1ZN8A

Human adenine phosphoribosyltransferase complexed with amp, in space group p1 at 1.76 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
b'DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenine phosphoribosyltransferase
publication title Structural Complexes of Human Adenine Phosphoribosyltransferase Reveal Novel Features of the APRT Catalytic Mechanism
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zn8A00
1DQNA 1VCHA 4LYYA 4PAWA 1GPH1 1LH0A 4RABA 3ACBA 1A4XA 4RV4A 2WNSA 3ACDA 1QB7A 5ESXA 5IPFA 5JSQA 1BZYA 2H07A 2JI4A 1OPRA 1GRVA 3GGJA 4RQBA 4JLSA 1PZMA 1ZN8A 1AO0A 1ZN7A 1NULA 5BQOA 1WD5A 1I0IA 3H83A 3DAHA 4RHUA 4M0KA 2FXVA 2YZKA 4LZOA 5BQPA 1UPFA 5EUCA 1DBRA 1UPUA 1D6NA 1A98A 1G2PA 1VSTA 4RAQA 1P4AA 2P1ZA 5ESWA 1QB8A 2JKZA 3ACCA 1BD4A 1O57A 1Y0BA 1DQPA 3OZFA 3N2LA 4WMLA 3DMPA 1QCCA 2IGBA 4P86A 5K51A 1ECBA 4RADA 4RACA 1VDMA 1A3CA 1ZN9A 5E38A 1J7JA 1JLRA 3G6WA 1STOA 4RHYA 2C4KA 4P3KA 4WN3A 1ECJA 1A97A 5HKLA 3NAGA 3M3HA 4KN6A 1XTTA 2PS1A 1I5EA 1R3UA 1OROA 4QYIB 4Z1OA 3QW4B 2EHJA 1I0LA 1A96A 1XTVA 2GEBA 2HCRA 3KB8A 3DEZA 1QCDA 3OHPA 5BRNA 1XZNA 1HMPA 1ECCA 1O5OA 3HVUA 3OZGA 4RHTA 4M0UA 4MB6A 4X45A 1BD3A 4IJQA 1IBSA 3GEPA 4RHXA 1ECGA 1ECFA 1U9ZA 1TC2A 1Z7GA 2E55A 4M0PA 2JBHA 4LYGA 4QYIA 4TWBA 1G9SA 3S5JA 1XZ8A 1G2QA 1QK5A 1MZVA 4LZAA 3LPNA 1JLSA 1L1RA 2XBUA 5KAPA 1P17A 2DY0A 4RQAA 4RAOA 1DKUA 4P83A 4F8EA 4P82A 1V9SA 3LRTA 4X44A 1U9YA 4OHCA 1QK3A 4JITA 1G9TA 3O7MA 2PRYA 3GGCA 2JKYA 1UFRA 1QK4A 2H08A 2AEEA 4P80A 3MBIA 5KAMA 1P18A 1CJBA 1HGXA 1P19A 1XTUA 1L1QA 4QRIA 4P81A 1TC1A 5BSKA 5HIAA 5IAOA 1DKRA 1A95A 2PRZA 1I13A 4LZNA 1I14A 1FSGA 4PFQA 1NONA 3MJDA 5JV5A 4FYMA 1YFZA 1W30A 2VFAA 4S2UA 3EFHA 4P84A 4RANA 2H06A 4ZFNA 1OREA
chains in the Genus database with same CATH superfamily
4KXNA 1M6EX 2G71A 4FJ1A 4JJFA 2ZE6A 1G8PA 3EDQA 4ZO4A 2QLBA 3ZE1B 1WETA 2QRNA 5DHQA 2WNSA 3REFA 1EUDA 1F51E 2ZI7A 3H5LA 5YASA 3A37A 2RHMA 2AOVA 3ER8A 4HWRA 3ORRA 5E2BA 2JH8A 3SBEA 4AAYA 5LP1A 2ZYUX 1TEZA 3KBOA 1PFQA 3VKUA 3GUZA 4XTCS 1RWPA 1SR8A 1N0VC 1Q12A 2Q4DA 3U44A 3HXOA 2VYNA 3FVRA 5J2TB 3F6EX 4NZOA 2WW8A 4PPYA 3R0QA 4N41A 1WSWA 4HB2A 3B9RA 1WQ4A 3ACCA 4E5UA 1YWGO 1KFCB 3T1VA 3W6PA 3ZWPA 2B8TA 1FNNA 1JEYB 4QC2A 2CHGA 2OILA 3S8MA 1KJYA 5IK2A 3MUFA 3PDUA 3ENKA 3DBRA 2F9FA 1QGUB 2XR1A 2ZS7A 4O1MA 1O4WA 4XJTA 3R7WA 3GZTB 4OEHA 4YVFA 5B1DA 4MGYR 1RBYA 3VSAA 2EBWA 1L7EA 2O5RA 3KJZA 3Q10A 4UZEA 3RBAA 3OFSA 4P4GA 1P73A 1VL5A 4LHZA 1J2UA 2Y1CA 1QVVA 1ISSA 2NW6A 3P27A 3E58A 2O07A 2VHWA 1BKYA 3NPMA 4K9OA 4EPWA 1COWA 4Z3OA 4ZICA 2Q50A 4HAYA 3NP9A 3TQRA 3VO9A 2A0YA 4HH0A 5DM60 3QEMB 5DM2A 2W8BA 1JAZA 1Z0IA 4N82A 3EC7A 3I6MA 4BAUA 4YV7A 1IBCA 3DMNA 3L7AA 4E2WA 1XK6A 4Z4HA 2YOGA 1ORIA 2BKEA 1NHWA 2PBRA 1WZCA 1LLFA 2CDCA 3K73O 4K8RB 2LCIA 5I9IA 4A5OA 3FPJA 5KQGA 1CRZA 1MW8X 3KL4A 4WKBA 5NLLA 1A5TA 1M72A 1UEJA 3QLVA 2NQ8A 3PBKA 2DFVA 4N0EA 1Y8RA 2WTBA 5MN6A 3S1SA 3SYTA 3DGEC 4M88A 5C52B 1XZGA 3ERCA 1CVLA 2J09A 4KMOA 4WY5A 2JPDA 2WINI 4D96A 3GFOA 3RAEC 1YDGA 1W93A 1ZCBA 3ESRA 5J40A 5BQ5A 5FJIA 3S1AA 3WHKA 1ODLA 2ZXFA 1IG0A 2FPUA 2XNHA 3R7LA 2ZIAA 1Z5NA 1YZYA 2Q2QA 2BGTA 3AG6A 2WVHA 4MI1A 4DW8A 4K3VA 3S68A 2P69A 3NTRA 1N75A 2AKYA 1ZIOA 2GESA 5AW0A 1ENPA 1YS7A 1SBYA 4NSNA 2DPYA 1FRFS 5C8YA 1ZM4A 2EQBA 4MGKR 4Y30A 3KQMA 2CJFA 2VDNB 3FKSA 5K0NA 2QOEA 2QT9A 3F5FA 3UGJA 1JHXA 1T6YA 1G3UA 1HDGO 2EARA 3I2IA 4IQ8A 2PUAA 3GL9A 4DV7B 4AZ3B 3IXLA 5CHYA 2A67A 1G8YA 1H2BA 4LRSB 3GPCA 4RVOA 3WFJA 4PANA 3RYCA 5E4FA 3ZGOA 4ZJZA 1UBHS 1E7WA 4GLLA 5BYAA 1QJ4A 2P11A 5LLDA 4WEQA 1SZDA 1YS9A 1JLLB 5IT4A 2A30A 2CXXA 5FPKA 4EY5A 1UP6A 1Z5ZA 4MR9B 3K9NA 2JFOA 3K20A 1RP1A 1S6YA 5EJ4A 4RTPA 3PL1A 1GPH1 1DG3A 2NZJA 4ECEA 4UOEA 2W98A 4O2AF 4KQMA 5FWAA 5IUKC 2XX3A 5CGQB 1A04A 2XSZD 1S2IA 3L43A 2XB9A 4IV0A 1E6CA 1P0CA 3W9YA 3EVCA 2FPPB 4EJSB 5LOVF 2BEVB 2E21A 1QE3A 2QVZX 3K9BA 3TLAA 3ZWQA 4F8JA 2XTMA 1EVQA 3TZKA 3ZDFA 1I0IA 2F7SA 2WAAA 5B1HA 5JD4A 4ZT6A 4FCCA 3LPAA 4CQNA 2E5LB 1D6NA 1JIXA 5IBPA 4IDFA 4I4LA 3WOVA 2HMUA 1MIOB 1VA4A 3M9XA 4RESA 5F23A 2VK8A 1QR6A 1DC5A 4WIAA 1QIFA 4BE7B 5G53C 5J5VA 5B5SA 5JJBA 3N70A 3PRHA 3R0XA 4KLNA 1FLAA 2FW1A 3BHNA 4YLEA 4BMNA 3UT5A 4EHBA 3B6EA 3ZBQA 1N1DA 1JS1X 2B3TA 3H5NA 5BOSA 4G0WA 4O3MA 4PX9A 2I4RA 5FAKA 5LMZA 5E8RA 2HF2A 1ZHOA 1BWPA 2FQQA 2PO7A 3OQIA 4I19A 3ELUA 2PV7A 4OYYA 1EVZA 4G4JA 4M9RA 4O2LA 1A97A 3CNHA 4XSVA 3UXEA 2IBSA 2AXPA 3NT2A 4UBLA 4C0JA 5K4HA 1BFKA 3VMFA 1ZD4A 2GEKA 5A5EA 5JANA 1P4GA 3GYGA 1XTVA 1MUUA 2EZUA 3H04A 4RM3A 3QEKA 5J2UB 3ZDBA 1MGPA 3BCHA 3NOXA 3F2VA 1SY7A 2X8LA 4S35A 3ZWDA 3K5HA 4LRYA 4GKJB 4INJA 2PZMA 2E5FA 4RHTA 1FS6A 3FM9A 2ZUSA 1HQCA 2FK7A 3KWFA 4K9KA 2XCIA 4KO1S 4OHFA 2QSJA 4DF3A 4YCLA 2XF2A 5I7AA 4G0PA 1XD9A 4QTXA 1EFVA 3EDCA 4Y18A 3WHLA 1NW9B 1QMPA 2CLFB 4R6XA 4EELA 5A2QA 3Q3IA 2G1UA 4XWOA 3V2UA 5BR4A 2R0QC 4JS0A 5CTJA 1R0ZA 5D7NA 3ICPA 1TNDA 2WSSA 3H97A 2BTQA 2ZUDA 2Y1WA 3MGKA 3QLVC 1JFSA 1M34B 1RTKA 2G1JA 2VHTA 2GCGA 2YHUA 4PXSA 5LJIA 4WEOA 4ZYLA 1PNTA 1GRNA 1QIKA 1Y81A 1Y63A 2IC5A 1DFIA 4LBYA 