1ZN8A

Human adenine phosphoribosyltransferase complexed with amp, in space group p1 at 1.76 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenine phosphoribosyltransferase
publication title Structural Complexes of Human Adenine Phosphoribosyltransferase Reveal Novel Features of the APRT Catalytic Mechanism
pubmed rcsb
source organism Homo sapiens
total genus 58
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zn8A00
1ZN8A 1G9TA 1MZVA 4M0UA 3ACBA 3N2LA 3HVUA 1A97A 3EFHA 1XTVA 1G9SA 1HGXA 1UPFA 3DMPA 3GGCA 4P3KA 4S2UA 2VFAA 1A98A 5IPFA 3GEPA 1HMPA 4ZFNA 2XBUA 3OHPA 1DKUA 1O57A 1ECFA 1P4AA 3MJDA 1QB8A 2PS1A 4Z1OA 1NONA 3G6WA 3MBIA 4LYYA 4LZNA 1A96A 5HKLA 5BQPA 1Y0BA 4P82A 1BD3A 3ACDA 5E38A 4WMLA 5EUCA 3M3HA 1J7JA 1TC1A 4LYGA 2EHJA 1V9SA 5KAPA 4IJQA 3DAHA 1G2QA 2H07A 4RHUA 1CJBA 2JBHA 3S5JA 2JKZA 1OROA 1ZN7A 3LRTA 4JLSA 4P80A 2JI4A 1QK5A 2E55A 1JLRA 5K51A 2C4KA 4P83A 4KN6A 5IAOA 1BZYA 1OPRA 2FXVA 1P19A 1STOA 1DKRA 2YZKA 4QRIA 2P1ZA 4OHCA 1VSTA 4RABA 1DQNA 5JV5A 1VCHA 5BQOA 1GRVA 1JLSA 1QCDA 5BSKA 2HCRA 2DY0A 1ECGA 1DBRA 2GEBA 1TC2A 1G2PA 4LZOA 5BRNA 2JKYA 3OZGA 4TWBA 1WD5A 1I14A 1ECJA 4MB6A 1A3CA 1R3UA 4JITA 4RQAA 1O5OA 4RHYA 1UFRA 1U9YA 5ESWA 1IBSA 1UPUA 3O7MA 4M0PA 1L1QA 2IGBA 1XTTA 3KB8A 1ECBA 1QK3A 1ZN9A 1GPH1 1ECCA 4RADA 1XZNA 4QYIA 1P17A 1Z7GA 3LPNA 4RHTA 1I13A 5HIAA 1D6NA 1I0LA 5ESXA 1W30A 3QW4B 1I0IA 1NULA 1QCCA 2H06A 1XZ8A 1OREA 4RV4A 1VDMA 3H83A 4X44A 1U9ZA 5KAMA 1DQPA 3NAGA 1L1RA 2H08A 4RAQA 4PFQA 2AEEA 1FSGA 3GGJA 1XTUA 3ACCA 1YFZA 1I5EA 4M0KA 4RACA 4P84A 2WNSA 4RANA 1AO0A 2PRZA 3OZFA 4RAOA 4X45A 4FYMA 1LH0A 4P81A 1QB7A 4RHXA 1P18A 1A95A 1A4XA 5JSQA 2PRYA 4QYIB 4PAWA 4RQBA 4WN3A 1QK4A 1PZMA 3DEZA 4LZAA 4F8EA 1BD4A 4P86A
chains in the Genus database with same CATH superfamily
3AKDA 4D9IA 2D0PB 2XGSA 2JGFA 2JZNA 4UHFA 4MUIA 3MWDB 5DW3A 5C5EA 1AHPA 1LUAA 3GUUA 4RFVA 1T9BA 2E18A 1ZPDA 4JP5A 3WP0A 1PUIA 4XJVA 2Q1XA 1CIVA 5DI3B 1G16A 4FHFA 4JA2A 2W6ZA 4M88A 4AECA 1WZ2A 3Q12A 5G4KB 1AG9A 3H9UA 3Q10A 2JFFA 5EJ8A 4K1XA 4B0OA 5A1JA 1GILA 2J1LA 2FWAA 4POOA 3P9ZA 3TNDA 4J75A 3JWHA 5I8ZA 1JW9B 4DPLA 4HNAA 4TROA 1YRQA 2ODBA 3TIFA 3A31A 4F8JA 1N5DA 4JUAA 4EY3A 1NIPA 2DSTA 3GDWA 4JT4A 5EHGA 3G0CA 5FWYA 2EHJA 4GI1A 4NK4A 3VSDA 4XYEA 1U3CA 4HDMB 4DLNA 2CE2X 1G21E 3PCRB 3L4BC 3T12A 1XWFA 2IGTA 1XO1A 4G3XA 4BUJA 2BFCB 2N3ZA 3C97A 4QBTA 4CQLB 3RJ5A 3REQA 1NVEA 1YNOA 1QR6A 4NQZA 2NO1A 2W43A 3UO8B 2QVLA 4TV9B 1G7SA 1U6KA 5LNK6 4HPWA 1PV2A 5JV5A 3OQNA 1ESEA 1LCIA 1L5LA 4IUBS 3FUCA 3ESQA 3K5HA 3ZE2B 3ELDA 3OX3A 1PS9A 5C7IO 2X9LA 4NICA 3SIXA 5P8WA 5F3WB 1YMQA 1GL9B 1U9CA 1ZESA 1XEWY 3FZQA 4G84A 4XFJA 3O8NA 3RRJA 5SZJA 2GVZC 2A94A 3TIGA 3B13B 1RLTA 1VKOA 4NBRA 3B6KA 4IDQA 2ZT7A 3QUQA 2QVZX 4XPIB 4Y2XA 3BAFA 1HPLA 2Z5VA 3I9NA 2VN8A 5EJ7A 4LE2A 4JVNA 1XC7A 2ZTVA 3RQSA 4BFZA 521PA 4DR6B 2CLFB 4MIEA 4PCAA 3TNJA 5JPIA 3R3JA 4DCVA 2JFPA 3CUEF 3L2OB 5K0BA 3UT6A 2JIBA 3FPHA 3BRWA 1IVYA 1GRRA 5DWVA 3VTAA 4CGYA 4RADA 2WB4A 3K9FC 4CEIA 4IIUA 4XIYA 3NHLA 5IYZF 3TX2A 3RTBA 1AV7A 3OPYA 5K0GA 2FPGA 4CM4B 4E5UA 3K5WA 1DC4A 2A9OA 1NVKA 2R1ZA 3DZ8A 4IMIB 3DZGA 4JNKA 4G5QA 3B3FA 2X9NA 3NV7A 4QLAA 4ZJYA 4YP1A 3K2EA 5E0KB 3BSSA 3Q11A 3D8NA 4F5YA 2GBGA 2B8WA 2QRHA 3GMIA 4H6VA 3LTNC 1S1MA 1F0NA 4LGMA 2KLHA 1P6XA 1NP6A 4XGIA 2PS9A 2QIOA 3RC7A 2GD2A 5HK8A 2C98A 2GM9A 1N6OA 2MU1A 3AY6A 2OYSA 3GLHE 3FXAA 1KI3A 3LF2A 5I3CA 1T34A 4AY3A 1MKYA 2GESA 5IYZA 2BGWA 3FPLA 2OORC 4K8RB 2Q3JA 4HGNA 3UJCA 221PA 3GXOA 3N2KB 2ZJ0A 1ISGA 4CMBA 1A1SA 3DMNA 3O1LA 4PHTA 1Q0UA 2O2IA 3BXOA 4R1MA 2P9JA 2Y4OA 3EXIB 2RE8A 2ZJ2A 1NIJA 1T8YA 3HWSA 3CLTD 3DT6A 3B7GA 4GIBA 3DBLA 4IRXA 3ZGNA 1N6NA 1VKJA 4S2EA 3HXKA 1DUIA 1X70A 4N0MA 3VDXA 3PIRA 4EEKA 2Z8XA 4HAZA 1THMA 4D2IA 3UJAA 5CB8A 4D44A 4EF4A 1L5VA 2CSXA 1U2EA 3CJRA 3DMRA 5FPTA 1BYIA 4ZQIA 2EC5A 4ES6A 3HJFA 3GLKA 1BJTA 5TS3A 5IVHA 5C8VA 1DKUA 1T4DA 2P78A 1P0CA 1K98A 4TTRA 5C4MA 3I2HA 5C1IA 1K7CA 3VTKA 2DT5A 3WLQA 3H2BA 4ZO8A 3EEBA 4Y6LA 3I73A 2R4TA 4MRNA 1P1JA 3KPUA 5IVKA 3FUTA 4NC9A 1CB0A 2ONZA 3DHWC 5L7TA 4LDZA 1L5RA 1WCWA 4PQGA 3NBQA 4RVNA 5C80A 3PD0A 1E7QA 3WGGA 1F17A 1M8JA 2SCUA 4S1TA 4BNUA 5LSAA 4NXMB 3KYBA 3STUA 1KI4A 4GOLD 2AE2A 1P6QA 4AJ4A 2EWWA 1NXQA 1KSHA 3EYAA 3HU3A 3GA7A 2QSJA 2D8MA 3JPWA 2UVQA 3KYJB 3LUHA 2V58A 4ZGBA 4NDZA 4BX2A 2NP7A 2CL5A 1NQ5A 2JZCA 4I46A 3O8CA 1WPRA 4N1AA 1E1QD 3HB9A 4FBMA 1FJ2A 3CT4A 3NHRA 4HH4A 2EP7A 3T3NA 3J81k 4KLZA 3H42B 4W5NA 1GAWA 5DTEA 2IYQA 2NU9B 2R6JA 1MAWA 3TLXA 2DECA 2G09A 1WX1A 1IWOA 2H4JA 4KBFA 2C2YA 1BX1A 2EEZA 1VA5A 1Y81A 4B6OA 1MG5A 5DCUA 5A5GA 1E6CA 3DF9A 3TM4A 4F4JA 3MUEA 2R3SA 2Z6AA 3FOBA 1E32A 1ZWKA 1V7PC 2BFPA 2RGNA 3O8OB 4N4AA 1TX4B 4RPHA 4I4CA 3AL0C 3RSSA 1U0NA 4DVJA 2NTEA 3BWYA 3KUKA 2I5PO 5FTLA 2D3TA 4H16A 4GNRA 1VJRA 1TUGA 4Z4HA 3QKUA 4YT5A 5KSOA 2WKSA 3H2YA 3Q8MA 5ERXA 3I2GA 8ADHA 4IDGA 2C7BA 5EIBC 3K4QA 3V80A 4BXOA 1P62B 2GA8A 3ISVA 1Q2UA 3B5EA 1POWA 3CYFA 1SCKA 1N3LA 3RS4A 2NZ8A 1UT5A 1J42A 1XTPA 5J23A 1SVUA 1XNJA 3AEQA 3PNKA 1WBDA 3B9RA 3B6ZA 4Q4JA 4WV3A 