1ZNEA

Strong solute-solute dispersive interactions in a protein-ligand complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
157
Chain Sequence
EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major Urinary Protein
publication title Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 44
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1zneA00
1ZNKA 4OMWA 1LF7A 1PM1X 2YG2A 2ALLX 3P6HA 4TLJA 3NADA 3VG3A 2R56A 3HWEA 3WJEA 4HPCA 5LJBA 3L4RA 3GAQA 4IAWA 5HAEA 4ODDA 3PH5A 1EALA 1KT3A 3WJCA 2HYSA 3IA8A 4LZUA 1KQXA 1LPJA 4LKTA 4EFGA 3CR6A 3BS2A 1N0SA 1ACDA 4ORWA 2FTBA 1LIBA 2WEXA 3DTQA 4ZH6A 5KICA 1IIUA 1DF3A 3FEPA 1QFVA 3RZYA 5L8OA 4QYPA 4TKJA 3PP6A 1T8VA 3P6FA 2GC9A 3B2JA 1FELA 3B2KA 4NYRA 4YDAA 4QYNA 2W2AA 3APWA 5CE4A 3WBGA 1FTPA 1KT6A 4GH7A 1CBQA 2JOZA 2L67A 1TVQA 4GETA 5EDBA 3TGAA 3ELZA 5AQ6A 1GXAA 1A2DA 2WSJA 5F7GA 4TKBA 1CRBA 1VYFA 3NP1A 2AT3X 3AKMA 3TZSA 4ZHFA 3KFIA 1LICA 3APVA 4IB9A 4ORYA 2X45A 4NLJA 3K3LA 2LKKA 1U17A 1LNMA 1MVGA 2LBAA 5FAZA 4WFVA 1U18A 4DQ3A 3MVFA 4MVLA 3WJFA 2NNDA 3KFGA 3FELA 1YWBA 4AZRA 2FLJA 5LJGA 1BJ7A 1BRPA 4A1YA 5HTDA 3KFFA 1NGLA 4D6AA 2G79A 2O62A 1TXLA 2X46A 3U0DA 4YFRA 3BLGA 2E4JA 1KQWA 4YFQA 3U9PC 2Q9SA 1OEKA 3P6EA 1GM6A 2FT9A 1CBIA 3CQRA 3CBSA 4HPDA 1YWAA 5LJCA 4AZMA 3VG6A 2L68A 5IO7A 1AQBA 4ZR2A 1LFOA 2NNQA 1OBQA 2QO5A 3MBTA 1CJ5A 1HN2A 1OPBA 1NP1A 2NNEA 4N7DA 1D3SA 1QABE 5B29A 5EZ2A 1ALBA 1YP7A 3G7XA 5EEDA 1GT1A 4UU2A 3DSZA 1LIDA 3ZQ3A 1MDCA 1FENA 1ICMA 3IFBA 3HWFA 1XKIA 3BY0A 4NNTA 1HQPA 1BM5A 1B8EA 1ZNEA 3VG5A 4AZQA 4LKPA 5HWZA 1KXOA 2Q2MA 4LZVA 4NYQA 4YFPA 5HTEA 1SY3A 5H8TA 4NNSA 3APXA 2WR6A 1B0OA 4CK4A 1LIFA 2Q4NA 1OBPA 5F1EA 5HCCC 3FA7A 3NQ9A 1ZRYA 3WVMA 1NP4A 3NR3A 2N93A 1QY0A 3FR5A 5D8JA 1OBUA 4EEJA 1S44A 3O19A 5HCEC 4ES7A 4Y0PA 3EMMA 4QGVA 2L9CA 4ORXA 1UZ2X 2FRSA 1S2PA 4XMEA 4ZGUA 4WFUA 2MM3A 4XMFA 4YBPA 3FA9A 3QKGA 2K62A 2RCQA 2CZTA 2MJIA 1P6PA 1FEMA 2LFOA 4ZH9A 4ZHHA 4RUUA 5BVQA 5B27A 3NX2A 5K06A 3ZUIA 5KIDA 1YP6A 2OVDA 4IB6A 1KOIA 2RQ0A 3STNA 4O9SA 4I3DA 4TNNA 1GGLA 1D2UA 1TOUA 3B2HA 2FS6A 2KTDA 1SXUA 1EIIA 4D6BA 3JSQA 5D47A 3UEXA 3FW5A 3PECA 4HPAA 5D45A 4I9RA 5BVSA 4A60A 1EUOA 3FW4A 4GNYA 1RLBE 3FA6A 1B4MA 1ICNA 2HZRA 3FEKA 2FS7A 5D4AA 5HZ9A 1SXXA 3ELXA 1YWCA 3CBCA 1BLRA 4UU3A 2RCTA 5JR8A 1G7NA 2G7BA 3O2YA 4Y0RA 4OMXA 1BSQA 1QY1A 1A57A 4YMYA 1CBSA 4ORSA 5HA0A 2LBVA 4A1HA 4AW8A 2JU8A 4QGWA 4YKOA 4YH0A 3F9DA 3KQ0A 4IB8A 4IMNA 2WUTA 3B2LA 1Z24A 2AH7X 3OJYC 1YWDA 1VPRA 1H91A 4TKHA 1S7DA 3FENA 1GT5A 4Y0QA 1X71A 1GX8A 5LJEA 1QG5A 5HZ8A 3S26A 4AZNA 1DZJA 3P6DA 1SY1A 4QAEA 2CM4A 1IW2A 5L8IA 5F58A 1IFBA 3WJGA 4XMCA 3U03A 1JJJA 2CBSA 3EM0A 1I06A 1LKEA 2QO6A 1DZKA 2G78A 3WXQA 4K19A 1ADLA 5LJHA 2ACOA 3BU9A 1MUPA 4NLIA 3FMZA 4ZJ0A 2K23A 2PY1A 4ALOA 3UEVA 1ZNGA 2OFMX 5DPQA 4ALBA 4M7MA 2A0AA 2FWVA 1EIOA 4YDBA 5EDCA 2JU3A 4BOEA 4BVMA 3EBKA 1EPBA 2AKQA 1JBHA 1R0UA 4AYHA 1O1UA 3STMX 3BSZE 3BU1A 1ERXA 4GNWA 2CM9A 1RBPA 3C76X 4OS3A 3CMPA 4YGHA 4YGZA 2LB6A 4ZHCA 1GKAB 2W2BA 5H9KA 2AT8X 3EYCA 1YIVA 2DM5A 1HMTA 4YGGA 4RUNA 5HZQA 1EQDA 3NX1A 1YUPA 3RSWA 2Q39A 1BEBA 5HCDC 1BBPA 1TOWA 1DV9A 5H9AA 1L6MA 2JN3A 1KT4A 5LJDA 2QOSC 2POAA 3FIQA 1IKEA 2NP1A 2A2UA 1AVGI 4QZUA 1X8NA 1FDQA 4ARHA 2HNXA 3P6GA 4R0BA 1KT7A 5KHPA 5LKFA 2CZUA 2QO4A 3NQ3A 2A3FX 4QGXA 2HMBA 2AT5X 5H9NA 5HZ5A 4WBKA 2GJ5A 2RA6A 3JS1A 4EDEA 3NPOA 5C0NA 2FR3A 1A18A 4IB7A 3APUA 1I05A 1EXSA 3BDRA 3TF6A 1GKAA 1PEEA 1SY2A 2P8GA 1O1VA 2MO5A 5DG4A 3P6CA 2GTFX 4ORUA 4I3BA 2WEWA 3C78X 1BWYA 3PPTA 5HZ6A 4AZOA 3Q6LA 3ZUOA 5HA1A 3I17A 5F6ZA 2Q2PA 1SXYA 5EEEA 4YBUA 3SAOA 4XMDA 3UEUA 2A2GA 2ASNX 5IO5A 2F73A 2WQAE 2W2FA 1A3YA 1MX7A 5LJKA 1HBPA 1ERBA 1E02A 1BRQA 5HBSA 1EPAA 4YCEA 1QWDA 4ZFXA 1O8VA 1GT4A 3HWDA 3VG2A 2CBRA 3I0AA 3O22A 1PMPA 4ORRA 5IO6A 5FFHA 1GX9A 1BSYA 1E5PA 2ANSA 2ACPX 2AT0X 1VYGA 4OS0A 3BRNA 4TJZA 5BVTA 4TQ2A 2BLGA 3HK1A 1TW4A 4GRJA 1B56A 1KZWA 2IFBA 1DFVA 4HPBA 4IBAA 3FA8A 1DZPA 1EW3A 1HBQA 1JYJA 1CBRA 3BX7A 1UREA 1ML7A 1GT3A 1X89A 4GE1A 3TGCA 4N7CA 1OPAA 3D96A 1ZNDA 3FR4A 4Y0SA 2HZQA 3PH6A 4MVIA 1SXWA 1X8PA 3BX8A 1G85A 2R74A 5H9LA 1E00A 1G74A 4I3CA 3STKA 2AT6X 2AL0X 2L5PA 2R73A 1JZUA 4YCHA 3CWKA 1I04A 1KGLA 1AELA 5LKEA 1OEEA 3F8AA 1HMRA 3HWGA 3EBWA 3KFHA 4KIIA 2KT4B 2OVEA 1JYDA 4I9SA 4A8ZA 1LIEA 4GKCA 1U0XA 2XKLA 3FLLA 1T68X 1DC9A 1OEJA 2WQ9A 4XMHA 1JV4A 2EU7X 1SA8A 1X8QA 2AMMX 3CQNA 2OZQA 1KT5A 1XCAA 1MX8A 2OVAA 5F6BA 2RD7C 1HMSA 5FENA 3PEDA 2A13A 5EPQA 4M6SA 1IFCA 1ZNHA 4EXZA 1PBOA 1FE3A 3WJDA 2JU7A 5L8NA 1X8OA 3FR2A 1X8UA 4ZHDA 3D97A 4HFOA 4NP1A 3C77X 1BSOA 1DZMA 3AKNA 2QM9A 2XSTA 1T0VA 3VG7A 1QQSA 4PSQA 1JJXA 4IMOA 1E06A 1QY2A 4YKMA 4AZPA 4BQUA 3TGBA 2OFRX 1KZXA 3KZAA 1SY0A 3T1DA 1ZNLA 4OS8A 4DQ4A 4QZTA 2FR2A 3D95A 4ZCBA 3UEWA 1QFTA 2WWPA 4XMGA 3B2IA 4MVKA 5D48A 1AB0A 1G5WA 1IKJA 1I4UA 3VG4A 4IAXA 3WJBA 2HLVA 4ZHGA
chains in the Genus database with same CATH superfamily