4KQ2A 3UTDA 4MIEA 1WCXA 1Y3AA 3M4YA 4YH1A 5ILGA 4A16A 3KIPA 4MCIA 3HABA 3V32A 1RXCA 4NCKA 3G9UA 3K9FC 1I9CA 2WYIA 2PK3A 2ZR9A 3DE4X 2NO6A 2ZRNA 1JB1A 3OQPA 4QYMA 2EFDB 4N3BA 3TD6A 4AQDA 5EQTA 1DEXA 2O54A 1TK2A 2O8FB 4PIPA 1FOEB 3O2SB 3GN2A 3WDLA 2PBLA 4WPGA 2ZLBA 4Q3KA 1QV6A 1XDSA 1PJSA 4H7EA 5TMBA 4OSOA 1ISIA 4LNUA 5FAXA 5KVQA 2Q4TA 2HSWA 2J7PA 5HIAA 4QKQA 1CUVA 1XQ1A 1E6UA 4P4NA 1ZL0A 1NI4B 3RHFA 1S8FA 1KPHA 2YZMA 3HJCA 3HNOA 4X7PA 5FI0B 3SYLA 3H2IA 4OGKA 3KJIA 1U0FA 2I3ZA 3HM2A 1W25A 2HU8A 4IZ6A 3KLPX 5CIQA 1L0BA 4WGFA 4AF8A 1L8LA 1AOXA 2VAMA 5DNDA 1U7OA 4R7ZA 1MAAA 5G3ZA 1U80A 4RJTA 1M1ZA 2FQWA 1ADYA 4HWTA 4AS1A 3NG1A 1AV7A 2CMGA 2QD1A 3ZXYA 3P9CA 1NYTA 2OKGA 1NBME 2ZSHA 4D97A 1J4AA 1G6OA 1KE1A 3F5MA 3TMKA 3CX8A 4MWDA 3CR7A 2WPNA 1CIPA 1MORA 2W2LD 2WVAA 1AHPA 1XD8A 2QT0A 4Q4DA 5I3ZA 2ABWA 3PIDA 4N8SA 2OHVA 4GVPA 4CETA 3ANXA 1UJ4A 2GPSA 3SF8A 3FB4A 1P2FA 3LC0A 3M34A 4EAAA 1T5BA 1FYFA 3BTVA 3VVBA 4WXRA 5LQMA 3Q72A 4MSUA 2BW0A 1DRJA 1W0KA 1W96A 1RJ9B 4QGHA 3HPQA 2EF0A 5B1YA 1VSQA 1H1LA 1MJ5A 1MGOA 2HRQA 1NTRA 1K08A 2IGBA 1WSBA 2MSKA 1JWLA 3KQQA 3RTDA 1BX3A 1F12A 3TR6A 1U6KA 2BFOA 4A2CA 1ZOPA 2F2TA 2RGNA 2CYAA 3AP3A 3DAPA 3IIJA 1WMBA 3LBAA 2AR7A 2ZIEA 4OMDA 4TVOA 2BL4A 4AYWA 4UBOA 2VWPA 4B7ZA 4FS3A 2WM3A 3WGKA 2ZQZA 2O8CB 2ZOSA 1DPGA 3CCBA 3D8NA 3DFFA 4S1NA 5NULA 4QUBA 1HE5A 2PWZA 3QVGA 5BVHA 2RAVA 4ZIRA 3L4KA 4GKKB 3ZDDA 1YB1A 2GMWA 4P92A 1OKKD 1BQ4A 1UC4B 3LJKA 4ER0A 4KPUB 3ESQA 3FOAA 5C7OO 3KKEA 2WPDA 3QX8A 4RJ2A 1L7OA 3O94A 3NNSA 4HYYA 3OIWA 4C03A 5JCZA 1QS0A 3DE5X 4WNAB 4D46A 1SXJB 1Z26A 5EWLB 3ZHOA 5AUNB 2R6CA 1MRNA 3EIEA 4M0DA 2WZDA 3AILA 4RHEA 2E55A 4WKGA 1P6UA 3T35A 4ZZIA 3ZWAA 4YCCA 4NCAA 3FVVA 1M2OA 5BW8A 3TS1A 2ZIVB 1C0LA 2JI6A 1HURA 2OV8A 3EGDA 2A33A 2ZRDA 3FN4A 4P0TA 2BBOA 3JATB 1ABEA 1WHSB 2DY0A 2F48A 2FR0A 3P19A 4PSUA 2ZAYA 2XE4A 4KXQA 4WN9A 2N3ZA 5DP1A 4YX9A 5JOQA 3WYNA 3H3XA 5L4LA 2OE2A 2G0AA 3ASYA 4D82A 2NO7A 3GDHA 2AEMA 2B35A 4W9MC 2ZWVA 5IDWA 5L9AA 1OIVA 2ST1A 1XD2B 4Y2VA 3SD7A 1TO6A 5FOSA 2EU8A 1L7BA 1E3DA 4HB0A 1E3LA 3CVXA 3HQ4O 1J8QA 4V0RA 4RWZA 4Q3DA 3BXOA 2ZIXA 4Q15A 3GIDA 2VT3A 2D59A 4EHDA 4E11A 3PWSA 1GJRA 1J97A 1E2PA 4CN9A 3PC8A 3AVPA 4FGWA 4HNQA 1Z47A 4H3VA 4GT1A 3DEHA 2DWUA 3HP7A 5JAHA 2NU6A 4IUYA 1WPQA 3E70C 1TLLA 3T38A 2HDHA 3OMXA 3DAGA 3NIDB 3T5BA 5JW6A 4HF7A 4YWJA 2RIRA 3OURA 3VO2A 5C18A 1OIXA 2VT2A 4W9NA 3ZCXA 1KDPA 4ZXFA 1BIFA 4MDHA 4JEIA 1OX4B 4REOA 2EKDA 1OFVA 2BGLA 3NWEA 1PZXA 4RIFA 2ZIFA 3M8KA 5EG5A 3W8DA 3QX9A 2BUCA 1GCAA 2SBTA 4E1VA 2OENG 4KI7A 5BYKA 4B1FA 2CMDA 2NVUB 3FR8A 2OCYC 3EQ8A 1KF0A 5BXQC 4WWHA 5EA2A 1O96B 4EBFA 2YHAA 3H83A 3KZXA 1ORWA 3NNDA 2EIXA 4G85A 2RH4A 4AWXA 3ZV5A 1XL1A 3NI2A 1IY9A 2O5VA 2GD0A 3LXUX 4IX1A 1ZK2A 2XODA 3LGAA 4ENRA 3IFSA 2R8ZA 2RGGA 5LUBA 1NAHA 1TB4A 4ZC8A 4Z2AA 4PIMA 4X94A 2AXEA 2Z3ZA 2XY4A 4I0WB 4LYEA 4V0NA 1VHDA 3DM5A 3HKCA 5B37A 3N8DA 4N4AA 3MLBA 2VSYA 3WGHA 1FMTA 2FLKA 5BYJA 2OG1A 1PS0A 4PLVA 4RVFA 3OVMA 4CLRB 1ZGZA 2NVWA 5GONB 2EFEB 4GNKA 2VF8A 2UYQA 2X0JA 5FOXA 3KS9A 2REOA 5K0ZA 2A35A 3IPRA 3UB2A 3PNPA 4JYPA 4NBVA 5IH3A 2JHAA 1YOVB 1KNQA 1TX4B 1JAHA 3QWIA 1E2NA 3E8MA 4DXHA 3UNXA 2IS1A 1U3CA 3FTPA 5C3MA 5EE9A 1VIDA 1FFHA 1N8SA 4LE2A 4PSAA 2JCGA 4GZ5A 4P3OA 4ZCQA 5BN5B 4HBGA 4GI3A 2O0HA 3QEAZ 3N3BC 4IGAA 4BO3A 2QN8A 4G8DA 4EX6A 4GM0A 1N8TA 1PVDA 2JFXA 1DRKA 3MD0A 4WJLA 3GLIE 1S8AA 3UXHA 5GP1A 4K6KA 1JWAB 1LPSA 1Z16A 1CYDA 1Z73A 1CB7A 3ER6A 4I1VA 2CYBA 2AE1A 5LZ7A 4A0RA 3RNLA 5KU1A 4ER5A 3Q88A 1CD5A 3RBXA 3WLOA 2C4WA 2GZ3A 3RW9A 3ZTYA 2FP4B 1MJNA 3U3OA 4JA0A 1V1MA 4NNPA 2VPYA 1SG6A 3KZ1E 4L51A 3VZDA 4U7TB 1Q20A 2MYNA 3WTCA 2A0KA 1XALA 2YS6A 2RGEA 4IBOA 4IG9A 4YRTA 1YDWA 1LSSA 2ZBRA 4NCXA 3RYHB 3PGJA 1H4VB 1NXQA 3BZUA 2QM0A 2W6ID 1CY1A 1XZPA 1YFKA 4XTRA 4CKBA 5LFAA 3OO0A 3OZXA 4MYDA 3EISA 3K0SA 4GX0A 5G0WA 1TMGE 4J2HA 1GA6A 3I92A 4PC6A 4AY6A 3ESBA 3LLCA 4GR9A 3MEQA 1V48A 3HMKA 4H0NA 3ZJ5A 4P5PA 1BJTA 2ZP1A 1YZTA 4NESA 2Z4TA 4IGEA 1OH7A 5LQSA 1Z56C 4X00A 1H2HA 3LF2A 3ME5A 4U7JA 3FG9A 1KL7A 1CLUA 3QWAA 4X61A 4E7OA 3A4VA 4YP7A 3LECA 2R8BA 1ONBA 2UYGA 3FA2A 5DCWA 1BDHA 1WJGA 1L7PA 2PRZA 1PX0A 4FFSA 5J5CA 5LCXA 4C1NA 2GR9A 1PJLA 2AI1A 3RG2A 4MEAA 4C78A 3ZV6A 3PC8C 4J16A 4LTNA 1SHKA 4W4TA 5JE8A 3AVTA 2CBXA 1LTHR 3KKKA 3WO1A 4IMPA 3G17A 4B75A 1A8SA 1C1DB 4DQXA 2AN9A 3NYIA 3H2GA 2X1VA 3LAWA 1AS0A 5ALOA 2OBYA 2W6NA 4V02A 1XX6A 2R7LA 2Z2IA 4AZ0B 4KAJA 2CL7X 5D01A 1M66A 3F96A 1EX6A 1USGA 4GVLA 2XVYA 2NYUA 3NBAA 1A5AB 2IHYA 2NZ8A 5H7XA 3EMDA 4W9NC 1Z4JA 2J3LA 1KK0A 4KXYA 2GYYA 3BUSA 4NATA 5ES4B 3PQ2A 4DLBA 4DDMA 1NV8A 2H7VA 1GV1A 4DRYA 1XHLA 4EW1A 1UQRA 1E66A 1V5EA 2VHUA 2IPMA 3CF4G 3WK6A 1UP4A 1CFJA 2ILVA 3IP9A 2W2KA 3PUJA 4FHGA 2OCIA 2IUTA 4X1KB 3RVBA 8MHTA 1WR8A 3KQWA 4Y6QA 1EUCA 4XGIA 5H4GA 4JFAA 4HQFA 4LF5B 3E5NA 3GCZA 4IDCA 1H4QA 2HX1A 3AO0B 3FBTA 3S6JA 1Z7BA 4MA5A 4NZNA 2G28A 1C9JA 2O6LA 2WILA 3MWKA 3PHGA 5AJHA 1BGWA 1Z37A 2HH9A 3VNRA 1ECBA 1SXJE 2OZEA 4DMKA 4KREA 4GXTA 3KUKA 4B7AA 5D85A 5GPBA 1FVXA 3H6HA 2VCHA 1BVUA 3G3EA 2H1WA 3EWAA 2W2TA 2QZPA 