2IHJA 2WJYA 4AJKA 3KXLA 2WI8A 3PQ4A 3W3AA 3AR6A 2ONJA 1QO7A 3PD7A 3QKSA 5KYYB 4UBOA 5EP4A 4MVJG 3KQSA 4J7CA 1TT5B 3HC7A 1NJFA 4TRNA 3ELUA 1MOZA 1DADA 3B52X 3EZNA 2ZM5A 2ZI4A 2WRZA 3TQTA 3CLUC 3JQCA 4OD0A 4OM8A 4PZCA 4I5GA 4W1RA 4Z2YA 5THQA 1SPXA 4WLEA 1GR1A 3OEWA 2C2GA 2JCYA 4PHCA 1UMCA 1W88B 3ZHUA 5KO2A 1TD9A 1XF1A 3CWZA 4ID3A 4KXLA 1TJ3A 3EQ2A 1U9IC 2B30A 3FNQA 4IVQA 3WK8A 1Z3IX 2CXTA 3ESCA 3MLBA 4NNOA 4Z99A 1GKKA 4Z0TA 4BMDA 1SH7A 2WNHA 3C7TA 4K7JA 5TDHA 5JSQA 1DBIA 2PRYA 5DK4A 4BBZA 4RWZA 3G02A 4J49A 5DCLA 1E2JA 4PXSA 2WTAA 4IQ8A 3TD2A 3O0DA 5SY4A 2JF0A 1ZINA 1C8VB 2IYTA 5EQFA 1G17A 3JAMA 2XQGA 2VNSA 1V11A 1PL7A 1S8NA 2E3JA 3IQEA 2XF8A 4LJAA 2G0TA 4PFSA 4QFCA 4URYR 4L73A 5IPFA 3QV2A 5K0SA 5IT0A 2BRUA 4JYAB 3ZZ1A 4QPPA 4KBGA 1PF7E 5DRYA 3T99A 1UDXA 4BKQA 4H1TA 5E1MA 5KWEA 3KSMA 2PGAA 1OOEA 3TJRA 1XLTA 3Q0EA 4NOLA 4FMCF 5LQJA 2I99A 3EF0A 2O7QA 3JRWA 3ZGLA 5IF3A 1VMAA 2PRJA 3CSUA 2VJAA 3NRBA 4G0QA 5B1IA 5J2TF 4HH0A 3AJDA 1N1DA 2C99A 3SQDA 1Z4IA 3SJZA 3PHCA 2QF7A 4F85A 4Q34A 2OD7A 2PZEA 3WNVA 1OROA 3VX3A 1PK7A 5A5DA 1LI7A 3JYNA 3LL7A 2HB6A 1TRKA 1Y6RA 3R5SA 5FOXA 3F7OA 5EWLA 5EJ4A 1EIWA 2FHSA 1UCFA 3K0BA 4P83A 4QT0A 1OZGA 3MB5A 2I91A 4WGFA 5GOZA 5AW5A 2F1JA 2JK1A 2GHTA 4HPXB 4P98A 1VLLA 3TZLA 5K4HA 3W9SA 4KGDA 1JFFB 1T5TA 1H2XA 4C4YA 1ZM2A 4CQMB 5AKKA 1UWKA 5IXSA 2IBSA 3Q9NA 1ABFA 3EGVA 3LCUA 3WL4A 4DIDA 4ZVPA 1YK0A 1TUEA 4E2YA 1WDWB 4IDAA 3NEJA 2ZIGA 1A9SA 2AYYA 3NB0A 3SG0A 1N6KA 2F90A 4AKGA 2JLBA 1I0ZA 1EU1A 2GD0A 5KHOC 3A32A 1GSAA 4FFRA 5D86A 2ODWA 3LMKA 4RPLA 1UDBA 4KMMA 4P4SB 1JX6A 4KVAA 1ZK3A 1KYWA 3IKVA 3K09A 2AOTB 4UDOA 4FFPA 2BHTA 1LLCA 4RA6B 3IUPA 5T4EA 2Z9CA 2J0EA 2M1XA 3TUIC 1MRZA 2WTMA 3A9VA 3WKDA 4L8VA 3CVWA 1G3QA 2WJ4A 3PSAA 4KQWA 4PV7A 3R9KA 2YFYA 3RLFA 2C4MA 2FSVC 3P4UA 3RD5A 3QPAA 2DVMA 5DTMA 1XDUA 1NYRA 1BXRA 4M0LA 5TMDA 1RRMA 5I9SA 2F3SA 4L4YA 1VZ2A 5LJIA 4JP2A 5KNCD 4XQ9A 1U8TA 3KOWA 4E7PA 5LP6B 1RHRA 2P5TB 3O1JC 4X54A 1X7ZA 3LGSA 4TTIA 4RDCA 3WK4A 4HNGA 3VR3D 3ZJYA 2A5GA 3ZQKA 4LHXA 1EVZA 2GFQA 5EXPA 4MA4A 1E6UA 5K7SA 5LVAA 1WD7A 4P7GA 3EIHA 2FW8A 4AICA 5BWCA 3JSAA 1E2QA 2NUBA 1B23P 4TMYA 4DQ0A 4HI0E 2B4QA 2XQFA 2M6KA 1UXHA 1M8KA 1W2HA 4HLQB 3HR7A 1NNI1 3A27A 4R1UA 1BOFA 5KU7A 4Q3OA 1CJKC 4RKYA 3P94A 4JIGA 2QBYA 5AVJA 5CW2A 2RHLA 4LOIA 1NXTA 3H5LA 4OHZA 5DNUA 1CJVC 1LKZA 3KQKA 2WQZA 5A7HA 1UJBA 2FGKA 2X5XA 3PUIA 4H1VA 4LXXA 4B87A 4EHDA 2BMFA 2DERA 1QIFA 3UUGA 2PSHA 4RGQA 1OGIA 2M6SA 3KHUA 5FPSA 1T5DX 3OOYA 1MO6A 5DDIP 4M0UA 2UUOA 3RRZA 1EUCB 2AR0A 2HYIC 2Q4DA 1XGKA 4UJ3A 4RVDA 1JQEA 3V2IA 1KOJA 2YZNA 5HTKA 3TOSA 4ZPJA 4BOYA 4ZI7B 4AC9A 5B4TA 1KJJA 5ALEA 1TI7A 1AKUA 4Y1RA 4B7XA 3V3KA 1HE2A 2EKLA 3P2EA 5GGYA 1LSJA 3RFFA 2EJVA 3PXCX 4Q9KA 2FW6A 2QYHA 1RRGA 3QE4A 3OD5A 1Z36A 2J7PA 2ZYDA 3HGQA 4RGBA 3JYQA 2CUTA 3IJRA 5BYBA 2NIPA 3U7QB 1XCMA 3D3WA 4GI2A 3EGXA 4E4YA 1EFDN 4LKOA 2D13A 1QK5A 5JJIA 3WDMA 2CBXA 3LH5A 3C5HA 5CU7A 2O0LA 3TBHA 4BVKA 4RLSA 4FKBA 3IB3A 2APJA 1WXXA 5EZYB 4RU1A 3PGA1 3A6EA 1GRQA 2XUDA 3LVBA 1ZAYA 1OBOA 2CKMA 2VCHA 3FPAA 1YS1X 2WAAA 2XTZA 4RS3A 3MZ0A 4BMXA 4LV5B 4BNKA 2Z8YM 3L8MA 2AUNA 1Y1TA 4AMGA 1KBOA 2MMGA 1BJKA 2FUG6 5LYJF 1SOWA 3K6SB 2FP4A 2WSSD 1CDDA 2IHTA 2JFGA 2BFFA 3CUUA 4KXUA 3U4GA 5DX1A 2ZYHA 5IARA 3IBFA 1EVQA 1WZEA 3LY8A 4KSBA 1Q14A 5ESWA 2YWHA 1KZ7B 3VTFA 4E5DA 1DAMA 3ZZNA 1SMKA 3F5DA 3EGIA 2D62A 3QE2A 1ODCA 4X7PA 3RIXA 3TTSA 2ZXEA 3WGMA 3DL4A 3IDOA 4HNSA 3OJWA 3SHFA 2Z8YA 1P0QA 2AOUA 1YDEA 2GPBA 2QNRA 1JEDA 1ZN9A 3KLMX 3UAWA 5LM3A 2XVYA 3EDQA 4MKHA 4B2YA 2IDZA 1WUYA 3KZVA 3LT0A 2FR0A 4QLOA 4LYAA 4QYIA 5LYJA 3AEKA 5HQJA 2CMGA 3LPDA 3G88A 1CR2A 2H4HA 1NX6A 5CEFA 1LBEA 2QSZA 4NAVA 1F4LA 3TVDA 2CMFA 5FBHA 1N2CE 1NXPA 2YRXA 1NQXA 3U3OA 2BJHA 2IUYA 4WUVA 5EVCA 2CVZA 3UA4A 1FQWA 1JXQA 1WETA 5EE1A 1YZKA 3TO5A 2WA1A 4C29A 1ZD1A 1CUCA 2OE2A 1Q3TA 2PL3A 1AQUA 3D5TA 1VL5A 2NSLA 1TIPA 3W2GA 3W2HA 2ID8A 4IHKA 1EQ2A 4ZK2A 1VI2A 4K9RA 4MUXA 4CTNA 3I42A 4KPYA 3FCUB 4DY4A 1OWMA 1F9AA 1T4GA 4WBNF 4DV7B 5EMKA 3RAPR 1XPJA 3AY7A 1FC0A 4RACA 2M32A 4RJJA 5CDTA 5KNDA 3F7MA 3C5CA 3VR4A 5FUQA 3OIFA 1FNCA 1GGJA 1V3TA 2AKEA 1KTIA 2XDWA 3L7YA 3MWEA 2J8ZA 1CCWA 3DMHA 3UCFA 1K92A 2AFHA 3W04A 1M5UA 3OLQA 4KDRA 4BIIA 4OIFA 3K70B 2CK3D 5A4AA 1Y7LA 3C7KA 2XD9A 1ES9A 1X7HA 2PZLA 1MZVA 5KJCA 4WBNA 3ZK9A 3IBTA 4ZC1A 4FCVA 1LK7A 4BGDA 1WB4A 1ZD9A 3MMZA 4JODA 3H8SA 1IB0A 3ZWWA 1A77A 4I1OA 5DSTA 5J63A 1B1CA 2JGMA 3AOEA 1P9LA 3ENWA 4XX0A 4X5OA 2C58A 2D0DA 3U3KA 4B0PA 4WI1A 4H1HA 4MUJA 1POXA 2CL7X 3UGTA 4BEBA 1I10A 1PFYA 1J5XA 1KI8A 2OBLA 2CNWD 3M6LA 3PC4A 4INPA 4X9XA 4Z4FA 5DJ5A 3LXRA 3K72B 3NHYA 1SXJE 4AO6A 4BO3A 5KCMA 1GWNA 2CL6X 1IXRC 3KOMA 5ES4B 5LUBA 1NJ1A 5BSFA 1MX9A 1MX3A 1EJBA 2HXGA 4XEHA 4GE0A 4WZBA 3A9WA 1TMOA 4X95A 5ILOA 4D0NA 1TAGA 5CJ2A 2VAPA 4BLOA 2OL4A 1X7DA 3PTLA 5ALJA 1R9JA 2IZ7A 2VKQA 4QAJA 1GFZA 5BV7A 3KB2A 1YXMA 3N86A 4GPD1 3I0NA 4V0ME 4TXHA 1JB9A 1QHGA 2YINC 4ZT3A 3RBAA 4TZ6A 5FOUA 3WAJA 1HTWA 1EVLA 2BKUA 4JGGA 2PUVA 4Q6BA 1CF2O 2O2ZA 2WUGA 4FLMA 4JJIA 3TRJA 3T1TA 2EJBA 4J1TC 2JCGA 4EAAA 