1ZNKA 4OMWA 3WZQA 1LF7A 1PM1X 2YG2A 2ALLX 3P6HA 4TLJA 4QNIA 3NADA 3VG3A 2PI3O 2R56A 3HWEA 4HPCA 3WJEA 5LJBA 1WBIA 3L4RA 3GAQA 3MG5A 3SOTA 4IAWA 2KTSA 4CDCA 5IRUA 5HAEA 3PDFA 4GJSA 3PH5A 4ODDA 4Z2VA 1EALA 4GZVA 1KT3A 1N9MA 4GD9A 2A5BA 3RKGA 3RBYA 3WJCA 2HYSA 1Y53X 3IA8A 4Y5DA 4LZUA 1W4TA 2X55A 1KQXA 1LPJA 2Z4HA 4LKTA 5B11O 3VHMA 4EFGA 3CR6A 3BS2A 4BBOA 3VU1A 2OY7A 1N0SA 1ACDA 4ORWA 2FTBA 1NQNA 1VWGB 3HPEA 2OF8A 2M4LA 1LIBA 2WEXA 3DTQA 4ZH6A 3PQUA 1IIUA 5KICA 1DF3A 4O4OA 1RXKA 5IRAA 4U8UO 1UYOX 3RE5A 2BS6A 1QFVA 3FEPA 3RZYA 2OVSA 5L8OA 2KW1A 2FHLA 4QYPA 4TKJA 3PP6A 1T8VA 3VE1A 3P6FA 2GC9A 2HKDA 3SZHA 5K67A 3B2JA 1FELA 3B2KA 4NYRA 4YDAA 3WOVA 4QYNA 2QMIA 2W2AA 3APWA 4U9CA 3WBGA 5CE4A 1FTPA 1KT6A 4GH7A 1MEPA 1CBQA 2JOZA 2L67A 4QQ1A 2RTCB 4MIRA 4DNEA 1TVQA 4GETA 1N43A 5FQ7E 3WJBA 2RTHB 5EDBA 3TGAA 3ELZA 5AQ6A 1GXAA 4DCBA 1A2DA 4I95A 2WSJA 5F7GA 4TKBA 4O4UA 1CRBA 1VYFA 3ZW0A 4QGVA 3NP1A 2AT3X 3AKMA 3TZSA 1KFFA 1JIWI 5F2BA 2GTLM 4O4XA 4ZHFA 3EC5A 3KFIA 4YVBA 1LICA 3APVA 3ZZVA 4IB9A 4JGLA 4EQAC 2OL8O 4ORYA 2X45A 1VWHB 3P02A 3K3LA 2LKKA 4NLJA 1VWLB 3FDCA 1U17A 1LNMA 1MVGA 2LBAA 5FAZA 4WFVA 1U18A 4DQ3A 2AF5A 3MVFA 1SWJA 4O3ZA 2IZHB 4MVLA 3WJFA 2NNDA 3GE2A 3KFGA 1E2TA 3FELA 1YWBA 4OKAA 4AZRA 2Y3FA 2RTAA 2BC3A 4OS0A 2OYBO 2FLJA 1STPA 1N4JA 5LJGA 1BJ7A 1BRPA 2RTMA 4A1YA 4Z6JA 3KFFA 1N9YA 4ON1A 5HTDA 1NGLA 4D6AA 2F09A 1RXJA 2G79A 1SLGB 1TXLA 2O62A 1JMZA 2IZFB 2X46A 4YFRA 1VWJB 3U0DA 3BLGA 3H3IA 4KH8A 2RTQB 4B55A 2E4JA 4COTA 3EW2A 1KQWA 4YFQA 2C1QA 2Q9SA 3U9PC 4CDFA 1OEKA 4BX7B 3P6EA 1GM6A 2FT9A 1CBIA 4MEEA 3CQRA 3CBSA 4HPDA 1YWAA 5LJCA 1STSB 3VG6A 2L68A 1SWFA 2OF9A 1LELA 2Y3EA 1AQBA 1MK5A 4AZMA 5IO7A 4ZR2A 1VWQB 1LFOA 2NNQA 1OBQA 3VE2A 1JQPA 2BSZA 2QO5A 3MBTA 1CJ5A 1HN2A 2OY8A 1OPBA 1NP1A 2NNEA 2I5ZO 1D3SA 1QABE 4N7DA 4BCSA 5B29A 4MVEA 4JHQA 5EZ2A 1ALBA 1SWNA 3RE6A 3NQKA 2RTIB 4FBVA 1VWMB 1VWOB 5B10O 4BX6B 1YP7A 2KD2A 2JGSA 3G7XA 2CAMA 5EEDA 1GT1A 4UU2A 4NW4A 3DSZA 1LIDA 1LUQA 3HTYA 1MDCA 1FENA 1ICMA 3IFBA 3HWFA 3ZQ3A 2OL6O 1XKIA 2GTLO 1UYNX 3AEHA 3BY0A 4IAXA 4IRWA 1HQPA 4MVIA 1B8EA 1ZNEA 4NNTA 3RDMA 2Y32A 4LKPA 3VG5A 1KXOA 2Q2MA 2X56A 4GDZA 4LZVA 4WHIA 5HWZA 4NYQA 4YFPA 5HTEA 1SY3A 3D4RA 5H8TA 1AVEA 2IZCB 4NNSA 3APXA 2WR6A 1B0OA 4CK4A 4CSBA 1LIFA 2Q4NA 1OBPA 5F1EA 5HCCC 3FA7A 3NQ9A 1JMXA 5CHKA 1STRB 1ZRYA 3WVMA 5AJBA 1NP4A 1RSUB 3NR3A 3WYQA 2N93A 1VWDB 1QY0A 3ZI8A 3FR5A 5D8JA 1OBUA 4EEJA 1MM9A 1S44A 3O19A 5HCEC 4ES7A 4Y0PA 3EMMA 1VYOA 2L9CA 1NC9A 1UZ2X 2FRSA 1S2PA 4ORXA 4XMEA 3VHHA 4WFUA 4BX7A 2MM3A 4XMFA 4ZGUA 4YBPA 1EI5A 3FA9A 3QKGA 2K62A 2RCQA 2CZTA 2MJIA 1P6PA 5B5FA 1FEMA 1SWLA 1LCVA 2LFOA 3ZW0B 2RTDB 4ZH9A 4ZHHA 4RUUA 5BVQA 5B27A 3NX2A 3D9WA 1SWBA 5K06A 3ZUIA 5KIDA 1YP6A 1HXZA 2OVDA 1RXHA 4IB6A 1KOIA 2RQ0A 3STNA 4O9SA 4I3DA 2IZBA 4BX6A 2OFAA 4TNNA 1GGLA 1D2UA 1TOUA 3B2HA 4Z2PA 4CPHB 4BX5A 2FS6A 1VWKB 2KTDA 1N7YA 3RDOA 2X4MA 1SXUA 1EIIA 2IZJA 4D6BA 3JSQA 5D47A 3UEXA 1JBHA 3FW5A 3PECA 4HPAA 5D45A 4I9RA 5BVSA 4A60A 4O3XB 2IZGB 4L1NA 1EUOA 2FHNX 3RY1A 3FW4A 4GNYA 1RLBE 5IXGA 3FA6A 3MM0A 1B4MA 2ZSCA 1ICNA 2HZRA 3FEKA 2FS7A 5D4AA 5HZ9A 1SXXA 3Q34A 3ELXA 1YWCA 3CBCA 1BLRA 1K3BA 4UU3A 2ZAIA 3SLOA 2RCTA 4JNJA 5JR8A 1G7NA 2G7BA 3O2YA 4Y0RA 4OMXA 4JO6A 1BSQA 1QY1A 1A57A 4YMYA 1CBSA 4ORSA 5HA0A 2LBVA 4A1HA 1RAVA 4AW8A 2JU8A 3OBLA 4QGWA 4YKOA 4YH0A 3F9DA 2BHVA 3KQ0A 4HWMA 4IB8A 1GX3A 2WUTA 1Y9LA 1Z24A 3B2LA 4IMNA 4U3QA 4BGFA 2AH7X 3OJYC 1YWDA 2VFBA 1VPRA 1H91A 1VWAB 4TKHA 1S7DA 3FENA 1GT5A 4Y0QA 3RDQA 1X71A 1GX8A 3PK2A 3RDUA 1QG5A 4GGTA 5LJEA 5HZ8A 2IZDB 2DJFA 2A5CA 3S26A 4AZNA 2IZKA 3FYFA 4AZQA 1DZJA 3P6DA 1SY1A 4KCAA 2CM4A 4QAEA 3WZNA 4CPHA 1IW2A 2X8TA 4Z2OA 5L8IA 5F58A 1IFBA 1PBYA 1NQMA 3WJGA 3V8UA 1BM5A 2AVIA 3KVNA 4XMCA 3U03A 1JJJA 2CBSA 3EM0A 1I06A 1LKEA 2QO6A 4O3WA 5L3YA 4KC7A 1DZKA 2G78A 4U46A 4K19A 3WXQA 1ADLA 5BYPA 5LJHA 2ACOA 3BU9A 1MUPA 2GH7A 4FBOA 3FMZA 4KT5A 2K23A 1SRFA 2PY1A 4NLIA 1I9HA 1ZNGA 3UEVA 4ALOA 4ZJ0A 2OFMX 5DPQA 4L3RA 4ALBA 2RTBB 1SWTA 2A0AA 4M7MA 1SWDA 4NV8A 2F01A 2FWVA 2RTFB 1EIOA 4YDBA 5EDCA 2ZAGA 2JU3A 4BOEA 4BVMA 3EBKA 1EPBA 1KL4A 1LCWA 2AKQA 3FIDA 3HOLA 3S5XA 4CPIA 1R0UA 4CDDA 4AYHA 1W5RA 4CV7A 1O1UA 3STMX 3BSZE 3BU1A 4I60A 1NDJA 4O4SA 1ERXA 3OD9A 1SWAA 1Y55X 2CM9A 1RBPA 3C76X 4GNWA 3CMPA 4IABA 4OS3A 2LB6A 4YGHA 4YGZA 4ZHCA 1GKAB 4GU8A 2W2BA 2BT9A 5H9KA 2AT8X 3E3CA 3EYCA 1YIVA 2IZAA 2DM5A 2RTPB 1JJUA 2YMSA 3X00A 1HMTA 4CDEA 4YGGA 4RUNA 4CPFA 2C1SA 5HZQA 3CKFA 1EQDA 3NX1A 1YUPA 3LHNA 3RSWA 4GGRA 5CYBA 2Q39A 3SLTA 1BEBA 5HCDC 1BBPA 1SRIA 1TOWA 1DV9A 3VPJE 5H9AA 1L6MA 2JN3A 1KT4A 1SREA 5LJDA 1VWPB 2QOSC 2POAA 3FIQA 1IKEA 2NP1A 2A2UA 4Z28A 1AVGI 4QZUA 3S5VA 1X8NA 2VFCA 1FDQA 4ARHA 3OE3A 2HNXA 3P6GA 4R0BA 1KT7A 2X34A 2RTNB 4FQBB 2UYWA 5B5GA 4BX5B 1SWSA 4MISA 5KHPA 2I5VO 5LKFA 2CZUA 2QO4A 1W6FA 3NQ3A 3WYPA 2A3FX 4QGXA 2HMBA 1VWEB 4PJ2A 2AT5X 5H9NA 5HZ5A 2MWHA 4WBKA 1OSPO 4C5PA 2GJ5A 2RTEB 2RA6A 3JS1A 4EDEA 1PTSA 3NPOA 4KC8A 3QQ2A 5C0NA 2FR3A 1A18A 3SLJA 4IB7A 2IZLB 2MF6A 3APUA 1I05A 1EXSA 3BDRA 3CKGA 3TF6A 3RDXA 3ZW1A 1GKAA 1PEEA 1SY2A 2P8GA 4Y59A 1SRJA 1O1VA 3SZJA 2MO5A 5DG4A 3P6CA 1KL3A 1SRHA 2GTFX 2WPUA 4I3BA 4OEMA 4ORUA 2WEWA 3C78X 1BWYA 3MX7A 3PPTA 5HZ6A 4AZOA 2GTLN 1Y9TA 2RTGB 3Q6LA 3ZUOA 4INNA 1SLDB 5AEOA 1SRGA 1LDOA 3I17A 5F6ZA 5HA1A 1WUBA 1HQQA 1SXYA 2Q2PA 5EEEA 1SWHA 1SWUA 4YBUA 3SAOA 2FKGA 4XMDA 3UEUA 2A2GA 2DJGA 2ASNX 2VDFA 1LCZA 2G8CO 4I6SA 5IO5A 2F73A 4LQZA 2WQAE 1A3YA 2IZEB 2W2FA 5B2AO 1MX7A 5LJKA 1HBPA 1ERBA 1E02A 1VWRB 1BRQA 5HBSA 1EPAA 4YCEA 1QWDA 4ZFXA 1O8VA 1GT4A 2Z4IA 3HWDA 3VG2A 2CBRA 3I0AA 3O22A 1SWOA 3HOEA 4CPEA 3PQSA 1PMPA 4ORRA 5IO6A 5FFHA 3S60A 4Z27A 4O49A 1GX9A 1BSYA 1E5PA 2ANSA 1HY2A 2ACPX 1VYGA 1VWNB 2AT0X 2FGSA 3BRNA 2RTLA 2RTRB 4TJZA 4TQ2A 5BVTA 1SWKA 2BLGA 2X8FA 3HK1A 1TW4A 1SLFB 4BJ8A 4GRJA 1B56A 1KZWA 2IFBA 4O3YA 1DFVA 4HPBA 4IBAA 3FA8A 1DZPA 1EW3A 1HBQA 1JYJA 1CBRA 3BX7A 1UREA 1ML7A 1GT3A 2OY1O 1MOYA 4ID2A 1X89A 1NBXA 4GE1A 3TGCA 4N7CA 1VWCB 5B3MO 1OPAA 3P24A 2JMBA 4NV7A 3AUMO 