4PZ9A 5A0FA 3N05A 4TMYA 4D79A 3WLIA 1B0PA 4HYTA 4A2WA 4ATNA 1V7CA 3A36A 1KPGA 2XWJI 3JASA 4H1VA 2QW0X 3T1HB 4W6QA 5AFSA 4N7RA 3F6SA 3SR4A 1J9EA 2PD4A 3C5CA 1PR9A 3GJ4A 3PUZA 4CF3A 1NPDA 5HUHA 4B6GA 2MOKA 2OPBA 2OQRA 3MF4A 2MINB 2JFZA 3LC1O 5FWYA 2PGOA 2ZT8A 3OZGA 3NMUF 1SKQA 2X22A 1Z3CA 2XTZA 1JIUA 1OYWA 3GEPA 4MEBA 2CHEA 1MMFB 3E7PA 4UULA 3IKTA 1JIJA 4IYRA 1VMDA 2R8XA 3O3CA 3SSOA 5I7FA 1TCCA 3H17A 4DNOA 2FJ0A 4D0NA 2HHJA 3IGFA 4RV5A 3QXCA 4OUDA 4M9QA 2C07A 3OMLA 3PGVA 2PGDA 4G2NA 1AQUA 1UODA 2C9CA 5DN6D 3BERA 3S40A 3C3EA 1Y4SA 2H5JA 3B48A 2JZCA 1YBHA 2H2DA 2Q0SA 4F3YA 1OAAA 2Q5HA 4BV9A 2X1LA 5HF8A 4CIVA 1DKUA 2ZBPA 1IWOA 3SZGA 1T8TA 2WVGA 3OSZA 3MUNA 4M46A 4MJLA 5EEGA 3UAWA 1T4MA 4B4UA 8ADHA 1PFGA 3G5AA 2R11A 3C85A 4FOLA 4JL6A 4XIFA 4MW1A 5FH9A 5JCJA 1AKNA 1OXBB 2GHRA 5DNUA 1RWWA 1TK3A 3DMGA 4WXHA 3OBIA 2UVPA 1E0JA 5EJMA 1GYQA 4G5RA 1RHRA 2MJLA 3IEPA 2UVDA 4GYWA 4A15A 4KRFA 2DUJA 3T0FA 4V39A 2H4WA 4XI9A 2G06A 2IPAB 3J81A 1UZLA 1DTSA 1NW8A 1L5WA 2UDPA 2ORVA 3GR6A 3KXPA 4BO6A 4BO4A 4D44A 5GVSA 2D1RA 1PNVA 3HCCA 3W7AA 2J85A 5REQB 4IICA 2RFLA 3CGGA 3CZ5A 4G0YA 5FORA 3QPBA 1FQJA 3SR3A 1EIZA 1XCLA 1WL8A 2ADOA 4MYSA 2I22A 1JEDA 4QNMA 2DPXA 3PC2A 4OL9A 3UJDA 4WFQA 2O8DA 2R6HA 1M1YA 2XNSA 4J16C 3MWDB 3VR4A 1EFRA 5KX5A 2O0KA 3RSHA 1K8RA 1ZJ4A 1VMIA 2VJYA 1CSEE 4IEIA 4TYPA 1GN8A 4CMKA 4WESA 1DADA 1W2WB 3JVEA 2GJ4A 1XEFA 3CTMA 4Q00A 1JH9A 1FNDA 4YEDA 3V2GA 4BVAA 2VUUA 3LE8A 5T3UA 1CTQA 4EPTA 5KNCH 3VHXA 2WP0A 5J43A 2JJ1D 4GW3A 3ZD7A 1G5HA 8ABPA 3MGCA 5FQNA 4FFLA 4RIEA 1E7SA 1NQ5A 1G3QA 1RAEA 2PYIA 5IYZF 5AI8A 1Z45A 3FNGA 4RMGA 2HK8A 1Y0BA 3ELBA 2QQ0A 3II6X 4EVIA 2HXGA 3QBDA 1X0VA 4B35A 3L4SO 3K0CA 1EK0A 2D7DA 2R4TA 3L93A 3B52X 1QCCA 1GFSA 2NO1A 3CMMA 4BU0A 3ZX4A 2NV2B 1LS6A 3SMVA 3GEGA 2H6EA 3GAZA 3QKWA 3URMA 2IYNA 1CZKA 1JZTA 4LQCA 4PZYA 4Q1BA 1AMOA 1UK6A 4X62B 2MSDB 3KQNA 421PA 4EG0A 1S01A 2ZTMA 3LGXA 3OJLA 3DDSA 4J2OA 5HMLA 4ZZ0A 4F9GA 1I1NA 3HRKA 1XAIA 1YIOA 2B0JA 1SK8A 2YWFA 4CNQA 1E2LA 1AT1A 3BXFA 4B5KA 4CL3A 3F6CA 4JP3A 4G4IA 3J80A 4Q03A 2GEBA 2PUTA 3JTEA 1E61A 3FKJA 4X3PA 4EHHA 1CHNA 3GZNA 3KPYA 2PL9A 5LWHA 4N3NA 3QXXA 3QITA 4MVJM 2V4UA 3E18A 2VZ8A 4GRDA 4GAEA 2H1SA 3GK3A 3QKTA 4S1PA 3TEJA 1QH8A 4P3YA 2X19A 2IU6A 2FR1A 2VUHB 4FONA 2EZ9A 4LPKA 5DZSA 8LDHA 2IHNA 2F8LA 1HLFA 1SIWA 1QLJA 3EEFA 3MMNA 1JQDA 1TQ6A 3KVOA 4B3RB 4E1BA 5G0TA 3OFJA 3FCXA 2BFNA 4XQGA 4QTYA 2ZTUA 5ITZA 4BQPA 2Q6KA 2VQ6A 5H02A 4B3DA 5CB8A 2HNKA 1VG8A 1CZRA 3IP8A 3PEEA 3IAHA 4QTTB 2FHSA 5EIBD 4E1AA 3KBBA 4CMAA 4BB9A 2QTWB 1H2FA 1K89A 4M1MA 3M33A 4Y6SA 1H9CA 1SC6A 1DBWA 3IMFA 1NPTO 1XRRA 1UOQA 2P9TA 3MJCA 4JBNA 5FD8A 3EGXA 4QHYA 2YV1A 4Y9DA 3D2AA 1T8UA 2EYUA 4HNGA 3A4NA 2AW3A 4LEIA 5IEJA 3HJRA 1G5QA 1KC3A 1P0PA 3B6MA 3G5MA 5CX1A 3V97A 2JI9A 5A5GA 1NC1A 3QXJA 4RZ2A 2JGMA 2O0LA 1G7SA 2C5SA 3FMGA 4UOZA 2GJKA 1SD5A 1IATA 2B8EA 3I2GA 1C4OA 3VKVA 5JZSA 2FQYA 1JP7A 2XMQA 4FJ2A 2Z6AA 1LX6A 2OSBA 2VA9A 3HJGA 5ALDA 1JEOA 3MSXA 3RFCA 2WSLA 4KDEA 1GXSA 1AS3A 2FCRA 1WLYA 3QSGA 3CZQA 3TIXB 4AZTA 5HF5A 1YI8A 4DPMA 2G7ZA 1I94B 2Y66A 1UQTA 3CEPB 1BW9B 4BX8A 1U2DA 1QP8A 2FMIA 1XGKA 2P7IA 1ZXXA 4RC9A 1UBJS 3RANA 2EL7A 1BAPA 2EFJA 3EH1A 5PGMA 1NBMD 1Z6AA 3OQHA 2HT6A 1P3Y1 4G8JA 2QRVB 3VR5H 3BB1A 1Y3BE 1MNQA 4BLUA 2VF4X 1E2IA 2RCNA 2XOXA 3T8YA 1YUNA 3AEYA 1KJQA 4GC5A 1RE1A 3R7WB 2C77A 1P0FA 3PGLA 3F7MA 5KYGA 4ESHA 2OCXA 2QLTA 2CF5A 4BN5A 3QVLA 3EB9A 2J7KA 2B99A 3K6SA 1J24A 1KRHA 2PH3A 2Q5CA 2TS1A 3GLTA 3OKCA 5K0JA 2NZXA 2W2OA 3SS7X 4DABA 1RWKA 1TMOA 1XVIA 4BBJA 3VUFA 3A3OA 1IQRA 2NSJA 2RDMA 1V8BA 2Y6UA 4LGCA 5GIPE 1L6RA 2Z8ZA 1K86A 1MEEA 3OICA 4M0CA 5JWHA 2DLCX 3SBDA 5LQKA 4N3CA 4N76A 1RI1A 2AUTA 3LPLA 2WA1A 3UY4A 2GZDA 2JGFA 4W5WA 4A10A 5EIXA 1QRRA 5JQGA 3BZWA 3DTNA 3MTQA 1X2BA 2YUTA 1EE9A 4UBKA 5ICMA 4OXRA 3WL3A 3NALA 3OQNA 4E12A 1PAUA 4DCUA 2IOFA 1F0PA 3Q9SA 3ROKA 1Z9BA 4KN6A 2C83A 5BMVF 2GAFA 2XE7A 4FOSA 5BOVA 4LY6A 2UVQA 5K01A 4GLBA 2A0UA 1DTEA 1U1CA 1VZ2A 4M9ZA 3FWNA 2AUNA 3BCRA 2ZB8A 3OM0A 3WKAA 2WDPA 4MV4A 4G1MB 4ZO7A 1JW9B 1HQYE 2EXXA 2HIAA 2XQVA 4M6WB 3WQBA 1BWQA 2NZVG 3MTEA 3LUBA 1OWOA 3P71T 4WVLA 3HBNA 1GADO 1T2DA 1RWQA 4LJLA 4MQ4A 4MW7A 1T8PA 3SSAA 1EK2A 3DXFA 2P3SA 1M8JA 2J3QA 2R5NA 3H42B 1N2GA 2UZ1A 1CBUA 1YB6A 3EPLA 3RADC 2R6FA 1DMSA 1XKTA 2ZJ3A 3ITEA 3TTTA 1JFLA 2OVFA 4HJXA 5MGBA 4G67A 3R1IA 3MS2A 2HR1A 3DF7A 3L05A 3F46A 2IDMA 4LV5B 4TV9A 5K3DA 1YUBA 1IN1A 1YRLA 2FE4A 1R6UA 1YDHA 3HVJA 3TPCA 1RBMA 1NLZA 2ZQYA 3CJRA 2Q3HA 2GCOB 2QLJA 2I6UA 3AHIA 3LF1A 3GFPA 4S0ZA 3AM1A 1JLHA 3L5OA 1OZFA 3BN3A 5J5AA 1QIGA 4FDUA 4YA6A 4QM7A 1QWSA 5DOVA 5C34B 3VHLB 1OXXK 4FIDA 4C3ZA 4K9SA 1NU8A 1ZC3A 2V7TA 4JA2A 4YAOA 1X7ZA 1RCTE 4YXWA 6AT1A 1V4BA 2R751 4MP6A 2EWWA 4YS6A 2XLBA 1GY8A 4IIVA 4UE2A 4RNDB 2C2YA 3JZDA 4NZ9A 2AJBA 2HWUA 4DBLE 1A2KC 2EX4A 4KPGA 2VHXA 1MB3A 4TL8A 4F8YA 5K3EA 5THXA 3RS0A 4WJKB 5GWXA 3IB6A 4DR4B 3JQFA 1FU7A 2OV3A 1HEIA 1VLQA 4AULA 1PTKA 2GSWA 4J3NA 2OHGA 3WIUA 4CM5A 1W49A 1NV9A 4KIWA 2P9ZA 1VL8A 1G4HA 1HSOA 3JSAA 3JWEA 3N2EA 1BOOA 2IZ1A 3H2YA 2Q6OA 