1ZNKA

Strong solute-solute dispersive interactions in a protein-ligand complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
157
Chain Sequence
EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major Urinary Protein
publication title Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 44
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1znkA00
5CE4A 2FRSA 1H91A 1TW4A 3VG6A 1QG5A 3APXA 1YP7A 1FTPA 4TKBA 2RD7C 2FT9A 3ZUIA 2WR6A 1OBQA 1DZMA 1LICA 3NX1A 1A3YA 1LIDA 3EBWA 5FAZA 3FW5A 3D95A 2CBSA 1T68X 1LIFA 4IB6A 4MVLA 2CM4A 3O22A 2CM9A 5H9KA 4ZFXA 2CZUA 1HBPA 4AYHA 5HCCC 4GNWA 4UU3A 5LJHA 1D2UA 1KT6A 3FEKA 1ZNHA 2XSTA 5HTEA 1LKEA 3CWKA 5IO6A 5HZ9A 2HNXA 4LZVA 3STKA 1YUPA 1X8PA 5D4AA 5HZQA 1P6PA 3BS2A 3U9PC 1ZNKA 5IO5A 1BWYA 3K3LA 3AKNA 4EFGA 4XMCA 4AZQA 1L6MA 1SY2A 4HPAA 1OEJA 4OS0A 1LIBA 1U17A 2A2UA 3B2HA 4ORXA 3UEVA 3FA8A 1G7NA 4M6SA 3SAOA 3O2YA 3OJYC 5D8JA 2QO5A 4IB9A 2X46A 1MDCA 3BU1A 1ERXA 4RUNA 2QOSC 4ZH9A 2KT4B 4ORWA 5B29A 4WBKA 1GT1A 2WWPA 2MJIA 4MVIA 2OFMX 2NNDA 1VYGA 2Q2MA 3FA9A 3FIQA 5LJGA 4LKTA 5EPQA 3C76X 3WJGA 1DFVA 4ZR2A 2FWVA 3FLLA 5L8NA 1FENA 3EBKA 1Z24A 2L9CA 1NP4A 4IMOA 2ALLX 3UEXA 2AT3X 1HMRA 1HMTA 5L8IA 3TGBA 4I3BA 4XMDA 1G85A 4IMNA 3BRNA 4M7MA 2Q39A 2R73A 5LJBA 2NNQA 1D3SA 2LFOA 3P6GA 3KFGA 4A1HA 1B8EA 1JBHA 3NP1A 4TQ2A 1SA8A 5DG4A 3TZSA 2Q2PA 4WFVA 2F73A 4YGGA 5LKFA 1OEKA 4AZPA 4BVMA 5C0NA 2N93A 4QGWA 4ZHGA 5EDBA 1LIEA 2FR3A 2AT5X 3P6CA 4LKPA 5F1EA 1KZWA 2IFBA 1GGLA 1YP6A 2R74A 1HQPA 4AZNA 4QGVA 4NLIA 2AKQA 3ELXA 2WQAE 4D6AA 2QM9A 4NP1A 5H9LA 1DZKA 5H8TA 3S26A 2CBRA 2JU7A 4ZGUA 5EDCA 3B2IA 1I4UA 4YBPA 3U0DA 2OFRX 2RCQA 2A3FX 2NNEA 1S44A 3FR2A 1DV9A 3STMX 2LBVA 4ZHCA 1A2DA 1EXSA 2LKKA 2A2GA 3CBCA 1S7DA 5HCDC 2ACOA 2RQ0A 3Q6LA 3STNA 2YG2A 4YDBA 4XMFA 5KICA 4N7CA 2DM5A 4GKCA 4OMWA 4YFQA 1OEEA 1DF3A 4OS3A 1VYFA 3BDRA 4HPCA 2A13A 2Q4NA 4YCEA 1ZNDA 3EM0A 1X8QA 5JR8A 1LPJA 5L8OA 1GXAA 1IW2A 3CQNA 1DZPA 1JYJA 2P8GA 1IKEA 2HZQA 2A0AA 4GRJA 1O1UA 1I04A 4WFUA 5D48A 1AB0A 2RCTA 4AW8A 4R0BA 3VG5A 4ALBA 3RZYA 1JV4A 4ES7A 3VG2A 4A8ZA 2NP1A 4XMEA 4YFPA 2E4JA 1MVGA 3C77X 1X8NA 1KT3A 1GM6A 1SY1A 2L67A 3RSWA 4TJZA 5KIDA 4TNNA 4ZHFA 3NX2A 4I9SA 1UREA 3O19A 3CR6A 3FR5A 1CJ5A 4GETA 1HN2A 4QYPA 1IKJA 5LJEA 1KQWA 1X8OA 4YBUA 2HMBA 5LKEA 3U03A 3WJDA 3CQRA 2QO4A 2AT6X 3FEPA 3PP6A 4MVKA 4RUUA 1BLRA 1KT7A 3WJEA 4QGXA 1TVQA 1EQDA 2WEWA 4TKHA 3P6FA 4A1YA 1G74A 2AT0X 1IIUA 1EPBA 2GJ5A 4K19A 4Y0SA 2AH7X 3MBTA 5FENA 2JOZA 1GX8A 1A18A 4YGHA 1T8VA 3GAQA 1MX8A 2JU3A 5HAEA 3F9DA 5EZ2A 1KOIA 1U0XA 2X45A 4ODDA 2FTBA 1OBUA 5HA0A 4YH0A 1SXWA 2HYSA 3I17A 1GT5A 3HWGA 3JS1A 1QFTA 1FE3A 1YIVA 3VG3A 4ALOA 2G78A 5LJKA 1U18A 1SXYA 4EEJA 5F6ZA 1PBOA 2MM3A 1EW3A 4ZCBA 4TLJA 2OVEA 2FR2A 3EYCA 2Q9SA 1MX7A 4ORYA 3PECA 2AMMX 3G7XA 5D45A 2FLJA 4IB8A 1PMPA 3FELA 4QAEA 3ZUOA 4AZOA 1EALA 3PH6A 1YWDA 4BQUA 3TF6A 5HZ6A 3NQ3A 1B4MA 1LF7A 5HWZA 1JJXA 3WJBA 2GC9A 5F58A 1JZUA 4NLJA 1G5WA 4QZUA 2W2AA 2K62A 4IAWA 4AZMA 2LB6A 4ORUA 1OBPA 2OZQA 3HWFA 4IBAA 5FFHA 4DQ4A 4GH7A 1QY2A 4ZHHA 2OVDA 1B0OA 3VG7A 3NADA 3FA7A 3NPOA 2JN3A 1I05A 1E02A 1HBQA 4EDEA 4GNYA 2HZRA 5DPQA 3IFBA 2AT8X 1OPBA 3KFIA 3KZAA 1X8UA 1NGLA 2AL0X 4I9RA 1A57A 2W2BA 1I06A 2FS6A 3BX8A 4YKOA 1RBPA 4BOEA 3B2JA 3DSZA 1XCAA 1S2PA 1ACDA 1CBQA 1CBRA 3IA8A 1FEMA 1DZJA 1BBPA 2G7BA 4ZJ0A 2LBAA 4O9SA 1TXLA 2G79A 2W2FA 4ORSA 1CBIA 1XKIA 1AELA 1NP1A 3UEUA 1UZ2X 4TKJA 3APUA 1ICNA 1FDQA 4GE1A 1KXOA 3QKGA 5D47A 4UU2A 1BJ7A 4NNSA 1SXUA 5EEDA 1ML7A 3TGAA 1KT5A 3HK1A 3T1DA 1FELA 1E00A 3VG4A 1QABE 1CRBA 1ADLA 4I3DA 1ZRYA 2WQ9A 4D6BA 4HFOA 1YWCA 3WXQA 2R56A 5BVSA 1QQSA 1BSYA 4ZHDA 4OMXA 4XMGA 4ARHA 2L5PA 4NNTA 4A60A 2QO6A 1LFOA 1KQXA 5F6BA 5LJCA 3PEDA 4Y0PA 1JYDA 5BVQA 4N7DA 3FENA 5K06A 1IFBA 3BU9A 1HMSA 3D96A 5HTDA 1GT3A 4I3CA 5LJDA 4IAXA 2HLVA 3FW4A 5HCEC 1KGLA 3UEWA 1ZNEA 4YMYA 3I0AA 3B2KA 4Y0QA 3PH5A 1E06A 1GT4A 4YKMA 1MUPA 4YFRA 4ZH6A 1QWDA 1DC9A 3HWEA 1TOWA 3WJFA 3JSQA 5KHPA 2ANSA 1AVGI 1YWBA 3WVMA 3KQ0A 4YGZA 3KFFA 3FMZA 3BLGA 2WSJA 1RLBE 1R0UA 4NYRA 3BY0A 3FR4A 2XKLA 4PSQA 5H9NA 2ASNX 1EIIA 3MVFA 3F8AA 5BVTA 1BRQA 2JU8A 1T0VA 4YCHA 4EXZA 3BX7A 3AKMA 2RA6A 1ICMA 3APWA 3ZQ3A 5HBSA 3CBSA 1E5PA 2FS7A 3NQ9A 4QZTA 3WJCA 1B56A 2KTDA 1GKAA 3HWDA 1QY0A 2O62A 1PEEA 4IB7A 3BSZE 5H9AA 2ACPX 1IFCA 3WBGA 2L68A 4LZUA 1BM5A 1YWAA 1EUOA 5IO7A 3PPTA 4CK4A 5F7GA 2PY1A 4NYQA 4HPDA 4KIIA 1CBSA 1BSQA 3C78X 1VPRA 4OS8A 1EIOA 4AZRA 3TGCA 1KZXA 3B2LA 3CMPA 4DQ3A 1BEBA 1X71A 1SY0A 2POAA 5EEEA 1EPAA 1QY1A 3FA6A 1SY3A 2CZTA 5B27A 1BRPA 3KFHA 1TOUA 1BSOA 3L4RA 1GKAB 1O8VA 2BLGA 2WUTA 3P6HA 1X89A 5AQ6A 5HZ8A 1OPAA 1GX9A 3NR3A 1ERBA 2OVAA 1LNMA 3P6DA 1ALBA 1ZNLA 4Y0RA 3ELZA 3D97A 2MO5A 1AQBA 2K23A 3DTQA 3EMMA 1ZNGA 2EU7X 4XMHA 1QFVA 5HZ5A 3APVA 4QYNA 5HA1A 1PM1X 3P6EA 2WEXA 1SXXA 4YDAA 2GTFX 1N0SA 1JJJA 1KT4A 4HPBA 4ORRA 1O1VA
chains in the Genus database with same CATH superfamily