5JD2A 3D96A 3RWXA 5FQ8E 2A8GA 1ZNDA 3FR4A 1VWIB 2OFBA 4FGIB 4Y0SA 2HZQA 3PH6A 1IJ8A 1SXWA 1SWRA 1X8PA 2UZ2A 1G85A 1SWPA 2R74A 3BX8A 3JQOA 1E00A 4OELA 1G74A 2RTOB 4I3CA 5H9LA 2FKJA 3STKA 2AT6X 3LTWA 2AL0X 2L5PA 2R73A 4U8UN 1JZUA 2MHDA 4YCHA 3CWKA 2OL7A 1I04A 1KGLA 5CSEA 1AELA 5LKEA 1OEEA 3F8AA 1HMRA 3HWGA 3EBWA 3KFHA 4KIIA 3T6FA 5K68A 2KT4B 2RN4A 2OVEA 3RDSA 1JYDA 4I9SA 3N91A 1I78A 1LIEA 4GKCA 4A8ZA 1U0XA 2XKLA 3FLLA 1T68X 1DC9A 1OEJA 2WQ9A 4XMHA 1JV4A 2EU7X 3ZW2A 1SWGA 3ZW1B 1SA8A 4GGZA 1DF8A 1X8QA 1K24A 3NBXX 2AMMX 3CQNA 2OZQA 1KT5A 2QOMA 1XCAA 1MX8A 3T2XA 1LDQA 1Y0GA 2BS5A 2RTKA 2OVAA 2OY5O 2QCBA 3LV4A 5F6BA 2RD7C 1HMSA 5FENA 3PEDA 2A13A 5EPQA 4M6SA 1IFCA 4ML7B 1ZNHA 4EXZA 1SWEA 1PBOA 1FE3A 1SMPI 3WJDA 3EW1A 2JW1A 2JU7A 1KL5A 1X8OA 3VGWA 3UAQA 5L8NA 1Y52X 1VWBB 4GJVA 1SWCA 3FR2A 3T2WA 1X8UA 3T6LA 4ZHDA 2C4IA 3D97A 2G5LA 2RTJA 4HFOA 3WZPA 4NP1A 3C77X 3RY2A 4QRLA 1BSOA 1DZMA 3VHIA 4GDAA 2LA7A 3AKNA 2QM9A 2X32A 2XSTA 4U8UM 3WZOA 1T0VA 3SZIA 1QQSA 3VG7A 5IRWA 1VWFB 4PSQA 1JJXA 4IMOA 1E06A 1AVDA 1FJ1E 1QY2A 4YKMA 4AZPA 4BQUA 1SWQA 3TGBA 2OFRX 4GK9A 5FQ6E 1KZXA 3KZAA 1SY0A 3T1DA 4FBRA 1ZNLA 4OS8A 4DQ4A 4QZTA 2FR2A 3D95A 4ZCBA 3UEWA 1QFTA 1RSTB 1SLEB 4ZGFA 1HXLA 2WWPA 2IZIA 3F6ZB 3ZWEA 4EKVA 4XMGA 3B2IA 4MVKA 5D48A 1AB0A 1G5WA 1IKJA 1I4UA 3VG4A 4GUZA 2X8SA 5AJCA 2HLVA 4ZHGA
chains in the Genus database with same CATH topology
1ZNKA 4OMWA 1LF7A 1PM1X 2YG2A 2ALLX 3P6HA 4TLJA 4QNIA 3NADA 3VG3A 2R56A 3HWEA 3WJEA 4HPCA 5LJBA 3L4RA 3SOTA 3GAQA 4IAWA 2KTSA 5HAEA 4ODDA 3PH5A 1EALA 4GZVA 1KT3A 3RKGA 3RBYA 3WJCA 2HYSA 3IA8A 4LZUA 2Z4HA 1KQXA 1LPJA 4LKTA 4EFGA 3CR6A 3BS2A 3VU1A 1N0SA 1ACDA 4ORWA 2FTBA 2M4LA 1LIBA 2WEXA 3DTQA 4ZH6A 3PQUA 1IIUA 5KICA 1DF3A 4O4OA 4U8UO 2BS6A 1QFVA 3FEPA 3RZYA 2OVSA 5L8OA 2KW1A 4QYPA 4TKJA 3PP6A 1T8VA 3VE1A 3P6FA 2GC9A 3B2JA 1FELA 3B2KA 4NYRA 4YDAA 3WOVA 4QYNA 2QMIA 2W2AA 3APWA 4U9CA 3WBGA 5CE4A 1FTPA 1KT6A 4GH7A 1CBQA 2JOZA 2L67A 4QQ1A 4MIRA 1TVQA 4GETA 5FQ7E 3WJBA 5EDBA 3TGAA 3ELZA 5AQ6A 1GXAA 1A2DA 4I95A 2WSJA 5F7GA 4TKBA 4O4UA 1CRBA 1VYFA 3ZW0A 3NP1A 2AT3X 3AKMA 3TZSA 1JIWI 2GTLM 4O4XA 4ZHFA 3KFIA 1LICA 3APVA 3ZZVA 4IB9A 4JGLA 4EQAC 4ORYA 2X45A 4NLJA 3P02A 3K3LA 2LKKA 1U17A 1LNMA 1MVGA 2LBAA 5FAZA 4WFVA 1U18A 4DQ3A 3MVFA 4O3ZA 4MVLA 3WJFA 2NNDA 3GE2A 3KFGA 3FELA 1YWBA 4AZRA 2FLJA 5LJGA 1BJ7A 1BRPA 4A1YA 5HTDA 3KFFA 4ON1A 1NGLA 4D6AA 2F09A 2G79A 2O62A 1TXLA 2X46A 3U0DA 4YFRA 3BLGA 3H3IA 4KH8A 2E4JA 4COTA 1KQWA 4YFQA 3U9PC 2Q9SA 1OEKA 3P6EA 1GM6A 2FT9A 1CBIA 3CQRA 3CBSA 4HPDA 1YWAA 5LJCA 4AZMA 3VG6A 2L68A 5IO7A 1AQBA 4ZR2A 1LFOA 2NNQA 1OBQA 3VE2A 2QO5A 3MBTA 1CJ5A 1HN2A 1OPBA 1NP1A 2NNEA 4N7DA 1D3SA 1QABE 5B29A 4MVEA 5EZ2A 1ALBA 3NQKA 4FBVA 1YP7A 2KD2A 3G7XA 5EEDA 1GT1A 4UU2A 4NW4A 3DSZA 1LIDA 3ZQ3A 3HTYA 1MDCA 1FENA 1ICMA 3IFBA 3HWFA 1XKIA 2GTLO 3BY0A 4IAXA 4NNTA 1HQPA 1BM5A 1B8EA 1ZNEA 3VG5A 4AZQA 4LKPA 5HWZA 1KXOA 2Q2MA 4GDZA 4LZVA 4WHIA 4NYQA 4YFPA 5HTEA 1SY3A 3D4RA 5H8TA 4NNSA 3APXA 2WR6A 1B0OA 4CK4A 4CSBA 1LIFA 2Q4NA 1OBPA 5F1EA 5HCCC 3FA7A 3NQ9A 1ZRYA 3WVMA 5AJBA 1NP4A 3NR3A 2N93A 1QY0A 3ZI8A 3FR5A 5D8JA 1OBUA 4EEJA 1S44A 3O19A 5HCEC 4ES7A 4Y0PA 3EMMA 4QGVA 2L9CA 4ORXA 1UZ2X 2FRSA 1S2PA 4XMEA 4ZGUA 4WFUA 2MM3A 4XMFA 4YBPA 1EI5A 3FA9A 3QKGA 2K62A 2RCQA 2CZTA 2MJIA 1P6PA 1FEMA 2LFOA 3ZW0B 4ZH9A 4ZHHA 4RUUA 5BVQA 5B27A 3NX2A 5K06A 3ZUIA 5KIDA 1YP6A 2OVDA 4IB6A 1KOIA 2RQ0A 3STNA 4O9SA 4I3DA 4TNNA 1GGLA 1D2UA 1TOUA 3B2HA 2FS6A 2KTDA 1SXUA 1EIIA 4D6BA 3JSQA 5D47A 3UEXA 3FW5A 3PECA 4HPAA 5D45A 4I9RA 5BVSA 4A60A 4O3XB 4L1NA 1EUOA 3FW4A 4GNYA 1RLBE 3FA6A 1B4MA 1ICNA 2HZRA 3FEKA 2FS7A 5D4AA 5HZ9A 1SXXA 3ELXA 1YWCA 3CBCA 1BLRA 4UU3A 2ZAIA 2RCTA 5JR8A 1G7NA 2G7BA 3O2YA 4Y0RA 4OMXA 1BSQA 1QY1A 1A57A 4YMYA 1CBSA 4ORSA 5HA0A 2LBVA 4A1HA 4AW8A 2JU8A 3OBLA 4QGWA 4YKOA 4YH0A 3F9DA 2BHVA 3KQ0A 4HWMA 4IB8A 2WUTA 3B2LA 1Y9LA 1Z24A 4IMNA 4U3QA 2AH7X 3OJYC 1YWDA 1VPRA 1H91A 4TKHA 1S7DA 3FENA 1GT5A 4Y0QA 1X71A 1GX8A 5LJEA 1QG5A 5HZ8A 3S26A 4AZNA 3FYFA 1DZJA 3P6DA 1SY1A 4KCAA 2CM4A 4QAEA 1IW2A 2X8TA 5L8IA 5F58A 1IFBA 3WJGA 3V8UA 4XMCA 3U03A 1JJJA 2CBSA 3EM0A 1I06A 1LKEA 2QO6A 4O3WA 4KC7A 1DZKA 2G78A 3WXQA 4K19A 5BYPA 1ADLA 5LJHA 2ACOA 3BU9A 1MUPA 4FBOA 4KT5A 3FMZA 4NLIA 2K23A 2PY1A 4ALOA 4ZJ0A 3UEVA 1ZNGA 2OFMX 5DPQA 4L3RA 4ALBA 4M7MA 2A0AA 2FWVA 1EIOA 4YDBA 5EDCA 2ZAGA 2JU3A 4BOEA 4BVMA 3EBKA 1EPBA 2AKQA 3HOLA 3S5XA 4CV7A 1JBHA 1R0UA 4AYHA 1O1UA 3STMX 3BSZE 3BU1A 4O4SA 1ERXA 3OD9A 4GNWA 2CM9A 1RBPA 3C76X 4OS3A 3CMPA 4IABA 4YGHA 2LB6A 4YGZA 4ZHCA 1GKAB 4GU8A 2W2BA 2BT9A 5H9KA 2AT8X 3E3CA 3EYCA 1YIVA 2DM5A 2YMSA 1HMTA 4YGGA 4RUNA 5HZQA 1EQDA 3NX1A 1YUPA 3LHNA 3RSWA 5CYBA 2Q39A 1BEBA 5HCDC 1BBPA 1TOWA 1DV9A 3VPJE 5H9AA 1L6MA 2JN3A 1KT4A 5LJDA 2QOSC 2POAA 3FIQA 1IKEA 2NP1A 2A2UA 1AVGI 4QZUA 3S5VA 1X8NA 1FDQA 4ARHA 3OE3A 2HNXA 3P6GA 4R0BA 1KT7A 4FQBB 4MISA 5KHPA 5LKFA 2CZUA 2QO4A 3NQ3A 2A3FX 4QGXA 2HMBA 4PJ2A 2AT5X 5H9NA 5HZ5A 2MWHA 4WBKA 2GJ5A 2RA6A 3JS1A 4EDEA 3NPOA 4KC8A 5C0NA 2FR3A 1A18A 4IB7A 3APUA 1I05A 1EXSA 3BDRA 3TF6A 3ZW1A 1GKAA 1PEEA 1SY2A 2P8GA 1O1VA 2MO5A 5DG4A 3P6CA 2GTFX 4ORUA 4I3BA 2WEWA 3C78X 1BWYA 3MX7A 3PPTA 5HZ6A 4AZOA 2GTLN 1Y9TA 3Q6LA 3ZUOA 4INNA 5AEOA 5HA1A 3I17A 5F6ZA 2Q2PA 1SXYA 5EEEA 4YBUA 3SAOA 4XMDA 3UEUA 2A2GA 2ASNX 5IO5A 4I6SA 2F73A 4LQZA 2WQAE 1A3YA 2W2FA 1MX7A 5LJKA 1HBPA 1ERBA 1E02A 1BRQA 5HBSA 1EPAA 4YCEA 1QWDA 4ZFXA 1O8VA 1GT4A 2Z4IA 3HWDA 3VG2A 2CBRA 3I0AA 3O22A 