2XTAA 3K2EA 1HG1A 1JHOA 1U2DC 5BW5A 3ZVMA 3IPCA 1LLCA 3OU6A 2P67A 4RZHA 4A0SA 2PKCA 5EMMA 1GR1A 4RTJA 2X9GA 4MTLA 4QUGA 4EO9A 4OXKA 3RREA 3A4YA 2O0MA 1YBMA 5A1TA 5C4IA 2FJUA 5CA1A 1PJ3A 2X0IA 3I6IA 4OLJA 4TQUS 1E8DA 1RIFA 3L8GA 2DHDA 4FGJA 5FI5A 3VR0A 1UXIA 2Q8NA 2R1ZA 2FSVA 1V5GA 1IN8A 4M0KA 4C7VA 2IBTA 4OBXA 3V1NA 5TMPA 1A7UA 1MAWA 2BGJA 2YJGA 3JD2A 1KKUA 3O4FA 4AWAA 1NUPA 2I4TA 1P4AA 1QHEA 3T3EA 1IPHA 4F5YA 2D62A 3NV7A 1T5TA 2VNIA 1OZAA 4XVRA 3T5TA 5KHOC 3IQHX 5IHPA 3PLAE 3BTUA 5ABPA 2A9OA 1GKIA 1BKSB 3I04M 1I7QB 3SWWA 3LW8A 1NOKA 3QI7A 1DINA 2P9BA 2ZTLA 4JH0A 4LJRA 3LV8A 3IDOA 3U4MA 1STOA 1OXSC 1YO6A 1SEVA 4W8HA 2IEBA 3ZGZA 3B78A 3CR8A 4FR2A 3EA5A 3GDFA 1U2RA 3RF7A 1T9ZA 2H1LA 2O2ZA 4WZAE 3DTVD 5IW8A 1JYEA 3WK7A 4DIFA 3UTCA 1C3XA 2GPTA 2BELA 2BTQB 2GPWA 3O3NB 3E27A 1DNPA 4NMHA 2C42A 2VDLB 3RTCA 1LBIA 4O2BA 4Z1MD 4A6PA 3DCJA 4P35A 5L51A 3QLUC 4YMIA 2EIHA 2O19A 4QOHA 4XFKA 3VPFA 3ELWA 1FZTA 3C4QA 3OWHA 4EB0A 4BNNA 3FUCA 2QQFA 1Y9AA 1KZ1A 121PA 2I7DA 3NWJA 2PRJA 3T4PA 2VQFB 2PKEA 3B1FA 3NFYA 3UB4A 3T12A 5K20A 4TTQA 3VVCA 2FW8A 3NH6A 9GPBA 1DVRA 3L01A 2GCIA 1O95D 3TTYA 3ZXIA 4KHPB 1GSHA 4PLTA 1N3YA 2ENWA 5I9NA 3GFGA 2VRCD 5CVVA 1ZI8A 2O50A 4RH3A 1V2HE 3E1GA 4LNUB 4DCGA 1H5UA 4A4DA 3KXIA 3OZSA 3WL4A 3KUXA 2Z4RA 5K3OA 1C81A 1WUKS 4P98A 2UYHA 3CO0S 4PZAA 2OTCA 1G64A 3OC0A 5EHQA 3BGOS 1X7XB 5FUQA 3G0CA 4M1SA 1VI5A 1KO5A 4FFRA 4Q3BA 4JLOA 5CB4F 1U2QA 4TQGA 2PUVA 2ZYGA 3EIUA 1AF7A 2AJLI 2WHPB 2YWDA 3FHCB 2GA9A 1PT7A 5MN5A 1S0UA 4H7FA 1QHFA 3VZQA 3C8UA 3TB4A 4JQZA 5DBHX 5CT6A 5KWEA 1U3DA 3IKLA 3M89A 3QNUA 3Q7IA 3A6KA 4BVFA 1A0OA 1LF5A 4ZGBA 3GNLA 1X7DA 3MGBA 5HUQA 1JR3A 1UANA 4G5FA 3LRPA 3K9QO 1Z4NA 4KB5A 1H8HA 5EHIA 3V8VA 2NXWA 5B7NA 4TV8B 1SVKA 3SN6A 1NZJA 3KJHA 1NVDA 1LBSA 3QEJA 3T99A 2YYAA 3ECCA 4DT1A 5IKEA 3ADCA 3UQYS 3RSLA 1DJLA 1ZCFA 3VPGA 1XKLA 3VPDA 1QC5A 2DKNA 1DOAA 3AUXA 3KJQA 1AQ6A 3EQ2A 4HDNA 2OO7A 2R65A 1H1LB 4X7MA 5B7QA 1CUUA 3AY7A 4O4JF 1VYUA 2IW1A 3AERB 3CH4B 1NASA 1U94A 2NZYA 3C1OA 3EQ9A 3HNRA 2HWXA 3JYNA 4KIJA 4UVDA 2ZWMA 4XJVA 2CXUA 1CE8A 1L8XA 4A26A 4ENWA 1OR8A 1CRWG 2C5BA 2TMGA 3B1YA 4L8YA 5KKNB 3VPAA 3U3KA 3H9CA 3LVFO 1E5VA 1SVIA 2Y9MB 4B7XA 1TFUA 4Y9UA 3IVCA 3SQWA 3RARA 3K1YA 2YY6A 2FSVC 2WSBA 1SMKA 1UJMA 3KEQA 4EGAA 5B2EA 2YINC 5FI3A 1BHO1 1IWBB 3IELA 3UJ3X 2IEAA 4G9EA 1HTBA 3A1CA 1DKQA 4K9LA 1B93A 4ZCPA 3K6JA 3UHOA 1CC1S 3FPAA 4MB0A 2QHXA 3ZU4A 3H7AA 1FS5A 2A3NA 1EGQA 2I7XA 3IUSA 4U4AA 3WYAA 2YDYA 4IS2A 2XMGA 3H8JA 2UUBB 5DF1A 1Z2AA 2IOQA 2RBKA 1IJBA 1PJ8A 3EASA 5FLKA 4E2YA 5HCNA 3R40A 3U62A 2Q5FA 4RPJA 3PQEA 5KMGA 3DO5A 4R0VA 1K9SA 4DDUA 2ZBQA 3PUKA 2PGLA 2Z8YM 3O8QA 1XTPA 4K9PA 3WB0A 3U81A 4LSWA 4MLZA 2DXIA 3CKYA 3CKKA 2VTDA 3BXEA 4QXPA 3TZEA 4ZT3A 4YLYA 1XCOA 1RRPA 3HEMA 4H7HA 5BUQA 1YVPA 3P4XA 1AUOA 4IKEA 4N6NA 4EJ0A 2I62A 3HVUA 1USWA 3H16A 4L1KA 1QV7A 1Z08A 2CMFA 2BEWA 2PGXA 2E48A 3DLAA 4KR0A 2ZAIA 3K0FA 2IOFK 5JI3E 5ADWA 3HBLA 2J0UB 4WBXC 1TC2A 2A5JA 3NANA 3T5MA 2P7HA 4JVNA 5JH7F 2Q0XA 3IAM6 4GSKA 1QDLB 3AEUA 3FUVA 1YONA 1F3OA 4WY2A 3P0HA 3IR5A 4DV3B 3W5UA 2Z1MA 3BXZA 4QNRA 3D1LA 5AHOA 1ZVQA 3AOEA 4E03A 3TIVA 1YK0A 1N1GA 4B48A 3C43A 1Q7EA 2QJWA 1VP9A 2Q5JA 4NEQA 2IVZA 3P96A 2VQEB 1H2EA 3SS8A 4B3MB 2CLKB 3AEKA 4V3BA 1CEEA 1NYQA 4MV7A 2NU6B 3L4JA 4JT4A 5EXPA 2M6KA 4BCCA 1B6SA 4AQYB 1JA9A 1OU4A 4B4OA 4IDDA 4MYTA 2XCSB 4DV5B 2IHJA 4MH0R 1JG1A 4LXHA 3AR9A 5EHXA 1ZNQO 3B3FA 3B36A 3FZNA 3TI9A 2YXEA 5EJAA 3RNOA 2XXJA 3EFOB 4PS1A 4N1AA 1KZ6A 1DEHA 3C4VA 4QUIA 4TYMA 4MVJE 1DQSA 1TQDA 4OGLA 4HUQB 5FO0A 3D4IA 4B6PA 4G1FA 2IYVA 2W0SA 3V5NA 3N2ZB 2XB8A 2ZTHA 1KS2A 3SHTA 1JJBA 3PQ3A 3S70A 3LHSA 4IIJF 2LTAA 1ADCA 1EFPA 3BJEA 3FFWA 3AUKA 3HVKA 4W9RA 3TOVA 4S2UA 3A9WA 3CLTD 5GJBA 4QDKA 3V2HA 3VR2D 2C20A 3V8BA 3P4UA 4QARA 1ZKMA 4D6PA 3BMOA 4RLQA 1NL3A 1YCFA 3B3AA 4BO7A 4O2AA 2L69A 4EW6A 2PVCA 1XTRA 4AMGA 3KEGA 4MTCA 3A11A 1L2TA 3G59A 5C80A 4CDMA 2CZGA 1K98A 3LPMA 3TKLA 1GD1O 1TQ4A 3FTFA 5LOVA 4Q1DA 1V26A 5CH3A 3E0XA 4ARZA 5AVVA 1W59A 4JLSA 4YPVA 5AM0A 4MI3A 5HRCA 3U1TA 4YPFA 1Z5VA 4N5DA 1MC5A 3W06A 1DAGA 3N6VA 1DDIA 4D3FA 3RUEA 1JV2B 5JPCA 4RD0A 2DHQA 5AR1A 1D4FA 1HDEA 1XMIA 3CF4A 5ARCA 2PT5A 3M2TA 4YT5A 3TIIA 5ADUS 1D4OA 2C9OA 3Q5GA 4I7EA 2DVMA 3WJ2A 2FNAA 3RRMA 3TB6A 5A2GA 2ZULA 1X87A 3K72B 4WMLA 3WDSA 1ICIA 1JBQA 2LKDA 4E07A 5JTUA 3CLHA 2SICE 2QUKA 1MABB 1Q0PA 4N48A 1DELA 5UKDA 5CIWA 3HYLA 1GKLA 2HK7A 2X41A 4P22A 2ZE7A 5COQA 3C70A 2QVGA 5F3WB 2GBGA 3AETA 4IDEA 5ECDA 5EP2A 3UG6A 2ZDGA 4ZEMA 3QBTA 2O3UA 1N6PA 1P1JA 1PV1A 4P2GA 5BV2P 2QTZA 1VCIA 3ZK9A 3KE9A 1QAOA 1NMEA 4AJJA 3QX3A 4M1TA 2X9LA 4GYYA 3RVMA 5BN3A 1K63A 2P2DA 1XK7A 2OM2A 1GU1A 2OP1A 3CONA 4OQ4A 5AXBA 4PO1A 3SM9A 1C3JA 4Q1CA 4OHWA 3BAZA 5IJAA 3QE9Y 3U40A 1O89A 2VIIA 1W5TA 2AKEA 4XX1A 3ZU5A 4OP2A 4RETA 3IV6A 5I9LA 5IJXA 1EM6A 2QR2A 1U3WA 1NN3A 1NX9A 1GZ4A 1XMJA 1N5DA 1YQDA 2VOEA 3ZIAA 2AE2A 4R69A 4B4WA 4C2TA 2PTHA 4LJ7A 1KARA 4UC0A 4PC1A 3SIRA 1UM8A 2CLDX 1BA2A 3H8SA 5CHEA 4O4LF 6LDHA 2EFYA 3KQUA 1KU0A 5KNCA 1W8IA 3RYFA 1FK8A 1RYBA 5E3IA 4IO0A 4IW3B 