1WDKA 1Y6ZA 3PQEA 4QBIA 2IA5A 4BCBA 2XHEA 3OPVA 3LX8A 1NBEA 2FWNA 5CNJA 2ZLBA 4N8DA 2BV3A 5CT8A 3MBOA 5A02A 2O8EB 1Q2XA 4Q1BA 4N0QA 1S2DA 5HUQA 2IEGA 2WUWE 4WINA 1WCV1 4ZVKA 3W3AH 2O2CA 3LV8A 4ND4A 4BO2A 1IMJA 1TYCA 2RHRA 4B3CA 2QTVB 4F46A 4S1OA 2JFWA 3F46A 3MLAA 4HAVA 4XH9B 4ROSA 4E2FA 4EUHA 3LDUA 4CF7A 5AW7A 1MIOB 1XMQB 2XMRA 3IMEA 1U99A 3OTQA 5JPCA 4ZQCB 5TQ2A 4ENUA 1BQ3A 4HX5A 4KQCA 3V4FA 1XV5A 4B3FX 1QYWA 5FQNA 1E5DA 1YI1A 2VIIA 3MWDA 4UM7A 4H0FA 3GK3A 1OF1A 1EZZA 1SCNE 4WQMA 1GGNA 3A1NA 5DI3A 1UJ5A 3RHFA 4RW0A 5DO9A 3V1NA 4PQFA 1DIGA 4XOUA 1AQLA 3TXXA 3PDJA 5G4KA 2PSJA 4QQ8A 1SHUX 2Y93A 2H59A 4IMPA 5E6SB 3SQOA 2O0JA 2ERXA 1T5SA 4TV9F 1ICIA 5F2KA 2YYSA 1KNXA 1HLFA 1T9DA 2HDHA 2BGUA 4M0KA 1X19A 3TMKA 4G9BA 4ZOLB 3RIMA 5DHUA 2YY7A 1XRLA 4GR5A 5CXSA 2D7JA 4LXQA 4JI1B 3W2EA 4YT2A 1ETUA 2ZJOA 4RLQA 3ND8A 1N7HA 5KJEA 2P68A 4HDMA 1DAIA 3G8YA 3ZDRA 2GRUA 3R20A 2BFCA 4L8GA 5AWFC 4YECA 5A6VA 4JWKA 1EBUA 3KZMA 2O8VA 4TV9A 2BGNA 4XIJA 5AKGA 1EAMA 3ZCQA 3NNSA 3CGWA 3ZU6A 3K35A 2FMIA 4U9IS 1ZSNA 2GMWA 2QX4A 3AR9A 1YAHA 5G0VA 1AS0A 1JAIA 1R66A 3DFFA 4YCNA 4B3TB 4B4UA 2CF6A 3RARA 5JTTA 4RZSA 2QN9A 2ZI3A 1RKXA 3G9QA 4KNVA 1GGHA 3WK7A 3DW3X 5K5EA 2FSPA 3GPLA 4COKA 1QG0A 3EQZA 2GEKA 3RRFA 4JBWA 4N5NA 5DNYB 5I4BA 3W7BA 5CXXA 3FCXA 2Q0XA 2V7GA 2WFLB 1HMYA 4Y6RA 4UNRA 1VPTA 3TSOA 5EUCA 4TXJA 4DY6A 1C0IA 4XPIA 5COQA 1PZEA 2G07A 3FX2A 4MI9A 1Z88A 1SQGA 1FVXA 1PZXA 2H2FA 1KETA 2PH3A 3E9QA 3ME5A 4QOIA 4DBVO 1T25A 4G0PA 2Q9AA 3H5IA 2B4RO 4ZAYA 4ZAZA 5G02A 1U6IA 4BFWA 4L27A 3AIIA 5EIWA 4OJKA 5EMNA 3S70A 4ENQA 1UMDB 1GZUA 3PR3A 1XZGA 1BZYA 2CJFA 3MT9A 5D3QA 3MRSA 2KHZA 2FFBA 1AKWA 3OPQA 1U4NA 4NU8X 4OB7A 1KYQA 1GNPA 5F77A 1UPBA 5G2OA 4A5SA 1LI5A 1RJ9A 4CM4A 1L4HA 2PVCA 5CURA 4YCDA 5L7YA 4QJBA 4EZIA 1XKLA 2BONA 4BVHA 1EGHA 1M2VB 4MKIA 2VYVD 4WFIA 3JARB 1Y3DE 2YC4C 2J32A 4S24A 2ZWVA 1PQWA 4TXMA 5IC4A 4DV0B 3GVCA 5KNLA 3K53A 5CCXA 3ZDBA 1DTWB 3TLYA 1TVMA 3GJTA 3HFJA 3HJGA 5E1OA 1KWKA 4GOKA 2O2XA 3F5SA 4GXTA 4HDAA 4OQPA 3BHMA 2W70A 4D74A 7REQB 2FKNA 5FRDA 2K7FA 1CJCA 3OOEA 3NTXA 4HLDA 1KWGA 1Z5GA 3N2KA 4FIDA 4QVKA 3SZ3A 4QQKA 3H4MA 2F9MA 4INZA 5KCZA 4P38A 1U2GC 4M86A 1IZYA 4TYMA 2Z56A 5DYTA 3EXIA 4OJQA 3R7BA 3ZNQA 2G9ZA 3G17A 4BYMA 2MIIA 3QI2A 1AA9A 3ZVLA 3OPYI 1ZUD1 2AI1A 1DIOB 3LZ6A 1ADJA 2G9RA 2QVCA 3H3JA 2FTKE 2QN7A 3PEVA 1S7GA 3GLFE 2YY5A 3E8XA 3CCFA 3WG9A 1U8EA 1CLUA 4JJ4A 3TIVA 3ELYA 3KB6A 1LX7A 3AI7A 1U1GA 2QRPA 4JT9A 4F2HA 4NHEA 1K7EB 4G8JA 3G5AA 3UMJA 4KOAA 3QE0A 3VPSA 3TMAA 4MVJD 3IH5A 3OA0A 5ITZA 4NPHA 3GLTA 1LK0A 4GQIA 1WZCA 2QL7A 1RLUA 4LPKA 3VAAA 3PPXA 3PXAA 1VDZA 4LTNA 2HQSA 5K20A 3OZCA 4IV5A 2HTEA 4QX6A 3T34A 1RM3A 4L0CA 3K2BA 5B55A 1L4GA 3RJZA 4X45A 2YV5A 1NMSA 2VJCA 5JNRA 1E2BA 5EIXA 4F3CA 2P65A 1NOKA 3W2IA 3OY2A 1C0EA 3GARA 3I9FA 5LYYA 3DM9B 5TGZA 3VJLA 1G8YA 4LDJA 5LWHA 1AO0A 2Z58A 1B6SA 4KRYA 5EVJA 1Z68A 2DPGA 1YZVA 3MCTA 2V59A 1T24A 2WZCA 3HM2A 1NHGA 4PCVA 1XXHA 3EOZA 4FP9A 3U3MA 4C2AA 5AVSA 4ANFA 4EUKA 8GPBA 4AG5A 2NU9A 5JLAA 4UOEA 5CDFE 1FFCA 4ZV4A 5DTJA 4QHYA 2C8VA 1YO6A 2FWBA 2XOKD 4QG7A 1CRLA 1YKFA 4F45A 4XD7A 3W5DA 3A1VA 4WZAE 1NZJA 3H5NA 1VRVA 3O8OA 1C14A 1OX5A 1Z0AA 4TKVB 3GCDA 1FPQA 4EB3A 1FNNA 4UDYX 4OBWA 5CTJA 4BUCA 1YJQA 3AHEA 2O2HA 4YJFB 4GM1A 1S4QA 1TADA 4G5XA 1ZJ5A 2IEDA 4TV8B 3TJMA 5FJIA 1J8DA 2AFRA 4IF6A 4MDHA 1EGAA 2P40A 3CA8A 3T7AA 3DKVA 2SNIE 4X3PA 4F38A 1RXYA 4JGBA 1CY1A 1KZYC 3DFZA 4X85A 3GWZA 4BMYA 4Q48A 3RTGA 1E2HA 4ZARA 4GP7A 3KQQA 3HJBA 1DQNA 1H66A 3CLRC 4FWTA 2C2KA 4LPSA 5IM4F 1ZR4A 4GRIA 1PFWA 1MXFA 1ENYA 1PT8A 1SKQA 3INYA 1BYUA 3ZWKA 1VE5A 3CMCO 3EEOA 4ZO4A 4ZEXA 4IHJA 4TT3D 1XZAA 1BHJA 4G2NA 5BN3A 4KMRA 4DVGA 1TT5A 1M1YE 1I1OA 3JVVA 1CP2A 1OTHA 3ESAA 2YCLA 3KR2A 4H2DA 3LTEA 3TEFA 2EYQA 3FMVA 3P5SA 2YY6A 3DXFA 4O59O 3RFXA 4ND2A 4BBPA 2C0PA 3IBGA 1NQUA 3WGJA 3I2YX 3LY5A 4PVCA 5CD9A 1YACA 4F4FA 1W88A 1I1QB 3V1TC 5H4HA 2WU3A 5IM4A 1VLQA 3HKCA 4FFSA 4BNGA 2Z6VA 1OC4A 5HMMA 2M6LA 1T91A 1Y8QB 2IKQA 3EAQA 5FFMA 4MQUA 4WKGA 4Y2QA 2DQ4A 3SC2B 3RUEA 1MCZA 3AR4A 4GZ6A 4YXFA 3RUIA 5U9CA 4K6FA 3DV9A 3I9V1 2XCIA 4IGFA 5JI3E 2X4IA 1O5TA 2X58A 2I87A 1WCXA 1I2ZA 1WTAA 1ZIOA 2Q8PA 4GE3A 4JIMA 3VPXA 3ZXYA 5KNDH 5CA0B 3VR4H 2A9VA 1CIJA 1JTEA 1RXEA 2DCUA 4HFRA 4Y9DA 3ETNA 3L6EA 3W77A 2R62A 4HUJA 3W9UA 1S2GA 3GVPA 1R10A 4RL6A 3WXMA 2WG1A 5DBIA 2WVHA 1CHNA 2H8KA 2ZEJA 4QSMA 3WYDA 2RHTA 1FJGB 3OX4A 2AHRA 2E82A 3I9OA 2EG5A 3PNBA 4WXHA 1QOPB 5HW0A 4OQEA 5JASA 1JYFA 2Q46A 3LQ1A 2XEDA 1GQ2A 4GF5A 4GX1A 4BP8A 1P1IA 2Q50A 4YCLA 3LLMA 1TEXA 3H2ZA 4ZT4A 1IBMB 3VNVA 4MK4A 4FXPA 4HQKA 3H04A 3JRNA 1DRWA 3U3ZA 3U9LA 2Y0DA 5BSHA 3BD6A 3ZWDA 4WK6A 3TN7A 8OHMA 4OLJA 4A03A 1WHSA 2QTCA 4IQ0A 1UINA 3FLAA 3QWIA 2ZB4A 1JDTA 4JLDA 4QXQA 4AMVA 4L0DA 5BYKA 3BQ9A 1IC6A 1QRDA 3ZK7A 4CQMA 3JWIA 2WSBA 1M7HA 2GZMA 1ZNZA 1VGVA 1U3TA 4D8YA 3GEPA 3SJAA 1SUCA 3U4IA 3J7AC 3GZNB 5LLSA 2W9XA 5HS6A 1HF3A 3T1HB 3MJDA 3ZZTA 5DW0A 4UZEA 3O26A 4JBGA 2CVPA 2G80A 4FJ2A 4MW5A 1D1PA 4P4SA 1KSGA 2EKDA 2HRRA 1VA4A 1G0OA 2YVAA 3RABA 4A16A 4N7JA 4EJ6A 1OAAA 