3PGKA 4KKXB 1KJ8A 3V4PB 4LDPA 5J2TF 3WGJA 4WCFA 1E2HA 2ZPAA 1IQRA 2P65A 4HUQA 4O25A 3Q9SA 5HF8A 4I50F 2LGJA 4EO7A 2O2DA 3G5LA 1DTSA 3G2MA 3R2JA 4FWIB 3IEPA 5FPTA 4GI3A 4COKA 4D4JA 2Z9BA 3LVRE 4EKDA 1I1NA 1KZ6A 2YC4C 3C6QA 4MIKA 4MGKR 3ZHCA 3VQTA 3SXPA 4O4LF 4Y6PA 1KBZA 2M2IA 3EGEA 5DP1A 1TGYA 4ARUA 4RQBA 1GTMA 3DUFA 2A5GA 2X9VA 1TCUA 1DQPA 3FW1A 4QWWA 3TKAA 4MWGA 4MRRA 4D3XA 4DMMA 4EO4A 4HOYA 4M0MA 4BVBA 1NJ2A 2NVUB 2FSFA 2RSLA 1AZSC 1M7GA 1QZTA 4HNSA 4Y1RB 1VA4A 2XDYA 1GKYA 2GA9A 1XZMA 2PXXA 4Y2GA 3B6ZA 4I5EA 3HPQA 3RSLA 4WK0B 1HXHA 1R0YA 3GWGA 4FMBB 4PO3X 2ZE6A 3DZDA 2ZIAA 2LP4Y 2QRQA 4KVAA 1G17A 1N1EA 4L2IB 4WZAB 3C5WP 1QHXA 3IUYA 3U4HA 4KR3A 3FAKA 3WA7A 4BAUA 1A04A 5EJ6A 1DARA 1G21A 1Y3IA 2RK6A 4F4DA 2DLNA 2VQ6A 5JZ9A 5ILOA 1PUXA 1VYTA 1MB9A 3W6ZA 1Q84A 2AI3A 2O2SA 4TV8F 2IXDA 2KLBA 4W5NA 2IHKA 1BC5A 1N2ZA 4LYYA 4NK4A 2B4QA 1W4CA 3K4QA 3K5IA 2DFLA 1T25A 1QJ4A 1ZCZA 1GAQA 2WBLC 3P2MA 2V59A 5SZKB 3QX3A 2PHZA 2WDZA 3EVDA 4QJIA 1QH0A 2X7XA 3DDCA 1M34A 3KYJB 3OFVA 1VLHA 3LLCA 3QFRA 2YN0A 3L4EA 1GNVA 3RU3A 1TADA 1K9SA 3HBFA 4QIHA 4AUNA 4UEQA 1VCHA 2NVUA 4E4RA 3KE8A 3GEIA 1V41E 3MLBA 2Y1KA 3DT8A 5CJPA 4OA8A 5GADl 1M8PA 3D31A 3LSTA 2AL7A 3WR5A 1T10A 3EZFA 4PC7A 3UAZA 5HR5A 3ND8A 2IY9A 1OH5A 4MHTA 1E5TA 3ELDA 2REOA 1SCQA 2WNSA 2CYAA 1P17A 1TT5A 2HF9A 2J3DA 3L7MA 3C24A 1G60A 2GM5A 4EYOA 4BBJA 3K1YA 2QRJA 4S05A 2IYLD 5LQAA 3ZK8A 5JADA 2RAUA 1XHEA 3VI4B 1QG4A 4UFPA 1XZAA 4KBGA 2PRZA 2Q3LA 2ZZKA 4JLBA 4N49A 4PZCA 1VBMA 2VP4A 2OL4A 2X8AA 2WYVA 2EBHX 1E0DA 2WM3A 1MGOA 4V0QA 4YAEA 2OFPA 3V3TA 2QLJA 4NATA 4CLXA 2EX1A 3E48A 4XSHA 3GJTA 4ZVKA 5KMGB 3PQ8A 4G4JA 4UNNA 4Q4AB 4LPKA 5B58T 1N0IA 3GFBA 1MG0A 5IS2A 4DJ5X 5FR1A 3TCKA 4AMZA 1IXKA 1G7TA 2H11A 5IYZF 3ZWBA 4AROA 1JFSA 1BGVA 1Y1KE 1ETHA 2BMVA 2V0CA 4AMVA 2VQEB 4BQQA 3UHOA 3ODGA 4ZZ0A 3U3XA 2BISA 3L1UA 4IWYA 3ZLTA 