3HOEA 3PQSA 1PMPA 4ORRA 5IO6A 5FFHA 3S60A 4O49A 1GX9A 1BSYA 1E5PA 2ANSA 2ACPX 2AT0X 1VYGA 4OS0A 3BRNA 4TJZA 5BVTA 4TQ2A 2BLGA 2X8FA 3HK1A 1TW4A 4GRJA 1B56A 1KZWA 2IFBA 4O3YA 1DFVA 4HPBA 4IBAA 3FA8A 1DZPA 1EW3A 1HBQA 1JYJA 1CBRA 3BX7A 1UREA 1ML7A 1GT3A 4ID2A 1X89A 4GE1A 3TGCA 4N7CA 1OPAA 3P24A 2JMBA 3D96A 3RWXA 5FQ8E 1ZNDA 3FR4A 4Y0SA 4FGIB 2HZQA 3PH6A 4MVIA 1SXWA 1X8PA 3BX8A 1G85A 2R74A 3JQOA 5H9LA 1E00A 1G74A 4I3CA 3STKA 2AT6X 2AL0X 2L5PA 2R73A 4U8UN 1JZUA 2MHDA 4YCHA 3CWKA 1I04A 1KGLA 1AELA 5LKEA 1OEEA 3F8AA 1HMRA 3HWGA 3EBWA 3KFHA 4KIIA 2KT4B 2RN4A 2OVEA 1JYDA 4I9SA 3N91A 4A8ZA 1LIEA 4GKCA 1U0XA 2XKLA 3FLLA 1T68X 1DC9A 1OEJA 2WQ9A 4XMHA 1JV4A 2EU7X 3ZW2A 3ZW1B 1SA8A 1X8QA 3NBXX 2AMMX 3CQNA 2OZQA 1KT5A 1XCAA 1MX8A 2BS5A 2OVAA 3LV4A 5F6BA 2RD7C 1HMSA 5FENA 3PEDA 2A13A 5EPQA 4M6SA 1IFCA 4ML7B 1ZNHA 4EXZA 1PBOA 1FE3A 1SMPI 3WJDA 2JW1A 2JU7A 5L8NA 1X8OA 3UAQA 3FR2A 1X8UA 4ZHDA 3D97A 4HFOA 4NP1A 3C77X 4QRLA 1BSOA 1DZMA 2LA7A 3AKNA 2QM9A 4U8UM 2XSTA 1T0VA 3VG7A 1QQSA 4PSQA 1JJXA 4IMOA 1E06A 1QY2A 4YKMA 4AZPA 4BQUA 3TGBA 2OFRX 4GK9A 5FQ6E 1KZXA 3KZAA 1SY0A 3T1DA 4FBRA 1ZNLA 4OS8A 4DQ4A 4QZTA 2FR2A 3D95A 4ZCBA 3UEWA 1QFTA 4ZGFA 2WWPA 3F6ZB 3ZWEA 4XMGA 3B2IA 4MVKA 5D48A 1AB0A 1G5WA 1IKJA 1I4UA 3VG4A 2X8SA 5AJCA 2HLVA 4ZHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZNK A;  4OMW A;  1LF7 A;  1PM1 X;  2YG2 A;  2ALL X;  3P6H A;  4TLJ A;  3NAD A;  3VG3 A;  2R56 A;  3HWE A;  3WJE A;  4HPC A;  5LJB A;  3L4R A;  3GAQ A;  4IAW A;  5HAE A;  4ODD A;  3PH5 A;  1EAL A;  1KT3 A;  3WJC A;  2HYS A;  3IA8 A;  4LZU A;  1KQX A;  1LPJ A;  4LKT A;  4EFG A;  3CR6 A;  3BS2 A;  1N0S A;  1ACD A;  4ORW A;  2FTB A;  1LIB A;  2WEX A;  3DTQ A;  4ZH6 A;  5KIC A;  1IIU A;  1DF3 A;  3FEP A;  1QFV A;  3RZY A;  5L8O A;  4QYP A;  4TKJ A;  3PP6 A;  1T8V A;  3P6F A;  2GC9 A;  3B2J A;  1FEL A;  3B2K A;  4NYR A;  4YDA A;  4QYN A;  2W2A A;  3APW A;  5CE4 A;  3WBG A;  1FTP A;  1KT6 A;  4GH7 A;  1CBQ A;  2JOZ A;  2L67 A;  1TVQ A;  4GET A;  5EDB A;  3TGA A;  3ELZ A;  5AQ6 A;  1GXA A;  1A2D A;  2WSJ A;  5F7G A;  4TKB A;  1CRB A;  1VYF A;  3NP1 A;  2AT3 X;  3AKM A;  3TZS A;  4ZHF A;  3KFI A;  1LIC A;  3APV A;  4IB9 A;  4ORY A;  2X45 A;  4NLJ A;  3K3L A;  2LKK A;  1U17 A;  1LNM A;  1MVG A;  2LBA A;  5FAZ A;  4WFV A;  1U18 A;  4DQ3 A;  3MVF A;  4MVL A;  3WJF A;  2NND A;  3KFG A;  3FEL A;  1YWB A;  4AZR A;  2FLJ A;  5LJG A;  1BJ7 A;  1BRP A;  4A1Y A;  5HTD A;  3KFF A;  1NGL A;  4D6A A;  2G79 A;  2O62 A;  1TXL A;  2X46 A;  3U0D A;  4YFR A;  3BLG A;  2E4J A;  1KQW A;  4YFQ A;  3U9P C;  2Q9S A;  1OEK A;  3P6E A;  1GM6 A;  2FT9 A;  1CBI A;  3CQR A;  3CBS A;  4HPD A;  1YWA A;  5LJC A;  4AZM A;  3VG6 A;  2L68 A;  5IO7 A;  1AQB A;  4ZR2 A;  1LFO A;  2NNQ A;  1OBQ A;  2QO5 A;  3MBT A;  1CJ5 A;  1HN2 A;  1OPB A;  1NP1 A;  2NNE A;  4N7D A;  1D3S A;  1QAB E;  5B29 A;  5EZ2 A;  1ALB A;  1YP7 A;  3G7X A;  5EED A;  1GT1 A;  4UU2 A;  3DSZ A;  1LID A;  3ZQ3 A;  1MDC A;  1FEN A;  1ICM A;  3IFB A;  3HWF A;  1XKI A;  3BY0 A;  4NNT A;  1HQP A;  1BM5 A;  1B8E A;  1ZNE A;  3VG5 A;  4AZQ A;  4LKP A;  5HWZ A;  1KXO A;  2Q2M A;  4LZV A;  4NYQ A;  4YFP A;  5HTE A;  1SY3 A;  5H8T A;  4NNS A;  3APX A;  2WR6 A;  1B0O A;  4CK4 A;  1LIF A;  2Q4N A;  1OBP A;  5F1E A;  5HCC C;  3FA7 A;  3NQ9 A;  1ZRY A;  3WVM A;  1NP4 A;  3NR3 A;  2N93 A;  1QY0 A;  3FR5 A;  5D8J A;  1OBU A;  4EEJ A;  1S44 A;  3O19 A;  5HCE C;  4ES7 A;  4Y0P A;  3EMM A;  4QGV A;  2L9C A;  4ORX A;  1UZ2 X;  2FRS A;  1S2P A;  4XME A;  4ZGU A;  4WFU A;  2MM3 A;  4XMF A;  4YBP A;  3FA9 A;  3QKG A;  2K62 A;  2RCQ A;  2CZT A;  2MJI A;  1P6P A;  1FEM A;  2LFO A;  4ZH9 A;  4ZHH A;  4RUU A;  5BVQ A;  5B27 A;  3NX2 A;  5K06 A;  3ZUI A;  5KID A;  1YP6 A;  2OVD A;  4IB6 A;  1KOI A;  2RQ0 A;  3STN A;  4O9S A;  4I3D A;  4TNN A;  1GGL A;  1D2U A;  1TOU A;  3B2H A;  2FS6 A;  2KTD A;  1SXU A;  1EII A;  4D6B A;  3JSQ A;  5D47 A;  3UEX A;  3FW5 A;  3PEC A;  4HPA A;  5D45 A;  4I9R A;  5BVS A;  4A60 A;  1EUO A;  3FW4 A;  4GNY A;  1RLB E;  3FA6 A;  1B4M A;  1ICN A;  2HZR A;  3FEK A;  2FS7 A;  5D4A A;  5HZ9 A;  1SXX A;  3ELX A;  1YWC A;  3CBC A;  1BLR A;  4UU3 A;  2RCT A;  5JR8 A;  1G7N A;  2G7B A;  3O2Y A;  4Y0R A;  4OMX A;  1BSQ A;  1QY1 A;  1A57 A;  4YMY A;  1CBS A;  4ORS A;  5HA0 A;  2LBV A;  4A1H A;  4AW8 A;  2JU8 A;  4QGW A;  4YKO A;  4YH0 A;  3F9D A;  3KQ0 A;  4IB8 A;  4IMN A;  2WUT A;  3B2L A;  1Z24 A;  2AH7 X;  3OJY C;  1YWD A;  1VPR A;  1H91 A;  4TKH A;  1S7D A;  3FEN A;  1GT5 A;  4Y0Q A;  1X71 A;  1GX8 A;  5LJE A;  1QG5 A;  5HZ8 A;  3S26 A;  4AZN A;  1DZJ A;  3P6D A;  1SY1 A;  4QAE A;  2CM4 A;  1IW2 A;  5L8I A;  5F58 A;  1IFB A;  3WJG A;  4XMC A;  3U03 A;  1JJJ A;  2CBS A;  3EM0 A;  1I06 A;  1LKE A;  2QO6 A;  1DZK A;  2G78 A;  3WXQ A;  4K19 A;  1ADL A;  5LJH A;  2ACO A;  3BU9 A;  1MUP A;  4NLI A;  3FMZ A;  4ZJ0 A;  2K23 A;  2PY1 A;  4ALO A;  3UEV A;  1ZNG A;  2OFM X;  5DPQ A;  4ALB A;  4M7M A;  2A0A A;  2FWV A;  1EIO A;  4YDB A;  5EDC A;  2JU3 A;  4BOE A;  4BVM A;  3EBK A;  1EPB A;  2AKQ A;  1JBH A;  1R0U A;  4AYH A;  1O1U A;  3STM X;  3BSZ E;  3BU1 A;  1ERX A;  4GNW A;  2CM9 A;  1RBP A;  3C76 X;  4OS3 A;  3CMP A;  4YGH A;  4YGZ A;  2LB6 A;  4ZHC A;  1GKA B;  2W2B A;  5H9K A;  2AT8 X;  3EYC A;  1YIV A;  2DM5 A;  1HMT A;  4YGG A;  4RUN A;  5HZQ A;  1EQD A;  3NX1 A;  1YUP A;  3RSW A;  2Q39 A;  1BEB A;  5HCD C;  1BBP A;  