2B37A 2VYFA 2B5OA 1YCDA 3EFEA 3HP7A 4RA6A 5LP6F 3H5RA 2ZBFA 3GBSA 3KKMA 1COWD 4DA9A 2Q6VA 5FBVB 4MDEA 2BELA 2EBWA 3SBXA 1RWQA 4GECA 2V7WA 2WKRA 4YMLA 1EESA 2ADFA 3IELA 5T41A 1NGSA 4TYPA 1KORA 2UU9B 1FSFA 9LDBA 2KBFA 3H86A 3TQIA 2GYYA 1NP7A 2WIKA 4BB5A 4O3MA 1DKRA 2B0CA 3AFGA 4RTOA 2NUAB 4LBZA 4B1FA 1VLJA 3RROA 4Z4CA 2XV1A 4ZQHA 2RK4A 2J31A 2W8BB 2NVOA 3SSOA 4HWGA 2GAIA 2Q1SA 1EFAA 1WSDA 2H1HA 3EH2A 3KCNA 4KDFA 2FEWB 4YCBA 5LP6A 4EK9A 3LOQA 5IASA 1YF3A 2HHHB 2H1VA 4QUIA 4AKTA 5LLDA 1I3NA 1SXGA 4H3KB 2FE4A 3KUCA 3FAZA 1O97C 2NUPB 1GNRA 5KC9A 1UKAA 1DKMA 1WIWA 3EIOA 1F4PA 1YS6A 1QV7A 1YIDA 5BR4A 2WNIA 5AK3A 2CCJA 2ZANA 1I4LD 5AH0A 6GPBA 1ABBA 4Y30A 4ZI7F 1W59A 1RCFA 1DAFA 3OAAD 3D43A 3VVBA 2W83A 4F5EA 3OJLA 4AX4A 1U1IA 2R65A 4B33A 1F2DA 4BN4A 3RBZA 1RQLA 1M8PA 1TK3A 1UWCA 5B2ZA 5KTYA 3LYLA 1GV0A 1OXKB 3D81A 4JMPA 2CB0A 3M6VA 2B4YA 3A1EA 2VP2A 4FSXA 4GNKA 1ML4A 3SMVA 3UXEA 4D9GA 3C2QA 1EUCA 2NZJA 2ZPAA 2H4ZA 2YWCA 1YZGA 3QYPA 1T10A 4II2A 4XLZA 1ZH6A 4RWEA 1RLMA 1FXSA 4EI9A 2GUGA 1U8ZA 3IT1A 1CUIA 3P71T 4E1BA 4JSYA 4UHEA 4GBED 1G19A 5GINE 1HC7A 2AXQA 3LOUA 2V7TA 4XQEA 721PA 1YRBA 1P2UA 4QVGA 5NLLA 4FDMA 3GJYA 5EZYF 2DQYA 2JIZA 3LFTA 5B57C 3VYRB 4CDNA 1ZJJA 2OC9A 2V7QD 4HRAA 5FHRA 1WCYA 5LIPA 1E3JA 4MHOA 1WW8A 1R4NA 1ULSA 1WXHA 2OQRA 3NOOA 2HJGA 2WOJA 3RC8A 3KB1A 1DINA 5FLKA 4TMVA 5GM1A 3U7QA 1QJ4A 3R3WA 3S3TA 4NV3A 1GUBA 3PIDA 3I6QA 2PEYA 4KC0A 4HHEA 4F2PA 3OQVA 4DZRA 4CI0B 4TTPA 4BRSA 1J5EB 3C74A 3OKFA 3OU2A 4N6NA 4U2CA 3VHLB 2XCSB 2GCEA 4QU8A 2GHRA 4YMIA 5C1OA 5EZYA 2CF5A 2V45A 1RYDA 2WV9A 3EFHA 1ONNA 3GO4A 2QY9A 4J6FA 5EOVA 4WOPA 1R6AA 2ZXFA 3ZPXA 5JARA 1JDBB 1OJLA 3SJCA 3SM3A 4B40A 5KYUB 5DRTA 2BBTA 3VH4A 4AJHA 1XP8A 1YZQA 3OCYA 3E7FA 2GS9A 2HF8A 5HCNA 2H5EA 4J2HA 2Q1UA 3U40A 5I7OA 2WYIA 1FS5A 1C9DB 4XYGA 1JLKA 3UT5A 2XCTB 1M34B 1O9BA 2QVXX 2DC1A 3X1MA 4PSKA 5KINB 4J0FA 3PNQA 3B9QA 1ODKA 3QU7A 4H17A 1LBIA 4PXYA 5EKUA 2DGDA 3PVCA 1DVRA 2I29A 2WEKA 1WRBA 3PX2A 4R9VA 4TWIA 4Q3KA 2O6LA 4Y6PA 4FFVA 1CERA 2P5SA 5CXUA 3ZVKA 4F4CA 3QX3A 1KZ1A 4KPEC 3H2GA 1YC5A 2BC9A 2IZ6A 4IQFA 1JHQA 1SQSA 1N78A 1NMYA 3N0TA 1NVXQ 4K03A 1KZ6A 2C5GA 3KETA 3E81A 4YRFA 4FR0A 3WFZA 1T6ZA 2WVJA 3D1LA 3CRVA 2DM6A 3VVMA 4JU9A 2Y1GA 2PKQP 2YUIA 3E82A 3PXXA 1L3BA 3UK0A 1Q11A 3LVQE 3TAHA 1DB3A 2GN9A 4O2BA 4IO1A 2QJTA 3VVCA 2CBZA 2JJ2D 3AZPA 4CKCB 4JLVA 1ZMXA 1Y5RA 4PGHA 3FPBA 2HU8A 3V46A 4JITA 4ZYUA 1ZW1A 2BH2A 3SIWA 1PT5A 3OWHA 2E9SA 4L1KA 4EYEA 4F96A 4JB8A 1E3MA 1KO8A 3BQMB 1F1JA 2J3MA 3TTXA 1KAQA 2AVNA 5IVIA 3UMVA 4CNQA 4EZBA 3R8FA 3E4CA 4CETA 2O8BB 3JTMA 3OIYA 2J5BA 2OZEA 3QPVA 1Z0UA 4GICA 1UPTA 5T4FA 3QFTA 2OHJA 1A9OA 3D2CA 5IJXA 3P0RA 4G5HA 3B1KA 5JZ9A 3EMDA 1UJ4A 3V6MA 3FSJX 3HL0A 3GJRA 1LBQA 1P4GA 1E0SA 4Z0HO 4OHKA 4QECA 3I0MA 5AI6A 1G6OA 1G4HA 2PUTA 3EWNA 4AP9A 2IDMA 3L8FA 3G8AA 1DDIA 5JCJD 4XWTA 4LNUB 1JEOA 3X1YA 2DFDA 3NP9A 1JMVA 4QBKA 3U0VA 3OFVA 2C03A 2X86A 3QG1A 2H4XA 1SIBE 3ZD8A 4GOJA 1ECPA 1JIUA 1M10A 3HYTA 5AI9A 1Y6FA 4G67A 5IZ4A 2RGEA 3VPBA 4P54A 3IEIA 4MW6A 4IXDA 1SZDA 2M9MA 3DZIA 2QD5A 4ATNA 2B7CA 4Q7QA 1UBSB 4ENTA 1D2AA 3GJ4A 3GNSA 1W93A 4J29A 2F6RA 1RXVA 3ND6A 1ZN2A 3OQIA 2ZSDA 4JK3A 4ND5A 2DBZA 2QR3A 5ALZA 3Q9LA 3AL2A 4BVGA 1ZR2A 2BBSA 5DLDA 1RZVA 3CLRD 3QTTA 1IEWA 2XYPA 4IF4A 1W9HA 3AU8A 3C45A 4YP7A 1ESDA 4RAOA 3H4VA 4RE6A 3PQ7A 4UCQA 4FT2A 4JI6B 2J4DA 4DMUB 4D41A 3BXGA 2NT4A 1HFKA 1BFKA 4JR0A 3U49A 4GL4A 4F8EA 3B1JA 3PC8A 5ESRA 4AO7A 4CFZA 1FTYA 4RMGA 3ROQA 421PA 1K7FB 4DV6B 4MB0A 4W9NC 4E5SA 4Q4AB 3VDNB 1ZGAA 3FN4A 5EHQA 3KDAA 3KJEA 2COUA 4DR4B 4MV3A 4K6CA 4PHFA 1P91A 2DPMA 1Y9JA 1TA4A 4WOKA 5FPPA 4IEIA 3T5BA 2R48A 1DIHA 2XCOA 4D9MA 4JELA 1G66A 1U3UA 3INGA 4OGWA 4P4GA 4A91A 3ED5A 2ERYA 3C87A 4MGIR 4CEHB 2BJVA 4IQGA 1KBZA 2I1WA 2RAPA 5BW4A 5GIOE 1DP4A 1P2FA 1IOLA 1J8QA 2X7JA 2Q3EA 3I72A 4U9HS 4UPDA 4C0HA 5K8CA 1N3IA 4W5QA 4MPRA 2O8EA 3BPSA 1IHXA 2H0RA 5KAPA 2V7UA 3OLXA 4JT8A 1RZ3A 2BI8A 3O82A 3M6IA 5LLTA 1LRJA 3BJEA 4NBKA 1CEXA 3QP9A 2PUGA 2PJRA 4KQFA 3QITA 4YMSA 4DLTA 2QTVA 3B6EA 1V5GA 2RARA 3HK2A 2NXJA 3MRTA 3SYKA 1N9KA 1MIOA 2YHUA 4HB3A 1CNFA 4D8VA 1JEAA 1F38A 4PLCA 1Z8HA 4ZOLF 3WIEA 4AB1A 4QPDA 1KYYA 5KPDA 3ZWPA 4H0CA 1XJWA 2FVYA 4NDAA 1RKBA 2GJ4A 3IHTA 1OI2A 3MWJA 1X13A 2NO7A 3D6AA 1AOXA 4J0HA 4L85A 4QC2A 3WLAA 3HFSA 3ZDQA 4GLFA 2JIQA 3FF4A 1ZVQA 2PMCA 1EM6A 1AK9A 1B41A 4C88A 4C2TA 1NJ8A 1H3FA 3O84A 3KV3O 4OHOA 4FHZA 1RYHA 2B25A 4RVHA 2FMUA 1E2UA 3L9WA 5E6SA 5ICEA 1UC9A 3SNKA 2DR2A 4LG1A 2JD2A 3ZE7A 3SHQA 2W2KB 2NMVA 1GD1O 1H4VB 3FTFA 3DLIA 3KQNA 4NCHA 1JBQA 1N32B 5TSDA 4M0PA 4RPGA 4ZOLA 1PHPA 5DLPA 2BGGA 1M0SA 3EZYA 1SQFA 1XDBA 2PJUA 1K7XB 3NTQA 3ISTA 1L7VC 1HEYA 4GR9A 5CR9A 4ARVA 3UANA 1QZUA 2FH5B 3WLIA 5JIBA 2Z83A 1JKIA 1FX0B 2UUAB 2G06A 3C41J 3SGLA 1XRSB 1P33A 4EHKA 5L3VA 4I5IA 1YFLA 1NJ2A 4PNEA 5G3YA 1L4BA 1W73A 2OUKA 4R54A 3ZV4A 5I5EA 5J4VA 2HSJA 1SHKA 1CQIB 3JS5A 3MELA 4BLPA 5FWAA 3TQSA 4XTRA 4CG0A 1WU8A 4AX8A 7GPBA 3WWZA 1M0EA 5JYEA 3LYUA 4JX8A 3ZUGA 2P5YA 2IW1A 2NZXA 1F06A 1U3DA 1YDWA 2GK6A 4TTAA 1C1XA 2CE7A 2GLTA 