1ZN8A

Human adenine phosphoribosyltransferase complexed with amp, in space group p1 at 1.76 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Complexes of Human Adenine Phosphoribosyltransferase Reveal Novel Features of the APRT Catalytic Mechanism
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenine phosphoribosyltransferase
total genus 58
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zn8A00
1R3UA 2H07A 1A97A 4RHTA 5BSKA 4RHUA 3G6WA 1V9SA 5KAMA 1STOA 1XTTA 2PRZA 1UFRA 4LZAA 1DBRA 1JLRA 1Z7GA 1XZNA 1TC2A 3DMPA 2YZKA 1HGXA 3S5JA 1CJBA 2VFAA 2EHJA 3OHPA 4MB6A 3GGCA 1QB7A 5JSQA 1LH0A 4QYIB 2WNSA 4P81A 1D6NA 1VDMA 1WD5A 4LYGA 4RV4A 4X45A 4F8EA 4RADA 4RHYA 4M0PA 4IJQA 5ESXA 4RABA 1DQPA 3O7MA 1ECCA 3OZGA 1AO0A 1QCDA 4PAWA 3M3HA 1J7JA 1VCHA 4ZFNA 1G9SA 1L1RA 4JITA 1ZN9A 1O5OA 4P82A 1UPUA 1ECBA 3LRTA 1QK4A 3LPNA 1XTVA 1I5EA 2IGBA 4LZNA 4P84A 4X44A 2C4KA 2AEEA 1QK3A 3KB8A 5K51A 4M0KA 4QRIA 2PRYA 5HKLA 5BQPA 4WMLA 4RAOA 1P17A 2FXVA 5JV5A 1OREA 1OROA 2GEBA 1PZMA 4PFQA 1A98A 1XZ8A 5ESWA 5HIAA 1Y0BA 1L1QA 2H06A 4QYIA 3EFHA 1OPRA 4S2UA 4P80A 4OHCA 1I0IA 1ZN7A 1A4XA 1DKUA 4P86A 4KN6A 4FYMA 1XTUA 4M0UA 3H83A 1A96A 4RACA 4Z1OA 1DKRA 2XBUA 1UPFA 4RAQA 5IAOA 1G9TA 4RQBA 3NAGA 1P19A 1BD4A 3DAHA 1BD3A 3ACDA 1G2PA 3GEPA 1ECJA 3QW4B 4P3KA 1I13A 5IPFA 1ECGA 2PS1A 1I14A 2JKZA 3HVUA 3MBIA 3ACCA 5E38A 2H08A 4P83A 1U9ZA 1A95A 4RQAA 1G2QA 1ECFA 1A3CA 1NONA 1NULA 4LZOA 4TWBA 4WN3A 2DY0A 1DQNA 1YFZA 1QCCA 1P4AA 1JLSA 3N2LA 1HMPA 3OZFA 2E55A 3GGJA 3MJDA 5BQOA 4LYYA 1GPH1 1P18A 1BZYA 2JBHA 1QK5A 1TC1A 1W30A 2HCRA 4RANA 4RHXA 3DEZA 1IBSA 1MZVA 1ZN8A 2JKYA 1U9YA 1GRVA 4JLSA 5EUCA 2P1ZA 1VSTA 5BRNA 2JI4A 3ACBA 1QB8A 1O57A 1I0LA 1FSGA 5KAPA
chains in the Genus database with same CATH superfamily
1KXJA 4UPEA 4Q9NA 4BX8A 1O7JA 3CNHA 1Q74A 3HYTA 2BFNA 2A0YA 1XA4A 3KQYA 4HTFB 5HOEA 1IUKA 2CLIB 2VNAA 3HXMA 2C1ZA 3DP7A 2OXIA 1FRVA 3R4CA 2CUZA 1DZ3A 1B8PA 3KCNA 4WZBA 5CYFA 2CFIA 1ZJ6A 1NX9A 1Q0LA 3DPIA 3PGXA 3EMVA 4NDZA 3S5JA 5ITVA 1D2RA 1P31A 4P7BA 4ZOLA 3GGCA 4NX2A 1CRWG 1FBTA 2XECA 4RL4A 2BHLA 3IPRA 1CZHA 4JB2A 1U9JA 4TVOA 1IZ8A 1R18A 2GT1A 1VM6A 1QRAA 3AUFA 1ULTA 1Q57A 3WOHA 1T9GR 1ONBA 4CDNA 2P1DA 3BB4A 3O83A 1NG9A 3DA8A 1VIYA 4GRIA 4M3NA 4B7XA 4WOBA 4OXRA 3KAQA 5I6DA 4HHEA 4BX9A 1VIDA 1F4PA 1XZGA 3VPGA 4RULA 1VJ1A 1YZ3A 3G5AA 5DM0A 3PQ5A 3K2IA 3L8GA 4TV9F 4WNCA 3GA0A 4IH4A 1Z08A 4KBGA 3U3OA 1SXHA 3O3MB 4FJ0A 4AD8A 4GZLA 1P9NA 1PF7E 1YR9A 1ANKA 4JYMA 4NYJR 5D5QA 4EG3A 1P9OA 3BRCA 4L72A 5DM70 3SZ3A 4HGZA 1GTG1 4QFBA 3GDFA 5DI9A 4REMA 1FRFS 4R8LA 3GJ6A 3E9RA 5DK4A 2QSZA 1J6UA 2QT9A 2Z1DA 1M6VB 3QKSA 3CA8A 1QOPB 4ND8A 4WY8A 1AXGA 2Q0XA 1V71A 2G40A 2ACWA 5CLGA 1IUNA 1GNVA 3QXCA 3DULA 4XWGA 4UM5A 2IYVA 4YC7A 3ICQB 3O8LA 3ZNOA 1I1QB 4MV9A 3ZS8A 2QGNA 4F72A 1RLTA 1PJ8A 4FYMA 1YDEA 4KX5A 4LX0A 1Z0JA 2A5YB 3OCCA 2C7QA 3OM9A 1E92A 4RS3A 4KVFA 1NR7A 1FFXB 2AKEA 4XWAA 1IY8A 2B35A 4MW4A 4TV9B 4Y2RA 4ODIA 1OV6A 2BFEB 2Y1CA 2YXLA 4RJKA 4NG5A 4R6XA 2IY8A 1CNEA 4IRUB 1GM5A 5FUXA 1FP2A 3UOGA 3ZX4A 1TIBA 5ITWA 2OILA 1SC9A 3L40A 2PANA 2D5BA 4XJTA 3W8EA 3MBIA 3O4RA 3F6EX 3HO6A 4M1OA 1NYRA 2W6QA 1N25A 4MA0A 4CQMD 1ZI6A 1QP8A 3I0MA 3CCCA 1DDIA 4CN8A 2UUPA 2PA0A 2VTDA 4TWAA 1F2UB 1XCMA 1AKRA 1SPXA 5A7GA 1NVGA 4Y6OA 5SY6A 3EH2A 1HRDA 1NY5A 1GCUA 1Y9ZA 5EKUA 3JWIA 2XKJE 1UBJS 2AS0A 2IP2A 1DE0A 2C00A 2XQJA 3OPYA 4MX8A 4R9NA 5D7NA 3WWPA 1N78A 3TRFA 2WR8A 2B9VA 3NHKA 1TJ4A 4TL9A 1BX3A 3A6PC 4TZKA 4RYLA 2JFZA 4OHBA 1TLFA 1BFUA 2CY0A 1LBTA 4Q3OA 5A6SB 1Z2NX 3BORA 4LJKA 5LBIA 4F9TA 3EXIA 4NULA 3K9WA 5HSGA 121PA 1CB0A 2XGOA 1W6RA 5TS3A 5TVGA 2WSIA 2WHPB 4YO8A 5BNZA 4WV3A 2F1JA 3ELWA 1E61A 4R2XA 3SQOA 3B9PA 1QHFA 1BEUB 1NF8A 1B8NA 2W2XA 3NTXA 4ZYUA 4M1QA 3CUKA 1O58A 2C4NA 2YZ7A 3WQBA 4D9MA 4E1AA 3VPHA 2PFKA 2VP0A 4GI3A 4DBLE 2WHPA 5D3MB 3DAPA 4KQXA 1CD5A 2SCUB 3OQBA 4NYJQ 3NDBB 1AQ6A 1W85A 3OCUA 4ES6A 3C4JA 2YN2A 2DF8A 1BMFA 5DX0A 1F4LA 5TJHA 3ICCA 1KBQA 3FB1A 1ZUWA 4BLRA 4F4IA 1RVDA 2AC2A 2ZYHA 4UNSA 5DSXA 2IH2A 1LRKA 3BKXA 1Z35A 2GJ9A 2OC4A 1K66A 4YA6A 1YULA 4UDXX 5TMPA 4LE2A 3WFIA 2BI8A 1Z3CA 3STUA 5M34A 4MW5A 1FU4A 1LK5A 1XVVA 3DL4A 3K9GA 3E58A 3PDCA 2QX8A 2UZ0A 1M2OA 1BGXT 1LX7A 2QPAA 4BB0A 4EB6B 1X1CA 2NADA 4ZQBA 1E6MA 2H54A 4L2IA 1PT6A 3FTEA 1O4VA 4GOKA 1PG5A 1OVMA 1G5HA 2FG6C 5TGDA 4Z7OB 2IBTA 2IBSA 2YZMA 1A88A 1A5AB 3GZNB 4TS3A 1IQUA 5CMLA 5HMLA 3R9KA 3IUEA 3RU9A 5DBEX 3HHEA 4BNJA 1GR1A 3LSYA 2UVPB 1R9NA 2XBMA 2OGUA 4PIVA 2IWHA 1SZDA 2RGUA 4N9QA 3WJ1A 2L42A 1P1KA 4IIVA 3ZJYA 5T57A 1A2BA 2WD8A 3MRVA 3VR4H 2O2EA 2X76A 2PX8A 1U3CA 3UK1A 2ZJ0A 5ERYA 5HIIA 4B3IA 2JG3A 1ISIA 3TZEA 1P45A 1KZ6A 1YQDA 5CCEA 3DFZA 4MUGA 4CMCA 4KKVA 4PQEA 2P9BA 4YJGA 5AJVB 4RAQA 2ZK7A 4E15A 4QXAA 2JAQA 4YS6A 4RQBA 4ZDKA 2QJWA 2RIRA 1EZZA 2GBFA 2VLIA 4ER0A 4DV4B 4BC0A 4MVJP 2BGNA 2J59A 4F9FA 3CCBA 4MI3A 5JTUA 1JJFA 5FWNA 3HYCA 3P9PA 3DVQX 4WIAA 3DOIA 4JXZA 1Z0ZA 2OCLA 4UPDA 4NDNE 1I3NA 3B2EA 3ILHA 3HJRA 3JWEA 5F2KA 1GN8A 1E89A 3K7EA 4GOLD 4P8RA 4WN3A 2G63A 4R7GA 5HKBA 1UC5B 4FGUA 2DSTA 