5CE4A 1SWLA 1H91A 2FRSA 1TW4A 2GTLM 3VG6A 1QG5A 4GUZA 3APXA 4MIRA 1YP7A 4DNEA 1FTPA 3P02A 4TKBA 2RD7C 2FT9A 3ZUIA 2WR6A 3LV4A 2M4LA 1OBQA 1DZMA 1LICA 3NX1A 1A3YA 1LIDA 3PDFA 1SLGB 2IZBA 3VPJE 3EBWA 5FAZA 3FW5A 3D95A 2CBSA 1T68X 1LIFA 4IB6A 3AUMO 4MVLA 4O3XB 4BX7A 2CM4A 3O22A 2CM9A 4O3YA 4BX5A 4Y5DA 4JHQA 5H9KA 4ZFXA 2CZUA 2RTGB 4MISA 1HBPA 4AYHA 4EQAC 4GK9A 4GNWA 4UU3A 5IRUA 5HCCC 5LJHA 2I5VO 1D2UA 1KT6A 2OFBA 3FEKA 1NQMA 2Y32A 2Z4IA 4CPFA 4Y59A 1MK5A 2AF5A 2Z4HA 1ZNHA 2XSTA 5HTEA 1LKEA 1N7YA 3CWKA 5K68A 5IO6A 5HZ9A 4NW4A 2HNXA 2X8SA 4LZVA 3STKA 1SWQA 1YUPA 1X8PA 4CSBA 1KL5A 1Y0GA 4ID2A 5D4AA 5HZQA 3RDMA 1P6PA 1EIOA 3BS2A 3U9PC 1ZNKA 4CPEA 5IO5A 2IZLB 1BWYA 1VWEB 3K3LA 3ZWEA 1VWRB 1HXLA 3AKNA 1OSPO 4EFGA 1NQNA 5KICA 3SZIA 4BX7B 4XMCA 3VHMA 3RBYA 1SWGA 1L6MA 2LA7A 3WYPA 3ZZVA 1SY2A 4HPAA 3FIDA 4AZQA 1N9MA 1OEJA 1VWGB 4OS0A 1LIBA 1RSUB 5FQ7E 2OY7A 1U17A 2A2UA 4B55A 3B2HA 4ORXA 5CYBA 3UEVA 3FA8A 1G7NA 1JIWI 4M6SA 2UZ2A 1SWRA 2WPUA 3SAOA 3O2YA 3OJYC 4GJVA 5D8JA 2QO5A 4IB9A 5AJCA 2X46A 4LQZA 1MDCA 3EC5A 3BU1A 1ERXA 4RUNA 1LCZA 2QOSC 4ZH9A 3VGWA 2KT4B 4ORWA 5B3MO 5B29A 4WBKA 1GT1A 2FHNX 2KD2A 3JQOA 2KTSA 3Q34A 2WWPA 2MJIA 4MVIA 3RDSA 3RE6A 2OFMX 1UYNX 2NNDA 1FJ1E 1VYGA 2Q2MA 3FA9A 2OF8A 3E3CA 3FIQA 4LKTA 5CHKA 5EPQA 1WBIA 3C76X 5LJGA 2RTEB 1DFVA 3WJGA 2BSZA 4ZR2A 2FWVA 3EW1A 1VWKB 1JQPA 3FLLA 5L8NA 1FENA 3EBKA 2OY5O 1RXKA 1Z24A 1SRFA 1NP4A 2L9CA 4IMOA 3SLTA 2ALLX 2RTRB 3RE5A 3SLJA 3UEXA 3S5VA 1DF8A 1VWJB 1HY2A 1HMRA 1HMTA 2AT3X 2X32A 5L8IA 4QQ1A 3TGBA 1LCWA 4I3BA 4XMDA 1G85A 3VHIA 4IMNA 4BBOA 1K24A 3BRNA 4M7MA 4CV7A 2Q39A 2FKJA 2R73A 5LJBA 2NNQA 3SLOA 1D3SA 2JMBA 2LFOA 2IZIA 1STPA 3KFGA 3P6GA 5B2AO 4A1HA 1B8EA 2C1QA 2HKDA 1JBHA 3T2XA 2OFAA 3NP1A 2BS5A 1SA8A 4OEMA 5DG4A 4TQ2A 3TZSA 2Q2PA 2RTNB 2RTAA 4PJ2A 1W5RA 4QRLA 4QNIA 3D4RA 4WFVA 2F73A 4YGGA 5LKFA 1OEKA 4AZPA 2ZSCA 4BVMA 2VFCA 4L1NA 5C0NA 2I5ZO 2IZKA 4O49A 2N93A 4QGWA 4ZHGA 5EDBA 1LIEA 3HOLA 2FR3A 2AT5X 3P6CA 1STSB 4LKPA 4GDZA 5F1EA 1KZWA 4GGZA 1Y9LA 2IFBA 1GGLA 1YP6A 2R74A 1HQPA 1RSTB 4AZNA 4NLIA 4QGVA 1VWMB 2AKQA 3ELXA 2WQAE 4D6AA 1SRIA 2QM9A 4NP1A 2AVIA 1DZKA 5H8TA 5H9LA 2CBRA 2JU7A 3S26A 4ZGUA 5EDCA 1N4JA 1SWCA 3HPEA 3B2IA 1I4UA 4YBPA 3FYFA 3S5XA 3U0DA 2OFRX 3ZW0A 2RCQA 2A3FX 2NNEA 1S44A 2RTQB 3FR2A 1DV9A 1JMZA 3ZW1A 3STMX 2QCBA 2LBVA 3T6LA 4ZHCA 1A2DA 1EXSA 2LKKA 2A2GA 3CBCA 1S7DA 5HCDC 2ACOA 2RQ0A 3Q6LA 3STNA 2YG2A 3F6ZB 4U46A 4XMFA 4N7CA 2DM5A 4GKCA 4OMWA 4YDBA 1OEEA 1N43A 4OS3A 4YFQA 2JGSA 1VYFA 1DF3A 3BDRA 3KVNA 4HPCA 2A13A 2Q4NA 4O4SA 4YCEA 2RTJA 1ZNDA 3EM0A 2DJGA 5CSEA 1X8QA 5JR8A 1LPJA 3RY2A 5K67A 5L8OA 1GXAA 2BHVA 1IW2A 3CQNA 1DZPA 1JYJA 2P8GA 1IKEA 2HZQA 2A0AA 4GRJA 1SWHA 1O1UA 1I04A 4WFUA 5D48A 1AB0A 1VWBB 2RCTA 4AW8A 4R0BA 3RY1A 3VG5A 4ALBA 3RZYA 1JV4A 3MM0A 3NBXX 1SREA 3VG2A 4ES7A 4A8ZA 2NP1A 4XMEA 4DCBA 4YFPA 2E4JA 1MVGA 3C77X 1X8NA 1KT3A 1GM6A 1SY1A 2L67A 2X56A 2RTLA 1SWBA 3N91A 4MEEA 3RSWA 4TJZA 5KIDA 2X8TA 1WUBA 4TNNA 3RDOA 4ZHFA 2MF6A 3NX2A 4I9SA 1UREA 3O19A 1SLDB 3CR6A 3FR5A 1CJ5A 4GETA 1HN2A 4QYPA 1IKJA 5LJEA 1NBXA 4U8UN 3ZI8A 1KQWA 1X8OA 1VWFB 4YBUA 3VE1A 2HMBA 5LKEA 4BX5B 3U03A 3WJDA 3CQRA 2JW1A 2QO4A 5BYPA 2AT6X 3FEPA 3PP6A 4OELA 2RTFB 4MVKA 4RUUA 3T2WA 3T6FA 3WZNA 4CPHA 1BLRA 4GDAA 1KT7A 1W4TA 3OBLA 3WJEA 4QGXA 1TVQA 1EQDA 2WEWA 4TKHA 2IZEB 2PI3O 3P6FA 2FHLA 4A1YA 1G74A 2AT0X 1IIUA 2RTMA 3HOEA 3CKGA 1HQQA 5IRAA 3VE2A 1EPBA 2GJ5A 4K19A 4Y0SA 2AH7X 3MBTA 5FENA 2A5BA 2JOZA 1A18A 1GX8A 4NV7A 4YGHA 1T8VA 3GAQA 1MX8A 2JU3A 5HAEA 1JJUA 3F9DA 5EZ2A 1KOIA 1U0XA 1HXZA 2X45A 2MWHA 4ODDA 1OBUA 2FTBA 1MEPA 4CPHB 5HA0A 4YH0A 1SXWA 2HYSA 3I17A 1GT5A 3HWGA 3JS1A 4KH8A 4BCSA 1QFTA 1FE3A 1YIVA 3VG3A 4ALOA 1W6FA 1Y52X 2G78A 2IZGB 4CDEA 5LJKA 1U18A 1AVDA 1SXYA 3LTWA 4YVBA 4EEJA 1GX3A 2F01A 1MOYA 5F6ZA 4FGIB 1PBOA 2MM3A 2OL7A 1EW3A 4FQBB 4ZCBA 4TLJA 2X8FA 2OVEA 2FR2A 1SWSA 2X55A 3EYCA 2Q9SA 1MX7A 2BS6A 3MX7A 3PECA 2Y3FA 2AMMX 4ORYA 4MVEA 1VWDB 3G7XA 1EI5A 2FLJA 1PMPA 4IB8A 5D45A 3FELA 5IXGA 4QAEA 2KW1A 3H3IA 3ZUOA 4AZOA 1EALA 3PH6A 1YWDA 1SWJA 2CAMA 4GU8A 3TF6A 4BQUA 5HZ6A 3NQ3A 3RDUA 5B11O 2IZCB 1B4MA 4IRWA 1LF7A 5HWZA 1LELA 3WZQA 1JJXA 3WJBA 1LUQA 2GC9A 3WYQA 4L3RA 5F58A 3RWXA 3P24A 3LHNA 2QOMA 4I60A 1JZUA 4NLJA 4BJ8A 1N9YA 1G5WA 2BC3A 4QZUA 1KL4A 2W2AA 2K62A 4IAWA 4AZMA 2LB6A 4ORUA 3QQ2A 1OBPA 2OZQA 2QMIA 3HWFA 4IBAA 5FFHA 4DQ4A 4GH7A 1Y53X 2C4IA 1QY2A 1KL3A 4ZHHA 2OVDA 2IZAA 1B0OA 2RTKA 3VG7A 2A8GA 2VFBA 3NADA 3FA7A 1STRB 1IJ8A 2JN3A 1I05A 3NPOA 1E02A 1UYOX 1HBQA 4Z2PA 4EDEA 4GNYA 1RAVA 1SRHA 2HZRA 5DPQA 1VYOA 3IFBA 2AT8X 1OPBA 3SOTA 3KFIA 3KZAA 1X8UA 1NGLA 3WZOA 2AL0X 5B5FA 2YMSA 4I9RA 2W2BA 4CPIA 1A57A 1I06A 3SZHA 4GGRA 1MM9A 2FS6A 3BX8A 2OVSA 1RBPA 4YKOA 4I6SA 1NC9A 4BOEA 1PTSA 1SWOA 3B2JA 1SWEA 2RTPB 2IZDB 3DSZA 4NV8A 4CDDA 1XCAA 3OD9A 1SMPI 1S2PA 2FKGA 1ACDA 1CBQA 1CBRA 1I9HA 1FEMA 3IA8A 1E2TA 2RTOB 1DZJA 1BBPA 4ORRA 3ZW0B 4EKVA 2VDFA 2G7BA 3ZW1B 2LBAA 1VWQB 4O9SA 4ZJ0A 1VWPB 1Y55X 1TXLA 2G79A 2OY1O 2BT9A 2W2FA 1CBIA 3CKFA 4FBOA 3GE2A 4ORSA 1XKIA 1AELA 1NP1A 3UEUA 1UZ2X 3VHHA 4TKJA 3APUA 1ICNA 1FDQA 4GE1A 1KXOA 3QKGA 5D47A 1AVEA 4BGFA 4UU2A 1BJ7A 2MHDA 4NNSA 2RTDB 1SXUA 1VWLB 5EEDA 1ML7A 3TGAA 1NDJA 1KT5A 3HK1A 3T1DA 4GJSA 4KC8A 3X00A 1FELA 1E00A 4Z27A 3VG4A 1SWFA 4WHIA 1QABE 1CRBA 4BX6A 1ADLA 4U8UO 4I3DA 1ZRYA 2WQ9A 5FQ6E 4D6BA 4HFOA 1YWCA 3WXQA 2R56A 5BVSA 2UYWA 4JGLA 1QQSA 1BSYA 4ZHDA 4OMXA 4XMGA 3PQSA 5B5GA 4ARHA 2RN4A 2L5PA 4NNTA 4A60A 2OL8O 2QO6A 4GGTA 1LFOA 3ZW2A 2IZFB 4O3WA 1KQXA 2X34A 5F6BA 5LJCA 3PQUA 3PEDA 4Y0PA 4U9CA 5L3YA 1JYDA 5BVQA 4N7DA 3FENA 5K06A 1IFBA 3BU9A 1HMSA 4GZVA 3D96A 2G8CO 5HTDA 1GT3A 4I3CA 5LJDA 2GTLO 4IAXA 3RDQA 2GTLN 1SRGA 2HLVA 4O4XA 1SWTA 3FW4A 5HCEC 1KFFA 3D9WA 1KGLA 4BX6B 2C1SA 3UEWA 1ZNEA 4YMYA 3I0AA 3B2KA 1SLEB 4GD9A 3PH5A 1E06A 1GT4A 4Y0QA 4YKMA 4Z6JA 1VWHB 3WOVA 1MUPA 4ZGFA 4O4UA 1LCVA 4FBVA 4YFRA 4ZH6A 1QWDA 1DC9A 3VU1A 3HWEA 1TOWA 3RKGA 2OY8A 3WJFA 3JSQA 4FBRA 5KHPA 2ANSA 1AVGI 1YWBA 3AEHA 3WVMA 4Z2VA 3KQ0A 4YGZA 