3RM3A 2WFLA 4PVDA 2B61A 1ZI9A 1OHHD 1L7PA 2ZE8A 3A1UA 3LU1A 3NAQA 3C3EA 3QWAA 4RVOA 2DUMA 4KR3A 4XVQA 5CH5A 1R0XA 1U31A 2I6SA 4RK1A 5EGSA 4X24A 4PZAA 3ZUPA 1U90A 3THYB 1NVWQ 1M2EA 4MP6A 4CMKA 3G59A 5F21A 2BZ1A 1MC5A 2V54A 1PVOA 3FNBA 2RHWA 1QHHB 3HU5A 4ZOEA 4A7PA 5JYBA 3VNBA 3DTNA 4MWDA 3AXSA 3MCAA 5YASA 2G7ZA 5KPJA 3BZUA 2HY7A 1TYDE 1O97D 3BGDA 2XZTA 3CRRA 3I4CA 4HGQA 3RSHA 1PDVA 3BBPA 2J0SA 4Y9SA 4ZJUA 4CLRA 3FF1A 2X13A 3MQ2A 2J9ZB 2FPUA 2WHQA 1PI3A 3TAXA 2V7XA 2O5VA 1JAXA 1M2VA 2WINI 1YR2A 1VMIA 2VYNA 3OETA 3OWXA 1EJ0A 3JARA 3HYSA 1EK6A 4G4SO 4U6QA 3NRJA 1EMDA 3SLGA 2Q8QA 2JJ8A 3FTQA 3IQZA 3ENKA 1E2PA 1XHFA 1XTBA 1ZMOA 4DF3A 3GJ8A 1HOTA 1DTWA 2ZI9A 1Z4MA 1PUJA 1V6SA 2LVBA 2NNWB 3S1AB 4JFRA 2ISQA 2BUBA 2OTCA 1SB9A 2BDTA 1HOXA 5BYAA 2WYUA 4XWAA 1KDTA 3GL9A 2QLLA 1PK8A 1XMSA 1ACMA 3MJFA 1WF3A 4I08A 4A1OA 4BNWA 5JWOA 2TS1A 2GF9A 3CKLA 2D5LA 2VUSA 3I6IA 1EK0A 1VL6A 4OA5A 1PJLA 5AK5A 3KAJA 1JMYA 1OW3B 3H5TA 1O58A 2J59A 4GLBA 5AW3A 1E89A 1W5SA 1YVUA 4M22A 1A7UA 3J81A 2ISCA 4F4DA 4OUDB 1FDVA 1ZS9A 4B32A 4DNQA 1LZLA 3PE3A 3NVKI 1P8AA 1QP7A 3LUBA 3JU3A 4M6WB 3N0XA 2IS4A 4EVSA 1ORDA 1FDIA 1ZDMA 3D4OA 2E7ZA 3NVMB 4M46A 3KWLA 4QODA 4LJ8A 4JQCA 2IPMA 4D4GA 3LUJA 4RHYA 1EFVB 3P19A 3LDFA 4ZP1A 1FFXB 3C3BA 3ITEA 4TSFA 1DCKA 5BSTA 3NYIA 4MWZA 4WNIA 2I4NA 4IOJA 5CEEA 3DWIA 4BNDB 2X41A 4HYQA 1TUIA 3W78A 1QIEA 3DMFA 1ZL2A 2RCYA 1WHTB 2VDRB 2VJBA 3UH1A 5BUSA 3IERA 4J16C 2BMAA 2BZGA 2ODTX 3KLNA 3L01A 3GLQA 4UJ5A 3NJRA 3VO2A 3DZFA 3JQBC 3QBTA 4JEHA 2QUHA 1MHPA 4FKMA 4XUDA 4WSOA 2D0OB 3O9ZA 4YIHA 2VOEA 4EIWA 3AF2A 3BF8A 1TDJA 2CWWA 1GNLA 2CVHA 3FLBA 4LGCA 1ONBA 4TLLB 1XZ8A 4P4LA 2W58A 5KKAA 2PLNA 1YT5A 3KR0A 1YQ9A 4TV8F 5F1OA 2OFOA 1TTHA 1CUBA 4Y7DA 3K15A 2V3CC 1PQ4A 5K3FB 4WK2B 5ENVA 4AZ0A 2J4FA 4TOIA 3WWPA 3K71B 2HPZA 2A57A 5K0CA 2VSOA 3PENA 5HWSA 5AT1A 2WSYB 1V47A 1BCRA 4FNGA 4G9EA 4MLPA 4TKVA 2YXNA 3A9TA 5E2BA 2VZ8A 3HCRA 5JNLA 3WAGA 1F5NA 5HNKA 4K3UA 4YJFA 4YRJA 4P3NA 1A95A 4LSWA 4TV8A 2IXGA 5HCIA 3AM3A 3ETDA 4Y3UA 2QHXA 3ECSA 3UAVA 1AQ6A 3HKBB 3KFLA 3W3AD 1ZUIA 1AX9A 3C16C 1FY2A 2WLTA 1HTTA 3BSYA 3EQ9A 2J5QA 3AONB 2WYHA 4UMDA 3K9GA 2QLFA 3OC6A 1VIDA 3PXDA 2ZCVA 1IWPB 1XTVA 1G9SA 1UBCA 3LS2A 2GCPA 2V97A 5FO1A 4H6XA 4J94A 1R00A 4KZPA 4RLHA 2ZK7A 5F35A 4Y1GA 5CLGA 2DWUA 1H0SA 4UHCA 2EFYA 2FF5A 4BDTA 3QE3A 2GVNA 1ZC3A 2OZPA 3DMTC 3E1KA 2I7CA 5ANRB 1XVLA 1UKBA 2QM3A 4A23A 4R2XA 1M83A 1UAGA 1QUEA 5I7WA 1I01A 3CNQS 5CA0F 2H8GA 5JAHA 2FSHA 4DLPA 3WA7A 4RORA 5KEIA 4GWGA 1THTA 3BTOA 2YV3A 3HWWA 3QVLA 1AGYA 3LBAA 1QH0A 2CCKA 4XYLA 1Y8RB 3F96A 3NBAA 1NOIA 1A76A 2DWOA 1M6WA 1VCOA 2WMYA 3B5IA 2ATXA 2ZSUA 4PNPA 4EGAA 1JE0A 1H0HA 2JGEA 3PB3A 3SC2A 1JG1A 2DPXA 1FSZA 2ZTHA 3A9SA 1UKEA 3AERA 5AM4A 3SHTA 5AFSA 1OH7A 2YZKA 7AT1A 1KJYA 1OCEA 1SVIA 4DNXA 4PQRA 5JDCC 3EIXA 4MSUA 4O0LA 2UXCB 2Y67A 2Z08A 2QJOA 1II8A 5CA0A 1R5BA 2RAUA 4TS3A 3UNXA 2VOJA 1NNLA 1YH3A 3SKVA 3OLWA 3EGEA 3JYPA 5FUWA 3OCXA 4B6EA 3UC5A 3PX7A 3USCS 5JZVA 2JARA 2NU7B 1NMQA 2PX2A 2GPSA 4PZ0A 1T8SA 4O8ZA 2P7IA 1L1FA 2VRNA 1VIMA 1UIRA 1IBSA 4Z3KA 4NFYA 3OCUA 1EZ1A 3I9MA 3CSSA 5GADl 3ZDDA 4KPGA 3A1TA 2P35A 1AUQA 1PQYA 4HZGA 5L3RA 1AB5A 1LJ8A 3MTBA 1ILWA 1TGYA 5ED0A 5J5AA 3Q7QA 1ISRA 1QX4A 1P7CA 2V3WA 3DGFC 1R0SA 1YA6A 2OEPA 3ESBA 1GPH1 5EJIA 2P9YA 2VAVA 4FGJA 1TYEB 4D3SA 1L5MA 1DBQA 3C6ZA 2FK8A 3NTOA 1MT3A 4RHEA 1PT7A 1TU4A 3B2NA 4JB0A 1UPXA 4D79A 1EK1A 1D6NA 1Q20A 4M9UA 4XFKA 4Q3NA 3LZCA 4QDJA 2YBEA 4Q7MB 4DM7A 1IN4A 4ON9A 3QA9A 1U2DC 2Q3LA 1LWOA 4ZAWA 2JL1A 2QLJA 2XX3A 1O7JA 3R5JA 3PPIA 1RFLA 4IINA 1NM5A 3OE7D 1C3JA 5TNXA 3GZNA 8AT1A 1UR5A 4N3GA 5U4XA 5A4KA 3SYLA 1Z6ZA 5A06A 4TLMB 2G88A 1LS6A 2Z30A 3V7UA 1W9MA 3TVYA 3M1LA 4C06A 4GOXA 5JNVA 2AEJA 2BR3A 1RWVA 3ETEA 1ZLYA 4XXHA 2XJ9A 3NTUA 4P2BA 2HXSA 4OFZA 4M7RA 3HHPA 3P9RA 1C30B 4EO7A 1Y1SA 3TTUA 3E84A 4RXUA 3C3AA 4XVRA 1NSFA 1FDSA 4QU9A 3HJNA 2CHGA 3SX2A 4OSPA 4EGJA 4ZK6A 4KIFA 5K6AC 2B98A 4DMKA 4IVPA 4OXQA 3TQRA 1VXRA 3SLRA 3TRFA 1ZJ6A 2O1XA 4R8RA 1RIIA 3M8KA 3G2QA 4G0YA 2NUAA 2AKYA 2X76A 1V2HE 4OYLA 5KSPA 3FKQA 2PBFA 4UBJA 4B46A 1OFHA 5HJ7A 1AQNA 1QZ3A 1LU9A 3OPXA 3CEHA 4HVTA 2R6DA 1JKFA 1NA5A 3QKRB 4D9BA 3OHPA 4NXNB 1UZNA 5BR8B 3B6JA 4HF7A 1GFIA 1SG9A 3FB1A 1HFWA 4X1KA 4B7ZA 2ZGVA 3QHAA 3OQJA 2R6HA 4EBBA 4F12A 2ZWAA 3BGWA 1ITZA 2NUPA 3FMGA 3D1VA 4UM9D 5KHAA 2PX0A 4M87A 3GJZA 4M9CA 4Q39A 3RR2A 2AWOA 3HKEB 3F6SA 4EG6A 5T7BA 2IXAA 5CT6A 2HZBA 3PUVA 3FE2A 4AUMA 2J67A 1XU7A 2VXBA 4H18A 1ZX1A 4J3FA 2FRDC 3ZLUA 3DBOB 5IBPA 1ZGJA 5C8ZA 2O8NA 1GSIA 1MXHA 4RHCA 5J3JA 4A92A 1FMFA 2FFAA 2OLEA 5F51A 1DFIA 4OM7A 3ZX5A 4ZIRB 2R8ZA 1NF2A 1EVYA 1K4MA 2C00A 2XCUA 2DFNA 2ZRCA 1HE5A 1K8XB 1Z7WA 2HV9A 1WOYA 3IP7A 1SU7A 2GJ9A 4OGLA 5AKHA 3WJ1A 3OFJA 5TRTA 2Q3MA 3FJ1A 4BB0A 2CXOA 3KWFA 4CF5A 1GNVA 1M2HA 4RPJA 3VR2A 2VQ3A 4L2IB 2IIPA 1E58A 2B8NA 5KKCA 2P2NA 2DAPA 1S8AA 2L69A 3B70A 1WBJB 4BO7A 1A7JA 2E37A 4GVLA 2XWBF 1KMCA 1ANKA 4Z9XA 3AW9A 4DN6A 4B6QA 1P1KA 2C97A 3KCQA 2WHPA 3SBDA 1Z5PA 3H97A 3USZA 4TSRA 3H9EO 2XGGA 3AG5A 4ZDIA 2WTUA 4ERNA 5DYWA 2AYZA 