3BGSA 3LCJA 4DM7A 3LY9A 3L0PA 2GCOA 1RWBA 1OFTA 1L3BA 2VF4X 5ALOA 3EAGA 1N3LA 2OWDA 1UBFA 4GICA 4H7IA 4HBGA 1YE3A 4BX8A 5BNZA 1Z34A 2FW1A 3DEFA 5FBRB 4IICA 2C95A 2ZXUA 2Q3CA 4UE3S 2JFUA 4IJWA 3H86A 2JL1A 4QPNA 5T6MA 3CO0S 1T9BA 3EVFA 3I37X 4N5DA 3IKMB 1HT2E 3G8AA 2NLOA 4JA0A 5FTKA 4WOCA 3D8NA 1EZ4A 3HN7A 4B82A 1S8FA 1LWNA 1TXGA 3GHHA 4X0EA 3LXMA 3HXTA 3OWXA 3BJMA 1R74A 1Y33E 3R7SA 4D0SA 4O2RA 3GG2A 2A58A 1D4OA 3MT0A 3M9LA 4QGGA 5JDCC 1DIHA 1KMHA 1C3VA 1SVNA 3ZWVA 3SZRA 4A03A 1EWTA 2I3BA 2PSHA 2Q1XA 4MYUA 3IR7A 3O26A 4TS4A 2RC6A 2IZ7A 1IWOA 4YUVA 1BYUA 3NBZC 4PTLA 2IUUA 1JJVA 1G2QA 2CXXA 4YMUA 1D04A 1XTIA 2VTBA 1T0UA 1FYDA 3D4OA 1IHPA 3B5JA 1J2EA 3UAYA 3PGXA 5SY4A 3IEXA 3IULA 4JLWA 5JTUA 2A9OA 1JHMA 3GUVA 2BFFB 2M1XA 1YJQA 2OCPA 2AFIE 2G25A 3BF8A 2B8WA 2CL0X 2NX2A 4RK4A 3LDHA 4DTCA 2X14A 1YDFA 1MP0A 1EHCA 3DZ8A 4ZK2A 1CQXA 1OQAA 2VG8A 5ED0A 1YRYE 3AL0C 3BMNA 3E8SA 2Z43A 1JIUA 3FPFA 4JENA 4DDMA 3U4CA 3E3AA 3RC9A 1CRLA 3OCYA 2D3WA 3N53A 3QU9A 4IDEA 4K5QA 3VZCA 5IKOA 3ZBUA 2RC5A 5LA6B 5JNSA 1E5VA 1ENPA 3N2ZB 1PNQA 4JQYA 5JSFA 1OU0A 2H51A 2X4LA 3JYPA 1N6RA 8AT1A 3COWA 2BV3A 1XE3A 5EKXA 3U6BA 5LKRA 3KHKA 4XPIB 2GZSA 3L92A 2J9RA 4LXXA 1ZZEA 2P9BA 3CF6R 5K6AC 1CV2A 4BMVA 4TL9A 1QU2A 5KMGA 5C51B 2BMJA 2ZI3A 3DSRA 3IOEA 4I4TB 2R0QC 1S2DA 4KXMA 1JIVA 1WKCA 1XKLA 4UBMA 1W5BA 3Q3EA 2VLBA 3RODA 4UTZA 5K6AA 2PANA 3ZNQA 1VPEA 1SN7A 4Q24A 3GGGA 4G8CA 2I9PA 4WCVA 2A9RA 4B32A 2O8EB 4KXYA 4OHXA 2R4QA 3EIEA 4AY3A 3PE3A 3PIRA 1MQ9A 4RKWA 5LQNA 2CMHA 1J5EB 2VC2B 4NV1A 4XIGS 3AR7A 3D8RA 3E2PA 2C83A 5JDIA 1DG1G 3BHNA 1WPXA 1RPJA 1RXEA 3N0XA 5D01A 1WPQA 2Z56A 1H85A 4RHUA 5IC4A 1NLUA 4IRUB 2YOHA 1WY5A 2CMGA 2AYYA 2P0AA 1O6BA 3KYIB 3KTFA 3I5UA 3QJGA 2I4TA 3LGXA 4C6HA 2MMGA 4PFJA 4OGGA 2R65A 2P5TB 3OEEA 4U2KA 2YW9A 3EZ9A 2QA5A 2ZUDA 4KO1S 4YRRA 4MUFA 3KQTA 5FH9A 4BV9A 1ATZA 