3KFFA 5AEOA 3FMZA 4ON1A 1VWIB 3BLGA 4O4OA 4KT5A 1VWCB 2WSJA 1RLBE 1SWKA 1R0UA 4NYRA 3BY0A 3FR4A 4U3QA 2XKLA 4PSQA 5H9NA 2ASNX 1EIIA 2ZAGA 3F8AA 3MVFA 5BVTA 1SWDA 1BRQA 3FDCA 2JU8A 1I78A 1T0VA 3MG5A 2ZAIA 4YCHA 4EXZA 1RXJA 3BX7A 3UAQA 3AKMA 2RA6A 5JD2A 1ICMA 3APWA 3ZQ3A 2IZHB 3CBSA 5HBSA 1E5PA 3PK2A 2FS7A 3NQ9A 4QZTA 3WJCA 1B56A 2KTDA 1GKAA 3HWDA 1QY0A 2O62A 1PEEA 4IB7A 2RTHB 3BSZE 5H9AA 5FQ8E 2A5CA 2ACPX 1IFCA 3WBGA 2IZJA 2GH7A 2L68A 1SRJA 4KCAA 1YWAA 1EUOA 2OF9A 2OL6O 4LZUA 4C5PA 1BM5A 4CDFA 5IO7A 5AJBA 3PPTA 4CK4A 5F7GA 2PY1A 4NYQA 1Y9TA 4O3ZA 4HPDA 2X4MA 4I95A 3WZPA 2DJFA 3HTYA 5B10O 4KIIA 1CBSA 1JMXA 1BSQA 1VPRA 2F09A 3C78X 4OS8A 4AZRA 3TGCA 1SWPA 3B2LA 3CMPA 4DQ3A 1KZXA 1BEBA 3EW2A 1PBYA 2RTBB 1X71A 1SY0A 2POAA 1SWNA 5EEEA 1EPAA 1QY1A 3FA6A 4KC7A 1VWOB 1RXHA 1SY3A 2CZTA 1LDOA 5B27A 1BRPA 3KFHA 1TOUA 1BSOA 4Z28A 5F2BA 3L4RA 2RTCB 4Z2OA 1GKAB 1O8VA 2BLGA 2WUTA 3P6HA 4COTA 1X89A 5AQ6A 3S60A 1SLFB 1OPAA 4U8UM 1GX9A 5HZ8A 3NR3A 1ERBA 2OVAA 1VWNB 1LNMA 4JO6A 3P6DA 1ALBA 1ZNLA 4Y0RA 4INNA 3ELZA 3D97A 2MO5A 1AQBA 2FGSA 2K23A 3DTQA 3EMMA 1ZNGA 2EU7X 4OKAA 4XMHA 1QFVA 4ML7B 4IABA 5HZ5A 3APVA 4QYNA 3RDXA 1SWUA 2G5LA 2OYBO 2Y3EA 3OE3A 3NQKA 5HA1A 1SWAA 1PM1X 3P6EA 4CDCA 2RTIB 2WEXA 1SXXA 4YDAA 3V8UA 1LDQA 2GTFX 1N0SA 1JJJA 1KT4A 3SZJA 1VWAB 4HPBA 4HWMA 5IRWA 4JNJA 1K3BA 1O1VA
chains in the Genus database with same CATH topology
5CE4A 2FRSA 1H91A 2GTLM 1TW4A 3VG6A 1QG5A 4MIRA 3APXA 1YP7A 1FTPA 3P02A 4TKBA 2RD7C 2FT9A 3ZUIA 2WR6A 3LV4A 2M4LA 1OBQA 1DZMA 1LICA 3NX1A 1A3YA 1LIDA 3VPJE 3EBWA 5FAZA 3FW5A 3D95A 2CBSA 1T68X 1LIFA 4IB6A 4MVLA 4O3XB 2CM4A 3O22A 2CM9A 4O3YA 5H9KA 4ZFXA 2CZUA 4MISA 1HBPA 4AYHA 4EQAC 4GK9A 4GNWA 4UU3A 5HCCC 5LJHA 1D2UA 1KT6A 3FEKA 2Z4IA 2Z4HA 1ZNHA 2XSTA 5HTEA 1LKEA 3CWKA 5IO6A 5HZ9A 4NW4A 2HNXA 2X8SA 4LZVA 3STKA 1YUPA 1X8PA 4CSBA 4ID2A 5D4AA 5HZQA 1P6PA 3BS2A 3U9PC 1ZNKA 5IO5A 1BWYA 3K3LA 3ZWEA 3AKNA 4EFGA 4XMCA 3RBYA 2LA7A 1L6MA 4AZQA 3ZZVA 1SY2A 4HPAA 1OEJA 4OS0A 1LIBA 5FQ7E 1U17A 2A2UA 3B2HA 4ORXA 5CYBA 3UEVA 3FA8A 1G7NA 1JIWI 4M6SA 3SAOA 3O2YA 3OJYC 5D8JA 2QO5A 4IB9A 5AJCA 2X46A 4LQZA 1MDCA 3BU1A 1ERXA 4RUNA 2QOSC 4ZH9A 2KT4B 4ORWA 5B29A 4WBKA 1GT1A 2KD2A 3JQOA 2KTSA 2WWPA 2MJIA 4MVIA 2OFMX 2NNDA 1VYGA 5AEOA 2Q2MA 3FA9A 3E3CA 3FIQA 5LJGA 4LKTA 5EPQA 3C76X 3WJGA 1DFVA 4ZR2A 2FWVA 3FLLA 5L8NA 1FENA 3EBKA 1Z24A 2L9CA 1NP4A 4IMOA 2ALLX 3UEXA 3S5VA 2AT3X 1HMRA 1HMTA 5L8IA 4QQ1A 3TGBA 4I3BA 4XMDA 1G85A 4IMNA 3BRNA 4M7MA 4CV7A 2Q39A 2R73A 5LJBA 2NNQA 1D3SA 2JMBA 2LFOA 3P6GA 3KFGA 4A1HA 1B8EA 1JBHA 3NP1A 2BS5A 1SA8A 4TQ2A 5DG4A 3TZSA 2Q2PA 4PJ2A 4QRLA 4WFVA 4QNIA 3D4RA 2F73A 4YGGA 5LKFA 1OEKA 4AZPA 4BVMA 5C0NA 4L1NA 4O49A 2N93A 4QGWA 4ZHGA 5EDBA 1LIEA 3HOLA 2FR3A 2AT5X 3P6CA 4LKPA 4GDZA 5F1EA 1KZWA 1Y9LA 2IFBA 1GGLA 1YP6A 2R74A 1HQPA 4AZNA 4QGVA 4NLIA 2AKQA 3ELXA 2WQAE 4D6AA 2QM9A 4NP1A 5H9LA 1DZKA 5H8TA 3S26A 2CBRA 2JU7A 4ZGUA 5EDCA 3B2IA 1I4UA 4YBPA 3FYFA 3S5XA 3U0DA 2OFRX 3ZW0A 2RCQA 2A3FX 2NNEA 1S44A 3FR2A 1DV9A 3ZW1A 3STMX 2LBVA 4ZHCA 1A2DA 1EXSA 2LKKA 2A2GA 3CBCA 1S7DA 5HCDC 2ACOA 2RQ0A 3Q6LA 3STNA 2YG2A 3F6ZB 4XMFA 4YDBA 4N7CA 2DM5A 4GKCA 4OMWA 4YFQA 1OEEA 5KICA 4OS3A 1DF3A 1VYFA 3BDRA 4HPCA 4O4SA 2A13A 2Q4NA 4YCEA 1ZNDA 3EM0A 1X8QA 5JR8A 1LPJA 5L8OA 1GXAA 2BHVA 1IW2A 3CQNA 1DZPA 1JYJA 2P8GA 1IKEA 2HZQA 2A0AA 4GRJA 1O1UA 1I04A 4WFUA 5D48A 1AB0A 2RCTA 4AW8A 4R0BA 3VG5A 4ALBA 3RZYA 1JV4A 3NBXX 3VG2A 4ES7A 4A8ZA 2NP1A 4XMEA 4YFPA 2E4JA 1MVGA 3C77X 1X8NA 1KT3A 1GM6A 1SY1A 2L67A 3N91A 3RSWA 4TJZA 5KIDA 2X8TA 4TNNA 4ZHFA 3NX2A 4I9SA 1UREA 3O19A 3CR6A 3FR5A 1CJ5A 4GETA 1HN2A 4QYPA 1IKJA 5LJEA 4U8UN 3ZI8A 1KQWA 1X8OA 4YBUA 3VE1A 2HMBA 5LKEA 3U03A 3WJDA 3CQRA 2JW1A 2QO4A 5BYPA 2AT6X 3FEPA 3PP6A 4MVKA 4RUUA 1BLRA 1KT7A 3OBLA 3WJEA 4QGXA 1TVQA 1EQDA 2WEWA 4TKHA 3P6FA 4A1YA 1G74A 2AT0X 1IIUA 3HOEA 3VE2A 1EPBA 2GJ5A 4K19A 4Y0SA 2AH7X 3MBTA 5FENA 2JOZA 1GX8A 1A18A 4YGHA 1T8VA 3GAQA 1MX8A 2JU3A 5HAEA 3F9DA 5EZ2A 1KOIA 1U0XA 2X45A 2MWHA 4ODDA 2FTBA 1OBUA 5HA0A 4YH0A 1SXWA 2HYSA 3I17A 1GT5A 3HWGA 3JS1A 4KH8A 1QFTA 1FE3A 1YIVA 3VG3A 4ALOA 2G78A 5LJKA 1U18A 1SXYA 4EEJA 5F6ZA 4FGIB 1PBOA 2MM3A 4FQBB 1EW3A 4ZCBA 4TLJA 2X8FA 2OVEA 2FR2A 3EYCA 2Q9SA 1MX7A 2BS6A 3MX7A 3PECA 4ORYA 2AMMX 4MVEA 3G7XA 5D45A 1EI5A 2FLJA 1PMPA 4IB8A 3FELA 4QAEA 2KW1A 3H3IA 3ZUOA 4AZOA 1EALA 3PH6A 1YWDA 4GU8A 4BQUA 3TF6A 5HZ6A 3NQ3A 1B4MA 1LF7A 5HWZA 1JJXA 3WJBA 2GC9A 4L3RA 5F58A 3RWXA 3P24A 3LHNA 1JZUA 4NLJA 1G5WA 4QZUA 2W2AA 2K62A 4IAWA 4AZMA 2LB6A 4ORUA 1OBPA 2OZQA 2QMIA 3HWFA 4IBAA 5FFHA 4DQ4A 4GH7A 1QY2A 4ZHHA 2OVDA 1B0OA 3VG7A 3NADA 3FA7A 3NPOA 2JN3A 1I05A 1E02A 1HBQA 4EDEA 4GNYA 2HZRA 5DPQA 3IFBA 2AT8X 1OPBA 3SOTA 3KFIA 3KZAA 1X8UA 1NGLA 2AL0X 2YMSA 4I9RA 2W2BA 1A57A 1I06A 2FS6A 3BX8A 2OVSA 1RBPA 4YKOA 4I6SA 4BOEA 3B2JA 3DSZA 1XCAA 3OD9A 1SMPI 1S2PA 1ACDA 1CBQA 1CBRA 3IA8A 1FEMA 4ORRA 3ZW0B 1DZJA 1BBPA 2G7BA 3ZW1B 2LBAA 4ZJ0A 4O9SA 1TXLA 2G79A 2W2FA 2BT9A 4ORSA 1CBIA 4FBOA 3GE2A 1XKIA 1AELA 1NP1A 3UEUA 1UZ2X 4TKJA 3APUA 1ICNA 1FDQA 4GE1A 1KXOA 3QKGA 5D47A 4UU2A 1BJ7A 2MHDA 4NNSA 1SXUA 5EEDA 1ML7A 3TGAA 1KT5A 3HK1A 3T1DA 4KC8A 1FELA 1E00A 3VG4A 4WHIA 1QABE 1CRBA 1ADLA 4U8UO 4I3DA 1ZRYA 2WQ9A 5FQ6E 4D6BA 4HFOA 1YWCA 3WXQA 2R56A 5BVSA 4JGLA 1QQSA 1BSYA 4ZHDA 4OMXA 4XMGA 3PQSA 4ARHA 2RN4A 2L5PA 4NNTA 4A60A 2QO6A 1LFOA 3ZW2A 4O3WA 1KQXA 5F6BA 5LJCA 3PQUA 3PEDA 4Y0PA 4U9CA 1JYDA 5BVQA 4N7DA 3FENA 5K06A 1IFBA 3BU9A 1HMSA 