2JGRA 5AO9A 3E9RA 3VUEA 3F5FA 4B8YA 1NZDA 5CLIA 5ILQA 3QUSA 3PHHA 2HADA 1E6EA 4HQ0A 3RWBA 2ZI6A 3HO8A 3JZDA 4JJAA 4RVFA 1E7YA 4UNIA 3VC2A 3EPPA 3GFFA 1EP3B 4YO7A 1GUYA 1NC1A 2JHCA 4DQLA 2X14A 2N9UA 5JS7A 4QEZA 4UHHA 3NALA 2AX4A 4B6PA 2EW2A 4EVIA 3ORYA 1RBZA 5E8JA 2O3SA 3I6ZA 1QOQB 4YFVA 2R8EA 3OC0A 1JG6A 4C05A 1M34A 3TLAA 1VHWA 3O4FA 4QUBA 1WMAA 3X43A 2VDOB 1WULS 2XB8A 3GRRA 2G9VA 3R40A 2WWWA 1IYZA 4KQ9A 4P84A 5AYVA 1K0UA 2NTNA 1T2VA 3CR8A 3EQ8A 4YIKA 4F56A 1DELA 3D5EA 1HUQA 4MS4A 3UTDA 4BQRA 3FETA 4FX5A 3N8GA 3G13A 1R8YA 4EEZA 1PQUA 3DOEA 1Q0HA 3Q72A 3V1LA 3W6ZA 1OI7A 5JSFA 1F14A 2JATA 3QFFA 1E62A 2HIGA 2HKIA 1GZDA 1I6LA 3G2PA 3RU3A 3F7TA 4LDQA 2RGCA 3W8DA 1E66A 2OGWA 3KQVA 4FGKA 4MP8A 4Q1CA 4TMFA 3CW8X 2W2XA 2JLRA 4MYDA 4Q5IA 2ZDQA 4CN8A 3FW1A 1RWKA 2QRKA 2P0YA 3QENA 5ARDA 1OFVA 5B1EA 1PAUA 2A30A 2WP8J 4Q9AA 4C6HA 2A78A 4HDCA 1U0FA 4TLBA 4TM8A 3RK1A 4DLXA 1QGUB 2ILTA 2EBUA 4KXXA 3NTRA 1QUFA 2OSVA 4S3MA 4CUKA 3FZYA 4CKCA 2ET6A 4DJTA 2QP4A 1DAHA 2FMTA 4DNOA 5JE8A 4RDIA 1NVBA 2CHEA 2KWIA 5CH8A 5B1HA 4FMBB 4GWKA 4HFNA 3MINB 4IPTA 1XKXA 4DT1B 3LBFA 3ZN2A 3PDWA 2HQ1A 1VSVA 4QUGA 3WO1A 3OECA 3G3EA 3LUFA 4AROA 2W22A 1CDEA 4HFJA 1C0KA 2C5FA 4QASA 4EW3A 5F9HA 1BW9B 2GBCA 3IULA 3B3GA 2K6GA 3LGXA 4BRWA 1W2WB 1YQDA 4HX9A 2R7LA 3DPSA 1KVTA 3EH1A 4CL0A 5L4NA 3MJSA 4X65B 1EDDA 2OFPA 3EVFA 1P2VA 5TEVA 1ZGZA 2VF2A 3C98A 3ZV3A 1KIMA 3B1YA 3CVXA 1JRLA 4LNUA 3AF5A 5HBGA 3IHWA 3TI9A 3BB3A 4OUKX 2YJ6A 3MUOA 1G55A 1HDCA 1YL6A 3STHA 4EM6A 3C6YA 4FHDA 3U4MA 3IILA 4G8CA 2ECOA 3E48A 3S2UA 2VEOA 3VO9A 3PLNA 1B76A 5TGTA 4HBZA 3PGVA 4HWSA 1N7JA 2X9GA 3K8ZA 5K0FA 4HRVA 3JQAD 3L1UA 4HADA 1N6LA 3QXSA 1I3LA 3G79A 4HUQB 2HR1A 3TSZA 2ZSHA 1X14A 3TECE 1G3IA 4LISA 4N49A 4V0RA 3L04A 2VH5R 5LB4A 4GZLA 4C7KA 1A9YA 4OU5A 1GA1A 2I55A 5IEJA 5INTA 4WZZA 4HVLA 3OOWA 1CWUA 3T7JA 2BGIA 5L51A 2KB0A 1V1MB 3LRXA 1N36B 3ZZUA 3JSXA 3OEYA 1WY7A 4D82A 2H1SA 5KOHA 2ZJ7A 4URZR 3UXYA 2AJDA 2HAEA 2I33A 3BMOB 1T6XA 1Z2PX 2I4OA 3WIUA 4EMBA 3ZDZB 4PPNA 4IKEA 2JHFA 2JHAA 3AFHA 4RZIA 3BE8A 5D5PA 3ZWVA 3I53A 4MS1A 1F2UB 3QLEA 4Q4AA 2A9KA 4EB0A 4LOHA 2IUUA 3ZBQA 2XQIA 2C83A 1L4EA 3H83A 3FPJA 3JWPA 2XOXA 5FLXA 4ROTA 1J2TA 2VF4X 1M7GA 2WSIA 3HNOA 5L95A 2FWIA 2JIOA 2ZREA 1CHDA 1XT6A 4BL5A 1PS0A 3O94A 4M9XA 1P1BA 3Q6NA 4W1PA 4YLGA 1XVUA 4ZQEA 1E79A 4A0HA 4I1YA 1G1MA 3HU2A 1JHMA 2JANA 4J1SA 4LXIA 4B75A 5C8DA 2C8JA 1A2BA 4AWBA 3E0QA 1EUZA 2H17A 3E8SA 4W82A 1DAEA 4GRDA 4IS2A 4E08A 5KNDD 4U7JA 4ZVSA 1KDPA 2BEWB 4MAFA 2GXAA 2JZOA 4MULA 1Q12A 3HJUA 1FZTA 2A9FA 1TLFA 3A1SA 4M8SA 2X22A 1QX3A 2HIHA 4HNQA 2XUFA 3ZGVA 3IR5A 4ENRA 3KT0A 1EJ2A 5ISMA 4PY2A 1JBEA 3BJIC 4XM1A 2YYYA 2CEKA 3HVHA 1UM8A 5LP6C 5I7RA 1FPMA 3AFNA 1H4QA 2OO5A 1FRQA 4OQXA 2PHZA 3ZJTA 3F73A 3GT0A 1JXOA 1PWXA 4KVZA 4IJWA 2BMDA 1V45E 1N9ZA 2V7PA 4CRWB 2K4MA 2PD6A 4YO8A 4O1IA 2CVQA 5ADWA 1RHMA 4TTVA 1U65A 5IRCD 4P6VF 4RZXA 2AV6A 3U4QB 4D3XA 2P9BA 3E35A 1BDHA 1BU5A 4C7VA 1GPYA 1B0AA 1J8FA 5MDHA 2JLYA 5HP4A 1FX0A 2ZTLA 4O4JB 4OG2A 1PLLA 4QNRA 5BQOA 3GEIA 4L78A 1J24A 2NN3C 2C9DA 4WOBA 2EIXA 5HIMA 5LMCA 1BVHA 3T6KA 3FNEA 4FB4A 5PNTA 4PYKA 3O74A 1T0JB 2VSQA 1PGNA 3R5TA 4QYWA 4AN0A 2WWGA 1YR3A 2QJWA 3R7DA 3FI0A 1YB7A 1EM8B 1S7CA 2NVUB 3AI1A 5BR1A 2NVWA 1LDNA 3JZFA 3BXFA 3DUWA 4NZPA 3KQOA 1R0ZA 2VTEA 3JQDA 1ZL0A 2HSGA 1U7HA 4YONB 4U39A 5FLYA 5KVCA 1RZRD 3GLSA 1TKRA 2HF2A 4JQOA 2OT3B 1RRKA 2XWSA 5SY6A 2OILA 2G0AA 3Q5EA 1U6JA 2G9NA 4UQLA 5I45A 3W7AA 3LLCA 2QE6A 3THYA 5KTSA 4N5HX 3FRIA 2GBLA 3L41A 1IULA 1QHHA 3LT1A 3KD2A 1JN0A 4TWAA 2OO3A 4JLAA 4RKQA 1MH1A 3AINA 1ACLA 4OQMA 1N25A 4GLJA 4EY4A 2Z3ZA 2X0EA 3GLGE 3ZR4B 4BV3A 3LQRA 1EFPB 2CFSA 4NONA 3FJOA 1KL7A 3V4VB 2YFKA 2GEVA 2HUPA 2CV1A 2VTVA 4KK4A 3PPVA 4OQNA 1EE1A 3GGOA 4J1QA 1MVOA 3T0GA 3RYFA 3T7IA 3W5VA 4OBEA 1YJBA 1TAQA 4PX5A 4ERXA 1Y6QA 2OGUA 2RI6A 4XGQA 4JLNA 5A4IS 1ADCA 3AVQA 4LY0A 2B4TO 1I4WA 3DNPA 3JQ9A 4O2AB 4YHBA 1JU9A 3EG5A 3IP9A 5BNIA 1W0KA 4BAUA 5ADUS 4UDNA 5DIFA 4C4SA 2H1LA 4GEGA 2OZLB 2WNSA 3LSYA 4WXEA 3S1AA 2XUOA 4KCGA 2X0KA 4N5DA 3OT5A 1XQYA 4IFBA 4FDUA 4Q4LA 3F47A 3K1AB 1Z6TA 3CEPB 4KQJA 4UUAA 2BOVA 9MHTA 2VZ0A 3D2AA 1JSCA 4F11A 2FMKA 4YALA 1C29B 1NFRA 2EZ8A 4WN3A 1VPWA 1SD1A 3MERA 4DG8A 4X84A 3IKMB 4W6QA 1EXWA 3LUKA 4WGGA 1P75A 1J8VA 5TMBA 5LOVB 1ID1A 4B5LA 4S05A 1Q7RA 1Y34E 3HCEA 4W1SA 2CVOA 1W0JA 3UKOA 4CG1A 4XRGA 4KWIA 4IZIA 3LHFA 5FHQA 5D5HA 1M73E 4MQMA 4OUDA 3NC4A 2FPSA 2PR2A 4B34A 1J97A 1G42A 4L9WA 4LWQA 3AEUB 3OQMA 5DN9A 3EXHC 4RY8A 3U1VA 4DADA 4JBIA 4M6WA 3KOYA 3HZHA 4N0PA 1FNSA 4BEJA 3H6GA 3QFCA 2H31A 2PMWB 3N1UA 1NONA 5GM2A 3MTEA 3MSCA 4FHEA 2AN5A 1PR2A 4BBJA 2ZVPX 4DC0A 1DU4A 3DE4X 1EFVA 4UE6A 1SU6A 3GJ7A 1X1QA 1FFXA 5DTIA 4NYMQ 3RUDA 2R8YA 5JJLA 2YFQA 4K9LA 1W4AA 4XR9A 3U13A 3ZHZA 2XB6A 1Q19A 2EBHX 2XLCA 3NOVA 4R6WA 3N39C 3S8YA 1QP4A 3K0CA 1WHTA 4X3CA 4E3ZA 2YASA 1KKMA 3WO0A 4BFCA 3NWOA 5CG1A 2O8DA 1UJCA 1JXMA 4OF4A 2Q07A 4JV5B 3A2NA 4IGAA 1I6WA 1OLSB 3P2IA 2XVAA 3LQYA 3FLMA 3WKAA 5FI5A 4WLUA 3ZOKA 3ZDFA 3P9XA 3K70C 2EF0A 1G8HA 3B2QA 2WWIA 2XUKA 1R15A 3DEJA 