1TOW A;  1DV9 A;  5H9A A;  1L6M A;  2JN3 A;  1KT4 A;  5LJD A;  2QOS C;  2POA A;  3FIQ A;  1IKE A;  2NP1 A;  2A2U A;  1AVG I;  4QZU A;  1X8N A;  1FDQ A;  4ARH A;  2HNX A;  3P6G A;  4R0B A;  1KT7 A;  5KHP A;  5LKF A;  2CZU A;  2QO4 A;  3NQ3 A;  2A3F X;  4QGX A;  2HMB A;  2AT5 X;  5H9N A;  5HZ5 A;  4WBK A;  2GJ5 A;  2RA6 A;  3JS1 A;  4EDE A;  3NPO A;  5C0N A;  2FR3 A;  1A18 A;  4IB7 A;  3APU A;  1I05 A;  1EXS A;  3BDR A;  3TF6 A;  1GKA A;  1PEE A;  1SY2 A;  2P8G A;  1O1V A;  2MO5 A;  5DG4 A;  3P6C A;  2GTF X;  4ORU A;  4I3B A;  2WEW A;  3C78 X;  1BWY A;  3PPT A;  5HZ6 A;  4AZO A;  3Q6L A;  3ZUO A;  5HA1 A;  3I17 A;  5F6Z A;  2Q2P A;  1SXY A;  5EEE A;  4YBU A;  3SAO A;  4XMD A;  3UEU A;  2A2G A;  2ASN X;  5IO5 A;  2F73 A;  2WQA E;  2W2F A;  1A3Y A;  1MX7 A;  5LJK A;  1HBP A;  1ERB A;  1E02 A;  1BRQ A;  5HBS A;  1EPA A;  4YCE A;  1QWD A;  4ZFX A;  1O8V A;  1GT4 A;  3HWD A;  3VG2 A;  2CBR A;  3I0A A;  3O22 A;  1PMP A;  4ORR A;  5IO6 A;  5FFH A;  1GX9 A;  1BSY A;  1E5P A;  2ANS A;  2ACP X;  2AT0 X;  1VYG A;  4OS0 A;  3BRN A;  4TJZ A;  5BVT A;  4TQ2 A;  2BLG A;  3HK1 A;  1TW4 A;  4GRJ A;  1B56 A;  1KZW A;  2IFB A;  1DFV A;  4HPB A;  4IBA A;  3FA8 A;  1DZP A;  1EW3 A;  1HBQ A;  1JYJ A;  1CBR A;  3BX7 A;  1URE A;  1ML7 A;  1GT3 A;  1X89 A;  4GE1 A;  3TGC A;  4N7C A;  1OPA A;  3D96 A;  1ZND A;  3FR4 A;  4Y0S A;  2HZQ A;  3PH6 A;  4MVI A;  1SXW A;  1X8P A;  3BX8 A;  1G85 A;  2R74 A;  5H9L A;  1E00 A;  1G74 A;  4I3C A;  3STK A;  2AT6 X;  2AL0 X;  2L5P A;  2R73 A;  1JZU A;  4YCH A;  3CWK A;  1I04 A;  1KGL A;  1AEL A;  5LKE A;  1OEE A;  3F8A A;  1HMR A;  3HWG A;  3EBW A;  3KFH A;  4KII A;  2KT4 B;  2OVE A;  1JYD A;  4I9S A;  4A8Z A;  1LIE A;  4GKC A;  1U0X A;  2XKL A;  3FLL A;  1T68 X;  1DC9 A;  1OEJ A;  2WQ9 A;  4XMH A;  1JV4 A;  2EU7 X;  1SA8 A;  1X8Q A;  2AMM X;  3CQN A;  2OZQ A;  1KT5 A;  1XCA A;  1MX8 A;  2OVA A;  5F6B A;  2RD7 C;  1HMS A;  5FEN A;  3PED A;  2A13 A;  5EPQ A;  4M6S A;  1IFC A;  1ZNH A;  4EXZ A;  1PBO A;  1FE3 A;  3WJD A;  2JU7 A;  5L8N A;  1X8O A;  3FR2 A;  1X8U A;  4ZHD A;  3D97 A;  4HFO A;  4NP1 A;  3C77 X;  1BSO A;  1DZM A;  3AKN A;  2QM9 A;  2XST A;  1T0V A;  3VG7 A;  1QQS A;  4PSQ A;  1JJX A;  4IMO A;  1E06 A;  1QY2 A;  4YKM A;  4AZP A;  4BQU A;  3TGB A;  2OFR X;  1KZX A;  3KZA A;  1SY0 A;  3T1D A;  1ZNL A;  4OS8 A;  4DQ4 A;  4QZT A;  2FR2 A;  3D95 A;  4ZCB A;  3UEW A;  1QFT A;  2WWP A;  4XMG A;  3B2I A;  4MVK A;  5D48 A;  1AB0 A;  1G5W A;  1IKJ A;  1I4U A;  3VG4 A;  4IAX A;  3WJB A;  2HLV A;  4ZHG A; 
#chains in the Genus database with same CATH topology
 1ZNK A;  4OMW A;  3WZQ A;  1LF7 A;  1PM1 X;  2YG2 A;  2ALL X;  3P6H A;  4TLJ A;  4QNI A;  3NAD A;  3VG3 A;  2PI3 O;  2R56 A;  3HWE A;  4HPC A;  3WJE A;  5LJB A;  1WBI A;  3L4R A;  3GAQ A;  3MG5 A;  3SOT A;  4IAW A;  2KTS A;  4CDC A;  5IRU A;  5HAE A;  3PDF A;  4GJS A;  3PH5 A;  4ODD A;  4Z2V A;  1EAL A;  4GZV A;  1KT3 A;  1N9M A;  4GD9 A;  2A5B A;  3RKG A;  3RBY A;  3WJC A;  2HYS A;  1Y53 X;  3IA8 A;  4Y5D A;  4LZU A;  1W4T A;  2X55 A;  1KQX A;  1LPJ A;  2Z4H A;  4LKT A;  5B11 O;  3VHM A;  4EFG A;  3CR6 A;  3BS2 A;  4BBO A;  3VU1 A;  2OY7 A;  1N0S A;  1ACD A;  4ORW A;  2FTB A;  1NQN A;  1VWG B;  3HPE A;  2OF8 A;  2M4L A;  1LIB A;  2WEX A;  3DTQ A;  4ZH6 A;  3PQU A;  1IIU A;  5KIC A;  1DF3 A;  4O4O A;  1RXK A;  5IRA A;  4U8U O;  1UYO X;  3RE5 A;  2BS6 A;  1QFV A;  3FEP A;  3RZY A;  2OVS A;  5L8O A;  2KW1 A;  2FHL A;  4QYP A;  4TKJ A;  3PP6 A;  1T8V A;  3VE1 A;  3P6F A;  2GC9 A;  2HKD A;  3SZH A;  5K67 A;  3B2J A;  1FEL A;  3B2K A;  4NYR A;  4YDA A;  3WOV A;  4QYN A;  2QMI A;  2W2A A;  3APW A;  4U9C A;  3WBG A;  5CE4 A;  1FTP A;  1KT6 A;  4GH7 A;  1MEP A;  1CBQ A;  2JOZ A;  2L67 A;  4QQ1 A;  2RTC B;  4MIR A;  4DNE A;  1TVQ A;  4GET A;  1N43 A;  5FQ7 E;  3WJB A;  2RTH B;  5EDB A;  3TGA A;  3ELZ A;  5AQ6 A;  1GXA A;  4DCB A;  1A2D A;  4I95 A;  2WSJ A;  5F7G A;  4TKB A;  4O4U A;  1CRB A;  1VYF A;  3ZW0 A;  4QGV A;  3NP1 A;  2AT3 X;  3AKM A;  3TZS A;  1KFF A;  1JIW I;  5F2B A;  2GTL M;  4O4X A;  4ZHF A;  3EC5 A;  3KFI A;  4YVB A;  1LIC A;  3APV A;  3ZZV A;  4IB9 A;  4JGL A;  4EQA C;  2OL8 O;  4ORY A;  2X45 A;  1VWH B;  3P02 A;  3K3L A;  2LKK A;  4NLJ A;  1VWL B;  3FDC A;  1U17 A;  1LNM A;  1MVG A;  2LBA A;  5FAZ A;  4WFV A;  1U18 A;  4DQ3 A;  2AF5 A;  3MVF A;  1SWJ A;  4O3Z A;  2IZH B;  4MVL A;  3WJF A;  2NND A;  3GE2 A;  3KFG A;  1E2T A;  3FEL A;  1YWB A;  4OKA A;  4AZR A;  2Y3F A;  2RTA A;  2BC3 A;  4OS0 A;  2OYB O;  2FLJ A;  1STP A;  1N4J A;  5LJG A;  1BJ7 A;  1BRP A;  2RTM A;  4A1Y A;  4Z6J A;  3KFF A;  1N9Y A;  4ON1 A;  5HTD A;  1NGL A;  4D6A A;  2F09 A;  1RXJ A;  2G79 A;  1SLG B;  1TXL A;  2O62 A;  1JMZ A;  2IZF B;  2X46 A;  4YFR A;  1VWJ B;  3U0D A;  3BLG A;  3H3I A;  4KH8 A;  2RTQ B;  4B55 A;  2E4J A;  4COT A;  3EW2 A;  1KQW A;  4YFQ A;  2C1Q A;  2Q9S A;  3U9P C;  4CDF A;  1OEK A;  4BX7 B;  3P6E A;  1GM6 A;  2FT9 A;  1CBI A;  4MEE A;  3CQR A;  3CBS A;  4HPD A;  1YWA A;  5LJC A;  1STS B;  3VG6 A;  2L68 A;  1SWF A;  2OF9 A;  1LEL A;  2Y3E A;  1AQB A;  1MK5 A;  4AZM A;  5IO7 A;  4ZR2 A;  1VWQ B;  1LFO A;  2NNQ A;  1OBQ A;  3VE2 A;  1JQP A;  2BSZ A;  2QO5 A;  3MBT A;  1CJ5 A;  1HN2 A;  2OY8 A;  1OPB A;  1NP1 A;  2NNE A;  2I5Z O;  1D3S A;  1QAB E;  4N7D A;  4BCS A;  5B29 A;  4MVE A;  4JHQ A;  5EZ2 A;  1ALB A;  1SWN A;  3RE6 A;  3NQK