4GZVA 3D96A 5HTDA 1GT3A 4I3CA 5LJDA 2GTLO 4IAXA 2GTLN 2HLVA 4O4XA 3FW4A 5HCEC 1KGLA 3UEWA 1ZNEA 4YMYA 3I0AA 3B2KA 4Y0QA 3PH5A 1E06A 1GT4A 4YKMA 3WOVA 1MUPA 4ZGFA 4O4UA 4FBVA 4YFRA 4ZH6A 1QWDA 1DC9A 3VU1A 3HWEA 1TOWA 3RKGA 3WJFA 4FBRA 3JSQA 5KHPA 2ANSA 1AVGI 1YWBA 3WVMA 3KQ0A 4YGZA 3KFFA 3FMZA 4ON1A 3BLGA 4O4OA 4KT5A 2WSJA 1RLBE 1R0UA 4NYRA 3BY0A 3FR4A 4U3QA 2XKLA 4PSQA 5H9NA 2ASNX 1EIIA 2ZAGA 3F8AA 3MVFA 5BVTA 1BRQA 2JU8A 1T0VA 2ZAIA 4YCHA 4EXZA 3BX7A 3UAQA 3AKMA 2RA6A 1ICMA 3APWA 3ZQ3A 5HBSA 3CBSA 1E5PA 2FS7A 3NQ9A 4QZTA 3WJCA 1B56A 2KTDA 1GKAA 3HWDA 1QY0A 2O62A 1PEEA 4IB7A 3BSZE 5H9AA 5FQ8E 2ACPX 1IFCA 3WBGA 2L68A 4LZUA 1BM5A 4KCAA 1YWAA 1EUOA 5IO7A 5AJBA 3PPTA 4CK4A 5F7GA 2PY1A 4NYQA 1Y9TA 4O3ZA 4HPDA 4I95A 3HTYA 4KIIA 1CBSA 1BSQA 3C78X 1VPRA 2F09A 4OS8A 1EIOA 4AZRA 3TGCA 1KZXA 3B2LA 3CMPA 4DQ3A 1BEBA 1X71A 1SY0A 2POAA 5EEEA 1EPAA 1QY1A 3FA6A 4KC7A 1SY3A 2CZTA 5B27A 1BRPA 3KFHA 1TOUA 1BSOA 3L4RA 1GKAB 1O8VA 2BLGA 2WUTA 3P6HA 4COTA 1X89A 5AQ6A 3S60A 5HZ8A 1OPAA 4U8UM 1GX9A 3NR3A 1ERBA 2OVAA 1LNMA 3P6DA 1ALBA 1ZNLA 4Y0RA 4INNA 3ELZA 3D97A 2MO5A 1AQBA 2K23A 3DTQA 3EMMA 1ZNGA 2EU7X 4XMHA 1QFVA 4ML7B 4IABA 5HZ5A 3APVA 4QYNA 3OE3A 3NQKA 5HA1A 1PM1X 3P6EA 2WEXA 1SXXA 4YDAA 3V8UA 2GTFX 1N0SA 1JJJA 1KT4A 4HPBA 4HWMA 1O1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CE4 A;  2FRS A;  1H91 A;  1TW4 A;  3VG6 A;  1QG5 A;  3APX A;  1YP7 A;  1FTP A;  4TKB A;  2RD7 C;  2FT9 A;  3ZUI A;  2WR6 A;  1OBQ A;  1DZM A;  1LIC A;  3NX1 A;  1A3Y A;  1LID A;  3EBW A;  5FAZ A;  3FW5 A;  3D95 A;  2CBS A;  1T68 X;  1LIF A;  4IB6 A;  4MVL A;  2CM4 A;  3O22 A;  2CM9 A;  5H9K A;  4ZFX A;  2CZU A;  1HBP A;  4AYH A;  5HCC C;  4GNW A;  4UU3 A;  5LJH A;  1D2U A;  1KT6 A;  3FEK A;  1ZNH A;  2XST A;  5HTE A;  1LKE A;  3CWK A;  5IO6 A;  5HZ9 A;  2HNX A;  4LZV A;  3STK A;  1YUP A;  1X8P A;  5D4A A;  5HZQ A;  1P6P A;  3BS2 A;  3U9P C;  1ZNK A;  5IO5 A;  1BWY A;  3K3L A;  3AKN A;  4EFG A;  4XMC A;  4AZQ A;  1L6M A;  1SY2 A;  4HPA A;  1OEJ A;  4OS0 A;  1LIB A;  1U17 A;  2A2U A;  3B2H A;  4ORX A;  3UEV A;  3FA8 A;  1G7N A;  4M6S A;  3SAO A;  3O2Y A;  3OJY C;  5D8J A;  2QO5 A;  4IB9 A;  2X46 A;  1MDC A;  3BU1 A;  1ERX A;  4RUN A;  2QOS C;  4ZH9 A;  2KT4 B;  4ORW A;  5B29 A;  4WBK A;  1GT1 A;  2WWP A;  2MJI A;  4MVI A;  2OFM X;  2NND A;  1VYG A;  2Q2M A;  3FA9 A;  3FIQ A;  5LJG A;  4LKT A;  5EPQ A;  3C76 X;  3WJG A;  1DFV A;  4ZR2 A;  2FWV A;  3FLL A;  5L8N A;  1FEN A;  3EBK A;  1Z24 A;  2L9C A;  1NP4 A;  4IMO A;  2ALL X;  3UEX A;  2AT3 X;  1HMR A;  1HMT A;  5L8I A;  3TGB A;  4I3B A;  4XMD A;  1G85 A;  4IMN A;  3BRN A;  4M7M A;  2Q39 A;  2R73 A;  5LJB A;  2NNQ A;  1D3S A;  2LFO A;  3P6G A;  3KFG A;  4A1H A;  1B8E A;  1JBH A;  3NP1 A;  4TQ2 A;  1SA8 A;  5DG4 A;  3TZS A;  2Q2P A;  4WFV A;  2F73 A;  4YGG A;  5LKF A;  1OEK A;  4AZP A;  4BVM A;  5C0N A;  2N93 A;  4QGW A;  4ZHG A;  5EDB A;  1LIE A;  2FR3 A;  2AT5 X;  3P6C A;  4LKP A;  5F1E A;  1KZW A;  2IFB A;  1GGL A;  1YP6 A;  2R74 A;  1HQP A;  4AZN A;  4QGV A;  4NLI A;  2AKQ A;  3ELX A;  2WQA E;  4D6A A;  2QM9 A;  4NP1 A;  5H9L A;  1DZK A;  5H8T A;  3S26 A;  2CBR A;  2JU7 A;  4ZGU A;  5EDC A;  3B2I A;  1I4U A;  4YBP A;  3U0D A;  2OFR X;  2RCQ A;  2A3F X;  2NNE A;  1S44 A;  3FR2 A;  1DV9 A;  3STM X;  2LBV A;  4ZHC A;  1A2D A;  1EXS A;  2LKK A;  2A2G A;  3CBC A;  1S7D A;  5HCD C;  2ACO A;  2RQ0 A;  3Q6L A;  3STN A;  2YG2 A;  4YDB A;  4XMF A;  5KIC A;  4N7C A;  2DM5 A;  4GKC A;  4OMW A;  4YFQ A;  1OEE A;  1DF3 A;  4OS3 A;  1VYF A;  3BDR A;  4HPC A;  2A13 A;  2Q4N A;  4YCE A;  1ZND A;  3EM0 A;  1X8Q A;  5JR8 A;  1LPJ A;  5L8O A;  1GXA A;  1IW2 A;  3CQN A;  1DZP A;  1JYJ A;  2P8G A;  1IKE A;  2HZQ A;  2A0A A;  4GRJ A;  1O1U A;  1I04 A;  4WFU A;  5D48 A;  1AB0 A;  2RCT A;  4AW8 A;  4R0B A;  3VG5 A;  4ALB A;  3RZY A;  1JV4 A;  4ES7 A;  3VG2 A;  4A8Z A;  2NP1 A;  4XME A;  4YFP A;  2E4J A;  1MVG A;  3C77 X;  1X8N A;  1KT3 A;  1GM6 A;  1SY1 A;  2L67 A;  3RSW A;  4TJZ A;  5KID A;  4TNN A;  4ZHF A;  3NX2 A;  4I9S A;  1URE A;  3O19 A;  3CR6 A;  3FR5 A;  1CJ5 A;  4GET A;  1HN2 A;  4QYP A;  1IKJ A;  5LJE A;  1KQW A;  1X8O A;  4YBU A;  2HMB A;  5LKE A;  3U03 A;  3WJD A;  3CQR A;  2QO4 A;  2AT6 X;  3FEP A;  3PP6 A;  4MVK A;  4RUU A;  1BLR A;  1KT7 A;  3WJE A;  4QGX A;  1TVQ A;  1EQD A;  2WEW A;  4TKH A;  3P6F A;  4A1Y A;  1G74 A;  2AT0 X;  1IIU A;  1EPB A;  2GJ5 A;  4K19 A;  4Y0S A;  2AH7 X;  3MBT A;  5FEN A;  2JOZ A;  1GX8 A;  1A18 A;  4YGH A;  1T8V A;  3GAQ A;  1MX8 A;  2JU3 A;  5HAE A;  3F9D A;  5EZ2 A;  1KOI A;  1U0X A;  2X45 A;  4ODD A;  2FTB A;  1OBU A;  5HA0 A;  4YH0 A;  1SXW A;  2HYS A;  3I17 A;  1GT5 A;  3HWG A;  3JS1 A;  1QFT A;  1FE3 A;  1YIV A;  3VG3 A;  4ALO A;  2G78 A;  5LJK A;  1U18 A;  1SXY A;  4EEJ A;  5F6Z A;  1PBO A;  2MM3 A;  1EW3 A;  4ZCB A;  4TLJ A;  2OVE A;  2FR2 A;  3EYC A;  2Q9S A;  1MX7 A;  4ORY A;  3PEC A;  2AMM X;  3G7X A;  5D45 A;  2FLJ A;  4IB8 A;  1PMP A;  3FEL A;  4QAE A;  3ZUO A;  4AZO A;  1EAL A;  3PH6 A;  1YWD A;  4BQU A;  3TF6 A;  5HZ6 A;  3NQ3 A;  1B4M A;  1LF7 A;  5HWZ A;  1JJX A;  3WJB A;  2GC9 A;  5F58 A;  1JZU A;  4NLJ A;  1G5W A;  4QZU A;  2W2A A;  2K62 A;  4IAW A;  4AZM A;  2LB6 A;  4ORU A;  1OBP A;  2OZQ A;  3HWF A;  4IBA A;  5FFH A;  4DQ4 A;  4GH7 A;  1QY2 A;  4ZHH A;  2OVD A;  1B0O A;  3VG7 A;  3NAD A;  3FA7 A;  3NPO A;  2JN3 A;  1I05 A;  1E02 A;  1HBQ A;  