1S7GA 1AXGA 1XD9A 3E7XA 3QVWA 4JJAA 4MXDA 4MVJP 3A11A 4Q3KA 4XD7D 5J40A 3KL2A 1CZKA 4L78A 3ANYB 4FWTA 4ZRDA 2PH7A 2NW6A 2X8LA 4KZPA 1UXIA 1I3CA 4QPPA 5ALIA 3WGOA 3IT2A 4XFDA 3SC2B 2BJVA 3UGTA 2C3MA 4LXHA 1KI6A 2AUMA 5BN3A 1PGJA 2I80A 3KQOA 1ZVJA 4QYIB 2BGJA 1NURA 4HXGA 3UA3A 4WV3A 1I2BA 4PPFA 5DLQC 2ZRMA 1I01A 2A88A 1UJBA 1O97C 3HWRA 2GTPA 1E8MA 1IOVA 3CUSA 1ZH8A 3HJAA 1KS9A 2E87A 3LC0A 3LL7A 1YRAA 1UBHS 4BV3A 1KDPA 3PV0A 3RROA 3RSZA 3SEAA 1RHKA 4LGYA 1ZH2A 2CUZA 2XNDA 2EL9A 2J4FA 5ERXA 4KMRA 1WXQA 3P5BA 3DBHA 3I58A 5FPPA 2PUCA 5IK2D 3VPHA 1KAGA 3X0DA 2Z0MA 3A6ZA 1QV9A 3KPUA 2FOXA 1VL5A 5DH9A 4Q7EA 4MR9A 2CLMB 3SF8B 1PDWA 3SYMA 4LTNA 2O14A 4HQLA 4RH0A 2QL7A 2VSFA 4OXXA 2DCUA 4M1QA 5C81A 1AZTA 1L7DA 2IGTA 4DSOA 4F92B 1E61A 2PL9A 2I6XA 2XT9A 3EVZA 3L1JA 3MGAA 4JC5A 1GDTA 5B55A 2QLLA 3OFNA 4ZU1X 5CB4F 1JFRA 3GFFA 3QVGA 4R54A 4NZMA 4HDNB 4RZXA 4L8FA 4Q6BA 2WD9A 3C5CA 4FR5A 4R2IA 3IAS6 5DYIA 4HTAA 2JHPA 5BSFA 2D1QA 1X70A 4BN0A 3IP5A 3JALA 3JRNA 2FPPB 2W2XA 2JGIA 4FOTA 4MGIR 4Z9YA 1AGNA 3J7TA 3ZI4A 3Q87B 5A02A 2E5WA 5ALXA 1E9VA 1NYRA 2P69A 3MD9A 3CWQA 3NIWA 1TYBE 4NONA 4RGYA 4ABTA 1H2XA 4LPSA 4C21A 4RXTA 2O8EA 4I66A 1EH5A 5GPBA 3CVYA 1Y7PA 3NCTA 5GAJA 4OP3A 3RK4A 3ZI7A 1P7VA 4LBYA 4K28A 3EF1A 4JV5B 2HBYA 1KAQA 1O94D 3I3OA 4DV1B 3R5FA 4NBSA 3K70C 3IC5A 3FMIA 1TUBB 3B70A 3LXRA 4EBFA 4C78A 4YLYA 4JI3B 1QHEA 4E21A 3MYRA 3PENA 3BWBA 4UPVA 1GADO 3OP1A 2VJQA 1TAGA 3C48A 4E13A 5C8DA 4M4SA 1N5KA 1S2MA 4DLVA 1U0BB 5BOSB 1UKZA 1C81A 2PX2A 3ICCA 5EJ8A 3A25A 3Q8MA 1ORRA 2OHIA 3ZCUA 1RI2A 4EJ2A 5B7PA 4Y67A 3LV8A 1FW8A 3MS4A 4JJKA 5HUQA 5JNLA 1DAIA 3RBZA 4F8YA 6REQB 4L3WA 2I03A 3NXKA 1QANA 4MUMA 4PG8A 1MMFB 1VL6A 1ZRMA 2X0FA 4XQ9A 2HU7A 2R6HA 3S1AA 3OZGA 4JBIA 3C8MA 1ZHOA 1MC4A 2BGMA 5L45A 1UFRA 4CQNA 2OXCA 3PI7A 1X7XA 1YRBA 1Z3IX 4WE3A 5EHIA 5JZVA 3ID6C 4XJXA 1E7SA 4EKEA 