2CNDA 5U4QA 2O59A 2IY9A 3KWLA 4TQ9A 1MPTA 1JMKC 4OB8A 1DHTA 2BV3A 2W9XA 5KC8A 1CS0A 1Q1NA 3OCZA 3ZWKA 2Y0PA 5DW3A 1EYZA 4JV5B 3AW8A 4Q66C 1Y7LA 2GX6A 3LFHA 4QU9A 4R2XA 4R1PA 5FOWA 4PG7A 4BYMA 1GYRA 1DEAA 3U60B 4ZQEA 1RM4A 3CUTA 3T5CA 4YRAA 5CYOA 5E95A 1TAUA 4AY2A 1NJ5A 4NFSA 5DM1A 1QRTA 2JLXA 2A0WA 2HSZA 3QOFA 5C3UA 4ZJUA 1I14A 2FFAA 2AFIB 3C6BA 4KHZA 4AO6A 4B9EA 4C2BA 3IULA 3FCUB 3EGEA 1OGYA 2VDVE 3PI7A 3R9IA 1E1RD 4TYYA 2YDXA 3S4YA 2QE7A 4MW9A 4IVNA 4OH1A 1UAAA 1E6LA 3T4UA 2XAUA 1U8YA 4F3RA 1LEHA 4ZOLA 1T2FA 1AY0A 1J39A 1Z0DA 5EUQB 2UUCB 4OLFA 2JGRA 3KB2A 1SRQA 2P4HX 1Z4LA 4E09A 4MWEA 2X2OA 1YRWA 2QRQA 4X8OA 4I4TA 4NJMB 4V2IA 1YGPA 3ZZTA 5KB3A 2ACVA 3GC6A 3IAEA 1SBHA 4P4TA 1BG6A 2AQIA 4K2HA 4OQXA 3EEYA 3K2IA 4MV5A 3S2UA 4PU0A 4EY8A 1VMEA 5CM9C 4YALA 1EIWA 2CXSA 1N5RA 2H5LA 1C3OA 1G19A 2O2XA 3O1JC 5H3HA 3U80A 4BQRA 4DANA 2XI4A 2QR3A 1ESNA 2X8AA 3IP3A 4JYAB 3HXPA 3WXBA 4P0QB 2I1LA 2WTNA 1FP7A 1WD7A 3WBJA 1LPMA 2Y99A 4Y9TA 5FWYB 3FZGA 1MB2A 2XB4A 2E18A 2JJQA 5DK6A 2OHFA 3M4XA 1W4RA 3WLNA 1ML4A 2BGNA 3LXXA 1QO7A 4X63A 1ECJA 1EINA 1I7PA 3EMVA 1LPPA 2HL6A 2JIZA 3RVQA 2CWWA 5IM4A 4A2PA 5DGTA 1Q7CA 1N6LA 3IPAA 2PS1A 5CM2Z 1P77A 4M60A 1COZA 2CJWB 1QR2A 4OUDB 5AXCA 5LQNA 4S24A 1QE5A 4Q3AA 4BFLA 2HGZA 2WKRA 1U0TA 1E2FA 1QH1A 5K3FA 3TKYA 1TUBA 1XAHA 2WJHA 3ZC3A 4BNHA 4R3WA 1Y8QA 1P6XA 2A88A 4L4YA 4ZODA 1JJFA 4BB0A 2NSLA 3TUZC 1HTTA 1YS6A 2ES4A 2DJIA 2IFTA 2PVPA 2V97A 3MM4A 2P9CA 4RY8A 1JR4A 5D5HA 4PHTA 4ER3A 3P26A 2PWBA 1HRDA 5HNKA 4XSGA 1SUSA 3PXCX 1Z82A 4RMHA 5KC9A 4TMWA 4UTOA 1R74A 1B15A 1YTLA 1GAWA 2OBLA 3FR7A 4U9IS 4X1YB 3WNQA 4YT4A 2IEIA 1K0FA 3HSKA 3TQOA 2K6GA 2Q28A 2UVPB 3VR5A 5AUOB 5GGXA 5KYTA 5B6JA 3DHWC 4TXNA 3ISVA 3TE6A 4IIXA 2ZU6A 2R60A 1P74A 4Q6BA 1JIIA 3NU1A 3V3TA 3AFOA 4RAOA 2WE8A 2FLWA 3DNPA 4HRAA 4PAQA 3WLLA 1DAPA 4KYVA 3OSUA 2J0EA 1Z8DA 1DAIA 3A05A 4FW9A 4IXTA 2Q4EA 2BGUA 2JFNA 4CV2A 3NT4A 4JQOA 4PSKA 2ZBDA 4LXUA 1NM5A 1H8EA 1VCNA 1SCQA 2AN3A 2WUGA 4HGQA 4M9UA 4WVFA 3WGIA 3BHJA 4CM8A 5ETJA 3O91A 4Q4CA 3LX8A 3FYHA 1NP7A 4CF4A 2QENA 1E9VA 1SBQA 3K32A 1EG7A 1T43A 3PIRA 4DQDA 1FC0A 1VCMA 1KXJA 4PX2A 4HB4A 4YCBA 3WLRA 2R8OA 1RAFA 3D3QA 3VHXB 4GWLA 4GH5A 2FI1A 5K0LA 4BP3A 4C7JA 1T5IA 4OOFA 5DHFA 3QUCA 1GPAA 1UKYA 3CVWA 2IE0A 2RHTA 4E22A 2FSPA 3FUWA 5IKOA 1L7XA 4DB4A 4K26A 2LCQA 1Y1TA 5AW4A 2DKFA 1U11A 1TD9A 4PG8A 2BHLA 2QTTA 1M6WA 2CDNA 2R6AA 3RVLA 1QH0A 3T7EA 3E3LA 1SXQA 4YJGB 5JYEA 4G1VA 3R5HA 4O0MA 4FUQA 2JKVA 2WWIA 4IJUA 4URUR 1JQLB 3ZWMA 3ONDA 1FXWA 1T91A 2QTAA 1C29B 2UZIR 2EEZA 3BMNB 4Q4HB 4A73A 1L4LA 1SBZA 4IJMA 2NTJA 1JAYA 1JHUA 1LSJA 4FEAA 2I3BA 4JQSA 5CB6A 2JA1A 2YRFA 5DLDA 3AHHA 1U2EA 2EJTA 4RTMA 1WB9A 1VKNA 1FYWA 3GUUA 2HYIC 1XA4A 3KG2A 2JI7A 2B4KA 3O4GA 3HWSA 4E46A 1HC7A 2GEUA 4YR9A 3IEVA 1X7HA 1OLUB 3I8XA 2RG7A 2DGDA 3BPSA 2QX4A 1V1RA 3LY5A 2I2AA 4XDGA 4ZK6A 3PDIB 3IP6A 3ZCPA 3W6ZA 2Q2OA 2WD7B 1QH8B 3AY0A 3FDFA 3B82A 3INNA 4YRRA 1BVRA 2ZJAA 1X7WB 2BKAA 3HZZA 1LDBA 2XUZA 3IVAA 5D7BA 3SC6A 3TLKA 3WI7A 1Q1AA 4HWGA 1Y7IA 4OKSA 4FT2A 3TLCA 2D0OB 1PD0A 2HD4A 2IHKA 2YUIA 4E6EA 4ZKDA 4E14A 3IP7A 2JCYA 2Z9CA 1RD4A 5DYTA 1HZJA 2O1XA 1WZEA 5HCUA 2PMWB 4UDYX 4BVHA 4JSRA 2XNJA 1FNSA 3CX7A 1WZUA 1QGDA 3VX4A 3GQBA 3BHMA 1OU0A 1V71A 4CI9A 2QD2A 3CRRA 1U7XA 1XJWA 1Z4QA 3IMKA 4PLFA 1H9AA 1XCJA 1N3IA 1LRJA 1LQ2A 5G4KA 5A05A 5CX1B 1QGYA 1GUAA 1RAAA 1ZD2P 5FLXA 1SU7A 3WLKX 2GM9A 2QRLA 1NZFA 4KLZA 3PX7A 1JDBC 5I9BA 4U5QA 2AFIE 1HDOA 4HQNA 4IINA 4X71A 1PRYA 2RC5A 4NWIA 4DARA 3LL4A 3K16A 5EKSA 1XZDA 3FUUA 5DNEA 5JCXA 1II8A 8OHMA 3GWZA 1N5IA 1L4HA 2I2WA 3STVA 3ZCVA 3ZDRA 2ZT7A 1WU8A 4WLVA 2NSYA 4L27A 3OJOA 2Y1EA 3KZKA 2OQVA 5LA6A 1QHIA 1KDVA 1JFTA 4KX5A 2C9YA 5BN4A 3H4VA 3PK0A 3HFSA 1NM5C 2WE7A 3PKJA 4QDTA 4I3HA 2PJZA 1G16A 1ELOA 2W93A 1N2ZA 3EHDA 3CPEA 5HPYB 3CJTA 1YQ9A 1IHOA 1GHTA 2J0VA 3EAFA 1U2TA 4A3SA 1HO3A 3DHNA 1KI6A 3RR2A 4JUFA 3GD7A 1BMDA 1XYVA 2FVXA 4QPJC 1P31A 2XRMA 3CS3A 1WUYA 4QECA 4FD3A 3PXBA 1LY1A 3HJNA 4BX9A 1VJDA 5EQFA 3K8YA 4KN8A 2GZRA 4CBVA 1PJCA 4D1YA 1W4ZA 1EVLA 2G5CA 3FUTA 3KOOA 3BH7A 3GRVA 3DO6A 2FCAA 2HPHA 1RWXA 1F8FA 1LDNA 4IXWA 2OGSA 1VRCA 4U8GA 3SK0A 3C6MA 1SD2A 3GNTA 3TL3A 5DKFA 4F4HA 4LW8A 8AT1A 4EUNA 2XGJA 4BB5A 2CK3D 3L0IB 4LQDA 5JHHB 3RRZA 4KTTE 5COAA 1MT0A 1NWHA 4PQFA 3I1YA 3SZLA 1Z63A 1C7IA 1GAEO 3RS7A 5ICGA 1QIDA 4YREA 1TQHA 2B1QA 1D7AA 5FBRB 4HT3B 5LZ2A 2G67A 4C4SA 2K87A 2XXAB 1YA4A 1WBDA 4B6SA 4WH0A 1J90A 2WZQA 5EY5B 2RBEA 1T0UA 5C81A 1PDWA 1V0JA 3NRCA 4PNPA 2BZGA 5IDVA 1XL0A 3LI2A 5AJZA 1QYRA 1KA9H 4CE6A 2RGCA 2XKAA 4OB6A 4Q7EA 2BGRA 4YDQA 1F2UB 3FVTA 3SXPA 3QMMA 1OB2A 4KYIB 2AV6A 3WE7A 3OOEA 4NTZA 5E9AA 4EPYA 1EHCA 2ACKA 3VGPA 5JFTA 4ZQCB 2IYUA 1SRRA 3RIMA 1ORTA 1AXRA 2P30A 4GICA 2WD9A 3PE6A 3AV0B 3NKLA 4TV9B 2F8TA 1AKUA 4CWAA 1G41A 3VAZA 1MZPA 3MUOA 4REQB 1KMIY 1C8LA 3IRVA 2X3YA 2BI4A 2Z43A 3H99A 2EP5A 3B60A 2GJAA 4FC6A 1KDYA 4B6OA 3KZOA 4RY9A 2XMBA 4FYYA 5FEUA 1B6RA 1GDDA 2JFBA 4R1MA 5I4IA 4LDQA 2D1SA 3A0RB 3RSOA 3A2KA 4IWNA 2CCKA 4ZN6A 2PS3A 2VBCA 1BS9A 1GPYA 5IKMA 5FUVA 2BBTA 