1ZNVA

How a his-metal finger endonuclease cole7 binds and cleaves dna with a transition metal ion cofactor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structural analysis and metal-dependent stability and activity studies of the ColE7 endonuclease domain in complex with DNA/Zn2+ or inhibitor/Ni2+
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Hydrolase/protein binding
molecule keywords Colicin E7 immunity protein
total genus 29
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1znvA00
5EW5E 1ZNVA 1E0HA 3GJNA 2GZIA 2VLPA 1MZ8A 1AYIA 2GYKA 1CEIA 2GZFA 2GZGA 3GKLC 1UNKA 4QKOA 1GXHA 1UJZA 2VLNA 1IMQA 4F37A 2K0DX 2GZEA 2JBGA 2K5XA 1FR2A 1BXIA 3U43A 2NO8A 7CEIA 1EMVA 2ERHA 2JB0A 2VLQA 2VLOA 4UHPB 2WPTA 1GXGA 1IMPA 2JAZA 2GZJA
chains in the Genus database with same CATH superfamily
1VQKP 1EIAA 1AYIA 2KG9A 3CC7P 1YITP 3I56P 2GZGA 1KC8Q 1UNKA 2FVAA 4QKOA 2FVFA 2VLNA 2PNGA 3G71P 2LPKA 2MF4A 5F2KA 1M6EX 1VQ9P 3P05A 1ACPA 3GZMA 2CG5B 5KP7B 3I55P 1IMPA 3RG2A 1GPJA 3WBHA 3EJEA 2FQ0A 2JO0A 4PXHB 3CCQP 2JU1A 1YJ9P 2EHSA 2LIUA 2PENA 1NQ4A 4XRQA 2DGYA 2KGAA 2LIWA 1IUQA 2CGQA 4COPA 3CMAP 5KP6B 1K8AQ 5F2OA 1QRJA 1GXGA 1VQLP 5HGMA 4IZ6A 1W2BO 2GZIA 1YHQP 3G0VA 1VQ7P 3G6EP 2L9FA 1F80D 2KR5A 4F37A 5HGLA 2FADA 2K5XA 2DNWA 2LOLA 5HGOA 2PEJA 2JYGA 5BS2A 2GZJA 1L0IA 2K92A 5JPAA 2K0XA 3E2DA 2GYKA 4PWVB 1Q7YQ 2GZFA 5BS1A 1YJNP 4H2XC 2MY5A 1BAJA 3U43A 1A8OA 1A43A 1D1DA 1T8KA 3DTJA 1JJ2O 4BPHA 1EOQA 1VQOP 2L0QA 1GXHA 3CCMP 2AFDA 2M5RA 2CWOA 3M1MA 3LRYA 3CC4P 2JBGA 1VQMP 3CD6P 2JQ4A 3Q20A 2PEKA 1OR5A 2VLPA 4XFXA 3NTEA 2LMLA 1CEIA 2N5HA 3MGEA 4XROA 2XV6A 3OW2O 1IMQA 4PH0A 2LKIA 1AF8A 1BXIA 2QNWA 2M8LA 1K30A 2JAZA 2LTEA 2QA4P 2AFEA 1S72P 3G26A 2OTJP 3CMEP 1QVGO 1RNIA 2K94A 1YJWP 4XFYA 3HYBA 4U0AA 2KOSA 2KGCA 2LL8A 1HY8A 1M6NA 3B5IA 2GDXA 4BPGA 1KD1Q 3DS4A 1VHNA 4XFZA 5HGNA 1L0HA 2EIAA 2GDWA 2LF4A 4DG9A 1RO0A 3DS0A 7CEIA 4GR6A 2JB0A 2KODA 2FQ1A 2VLOA 4HKGA 3G1GA 5EW5E 2N98A 2MVVA 1MZ8A 1KLPA 1X3OA 3GKLC 2OTLP 4MRTC 4R0MA 1VQPP 2FAEA 1UJZA 2Z46A 2KWLA 2GZEA 2JYLA 1N8RQ 1EMVA 2MD9A 4WYMA 4H2YC 2K0YA 1M90Q 5F2NA 3CXCO 1E0HA 2N50A 3NY7B 2CQ8A 2KORA 2Z45A 2N6YA 3HZQA 2FACA 1VQ5P 2OARA 2QEXP 2XXMA 2KG8A 1FR2A 2KG6A 2P9XA 2EFJA 2CNRA 2M8PA 3CCUP 2PEMA 3GJNA 2BUOA 4U0EA 2FHSC 5KP8B 4U0BA 2PEIA 2K0DX 3CC2P 5HV8A 3G1IA 2VSQA 3CCRP 2WPTA 2ONTA 2KGDA 3CCVP 2N6ZA 1VQ6P 3DS5A 2BHVA 3EJBA 1K73Q 2MR7A 2KGEA 3VRLC 3H0DA 2JU2A 2FVEA 2XZ0D 2L22A 1Q81Q 3RG6C 4CA3A 2AVAA 4U0DA 2PEQA 2ROQA 4PH1A 3B4QA 2FQ2A 2PY8A 1VKUA 4NEOA 3CCJP 1DNYA 