2JLVA 3SVLA 2QX6A 3LAWA 3OEWA 3OE7A 2BBWA 2VT6A 3KJNA 2IHYA 3IJEB 5F5XA 1MVOA 4AC9A 1P72A 1YGYA 3ILSA 4TSKA 3M3DA 4BWFB 4ND3A 4FB5A 3GLFE 2HXSA 3DB2A 3KT3A 4L5AA 2C8LA 2GYYA 4LNUB 1TO2E 2X76A 4EHBA 2WJ3A 3JSXA 1I9GA 3EUWA 1FBTA 3BDIA 4DCOA 2V98A 3PDWA 1Q7CA 3WY9A 4N0QA 1ISHA 4YWHA 4MR9B 2XY4A 1VCIA 4PLCA 2WE8A 3R74A 5K3FB 3ZHYA 4B73A 2HXGA 2DYKA 2CXQA 1XRQA 2Y0BA 3M5WA 2DSTA 1YU9A 2VK8A 3P9SA 4K88A 4Y9DA 1G8AA 3LF1A 4H6WA 4WY5A 2P35A 5CM9C 4HAUA 3GHYA 4QEKA 1YASA 1V95A 3T12A 1BHSA 4J76A 3VPSA 4BVFA 1SZJG 4HGYA 4WA8A 1QTQA 1XQ9A 2FN3A 2YJZA 1E2EA 1ADCA 1H3FA 1T4GA 3IVXA 2NU6A 4KWHA 4WL0A 1PZNA 1WJGA 3CO5A 2ZS7A 3WB1A 5BVGB 1BXZA 2BELA 4K6CA 2P2NA 4DWWA 5KWEA 2AT1A 2RHOA 1X7XB 4MGEA 5D2CA 3KPVA 3OCCA 2GF0A 3OUTA 4QLBA 2YJTD 2Q29A 3GLFA 4HD8A 1UPTA 3HEMA 2Q07A 5IABA 4YAOA 3GLHA 1PAUA 2O2HA 2HK7A 3KV1A 4F04A 1I0IA 4H59A 2J0UB 2Q3HA 2GSDA 2R85A 4B8ZA 1JXQA 5A03A 3SHOA 1Z8DA 3E5RA 3FKSA 3Q6NA 4I55A 1NN5A 3RIYA 5DI9A 1K5PA 3R9WA 4BNNA 1XNHA 2GUWA 2BY4A 3H99A 3LX6A 5KJ6A 4JOCA 4QPDA 2HA2A 4GRAA 1R16A 1VXOA 1Y3FE 2GF9A 4UDXX 3SYTA 1K7YA 2C8KA 1YC5A 3EWIA 1S6YA 3WO1A 3IDQA 3I62A 4MMYB 2HMSA 4G01B 5HHTA 3IBGA 1E3MA 2PGIA 1QP8A 5LB4A 4Q3EA 2GEJA 5BOSA 3JQGA 4BVHA 1NWCA 4D26A 1IG3A 1WR8A 2VBFA 3OZDA 3BGOS 3IVCA 5CX4A 4EZIA 2YRWA 4FYMA 1WB4A 2GZHA 3TZCA 3ZXSA 4QG3A 5F2EA 3T3OA 3VU0A 1UINA 2BAGA 3BZWA 4IQ4A 1ZW1A 2O3QA 2FGJA 2ORVA 4OP1A 1A9ZA 5DBGA 3PJRA 2C4HA 1SMKA 1ZOSA 1NVWQ 2CL6X 3L3BA 3RVMA 2Z57A 5FUVA 2EERA 4ARZB 1YXMA 4ZQHA 2NTJA 4L51A 1AV7A 1G6OA 1SVSA 1UJ6A 1BWRA 1N75A 2GAFA 2QRUA 2SKCA 3N5CA 5IANA 5ITZA 2XCTB 2EX0A 2J32A 3N8NA 2QN6A 1ZD3A 2JIPA 1UBSB 2HGZA 4L0DA 4L3OA 4NCHA 4WNAB 3ITKA 2VKTA 1D6NA 4WLVA 3OUUA 1X39A 2V5AA 2VS1A 3OJCA 5JEDA 2R8OA 3KEFA 2Q5OA 2H59A 4XE5A 2PZFA 4YRAA 3BSYA 3A9SA 4XDZA 1SUBA 4MV1A 1XQWA 2DVMA 1PIWA 3RYFA 3KHTA 5IKPA 4HPXB 