4NFYA 1QPBA 3BEOA 3PJGA 3EVAA 3PNQA 1TTPB 4NYMQ 3H0KA 4MX8A 4QO8A 4EHFA 4U6SA 1KDRA 4TMXA 5FFMA 3OU2A 2XVXA 4KBFA 4BNYA 1J21A 5KTPA 1RYMA 3C5WP 3RTBA 1XEXB 4G4SP 3MRSA 3R0JA 2RHGB 1X3LA 3N5KA 4HLUA 4Y2SA 2YVAA 3FFTA 3TCKA 2DULA 4CCYB 4Q47A 1NNUA 1QQTA 1NI5A 3CCCA 3HMQA 3U6BA 3CLUD 1VE9A 2RGYA 2CVQA 3TUIC 2CNNA 5LVAA 3HA7A 4KXUA 1T9DA 4OKNA 4ENQA 5MN4A 3QKSB 3O7MA 1NF8A 1GAQA 3BWDD 1O6FA 3BJZA 1Y3FE 3AFIA 5AUPB 1R8SA 1DMRA 1XRSB 2BMDA 2IBMA 2RMKA 4N5IX 3TWOA 4JU8A 1TW3A 2AG0A 2J9ZB 2ONZA 5HZGA 3IKVA 4MVJD 5AKZA 3IAFA 3LSYA 3FZQA 1YMUA 3ZE9A 1WPXA 3WRYA 1ID1A 2ANCA 2BIFA 3WWCA 5IDQA 1EK5A 4QM6A 2FEPA 1QKKA 1GNRA 3THSA 4K0KB 2OV2A 1E1NA 2OGUA 3JRWA 3BS4A 4LOLA 1I10A 4XDHA 1Q22A 1OTYA 4U02A 3RIEA 1K3TA 4D4KA 2YQZA 4ZREA 1YUMA 4B8ZA 3NBQA 1UMBA 1C41A 2H2FA 4K6OA 2I91A 4AP9A 5H81A 1S3SA 5I9MA 4G0MA 4YRPA 4B80A 4CIYA 4KRGA 5JEDA 3RE1A 9LDBA 4BO1A 3WYBA 3AF4A 1EWQA 2PGNA 4TUYB 4TT3A 1GZUA 2A5YB 5EP4A 1BCRA 3PI6A 3ZLJA 2WLTA 3EQ6A 1HRKA 4R3UC 2VF7A 4MZXA 3WFIA 1XXHA 4DUZB 3UCFA 4Z0TA 1GNTA 2FKAA 4CDGA 5ELLA 3IA2A 3TL6A 3LCVB 4BQNA 2CZCA 3U2QA 2FU5C 3VVLA 4F5WA 3BTOA 3V7NA 3EPHA 2G4CA 1MENA 1RYEA 3IC5A 1GCOA 5IYZA 4L0QA 3TNFA 2D1YA 2QPTA 4AWBA 4UJ5A 1FSPA 4PZ0A 1AIPA 2WJYA 4RA6B 2W6PA 5CXUA 5FUMA 1PZNA 2GHIA 2NSDA 2PA0A 1FTYA 3DZCA 1ZO8A 4CM9A 5L4NA 2QY6A 3RC9A 3HDVA 5ALSA 1QHNA 1W75A 3HKBB 4BLSA 4LYJA 1JEJA 3PX3A 4OJMX 4Q4AB 4L5YA 2F59A 4XWKA 4LDAA 1XN4A 3OQJA 2ENUA 2C4KA 2NG1A 5AVXA 2HHLA 3NTQA 2E4YA 2RK6A 4LRXA 4XYLA 4MZDA 3RBZA 1OA0A 3NC0C 4GOOD 4PRYA 3UWOA 1FP4B 3X1DA 4GMHA 4FKBA 4HZGA 1MFPA 3EHEA 1F0KA 1PYDA 4G5QA 4XYBA 5FUBA 1LW7A 4HV4A 3ZHXA 1XNHA 3T5GA 5J4YA 2IUYA 1WTAA 1A8QA 3CSSA 3GP3A 5FWXA 5CBKA 2WU1A 2XT6A 5HA5A 4TWIA 4DYDA 1AGNA 1M6YA 2QGFA 3OFVA 1Z3IX 4DV1B 3IQGX 4DBZA 1PR0A 4GGMX 1F2TB 1CEQA 4NDNE 3CNNA 4MINA 4ZQFA 3LOQA 3ISTA 4FFNA 3HA2A 2RGBA 4JLPA 1EFAA 3QVTA 1I80A 4GZ6A 2VH5R 2ZRIA 2I55A 3HUUA 3I12A 5ESDA 3Q9NA 1IYZA 2HQRA 1KOLA 3S44A 1CETA 1YIDA 4KZPA 2VRNA 3W8EA 2Q5IA 3UA4A 3BG5A 4PCVA 1QBGA 2CNWA 3CWQA 4ZOBA 3MINA 2PR7A 4XD7A 1Q0HA 2YJZA 3IKMB 4OI1A 5K0CA 2PZLA 1E2HA 3DVLA 1JIQA 2QGZA 3ON5A 4GE3A 4BGDA 1O1YA 2PAFA 2R48A 4RQAA 1SU6A 3RHTA 2HJRA 3JVVA 4HLUC 1NE7A 4AKEA 3ZYZA 3DFZA 1SD1A 4IKPA 4MPJA 4MWBA 5AQEA 3L77A 1QVWA 2IXEA 4OTZA 3R6DA 2VUTA 2P4UA 3QOWA 4DT1B 3H5TA 4K6FA 1XELA 3MIZA 4QBFA 3GFBA 1TXGA 2F1HA 1MB4A 1ZUHA 4JL8A 4UPVA 2WICA 1TMYA 3E3NA 1KAEA 1UKEA 1P60A 1XAJA 3EPPA 4HTAA 4M7WA 1CNEA 3M5PA 2BCGY 4IGKA 4R8LA 3E9NA 3RC7A 4JXZA 3DOJA 1EM8B 4DJEC 1GA1A 2E4VA 2C2MA 1IM8A 1QO0D 4KO3S 3WRYC 3H5RA 2WIKA 4IFIA 4UUQA 4FYPA 4DDWA 4MGIR 4CQMB 1RADA 3KYCA 1PJ4A 5BORA 1Z2CA 4PZZA 4IG4A 2C5FA 1Z4PX 3AFNA 3HBAA 4FYMA 2C2WA 1SEPA 4XE5A 1GP2A 5K3BA 3ZGLA 3GVHA 1YHYA 2PPVA 1Q0UA 2M9MA 3RS3A 4DNXA 1U8EA 2CFCA 2C04A 5FBKA 3R7FA 1VSUA 2J41A 1EXVA 1GG8A 2CF6A 2WWGA 1WVIA 1GPDG 1QH9A 2F67A 1AQIA 1PSZA 3DL4A 3H1GA 3ZU6A 4BVKA 4I1RA 4AS3A 3PEFA 4U7PB 1SCAA 1U0GA 3IBCA 4I1OA 2EW8A 2MR5A 2AJDA 4KSBA 1R9GA 3IBGA 4HH1A 5A7GA 2BR5A 1E92A 2GM5A 4MS3B 1R4ZA 1S9DA 4H59A 4LI3X 2HBRA 2V4ZA 5AIBA 2BMJA 3GY0A 4PTYA 2J31A 2A94A 3HSYA 3M6VA 4N5HX 5JCPA 2JLRA 4KBGA 1H2WA 1XDGA 1O08A 2GETA 5KMGB 3VI4B 1NN1A 3SC2B 3DCYA 4HTFA 4IIUA 3R0IA 4QE3A 1AJEA 2EKZA 1JFVA 3UV3A 3O26A 1TI7A 1FFXB 2JKZA 2G63A 3KYDA 3DKKA 4HAXA 4L74A 4UDOA 4AP6A 2PEYA 3QKRA 2C9BA 2XYPA 3BDIA 4MVYA 5DX8A 1TU0A 4HNSA 5KTKA 3HO8A 4FZ3A 3NVAA 3MQFA 3WGJA 2LW7A 1YVDA 4Z51A 1AHNA 1SH7A 2BEWB 1VJ5A 5CYPA 1LPBB 2HGSA 3AKCA 4WL0A 5ENZA 1UKZA 2QU8A 5BMVA 4ZV9A 4B5LA 4HVTA 3WLHA 5ED0A 2VZ0A 1KYIA 4BS9A 4P93A 2VDUE 1I3CA 2HRDA 2ZR0A 1BROA 2FN9A 4M0EA 2VJMA 4BLTA 2OFOA 2QV0A 5TARA 2P4QA 2H48A 4YYEA 3CKMA 1CY0A 3VJMA 1VMAA 3UJ7A 3EOAI 1DUIA 1VIYA 3OECA 2POQX 1GKKA 1E2MA 2JRCA 5JRJA 4A0FA 4MQLA 4UEJA 1DRVA 4OQDA 4TZ0A 4TLMB 5CFQA 1MO3A 5HVNA 3ZN2A 1KHTA 1P7YA 5B4UA 1KYQA 2BKVA 5FTWA 1C9YA 3JAMA 1AG9A 2VSQA 5B3KA 5K99A 1U8ZA 4WOBA 2HMYB 3WL6A 3OKAA 3ED1A 5CVTA 1DLJA 1TYEB 1E96A 1ZXLA 1E2UA 1XC7A 2X3UA 1QLWA 1J5PA 4LJ6A 5DRYA 2W4QA 2YH2A 3IDSA 2XUFA 1YA8A 1JKXA 2YJ4A 4FLMA 4INOA 2F43A 4Y1RA 5JBQA 4AROA 2YYZA 2C3YA 1V3TA 3DCIA 3S2FA 2CL6X 4C5AA 1YTUA 1EFPB 3AIOA 1K66A 2H9YA 4W82A 3SQDA 5JNRA 5J59A 4BNGA 1YZGA 1ZUNA 1FFSA 2CL5A 3UCXA 1QDEA 3KC2A 4D57A 5K8LA 5FIUA 2VTBA 4LYFA 1LPOA 2VP2A 1B8NA 3BMOB 4QFCA 4HO1X 4LK2A 4O2AB 1FNMA 3AHDA 1N32B 4FM9A 3K35A 4RFSB 1V2GA 2W7TA 2VHZA 3N0RA 1AD2A 3OFNA 3T9EA 2QT1A 3A32A 3L4BA 1Y3CE 3O6VA 1KAMA 3OJXA 4FZRA 4PN3A 3G7SA 2R44A 4LK3A 2X4DA 4ZP1A 3U3DA 3DOEA 4YJHA 4XEUA 1QCZA 3BKWA 2O20A 3WGZA 5CLQA 1BHJA 2OWEA 5KKAA 3A0UA 1M76A 2GT1A 4CIAA 3PEWA 2VP6A 3H5VA 3NKFA 3TD9A 5E3HA 5B1IA 2PKRA 3AHEA 2YY5A 3GJ7A 3ZIUA 4NMLA 1SQSA 4R5HA 3BVPA 4MAFA 4B3JA 4QEKA 3QE0A 1E3EA 1RKVA 5ALJA 1KMMA 4OLAA 5BQFA 3KFVA 3HP4A 3L0PA 3N8KA 4BZXA 5A4MS 5B1SA 2J0SA 2HZ7A 1OYOA 3HUTA 4LJAA 2QZZA 1NF2A 1I3KA 2VDJA 1MX1A 1ZICA 4HNUA 2JIBA 1TEVA 2G9QA 1PBNA 1L5YA 1ETHA 2ZJ5A 4L9AA 4LXTA 5DU2A 5EIOA 5TVGA 2Q7OE 3UFXB 4DCVA 3JWGA 3QKUA 2BFEA 4LQ4A 3UWSA 3I5YA 2LP4Y 1T2CA 2P65A 