3A1NA 3AKYA 1Q0ZA 4BVGA 1TM3E 4QYWA 5H0IA 5K0CA 1H9CA 5KVSA 4G1VA 3ONWA 4AY5A 5JADA 4I5GA 3TGPA 3DUFB 1NRJB 2R6FA 3ZIDA 2AR0A 3GGJA 4GZ3A 1UPAA 1I3KA 2ZAMA 2ZRPA 3I9LA 4P7GA 2CHFA 2DBVO 4EAQA 1SXJB 4H3VA 4EHAA 3PK0A 1A9XB 3EZ2A 3ZI7A 1P5FA 4ETIA 2LP4Y 1RZRA 2RHRA 1QOZA 2HCJB 3PE6A 5C8YB 4WK6A 2B7LA 4AULA 2ZBUA 3MXOA 4XDYA 1YRQA 5CT6A 2C5AA 5F12A 3OHMA 3QLVA 3CVUA 2B2CA 2X0IA 4NBRA 3AY7A 4OTZA 1UFVA 1DAHA 1YRBA 2J5KA 4RHUA 2CDAA 5LDGA 3RR2A 2GBGA 5EZYB 3C97A 3D31A 2QMUA 2E1RA 4FKMA 2JAHA 2A1IA 1FLDA 3O8DA 4WX2B 2NQ8A 4O1MA 4I19A 2V4UA 4QJIA 5FUVA 2D1YA 3OQIB 2ZROA 4HAIA 5B53A 2XUHA 4I9HA 3WICA 2YVKA 1TF5A 2ZBRA 4UHKA 2P67A 1QAQA 1NUSA 2P7HA 3BWBA 2XCLA 3NEAA 1WD5A 4JJ4A 4V2IA 1NUTA 1T9AA 1HRKA 1M5UA 1V39A 1QG6A 1SVUA 2JRLA 2QX7A 3NCTA 2GEVA 1XLWA 1P3DA 2APJA 4GEKA 4K05A 1XL1A 3RSSA 2VJMA 4B4DA 2XMCA 4Q3DA 1Y8AA 5KMGA 1TB4A 3WGZA 2XZTA 3GG9A 3OM0A 3IIEA 5EHNA 1NLFA 3O6VA 2OOKA 3KKMA 2ZUSA 5G0UA 1KS2A 4YJFA 3CRW1 3GY0A 5KIAA 1OYWA 3PITA 1AX9A 2ZB2A 5CHEA 4MNTA 3ZQUA 4GMHA 1R4MA 1XSEA 3DB2A 1S7CA 3Q8LA 4HXGA 5IJAA 1BMFD 4HF7A 1QS0B 2GXQA 3FSGA 4QTZA 5DTEA 1M6YA 3DT9A 2MINB 2WVJA 4R69A 2NXNA 4CI0B 2OXTA 1KJ9A 3CRVA 3TG8A 2W58A 4RKRA 3NEJA 4JOSA 4OH7A 4F92B 1IY1A 4V3BA 2WJGA 1VHWA 2ADOA 2AA3A 5SZKB 4AJ1A 1ZIYA 4YHHB 3MJ4A 1TIKA 2XQIA 2FXIA 3M6VA 1Y3IA 1PS8A 5FBKA 3SFTA 1T8TA 1R0XA 1X7GA 2CZQA 2IEZA 3FSJX 4M98A 4WFJA 4D25A 3A8TA 3AG5A 3WR5A 4A6DA 1KMCA 3U7EB 1Q1ZA 4ILKA 2JLBA 2WD9A 4ARIA 1TDJA 1KETA 4P1ZA 4ZHQF 2DLCX 1RD4A 3FOBA 5G4KA 2NU7B 3FF1A 2D7DA 2OORC 3ZWCA 4DV1B 2ZRLA 4LJRA 2VG8A 2DKFA 3VO1A 3AEUB 1RHUA 3GIDA 2F62A 4H7IA 2FWPA 1Y1LA 3BWXA 4NXNB 2DFKB 3QU9A 3Q9LA 1M2GA 3CVJA 2OFFA 4NWIA 1W581 3CKYA 3GU3A 4OF4A 5A05A 4D3DA 2V96A 4M7WA 3RBZA 2QQ0A 1G9TA 5AVWA 5I7HA 1BA3A 1EDEA 3RFUA 4GLLA 1DRWA 4LXXA 1XLTA 4FVTA 4P3KA 5EP4A 2H5EA 5HXAA 4IUYA 1M6EX 3SG0A 4OXXA 3IDQA 5FIUA 1TYCA 3LO5A 2IZ7A 4L5YA 4BEWA 4N7BA 2PV0A 3HVUA 4UVGA 3EVFA 3ZCXA 5HQ3A 1N1MA 4QAQA 4U9UA 3UA4A 4ER3A 3NHMA 4YAIA 3NVMB 2BFBB 4EY8A 1I7DA 4DA8A 1E98A 1IOLA 2EBFX 1NSFA 2ID9A 3IMCA 1SQ0A 1ZD4A 3R23A 3WL8A 1E1RD 4PXAA 4BP1A 2FRXA 3BSWA 3JWHA 4KEAA 2GRUA 1JQBA 4ENWA 3TW4A 3H7IA 3L7YA 3FDZB 1Q1BA 4E31A 5JAUA 1P0MA 3KFVA 1XV5A 3OMXA 2CJYA 2LRHA 4MMXB 2MSEB 2J0EA 4BRSA 2OBFA 2QG4A 2QENA 4EUHA 2FPGB 4RTNA 3OPVA 1E1MA 1HE1C 2GF2A 4E5VA 4P35A 2H65A 4A6EA 2PGNA 4L1KA 2I6QA 3SKVA 3TCKA 3FPFA 3SZRA 1E7RA 5JANA 3OESA 3WFZA 3ABOB 3G0IA 3KQLA 3W2FA 2PMKA 1Q1AA 4KIFA 2DOKA 2WG1A 3O3OB 4OMFG 1C7QA 1GWNA 2Q3LA 2ZB7A 3KLBA 4OHVA 3S55A 1RC0A 4QASA 4UE2A 1PNQA 4MB6A 4FE7A 4QIHA 1EP9A 4RD4A 4JOBA 5C35A 1DJMA 3T38A 2G82A 1ODJA 3NBUA 4FFLA 3RUPA 3VBCA 1PTJA 2OD9A 3QA9A 5I4CA 5K0GA 5ADUS 2BSAA 3U7QA 2JFFA 2RH8A 4AN4A 2JC3A 2Z2KA 3TGLA 3T1QA 4KO4S 4UTRA 2P9FA 2Q2OA 5HCNA 3T5CA 2JGRA 4PLGA 4AY3A 4QDZA 2ZULA 2W43A 2I2WA 3MYYA 1WVGA 3ZN2A 2Z83A 4C22A 4S1OA 4UNNA 5H1YA 4FIDA 2OZEA 5CDFA 4F3TA 1NBAA 4UBNA 4MB0A 4AJPA 2YMLA 2WT4A 4MDFA 1BRTA 3FMIA 2GRAA 2HDNB 3CM0A 3VH2A 5JAIA 1LW6E 1KI8A 5JXGA 1RXVA 1IG0A 1ZFNA 4JJGA 4CGYA 3TZKA 3GJQA 1CYDA 1O9GA 1EFDN 3DBHA 4UKDA 4IINA 2V55B 5ELMA 1CUWA 4EY7A 4EDHA 2WWGA 3G9UA 3AM1A 1T35A 3MBOA 3BSYA 1Q7TA 5LD2C 4MW0A 4I1VA 2VZLA 2Q1XA 2HK6A 5L40A 2IHYA 3GPIA 5AKXA 5FR1A 1E7MA 2YDYA 2IU3A 3ED5A 4R7ZA 2AN3A 5FD8A 4QNRA 1PWHA 2OT3B 1KI1A 2M1ZA 3HJTA 1QYVA 2ZJ3A 3B48A 4HGNA 1NC1A 4FGLA 4ZAGA 5A5GA 1JEYB 4YMUA 4PQRA 2PRJA 3KZKA 4BKMA 3F0TA 4NJEA 1VYUA 2VQDA 3NHWA 3COJA 2H2DA 3IC5A 1ZM9A 4Q03A 1V5WA 2LXNA 3EAQA 5AOVA 5BR8B 5EVCA 3IP9A 2CXUA 3G7UA 2PU7A 4B44A 4MPRA 4I4IA 1SKBA 2JGAA 3KZMA 2J1LA 1H22A 2O2YA 1JBQA 4AW9A 2QRJA 5HM6A 2JCYA 4KWCA 1T9KA 1T5LA 3FPGA 4MW7A 4QOJA 1ZHHA 1P4JA 4PZCA 3ZDFA 2PMWB 4HC4A 3C2QA 2O2ZA 3P4XA 4PHGA 5AK4A 1GUAA 4DCPA 3LLMA 1EJ2A 2V03A 2Y6VA 5AVYA 4JYCA 5KWIA 5JYBA 4DR3B 5LIRA 1IQ0A 4HVAA 1R64A 2GCPA 4HG2A 1XRMA 2ZRQA 4WKGA 5JNUA 1NUPA 2CHGA 1OLSA 4JEIA 4EWLA 3PQ7A 1QCCA 2Q3FA 1Z5ZA 4H0CA 2G09A 3S8YA 3B6IA 3CZ5A 4C4RA 1RM0A 2O1EA 2WFAA 2YWRA 3QWIA 3VZPA 2NU6A 2P2DA 2QTVA 1Z6ZA 1SUAA 2OLEA 3QITA 3V9PA 4V24A 4BO2A 2J9YB 4GW3A 1VIMA 3Q3IA 4UEJA 3B6ZA 3HUTA 4YRTA 1Q20A 3TZCA 4N5LA 3QEBZ 4XLTA 3LKDA 4A91A 2IJGX 2L82A 3G5LA 5EOVA 1I32A 1Q1QA 4DSNA 5D7BA 2GETA 4CQNA 1XYVA 1AB5A 4K28A 4NBVA 4U7HA 4XGQA 2W42A 1EFVB 2XQKA 3NG1A 1AB6A 4BYMA 5EPOA 4EEZA 1OAAA 4OV6B 3VTFA 2Q8PA 2QTFA 3PC7A 4B82A 1Y1QA 4PC7A 4DBLC 2JAOA 3H11B 1VJCA 4O4JA 3MOGA 2SKEA 2Q2WA 4K9KA 4AY4A 2WVAA 4GMXA 1ZL2A 4B83A 1GL9B 4FT2A 3LVQE 3OP1A 2L2QA 1IWBB 1T9CA 4CM4B 2FB9A 3F4LA 3EB9A 2DH6A 2BONA 4QQ8A 3OQNA 5EIBC 4YROA 2QR5A 1Z2CA 2J0QA 2WQ6A 1N5DA 4PRLA 2FF5A 2HU8A 3WDLA 1Z88A 1SCAA 1HDIA 2FSVA 2CWWA 3TNJA 2PCLA 2BKXA 4BN0A 1P0CA 4XARA 1ZIXA 3TKYA 1JHRA 2O6HA 3ZPXA 1MB3A 3B60A 3OCJA 3WDKA 1AK9A 3AVQA 1SG6A 1L0BA 1NT4A 2J4FA 3LFUA 5IDWA 2M6SA 3HK2A 2R6CA 1FNBA 4B3RB 2RC5A 2VUSA 1PJSA 2YCLA 5IVPA 2GS9A 4OQEA 4CM8B 3KB8A 2X9GA 3NIDB 3Q3JB 3SGLA 3S2SA 3GV0A 2WKPA 1JA9A 5H5JA 3S81A 2PT6A 1QIIA 1E1CA 3W5DA 1TVKA 2M6RA 5D3KA 3O38A 3CF4G 2P91A 1J39A 2PX4A 3RAGA 3ZNPA 