3CQ9A 1K98A 3RVNA 4GPBA 3TXAA 5ALPA 1YR9A 1M2OB 1ZICA 1QCDA 3RV3A 4HDRA 4EATA 2C42A 4YLEA 2X1LA 4ZQCB 3WJ7A 5B2ZA 3AG5A 2FRDC 2EOAA 3AY0A 3OLXA 3RNLA 2DTXA 3KPWA 1UF9A 1Y81A 4C5CA 2BKLA 4CYMA 1TO1E 4EHKA 1QFXA 3GJ5A 1AU9A 4UZFA 2R1VA 3MT9A 1G9TA 4FDUA 3X1JA 5IASA 4K9LA 4Y2YA 3SZGA 3U48A 1KU0A 1NXOA 1SOMA 1QWSA 2O1EA 1HEUA 5I5GA 1RBQA 3D2CA 5H3HA 4BZQA 2M6KA 1B00A 4JI5B 1O97D 4RZQA 3R5JA 2YHIB 3E9NA 3IPXA 1X7WB 1G8SA 2GH1A 2JCGA 1QB7A 1X7ZB 4Z99A 1M1YA 5LUAA 2O5VA 2VBIA 3OU6A 3SS9X 2OQRA 4Q21A 5C7IO 1NJGA 1AHIA 2J7PD 4ZVVA 3JAMA 1GNLA 3TAUA 3EDOA 1GG9A 1M1NA 5KO2A 4I1IA 5JNVA 4MR7A 4MUNA 5AKEA 3ORSA 3T5MA 2EJCA 1P3DA 2HRZA 2C2XA 3RQSA 1AUPA 4F8EA 4FKZA 4HLUC 2Z04A 1U02A 2LV8A 2QQ5A 4I4CA 2HHAA 4NMWA 3WBBA 1E9SA 3BXXA 5JNWA 1ZMRA 1IONA 3TKYA 3CH7A 4LWPA 3PZRA 2FLKA 3AC0A 3JCZA 2Q3MA 4I5GA 2XV1A 1KMCA 2BM8A 3HO6A 3L06A 4ZAVA 3ZZNA 1OBOA 2Y68A 2J3MA 2QTRA 3GELA 4OK6A 1YJXA 5HK8A 4ASUD 3DEKA 3MMNA 4RVFA 3PPWA 3TR6A 3DDOA 1V9LA 1Z2CA 2VWQA 4LECA 4ZODA 5BYAA 4YT5A 5TB5A 2HCBA 4DFDA 4DIEA 5FI5A 3KHUA 4PCAA 2H85A 4AM8A 1L9KA 3ZKAA 3E7WA 1QHFA 2CXRA 4RV9A 2O7SA 3EHDA 2XE7A 4B79A 5B36A 4KJXA 4YP7A 1SR8A 2ZYAA 1AHNA 3TQHA 1T2CA 3QU7A 4A92A 3X1XA 1UFVA 4EUFA 5BWMA 1IWPB 3EMBA 1RXYA 3A31A 4X61A 3H9CA 3NHWA 1TZJA 2AG6A 1HY3A 3I4FA 3LPMA 3SQDA 2G0NA 4M8IA 3ZXIA 1OTYA 4B34A 4DLPA 1H2BA 3ZHQA 1YUBA 5M2QA 2G07A 4IDOA 3IV6A 4F56A 2FWBA 4J1TA 2QORA 4B40A 3K70D 3U3DA 1ZUD1 5FV7A 3SYKA 3UMRA 3U3KA 4HH0A 5BV2P 3GLTA 1P6QA 3BMNB 4PO8A 5AI5A 4JCOA 5IYZA 5JDIC 3RF6A 5TEWA 2O3UA 5IVKA 2HA5A 1H2YA 1XUOA 1GSHA 3E3NA 4FILA 3GG9A 1JB9A 3B6IA 1VFNA 3ND5A 4FINA 4C0WA 1F06A 2GBFA 2BBSA 1RYYA 2QPAA 4XLTA 1BO6A 4MEAA 1QDEA 3MUNA 7MHTA 1TK3A 3BMCA 4L75A 3OPYA 2JLBA 2PT7A 2GM9A 1H8EA 4G41A 5IM4A 2BSQA 3AVWA 3TJRA 3ZDDA 3FJYA 5L7WA 3GFQA 4MWOA 2VPTA 4J4TA 4NDAA 4WERA 3MBOA 3BWMA 4PX5A 4A8JB 