3L7NA 5GJCA 1ADBA 2W6MA 1U2GA 4P0PB 2YZKA 4M7OA 4GD3Q 3WJ1A 2C03A 1DBRA 1ZRMA 3WLPA 1B3RA 5AO9A 1SN7A 4LNHA 2V74B 5L3VA 2IU3A 1L7AA 3Q11A 4CUJA 4F3CA 2CHUA 2BLLA 3DB2A 4KQEA 4X64B 4U2EA 1ZI6A 1E3WA 4CU2A 5AW9A 3IUPA 4BTLA 3Q7RA 1ZPDA 1A69A 5B2ZA 3MCTA 2CDRA 2QVYX 4RMJA 1JG2A 1CQZA 4IDQA 3NHUA 4MWZA 3LA8A 3PVZA 1M5UA 3CA8A 3IYLW 4PWYA 3CXUA 3X2FA 1Q11A 4KQ6A 1XCPA 2HEIA 3DDNA 3HCFA 5CVUA 3DL0A 4CEJA 2QTVB 2E6KA 4YR7A 2AMVA 2EHJA 2EBHX 2Q9CA 2XVAA 2OFWA 3C3BA 4LXGA 2OHJA 4QBHA 4WK2B 4X91A 1JX6A 2HIHA 3WMEA 3C3XA 4BC0A 4CKWB 2V6JA 1G63A 2H3EA 2JBWA 3QEOA 2NUTB 4PEVA 1ISFA 1YCGA 4QJ5A 3VR3D 3CRNA 3KDSE 1GZ6A 2IPXA 1JQBA 2NXCA 5H70A 2FUNB 2DLDA 3C6QA 4TLEA 3FGPA 1KZYC 3NQ41 1MAVA 3BSSA 1WMAA 5DFAA 1KK1A 4D42A 2Z09A 3MCAA 1P7CA 1KC1A 1QM5A 4ZI7B 4LF4B 1EWRA 4YT8A 3THWA 1SA0B 5IAKA 3QTTA 2EG9A 4RMIA 5CYFA 4LUCA 4YP6A 4F11A 3EBOA 4WKOA 3O73A 4HSGA 5AIAA 4IFEA 1ISPA 5KYYB 4DSZA 4EITA 3V33A 4DEVA 3DKPA 1ZNXA 4AUKA 2FWRA 2ECQA 2HN9A 1YS4A 3DDZX 1SPBS 4BWGA 3Q5DA 1RSZA 1EVKA 3KHSA 2CB9A 3HY3A 3WIVA 7REQA 5CAEA 2WIJA 2IHZA 3SAJA 2W90A 2WMOB 4MHOA 4WASA 3GLRA 3MOSA 3ZHUA 3TSYA 2QX9A 3MWYW 4MARA 3TQFA 5J4HA 4J8PA 2H4JA 3L40A 3OAAA 1T4CB 2W6OA 1TDJA 3OEED 3NFRA 3Q0TA 4IFBA 4KNWA 1E6MA 3RT7A 1C1XB 1R37A 3WOHA 4QLBA 1G8AA 2F8SA 4KK3A 4KQCA 2I7VA 3FOEC 3N2GB 3F6RA 1C1HA 2QAGC 3KM0A 4UMDA 2JBAA 3ROPA 3VOBA 5C51B 4JUDX 3PNVA 1KY4A 4JZKA 4LXIA 3C6ZA 5LIPA 1HE8B 1C5KA 2AXQA 2BH9A 4ZOQI 1D2NA 5AK4A 1W4AA 2WF5A 1J99A 4C3VA 1ZGAA 2QN9A 3R7AA 1WHTB 2OHHA 4HEA6 1SVMA 3Q3GE 4KQIA 4Q24A 2RIPA 3HKEA 3OKFA 4QXQA 1UBUS 2J3JA 3EAGA 3ZY2A 4EFNA 1E1DA 4BO5A 1CERA 3M1AA 3UJ6A 1NN5A 3UCEA 4B0PA 4ZVKA 1R9MA 4HX2A 4O4JA 1SNYA 5HQ3B 2W2NA 2QWXA 4X9XA 4OQEA 1W5EA 3FJYA 4QGBA 4XXHA 2WWFA 3CO5A 5JBIA 2ONCA 1R16A 2HHHB 5IJZA 5CCXA 5TQJA 4P4LA 3VZBA 3AL2A 4JT8A 5H82A 3FWYA 1OLSA 3ZCQA 4YRMA 2CXNA 1VSBA 1WBBA 4Z3DA 4F3KA 1JA0A 4EJFA 1P1IA 1TFRA 4MLCA 2XCOA 2WZCA 3ANTA 1NLFA 3ESYA 2RARA 4CF6A 5IVPA 4RCVA 1BOFA 3PC4A 3OM1A 4CLOA 1YJBA 3D7NA 3GNSA 3NM4A 2P5YA 4GQIA 5FTMA 5AM2A 4JQCA 1U2GC 2ZSDA 4I6GA 1TUBB 2ZROA 5FA5A 1UDRA 2Y2UA 4O2RA 5KINB 4Q37A 1H85A 2JD0A 3O8LA 4EG8A 4HFJA 4B83A 2XHEA 4P4UA 4BLRA 4EG4A 5I3CA 4LJSA 5GONF 2FEAA 2OBFA 3SJUA 3BKXA 3U49A 1OFGA 2M98A 1PK9A 2XSZA 5DSXA 4YAUA 3LQ1A 2FUKA 2AKAB 5LBTA 3PTAA 4LJ4A 4UHCA 3U17A 4FEGA 1X74A 1UAYA 3CXRA 3I34X 3QY9A 3IO5A 1JDBB 1OBVA 5CLLA 3AI7A 3KEOA 4FFWA 1X6VA 4M87A 2PFGA 5F2OA 3MFYA 4MLPA 3P1JA 4MPTA 4NDZA 1ZVKA 2V5VA 4FKMA 4LJ9A 3D7MA 3RSCA 5KSZA 3ADKA 2ODQA 2QTNA 3PNBA 3G79A 2PX4A 5L3SA 2IXGA 2O6HA 5JJCA 3NC4A 5CD9A 2L0XA 1W47A 1XUOA 3S2IA 5C4MA 2FZWA 5BT8A 4J9VA 5JD5A 4BNDB 1HZZC 4QXOA 4P3NA 1ENOA 4FYWA 3ANMA 1KBQA 1N7GA 2VCYA 3BE8A 4LDZA 3TOCA 5JH7A 2WI8A 1R4MB 4ZQIA 3U56A 2V0GA 4N0PA 1Y1SA 1BJKA 3FHTA 3SEAA 7GPBA 4H9GA 2FSIA 2HC9A 2OLKA 4WFJA 2JLSA 5DGCA 2Q2WA 2AEFA 2W6ZA 3D3NA 3NIWA 3WIOA 1KTVA 3QWFA 4KMMA 4EGJA 4NQZA 1TT5B 2XA2A 3IAUA 3IS3A 2I5PO 2OFXA 1NZDA 4QREA 4RZIA 4UEWA 4EIWA 2UXBB 4ZEVA 1CY2A 1JDZA 5D00A 1PO7A 1F1JA 1MOSA 3AUJB 3O75A 1UMKA 3NHRA 4WY8A 1I51A 4B3FX 1ZZEA 2AQKA 1RQLA 2C4NA 3WNBA 4BXOA 5TJHA 4EG7A 10MHA 4H7IA 1DAEA 4I6JA 4DZTA 2YKGA 4GO1A 5EYPB 1J07A 4K2AA 2Q3FA 1JRLA 1FW8A 4M9XA 1FUUA 4BBZA 4E5PA 1IOWA 3CUVA 3MSCA 3I2KA 4IEEA 3SFTA 3TLEA 4PNEA 5EJ6A 3A2LA 1V9CA 2Z08A 1ZGGA 3FF1A 4TYQA 3F3YA 4BKQA 4IIJA 1G98A 1UINA 3QELB 4AQ7A 1PLKA 1Y82A 4XUCA 4OGFA 3IMCA 1IBRA 2JCVA 3JQ7A 2N47A 4NV1A 4ZRNA 3RHZA 3AR7A 2ZE8A 1G6HA 4DTCA 4JASB 3PXAA 2AGVA 3GBSA 4C7KA 1A9XB 4IMJB 2WHYA 4RPCA 5E2IA 5EWJA 1V1RB 2F17A 3TRDA 3KWJA 3KUCA 4GYKA 2PHZA 3GX1A 3H5IA 3HJTA 1PR3A 5C7YA 4BN4A 4FJ0A 4EUEA 1USUA 3NJ4A 4HDOB 1PR4A 4QPDA 4WK4B 3VYVA 3MLEA 4MRVA 1TE2A 2Q6IA 5JDCA 3A04A 1CQIA 1A4IA 2JFGA 3GFFA 1SQ6A 4FOPA 4MHSA 5ALQA 3SICE 2OESA 4C7OB 3LBFA 1IUNA 4NOLA 1RAIA 5HFJA 1BEZA 1FVHA 3DBLB 1G1MA 3EEBA 1D07A 4RGVA 5AVTA 3PHJA 2MCFA 4M8LA 3OM9A 3ZQJA 3IQXA 2VK2A 2QL6A 3CUSA 3A1FA 2DUMA 9MHTA 3IX7A 2CD9A 2B1GA 5FP0A 5M3BA 1EXMA 5KI6A 2L19A 1PD1A 2ODTX 4DPKA 4ERXA 2BT4A 2YBDA 1VQ1A 3GQBB 1RHQA 3MS7A 3SJ7A 2I6XA 4KR3A 4UHKA 4QGSA 2BP7B 1JDTA 4E70A 1CY8A 2EP7A 3K9GA 3GBPA 1E0DA 3IP1A 3GFTA 2DCMA 3PF8A 5J58A 2BTEA 1YI0A 4C5BA 4Z6KA 2XE8A 3P9IA 2ID8A 3UMFA 2NAFA 1DLIA 1IHPA 5AYVA 4LMPA 1EWKA 4XX0A 2CBZA 3QW4B 5HILA 5K2MA 3RPEA 3TK1A 1WAMA 3MTDA 1LJUA 1Y6JA 2SCUA 3NWPA 4PR0A 4YWHA 3H4MA 3OE4A 2HTFA 2O3QA 2W48A 5SZHB 1ESZA 4EK9A 1XPRA 1JTEA 4MUAA 4LE0A 3BWCA 3ZDXB 2XYRA 1PS9A 3H2SA 1PHRA 3CF0A 4KWHA 1FDWA 4I3FA 5EQJB 3E9YA 4XPIA 5KOJA 3AG5A 2WMDA 3ZZ0A 1CB0A 1OJ7A 3LDAA 3NRJA 3KKZA 5IKPA 1OA1A 3RC3A 3WGTA 5HKKD 4UD2A 1BWRA 4C0WA 1B2RA 4O4LA 3LPNA 2IJGX 3TDMA 1JZSA 4DKJA 2PFSA 4GOLD 2F6RA 1ZGBA 1L5LA 1X8LA 4AG6A 4W5JA 4M49A 3L7LA 5L7TA 2B21A 4TKLA 1PBTA 3FD8A 4B4DA 1OKKA 2WU0A 3W3AH 1MAUA 3CF6R 1NVVQ 2JARA 2ALJA 3DKVA 1N9ZA 2QMZA 5IKXA 4YJKA 3TG8A 3R9XB 1WABA 4AMZA 3LK7A 4UM9B 1A2BA 3CINA 3Q85A 3NIBA 2RH8A 2AD1A 3Q41A 3EULA 1PNOA 1HGXA 4K9NA 3ZZ1A 3M5DA 4FNMA 5FWDA 5D3ZA 1UQUA 5HOQA 3T7DA 1W5AA 1E1QD 4J7CA 3T3DA 