4EDE A;  4GNY A;  2HZR A;  5DPQ A;  3IFB A;  2AT8 X;  1OPB A;  3KFI A;  3KZA A;  1X8U A;  1NGL A;  2AL0 X;  4I9R A;  1A57 A;  2W2B A;  1I06 A;  2FS6 A;  3BX8 A;  4YKO A;  1RBP A;  4BOE A;  3B2J A;  3DSZ A;  1XCA A;  1S2P A;  1ACD A;  1CBQ A;  1CBR A;  3IA8 A;  1FEM A;  1DZJ A;  1BBP A;  2G7B A;  4ZJ0 A;  2LBA A;  4O9S A;  1TXL A;  2G79 A;  2W2F A;  4ORS A;  1CBI A;  1XKI A;  1AEL A;  1NP1 A;  3UEU A;  1UZ2 X;  4TKJ A;  3APU A;  1ICN A;  1FDQ A;  4GE1 A;  1KXO A;  3QKG A;  5D47 A;  4UU2 A;  1BJ7 A;  4NNS A;  1SXU A;  5EED A;  1ML7 A;  3TGA A;  1KT5 A;  3HK1 A;  3T1D A;  1FEL A;  1E00 A;  3VG4 A;  1QAB E;  1CRB A;  1ADL A;  4I3D A;  1ZRY A;  2WQ9 A;  4D6B A;  4HFO A;  1YWC A;  3WXQ A;  2R56 A;  5BVS A;  1QQS A;  1BSY A;  4ZHD A;  4OMX A;  4XMG A;  4ARH A;  2L5P A;  4NNT A;  4A60 A;  2QO6 A;  1LFO A;  1KQX A;  5F6B A;  5LJC A;  3PED A;  4Y0P A;  1JYD A;  5BVQ A;  4N7D A;  3FEN A;  5K06 A;  1IFB A;  3BU9 A;  1HMS A;  3D96 A;  5HTD A;  1GT3 A;  4I3C A;  5LJD A;  4IAX A;  2HLV A;  3FW4 A;  5HCE C;  1KGL A;  3UEW A;  1ZNE A;  4YMY A;  3I0A A;  3B2K A;  4Y0Q A;  3PH5 A;  1E06 A;  1GT4 A;  4YKM A;  1MUP A;  4YFR A;  4ZH6 A;  1QWD A;  1DC9 A;  3HWE A;  1TOW A;  3WJF A;  3JSQ A;  5KHP A;  2ANS A;  1AVG I;  1YWB A;  3WVM A;  3KQ0 A;  4YGZ A;  3KFF A;  3FMZ A;  3BLG A;  2WSJ A;  1RLB E;  1R0U A;  4NYR A;  3BY0 A;  3FR4 A;  2XKL A;  4PSQ A;  5H9N A;  2ASN X;  1EII A;  3MVF A;  3F8A A;  5BVT A;  1BRQ A;  2JU8 A;  1T0V A;  4YCH A;  4EXZ A;  3BX7 A;  3AKM A;  2RA6 A;  1ICM A;  3APW A;  3ZQ3 A;  5HBS A;  3CBS A;  1E5P A;  2FS7 A;  3NQ9 A;  4QZT A;  3WJC A;  1B56 A;  2KTD A;  1GKA A;  3HWD A;  1QY0 A;  2O62 A;  1PEE A;  4IB7 A;  3BSZ E;  5H9A A;  2ACP X;  1IFC A;  3WBG A;  2L68 A;  4LZU A;  1BM5 A;  1YWA A;  1EUO A;  5IO7 A;  3PPT A;  4CK4 A;  5F7G A;  2PY1 A;  4NYQ A;  4HPD A;  4KII A;  1CBS A;  1BSQ A;  3C78 X;  1VPR A;  4OS8 A;  1EIO A;  4AZR A;  3TGC A;  1KZX A;  3B2L A;  3CMP A;  4DQ3 A;  1BEB A;  1X71 A;  1SY0 A;  2POA A;  5EEE A;  1EPA A;  1QY1 A;  3FA6 A;  1SY3 A;  2CZT A;  5B27 A;  1BRP A;  3KFH A;  1TOU A;  1BSO A;  3L4R A;  1GKA B;  1O8V A;  2BLG A;  2WUT A;  3P6H A;  1X89 A;  5AQ6 A;  5HZ8 A;  1OPA A;  1GX9 A;  3NR3 A;  1ERB A;  2OVA A;  1LNM A;  3P6D A;  1ALB A;  1ZNL A;  4Y0R A;  3ELZ A;  3D97 A;  2MO5 A;  1AQB A;  2K23 A;  3DTQ A;  3EMM A;  1ZNG A;  2EU7 X;  4XMH A;  1QFV A;  5HZ5 A;  3APV A;  4QYN A;  5HA1 A;  1PM1 X;  3P6E A;  2WEX A;  1SXX A;  4YDA A;  2GTF X;  1N0S A;  1JJJ A;  1KT4 A;  4HPB A;  4ORR A;  1O1V A; 
#chains in the Genus database with same CATH topology
 5CE4 A;  1SWL A;  1H91 A;  2FRS A;  1TW4 A;  2GTL M;  3VG6 A;  1QG5 A;  4GUZ A;  3APX A;  4MIR A;  1YP7 A;  4DNE A;  1FTP A;  3P02 A;  4TKB A;  2RD7 C;  2FT9 A;  3ZUI A;  2WR6 A;  3LV4 A;  2M4L A;  1OBQ A;  1DZM A;  1LIC A;  3NX1 A;  1A3Y A;  1LID A;  3PDF A;  1SLG B;  2IZB A;  3VPJ E;  3EBW A;  5FAZ A;  3FW5 A;  3D95 A;  2CBS A;  1T68 X;  1LIF A;  4IB6 A;  3AUM O;  4MVL A;  4O3X B;  4BX7 A;  2CM4 A;  3O22 A;  2CM9 A;  4O3Y A;  4BX5 A;  4Y5D A;  4JHQ A;  5H9K A;  4ZFX A;  2CZU A;  2RTG B;  4MIS A;  1HBP A;  4AYH A;  4EQA C;  4GK9 A;  4GNW A;  4UU3 A;  5IRU A;  5HCC C;  5LJH A;  2I5V O;  1D2U A;  1KT6 A;  2OFB A;  3FEK A;  1NQM A;  2Y32 A;  2Z4I A;  4CPF A;  4Y59 A;  1MK5 A;  2AF5 A;  2Z4H A;  1ZNH A;  2XST A;  5HTE A;  1LKE A;  1N7Y A;  3CWK A;  5K68 A;  5IO6 A;  5HZ9 A;  4NW4 A;  2HNX A;  2X8S A;  4LZV A;  3STK A;  1SWQ A;  1YUP A;  1X8P A;  4CSB A;  1KL5 A;  1Y0G A;  4ID2 A;  5D4A A;  5HZQ A;  3RDM A;  1P6P A;  1EIO A;  3BS2 A;  3U9P C;  1ZNK A;  4CPE A;  5IO5 A;  2IZL B;  1BWY A;  1VWE B;  3K3L A;  3ZWE A;  1VWR B;  1HXL A;  3AKN A;  1OSP O;  4EFG A;  1NQN A;  5KIC A;  3SZI A;  4BX7 B;  4XMC A;  3VHM A;  3RBY A;  1SWG A;  1L6M A;  2LA7 A;  3WYP A;  3ZZV A;  1SY2 A;  4HPA A;  3FID A;  4AZQ A;  1N9M A;  1OEJ A;  1VWG B;  4OS0 A;  1LIB A;  1RSU B;  5FQ7 E;  2OY7 A;  1U17 A;  2A2U A;  4B55 A;  3B2H A;  4ORX A;  5CYB A;  3UEV A;  3FA8 A;  1G7N A;  1JIW I;  4M6S A;  2UZ2 A;  1SWR A;  2WPU A;  3SAO A;  3O2Y A;  3OJY C;  4GJV A;  5D8J A;  2QO5 A;  4IB9 A;  5AJC A;  2X46 A;  4LQZ A;  1MDC A;  3EC5 A;  3BU1 A;  1ERX A;  4RUN A;  1LCZ A;  2QOS C;  4ZH9 A;  3VGW A;  2KT4 B;  4ORW A;  5B3M O;  5B29 A;  4WBK A;  1GT1 A;  2FHN X;  2KD2 A;  3JQO A;  2KTS A;  3Q34 A;  2WWP A;  2MJI A;  4MVI A;  3RDS A;  3RE6 A;  2OFM X;  1UYN X;  2NND A;  1FJ1 E;  1VYG A;  2Q2M A;  3FA9 A;  2OF8 A;  3E3C A;  3FIQ A;  4LKT A;  5CHK A;  5EPQ A;  1WBI A;  3C76 X;  5LJG A;  2RTE B;  1DFV A;  3WJG A;  2BSZ A;  4ZR2 A;  2FWV A;  3EW1 A;  1VWK B;  1JQP A;  3FLL A;  5L8N A;  1FEN A;  3EBK A;  2OY5 O;  1RXK A;  1Z24 A;  1SRF A;  1NP4 A;  2L9C A;  4IMO A;  3SLT A;  2ALL X;  2RTR B;  3RE5 A;  3SLJ A;  3UEX A;  3S5V A;  1DF8 A;  1VWJ B;  1HY2 A;  1HMR A;  1HMT A;  2AT3 X;  2X32 A;  5L8I A;  4QQ1 A;  3TGB A;  1LCW A;  4I3B A;  4XMD A;  1G85 A;  3VHI A;  4IMN A;  4BBO A;  1K24 A;  3BRN A;  4M7M A;  4CV7 A;  2Q39 A;  2FKJ A;  2R73 A;  5LJB A;  2NNQ A;  3SLO A;  1D3S A;  2JMB A;  2LFO A;  2IZI A;  1STP A;  3KFG A;  3P6G A;  5B2A O;  4A1H A;  1B8E A;  2C1Q A;  2HKD A;  1JBH A;  3T2X A;  2OFA A;  3NP1 A;  2BS5 A;  1SA8 A;  4OEM A;  5DG4 A;  4TQ2 A;  3TZS A;  2Q2P A;  2RTN B;  2RTA A;  4PJ2 A;  1W5R A;  4QRL A;  4QNI A;  3D4R A;  4WFV A;  2F73 A;  4YGG A;  5LKF A;  1OEK A;  4AZP