4YCAA 3FHTA 1T8UA 1W29A 3A1SA 5ALMA 4EF5A 2R7NA 1IB6A 2IX3A 3FXAA 3JZFA 3B1YA 1Y4SA 1N9ZA 2VHYA 3IQDB 3ZNPA 5C1DA 4JLKA 3LHIA 3AR4A 3GDHA 4J2TA 5E7JA 5I7AA 1C41A 3IAAA 2BT4A 3CN9A 5BWCA 4J0GA 3S99A 5SYAA 4UD2A 2KBEA 3H5VA 4FMCF 5BMVB 1B8NA 2PZAA 3DULA 4EI8A 1GDHA 3NR2A 3OH8A 2AQKA 3CUWA 3PNMA 2A9QA 2CXTA 2WIJA 1E64A 2ZI5A 3OBIA 4X7BA 4ANFA 4CM8A 2CVZA 2YX1A 4K8OA 1E9BA 1T1SA 2ZIFA 5T41A 3GA0A 3NDJA 5SZJA 2JI8A 3AYZB 4GVLA 5HNKA 4QM7A 1IDOA 2QVBA 5I45A 2MR5A 2WY2D 5I9BA 2QMYA 4HY3A 1JEOA 4LHZA 3DVRX 1AIPA 3OETA 1SUAA 3ZVKA 5FUQA 4R98A 4BB5A 2Z6UA 3AFIA 4FJ2A 5HMMA 3GYBA 1I3MA 1UM9A 4J1NA 3N86A 4JR2A 1RZVA 2HT1A 3D4IA 3OZVA 3PVSA 4XOUA 4CKWA 3VUEA 2J41A 5KQLA 4GMHA 1XEXB 3GV0A 4LRYA 1H9BA 1JLMA 3C3CA 3GH3A 4JK3A 2IL1A 3PDJA 1Y37A 3VV3A 2DX7A 3D2AA 4NCKA 2V4UA 4OIMA 4XKJA 3Q72A 1HH4A 4UAGA 4YUWA 3I2YX 1WXIA 1COWA 3NTVA 4FOLA 1AB6A 3MTBA 4BBZA 4CJXA 4X65B 1K4KA 4C0BA 2YKGA 3C14C 4F38A 1T26A 4IF6A 4JYMA 3T9DA 1AKEA 3MUFA 3Q40A 4I99A 4IJ5A 4DLSA 4DYVA 4K05A 4LOHA 4F4IA 2ODEA 1E59A 1M2KA 3AIMA 3R7BA 3TIGA 2XUGA 3P9CA 1MOQA 5HZKA 1UBMS 3QK7A 4JQSA 2IPLA 1BEEA 3DHNA 3S7TA 1B3RA 2CBXA 2QN7A 3X1DA 1NSYA 3D3WA 2X4DA 3VMFA 1DCMA 3WKCA 1XMOB 2JLWA 2ECKA 3OF5A 3ZQ6A 4PX2A 2NTEA 1RYNA 4PTZA 1N2GA 2F9LA 4RTOA 2H3EA 5AW9A 4D3YA 1EUDB 1RMYA 3H5LA 3L04A 1ZG3A 4TVBA 3DDHA 3Q6MA 4YJGA 3QGMA 3PE6A 1R6XA 3I8XA 1RZRD 5DGHA 2PLRA 3AI2A 2C3UA 1NUTA 4GKAA 2O06A 2PGOA 2Q6VA 3ISTA 4G3XA 4U2DA 3UM9A 3AESA 3LUHA 4OYYA 5FXMA 4D02A 5IEJA 1TC1A 3J80A 2OMEA 1HDRA 5TF0A 5JCOC 4OXYA 1IE3A 2PT9A 1DRUA 2JBHA 4KLCA 1O4VA 4GX2A 5A3VA 1E60A 2YBDA 3EPRA 1LLFA 5AO9A 4ER5A 5BMVA 2BKXA 1T5IA 3AI1A 3FZGA 1J8MF 2NPIA 3CZAA 1F48A 3R4VA 4BB6A 1RAAA 2R68A 2BEUA 1TZ2A 2B25A 3Q4GA 5LIRA 4GYJA 1OD6A 5FKJA 1GG5A 2E37A 4HB0A 4QXRA 3Q1KA 4IV5A 1X80B 5C8YA 2JI6A 4QVGA 2V7WA 4YAGA 4FOSA 4WMLA 3VNAA 3VR0A 1NZDA 