5CX4A 1Q95A 3ZDAA 2GI4A 3RVSA 2FEMA 4PIPA 2I6FA 2RD2A 1H2AS 3AEKB 5FL7A 3HJAA 3VKUA 4J75A 4CCYA 1ZCFA 3RH0A 3CEMA 3UWMA 3FMVA 5E3IA 4Y1EA 3SICE 1S5PA 2HA2A 2ZXFA 5LQCA 4ZRMA 2H2FA 2F2TA 2VC2B 1PBTA 4NQZA 1YMVA 2QR3A 2ZEJA 4J1TA 3R0XA 1ZXBA 4XQ9A 2PJDA 4P34A 1K89A 4DBZA 1Z34A 3HV2A 3IULA 3VPCA 5GONA 3FAKA 1BMQA 4Q7LA 5E6UB 3CINA 3LH5A 3RE1A 4AKTA 5KOYA 4JDUA 1AHIA 1I9CA 4MO9A 4DUYB 4KH1A 2R3SA 4LTMA 3SIRA 2FUCA 4LYEA 2BM0A 2Y76A 3HXPA 3NETA 5K8UA 1QHEA 5AVTA 2XDQA 3GLRA 3WK7A 3LPAA 2WV9A 4J76A 5IP5A 5REQB 3RUCA 4XYEA 4JT8A 2PQ2A 2PTHA 4OI2A 2VDPB 4G0XA 1C29B 5E38A 4OLJA 2QE7A 1E3SA 3F6SA 3M7IA 4D2IA 1E94E 2OSVA 3FD8A 4WPGA 3CWCA 3RTCA 3A9RA 3L0IB 4ZI7B 4UDOA 1XWIA 2XQGA 3AH8A 4M2LA 4BVJA 2H8GA 4L6IA 3JQAB 4RZIA 1ACJA 3PUIA 1JFVA 2VHYA 2GEFA 2QAGC 3MWLA 4JIMA 3V2GA 4OB6A 5K2MA 1KAGA 2A4MA 4AL4A 4EPYA 4KDFA 2XDQB 2AXEA 1FNNA 1L5VA 1ETUA 2XA2A 2ZYTX 3ZZUA 4BIIA 4EI9A 4IX1A 2WT9A 3C4VA 3DOOA 3KD3A 2ZRIA 2HLDA 3MINA 1JB1A 3R3HA 4G81A 1BJKA 5A71A 3W04A 4QNNA 3HTXA 3U61B 1BA2A 3AIMA 3WBBA 2O1SA 1BYIA 4KOEC 1QVZA 5JI2E 1RU3A 1K6EA 2D0IA 3MTQA 4LJSA 5BN1A 4LRSB 4EW6A 1ISMA 2I3GA 2OB1A 3CSSA 1GFSA 4LK3A 1L5KA 4KXXA 2I80A 2O5RA 2R8PA 2XMPA 5KTMA 3F8WA 5AOBA 3HV0A 5AJUA 2B3DA 4YN3A 1LF0A 4S24A 2IW3A 4ZQFA 4US2R 4G4SP 5KQMA 3QPAA 5LKAA 10MHA 3OTHA 4EG1A 3UC5A 3K70D 4D9FA 3GFPA 1RPJA 3QKUA 3B6EA 3TRJA 2F3UA 2SBTA 1U7DA 3EK2A 1JIVA 2VAWA 2V98A 2OEPA 1QTQA 1ACMA 3GT0A 1Z4OA 1H2EA 4A0FA 3ZR4B 2AG6A 1SHTX 3Q8KA 3KL4A 1FY2A 3AJRA 3K9BA 1L6IA 4AU1A 4BNUA 3DE5X 3CBQA 4KU4A 2Z95A 1M5RA 3IBYA 1NFFA 1CU1A 1OFUA 2IY9A 3FJOA 2VAPA 3A1FA 3DTYA 1VKZA 5IK2A 3DBIA 3QX7A 3UKOA 4F6RA 4HV4A 3IBSA 3JATA 3RYHA 5AKGA 3HJUA 4ITUA 1W0JD 3USES 3SYKA 4ERXA 3JASA 4QT4A 1H1TA 2FMIA 4RTLA 4GRDA 4D96A 1CJVC 1ADGA 4NG4A 1AUXA 1RBZA 4INJA 1C9MA 2LPMA 4TUYF 3REQB 1NN0A 3RUEA 3VMFA 4A5OA 1HFJA 3QFFA 3IR5A 2G5PA 1USWA 1S2DA 1N6LA 1Y0BA 4M1KA 1L1QA 4OHWA 1R12A 3DTNA 5DNAA 2HRBA 3HDHA 4EW2A 3ECAA 1FTQA 3UUGA 1AZSC 1GSOA 3G82C 4PSCA 1Y89A 1TQ6A 4XWTA 4J49A 1O96B 1WSBA 4G97A 5F5NA 1C8LA 1EE9A 2FA9A 1ZG3A 4OHKA 3MILA 1E4YA 1YACA 1ZONA 1Z82A 1DMRA 1RIIA 3O4FA 2WAYA 3KV1A 2PT9A 3OIYA 4GKAA 4URXR 1U31A 4J16C 2W6CX 2G5GX 3R7FA 1Q6ZA 1C0EA 2GAJA 1H1LB 4GR9A 4A0RA 4DJFC 4OQZA 2FPXA 3ZCTA 3U09A 5E2IA 1WZEA 2FEAA 3UJAA 1Z5WA 3VDNB 3K2QA 4I1IA 2DR2A 5LUBA 3P4UA 4OY3A 3ZNQA 3PRJA 4L08A 4WERA 1XALA 5FKJA 3RYCB 3TN7A 4P38A 1E9DA 3ZE2B 4MQFB 3PP8A 4RNCA 1K92A 4H2DA 1N2GA 3ZWQA 3IAS1 1LKZA 2GO1A 1SUBA 1XPJA 4PRKA 3CKLA 1LZKA 1XZIA 4HPJB 2GXAA 4L7QA 4GU5A 3L46A 2BOVA 2NSYA 1M75A 2KSQA 2VEDA 3N87A 1JILA 2NACA 3CUVA 1KZ4A 1VHTA 3MNFA 5SYNA 4G0QA 1ORIA 4KZPA 2AJTA 2PH3A 4QD3A 4N8DA 2BC9A 1G1AA 2V7QA 4DYHA 1Q0RA 1T0BA 1G8YA 1DQRA 4BKQA 4BCCA 1XMIA 3VO2A 3K8YA 3IUNA 2E4UA 2FW0A 4LHVA 1HTWA 1UXKA 2WJZB 1HT3A 3OZTA 4CL8A 4CMIB 2CDCA 4AP5A 1AQNA 3O95A 4F2DA 1D4ZA 1ZCJA 4WUVA 5EHQA 4B3DA 1FSPA 1O97D 4PQYA 2QJFA 2WFMA 1B0PA 3ZWDA 1E59A 1DQSA 2C4WA 3VHQA 1XTTA 3W8DA 5DRTA 3DS8A 4JI7B 3A31A 2X13A 2PA3A 4WT7A 1N2OA 3BWYA 4BP3A 4XM1A 4PPNA 4F8JA 2PAFA 3CH7A 4EZIA 5EWLA 1J56A 3C45A 3RIEA 4KQ1A 3JQ6A 4CLRA 5CFLA 5B6PA 2GVZC 3H9JA 4FMDB 4YQFA 3HCPA 3W1WA 1CRQA 3NRCA 2HDWA 5ESXA 1HT1E 3D7RA 1ZHOA 3PGKA 2G67A 5G0TA 1JT9A 1VJGA 2ZGVA 1Y9DA 2V59A 3EVDA 2DETA 1NHGA 3BD6A 2C7PA 2O0KA 1GG8A 1VCHA 2QRQA 1XDWA 4DN6A 3ADCA 4Q7QA 3ZI0A 4Q7JB 4RD3A 4C05A 1UPUA 4V38A 2I7VA 5TLSA 1YS7A 3LDAA 1BOFA 2H48A 4QRHA 4MEJA 3HCCA 5FPHA 1QHHB 2POCA 2BH9A 3QBVA 2FH5B 3FCYA 4K9LA 4WNAA 3WA7A 5CR9A 3QEAZ 2Q5QA 4OP3A 1V7ZA 4KFCA 2JLWA 3CXUA 4DSAA 1THMA 1RABA 2K4MA 1XCBA 1UANA 2VDWA 4TWZA 4BWYA 5A9RA 2WJVA 2H0QA 3OZUA 3MWGA 2GAFA 4ZGWA 3N2NA 1J1IA 3SS9X 3OLXA 3JASB 4Q9KA 4OHZA 3KQSA 4EFNA 2QN8A 5CXUA 4WLVA 2PX3A 2IEIA 1FXWF 2GYYA 3G1TA 2HQ1A 1ZEJA 2G88A 3ID6C 1ISSA 2PXCA 4JJ6A 2FFRA 2HV9A 1UBEA 3FDJA 3TLMA 1B26A 4RK1A 1X2EA 3L8MA 3QFCA 4RK0A 4YRDA 5AT1A 3TTSA 2NZVG 2I67A 4DLUA 4P32A 4CE6A 1CJSA 2Q4DA 4TKLA 1JSZA 1Y7TA 4UNPA 5F3DA 3D4NA 4Q3NA 4MW1A 5FBQB 2XPCA 2HMSA 4ZREA 1PS0A 3RRNA 3SDZA 4BGIA 5IAOA 2FZWA 1NW6A 2DHEA 1BXGB 4HP8A 3T0GA 1HNXB 1OILA 3GWGA 4D79A 5FBZA 5IDQA 2GK7A 1R4MB 4FOSA 1M6VA 1EP1B 4OBEA 1Z6GA 3UYLA 1JW9B 4FMCF 3F2VA 4HFJA 4HLNA 1U8TA 2Z6AA 4B6QA 3AHIA 1G4HA 4Z9XA 2MR5A 2WM2A 2R8OA 3ZWXA 3QH4A 1I14A 4I6JA 5IJ0A 4GP6A 1B3RA 1V45E 5T3UA 3I9JA 2CVFA 1AD2A 1TA0A 1G6OA 1U9IA 3C0KA 1AZWA 1BXKA 1NFQA 3R40A 1WRBA 5KS2A 1YF3A 4F4DA 1OH6A 3G5MA 4C1NA 4GZ5A 2HWKA 4OL0A 3V8PA 1HF3A 1JLSA 1YE5A 2WNIA 3QJYA 4MLCA 4IH9A 5HGJA 2EU8A 3AVXA 2AI1A 1ZJ5A 4TQAA 4BB9A 2RKBA 5EYPA 3T7EA 2O8FA 5JZBA 2GD0A 3EOBI 5IM4A 2YIMA 2YZ2A 3THOA 2XZOA 4PM4A 1NVUQ 4FUTA 4HZGA 1PR6A 3LVFO 4YP9A 3N86A 3EGVA 5I4KA 5JMOA 1CUJA 2AG5A 3OI7A 2GM3A 1QF7A 3TQTA 5DLDA 2P1ZA 2BPOA 4OHPA 3LG2A 2YW9A 4JAVC 2BCEA 3MC1A 3EJ6A 2IDZA 5KSOA 2XMGA 4MYHA 3TX6A 4IJVA 1W93A 2UXDB 3DOHA 2ZTMA 1FU7A 2P78A 2Q3JA 4PZDA 1A7AA 1WPRA 4RIFA 3RS9A 3K4HA 3EWSA 4ZOCA 5IBQA 2Q5EA 3CNOA 3ZJ4A 3CH6A 4CW7A 1Q2UA 1JVBA 2JIRA 4PO3X 3U9LA 5F64A 2DFTA 3PC2A 1C9KA 2ZRGA 1CQJA 2HD4A 