3CE7A 3CCLP 3LMOA 3DPHA 2X2BA 2KOPA 4H2WC 2EG5A 2AF8A 1RO2A 1M74A 4GR2A 5I4TG 2K93A 3GZLA 3DS3A 4COCA 2EHTA 5DCKA 1YI2P 2E1MA 3G29A 4IPYA 3G21A 3G28A 2L6EA 1Q86Q 3H47A 2MR8A 3H4EA 2NO8A 2VLQA 2KW2A 2N5IA 2Z44A 1ZNVA 2KOOA 1Q82Q 2XT1A 1NJIQ 2MVUA 1AUMA 2KOQA 1KQSO 3CPWO 4U0FA 1VQ4P 3EJDA 4M0IA 4BPFA 1M1KQ 2PEOA 2ERHA 4U0CA 3CCEP 1ZMBA 5CZDB 2JGPA 3DS1A 2XZ1C 1VQ8P 5EJDA 1Z6MA 2K2QA 4QNBA 1DV5A 2GDYA 1K9MQ 5HVCA 1E6JP 1QVFO 3G4SP 3CCSP 1HQBA 4UHPB 1VQNP 3DS2A 1YIJP 2L4BA 2M8NA
chains in the Genus database with same CATH topology
5EW5E 1ZNVA 1E0HA 3GJNA 2GZIA 2VLPA 1MZ8A 1AYIA 2GYKA 1CEIA 2GZFA 2GZGA 3GKLC 1UNKA 4QKOA 1GXHA 1UJZA 2VLNA 1IMQA 4F37A 2K0DX 2GZEA 2JBGA 2K5XA 1FR2A 1BXIA 3U43A 2NO8A 7CEIA 1EMVA 2ERHA 2JB0A 2VLQA 2VLOA 4UHPB 2WPTA 1GXGA 1IMPA 2JAZA 2GZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EW5 E;  1ZNV A;  1E0H A;  3GJN A;  2GZI A;  2VLP A;  1MZ8 A;  1AYI A;  2GYK A;  1CEI A;  2GZF A;  2GZG A;  3GKL C;  1UNK A;  4QKO A;  1GXH A;  1UJZ A;  2VLN A;  1IMQ A;  4F37 A;  2K0D X;  2GZE A;  2JBG A;  2K5X A;  1FR2 A;  1BXI A;  3U43 A;  2NO8 A;  7CEI A;  1EMV A;  2ERH A;  2JB0 A;  2VLQ A;  2VLO A;  4UHP B;  2WPT A;  1GXG A;  1IMP A;  2JAZ A;  2GZJ A; 
#chains in the Genus database with same CATH topology
 1VQK P;  1EIA A;  1AYI A;  2KG9 A;  3CC7 P;  1YIT P;  3I56 P;  2GZG A;  1KC8 Q;  1UNK A;  2FVA A;  4QKO A;  2FVF A;  2VLN A;  2PNG A;  3G71 P;  2LPK A;  2MF4 A;  5F2K A;  1M6E X;  1VQ9 P;  3P05 A;  1ACP A;  3GZM A;  2CG5 B;  5KP7 B;  3I55 P;  1IMP A;  3RG2 A;  1GPJ A;  3WBH A;  3EJE A;  2FQ0 A;  2JO0 A;  4PXH B;  3CCQ P;  2JU1 A;  1YJ9 P;  2EHS A;  2LIU A;  2PEN A;  1NQ4 A;  4XRQ A;  2DGY A;  2KGA A;  2LIW A;  1IUQ A;  2CGQ A;  4COP A;  3CMA P;  5KP6 B;  1K8A Q;  5F2O A;  1QRJ A;  1GXG A;  1VQL P;  5HGM A;  4IZ6 A;  1W2B O;  2GZI A;  1YHQ P;  3G0V A;  1VQ7 P;  3G6E P;  2L9F A;  1F80 D;  2KR5 A;  4F37 A;  5HGL A;  2FAD A;  2K5X A;  2DNW A;  2LOL A;  5HGO A;  2PEJ A;  2JYG A;  5BS2 A;  2GZJ A;  1L0I A;  2K92 A;  5JPA A;  2K0X A;  3E2D A;  2GYK A;  4PWV B;  1Q7Y Q;  2GZF A;  5BS1 A;  1YJN P;  4H2X C;  2MY5 A;  1BAJ A;  3U43 A;  1A8O A;  1A43 A;  1D1D A;  1T8K A;  3DTJ A;  1JJ2 O;  4BPH A;  1EOQ A;  1VQO P;  2L0Q A;  1GXH A;  3CCM P;  2AFD A;  2M5R A;  2CWO A;  3M1M A;  3LRY A;  3CC4 P;  2JBG A;  1VQM P;  3CD6 P;  2JQ4 A;  3Q20 A;  2PEK A;  1OR5 A;  2VLP A;  4XFX A;  3NTE A;  2LML A;  1CEI A;  2N5H A;  3MGE A;  4XRO A;  2XV6 A;  3OW2 O;  1IMQ A;  4PH0 A;  2LKI A;  1AF8 A;  1BXI A;  2QNW