A;  2ZSC A;  4BVM A;  2VFC A;  4L1N A;  5C0N A;  2I5Z O;  2IZK A;  4O49 A;  2N93 A;  4QGW A;  4ZHG A;  5EDB A;  1LIE A;  3HOL A;  2FR3 A;  2AT5 X;  3P6C A;  1STS B;  4LKP A;  4GDZ A;  5F1E A;  1KZW A;  4GGZ A;  1Y9L A;  2IFB A;  1GGL A;  1YP6 A;  2R74 A;  1HQP A;  1RST B;  4AZN A;  4NLI A;  4QGV A;  1VWM B;  2AKQ A;  3ELX A;  2WQA E;  4D6A A;  1SRI A;  2QM9 A;  4NP1 A;  2AVI A;  1DZK A;  5H8T A;  5H9L A;  2CBR A;  2JU7 A;  3S26 A;  4ZGU A;  5EDC A;  1N4J A;  1SWC A;  3HPE A;  3B2I A;  1I4U A;  4YBP A;  3FYF A;  3S5X A;  3U0D A;  2OFR X;  3ZW0 A;  2RCQ A;  2A3F X;  2NNE A;  1S44 A;  2RTQ B;  3FR2 A;  1DV9 A;  1JMZ A;  3ZW1 A;  3STM X;  2QCB A;  2LBV A;  3T6L A;  4ZHC A;  1A2D A;  1EXS A;  2LKK A;  2A2G A;  3CBC A;  1S7D A;  5HCD C;  2ACO A;  2RQ0 A;  3Q6L A;  3STN A;  2YG2 A;  3F6Z B;  4U46 A;  4XMF A;  4N7C A;  2DM5 A;  4GKC A;  4OMW A;  4YDB A;  1OEE A;  1N43 A;  4OS3 A;  4YFQ A;  2JGS A;  1VYF A;  1DF3 A;  3BDR A;  3KVN A;  4HPC A;  2A13 A;  2Q4N A;  4O4S A;  4YCE A;  2RTJ A;  1ZND A;  3EM0 A;  2DJG A;  5CSE A;  1X8Q A;  5JR8 A;  1LPJ A;  3RY2 A;  5K67 A;  5L8O A;  1GXA A;  2BHV A;  1IW2 A;  3CQN A;  1DZP A;  1JYJ A;  2P8G A;  1IKE A;  2HZQ A;  2A0A A;  4GRJ A;  1SWH A;  1O1U A;  1I04 A;  4WFU A;  5D48 A;  1AB0 A;  1VWB B;  2RCT A;  4AW8 A;  4R0B A;  3RY1 A;  3VG5 A;  4ALB A;  3RZY A;  1JV4 A;  3MM0 A;  3NBX X;  1SRE A;  3VG2 A;  4ES7 A;  4A8Z A;  2NP1 A;  4XME A;  4DCB A;  4YFP A;  2E4J A;  1MVG A;  3C77 X;  1X8N A;  1KT3 A;  1GM6 A;  1SY1 A;  2L67 A;  2X56 A;  2RTL A;  1SWB A;  3N91 A;  4MEE A;  3RSW A;  4TJZ A;  5KID A;  2X8T A;  1WUB A;  4TNN A;  3RDO A;  4ZHF A;  2MF6 A;  3NX2 A;  4I9S A;  1URE A;  3O19 A;  1SLD B;  3CR6 A;  3FR5 A;  1CJ5 A;  4GET A;  1HN2 A;  4QYP A;  1IKJ A;  5LJE A;  1NBX A;  4U8U N;  3ZI8 A;  1KQW A;  1X8O A;  1VWF B;  4YBU A;  3VE1 A;  2HMB A;  5LKE A;  4BX5 B;  3U03 A;  3WJD A;  3CQR A;  2JW1 A;  2QO4 A;  5BYP A;  2AT6 X;  3FEP A;  3PP6 A;  4OEL A;  2RTF B;  4MVK A;  4RUU A;  3T2W A;  3T6F A;  3WZN A;  4CPH A;  1BLR A;  4GDA A;  1KT7 A;  1W4T A;  3OBL A;  3WJE A;  4QGX A;  1TVQ A;  1EQD A;  2WEW A;  4TKH A;  2IZE B;  2PI3 O;  3P6F A;  2FHL A;  4A1Y A;  1G74 A;  2AT0 X;  1IIU A;  2RTM A;  3HOE A;  3CKG A;  1HQQ A;  5IRA A;  3VE2 A;  1EPB A;  2GJ5 A;  4K19 A;  4Y0S A;  2AH7 X;  3MBT A;  5FEN A;  2A5B A;  2JOZ A;  1A18 A;  1GX8 A;  4NV7 A;  4YGH A;  1T8V A;  3GAQ A;  1MX8 A;  2JU3 A;  5HAE A;  1JJU A;  3F9D A;  5EZ2 A;  1KOI A;  1U0X A;  1HXZ A;  2X45 A;  2MWH A;  4ODD A;  1OBU A;  2FTB A;  1MEP A;  4CPH B;  5HA0 A;  4YH0 A;  1SXW A;  2HYS A;  3I17 A;  1GT5 A;  3HWG A;  3JS1 A;  4KH8 A;  4BCS A;  1QFT A;  1FE3 A;  1YIV A;  3VG3 A;  4ALO A;  1W6F A;  1Y52 X;  2G78 A;  2IZG B;  4CDE A;  5LJK A;  1U18 A;  1AVD A;  1SXY A;  3LTW A;  4YVB A;  4EEJ A;  1GX3 A;  2F01 A;  1MOY A;  5F6Z A;  4FGI B;  1PBO A;  2MM3 A;  2OL7 A;  1EW3 A;  4FQB B;  4ZCB A;  4TLJ A;  2X8F A;  2OVE A;  2FR2 A;  1SWS A;  2X55 A;  3EYC A;  2Q9S A;  1MX7 A;  2BS6 A;  3MX7 A;  3PEC A;  2Y3F A;  2AMM X;  4ORY A;  4MVE A;  1VWD B;  3G7X A;  1EI5 A;  2FLJ A;  1PMP A;  4IB8 A;  5D45 A;  3FEL A;  5IXG A;  4QAE A;  2KW1 A;  3H3I A;  3ZUO A;  4AZO A;  1EAL A;  3PH6 A;  1YWD A;  1SWJ A;  2CAM A;  4GU8 A;  3TF6 A;  4BQU A;  5HZ6 A;  3NQ3 A;  3RDU A;  5B11 O;  2IZC B;  1B4M A;  4IRW A;  1LF7 A;  5HWZ A;  1LEL A;  3WZQ A;  1JJX A;  3WJB A;  1LUQ A;  2GC9 A;  3WYQ A;  4L3R A;  5F58 A;  3RWX A;  3P24 A;  3LHN A;  2QOM A;  4I60 A;  1JZU A;  4NLJ A;  4BJ8 A;  1N9Y A;  1G5W A;  2BC3 A;  4QZU A;  1KL4 A;  2W2A A;  2K62 A;  4IAW A;  4AZM A;  2LB6 A;  4ORU A;  3QQ2 A;  1OBP A;  2OZQ A;  2QMI A;  3HWF A;  4IBA A;  5FFH A;  4DQ4 A;  4GH7 A;  1Y53 X;  2C4I A;  1QY2 A;  1KL3 A;  4ZHH A;  2OVD A;  2IZA A;  1B0O A;  2RTK A;  3VG7 A;  2A8G A;  2VFB A;  3NAD A;  3FA7 A;  1STR B;  1IJ8 A;  2JN3 A;  1I05 A;  3NPO A;  1E02 A;  1UYO X;  1HBQ A;  4Z2P A;  4EDE A;  4GNY A;  1RAV A;  1SRH A;  2HZR A;  5DPQ A;  1VYO A;  3IFB A;  2AT8 X;  1OPB A;  3SOT A;  3KFI A;  3KZA A;  1X8U A;  1NGL A;  3WZO A;  2AL0 X;  5B5F A;  2YMS A;  4I9R A;  2W2B A;  4CPI A;  1A57 A;  1I06 A;  3SZH A;  4GGR A;  1MM9 A;  2FS6 A;  3BX8 A;  2OVS A;  1RBP A;  4YKO A;  4I6S A;  1NC9 A;  4BOE A;  1PTS A;  1SWO A;  3B2J A;  1SWE A;  2RTP B;  2IZD B;  3DSZ A;  4NV8 A;  4CDD A;  1XCA A;  3OD9 A;  1SMP I;  1S2P A;  2FKG A;  1ACD A;  1CBQ A;  1CBR A;  1I9H A;  1FEM A;  3IA8 A;  1E2T A;  2RTO B;  1DZJ A;  1BBP A;  4ORR A;  3ZW0 B;  4EKV A;  2VDF A;  2G7B A;  3ZW1 B;  2LBA A;  1VWQ B;  4O9S A;  4ZJ0 A;  1VWP B;  1Y55 X;  1TXL A;  2G79 A;  2OY1 O;  2BT9 A;  2W2F A;  1CBI A;  3CKF A;  4FBO A;  3GE2 A;  4ORS A;  1XKI A;  1AEL A;  1NP1 A;  3UEU A;  1UZ2 X;  3VHH A;  4TKJ A;  3APU A;  1ICN A;  1FDQ A;  4GE1 A;  1KXO A;  3QKG A;  5D47 A;  1AVE A;  4BGF A;  4UU2 A;  1BJ7 A;  2MHD A;  4NNS A;  2RTD B;  1SXU A;  1VWL B;  5EED A;  1ML7 A;  3TGA A;  1NDJ A;  1KT5 A;  3HK1 A;  3T1D A;  4GJS A;  4KC8 A;  3X00 A;  1FEL A;  1E00 A;  4Z27 A;  3VG4 A;  1SWF A;  4WHI A;  1QAB E;  1CRB A;  4BX6 A;  1ADL A;  4U8U O;  4I3D A;  1ZRY A;  2WQ9 A;  5FQ6 E;  4D6B A;  4HFO A;  1YWC A;  3WXQ A;  2R56 A;  5BVS A;  2UYW A;  4JGL A;  1QQS A;  1BSY A;  4ZHD A;  4OMX A;  4XMG A;  3PQS A;  5B5G A;  4ARH A;  2RN4 A;  2L5P A;  4NNT A;  4A60 A;  2OL8 O;  2QO6 A;  4GGT A;  1LFO A;  3ZW2 A;  2IZF B;  4O3W A;  