5F23A 1T0BA 3OU6A 4OREX 3SHOA 4JR2A 3AJ9A 1ISSA 1QIJA 2Z9BA 5IP5A 3MMSA 1I6MA 5JCPA 1D2GA 4MR9B 4B09A 2RFLA 3O2SB 4DYDA 1M0WA 4TUYB 4BAZA 1NN1A 2DBVO 2MINB 3NRCA 1JR3E 1O9GA 2JKVA 2ZB2A 3W8EA 2XMQA 1Y7TA 1OBVA 5CM9C 2D7DA 1U8FO 4TT8A 2B2XA 2QTZA 3GP8A 1RS0A 2ONYA 5I7FA 1VKNA 4DAOA 5T57A 2PKWA 3SDBA 2FLKA 3HKBA 2RKWA 3OUUA 1JQDA 4ALJA 4UASA 1FJXA 2B1JA 1GR0A 3H99A 2XMBA 5HOQA 2WD9A 3QK7A 1D5WA 2I6XA 1RCUA 1FFAA 1IHPA 1RAGA 1C3VA 1KPHA 4UNPA 3S6JA 5AQEA 3O1IC 3P9KA 2C96A 2QYOA 3C8HA 4ESOA 1O3YA 5GAJA 3IB6A 1DIRA 4OKSA 3ROXA 3BM5A 2ODEA 3NM4A 4NMLA 5DOVA 3A11A 3ANMA 3GR6A 4BNFA 4C4TA 5K01A 2BMEA 2E6KA 4LY6A 3NHAA 1V1JA 4TYYA 2Y1OA 1LPMA 3W3ZB 2VNJA 4JDPA 2VXCA 2CNKA 4IS3A 3B9PA 3BA6A 1BEUB 1G291 3PWSA 1DKPA 3OM0A 4PSCA 4ZKEA 4EA6A 1WXDA 2IYRA 4WX2B 3SZOA 3UT0A 5EA2A 1RMQA 5ECGC 1AZWA 1BDBA 1VP9A 1G21B 3RUCA 2PU5A 3RYHB 1Y8RA 1K5GA 1D5CA 1N0UA 2WTBA 3GCXA 3OURA 3P4XA 3P0HA 4CU2A 5ALVA 5HKKA 3I3OA 3VR6A 5ELXA 1HLGA 5CDSA 2QJFA 4YRRA 3OJ0A 1H1LB 3VR0A 4HJRA 4LRTB 1NURA 2PXAA 4RSRA 4DDWA 4JYZA 1D4AA 4M8NE 3W7VA 3ZDCA 2XHZA 4OHXA 1P39A 3EIWA 4URHA 1CR6A 4F84A 1B8PA 1KEEB 4TVBA 2LNDA 2Z2KA 3BRQA 3MS2A 4WY5A 4R01A 5F33A 4QFDA 3RC2A 3VMFA 4YAKA 4ZKDA 3AVYA 2PZJA 4MS3B 1WOMA 2X1MA 2A6PA 3K1JA 3KRTA 4IAOA 1OH8A 4DMMA 5JSZB 5ECWA 2AQIA 2CY0A 3GP5A 3R9IA 2NU7A 4BTEA 5IWAB 2OCPA 1B6TA 3FDFA 3X1XA 1D8TA 3SZRA 2OK7A 1C0PA 4L5YA 2PK3A 3GAMA 3GELA 4UTVA 3DOCA 2GWRA 3IA2A 2XADA 3X44A 3N5KA 4J7UA 1U7UA 3MAGA 3KQHA 1DPGA 2LPMA 5ALRA 2I2DA 3VR5A 5K51A 2XA2A 1DMSA 4CMGA 4A0RA 2XNKA 1M6EX 3IYLW 2W8ZA 4IWNA 3PLAE 4HX2A 2LTAA 2VBIA 1M72A 4OYHA 1Z0ZA 4A2PA 1U4OA 2VEDA 1PIWA 3FYUB 3H4TA 3RC9A 3ZX4A 4ID9A 2HHAA 2BR5A 3BFPA 3L8ZA 2EFCB 2C9BA 4JYMA 5L53A 2V74B 4KUEA 1FIUA 1BQ4A 3FD8A 1G6KA 4GQBA 3BDIA 2JKYA 3BHNA 3C4QA 2Z2JA 1F8YA 3JRXA 5E6UB 4HGYA 2FSGA 2PKYX 1R6TA 4D9JA 3IEKA 1NSTA 2QS9A 4YRTA 3GLHB 2BSXA 4L0QA 2BHLA 4PSAA 1ZCBA 2R68A 4QD3A 2I62A 3O38A 3WA6A 4E5KA 4IIBA 1KERA 2RJNA 4GG1A 1FFHA 1UXGA 2CXXA 3BFXA 2ZUBA 5DI9A 3OJOA 1CW2B 3WGUA 4BASA 5TE9A 4J0KA 1PNQA 2DPYA 1C30A 1ECBA 4TMTA 1HQCA 1AH2A 1LW6E 1NR1A 2F1KA 3H05A 4OK3A 5KJFA 2V0GA 4YDRA 1D9ZA 1JDNA 4EQZA 5HPYB 3VPGA 4MTLA 1Z7GA 3I4LA 3LP5A 3TRKA 3CF4G 1AMNA 1A9ZA 4I6EA 4IOKA 1CT9A 1JHUA 1TFRA 3I8SA 1J1UA 1PL0A 6PFKA 2YMQA 1SUIA 2FDXA 4LJYA 4PC1A 3THOA 1AF4A 3QXHA 3EDCA 4ZEWA 3EPRA 4G86A 5JCXA 1OQAA 3QKRA 3H5AA 5F64A 5IN5A 2XNCA 3CRW1 3GNQA 3EVEA 2GAOA 3E0XA 4KGXA 4QTXA 4Q7JB 3B8HA 4C6SA 3RVQA 3OZRA 3RIHA 1LI4A 4BVFA 4QJ4A 5K8UA 3PD1A 2IEBA 3H1AA 5E9JA 2CLEB 2QMEA 2ZU0C 4QOFA 2FFQA 1E6LA 5JY1A 1P6UA 2BEKA 3K6SA 4OQQA 1KE2A 1JR4A 3V1YA 2NO4A 1MDBA 3GRFA 3HKEA 1N1MA 2PANA 4EYKA 5DIZA 2HNAA 4GS5A 2XXJA 1WM1A 1CJSA 1GY8A 2A88A 2AD5A 2P9CA 3L05A 2P77A 3BE6A 2FZKA 3MAAC 4I99A 2F8TA 4WLOA 4G9GA 1DUSA 4QNMA 3OIWA 1QKIA 5E4YA 4ZZIA 1NW6A 2YWDA 1IN7A 3MW8A 4YJ2B 3QBVA 4Y6GB 4CMEC 5JS8A 4ZIRA 3QPWA 3HVUA 1A97A 4LYDA 3TXYA 4AUNA 1T2NA 5IJWA 1BN6A 4TYWA 1A8UA 2C9YA 3UEOA 2JG3A 1WMFA 3TYXA 3U61B 2O1WA 2YDXA 3SQNA 2GASA 2WPDA 4G65A 4G23A 3DZKA 3N58A 4AY5A 4O25A 1FE8A 1W19A 1F2TA 1ZRMA 4TTTS 3L40A 1HBJA 3QGMA 2GFHA 2HK7A 4IUCS 3WRXC 1PD1A 1V4VA 1W36C 2OM6A 3ISJA 4RIIA 2P9FA 3IOYA 1A5ZA 4BLUA 3ZDXB 4G4JA 5BW8A 2Q5JA 4NESA 4Q6WA 3PWZA 5IU6A 1ZK1A 2B1IA 2YVQA 4I8IA 4ECAA 1B00A 4B9EA 2FX5A 3PU6A 2XSZD 2FQYA 2JI4A 5ALIA 5JMTA 4F2WA 1DX4A 2G70A 3PC2A 3ER8A 4IOLA 3KKEA 5C7YA 1GNSA 1MOSA 3PRJA 4M98A 3TPCA 1DWOA 3ET5A 3STTA 2FWMX 3AP2A 3CBQA 3P45A 3TK1A 3O4RA 5IULC 2XDAA 1F8FA 2ZQYA 4IG9A 4NABA 2UZ4A 4J3JA 1K9SA 3L4EA 1KI1A 3ES9A 4PS0A 4AG3A 1DQZA 4GI5A 1CVRA 1QTIA 2JFQA 3DAGA 3OJXA 5ALOA 4WBXC 5HCUA 1ZOOA 2I3AA 1GKIA 3M9LA 5D3KA 4PEVA 1GPWB 4MROA 5JRZA 4DUYB 1D0VA 2SECE 4FUTA 1SBNE 1UPUA 1FOEB 5H1YA 4KR6A 2W2TA 6NULA 4OLBA 1GGVA 3QVKA 2P6UA 4Q3AA 4NOJA 4RMNA 5DASA 4ENPA 4NENB 1XFAA 4PPQA 1FK8A 2Z5GA 1KEVA 4S1NA 1U5CA 2SKDA 2DTXA 4XWKA 2ZZKA 4J8PA 1NY6A 5JH7F 2JIPA 3DD1A 1P80A 5LB2A 1QC5B 2AFIE 4EDFA 2BFDA 5DGXA 1EEHA 1RLIA 1VMDA 3ZY3A 1HE1C 3DE0X 2QXTA 3ECAA 2HMVA 1AK1A 5EPEA 4ZDKA 1CETA 3VKHA 1PLJA 1T8PA 4PGFA 2JK0A 3WR5A 1X1DA 3KNZA 1EFHA 1YS2X 3JAWB 4RMHA 5LQKA 4UATA 1E9RA 4P0QB 4WHMA 1U2PA 3B38A 4RPCA 3OIUA 4I4TB 4BO5A 4S04A 1FQKA 3AQIA 5J4HA 4OJNA 3U7IA 4PPFA 4MYTA 3S81A 5TPWB 5BT8A 2Q29A 2ZULA 3W1WA 1KVSA 4QLBA 1BDJA 3G2KA 4AO8A 4G8BA 5JH7A 2UYCA 2WU4A 4K46A 1R9NA 4F9GA 3REGA 4Q9DA 3W5IA 1UMBB 1LVUA 1SCIA 2P27A 4E12A 1XVIA 3MINA 4NECA 1T2UA 1G98A 3PQ3A 3K70D 4BWFB 2LGJA 1VBMA 1XD9A 1C1YA 2ZW9A 4HMQA 2VC2B 4NPAA 4BZWA 1U9JA 2PMKA 1BW9A 1PT9A 3UOGA 2XCQA 4KO4S 4FW8A 4KQXA 4DLAA 3DNFA 3TMYA 3AGPA 2B5WA 3KBOA 5CGZA 4ZCIA 2PKXA 1E0DA 3BD8A 3Q8WA 1T9ZA 2MSKA 3OO1A 2IV2X 1TK2A 3ANLA 1YVEI 2C92A 4PBTA 1TA9A 2J3HA 4D3FA 1OWPA 1HORA 2ZSAA 4KW7A 1EA7A 5JUWA 2VT3A 4EMSA 2I6QA 2ZDGA 3LQKA 1N5JA 2YOFA 2OGTA 3M5WA 1W4RA 3IAUA 3PJEA 2X23A 4Q01A 4U5QA 4YYZA 5J4YA 4HAYA 5AI0A 4OHPA 4YRPA 3VZSA 4W9MC 2LKDA 1KQOA 4ZZ0A 4HUQA 1HM5A 3OZAA 3TCNA 1BMQA 4E33A 1LV7A 1HETA 3HI4A 1KIFA 1MN6A 3D4LA 3OQ1A 4MUAA 5DLYA 4CE6A 1XTJA 