1ZNVA

How a his-metal finger endonuclease cole7 binds and cleaves dna with a transition metal ion cofactor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E7 immunity protein
publication title Crystal structural analysis and metal-dependent stability and activity studies of the ColE7 endonuclease domain in complex with DNA/Zn2+ or inhibitor/Ni2+
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Hydrolase/protein binding
total genus 29
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1znvA00
1IMQA 2VLQA 4UHPB 3GJNA 4QKOA 3U43A 1BXIA 2GZEA 1MZ8A 2NO8A 1GXGA 1EMVA 1ZNVA 2K0DX 1CEIA 1UNKA 2GZFA 3GKLC 2ERHA 1IMPA 1E0HA 1UJZA 2VLNA 2WPTA 2GZJA 1GXHA 2JBGA 5EW5E 2VLOA 2VLPA 2GZIA 2K5XA 2GZGA 1FR2A 2JAZA 7CEIA 2GYKA 4F37A 1AYIA 2JB0A
chains in the Genus database with same CATH superfamily
4GR6A 4MRTC 3GZLA 3U43A 2CGQA 5HGMA 1VQ6P 2PEJA 3G28A 1BAJA 1YHQP 1E6JP 2KGAA 2FVFA 3DS1A 2JAZA 2BHVA 5F2KA 1DNYA 2DNWA 2XXMA 2K93A 1K30A 2FQ0A 1K8AQ 3CCSP 2PENA 1VQ4P 3GKLC 2KORA 4BPHA 4U0DA 3G1GA 1GXHA 2XT1A 3DS5A 1RO2A 3CPWO 1JJ2O 3G21A 7CEIA 2JU1A 4DG9A 5KP7B 2DGYA 4U0FA 2JQ4A 2L6EA 2KODA 2PEQA 3MGEA 1N8RQ 2LF4A 4NEOA 2FADA 4WYMA 2PEKA 5HGOA 1RNIA 4PWVB 1M90Q 2MR7A 2FVAA 1M6EX 3H47A 1QVGO 2N5IA 5HGNA 3DTJA 3I55P 1YI2P 1Z6MA 5KP8B 3CMAP 3CE7A 1MZ8A 2L0QA 3DS2A 1D1DA 2EFJA 1Q86Q 5I4TG 2KW2A 1AF8A 2GDXA 1VKUA 3CCRP 2PEMA 2QA4P 3G29A 3CXCO 3G1IA 3CC7P 2AFEA 2KWLA 1ACPA 3G26A 5F2NA 1YJ9P 1ZNVA 5DCKA 2EHTA 1HY8A 2AVAA 2VSQA 2KOSA 2VLPA 3DS0A 1HQBA 3DS4A 2MY5A 2N50A 5HVCA 1NJIQ 4QNBA 3RG2A 1YITP 2NO8A 2MF4A 1CEIA 1UNKA 2K0YA 2PNGA 2FHSC 2VLOA 2JYGA 3CMEP 4XFYA 5KP6B 2KGDA 1F80D 2MD9A 1YIJP 1VQLP 3NY7B 2JB0A 1EOQA 5EJDA 1IMQA 2E1MA 2XZ1C 3G6EP 2CNRA 1GXGA 1EMVA 2GZFA 2QNWA 2X2BA 4XRQA 1X3OA 1E0HA 1UJZA 2N6ZA 2Z45A 3P05A 3CD6P 2JO0A 2QEXP 5HGLA 2LIWA 2OARA 2KGCA 2LKIA 3CCEP 1K73Q 3B4QA 2LMLA 3GJNA 4M0IA 2K2QA 4GR2A 2GDYA 1VQPP 2VLNA 3B5IA 1KC8Q 1RO0A 2N6YA 2OTJP 3WBHA 4R0MA 3CC2P 3CCQP 2ONTA 4F37A 3G0VA 1AYIA 4H2YC 1KQSO 2MR8A 2GZEA 2K94A 2FVEA 2K92A 2CG5B 1QVFO 4U0AA 4BPFA 2M8PA 3I56P 2L22A 4U0CA 3EJDA 3DS3A 2PEIA 1Q7YQ 3H0DA 4U0EA 4IZ6A 1YJWP 2FAEA 3LRYA 2OTLP 1K9MQ 1VHNA 2FQ1A 1IMPA 3Q20A 2JBGA 3HYBA 4PH1A 2LOLA 2KG8A 2GZGA 3H4EA 3CC4P 2L9FA 3EJEA 1GPJA 2N5HA 4PXHB 1DV5A 1KD1Q 2L4BA 3NTEA 2JU2A 2GZJA 5CZDB 2GZIA 2EIAA 2AFDA 1VQ5P 1VQKP 2K0XA 2M5RA 1M6NA 2K0DX 2ROQA 2CWOA 2FQ2A 3G71P 4XFZA 2KOQA 2K5XA 1L0IA 