3H1BA 5LZ7A 3F1LA 3LT2A 2I6XA 3R9IA 4C6HA 3GH3A 3KSMA 2O8BA 4IHJF 1ZSNA 4QUHA 13PKA 1XGKA 3PCXA 3DDOA 1WV0A 4G5OA 1OLXB 2F8LA 4HLUA 1AQUA 2C3PA 3X1XA 1Y82A 2QIOA 4C0SA 3GG2A 1SUDA 1ABBA 5IVKA 3OMLA 1PZNA 3F4BA 1W35A 3HA7A 1LI7A 2FW8A 5DBIA 1VI5A 4MWOA 4DDKA 621PA 3UUEA 3IO3A 1L7EA 4HQOA 4ZOAA 4XM2A 4M76B 1WNTA 1L8LA 3PHBE 3KRTA 3IE1A 5CX1B 1NVBA 2GFQA 4MCJA 1KK2A 1L5OA 2ODEA 3PL1A 1MA0A 5HE8A 4YCMA 5IASA 2ZYDA 1K6IA 3EAGA 4FFRA 3AFIA 3BIOA 5JYCA 1MH9A 3RDPA 3IMGA 4YJ2A 1U80A 3LHSA 3TM5A 5J2TF 1Z62A 2FW1A 1I2ZA 1YL6A 4Z7NB 1G2OA 1I33A 2GPAA 2HW8A 3MT7A 2CZGA 3ABZA 3CUSA 3D6MA 3P1JA 1AS3A 2PKQP 4JBGA 1NW3A 4NFSA 3W6OA 3COYA 4BRZA 3EGCA 3E0XA 2V6IA 1PJZA 1SK8A 1I3LA 3MTDA 3UAYA 5LQAA 1GV0A 4RHEA 2C5GA 3KLNA 4TTRA 1FK8A 2CHEA 3C3DA 5CX1A 3FYUA 3F5QA 1LWOA 3O9MA 2FP4A 1QQ6A 3IVCA 1E0KA 2CUKA 1P75A 3QYAA 1UODA 4M0UA 4R8KA 5JYEA 4JBIA 2YFHA 3QOWA 1SVIA 1ZVJA 4X0EA 3SJ7A 4DR2B 5A4MS 1E2JA 1DL5A 2WK1A 3OE4A 2NV6A 5IM4F 4D4JA 4MYSA 2ATIA 1W4LA 2Z08A 3JD0A 1KK1A 3L7DA 5BUCA 4MQ4A 5BOSB 4FYIA 1K6XA 1THGA 4W9RA 4UOZA 1E9VA 3RT7A 4EVRA 1EXNA 1AK2A 1X7XB 3HCWA 5F76A 1A72A 1KIAA 3ZCQA 5C34B 4C0JA 4AUMA 1HZJA 5J2TB 3CZQA 4U7DA 4V3CA 3AVVA 2HOQA 3HZZA 4OYHA 1B41A 1QRTA 2JGDB 3EZ7A 1GYPA 2FMKA 2XHZA 3AM5A 2JFWA 4IDNA 4YUXA 3IVRA 2FWIA 2P35A 1I7SB 1NQOA 4Y98A 1T8RA 1QC5A 3LO8A 3VYVA 3S1LA 1G0NA 1X87A 1L9KA 4Q4DA 4CIDA 2P4EA 1AC5A 3MD0A 1U2ZA 3L9XA 1LDMA 4W1PA 5JRZA 3KX2A 3JVUA 4JUCA 3VR6D 1ZN8A 2VHJA 1D4FA 1GGVA 3SNKA 5K9ZA 3C5CA 4DNQA 3HDVA 4RQTA 3DMGA 4P5PA 2AYZA 3F47A 4KVZA 3KKQA 1IPFA 1L1EA 1Q0QA 3TBFA 4B6FA 3MWDA 5ES3A 1ILEA 1YZNA 5DBGA 2R00C 1BSVA 2ZJAA 1K2VN 1L5WA 5CLFA 2IVFA 4MUKA 2XQVA 1MJNA 3A9UA 4X91A 2Z8YA 3EWNA 5FFMA 2C58A 2JJ8A 2REQA 2IUYA 4LRQA 4EUFA 2RK4A 7ABPA 4G67A 4MVJM 1R1DA 1JMVA 4OAQA 1QHNA 2O8DA 2ODBA 4Q9JA 3W6ZA 2B0JA 4NVRA 5KVQA 3B5EA 2Q4TA 3ELDA 1ADBA 5CXQA 4FC7A 4OBBA 1YFJA 2ECFA 2GZHA 2ESRA 1AXRA 3FYDA 1OXVA 2Y2UA 3NTVA 5IXYA 4BNXA 2BGLA 2JHCA 3PEEA 4HNTA 3PNBA 2VWHA 2WE8A 3I9V1 2WMNB 2WUFA 3NEPX 1MO2A 4EY3A 2ZRHA 4NPHA 1G8SA 3EPRA 2VQEB 1A5BB 4OAPA 2R1UA 1R6TA 2RI1A 2BCJQ 4D6PA 3QG1A 4GWGA 3WIUA 1I5EA 5AVOA 2X2FA 1VLHA 1T2EA 3DJYA 4Q4HA 3ECSA 3GVHA 4R1NA 1S2OA 4YUVA 1RRKA 4DRXB 1TO2E 4MUJA 3EPKA 1QH8B 2IYXA 1EDZA 5L3QA 4KR3A 3A1CA 4U4AA 1MC8A 3AUUA 1YUNA 3DEFA 4MTCA 1DAPA 1P8JA 2XNKA 2P75A 3MWEA 4MP3A 1YE8A 4QO8A 4UAJA 4KFRA 1JYSA 2P6OA 3M6WA 3OLYA 2OQVA 2H8KA 2IOFK 1EZ4A 1E3EA 1GZUA 2GWRA 4ZKEA 3RNLA 2BW0A 2R4TA 2Z98A 4KH0A 1PHPA 1SFRA 2A1UB 3CRZA 1C9NA 3AEYA 2QIPA 3C7CB 4MUMA 4AG3A 1EFAA 2X19A 2GN6A 2YOGA 4DQLA 3WGGA 1HEIA 1W29A 5CGZA 2MSNA 3W6UA 4FNOA 5IDVA 5A5FA 2NMVA 3BD8A 4CFSA 4F4CA 4K5QA 4HEJA 1BCSA 4GPD1 3H17A 2HHLA 2YYYA 4LW8A 4ZPJA 2XBUA 2HRZA 1V4BA 1DIAA 4CT4B 4DMKA 2OV6A 1CY6A 5EKXA 5FWDA 5HUQA 2RARA 1P19A 821PA 3CZRA 3HFJA 3I09A 5DX8A 3V4ZA 5BV7A 3UH1A 5AW3A 5LMNB 1KJIA 3KB1A 5JNWA 2VP2A 1I2CA 3AF2A 3P9QA 4U2GA 4Y3UA 3TQOA 4QX6A 4QPCA 4XCXA 5CB4A 5EKDA 2HL6A 4G5XA 3V6LA 2EGGA 1U0BB 1JHAA 2YOHA 1IK6A 2Y9MB 3E2PA 1R9MA 1SB8A 1R6VA 3JAKB 2A0XA 3ICPA 2Z6VA 3WV5A 1DWUA 1LPMA 1N4AA 2N46A 2GBCA 3ZE6A 2QRNA 5EXSA 1KL7A 5D2CA 3T12A 4ZVTA 4P9NA 1F2DA 3NVAA 2XA9A 5D1HA 3AONB 3KZ1E 5LMUB 3AR8A 4BQOA 1ULUA 3UJ3X 3HR8A 1OLUB 2CLMB 5JCPA 1UBNA 3KPJA 4MUNA 4RPGA 4JUDX 4CLEA 2VPPA 5TIIA 1VQ1A 3BOSA 1RRMA 5FWXB 2GAIA 1PZEA 1XZHA 3NAZA 2P4HX 1Y48E 3GDWA 4PYOA 1JG2A 4N0EA 3C3MA 2XMZA 2GFHA 1Z0SA 4ZCIA 5C7YA 1JAYA 1FLVA 2OFXA 1JHDA 4GGOA 4LYJA 3PENA 3PT5A 5DW3A 2IYQA 3A25A 3BIXA 3TIIA 4B6OA 2MSCB 1HK7A 3MERA 4CDGA 5K3AA 3RVQA 1T2FA 2SKDA 1T0JB 3TOVA 3OWOA 3QVUA 3OZEA 4EITA 2O48X 1RLJA 2JLYA 3MWYW 3WGVA 3QPVA 4NQRA 4TL8A 3AUAA 1YBHA 3N2EA 1W48A 2HJ9A 2GCOB 1WDMA 3GGGA 1JSRA 4MGEA 5AK5A 3RVNA 1E7QA 1H4TA 2ZYWX 2HXYA 4OSOA 4Q02A 3ZE0B 4XVCA 1NYTA 3WSVA 1OFHA 1ULHA 3AR3A 4YV1A 4B84A 2ZR0A 3Q9UA 3HA2A 4D8TA 2PKRA 1H8EA 3VUEA 4B5KA 2OO5C 1WQ3A 2H9YA 1U5AA 1F4VA 3U3JA 4KRXA 4V0RA 1WPXA 5IJ9A 1GRNA 3NYWA 4OPMA 3HU2A 4MDHA 1MN6A 5J3JA 3IQWA 1JQKA 1VZ3A 3OC0A 3QFRA 2VH2A 5DIFA 4QEKA 2QUKA 3U4GA 1OZAA 2I4OA 1ZN9A 3OE1A 4RIIA 4DDHA 1O95D 3DG9A 4BJHB 3VYTB 4YI3A 4CF3A 4RD6A 1J90A 1NI4B 3C14C 5BPHA 4XFKA 4MCHA 5J2UB 3VV3A 3T06B 4U0KA 4EMUA 4MA4A 2VF5X 1LC3A 4F1JA 1WHSB 5F3RA 1UPBA 5KOJB 4HWSA 4FYXA 3PC4A 1NVDA 3OWHA 3UHAA 5H16A 1ACLA 3KYDB 3I32A 2D3TA 1EX9A 2WJ6A 3VX3A 3HLTA 4BJ1A 1NVAA 2B1GA 4U5QA 3S7TA 2C61A 4HYEA 5EIBD 1F9EA 3NZEA 2YHUA 3LNCA 5HILA 3DE0X 5L3ZA 2G76A 1EHYA 3IP8A 5J5AA 4BLWA 2WIFA 3KDAA 4MVWA 1TAGA 2ERYA 4HLQB 3ISTA 1CZLA 2UV8A 5DOZA 4DB2A 4YUAA 4BO3A 4X62B 3V9AA 1TVEA 2VAMA 4XASA 4LKOA 1D8AA 1Q0SA 1R8JA 3AUJB 4PPFA 4ZCQA 5IEBA 4BAUA 4B3GA 1ZMXA 4H3HB 5LP6A 1TLLA 3DKIA 3TIVA 4CTJA 1J23A 2ZBFA 1F3OA 2I34A 5JPDA 4I8XA 1Y1SA 1KH2A 3PIIA 1SUPA 3SK0A 1TAUA 1EGHA 3R0JA 1RCUA 1H1DA 2ODAA 3FOFC 2TMKA 1C8KA 2O7VA 3FJYA 3GJTA 3WDMA 4CDRA 4IKOA 1YK1A 1VG8A 4KK3A 3OJOA 2ZBDA 1UBOS 2ECPA 3N75A 5LYJB 4MV3A 1AV7A 3N0RA 3TKAA 2JJ1A 2JDIA 2ONKA 3MJFA 1JR6A 1PEYA 3EUWA 3F6CA 3FIJA 1TOAA 4A2QA 1CQWA 4MKXA 1V6CA 1JDSA 4JC5A 