1D2EA 3EA5A 2HZ7A 1XJ0A 2IYYA 2Z43A 2WJ3A 2C4NA 3RGGA 3MT7A 5EUQB 3V34A 1V1MA 3LRTA 4IDFA 3F3SA 1CVIA 3S1LA 3NUQA 1QBGA 2BE7A 1JTVA 1PR6A 4DJ5X 4K6OA 4YI3A 3TSWA 2PUDA 3IUJA 2JLWA 2VXYA 5E6RB 1YK1A 2TMKA 1T15A 3RVJA 3OJFA 1S8OA 1PBTA 1VYVA 2MYUA 3BMOA 4LUCA 5CYOA 4V02A 3T3HA 1CULC 4RABA 1QYXA 5DT2A 1SK8A 1TEZA 5DP2A 1JB1A 1UDRA 1ZIPA 1HA3A 5JAZA 4P7BA 4FE7A 1F2UA 5FFFA 3UENA 1E3LA 2YJ3A 3KTFA 2P11A 4RZQA 3ZY2A 3U4DA 2OP0A 5C46F 1O9HA 5K6TA 4RTKA 2UXBB 3WGIA 1ZVKA 4L16A 4MARA 4EUNA 2OCLA 1VE9A 1I3OA 3E2MA 2H63A 3GUVA 4DKXA 4CPDA 3LWDA 5HIJA 1X39A 4UHDA 2ENWA 3K0SA 4U9UA 3BAZA 1CFZA 1JV2B 1OLUB 1RMYA 3O7WA 4OHVA 5CW1A 2ZBDA 2AZDA 2VUIB 3PL1A 3EUFA 1E4YA 2NTVA 1FCJA 1P1RA 2I6TA 1U0EA 2FEPA 2JDIA 1S3IA 2Y2UA 3L0ZA 3OJCA 4DS3A 1M6VB 4R3WA 1PX2A 1RLOA 2VDVE 5ICMA 1P45A 2N0SA 4PSVA 5FOWA 4BV8A 4EKDA 5CXQA 5HS4A 5JBIA 4AKHA 1OIXA 1P74A 1SCBA 3W2TA 1U98A 2D1SA 2EJTA 4QGGA 5BNZA 3GUYA 2HYDA 4OQ4A 1L6RA 1TO1E 3GAFA 3BEDA 3HJHA 5CLFA 1IDN1 5JLJA 3I5XA 2V6BA 1OZHA 3S29A 1I1HA 2C54A 3VSBA 2RH4A 1BVYF 4Q37A 1NYLA 3NHKA 4PS1A 4AJ2A 4OX9B 1H9CA 1NFFA 2D74A 2VPWA 3KE9A 2UZ1B 1D04A 1XMXA 2XEXA 4DDTA 1UJMA 4NZOA 2AEEA 3RDPA 3BCRA 3GGJA 1L4LA 1E1QA 1KMHA 1J56A 4O4JF 3IIEA 3VR6H 3UMGA 3RYFB 4QNNA 3DDCA 1XD2B 5C8XA 1Q92A 2A9RA 1OYYA 4HV4A 4LFBB 1I6KA 3JCZA 3TGWA 4RF2A 5A03A 2ID7A 1ZSYA 4H7DA 2PZ8A 2Z3WA 4CI9A 2PUBA 4UHBA 1OGYA 5H4GA 4TYNA 1HKHA 2HA2A 3GYGA 3U4QA 1BIFA 3ZH9B 1B8NA 4ZU3A 5EESA 2AG8A 3CPJB 4DWVA 3FSRA 1B4DA 1VPEA 4G8DA 1ADBA 1LPAB 2D2FA 5D6OA 4O4JA 4PNHA 4YCJA 1B3BA 4KRGA 4PGMA 2VWPA 2ZB8A 4ND7A 5EEGA 5HUHA 1Y9EA 3UAZA 4QUAA 2J46A 3ONVA 4WOCA 1NW4A 1DXQA 2Q7OE 4C0KA 2R7KA 3ZCRA 3AYXB 3VR5H 1YBFA 2R87A 2VCYA 2W4IA 4Y6SA 3AV0B 3T9AA 1CQJB 1EM8A 3WMFA 1RYBA 4A2QA 2NVUA 4JENA 5IANA 3ZVMA 4PZ9A 3TZHA 2XQVA 3U26A 1M74A 1J33A 3QVGB 1XCJA 1ZOSA 3O3OB 4XX1A 5JFGA 4AMZA 3CX8A 3SZUA 4PZDA 4BO8A 4DEYA 1MB9A 1WUKS 1P31A 2VPXA 3IMCA 3R09A 4G41A 4WXRA 2JLQA 4CTKA 2BSQA 4IJUA 1RPTA 2XXBA 1LLQA 3NOXA 2PNFA 4O2AF 1HYQA 4HN4B 5AI4A 2VJNA 1D1QA 1UZLA 5JD3A 3NJ4A 3V7YA 4OK6A 1JILA 1GPKA 3GGGA 3HEMA 3QXJA 3RS5A 1SD2A 1A2KC 1ZNXA 2ZBUA 3EF3A 2HMAA 3OCVA 1EFPA 2IKSA 3WNBA 5B7PA 3BMXA 1Q0RA 2ZRPA 2Q1YA 3EVCA 1D7AA 4FWBA 1KJ9A 4KG7A 1RE1A 3ZDEA 2EERA 1U8CB 4A6XA 4H08A 4DQKA 1E6KA 1KZ9A 1DFHA 1LBHA 1YZTA 3A05A 2WG2A 3F49S 4KLCA 4DRYA 4E4TA 5B1YA 5LOVF 5GONF 4AKIA 2Y1XA 2I8LA 4RVSA 4XEUA 1QHXA 3EDOA 3SMQA 2V4MA 5CVJA 2QXYA 1MH9A 4O2AA 1ZI8A 2L42A 4ZZ1A 1QRUA 4F60A 4C7MA 4GC9A 3LD9A 2OZLA 3HDVA 2ODPA 1H05A 2LV8A 4A73A 5CVCA 4NARA 1V9CA 3ZWNA 1DQSA 5KTMA 1N8TA 2ZRGA 1P9WA 1KAMA 2YWGA 2LDBA 3K1AA 4NIMA 4RIHA 3RG8A 4IXNA 4Z4QA 2BP7B 1Z15A 4BMVA 3LVFO 5IJ0A 1HURA 1U28C 4MI6A 1Z6AA 3TEJA 1H8ED 1WMEA 3LPNA 3EGCA 3BJMA 3GV0A 5LOVA 2NP6A 3I52A 1G7RA 2IK8A 3DBIA 5GONA 4H4DA 3ZWQA 4CMHA 3EXG2 4NNJA 2BKLA 3EVAA 2F64A 1W36D 2WTEA 5FUBA 2VQEB 1H5NA 5K2MA 2VJMB 1WBBA 1Z29A 2QIPA 1JBKA 1I7LA 3C3KA 4LJLA 3RVRA 1M2FA 3ROFA 3ZGOA 1BMDA 2QAIA 4CIDA 3AEUA 5CJPA 1AXEA 4JB2A 1YZNA 3G9XA 1TPZA 2HI0A 4WAUA 1ZVVA 1YB2A 3RAEC 1CB7A 3CZMA 3DT8A 4CCSA 5CFRA 4ZI3A 1A7KA 3V8EA 4IGIA 2L17A 2A1IA 1HE4A 1W2GA 4PFKA 2A4KA 4C9BA 3LUDA 1J22A 4DLZA 1FF9A 3A3KA 3FWYA 3MUNA 5CDGA 821PA 4UBLA 4FE3A 3IUNA 5TEWA 1C1DB 2C2WA 1Z8NA 5DT9A 2C94A 2R1VB 4EO4A 1XYGA 5I7EA 1GPJA 4QATA 5AM0A 5EQDA 4GLLA 5LQRA 3AIKA 3UWMA 4TLEA 3QX7A 3TDNA 1PW5A 4B3XA 3NH6A 2HO5A 1XRJA 3B2EA 4J7AA 4TUYF 2WPNA 5AVXA 3BB4A 1OLSA 1CZLA 1T2CA 1TL7C 3JQRA 3VKFA 1T0UA 4EPWA 1HGXA 3NZEA 3W5JA 4Z3OA 3GGCA 2CNBA 2CXRA 4P53A 5KTNA 1SK9A 2IU6A 3W5SA 3TH5A 5DGCA 1T9HA 3NGLA 4RH3A 4PGGA 1O94C 1ECFA 4GXNA 4BRUA 4X90A 4NI5A 3OBBA 3RKRA 4ZVLA 4MR9A 1XTSA 3UKDA 3NBZC 3W6UA 5KVVA 2E4WA 1QG2A 3WC4A 3AUKA 5LDDC 3V1UA 4PG7A 1KP2A 1GU7A 2V8OA 1AKRA 2MINA 3AKYA 2E4UA 3BGIA 3R6DA 4TUYA 1M1ZA 3ZNOA 1TYZA 3DZBA 4E15A 5KNCA 2C82A 4K6HA 1W46A 2O3RA 2XRFA 4LBVA 2PMDA 2X6QA 4YRGA 3VR3A 1UZAA 4V2IA 4FOOA 3L4BA 4KIGA 5DYYA 2E55A 3WQRA 3ELWA 3UXHA 4GKKB 4DHWA 1GAJA 4KPFC 3ZD6A 2BI4A 3BCUA 4CW7A 2BEVB 1I3MA 3AGQA 4W5RA 1Z16A 2FXVA 2IFTA 1V26A 2FWJA 1G8SA 1DRUA 4J6EA 4M1KA 4YHHB 2I6GA 2C29D 3LCVB 1N1EA 3RT9A 4DM4A 2A1TS 3URMA 3RRMA 3NBFA 2NO5A 3AHHA 3DPIA 1M33A 4LZOA 5BRNA 3TSAA 5IHPA 2DQZA 5HRAA 4ENWA 3MEQA 4YUXA 3GRYA 1SVNA 2Q28A 1ODIA 4D7AA 3UAYA 1Z7BA 2QG6A 4DSNA 5EMLA 1H5QA 1GZ6A 5IMBA 3DULA 1T29A 2BZSA 2RI0A 3EUEA 3BXHA 3M1IA 2PD4A 1RAEA 4U0JA 3LO5A 4X60A 3I28A 2YJGA 2ZYSA 1C2TA 4GXRA 4URUR 3PGJA 5B64A 2OQ2A 1IONA 2YN4A 4BFSA 1QF6A 1T9KA 1G21A 5DE3A 3RYHA 4EABA 5B4VA 5M7EA 4R9SA 2WYWA 3TW8B 5G1OA 4U1RA 3PHLA 4L7VA 1E18A 2VPZA 1NYQA 4E70A 1WPGA 4F91B 1H1LA 3TS1A 4RUKA 2OXIA 1R0WA 3MTIA 4D1YA 2VHTA 2I4LA 3T94A 2W42A 4RENA 3WWEA 4ALIA 2PL5A 1Q1AA 2G28A 3HLTA 4R1NA 3QX8A 3Q85A 1KEEA 3B60A 5BN4B 2R751 2P4UA 2DHDA 1KDVA 1JPVA 3N2EA 5EJ2A 1T1EA 3NYQA 3SIRA 1I5RA 4MS3A 5DCYA 5TQ0B 3LECA 2AEMA 4ODIA 3HA7A 5JSZA 3JQ7A 3H75A 5KMGB 1EBFA 1L5HB 1QOZA 2ESRA 16PKA 2JLAA 2Y0BA 2ZG6A 3ZHQA 1WV1A 4DUZB 4TTSA 3N8KA 2OORA 2PR7A 1ZH4A 3UGQA 4GR4A 3QLVA 2PWBA 1Z0FA 1JHPA