A;  2M8L A;  1K30 A;  2JAZ A;  2LTE A;  2QA4 P;  2AFE A;  1S72 P;  3G26 A;  2OTJ P;  3CME P;  1QVG O;  1RNI A;  2K94 A;  1YJW P;  4XFY A;  3HYB A;  4U0A A;  2KOS A;  2KGC A;  2LL8 A;  1HY8 A;  1M6N A;  3B5I A;  2GDX A;  4BPG A;  1KD1 Q;  3DS4 A;  1VHN A;  4XFZ A;  5HGN A;  1L0H A;  2EIA A;  2GDW A;  2LF4 A;  4DG9 A;  1RO0 A;  3DS0 A;  7CEI A;  4GR6 A;  2JB0 A;  2KOD A;  2FQ1 A;  2VLO A;  4HKG A;  3G1G A;  5EW5 E;  2N98 A;  2MVV A;  1MZ8 A;  1KLP A;  1X3O A;  3GKL C;  2OTL P;  4MRT C;  4R0M A;  1VQP P;  2FAE A;  1UJZ A;  2Z46 A;  2KWL A;  2GZE A;  2JYL A;  1N8R Q;  1EMV A;  2MD9 A;  4WYM A;  4H2Y C;  2K0Y A;  1M90 Q;  5F2N A;  3CXC O;  1E0H A;  2N50 A;  3NY7 B;  2CQ8 A;  2KOR A;  2Z45 A;  2N6Y A;  3HZQ A;  2FAC A;  1VQ5 P;  2OAR A;  2QEX P;  2XXM A;  2KG8 A;  1FR2 A;  2KG6 A;  2P9X A;  2EFJ A;  2CNR A;  2M8P A;  3CCU P;  2PEM A;  3GJN A;  2BUO A;  4U0E A;  2FHS C;  5KP8 B;  4U0B A;  2PEI A;  2K0D X;  3CC2 P;  5HV8 A;  3G1I A;  2VSQ A;  3CCR P;  2WPT A;  2ONT A;  2KGD A;  3CCV P;  2N6Z A;  1VQ6 P;  3DS5 A;  2BHV A;  3EJB A;  1K73 Q;  2MR7 A;  2KGE A;  3VRL C;  3H0D A;  2JU2 A;  2FVE A;  2XZ0 D;  2L22 A;  1Q81 Q;  3RG6 C;  4CA3 A;  2AVA A;  4U0D A;  2PEQ A;  2ROQ A;  4PH1 A;  3B4Q A;  2FQ2 A;  2PY8 A;  1VKU A;  4NEO A;  3CCJ P;  1DNY A;  3CE7 A;  3CCL P;  3LMO A;  3DPH A;  2X2B A;  2KOP A;  4H2W C;  2EG5 A;  2AF8 A;  1RO2 A;  1M74 A;  4GR2 A;  5I4T G;  2K93 A;  3GZL A;  3DS3 A;  4COC A;  2EHT A;  5DCK A;  1YI2 P;  2E1M A;  3G29 A;  4IPY A;  3G21 A;  3G28 A;  2L6E A;  1Q86 Q;  3H47 A;  2MR8 A;  3H4E A;  2NO8 A;  2VLQ A;  2KW2 A;  2N5I A;  2Z44 A;  1ZNV A;  2KOO A;  1Q82 Q;  2XT1 A;  1NJI Q;  2MVU A;  1AUM A;  2KOQ A;  1KQS O;  3CPW O;  4U0F A;  1VQ4 P;  3EJD A;  4M0I A;  4BPF A;  1M1K Q;  2PEO A;  2ERH A;  4U0C A;  3CCE P;  1ZMB A;  5CZD B;  2JGP A;  3DS1 A;  2XZ1 C;  1VQ8 P;  5EJD A;  1Z6M A;  2K2Q A;  4QNB A;  1DV5 A;  2GDY A;  1K9M Q;  5HVC A;  1E6J P;  1QVF O;  3G4S P;  3CCS P;  1HQB A;  4UHP B;  1VQN P;  3DS2 A;  1YIJ P;  2L4B A;  2M8N A; 
#chains in the Genus database with same CATH homology
 5EW5 E;  1ZNV A;  1E0H A;  3GJN A;  2GZI A;  2VLP A;  1MZ8 A;  1AYI A;  2GYK A;  1CEI A;  2GZF A;  2GZG A;  3GKL C;  1UNK A;  4QKO A;  1GXH A;  1UJZ A;  2VLN A;  1IMQ A;  4F37 A;  2K0D X;  2GZE A;  2JBG A;  2K5X A;  1FR2 A;  1BXI A;  3U43 A;  2NO8 A;  7CEI A;  1EMV A;  2ERH A;  2JB0 A;  2VLQ A;  2VLO A;  4UHP B;  2WPT A;  1GXG A;  1IMP A;  2JAZ A;  2GZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...