3ND5A 4ND8B 4MI1A 3ANXA 3PLRA 1WBDA 1U7OA 1KSHA 2Z9DA 4NAUA 4ICIA 4B8ZA 2H85A 3QMPA 1L7OA 3DE1X 4D3SA 5DPMA 3I1JA 3ZGXA 4RU1A 4OIMA 3TB4A 2QR2A 5C5IA 2VJBA 3DKPA 1JRLA 1BMDA 4Y1RA 1JDVA 1RI5A 2G83A 1AUQA 1G20A 2O14A 1E6UA 3DO6A 3NP7A 3PFBA 4ZU3A 3BF8A 1B6GA 2JIQA 3BK7A 4GNRA 2P9TA 8AT1A 3AEQB 4EATA 3INTA 3P96A 5AHOA 4YAGA 1OH5A 2F9FA 1I51A 1P5JA 1JPUA 4FSHA 2XIQA 4KAXA 2W2NA 3GRFA 1E8MA 1IN4A 3L0YA 3OQVA 2JK1A 3HXOA 1IJFA 4NMWA 4TUYA 1Y9AA 3DEHA 4UHBA 3OQOA 1PVVA 4GL4A 4ADSG 2NUPA 4XRGA 2DBQA 1UT6A 3UC9A 2RSLA 3DE2X 5FNVB 5BURA 1DEAA 3BEDA 4N4AA 2D06A 3AEQA 3ET5A 4LYGA 4RV4A 4WZAA 4GC9A 4UU1A 3TL3A 4E7OA 5BN3B 2VATA 1D2CA 1A9OA 2P2SA 4GVLA 3WKBA 4RABA 4KIWA 4ZYLA 1IBKB 3S2GA 1YIOA 1KOFA 3EBLA 3LP6A 4MKIA 2BI7A 2HXSA 5ICEA 5A3SA 3FAZA 1QAMA 2FPIA 4UE3S 4COOA 5G53C 1Q0UA 1SKYB 2DM6A 2YJTD 3NTOA 4FDVA 4XDHA 3BFPA 3FI0A 1U2TA 1JYFA 1GGNA 1RWWA 2MSWA 2AFVA 1I4OA 3OIWA 5EFZA 1HC7A 2EWWA 5IMBA 2QYHA 4GH5A 3LV8A 1CE8A 4D74A 3DLBA 4BNGA 2RJ3A 4AN1A 1LV8A 2O3QA 1DPFA 4Y6SA 2XYGA 1HE2A 4HWOA 5AP9A 3AJEA 1NT2A 3EVCA 2NXEA 2XUQA 4Z4FA 4I9FA 4TMKA 1L4HA 4TM8A 2PMFA 3P0HA 4AURA 3GHHA 3L3BA 3TD9A 3WLKX 3QUQA 1UKVY 2DZDA 3DGEC 3FPJA 1D2HA 2DWUA 4LOKA 3U44B 3N6RA 2XZLA 1TVKB 4BZZA 5B36A 2FHSA 1WJGA 5KTRA 3FNGA 2IC5A 3SF8B 1OFTA 2VHCA 4DWJA 4NJMB 1ZD8A 3ZJVA 4WXEA 3S2UA 3UTCA 4BNDB 2Q0SA 1QGOA 2BFWA 3KEOA 4RLSA 5JMPA 3EXAA 3W5HA 4CM8A 3SNHA 3KOUA 2CBGA 4M9ZA 2OMKA 5B1EA 5JROA 4AF6A 1X7ZA 4XWWA 5JMTA 4WE3A 2ZWVA 4PSKA 1W85B 3TSAA 2VNKA 3INYA 4CTOA 5JBQA 3O94A 4LYFA 4LFBB 3DT8A 3NM5A 2QXTA 2EDCA 1DSSG 4ZCRA 5CXXA 1S0UA 3GLFE 1KKLA 1KIFA 1XU9A 5KNLA 3PXGA 3FETA 3KM0A 1INLA 3FDIA 1EHIA 1EP2B 3FYUB 3OFJA 4B0OA 3OT5A 4C3UA 4WESB 3N7TA 1X1TA 5FBLB 2P2GA 1DXYA 4LWQA 4E09A 2BBOA 1KSFX 2J3QA 4JMLA 5FTKA 2PGJA 3H5LA 1XZMA 3BC1A 2W70A 1VGQA 1G3IA 4II3A 5HTOA 4CT5A 5J4YA 2DWOA 5CW2A 5GOTA 3OU2A 3GK3A 2HCTA 3ZU6A 1LPOA 3AK4A 4E7PA 3HVIA 4EEXA 5C52B 4JP2A 2WIDA 1U2DA 3PUXA 3WZMA 3QEMA 4Q3CA 1N3LA 4EBFA 3SVTA 4RANA 2IX3A 2CXQA 2FUG1 4IDCA 2AOUB 2BGRA 4FP9A 4LF8B 4JB0A 3HRIA 1ZD5A 4YP1A 3U13A 4RTMA 2LW7A 1ZUHA 5EI5A 4Y2SA 3L4BC 4D3FA 3RQSA 4N6GA 1P1BA 4ZI7A 3S44A 1W0KD 1Y5RA 5K03A 4LHXA 1YOVA 4PCVA 1U6JA 1XPRA 1DJOA 3QIVA 2FQQA 3QWAA 4EUEA 4FGJA 1QG0A 3A28A 3NC1C 1XTKA 2W6JD 3RVOA 3EGXB 4PG7A 3UHPA 4F6RB 1RLIA 2HPAA 4O8CA 3HBFA 4A8TA 1J0DA 4HLUC 3ZV5A 4RW0A 5KEIA 4RV9A 1LH0A 1V1RB 1US8A 3DUFA 3SHWA 4X20B 3EVGA 3EULA 4HY3A 4US1R 1FFGA 4K6KA 3GLHB 1GARA 3COZA 4IMJB 1YHZA 4CNBA 1FJ2A 3GHYA 4QYMA 2VT2A 3PGLA 4EVQA 3D8SA 3EHEA 5IW8A 3RK1A 3WWOA 4RV5A 4L9RA 1TE2A 4JA0A 5A9TA 3PGJA 5DVZA 5I48A 4F7DA 1XAIA 2D74A 2UZIR 3K31A 5A2GA 3F73A 4MPTA 4F85A 4Y9TA 3EUAA 4I2NA 1N8TA 5T6BA 5T6MA 4K6OA 5TGTA 1E2UA 2B8NA 4N39A 4DILA 2WP8J 5M04A 4ZZ0A 1ADJA 2R6ZA 2C4KA 1QTNA 3PWZA 4KWTA 5FNZA 4YIKA 1QHYA 2FPIB 4QNMA 1W4AA 1VXRA 1O0BA 1A9XA 1COZA 3WYCA 4R5MA 1N3IA 3GP5A 1XMXA 2JJ2A 4KG7A 4MV4A 4XGKA 2IV3A 3RYHB 5EIXA 1G21A 2EYQA 3PEUA 3RS5A 2PKCA 4LJAA 5JPIA 3QXHA 4CIBA 4JYAB 1I6KA 2WLTA 4KNYA 4H6PA 4I7EA 3R9XA 1AA9A 1V1MA 2I2AA 3OUTA 3WMEA 4UAVA 1K9VF 3D1VA 1E9AA 1P0FA 2X5NA 4IUBS 3QKIA 1OJLA 3QU7A 5EQDA 1K97A 4MV0A 3PNYA 1WBBA 3WGMA 2VTBA 4MINA 5AMXA 4P4SA 1RPNA 4K86A 4J4HA 2WNHA 3JQ9C 4KTVE 5A03A 3RADC 1KO4A 4QQKA 1F7VA 3IE2A 1UJ2A 2AUNA 3PJFA 5FFNA 4JJ8A 4CLXA 3HKEB 5JS7A 1TECE 5I9MA 1NBOA 4UEOA 3MSCA 4AO7A 1M7BA 3DMDA 3TOCA 4BZXA 5FUQA 3TSCA 3R6TA 1NDUA 2VIIA 3NPMA 3PA6A 4NC9A 3C3AA 1J9EA 5U1PA 3WJ2A 3ZE7A 4WZ6A 1SK9A 1KEEA 4J6FA 1H1LA 3DR3A 5LSAA 3Q6MA 5EIEA 1YAHA 3HUUA 4YJ2B 4KAJA 3IOMA 4G5RA 2PS1A 1QZZA 3JD2A 3V1MA 4CM9A 1XA3A 2R11A 3LBYA 1HLDA 1QV7A 1HDYA 3B52X 5HW0A 1JHUA 2ZSBA 5JO9A 4CWAA 1BWRA 3A4MA 3HN6A 4PVCA 4C7VA 3OJCA 4LV8B 1CUAA 3EXHA 5IT9A 1QX4A 1UZAA 4TQUS 4ZO7A 2MINA 3AJAA 2XTZA 4BL5A 5BV0A 3IEVA 4LJLA 4RETA 5D3ZA 3ZDRA 1JBKA 4BDSA 3L8ZA 3PE4A 3IQZA 4KGDA 2RDMA 3NLLA 1EBUA 1DIRA 1BIFA 2QG9A 3K6RA 4EHIA 3OX3A 1RQ7A 4M0LA 2ZQZA 3NIBA 4KSYA 5JIBA 4DIKA 3RYCA 2XIJA 4IFEA 5CEJA 1LTKA 3UK7A 2C5FA 3RREA 4W5HA 1XNHA 2JGJA 2JHAA 2A9RA 2XVMA 3L0DA 1W4CA 3CN7A 4IUDS 3JQ7A 5DCYA 2B99A 1Q19A 2HQRA 4KLAA 5DXFA 3TR0A 3IODA 4K0KB 3EGIA 2CNNA 4C01A 4B6RA 3ETCA 4UCWA 5HFAA 2GHRA 3QVSA 5LP6F 4YJ2F 1XNJA 4ZAWA 4JUBA 1CJUC 2J7KA 4X92A 2V9CA 1DBRA 2DY1A 2NNWB 3T5AA 2QSYA 1QRSA 5JISA 4GXRA 1LTQA 4PZAA 1KEVA 5JDCC 3WHLA 1R6DA 3HXQA 1PJ2A 2Z57A 1HNZB 1NXXA 3CZ4A 3E7PA 3SVZA 2XNDA 2E5WA 2FU5C 3PGVA 1M0TA 4UTPA 1XZBA 1VDMA 4L22A 2YXPX 4YRRA 5CEEA 4G4SO 3MQ4A 4RGQA 2H1VA 4GYJA 3EXFA 5CUQA 1XK6A 1A69A 3BL8A 1WB6A 2E4AA 2HHJA 3G17A 4FUQA 3MIIA 1E3MA 4OB8A 4D8UA 4V1CI 3ABSB 1XTIA 2JI6A 4KO8A 2HREA 1LI5A 2LIPA 4Z8XA 5AKZA 4D9HA 1DKNA 521PA 1UPXA 3WIDA 5ALSA 1S8AA 1YZGA 3L1UA 1JSLA 5GZ6A 3WK4A 1LF5A 3U9TA 1XEWY 3I9KA 4G1BA 5JJCA 1AS2A 4TMFA 3A2MA 4KBFA 2JCSA 1NVTA 2WHQA 4AYTA 4DRZA 3LKVA 1G17A 1XE3A 2GX6A 3ZWNA 1T5DX 3R3XA 4M6WA 4OKIA 2EBWA 5HBRA 5FT9A 3IDOA 3V8RA 1MGOA 1N3BA 3WLLA 3KV3O 4K9QA 3DAYA 3OICA 3EQ2A 1B76A 4Q3LA 4NZPA 4KQCA 1B0AA 3CZ9A 4TMXA 5K6RA 1GCAA 3R3YA 5E8RA 1FNCA 