1KQX A;  2X34 A;  5F6B A;  5LJC A;  3PQU A;  3PED A;  4Y0P A;  4U9C A;  5L3Y A;  1JYD A;  5BVQ A;  4N7D A;  3FEN A;  5K06 A;  1IFB A;  3BU9 A;  1HMS A;  4GZV A;  3D96 A;  2G8C O;  5HTD A;  1GT3 A;  4I3C A;  5LJD A;  2GTL O;  4IAX A;  3RDQ A;  2GTL N;  1SRG A;  2HLV A;  4O4X A;  1SWT A;  3FW4 A;  5HCE C;  1KFF A;  3D9W A;  1KGL A;  4BX6 B;  2C1S A;  3UEW A;  1ZNE A;  4YMY A;  3I0A A;  3B2K A;  1SLE B;  4GD9 A;  3PH5 A;  1E06 A;  1GT4 A;  4Y0Q A;  4YKM A;  4Z6J A;  1VWH B;  3WOV A;  1MUP A;  4ZGF A;  4O4U A;  1LCV A;  4FBV A;  4YFR A;  4ZH6 A;  1QWD A;  1DC9 A;  3VU1 A;  3HWE A;  1TOW A;  3RKG A;  2OY8 A;  3WJF A;  3JSQ A;  4FBR A;  5KHP A;  2ANS A;  1AVG I;  1YWB A;  3AEH A;  3WVM A;  4Z2V A;  3KQ0 A;  4YGZ A;  3KFF A;  5AEO A;  3FMZ A;  4ON1 A;  1VWI B;  3BLG A;  4O4O A;  4KT5 A;  1VWC B;  2WSJ A;  1RLB E;  1SWK A;  1R0U A;  4NYR A;  3BY0 A;  3FR4 A;  4U3Q A;  2XKL A;  4PSQ A;  5H9N A;  2ASN X;  1EII A;  2ZAG A;  3F8A A;  3MVF A;  5BVT A;  1SWD A;  1BRQ A;  3FDC A;  2JU8 A;  1I78 A;  1T0V A;  3MG5 A;  2ZAI A;  4YCH A;  4EXZ A;  1RXJ A;  3BX7 A;  3UAQ A;  3AKM A;  2RA6 A;  5JD2 A;  1ICM A;  3APW A;  3ZQ3 A;  2IZH B;  3CBS A;  5HBS A;  1E5P A;  3PK2 A;  2FS7 A;  3NQ9 A;  4QZT A;  3WJC A;  1B56 A;  2KTD A;  1GKA A;  3HWD A;  1QY0 A;  2O62 A;  1PEE A;  4IB7 A;  2RTH B;  3BSZ E;  5H9A A;  5FQ8 E;  2A5C A;  2ACP X;  1IFC A;  3WBG A;  2IZJ A;  2GH7 A;  2L68 A;  1SRJ A;  4KCA A;  1YWA A;  1EUO A;  2OF9 A;  2OL6 O;  4LZU A;  4C5P A;  1BM5 A;  4CDF A;  5IO7 A;  5AJB A;  3PPT A;  4CK4 A;  5F7G A;  2PY1 A;  4NYQ A;  1Y9T A;  4O3Z A;  4HPD A;  2X4M A;  4I95 A;  3WZP A;  2DJF A;  3HTY A;  5B10 O;  4KII A;  1CBS A;  1JMX A;  1BSQ A;  1VPR A;  2F09 A;  3C78 X;  4OS8 A;  4AZR A;  3TGC A;  1SWP A;  3B2L A;  3CMP A;  4DQ3 A;  1KZX A;  1BEB A;  3EW2 A;  1PBY A;  2RTB B;  1X71 A;  1SY0 A;  2POA A;  1SWN A;  5EEE A;  1EPA A;  1QY1 A;  3FA6 A;  4KC7 A;  1VWO B;  1RXH A;  1SY3 A;  2CZT A;  1LDO A;  5B27 A;  1BRP A;  3KFH A;  1TOU A;  1BSO A;  4Z28 A;  5F2B A;  3L4R A;  2RTC B;  4Z2O A;  1GKA B;  1O8V A;  2BLG A;  2WUT A;  3P6H A;  4COT A;  1X89 A;  5AQ6 A;  3S60 A;  1SLF B;  1OPA A;  4U8U M;  1GX9 A;  5HZ8 A;  3NR3 A;  1ERB A;  2OVA A;  1VWN B;  1LNM A;  4JO6 A;  3P6D A;  1ALB A;  1ZNL A;  4Y0R A;  4INN A;  3ELZ A;  3D97 A;  2MO5 A;  1AQB A;  2FGS A;  2K23 A;  3DTQ A;  3EMM A;  1ZNG A;  2EU7 X;  4OKA A;  4XMH A;  1QFV A;  4ML7 B;  4IAB A;  5HZ5 A;  3APV A;  4QYN A;  3RDX A;  1SWU A;  2G5L A;  2OYB O;  2Y3E A;  3OE3 A;  3NQK A;  5HA1 A;  1SWA A;  1PM1 X;  3P6E A;  4CDC A;  2RTI B;  2WEX A;  1SXX A;  4YDA A;  3V8U A;  1LDQ A;  2GTF X;  1N0S A;  1JJJ A;  1KT4 A;  3SZJ A;  1VWA B;  4HPB A;  4HWM A;  5IRW A;  4JNJ A;  1K3B A;  1O1V A; 
#chains in the Genus database with same CATH homology
 5CE4 A;  2FRS A;  1H91 A;  2GTL M;  1TW4 A;  3VG6 A;  1QG5 A;  4MIR A;  3APX A;  1YP7 A;  1FTP A;  3P02 A;  4TKB A;  2RD7 C;  2FT9 A;  3ZUI A;  2WR6 A;  3LV4 A;  2M4L A;  1OBQ A;  1DZM A;  1LIC A;  3NX1 A;  1A3Y A;  1LID A;  3VPJ E;  3EBW A;  5FAZ A;  3FW5 A;  3D95 A;  2CBS A;  1T68 X;  1LIF A;  4IB6 A;  4MVL A;  4O3X B;  2CM4 A;  3O22 A;  2CM9 A;  4O3Y A;  5H9K A;  4ZFX A;  2CZU A;  4MIS A;  1HBP A;  4AYH A;  4EQA C;  4GK9 A;  4GNW A;  4UU3 A;  5HCC C;  5LJH A;  1D2U A;  1KT6 A;  3FEK A;  2Z4I A;  2Z4H A;  1ZNH A;  2XST A;  5HTE A;  1LKE A;  3CWK A;  5IO6 A;  5HZ9 A;  4NW4 A;  2HNX A;  2X8S A;  4LZV A;  3STK A;  1YUP A;  1X8P A;  4CSB A;  4ID2 A;  5D4A A;  5HZQ A;  1P6P A;  3BS2 A;  3U9P C;  1ZNK A;  5IO5 A;  1BWY A;  3K3L A;  3ZWE A;  3AKN A;  4EFG A;  4XMC A;  3RBY A;  2LA7 A;  1L6M A;  4AZQ A;  3ZZV A;  1SY2 A;  4HPA A;  1OEJ A;  4OS0 A;  1LIB A;  5FQ7 E;  1U17 A;  2A2U A;  3B2H A;  4ORX A;  5CYB A;  3UEV A;  3FA8 A;  1G7N A;  1JIW I;  4M6S A;  3SAO A;  3O2Y A;  3OJY C;  5D8J A;  2QO5 A;  4IB9 A;  5AJC A;  2X46 A;  4LQZ A;  1MDC A;  3BU1 A;  1ERX A;  4RUN A;  2QOS C;  4ZH9 A;  2KT4 B;  4ORW A;  5B29 A;  4WBK A;  1GT1 A;  2KD2 A;  3JQO A;  2KTS A;  2WWP A;  2MJI A;  4MVI A;  2OFM X;  2NND A;  1VYG A;  5AEO A;  2Q2M A;  3FA9 A;  3E3C A;  3FIQ A;  5LJG A;  4LKT A;  5EPQ A;  3C76 X;  3WJG A;  1DFV A;  4ZR2 A;  2FWV A;  3FLL A;  5L8N A;  1FEN A;  3EBK A;  1Z24 A;  2L9C A;  1NP4 A;  4IMO A;  2ALL X;  3UEX A;  3S5V A;  2AT3 X;  1HMR A;  1HMT A;  5L8I A;  4QQ1 A;  3TGB A;  4I3B A;  4XMD A;  1G85 A;  4IMN A;  3BRN A;  4M7M A;  4CV7 A;  2Q39 A;  2R73 A;  5LJB A;  2NNQ A;  1D3S A;  2JMB A;  2LFO A;  3P6G A;  3KFG A;  4A1H A;  1B8E A;  1JBH A;  3NP1 A;  2BS5 A;  1SA8 A;  4TQ2 A;  5DG4 A;  3TZS A;  2Q2P A;  4PJ2 A;  4QRL A;  4WFV A;  4QNI A;  3D4R A;  2F73 A;  4YGG A;  5LKF A;  1OEK A;  4AZP A;  4BVM A;  5C0N A;  4L1N A;  4O49 A;  2N93 A;  4QGW A;  4ZHG A;  5EDB A;  1LIE A;  3HOL A;  2FR3 A;  2AT5 X;  3P6C A;  4LKP A;  4GDZ A;  5F1E A;  1KZW A;  1Y9L A;  2IFB A;  1GGL A;  1YP6 A;  2R74 A;  1HQP A;  4AZN A;  4QGV A;  4NLI A;  2AKQ A;  3ELX A;  2WQA E;  4D6A A;  2QM9 A;  4NP1 A;  5H9L A;  1DZK A;  5H8T A;  3S26 A;  2CBR A;  2JU7 A;  4ZGU A;  5EDC A;  3B2I A;  1I4U A;  4YBP A;  3FYF A;  3S5X A;  3U0D A;  2OFR X;  3ZW0 A;  2RCQ A;  2A3F X;  2NNE A;  1S44 A;  3FR2 A;  1DV9 A;  3ZW1 A;  3STM X;  2LBV A;  4ZHC A;  1A2D A;  1EXS A;  2LKK A;  2A2G A;  3CBC A;  1S7D A;  5HCD C;  2ACO A;  2RQ0 A;  3Q6L A;  3STN A;  2YG2 A;  3F6Z B;  4XMF A;  4YDB A;  4N7C A;  