A;  2RTI B;  4FBV A;  1VWM B;  1VWO B;  5B10 O;  4BX6 B;  1YP7 A;  2KD2 A;  2JGS A;  3G7X A;  2CAM A;  5EED A;  1GT1 A;  4UU2 A;  4NW4 A;  3DSZ A;  1LID A;  1LUQ A;  3HTY A;  1MDC A;  1FEN A;  1ICM A;  3IFB A;  3HWF A;  3ZQ3 A;  2OL6 O;  1XKI A;  2GTL O;  1UYN X;  3AEH A;  3BY0 A;  4IAX A;  4IRW A;  1HQP A;  4MVI A;  1B8E A;  1ZNE A;  4NNT A;  3RDM A;  2Y32 A;  4LKP A;  3VG5 A;  1KXO A;  2Q2M A;  2X56 A;  4GDZ A;  4LZV A;  4WHI A;  5HWZ A;  4NYQ A;  4YFP A;  5HTE A;  1SY3 A;  3D4R A;  5H8T A;  1AVE A;  2IZC B;  4NNS A;  3APX A;  2WR6 A;  1B0O A;  4CK4 A;  4CSB A;  1LIF A;  2Q4N A;  1OBP A;  5F1E A;  5HCC C;  3FA7 A;  3NQ9 A;  1JMX A;  5CHK A;  1STR B;  1ZRY A;  3WVM A;  5AJB A;  1NP4 A;  1RSU B;  3NR3 A;  3WYQ A;  2N93 A;  1VWD B;  1QY0 A;  3ZI8 A;  3FR5 A;  5D8J A;  1OBU A;  4EEJ A;  1MM9 A;  1S44 A;  3O19 A;  5HCE C;  4ES7 A;  4Y0P A;  3EMM A;  1VYO A;  2L9C A;  1NC9 A;  1UZ2 X;  2FRS A;  1S2P A;  4ORX A;  4XME A;  3VHH A;  4WFU A;  4BX7 A;  2MM3 A;  4XMF A;  4ZGU A;  4YBP A;  1EI5 A;  3FA9 A;  3QKG A;  2K62 A;  2RCQ A;  2CZT A;  2MJI A;  1P6P A;  5B5F A;  1FEM A;  1SWL A;  1LCV A;  2LFO A;  3ZW0 B;  2RTD B;  4ZH9 A;  4ZHH A;  4RUU A;  5BVQ A;  5B27 A;  3NX2 A;  3D9W A;  1SWB A;  5K06 A;  3ZUI A;  5KID A;  1YP6 A;  1HXZ A;  2OVD A;  1RXH A;  4IB6 A;  1KOI A;  2RQ0 A;  3STN A;  4O9S A;  4I3D A;  2IZB A;  4BX6 A;  2OFA A;  4TNN A;  1GGL A;  1D2U A;  1TOU A;  3B2H A;  4Z2P A;  4CPH B;  4BX5 A;  2FS6 A;  1VWK B;  2KTD A;  1N7Y A;  3RDO A;  2X4M A;  1SXU A;  1EII A;  2IZJ A;  4D6B A;  3JSQ A;  5D47 A;  3UEX A;  1JBH A;  3FW5 A;  3PEC A;  4HPA A;  5D45 A;  4I9R A;  5BVS A;  4A60 A;  4O3X B;  2IZG B;  4L1N A;  1EUO A;  2FHN X;  3RY1 A;  3FW4 A;  4GNY A;  1RLB E;  5IXG A;  3FA6 A;  3MM0 A;  1B4M A;  2ZSC A;  1ICN A;  2HZR A;  3FEK A;  2FS7 A;  5D4A A;  5HZ9 A;  1SXX A;  3Q34 A;  3ELX A;  1YWC A;  3CBC A;  1BLR A;  1K3B A;  4UU3 A;  2ZAI A;  3SLO A;  2RCT A;  4JNJ A;  5JR8 A;  1G7N A;  2G7B A;  3O2Y A;  4Y0R A;  4OMX A;  4JO6 A;  1BSQ A;  1QY1 A;  1A57 A;  4YMY A;  1CBS A;  4ORS A;  5HA0 A;  2LBV A;  4A1H A;  1RAV A;  4AW8 A;  2JU8 A;  3OBL A;  4QGW A;  4YKO A;  4YH0 A;  3F9D A;  2BHV A;  3KQ0 A;  4HWM A;  4IB8 A;  1GX3 A;  2WUT A;  1Y9L A;  1Z24 A;  3B2L A;  4IMN A;  4U3Q A;  4BGF A;  2AH7 X;  3OJY C;  1YWD A;  2VFB A;  1VPR A;  1H91 A;  1VWA B;  4TKH A;  1S7D A;  3FEN A;  1GT5 A;  4Y0Q A;  3RDQ A;  1X71 A;  1GX8 A;  3PK2 A;  3RDU A;  1QG5 A;  4GGT A;  5LJE A;  5HZ8 A;  2IZD B;  2DJF A;  2A5C A;  3S26 A;  4AZN A;  2IZK A;  3FYF A;  4AZQ A;  1DZJ A;  3P6D A;  1SY1 A;  4KCA A;  2CM4 A;  4QAE A;  3WZN A;  4CPH A;  1IW2 A;  2X8T A;  4Z2O A;  5L8I A;  5F58 A;  1IFB A;  1PBY A;  1NQM A;  3WJG A;  3V8U A;  1BM5 A;  2AVI A;  3KVN A;  4XMC A;  3U03 A;  1JJJ A;  2CBS A;  3EM0 A;  1I06 A;  1LKE A;  2QO6 A;  4O3W A;  5L3Y A;  4KC7 A;  1DZK A;  2G78 A;  4U46 A;  4K19 A;  3WXQ A;  1ADL A;  5BYP A;  5LJH A;  2ACO A;  3BU9 A;  1MUP A;  2GH7 A;  4FBO A;  3FMZ A;  4KT5 A;  2K23 A;  1SRF A;  2PY1 A;  4NLI A;  1I9H A;  1ZNG A;  3UEV A;  4ALO A;  4ZJ0 A;  2OFM X;  5DPQ A;  4L3R A;  4ALB A;  2RTB B;  1SWT A;  2A0A A;  4M7M A;  1SWD A;  4NV8 A;  2F01 A;  2FWV A;  2RTF B;  1EIO A;  4YDB A;  5EDC A;  2ZAG A;  2JU3 A;  4BOE A;  4BVM A;  3EBK A;  1EPB A;  1KL4 A;  1LCW A;  2AKQ A;  3FID A;  3HOL A;  3S5X A;  4CPI A;  1R0U A;  4CDD A;  4AYH A;  1W5R A;  4CV7 A;  1O1U A;  3STM X;  3BSZ E;  3BU1 A;  4I60 A;  1NDJ A;  4O4S A;  1ERX A;  3OD9 A;  1SWA A;  1Y55 X;  2CM9 A;  1RBP A;  3C76 X;  4GNW A;  3CMP A;  4IAB A;  4OS3 A;  2LB6 A;  4YGH A;  4YGZ A;  4ZHC A;  1GKA B;  4GU8 A;  2W2B A;  2BT9 A;  5H9K A;  2AT8 X;  3E3C A;  3EYC A;  1YIV A;  2IZA A;  2DM5 A;  2RTP B;  1JJU A;  2YMS A;  3X00 A;  1HMT A;  4CDE A;  4YGG A;  4RUN A;  4CPF A;  2C1S A;  5HZQ A;  3CKF A;  1EQD A;  3NX1 A;  1YUP A;  3LHN A;  3RSW A;  4GGR A;  5CYB A;  2Q39 A;  3SLT A;  1BEB A;  5HCD C;  1BBP A;  1SRI A;  1TOW A;  1DV9 A;  3VPJ E;  5H9A A;  1L6M A;  2JN3 A;  1KT4 A;  1SRE A;  5LJD A;  1VWP B;  2QOS C;  2POA A;  3FIQ A;  1IKE A;  2NP1 A;  2A2U A;  4Z28 A;  1AVG I;  4QZU A;  3S5V A;  1X8N A;  2VFC A;  1FDQ A;  4ARH A;  3OE3 A;  2HNX A;  3P6G A;  4R0B A;  1KT7 A;  2X34 A;  2RTN B;  4FQB B;  2UYW A;  5B5G A;  4BX5 B;  1SWS A;  4MIS A;  5KHP A;  2I5V O;  5LKF A;  2CZU A;  2QO4 A;  1W6F A;  3NQ3 A;  3WYP A;  2A3F X;  4QGX A;  2HMB A;  1VWE B;  4PJ2 A;  2AT5 X;  5H9N A;  5HZ5 A;  2MWH A;  4WBK A;  1OSP O;  4C5P A;  2GJ5 A;  2RTE B;  2RA6 A;  3JS1 A;  4EDE A;  1PTS A;  3NPO A;  4KC8 A;  3QQ2 A;  5C0N A;  2FR3 A;  1A18 A;  3SLJ A;  4IB7 A;  2IZL B;  2MF6 A;  3APU A;  1I05 A;  1EXS A;  3BDR A;  3CKG A;  3TF6 A;  3RDX A;  3ZW1 A;  1GKA A;  1PEE A;  1SY2 A;  2P8G A;  4Y59 A;  1SRJ A;  1O1V A;  3SZJ A;  2MO5 A;  5DG4 A;  3P6C A;  1KL3 A;  1SRH A;  2GTF X;  2WPU A;  4I3B A;  4OEM A;  4ORU A;  2WEW A;  3C78 X;  1BWY A;  3MX7 A;  3PPT A;  5HZ6 A;  4AZO A;  2GTL N;  1Y9T A;  2RTG B;  3Q6L A;  3ZUO A;  4INN A;  1SLD B;  5AEO A;  1SRG A;  1LDO A;  3I17 A;  5F6Z A;  5HA1 A;  1WUB A;  1HQQ A;  1SXY A;  2Q2P A;  5EEE A;  1SWH A;  1SWU A;  4YBU A;  3SAO A;  2FKG A;  4XMD A;  3UEU A;  2A2G A;  2DJG A;  2ASN X;  2VDF A;  1LCZ A;  2G8C O;  4I6S A;  5IO5 A;  2F73 A;  4LQZ A;  2WQA E;  1A3Y A;  2IZE B;  2W2F A;  5B2A O;  1MX7 A;  5LJK A;  1HBP A;  1ERB A;  1E02 A;  1VWR B;  1BRQ A;  