1IIBA 3EXHC 5ALZA 2HA3A 4OIFA 4YCBA 5MFPA 3QA3E 4PWYA 5BV8A 3H19A 4AMVA 4Z1MA 5DKFA 2NIPA 3RBXA 4DZZA 3OBIA 3IO5A 1YQTA 2IS2A 4GPBA 3WYNA 4IEFB 1DADA 3L05A 6ABPA 4M6WB 2XCTB 4N7MA 2GPJA 4FYWA 5K3DA 3VOAA 1GZ3A 4Y9RA 1NXOA 3CWQA 1HMYA 4EBBA 3OKFA 3BXPA 3A6FA 2AFHE 1Y6QA 2C88A 3NH9A 4G1EB 3WLIA 4B6PA 1Z18A 3MOIA 4HAVA 4D81A 4YWJA 5EJ7A 5FO1A 4YDQA 2ZSFA 2HJRA 2PLWA 3D8NA 2MU1A 2BF4A 3R0VA 4N0MA 3VSCA 5HPYB 1ONPA 5DCWA 4PO1A 1KNXA 3W7BA 2UYOA 4DVJA 4E33A 2XYHA 3O3CA 3HU5A 4BX0A 2CDBA 4P2GA 4EQZA 1H94A 5LZ5A 1TQ2A 4CETA 3A6JA 3AF6A 1RS0A 3ANYB 1F38A 2WKRA 2VLBA 3FWPA 4H18A 4F4JA 4G0ZA 2C2WA 3MQ2A 2WJ3A 5JC8A 3AILA 3ORHA 3V8BA 5H4GA 3C3XA 4RTJA 1QR6A 2Z43A 2C9DA 3QVGB 3ZWYA 4Q9HA 5GMOA 3WBFA 4NKRA 3VHXA 3CEHA 3AHCA 2F43B 3VC2A 1DOZA 1NJFA 4IQFA 2I22A 4Y7CA 4C0HA 4HUJA 4NSNA 3VAYA 4Z5XA 2EJBA 1QP0A 1NBME 1DTSA 3B5JA 4YCNA 4BWVA 4LMRA 4JP3A 2CN1A 2IYEA 3H4TA 5DN6A 3SBEA 5J4HA 4ZGBA 1L7RA 3BH6A 1Y8QB 2GA8A 4EGQA 1OYYA 1SOUA 1UJMA 1PQ4A 5JLJA 1VKJA 2FN7A 3GEHA 1YR1A 1QUFA 2G08A 4FYPA 4H17A 1QLHA 4DUGA 5CXSA 2VP9A 1S2IA 2IUSA 4FGWA 5M7EA 1X7WA 1QLJA 1YCDA 4GI7A 2P2NA 2NXJA 3TK1A 4MWGA 5YASA 3WBJA 1FUIA 1U94A 5EMMA 4GE3A 5L4SA 5BVHA 2ZIVB 1N1EA 1ZA2A 4N6NA 4E5YA 4LY0A 1FB5A 1XL0A 2Q6LA 4WXMA 5AI4A 1M3SA 5B1DA 1H3EA 3ONNA 4II7A 3OOEA 4L57A 4XIJA 2EJWA 2PR7A 3DOJA 4G5GA 3TUJC 2OZLA 4QFDA 4AUNA 1C0PA 1GQQA 2V3WA 2ZBPA 4ARAA 2AZXA 4E6PA 5K4HA 2R7LA 3NEYA 4DRXA 3E84A 3OZXA 3FM9A 4BLOA 4G5HA 4DMHA 1JYEA 1EWVA 2HMVA 2EBHX 5SZHB 1SC3A 2QP3A 2H1OA 2AMJA 2FEXA 1H3FA 4QYSA 3D0KA 3WHPA 1X2BA 1ZNYA 4C4TA 2XOEA 1W46A 4YUWA 2HRQA 2WTXA 5KSZA 3DZKA 1H0SA 2IWRA 3VR5D 3AUYA 4ND7A 2ACVA 5DO9A 4JI3B 3S2YA 3ZDXB 4HX5A 1HI9A 3M8KA 1Y6JA 4J0EA 1PFYA 3KTFA 1RHMA 1TT5A 1WCIB 1Z68A 3PD7A 4C5BA 3JAMA 2IQ5A 3A1UA 1YB6A 5F4ZA 4DADA 1RI3A 2DQZA 5E95A 3S8MA 3KQHA 1W73A 2E9SA 5AKHA 5C0OE 1JIIA 4GOND 3U7IA 1KEUA 3KVOA 4PV7A 5KX5F 4W6ZA 1RJEA 2LVBA 4OP1A 1A5ZA 2YVLA 1SU4A 3NIFB 4B32A 4HBZA 4AKIA 2EFDB 2O2SA 4FYHA 4WJKB 4CKCA 5C8VA 3CWZA 1VPVA 3NB0A 2NZWA 4JJEA 4EW3A 3NONA 3H9BA 1D0SA 4ZYYA 4GNKA 4BLPA 3EPHA 3REGA 2L18A 3HUFA 1DAOA 3CBGA 2E6KA 4IHJA 2BGKA 1H8HD 4MQBA 5JD6A 1GPDG 4UJ3A 3B82A 5ALLA 1UAYA 4YDHB 1FTYA 4QTUB 5J9FA 4EYQA 1JFFA 5A1TA 4LC0A 1WD7A 3IELA 1T6NA 4QJ5A 9ATCA 2VBGA 3IALA 1JA1A 1H9BA 2NSHA 4LHWA 3V5NA 3H9GA 1ZZGA 2JIBA 4X41A 3MRSA 5E7IA 3UQYS 4A92A 1H5QA 1RKQA 4YT4A 1ZAKA 3II6X 3PQ3A 3FRHA 1QORA 1MH1A 3I0ZA 3QW4B 4RIEA 3VYRB 4DLPA 3H2ZA 1LXCA 1B6RA 4MJXA 4WAUA 3WB1A 3T3PB 2Q3DA 2WYHA 4P53A 4QRDA 3CF0A 4D82A 3H5RA 1EAYA 1IYZA 1OAKA 3SZOA 1V8PA 4I3HA 4MRPA 5AXBA 3NI2A 2HF9A 3OIDA 4RKFA 5DNUA 1U2PA 4MCIA 4R8VA 4DSOA 3VKVA 4EPVA 3P27A 4AIRA 4D99A 4EKDA 1LFAA 4N5HX 3FWNA 1S3GA 3RS8A 4D1YA 4JA2A 2OHFA 3BA1A 2CGEA 3SQWA 4H6VA 1CR4A 2JKYA 2XNSA 3P2JA 4G56A 2G9QA 5KYUA 2WA1A 3K0HA 2BAGA 1NFRA 4UREA 2QG6A 2B5OA 2WHEA 4ZTUB 1N5MA 3TLJA 1YFKA 1OXXK 3X1DA 1H8HA 2VSFA 4FI3C 1U81A 1AZTA 2JFHA 1WZNA 4UBLA 5C2JB 4RY2A 1ZUNB 5GVSA 3H18A 2D2VA 3P2OA 2KE5A 3C43A 3ZVLA 3FHTA 1KQGA 6REQA 2YMQA 4JQSA 4C4SA 3IHWA 3SJUA 3WNZA 2IU6A 3JWGA 5FUYA 5BWBA 3AFHA 3ROPA 1IQRA 4X3PA 3LCUA 3PRKE 2BL4A 3EZ9A 2AYXA 2IZ0A 3ZHZA 4O8ZA 4AECA 3GCWA 4WW0A 3ZKWA 4JUAA 3HVJA 4YB8A 4DGSA 1CS0A 3AEZA 3ZD7A 1FYWA 1I7PA 1XCJA 3QU5A 1QO9A 3SN6A 1PO7A 2OWDA 3MPOA 2PN1A 3HA5A 2GMWA 3NHPA 1WUKS 2WTNA 4FD2A 5L3VA 1PKXA 4QOHA 1WXIA 4IHAA 2A5LA 4UVIA 2NO0A 3ETGA 1B00A 1E0DA 1N6HA 3Q3VA 3IUJA 1LNSA 4JLKA 3EW9A 1ZRHA 1V8OA 2IF0A 3U4HA 3V1NA 3W34A 2X2OA 4C7KA 4K9PA 1GILA 5JI3E 3MJCA 1T10A 2JJYA 4NNOA 5HDQA 1O5TA 2AEEA 3A6ZA 1SBHA 3NBXX 2FZGA 2JGLA 1JA0A 1JXMA 3L7OA 1SA0A 3MT0A 1C7ZA 1IWOA 4IZ6A 5DHSA 4BV3A 4XOUA 1CF9A 2EJCA 2OCGA 3GZ4A 4P58A 5JSKA 3I9MA 2D00A 3VAZA 5KC8A 3EQ6A 1MORA 1Y81A 2EKQA 3W5VA 4JLDA 3WJAA 3R77A 4O4JF 2Q3EA 3HI6A 5ANRB 2NV2B 3K9QO 4OJKA 3SOZA 3BB3A 1WS6A 2V7TA 5B3JA 1D4AA 1BDMA 1KP2A 1E32A 2I6GA 5TPWB 4DUGD 4HVLA 5KJ1A 3OT1A 4JLVA 2PKQO 2ZRFA 2I7XA 3KWFA 3QKRB 1J4AA 2O5VA 2QEQA 3PD1A 1KC1A 3I2IA 4AMGA 3QJGA 2E4YA 3HB9A 1JN0A 1DC4A 2W11A 2X2EA 4R9UC 1OH8A 1EK5A 3DC2A 1SXJD 2EJTA 2H1RA 3ZUPA 1R6UA 2A33A 2FOXA 2IXEA 3IIJA 2BEWB 4QICA 3DXZA 2XWPA 3UVEA 3KYCA 3NBQA 3Q41A 3CGWA 1JDNA 4DR7B 3BQNB 1H42A 3QLUC 1KIMA 4AWAA 1OV4A 2PM8A 3REQA 3BE4A 1A7JA 2FPPA 1ZMBA 4CEHB 4N0QA 1USKA 3WHKA 1LY1A 1TMKA 1YO6A 2HSDA 5CJ2A 3V4OA 1CY8A 3GLGE 2PXXA 4CIWA 2RH4A 4YK7A 3UCXA 5F21A 2AC4A 2Q49A 3QLVC 4BFTA 3HDTA 2BSQA 1L4MA 2OP1A 4DYVA 3UH0A 5MN4A 1KEEB 1Z29A 3ETLA 1NLYA 4DARA 2EERA 4RVNA 2HMTA 2W4IA 3A0UA 3FHLA 1DLJA 4C2TA 2IXDA 1GU0A 1B1CA 4FDTA 4NZNA 5DGIA 4DLYA 1COWA 2Z2JA 3EISA 2FFHA 5C4IA 4DANA 2GSWA 3Q10A 2WKSA 1M6NA 3KSZO 4ENRA 1F60A 1T8YA 3F1KA 4LYAA 3DEYX 1X0VA 4F5YA 3V00A 1PJ3A 3R09A 5BSMA 2ZR9A 1D2AA 1GJRA 4TUYB 4O29A 2G06A 3ZWKA 3UGKA 4KR7A 3D4PA 1SURA 1KQ3A 4LF6B 4OXQA 3VR3D 3AVUA 1U1FA 1EK0A 1FDOA 1G1MA 1NQWA 3JAKA 1GL3A 4NBNA 3LDGA 4ON9A 3ZW7A 5AW6A 3MHTA 2IL1A 1NJ2A 3FPBA 4HBGA 1SUSA 1IDN1 3DLPX 4MWBA 4JSTA 4M7RA 2JBAB 3GLFA 2N1MA 4PIMA 4Y0AA 4MS4B 3UXYA 4BVKA 3ENVA 1B1AA 5LJIA 1E60A 