2DM5 A;  4GKC A;  4OMW A;  4YFQ A;  1OEE A;  5KIC A;  4OS3 A;  1DF3 A;  1VYF A;  3BDR A;  4HPC A;  4O4S A;  2A13 A;  2Q4N A;  4YCE A;  1ZND A;  3EM0 A;  1X8Q A;  5JR8 A;  1LPJ A;  5L8O A;  1GXA A;  2BHV A;  1IW2 A;  3CQN A;  1DZP A;  1JYJ A;  2P8G A;  1IKE A;  2HZQ A;  2A0A A;  4GRJ A;  1O1U A;  1I04 A;  4WFU A;  5D48 A;  1AB0 A;  2RCT A;  4AW8 A;  4R0B A;  3VG5 A;  4ALB A;  3RZY A;  1JV4 A;  3NBX X;  3VG2 A;  4ES7 A;  4A8Z A;  2NP1 A;  4XME A;  4YFP A;  2E4J A;  1MVG A;  3C77 X;  1X8N A;  1KT3 A;  1GM6 A;  1SY1 A;  2L67 A;  3N91 A;  3RSW A;  4TJZ A;  5KID A;  2X8T A;  4TNN A;  4ZHF A;  3NX2 A;  4I9S A;  1URE A;  3O19 A;  3CR6 A;  3FR5 A;  1CJ5 A;  4GET A;  1HN2 A;  4QYP A;  1IKJ A;  5LJE A;  4U8U N;  3ZI8 A;  1KQW A;  1X8O A;  4YBU A;  3VE1 A;  2HMB A;  5LKE A;  3U03 A;  3WJD A;  3CQR A;  2JW1 A;  2QO4 A;  5BYP A;  2AT6 X;  3FEP A;  3PP6 A;  4MVK A;  4RUU A;  1BLR A;  1KT7 A;  3OBL A;  3WJE A;  4QGX A;  1TVQ A;  1EQD A;  2WEW A;  4TKH A;  3P6F A;  4A1Y A;  1G74 A;  2AT0 X;  1IIU A;  3HOE A;  3VE2 A;  1EPB A;  2GJ5 A;  4K19 A;  4Y0S A;  2AH7 X;  3MBT A;  5FEN A;  2JOZ A;  1GX8 A;  1A18 A;  4YGH A;  1T8V A;  3GAQ A;  1MX8 A;  2JU3 A;  5HAE A;  3F9D A;  5EZ2 A;  1KOI A;  1U0X A;  2X45 A;  2MWH A;  4ODD A;  2FTB A;  1OBU A;  5HA0 A;  4YH0 A;  1SXW A;  2HYS A;  3I17 A;  1GT5 A;  3HWG A;  3JS1 A;  4KH8 A;  1QFT A;  1FE3 A;  1YIV A;  3VG3 A;  4ALO A;  2G78 A;  5LJK A;  1U18 A;  1SXY A;  4EEJ A;  5F6Z A;  4FGI B;  1PBO A;  2MM3 A;  4FQB B;  1EW3 A;  4ZCB A;  4TLJ A;  2X8F A;  2OVE A;  2FR2 A;  3EYC A;  2Q9S A;  1MX7 A;  2BS6 A;  3MX7 A;  3PEC A;  4ORY A;  2AMM X;  4MVE A;  3G7X A;  5D45 A;  1EI5 A;  2FLJ A;  1PMP A;  4IB8 A;  3FEL A;  4QAE A;  2KW1 A;  3H3I A;  3ZUO A;  4AZO A;  1EAL A;  3PH6 A;  1YWD A;  4GU8 A;  4BQU A;  3TF6 A;  5HZ6 A;  3NQ3 A;  1B4M A;  1LF7 A;  5HWZ A;  1JJX A;  3WJB A;  2GC9 A;  4L3R A;  5F58 A;  3RWX A;  3P24 A;  3LHN A;  1JZU A;  4NLJ A;  1G5W A;  4QZU A;  2W2A A;  2K62 A;  4IAW A;  4AZM A;  2LB6 A;  4ORU A;  1OBP A;  2OZQ A;  2QMI A;  3HWF A;  4IBA A;  5FFH A;  4DQ4 A;  4GH7 A;  1QY2 A;  4ZHH A;  2OVD A;  1B0O A;  3VG7 A;  3NAD A;  3FA7 A;  3NPO A;  2JN3 A;  1I05 A;  1E02 A;  1HBQ A;  4EDE A;  4GNY A;  2HZR A;  5DPQ A;  3IFB A;  2AT8 X;  1OPB A;  3SOT A;  3KFI A;  3KZA A;  1X8U A;  1NGL A;  2AL0 X;  2YMS A;  4I9R A;  2W2B A;  1A57 A;  1I06 A;  2FS6 A;  3BX8 A;  2OVS A;  1RBP A;  4YKO A;  4I6S A;  4BOE A;  3B2J A;  3DSZ A;  1XCA A;  3OD9 A;  1SMP I;  1S2P A;  1ACD A;  1CBQ A;  1CBR A;  3IA8 A;  1FEM A;  4ORR A;  3ZW0 B;  1DZJ A;  1BBP A;  2G7B A;  3ZW1 B;  2LBA A;  4ZJ0 A;  4O9S A;  1TXL A;  2G79 A;  2W2F A;  2BT9 A;  4ORS A;  1CBI A;  4FBO A;  3GE2 A;  1XKI A;  1AEL A;  1NP1 A;  3UEU A;  1UZ2 X;  4TKJ A;  3APU A;  1ICN A;  1FDQ A;  4GE1 A;  1KXO A;  3QKG A;  5D47 A;  4UU2 A;  1BJ7 A;  2MHD A;  4NNS A;  1SXU A;  5EED A;  1ML7 A;  3TGA A;  1KT5 A;  3HK1 A;  3T1D A;  4KC8 A;  1FEL A;  1E00 A;  3VG4 A;  4WHI A;  1QAB E;  1CRB A;  1ADL A;  4U8U O;  4I3D A;  1ZRY A;  2WQ9 A;  5FQ6 E;  4D6B A;  4HFO A;  1YWC A;  3WXQ A;  2R56 A;  5BVS A;  4JGL A;  1QQS A;  1BSY A;  4ZHD A;  4OMX A;  4XMG A;  3PQS A;  4ARH A;  2RN4 A;  2L5P A;  4NNT A;  4A60 A;  2QO6 A;  1LFO A;  3ZW2 A;  4O3W A;  1KQX A;  5F6B A;  5LJC A;  3PQU A;  3PED A;  4Y0P A;  4U9C A;  1JYD A;  5BVQ A;  4N7D A;  3FEN A;  5K06 A;  1IFB A;  3BU9 A;  1HMS A;  4GZV A;  3D96 A;  5HTD A;  1GT3 A;  4I3C A;  5LJD A;  2GTL O;  4IAX A;  2GTL N;  2HLV A;  4O4X A;  3FW4 A;  5HCE C;  1KGL A;  3UEW A;  1ZNE A;  4YMY A;  3I0A A;  3B2K A;  4Y0Q A;  3PH5 A;  1E06 A;  1GT4 A;  4YKM A;  3WOV A;  1MUP A;  4ZGF A;  4O4U A;  4FBV A;  4YFR A;  4ZH6 A;  1QWD A;  1DC9 A;  3VU1 A;  3HWE A;  1TOW A;  3RKG A;  3WJF A;  4FBR A;  3JSQ A;  5KHP A;  2ANS A;  1AVG I;  1YWB A;  3WVM A;  3KQ0 A;  4YGZ A;  3KFF A;  3FMZ A;  4ON1 A;  3BLG A;  4O4O A;  4KT5 A;  2WSJ A;  1RLB E;  1R0U A;  4NYR A;  3BY0 A;  3FR4 A;  4U3Q A;  2XKL A;  4PSQ A;  5H9N A;  2ASN X;  1EII A;  2ZAG A;  3F8A A;  3MVF A;  5BVT A;  1BRQ A;  2JU8 A;  1T0V A;  2ZAI A;  4YCH A;  4EXZ A;  3BX7 A;  3UAQ A;  3AKM A;  2RA6 A;  1ICM A;  3APW A;  3ZQ3 A;  5HBS A;  3CBS A;  1E5P A;  2FS7 A;  3NQ9 A;  4QZT A;  3WJC A;  1B56 A;  2KTD A;  1GKA A;  3HWD A;  1QY0 A;  2O62 A;  1PEE A;  4IB7 A;  3BSZ E;  5H9A A;  5FQ8 E;  2ACP X;  1IFC A;  3WBG A;  2L68 A;  4LZU A;  1BM5 A;  4KCA A;  1YWA A;  1EUO A;  5IO7 A;  5AJB A;  3PPT A;  4CK4 A;  5F7G A;  2PY1 A;  4NYQ A;  1Y9T A;  4O3Z A;  4HPD A;  4I95 A;  3HTY A;  4KII A;  1CBS A;  1BSQ A;  3C78 X;  1VPR A;  2F09 A;  4OS8 A;  1EIO A;  4AZR A;  3TGC A;  1KZX A;  3B2L A;  3CMP A;  4DQ3 A;  1BEB A;  1X71 A;  1SY0 A;  2POA A;  5EEE A;  1EPA A;  1QY1 A;  3FA6 A;  4KC7 A;  1SY3 A;  2CZT A;  5B27 A;  1BRP A;  3KFH A;  1TOU A;  1BSO A;  3L4R A;  1GKA B;  1O8V A;  2BLG A;  2WUT A;  3P6H A;  4COT A;  1X89 A;  5AQ6 A;  3S60 A;  5HZ8 A;  1OPA A;  4U8U M;  1GX9 A;  3NR3 A;  1ERB A;  2OVA A;  1LNM A;  3P6D A;  1ALB A;  1ZNL A;  4Y0R A;  4INN A;  3ELZ A;  3D97 A;  2MO5 A;  1AQB A;  2K23 A;  3DTQ A;  3EMM A;  1ZNG A;  2EU7 X;  4XMH A;  1QFV A;  4ML7 B;  4IAB A;  5HZ5 A;  3APV A;  4QYN A;  3OE3 A;  3NQK A;  5HA1 A;  1PM1 X;  3P6E A;  2WEX A;  1SXX A;  4YDA A;  3V8U A;  2GTF X;  1N0S A;  1JJJ A;  1KT4 A;  4HPB A;  4HWM A;  1O1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...