5HBS A;  1EPA A;  4YCE A;  1QWD A;  4ZFX A;  1O8V A;  1GT4 A;  2Z4I A;  3HWD A;  3VG2 A;  2CBR A;  3I0A A;  3O22 A;  1SWO A;  3HOE A;  4CPE A;  3PQS A;  1PMP A;  4ORR A;  5IO6 A;  5FFH A;  3S60 A;  4Z27 A;  4O49 A;  1GX9 A;  1BSY A;  1E5P A;  2ANS A;  1HY2 A;  2ACP X;  1VYG A;  1VWN B;  2AT0 X;  2FGS A;  3BRN A;  2RTL A;  2RTR B;  4TJZ A;  4TQ2 A;  5BVT A;  1SWK A;  2BLG A;  2X8F A;  3HK1 A;  1TW4 A;  1SLF B;  4BJ8 A;  4GRJ A;  1B56 A;  1KZW A;  2IFB A;  4O3Y A;  1DFV A;  4HPB A;  4IBA A;  3FA8 A;  1DZP A;  1EW3 A;  1HBQ A;  1JYJ A;  1CBR A;  3BX7 A;  1URE A;  1ML7 A;  1GT3 A;  2OY1 O;  1MOY A;  4ID2 A;  1X89 A;  1NBX A;  4GE1 A;  3TGC A;  4N7C A;  1VWC B;  5B3M O;  1OPA A;  3P24 A;  2JMB A;  4NV7 A;  3AUM O;  5JD2 A;  3D96 A;  3RWX A;  5FQ8 E;  2A8G A;  1ZND A;  3FR4 A;  1VWI B;  2OFB A;  4FGI B;  4Y0S A;  2HZQ A;  3PH6 A;  1IJ8 A;  1SXW A;  1SWR A;  1X8P A;  2UZ2 A;  1G85 A;  1SWP A;  2R74 A;  3BX8 A;  3JQO A;  1E00 A;  4OEL A;  1G74 A;  2RTO B;  4I3C A;  5H9L A;  2FKJ A;  3STK A;  2AT6 X;  3LTW A;  2AL0 X;  2L5P A;  2R73 A;  4U8U N;  1JZU A;  2MHD A;  4YCH A;  3CWK A;  2OL7 A;  1I04 A;  1KGL A;  5CSE A;  1AEL A;  5LKE A;  1OEE A;  3F8A A;  1HMR A;  3HWG A;  3EBW A;  3KFH A;  4KII A;  3T6F A;  5K68 A;  2KT4 B;  2RN4 A;  2OVE A;  3RDS A;  1JYD A;  4I9S A;  3N91 A;  1I78 A;  1LIE A;  4GKC A;  4A8Z A;  1U0X A;  2XKL A;  3FLL A;  1T68 X;  1DC9 A;  1OEJ A;  2WQ9 A;  4XMH A;  1JV4 A;  2EU7 X;  3ZW2 A;  1SWG A;  3ZW1 B;  1SA8 A;  4GGZ A;  1DF8 A;  1X8Q A;  1K24 A;  3NBX X;  2AMM X;  3CQN A;  2OZQ A;  1KT5 A;  2QOM A;  1XCA A;  1MX8 A;  3T2X A;  1LDQ A;  1Y0G A;  2BS5 A;  2RTK A;  2OVA A;  2OY5 O;  2QCB A;  3LV4 A;  5F6B A;  2RD7 C;  1HMS A;  5FEN A;  3PED A;  2A13 A;  5EPQ A;  4M6S A;  1IFC A;  4ML7 B;  1ZNH A;  4EXZ A;  1SWE A;  1PBO A;  1FE3 A;  1SMP I;  3WJD A;  3EW1 A;  2JW1 A;  2JU7 A;  1KL5 A;  1X8O A;  3VGW A;  3UAQ A;  5L8N A;  1Y52 X;  1VWB B;  4GJV A;  1SWC A;  3FR2 A;  3T2W A;  1X8U A;  3T6L A;  4ZHD A;  2C4I A;  3D97 A;  2G5L A;  2RTJ A;  4HFO A;  3WZP A;  4NP1 A;  3C77 X;  3RY2 A;  4QRL A;  1BSO A;  1DZM A;  3VHI A;  4GDA A;  2LA7 A;  3AKN A;  2QM9 A;  2X32 A;  2XST A;  4U8U M;  3WZO A;  1T0V A;  3SZI A;  1QQS A;  3VG7 A;  5IRW A;  1VWF B;  4PSQ A;  1JJX A;  4IMO A;  1E06 A;  1AVD A;  1FJ1 E;  1QY2 A;  4YKM A;  4AZP A;  4BQU A;  1SWQ A;  3TGB A;  2OFR X;  4GK9 A;  5FQ6 E;  1KZX A;  3KZA A;  1SY0 A;  3T1D A;  4FBR A;  1ZNL A;  4OS8 A;  4DQ4 A;  4QZT A;  2FR2 A;  3D95 A;  4ZCB A;  3UEW A;  1QFT A;  1RST B;  1SLE B;  4ZGF A;  1HXL A;  2WWP A;  2IZI A;  3F6Z B;  3ZWE A;  4EKV A;  4XMG A;  3B2I A;  4MVK A;  5D48 A;  1AB0 A;  1G5W A;  1IKJ A;  1I4U A;  3VG4 A;  4GUZ A;  2X8S A;  5AJC A;  2HLV A;  4ZHG A; 
#chains in the Genus database with same CATH homology
 1ZNK A;  4OMW A;  1LF7 A;  1PM1 X;  2YG2 A;  2ALL X;  3P6H A;  4TLJ A;  4QNI A;  3NAD A;  3VG3 A;  2R56 A;  3HWE A;  3WJE A;  4HPC A;  5LJB A;  3L4R A;  3SOT A;  3GAQ A;  4IAW A;  2KTS A;  5HAE A;  4ODD A;  3PH5 A;  1EAL A;  4GZV A;  1KT3 A;  3RKG A;  3RBY A;  3WJC A;  2HYS A;  3IA8 A;  4LZU A;  2Z4H A;  1KQX A;  1LPJ A;  4LKT A;  4EFG A;  3CR6 A;  3BS2 A;  3VU1 A;  1N0S A;  1ACD A;  4ORW A;  2FTB A;  2M4L A;  1LIB A;  2WEX A;  3DTQ A;  4ZH6 A;  3PQU A;  1IIU A;  5KIC A;  1DF3 A;  4O4O A;  4U8U O;  2BS6 A;  1QFV A;  3FEP A;  3RZY A;  2OVS A;  5L8O A;  2KW1 A;  4QYP A;  4TKJ A;  3PP6 A;  1T8V A;  3VE1 A;  3P6F A;  2GC9 A;  3B2J A;  1FEL A;  3B2K A;  4NYR A;  4YDA A;  3WOV A;  4QYN A;  2QMI A;  2W2A A;  3APW A;  4U9C A;  3WBG A;  5CE4 A;  1FTP A;  1KT6 A;  4GH7 A;  1CBQ A;  2JOZ A;  2L67 A;  4QQ1 A;  4MIR A;  1TVQ A;  4GET A;  5FQ7 E;  3WJB A;  5EDB A;  3TGA A;  3ELZ A;  5AQ6 A;  1GXA A;  1A2D A;  4I95 A;  2WSJ A;  5F7G A;  4TKB A;  4O4U A;  1CRB A;  1VYF A;  3ZW0 A;  3NP1 A;  2AT3 X;  3AKM A;  3TZS A;  1JIW I;  2GTL M;  4O4X A;  4ZHF A;  3KFI A;  1LIC A;  3APV A;  3ZZV A;  4IB9 A;  4JGL A;  4EQA C;  4ORY A;  2X45 A;  4NLJ A;  3P02 A;  3K3L A;  2LKK A;  1U17 A;  1LNM A;  1MVG A;  2LBA A;  5FAZ A;  4WFV A;  1U18 A;  4DQ3 A;  3MVF A;  4O3Z A;  4MVL A;  3WJF A;  2NND A;  3GE2 A;  3KFG A;  3FEL A;  1YWB A;  4AZR A;  2FLJ A;  5LJG A;  1BJ7 A;  1BRP A;  4A1Y A;  5HTD A;  3KFF A;  4ON1 A;  1NGL A;  4D6A A;  2F09 A;  2G79 A;  2O62 A;  1TXL A;  2X46 A;  3U0D A;  4YFR A;  3BLG A;  3H3I A;  4KH8 A;  2E4J A;  4COT A;  1KQW A;  4YFQ A;  3U9P C;  2Q9S A;  1OEK A;  3P6E A;  1GM6 A;  2FT9 A;  1CBI A;  3CQR A;  3CBS A;  4HPD A;  1YWA A;  5LJC A;  4AZM A;  3VG6 A;  2L68 A;  5IO7 A;  1AQB A;  4ZR2 A;  1LFO A;  2NNQ A;  1OBQ A;  3VE2 A;  2QO5 A;  3MBT A;  1CJ5 A;  1HN2 A;  1OPB A;  1NP1 A;  2NNE A;  4N7D A;  1D3S A;  1QAB E;  5B29 A;  4MVE A;  5EZ2 A;  1ALB A;  3NQK A;  4FBV A;  1YP7 A;  2KD2 A;  3G7X A;  5EED A;  1GT1 A;  4UU2 A;  4NW4 A;  3DSZ A;  1LID A;  3ZQ3 A;  3HTY A;  1MDC A;  1FEN A;  1ICM A;  3IFB A;  3HWF A;  1XKI A;  2GTL O;  3BY0 A;  4IAX A;  4NNT A;  1HQP A;  1BM5 A;  1B8E A;  1ZNE A;  3VG5 A;  4AZQ A;  4LKP A;  5HWZ A;  1KXO A;  2Q2M A;  4GDZ A;  4LZV A;  4WHI A;  4NYQ A;  4YFP A;  5HTE A;  1SY3 A;  3D4R A;  5H8T A;  4NNS A;  3APX A;  2WR6 A;  1B0O A;  4CK4 A;  4CSB A;  1LIF A;  2Q4N A;  1OBP A;  5F1E A;  5HCC C;  3FA7 A;  3NQ9 A;  1ZRY A;  3WVM A;  5AJB A;  1NP4 A;  3NR3 A;  2N93 A;  1QY0 A;  3ZI8 A;  3FR5 A;  5D8J A;  1OBU A;  4EEJ A;  1S44 A;  