2WM8A 3EXG2 3GVCA 2VR1A 4OQFA 3LP6A 5H68A 1RMQA 4ALKA 4GMFA 3QU2A 1JDNA 3JYOA 3LCRA 4PGAA 3AF2A 3MOGA 2WD8A 4L3OA 4XRRA 3RUAA 5TQ2A 3LOUA 5TS3A 1ZOSA 2AZDA 3D6MA 1WEKA 1SIUA 3D8TA 4Q01A 3DE6X 4AFNA 1FPQA 3NEPX 1SQ0A 1NVXQ 1SHZA 4A0QA 4CFSA 3BQ9A 1IXZA 1LBQA 3CVOA 4V2UA 5B53A 3VBCA 2YHIA 2WNHA 4UXJA 3E9RA 5CIYA 1CIJA 3T7KA 5F7ZA 1K7SN 2ZUEA 1QU2A 2CT8A 2JHPA 3TCXB 1U7TA 1EQAA 2ZQ5A 4RL4A 1JEQA 1MQAA 4GL4A 1F5SA 4F45A 4HLCA 2H54A 1OXKB 3FBGA 2FXVA 3COPA 3EAQA 4JSTA 4RORA 1XDWA 3I4LA 3G0OA 2WHRA 2P6RA 2NYAA 3D7LA 2NTYC 4OQQA 4CM4A 2AF3C 4QQRA 4FKZA 1B6TA 1UMCB 1R0RE 2OFFA 4HDMA 4PZDA 4DLRA 4FYXA 1FFDA 3KQKA 1OYVA 3KSBC 2QL7A 3NTUA 2D2EA 5KVSA 1K7EB 2WQ6A 3DVQX 1L8OA 4LDNA 2YXNA 3A6GA 1HPLA 1YHZA 3BWVA 1DKLA 2BC9A 2C58A 3AYXB 4IF6A 5EWMB 4Z0HO 5D84A 4EBBA 2JFHA 4LXXA 5KHAA 2FSHA 3K1TA 4KKXB 4TN5A 3VAYA 3MRTA 4D81A 2ZUUA 2VXBA 5EHNA 2G77B 4FINA 1CR0A 2PH7A 1F2DA 3ZE7A 1SUWA 1U1DA 2OCAA 3DLCA 3EIHA 3KOXA 3WHIA 3HU1A 1H6DA 1X3SA 2Q4BA 3D0OA 4NYJR 4PLPA 3RRJA 3AJRA 2IXFA 2VATA 3BC1A 1R5BA 3RRXA 3PKZA 2DB3A 4MA4A 1KY3A 4ROSA 2HTEA 3MD9A 4PO8A 4S0XA 4NIMA 5JASA 1NJ6A 5CVEA 4PFSA 4F38A 1L5MA 2H65A 1R5OA 4ZDIA 2FMXA 5ADVA 5DNWA 1IUOA 1B0AA 1N2XA 1UJ6A 1F06A 4OMCA 5IARA 4PRLA 1UDAA 1BA3A 1PGPA 3ND6A 3W1EA 2FX3A 3K0KA 4M8KA 2XZOA 3G0HA 1DTWA 4OJTA 5BPFA 1EBBA 1RC0A 1IQPA 1P0MA 1RRFA 2QMOA 5E7QA 3LY7A 4WK0B 2BEUB 1VSVA 3MS4A 5M2QA 5I6DA 1V9SA 1CQJA 3HU3A 3R5JA 4HC4A 5CTAA 1CEYA 1MJFA 2HCJB 4JJZA 3TO5A 2HWYA 1IC6A 1PGOA 1DX4A 3PC3A 1ORDA 1X80B 2JASA 5ICFA 3CN9A 1S1CA 1I9GA 2ZB4A 4LF7B 1X15A 3TH5A 2XDQA 3D4NA 1WMFA 5FNVA 4NV3A 3OQ6A 3HGTA 3K2QA 9ABPA 4ZRDA 2JAHA 2H1CA 1X42A 1XXHB 1AB6A 1L4MA 1J22A 1YZ3A 2AMYA 4XIGS 3I45A 5I47A 2CC2A 4JVSB 3VNSA 3OLXA 1UL1X 4DYHA 1W5BA 4QWMA 4YFYA 1WOMA 4QYTA 1D2RA 1HEYA 5FHQA 2J6HA 3TRJA 3U3MA 2QPAA 2QNIA 4MW5A 1Z0ZA 2E89A 3CB2A 3CG0A 2X5OA 3M82A 3KOUA 5JNSA 4FX2A 4FBLA 1PVOA 2W6IA 5DSTA 1HBJA 4IL5A 3H6KA 1QE0A 3COWA 1IBKB 4JLUA 3RS9A 3MGAA 1YNOA 3QU7A 3RQSA 5G1NA 2VDPB 1RM5A 2KJQA 1N2IA 1NJSA 1BZYA 3DOUA 4R05A 3MT0A 4BIIA 5BQXA 2H0AA 3BYZA 5G3YA 5GOTA 4BNXA 4JUBA 4OU5A 1YBFA 2AJTA 3QF4A 4FYJA 2ZVDA 4DUPA 4UQLA 2WP8J 4Q39A 3A3YA 3BGIA 1HDCA 1Q17A 2WV9A 1P2SA 2Y3IA 1JT2A 1W35A 2ZSBA 1PGQA 1PJBA 3EWSA 3Q98A 4FUTA 3H75A 4FDLA 2L18A 4N7MA 2AX3A 4QBTA 5AJWA 5FULA 1PJQA 3SC3A 3WQSB 3E1SA 1C30B 3CNBA 5D86A 3QXGA 3W8NA 1LVGA 3X1YA 3DMPA 4CCWA 2MSCB 3QBJA 2YIVX 4YI3A 3DFUA 4JBXA 1YJXA 3PNYA 4KWTA 4MRMB 2CLCX 4R81A 5K51A 4HLQB 1U7DA 2C9MA 4HR7A 5AVRA 5A7FA 4PYNA 3IILA 4J49A 1V43A 1YKSA 4F1JA 1TD1A 4YAGA 3RAFC 3IERA 3OEYA 4OQNA 4EY6A 1G5PA 1B8PA 1JF8A 1OE0A 1RLJA 3VKGA 4RJJA 3QMVA 5CT4A 5BVGB 1Y6QA 2WJGA 3X1KA 2VDWA 3EN0A 1ZW1A 3RVSA 1Y6FA 4DEYA 1DQRA 3SYMA 1MC1A 4C7BA 4KFRA 4TXMA 3KB8A 4B74A 5KDOA 1OWNA 2UKDA 2DPGA 1M6HA 1Y7PA 4EL0A 4KN9S 2KSQA 2Z6VA 1R0CA 5B3AA 4HNTA 1VBKA 2Q3LA 3PHBE 4L72A 2ZRMA 4UHFA 1WCIA 4JI7B 3EVNA 3BIJA 3G49A 4P2BA 4PRKA 5MDHA 2JH9A 4QZVA 2B30A 5LYJB 4P7FA 4EZEA 3ICQB 3SQNA 3T5AA 1VE3A 2LGJA 1SKYB 2O2YA 5E8JA 3W34A 4EMSA 4S2EA 2E85A 3WZ2A 2F3RA 2XXBA 1U8FO 1F7UA 3MWEA 3RRNA 4EECA 3Q9UA 1EXDA 1EBFA 1I32A 4JB0A 5CCBA 1G38A 2ASEA 1G2QA 4U7GA 2J6CA 1U5BA 3UVEA 1GA4A 4MWGA 4B2PA 1VIVA 3QYAA 2XBUA 4TKUB 4WTOA 4F6RA 5F7OA 1P17A 2R7MA 5HS4A 3Q1LA 4N54A 3KYCB 1YDEA 4BE9A 4CL0A 4MGZR 1P9WA 3B6KA 5KOIA 2P40A 5DVZA 2OGTA 4MYCA 2P35A 5E6UA 5K4GA 1EGVB 1QYVA 5BWBA 3STYA 1BXRA 3OCJA 3QPWA 2R8RA 1H05A 1T2UA 4LMBA 1OC2A 2SKDA 2IGTA 1W4BA 2A92A 2XPCA 3FX2A 3N0WA 4HPXB 5ENVA 4B3XA 5BSKA 3ORQA 4BNTA 3P0IA 1L4BA 1WP4A 1SWVA 2XADA 3HLTA 3RAGA 2NYRA 4D0SA 3IEMA 2ATXA 1DQZA 4A82A 1LK0A 3T1OA 3Q7EA 2O3JA 3KOWA 5FUWA 5IT0A 3VH3A 1ACJA 1N5MA 3E4DA 4U2FA 1A4RA 4Z7QB 3ZGYA 2R1TB 2WWWA 1JG3A 5KNDD 2JFFA 4LYYA 2AZMA 5KKCA 4B09A 1R15A 4H17A 5DCUA 1ZLYA 4CVNA 4NYIQ 4XVQA 4LECA 2CNBA 2C8KA 4A9AA 3JTMA 2FYTA 1RCFA 2VJDA 1THGA 2Q3CA 4JB3A 1EFKA 1PDOA 3QLTA 4WK6A 1CUSA 4MVJF 1IOLA 2H1HA 1IWPB 5B3LA 1PZMA 5EJ7A 2RK3A 1A9YA 5C53B 4ZC1A 5BMVB 4FGSA 1SG0A 4E94A 1HYQA 3AESA 3MMSA 3OZUA 5FA8A 2IH5A 2HJVA 3D0RA 5KREA 3ZHZA 3WBKA 4NG5A 4LCJA 4GLOA 1CUYA 3C1TA 3MBOA 4QVIA 4C2AA 1Z6QA 3GGOA 1T24A 4AYXA 2GZSA 3AJDA 4CT4B 3O1LA 3T1QA 4E3ZA 1ZDMA 4YRBA 4J0GA 1Z7WA 1H4SA 3OY2A 3GBVA 4V03A 3FNEA 3U26A 1NMYA 3EXIA 2PPLA 3Q7QA 2BDEA 5DTIA 3ZW7A 3K70D 3BCSA 4DR1B 2BZ1A 1EFUA 1YB5A 3FI0A 3GGDA 2J8ZA 2B5VA 5FUYA 3VISA 4G0VA 4HGYA 2BMFA 2CL0X 4JBLA 2OOKA 1NPYA 4DA6A 1JTVA 1DBPA 5CU7A 4HVCA 2YNMA 3LUCA 4EUFA 1BXGA 3QH4A 5KQPA 5IWCA 2LR0A 1Y6GA 5EC8A 2VDMB 1YRBA 2JJ1A 1Q19A 2A4MA 4C4TA 2WWXA 2P6OA 4JELA 4TSFA 3MTGA 4TYWA 5TDHA 1QAMA 1D1SA 1LKZA 4IAOA 1O0BA 2KB0A 3PT5A 4BFCA 3OPXA 5FPTA 4XWAA 1SOUA 2UU9B 5AI4A 1GOTA 1T9KA 3RIXA 3P9SA 1T9CA 5BNWA 1MJGM 3W2IA 1VCOA 3LHDA 1NQVA 3LM8A 5TJ9A 4BMSA 3G02A 2QAGB 2C5EA 3FCOA 1FW6A 3AEQB 4B47A 4RBNA 3FIJA 2VBIA 5HK9A 4FN4A 3JQAD 4N7JA 3K1ZA 5IABA 1XWFA 2WTEA 2ZS8A 2ZUCA 1RM3A 2B0CA 4DLUA 1JLSA 1T5DX 1UT8A 1EDEA 1RBZA 1MP0A 1TKCA 3AY6A 3N86A 3M1YA 4HFMA 1VBMA 4WA8A 1OYYA 3HL4A 2O2DA 1SIBE 5CK4A 1OTHA 4M1EA