4N47A 2RFLA 2Q9UA 2QTTA 2VDKB 2ZCVA 3RS3A 4URVR 1I36A 1BAPA 1FDRA 2BZGA 2AFIB 4MAAA 4S1PA 2OHOA 5AK3A 2JCBA 1KARA 4G4JA 4B74A 1FP4A 1N8SA 3DV0B 3EGOA 1LRLA 1TZBA 3L04A 5EE1A 3RV3A 4J0GA 3MTIA 221PA 4HEA1 5GTDA 4JYPA 5F2OA 1IBCA 1ZJJA 2X0NA 3ZC3A 1FFWA 1YNOA 3IR6A 5K0EA 2OL4A 3AHHA 1Y4SA 2ISSD 5AK6A 1JR3A 3AWIA 5IKEA 2CSXA 1W5BA 4ZWNA 1ECBA 1MRZA 1UXHA 2QVCA 5KHLB 5B5SA 4EF4A 1FYEA 2QLNA 3I28A 2W71A 1KWKA 3G1WA 3MMZA 3AU9A 3H9CA 2ZWMA 4QRIA 3RKSA 2PGIA 3ENZA 3TM4A 3UFXB 1SQ6A 4A6XA 4JV5B 4WKBA 1E58A 2B4TO 1QQBA 5D01A 1L2TA 1LW7A 1VLLA 5KTKA 5E4TA 3GDOA 5IANA 1U7PA 2H31A 2PVPA 3G2PA 4WY5A 4G8CA 3VR6H 2FDCA 1OPRA 4WHMA 2BM9A 4J7AA 1PT8A 4WI1A 1PJ4A 1E2PA 3DD1A 2CCJA 3NT5A 3F2IA 5KHAA 4RY8A 4YRCA 4DWWA 1T5BA 3VU1A 1AQIA 3OIVA 3KTOA 2I8AA 1OT5A 3N2KB 4LJ8A 1GLNA 2GFIA 2QZPA 5CLHA 3JWPA 3RC7A 3WLFA 3WLSA 4CUKA 1EVZA 1VPLA 2P5TB 1XXHB 3BF7A 3C8MA 3KT0A 3HGQA 4FZ3A 4YP6A 1NJSA 4CQJA 4DM7A 2CYCA 3RUHA 5E6RA 4PCLA 4KE6A 4CF6A 3AB7A 3CPSA 5LM3A 1ORRA 1V16B 5HZKA 4F86A 2D4AA 4H27A 4LDZA 1XCPA 3H5VA 4FDLA 4G0PA 2OUIA 2EZTA 5AM1A 1C1XA 2C78A 5B1IA 4LDJA 4RD2A 5JY1A 1SHUX 1BROA 3KSDO 2NG1A 4DKJA 4MTLA 1RAHA 1B15A 3PTLA 1MJGM 3JAWB 5F77A 1YQ9A 3H97A 3KLPX 2HSWA 1K06A 3K9NA 4BNMA 2EWMA 4Z9AA 3V8MA 4EA6A 5ALGA 3DM9B 3WYAA 2QD5A 2YNMC 1N2JA 3QJ5A 2V97A 4OFBA 2E55A 4GP7A 2X58A 4FHFA 1FFAA 3NC4A 4FHZA 5CLLA 1SNYA 1TZMA 4WLOA 1TM1E 2VCHA 4K0RA 4JH0A 4E88A 2ZZMA 1Z4KA 1PDVA 4TMTA 1XLUA 3QENA 1D2GA 1ZC4A 3ASZA 5K3CA 4LXHA 1M73E 2OYRA 1SVMA 5DHTA 3FSRA 5C1OA 5CT9A 1JG4A 4H7HA 4A3SA 3K8OE 2AN1A 3PXUA 5K4AA 5IWCA 1HYQA 2C54A 3JAWA 5HBGA 1NI5A 2ZRDA 3A32A 4PZ9A 5ALDA 3UJBA 5HIKA 4GKKB 1ZI9A 5ABPA 4E5SA 1L7AA 2JD1A 1V1RA 4TPKA 3NKLA 1P2GA 2JLUA 3LVRE 1FFXA 3K5PA 1WG8A 2O4UX 3TJRA 3U0VA 5JQGA 1Y6RA 2C2HA 2FOIA 4KYVA 3ENKA 3B1WA 5JT1A 1G41A 2QTZA 4F1WA 2FSSA 4KR9A 3X1WA 2VRWA 2CXOA 2PV7A 2NUAA 1AU9A 3H0CA 3BZWA 2R44A 4FOLA 5I9IA 1U2DC 5KVVA 1FBNA 4GP9A 3RLIA 4D0RA 1TD1A 2W6IA 3SHTA 4EHLA 1JFSA 2ZP1A 1BDIA 2BJWA 1CEXA 2AG8A 3ZH2A 3FNFA 1CIPA 4QBFA 4E2YA 4CG2A 1BVYF 1W1IA 2QVLA 2W2OA 1Z0IA 2R8XA 4A2CA 4CMIA 4BNVA 1Z7BA 3LRTA 1NSYA 4IAOA 2XW6A 1BX1A 3VU9B 4BVFA 2I2CA 4PCUA 1IE3A 2FE4A 1OPXA 3L4EA 4JHLA 4ENPA 1U7HA 3LOQA 3C5EA 3G0DA 1YRWA 3OPYB 5HKLA 3ESBA 1I2DA 2OZLB 2XZPA 1JPNA 3VH3A 4TTAA 4UOQA 4G36A 4I36A 2JIZD 2F1KA 4RXMA 4Z51A 1XZDA 3U3XA 4S05A 1FS4A 3KQQA 2SCUA 5DT2A 1TKCA 2IA5A 4X1IB 3VFDA 2G1JA 3U5TA 4HZUA 1DDOA 4KGXA 2CYBA 3OEYA 5ENZA 3LECA 5KBYA 1K7SN 2PUVA 2ZPUA 3B1ZA 2ZJ6A 1CZNA 1K86A 1LSUA 2BR3A 5JPCA 3EGWA 1F0KA 4P86A 3UMMA 3PDIB 1NMZA 1JTFA 1EWYA 2TMYA 2PG3A 2XOXA 1YUMA 4G25A 4B4OA 1CUVA 2HV8A 3O1IC 2AEMA 1IK4A 3EDCA 4TL7A 4AY2A 5H70A 2GN4A 1E79D 4LBZA 2C4MA 2W2LA 1JJAA 2G4CA 1Z17A 1H8ED 1K4KA 5AWFC 1UWCA 4R1LA 1CUIA 3Q15C 2IYOA 4XVRA 1QGAA 2Z2XA 3AFGA 4NS4A 4MR9A 3T3EA 1W88B 4BLSA 1CIVA 4IHJB 2OZPA 3BHJA 1IZYA 3Q7EA 4MVJA 1UDAA 1U0OC 5EJ6A 1KO8A 5HCIA 3U4IA 2O6LA 4H3KB 2FW9A 4LCEA 1OD6A 4UXHA 1U0LA 2EFYA 1DQZA 1ZOLA 3GLHE 3RI3A 1G64A 1YFZA 1WDTA 3AG6A 3CRMA 3W8FA 1LK7A 4FNAA 4Y2UA 2GVDC 2II6A 4UXJA 3AOGA 3E1GA 4YMSA 1EVEA 1NURA 1X8LA 1K7YA 5CT8A 2OFOA 4BQPA 2WWYA 3H87A 3U4QA 3IESA 4BDTA 1Z6XA 5ENVA 1K5DA 4CF5A 4DQUA 2OENG 1JXQA 4A82A 4TZ0A 4KBYA 1FYXA 3PQ8A 2JGDA 1QANA 5H7XA 4EI8A 4TKVA 1Z6QA 1E64A 3LIPA 1HUQA 3QX9A 1GYQA 3GARA 2AE2A 4ZODA 5JAQA 4R16A 1DINA 2HWXA 1GSIA 1FSGA 1N5RA 2ZJ2A 4RY9A 2WHYA 1A97A 1FS6A 3MAJA 1P2FA 1XEAA 2YMMA 4KFUA 1EQAA 1D1SA 4QUBA 5DV9A 4ZN6A 3LUJA 4I6GA 1Y6GA 1NXQA 2JBWA 2YDXA 3MCUA 3X43A 1G8HA 2QF7A 1NJGA 3KEGA 4Q3EA 2A35A 2X2PA 3PUWA 1CQPA 5E7JA 1F8FA 4J4BA 1PWYE 1RCTE 3R4VA 3B1FA 5IC6A 3GEMA 2XHEA 5FOUA 1EG2A 3MGCA 2I1WA 1TQ8A 4RF2A 1PN3A 3BMQA 3WWDA 3D2LA 1F8YA 3P4YA 4CMHA 4ZJZA 2XTMA 4C0XA 4CL2A 3R3UA 1ESMA 4AKHA 1BGVA 1SXJA 3NAQA 1YS4A 2V7UA 4YYEA 1WY5A 1PG0A 1QCDA 2X4GA 2NUTB 2JFVA 3BMNB 4TMVA 3TW8A 3RBVA 1ONOA 1WO8A 4KWHA 1WTCA 3F96A 1RI2A 3SS7X 3JQ8A 1M8PA 2RI6A 4TN5A 4C3OB 2CD7A 3HN2A 4CT0A 2NT4A 3TVYA 3N8GA 3GF4A 2I0FA 4LZNA 3W6NA 2PXHA 4F04A 4WASA 2QQ5A 5FB3A 1JWAB 2PRYA 1DKPA 3BCRA 5KHOC 4PRZA 1QYWA 1ZU5A 1M76A 2IHVA 1RHQA 2YBDA 1YKSA 2O3SA 4KRGA 2MWMA 4WLFA 5EXTA 3BCHA 2IY7A 1XFAA 3LJKA 3ZDZB 3ZGYA 5I4BA 3C87A 5JD4A 1O8CA 1U98A 4QGBA 3GRZA 1WP9A 1BHSA 4TS1A 3KZVA 1MT0A 4XWYA 1P3JA 1GQFA 3IEPA 1EX7A 4E08A 4IJMA 3IIKA 3UCEA 1XC7A 4KFTA 3HKBA 3RVJA 4B79A 2Z6QA 2W37A 2G5TA 4FM9A 4KIJA 5H3HA 2W6OA 4BLQA 2XCRB 2GJ4A 3R9XB 1OF1A 4ZT5A 3MMSA 3T1YB 1OOEA 3PYLA 4LK2A 3DMNA 2ZOSA 3SYTA 3OKCA 1HYGA 2WKWA 1UZLA 3T3DA 1OI2A 2DMRA 3VYSB 1NF2A 3UAWA 1QGYA 1SBQA 2EJUA 1P7ZA 2DTDA 1SXPA 2BHTA 2RB4A 2ADMA 3H16A 2VAXA 3AXSA 4FFNA 1HOXA 3PDIA 5IT0A 3KD2A 1HZZC 1I4TD 2W90A 3PT9A 3QHAA 1CHDA 2R6R1 3RJTA 1I1HA 5JATA 5I7FA 3FYTA 4HPWA 3ESDA 4R01A 5JJKA 1NZJA 1GFIA 1XZQA 3M4NA 3OUZA 1KP9A 4BO5A 3KEMA 4Q4CA 4YRMA 1J22A 2I99A 4NZZA 1KOJA 4Z0HO 3X1ZA 4EQ6B 4XVQA 1NKSA 3QLTA 5ALWA 1TX4B 2GH1A 2MT9A 1Z4JA 1GZ6A 1L8AA 1W0CA 2OKGA 4BQEA 1HPLA 3AHJA 1RBYA 4W8GA 1N33B 1P3Y1 3JU3A 3C8UA 4TWJA 2R7NA 1AN9A 1O08A 1DQNA 3W9BA 