3O19 A;  5HCE C;  4ES7 A;  4Y0P A;  3EMM A;  4QGV A;  2L9C A;  4ORX A;  1UZ2 X;  2FRS A;  1S2P A;  4XME A;  4ZGU A;  4WFU A;  2MM3 A;  4XMF A;  4YBP A;  1EI5 A;  3FA9 A;  3QKG A;  2K62 A;  2RCQ A;  2CZT A;  2MJI A;  1P6P A;  1FEM A;  2LFO A;  3ZW0 B;  4ZH9 A;  4ZHH A;  4RUU A;  5BVQ A;  5B27 A;  3NX2 A;  5K06 A;  3ZUI A;  5KID A;  1YP6 A;  2OVD A;  4IB6 A;  1KOI A;  2RQ0 A;  3STN A;  4O9S A;  4I3D A;  4TNN A;  1GGL A;  1D2U A;  1TOU A;  3B2H A;  2FS6 A;  2KTD A;  1SXU A;  1EII A;  4D6B A;  3JSQ A;  5D47 A;  3UEX A;  3FW5 A;  3PEC A;  4HPA A;  5D45 A;  4I9R A;  5BVS A;  4A60 A;  4O3X B;  4L1N A;  1EUO A;  3FW4 A;  4GNY A;  1RLB E;  3FA6 A;  1B4M A;  1ICN A;  2HZR A;  3FEK A;  2FS7 A;  5D4A A;  5HZ9 A;  1SXX A;  3ELX A;  1YWC A;  3CBC A;  1BLR A;  4UU3 A;  2ZAI A;  2RCT A;  5JR8 A;  1G7N A;  2G7B A;  3O2Y A;  4Y0R A;  4OMX A;  1BSQ A;  1QY1 A;  1A57 A;  4YMY A;  1CBS A;  4ORS A;  5HA0 A;  2LBV A;  4A1H A;  4AW8 A;  2JU8 A;  3OBL A;  4QGW A;  4YKO A;  4YH0 A;  3F9D A;  2BHV A;  3KQ0 A;  4HWM A;  4IB8 A;  2WUT A;  3B2L A;  1Y9L A;  1Z24 A;  4IMN A;  4U3Q A;  2AH7 X;  3OJY C;  1YWD A;  1VPR A;  1H91 A;  4TKH A;  1S7D A;  3FEN A;  1GT5 A;  4Y0Q A;  1X71 A;  1GX8 A;  5LJE A;  1QG5 A;  5HZ8 A;  3S26 A;  4AZN A;  3FYF A;  1DZJ A;  3P6D A;  1SY1 A;  4KCA A;  2CM4 A;  4QAE A;  1IW2 A;  2X8T A;  5L8I A;  5F58 A;  1IFB A;  3WJG A;  3V8U A;  4XMC A;  3U03 A;  1JJJ A;  2CBS A;  3EM0 A;  1I06 A;  1LKE A;  2QO6 A;  4O3W A;  4KC7 A;  1DZK A;  2G78 A;  3WXQ A;  4K19 A;  5BYP A;  1ADL A;  5LJH A;  2ACO A;  3BU9 A;  1MUP A;  4FBO A;  4KT5 A;  3FMZ A;  4NLI A;  2K23 A;  2PY1 A;  4ALO A;  4ZJ0 A;  3UEV A;  1ZNG A;  2OFM X;  5DPQ A;  4L3R A;  4ALB A;  4M7M A;  2A0A A;  2FWV A;  1EIO A;  4YDB A;  5EDC A;  2ZAG A;  2JU3 A;  4BOE A;  4BVM A;  3EBK A;  1EPB A;  2AKQ A;  3HOL A;  3S5X A;  4CV7 A;  1JBH A;  1R0U A;  4AYH A;  1O1U A;  3STM X;  3BSZ E;  3BU1 A;  4O4S A;  1ERX A;  3OD9 A;  4GNW A;  2CM9 A;  1RBP A;  3C76 X;  4OS3 A;  3CMP A;  4IAB A;  4YGH A;  2LB6 A;  4YGZ A;  4ZHC A;  1GKA B;  4GU8 A;  2W2B A;  2BT9 A;  5H9K A;  2AT8 X;  3E3C A;  3EYC A;  1YIV A;  2DM5 A;  2YMS A;  1HMT A;  4YGG A;  4RUN A;  5HZQ A;  1EQD A;  3NX1 A;  1YUP A;  3LHN A;  3RSW A;  5CYB A;  2Q39 A;  1BEB A;  5HCD C;  1BBP A;  1TOW A;  1DV9 A;  3VPJ E;  5H9A A;  1L6M A;  2JN3 A;  1KT4 A;  5LJD A;  2QOS C;  2POA A;  3FIQ A;  1IKE A;  2NP1 A;  2A2U A;  1AVG I;  4QZU A;  3S5V A;  1X8N A;  1FDQ A;  4ARH A;  3OE3 A;  2HNX A;  3P6G A;  4R0B A;  1KT7 A;  4FQB B;  4MIS A;  5KHP A;  5LKF A;  2CZU A;  2QO4 A;  3NQ3 A;  2A3F X;  4QGX A;  2HMB A;  4PJ2 A;  2AT5 X;  5H9N A;  5HZ5 A;  2MWH A;  4WBK A;  2GJ5 A;  2RA6 A;  3JS1 A;  4EDE A;  3NPO A;  4KC8 A;  5C0N A;  2FR3 A;  1A18 A;  4IB7 A;  3APU A;  1I05 A;  1EXS A;  3BDR A;  3TF6 A;  3ZW1 A;  1GKA A;  1PEE A;  1SY2 A;  2P8G A;  1O1V A;  2MO5 A;  5DG4 A;  3P6C A;  2GTF X;  4ORU A;  4I3B A;  2WEW A;  3C78 X;  1BWY A;  3MX7 A;  3PPT A;  5HZ6 A;  4AZO A;  2GTL N;  1Y9T A;  3Q6L A;  3ZUO A;  4INN A;  5AEO A;  5HA1 A;  3I17 A;  5F6Z A;  2Q2P A;  1SXY A;  5EEE A;  4YBU A;  3SAO A;  4XMD A;  3UEU A;  2A2G A;  2ASN X;  5IO5 A;  4I6S A;  2F73 A;  4LQZ A;  2WQA E;  1A3Y A;  2W2F A;  1MX7 A;  5LJK A;  1HBP A;  1ERB A;  1E02 A;  1BRQ A;  5HBS A;  1EPA A;  4YCE A;  1QWD A;  4ZFX A;  1O8V A;  1GT4 A;  2Z4I A;  3HWD A;  3VG2 A;  2CBR A;  3I0A A;  3O22 A;  3HOE A;  3PQS A;  1PMP A;  4ORR A;  5IO6 A;  5FFH A;  3S60 A;  4O49 A;  1GX9 A;  1BSY A;  1E5P A;  2ANS A;  2ACP X;  2AT0 X;  1VYG A;  4OS0 A;  3BRN A;  4TJZ A;  5BVT A;  4TQ2 A;  2BLG A;  2X8F A;  3HK1 A;  1TW4 A;  4GRJ A;  1B56 A;  1KZW A;  2IFB A;  4O3Y A;  1DFV A;  4HPB A;  4IBA A;  3FA8 A;  1DZP A;  1EW3 A;  1HBQ A;  1JYJ A;  1CBR A;  3BX7 A;  1URE A;  1ML7 A;  1GT3 A;  4ID2 A;  1X89 A;  4GE1 A;  3TGC A;  4N7C A;  1OPA A;  3P24 A;  2JMB A;  3D96 A;  3RWX A;  5FQ8 E;  1ZND A;  3FR4 A;  4Y0S A;  4FGI B;  2HZQ A;  3PH6 A;  4MVI A;  1SXW A;  1X8P A;  3BX8 A;  1G85 A;  2R74 A;  3JQO A;  5H9L A;  1E00 A;  1G74 A;  4I3C A;  3STK A;  2AT6 X;  2AL0 X;  2L5P A;  2R73 A;  4U8U N;  1JZU A;  2MHD A;  4YCH A;  3CWK A;  1I04 A;  1KGL A;  1AEL A;  5LKE A;  1OEE A;  3F8A A;  1HMR A;  3HWG A;  3EBW A;  3KFH A;  4KII A;  2KT4 B;  2RN4 A;  2OVE A;  1JYD A;  4I9S A;  3N91 A;  4A8Z A;  1LIE A;  4GKC A;  1U0X A;  2XKL A;  3FLL A;  1T68 X;  1DC9 A;  1OEJ A;  2WQ9 A;  4XMH A;  1JV4 A;  2EU7 X;  3ZW2 A;  3ZW1 B;  1SA8 A;  1X8Q A;  3NBX X;  2AMM X;  3CQN A;  2OZQ A;  1KT5 A;  1XCA A;  1MX8 A;  2BS5 A;  2OVA A;  3LV4 A;  5F6B A;  2RD7 C;  1HMS A;  5FEN A;  3PED A;  2A13 A;  5EPQ A;  4M6S A;  1IFC A;  4ML7 B;  1ZNH A;  4EXZ A;  1PBO A;  1FE3 A;  1SMP I;  3WJD A;  2JW1 A;  2JU7 A;  5L8N A;  1X8O A;  3UAQ A;  3FR2 A;  1X8U A;  4ZHD A;  3D97 A;  4HFO A;  4NP1 A;  3C77 X;  4QRL A;  1BSO A;  1DZM A;  2LA7 A;  3AKN A;  2QM9 A;  4U8U M;  2XST A;  1T0V A;  3VG7 A;  1QQS A;  4PSQ A;  1JJX A;  4IMO A;  1E06 A;  1QY2 A;  4YKM A;  4AZP A;  4BQU A;  3TGB A;  2OFR X;  4GK9 A;  5FQ6 E;  1KZX A;  3KZA A;  1SY0 A;  3T1D A;  4FBR A;  1ZNL A;  4OS8 A;  4DQ4 A;  4QZT A;  2FR2 A;  3D95 A;  4ZCB A;  3UEW A;  1QFT A;  4ZGF A;  2WWP A;  3F6Z B;  3ZWE A;  4XMG A;  3B2I A;  4MVK A;  5D48 A;  1AB0 A;  1G5W A;  1IKJ A;  1I4U A;  3VG4 A;  2X8S A;  5AJC A;  2HLV A;  4ZHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...