4XTCS 4BU1A 1AQNA 4S04A 2XTZA 1KSGA 2J9GA 1LBIA 4YJ3A 2VHTA 5HQJA 3DHVA 3FPAA 1P9OA 4OU4A 5JC1A 2AQIA 3ESDA 4OYRA 5IARA 3V7UA 2WUEA 2IPAB 1EK1A 2HHCA 3G89A 3PQ3A 4M1ZA 4PLHA 4Q34A 4CF3A 1JG7A 3CV3A 4L8YA 5JIBA 3RLFA 1BMDA 4UD6A 1F5SA 5ELMA 5FBLB 3W8FA 1FOEB 1YFZA 2IZ5A 3GLHE 4MQFB 4V0SA 3SQMA 3DQQA 2BDEA 2WWRA 4DDKA 1NNI1 4NZPA 3GLVA 5HVNA 4D6YA 5EIEA 5KVAA 1IQUA 2Y8EA 3AUFA 2PTHA 3BFKA 1X1TA 3OQPA 4I9HA 3IOBA 2YJGA 1KFCB 2V65A 2AZTA 2P2DA 3VDNB 1DCFA 1Y6FA 2YV2A 3H65A 4XWOA 2ZPUA 1RXVA 4JQCA 1GGMA 4YCDA 5JO9A 5ILQA 2AW3A 3S2YA 2QNBA 3MJVA 1JSRA 2O20A 2EFJA 4KBYA 1AGRA 1ZCFA 4LOAA 5GV7A 4MCHA 1W96A 4V0MA 1Q7EA 3MBKA 3UQYS 5KWVA 2BI4A 4ZEOA 4OXNA 3GCDA 3NNDA 2FF7A 2FE4A 2XWJI 5T4HA 3ZGYA 4JJIA 2XB2A 1QQ5A 3UUWA 4Q48A 3IHTA 5C1PA 2EKPA 4EGSA 3NIDB 3OIGA 2R11A 1M7BA 3UMCA 2HHHB 3RH0A 2C9YA 1C7IA 1KI9A 4WKNA 3TMAA 4BIMA 4D3DA 2ATXA 5BSRA 4BIIA 3CVWA 2VDRB 2NUTA 1GTVA 3EIUA 2O7VA 3MTGA 4OGWA 4WLUA 4EYQA 3E3MA 2R6CA 4JJZA 4KTVE 3C6YA 1MVNA 2PR2A 3BPSA 1GQQA 1DC6A 2VAWA 3RC1A 5ICEA 3DE7X 4HAIA 3OJ0A 3AZOA 3GLGE 1KP3A 4X1IB 4HAWA 1GY8A 3IEKA 2V6BA 3KKOA 1HX7A 4RA9A 2CLKB 5E7MA 4O5AA 4JLUA 2BMFA 1U0JA 4G9EA 1JN0A 1SVIA 2JARA 1SBIA 3BCUA 1CTQA 3DDSA 4GAEA 1JLHA 1LSUA 2R97A 1Z6TA 3TD9A 2HW8A 1H8HD 4ZAGA 1CRQA 2WTBA 3K72B 4CM6A 3SHFA 4LMPA 1QG6A 5AHWA 4X92A 1ZEMA 5K51A 1NY5A 4O2AB 4WDRA 1XMXA 2AE1A 4PX9A 3QLUC 4ID9A 3DXXA 1KE2A 1E1DA 2PM8A 1CJUC 3F6EX 3MWEA 5KTPA 4CV1A 1FQKA 3BUSA 2XB4A 1T5SA 1E7MA 1M2VB 1NASA 2I6GA 3GUUA 4P53A 2E3JA 1M8KA 2AXPA 2PG3A 3I2GA 1COWD 3BMOA 4FB4A 2PLWA 1ACMA 3AFMA 2DR2A 2VR1A 1ZR2A 2J85A 3KKKA 1SCUB 2CLFB 4YJ3B 3HY6A 1C0PA 3KU4A 2JAXA 3OT1B 3UYKA 3EDQA 3B78A 1DO8A 2A84A 2WD7A 1QO0D 1UJNA 3BULA 4JYAB 2UYYA 1LDMA 1QIMA 1UMCA 2JKYA 3JQAA 4QUDA 2O8BB 4RKEA 1C80A 1QFSA 1KU6A 2HF2A 5JG7A 3DPIA 3EHEA 5CITA 1GYQA 5CDTA 2BHNA 1BXGA 1EFLA 