3H4VA 1JL3A 4LZPA 1NZFA 1H2RS 2IITA 2PO5A 5EIFA 3NW9A 5G4KB 3AMVA 4KO2S 1JNXX 3KSRA 2FX3A 4W9MC 3I9NA 4H3SA 4G0VA 1V3UA 4FU0A 3WLOA 3RFFA 1N2CB 4AJ2A 4EKNB 4D9NA 4UBJA 2FSPA 3BWEA 5K3FB 3SIPA 1ORWA 4N0PA 2IPXA 2IHKA 2X3UA 4GFDA 5IVDA 2IBMA 4KITB 3UIEA 5K0SA 1XDZA 1JZTA 2V6JA 3VZRA 4N01A 3G0BA 2BWJA 2RHWA 2OM2A 2C4HA 4FKBA 3M4JA 1MB9A 3DV9A 4MEAA 1FXSA 1XA0A 4DIOA 3AV3A 2VNHA 1ZA1A 1YZUA 2ECQA 3LUFA 4NE7A 3BAFA 2JAWA 4KQWA 4NOLA 2WT8A 3IP1A 4YVFA 4NU6A 5EWJA 3RG2A 5IWAB 4GEGA 1T5IA 1PP4A 4HWPA 5GP1A 2HPVA 3ZCRA 5IUNC 5GAJA 5I45A 5IKPA 1U2QA 3AJ9A 3FTNA 1SBYA 4D9BA 5BNTA 5DI3A 4NOMA 2C5HA 1Z12A 1AURA 3VJKA 3L6DA 4LMAA 3JSXA 2G9UA 1NWHA 4L3OA 3K9FC 1XTRA 2ZRJA 2PSFA 4IWXA 5CLIA 4BFVA 3QSYA 1BNCA 2P4UA 4HNUA 3CC8A 4L27A 5L4NA 4EHJA 3C7KA 3LI2A 3Q7TA 4JC0A 2X5JO 4TLBA 1KRXA 3CISA 3CE9A 2FPUA 2WVGA 2I03A 3NT2A 3PUHA 4UTNA 1Y37A 2MYNA 4RPIA 4QM7A 1RYYA 1JIKA 1LNQA 3AF3A 2A30A 2VWPA 5JCZA 2XVAA 2F8SA 3KJZA 4K6CA 1ARZA 1K3TA 3HJBA 3Q7QA 1XAHA 3V3TA 2B4AA 5AXAA 4X7BA 4IOKA 5AM4A 5FOXA 2OCPA 1BQ4A 4OKSA 3VC1A 2O19A 3UY4A 4L0MA 3A1SA 2PUTA 2GBLC 2EQBA 3GYBA 3IYLW 4UE6A 4ZKDA 4V1CB 2ZW9A 4GIBA 4AJLA 2JFQA 1HH4A 3MBKA 4MHOA 2OBYA 3E9DA 3DE3X 3E7FA 4U2EA 4UFNA 1A50B 1M72A 1QO0D 1H6CA 3AFOA 1R4NB 1T1EA 4JQZA 1X94A 2N3ZA 4NESA 1XQXA 3Q5EA 1PU2A 2DGDA 3PZRA 2BTEA 2XMBA 1MOPA 2YXEA 1LS1A 1TFRA 4CKBB 4N0DA 5B4VA 2WYOA 3E15A 3E7DA 2G9VA 3QLUA 3O2JA 4UVDA 1TJ3A 1L7BA 2R8EA 2P0EA 3P8ZA 2HK8A 1WSAA 3I3SR 1N2ZA 2R1VA 3NOOA 4M21A 4A36A 1T6XA 4KR2A 3D3NA 1GD1O 1AF4A 1OGYA 2J9FB 4YRGA 1NQ5A 4KXUA 3G0CA 4NATA 4WEQA 4C21A 1J5XA 2RGRA 3OF3A 5L3QB 1SOWA 2IHTA 3KUUA 2GXSA 5AK0A 2M6LA 4ZT6A 1P7VA 4YMHA 1V8BA 2OBBA 2PQMA 3RU2A 3KVNA 4EDFA 3G7NA 4IHQA 2G7MC 3OEEA 3QXSA 4FCCA 3UAZA 1MF7A 3CEJA 3KKPA 5JWHA 1GQOA 4I8IA 2CXSA 3NR2A 2AQHA 1L4NA 4REOA 4J0HA 4Q4HB 1ZDMA 3OFND 5G41A 2SHKA 4DC0A 3CJTA 2RGNA 2NU8B 1RAEA 3P2IA 1RXSA 1JPVA 2CE7A 4R05A 5EERA 3E18A 3IEIA 3W9YA 3ZKAA 3KJGA 5IX8A 4ZVMA 5J2UF 5FTJA 5L8VA 1FYFA 4GBED 5AKIA 3R0QA 4QO7A 4UCQA 5DWQA 3VYWA 4G9GA 2G9NA 4B9AA 3MMPA 4IDDA 2ZTVA 4V0NA 5AJTA 1HLFA 1T9BA 4ZA2A 5BUSA 1IOWA 1E3TA 1SKQA 1XRQA 4KPEC 2BEWA 2VDUE 1BVRA 2PUGA 1PJQA 3LQKA 1CBUA 2AVDA 4QODA 4I4TA 3S0JA 4F3KA 3AYZB 5F9MA 2QGZA 1K08A 2WMDA 1FMCA 4RHTA 2C4TA 1YS6A 3VNAA 4JP5A 3G9QA 4LQ4A 2ON6A 4KN9S 5E9JA 2W8BB 3W5BA 3DP9A 2CMHA 1Z5PA 2OQ2A 1WEKA 4MQ6A 4GT1A 1TQDA 5KDLA 3Q3EA 4R3WA 5ICMA 1HGXA 1NXVA 3N9IA 1LVUA 2VHUA 3NBKA 5I01A 3GJRA 2XVXA 1RQLA 3KJIA 4GWLA 4AKGA 1GCOA 4MRNA 1V35A 2ZJYA 2E48A 2SKCA 1DJQA 3ED1A 5CPBA 4BE7B 3FOAA 2EFEB 3Q85A 1FRZA 1L5NA 4EAAA 2GN8A 1AH2A 1I5RA 4DLZA 1A1SA 1Z7WA 2FY8A 3SC3A 4BVLA 2AEFA 4K87A 2O2GA 2FSHA 4QUAA 4XB2A 1NHWA 1A9ZA 3KQPA 1OXUA 4GXNA 1ZK0A 3WRVA 3HWX1 1ORTA 1UZMA 3EDMA 1XD9A 4FEYA 4HN4B 4EYEA 2J3HA 1DARA 1MG0A 2OBXA 1CFJA 3GFGA 1GQRA 3LPNA 4CNQA 4AKEA 1I2AA 2BEUB 1IHYA 3IB3A 4CXMA 5A4DA 3W3AH 1Z15A 1AA6A 1G55A 1N9KA 2ZAYA 3KT8A 1UIMA 4LXYA 2X15A 2A1TR 4NMXB 3I01M 3REOA 4UM9D 1DRUA 1RYBA 3CRNA 4XIIA 1AKYA 2I3ZA 4CG1A 3V2HA 1RBMA 3ZIAD 4YYZA 1ADYA 1BH2A 2JBAA 2XT9A 3U4DA 4QUGA 3BE5A 2QRVB 1IZZA 5GV8A 3O7WA 4KXQA 3UWPA 5GJBA 3NGLA 2W93A 2JI7A 1MP0A 2W6MA 4DR6B 2DJIA 4A0GA 3EAFA 4PNPA 5FAXA 4EA7A 3KOXA 4MUHA 1RLMA 1TXGA 3ESRA 1ZCZA 3K6KA 2VF2A 3SM9A 4EA9A 3I61A 1WULS 5DYIA 1JKJA 3EY4A 5HUHA 3EZNA 4DR4B 1C4XA 1QSGA 2WIBA 2KHZA 3DB1A 2Q62A 3QY9A 4LQDA 4P3YA 4RSMA 4CODB 1C3JA 1ESCA 4IXMA 5FP0A 4UULA 3D81A 4CKWA 2MJLA 4Y6LA 2J0SA 5AI9A 3D6VA 3VRHA 1XTUA 2DQ4A 5EG5A 4YFVA 3ROGA 3SXPA 4YV7A 3G68A 1SY7A 2X0KA 1RFGE 2YJ5A 4WN9B 4R71A 1WSDA 3IT2A 1XEFA 3NX4A 3HWRA 2PSHA 2JIPA 2YJNA 1OC2A 1RVV1 3FKJA 1GKUB 1E2FA 2GEKA 5ED0A 4CI9A 1KO5A 1YR8A 2PUAA 1NMQA 2EG5A 2BI4A 1DP4A 1Q11A 1T2CA 3MJTA 1UP4A 4FWIB 1J8YF 4BV8A 1YVDA 1U1DA 4KOAA 5TR9A 5JJLA 3BIFA 2E4XA 4G01B 3RHFA 3DBHB 1O03A 3IPYA 5F98A 3BSSA 3LBFA 3T7RA 1IXYA 1ENPA 4KUHA 4KC0A 4NABA 3WB9A 1Z7EA 3LYLA 4PLVA 5BQOA 3D5TA 4KTTE 1M34A 4P4UA 4Q01A 4AZVA 2WSYB 1XMOB 3I6MA 2B82A 1R0BA 4ZZ2A 2XE7A 3IHLA 3TFOA 2H6EA 3E61A 3PHIA 3U56A 1Z13A 3DZHA 5JWRA 2NP6A 2ZRBA 3JQCA 2ZJBA 4RMHA 4MHSA 1TU4A 4M9UA 3A26A 4AMBA 3C6QA 3EARA 1IM2A 1U3WA 4N18A 2GPBA 3KL2A 4C0BA 2FCAA 4OGWA 3KNZA 3EEOA 1NXWA 2DPXA 1N2XA 5LQDA 3EVTA 3PX2A 4LWOA 3IDFA 1OIVA 3NHBA 1XZNA 3ICEA 3IAEA 4V03A 1KDTA 3UV7A 1XEWX 5J58A 2PU5A 1JVSA 1R5NA 2BMFA 4OMUA 1K5HA 2A67A 4YMGA 1X86B 1QB7A 2NSDA 4QXMA 5LNK6 1Y7PA 1NP3A 1NOKA 2BMVA 3CE6A 4LI3X 3HVRA 4DF3A 4JSYA 1IHUA 1PGPA 3QNMA 1MJGA 3MAAC 3UZUA 4ZP1A 1GGJA 1NVWQ 4BBJA 3DUWA 3ULKA 5FOQA 3FWKA 1KQOA 2PYZA 2ACEA 2KBEA 2L19A 3DDHA 1HDOA 1IEXA 3K1AB 3MTEA 4TOIA 4XLLA 1MABA 4ZALA 1RRGA 1QFSA 2D7CA 3HY6A 3UMGA 5PGMA 1TJYA 3M9XA 3GT3A 4TLDA 2C7BA 3TR5A 4ARBA 2P4QA 3COPA 2MMGA 5FLYA 3F74A 5I9BA 1WLSA 2QLJA 3TTXA 2NVUA 3AOEC 4FMDF 1R0KA 1WVIA 3URKA 2LNDA 1FL9A 3D1LA 4A8JB 4ZU1X 1YVUA 3ZHQA 3V1YA 2RCNA 4V2UA 3RF6A 4NV0A 3PNPA 4QELA 4ZICA 5EXXA 1F0YA 3WLNA 5EFOA 4U2DA 3S4YA 1E6WA 3C70A 1MKYA 4JR0A 2O3TA 5GOZA 4A0QA 1VKNA 2YY6A 3B2QA 3LE8A 3EVBA 4R1PA 3EGEA 4DMFA 3U4QB