1HQKA 1D0IA 4O3FA 2IYWA 3WRWA 4GZLA 1KXZA 1KJJA 2EGHA 2PRIA 4IS3A 3T15A 2C31A 3BORA 1Q11A 3U7EB 3ICOA 2P30A 4GC9A 4LI0A 1X7YA 3ROQA 2ZK7A 3RFCA 4PZYA 1Z5UA 4QBTA 3EBOA 3NUQA 4IOMA 3B3JA 4A0RA 4HQKA 4Q7JB 3AB7A 1F5NA 1UK8A 1Z0ZA 3VISA 3CZPA 4OTZA 4BBPA 5DHRA 2FEMA 1KJNA 1UBRS 4OXKA 1VG9B 2QLBA 3OLQA 4BJ3A 2R1TB 2Y05A 3FWKA 1L1EA 3NAGA 5AQ1A 5CG1A 2B35A 2OBFA 3TOXA 1PVDA 2GGSA 1E94E 2FVYA 3IBFA 1CNEA 3L0CA 2GK3A 5CFLA 1DRVA 3H42B 4TX1A 2WIGA 1ISMA 2PMDA 1XQ1A 1NDHA 2ZRHA 1OIWA 4HXEB 4NQRA 2UVPA 4ZAWA 1KY5A 3TZBA 3FDXA 2R5WA 4LHEA 3O03A 3KWFA 2CMDA 3W3ZB 1NQ5A 2P0YA 4MUKA 1YZHA 2WSIA 1D2EA 1ECGA 1HORA 4DARA 4GE0A 4F3YA 4ZCLA 2IHNA 3R1IA 4KAXA 2OQVA 1TK2A 2YNMC 2HWUA 3OTHA 4U8HA 5F7JA 1CY6A 5KEIA 2VZEA 2PX3A 1GN8A 4AIRA 1B0AA 4YJDA 3HZOA 3SIPA 1CD5A 4AN1A 2GLXA 3Q5GA 2LPMA 3DT9A 3LX4A 1PGQA 1W59A 1UP4A 4ZJZA 1TYAE 4KYUA 3G68A 3OQ1A 3TQTA 4IMIB 4C04A 2YUIA 2CWWA 1JEQB 4XB1A 3LBIA 1X7ZA 3BBLA 2Y0PA 1LBSA 2A0KA 1DMRA 1NJSA 1TC2A 2I7CA 5MFZA 3F3MA 5JCOA 4YPVA 1Y7HA 2PXAA 4N03A 3ORFA 4NYIR 4BX2A 2NNLD 2HB6A 2QBYB 1S2NA 2D1YA 4K1XA 4EENA 2ZUUA 4M88A 3WWYA 3ZWCA 4QA9A 2HM7A 5G4LA 1G8PA 2ZRAA 1A4IA 2YRFA 4Y2JA 3BL5A 3DE5X 2DHCA 1WW8A 3HGQA 4MRPA 3IPYA 3JAKA 1QVWA 4N8DA 1ZOLA 1K27A 1SU4A 4PAMA 3TB4A 3GFVA 2CHQA 1JYSA 1EE1A 4QICA 1F0PA 2H54A 2PMBA 2IRWA 1USUA 3BQNB 3MRXA 4GM0A 4CL2A 5G3ZA 1EX6A 4TT3D 4OHMA 2K6GA 4TLEA 1LRJA 1F0KA 4K86A 4LA4A 4F5DA 4M7OA 3BL8A 4PBTA 4AK9A 1D2RA 2AC2A 2BKAA 4D8VA 2KYRA 4RIEA 3UMGA 3KALA 2IYFA 2OM2A 4LXQA 3GXBA 1P4SA 2PZBA 2R3SA 3OZXA 4HRAA 3K8YA 4O1IA 3HL0A 4UEJA 5FO0A 3ZDRA 4A16A 5FUMA 2XWSA 4GKJB 3FKJA 4YV0A 3ZIAA 1M1ZA 4JR1A 5EESA 3THYA 1GYPA 4EHIA 3SR3A 4KPEC 1H0RA 4HSGA 2ZOSA 4C3UA 3K5HA 2XVXA 2DOKA 2EZ8A 1Z29A 2YZMA 3K8OE 1ZJ4A 4NWIA 5EWLA 1ZL2A 4X7RA 1ZGJA 2DULA 3E53A 3HSSA 2ZJFA 1T2VA 2I62A 4MI9A 3BM5A 4V02A 4DIOA 2QJTA 4PPQA