3G4SP 4PH0A 2XZ0D 1T8KA 2PEOA 5HV8A 1Q81Q 2Z44A 3LMOA 3DPHA 4H2WC 1VQ7P 1M74A 2WPTA 4XFXA 1L0HA 2LL8A 3OW2O 1VQNP 1Q82Q 3CCUP 4COCA 2BUOA 2FACA 2EG5A 5JPAA 2VLQA 4QKOA 3VRLC 1OR5A 4COPA 3CCJP 2ERHA 3HZQA 2PY8A 2GDWA 1NQ4A 1VQ9P 3GZMA 2AF8A 4CA3A 2LIUA 3EJBA 3E2DA 3RG6C 3M1MA 4IPYA 1S72P 2M8LA 2N98A 5BS2A 1IUQA 1VQOP 2M8NA 4HKGA 4U0BA 2JYLA 2CQ8A 1YJNP 2XV6A 1W2BO 2LTEA 1ZMBA 2JGPA 5EW5E 2KGEA 1A43A 2MVVA 4BPGA 4XROA 2KG6A 3CCVP 2GYKA 5F2OA 4UHPB 3CCMP 2LPKA 1BXIA 1AUMA 2KOOA 1KLPA 3CCLP 1VQ8P 2Z46A 1QRJA 2KR5A 2P9XA 2MVUA 2EHSA 5BS1A 2KG9A 1M1KQ 1VQMP 1A8OA 4H2XC 1FR2A 1EIAA 2KOPA
chains in the Genus database with same CATH topology
1IMQA 2VLQA 4UHPB 3GJNA 4QKOA 3U43A 1BXIA 2GZEA 1MZ8A 2NO8A 1GXGA 1EMVA 1ZNVA 2K0DX 1CEIA 1UNKA 2GZFA 3GKLC 2ERHA 1IMPA 1E0HA 1UJZA 2VLNA 2WPTA 2GZJA 1GXHA 2JBGA 5EW5E 2VLOA 2VLPA 2GZIA 2K5XA 2GZGA 1FR2A 2JAZA 7CEIA 2GYKA 4F37A 1AYIA 2JB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMQ A;  2VLQ A;  4UHP B;  3GJN A;  4QKO A;  3U43 A;  1BXI A;  2GZE A;  1MZ8 A;  2NO8 A;  1GXG A;  1EMV A;  1ZNV A;  2K0D X;  1CEI A;  1UNK A;  2GZF A;  3GKL C;  2ERH A;  1IMP A;  1E0H A;  1UJZ A;  2VLN A;  2WPT A;  2GZJ A;  1GXH A;  2JBG A;  5EW5 E;  2VLO A;  2VLP A;  2GZI A;  2K5X A;  2GZG A;  1FR2 A;  2JAZ A;  7CEI A;  2GYK A;  4F37 A;  1AYI A;  2JB0 A; 
#chains in the Genus database with same CATH topology
 4GR6 A;  4MRT C;  3GZL A;  3U43 A;  2CGQ A;  5HGM A;  1VQ6 P;  2PEJ A;  3G28 A;  1BAJ A;  1YHQ P;  1E6J P;  2KGA A;  2FVF A;  3DS1 A;  2JAZ A;  2BHV A;  5F2K A;  1DNY A;  2DNW A;  2XXM A;  2K93 A;  1K30 A;  2FQ0 A;  1K8A Q;  3CCS P;  2PEN A;  1VQ4 P;  3GKL C;  2KOR A;  4BPH A;  4U0D A;  3G1G A;  1GXH A;  2XT1 A;  3DS5 A;  1RO2 A;  3CPW O;  1JJ2 O;  3G21 A;  7CEI A;  2JU1 A;  4DG9 A;  5KP7 B;  2DGY A;  4U0F A;  2JQ4 A;  2L6E A;  2KOD A;  2PEQ A;  3MGE A;  1N8R Q;  2LF4 A;  4NEO A;  2FAD A;  4WYM A;  2PEK A;  5HGO A;  1RNI A;  4PWV B;  1M90 Q;  2MR7 A;  2FVA A;  1M6E X;  3H47 A;  1QVG O;  2N5I A;  5HGN A;  3DTJ A;  3I55 P;  1YI2 P;  1Z6M A;  5KP8 B;  3CMA P;  3CE7 A;  1MZ8 A;  2L0Q A;  3DS2 A;  1D1D A;  2EFJ A;  1Q86 Q;  5I4T G;  2KW2 A;  1AF8 A;  2GDX A;  1VKU A;  3CCR P;  2PEM A;  2QA4 P;  3G29 A;  3CXC O;  3G1I A;  3CC7 P;  2AFE A;  2KWL A;  1ACP A;  3G26 A;  5F2N A;  1YJ9 P;  1ZNV A;  5DCK A;  2EHT A;  1HY8 A;  2AVA A;  2VSQ A;  2KOS A;  2VLP A;  3DS0 A;  1HQB A;  3DS4 A;  2MY5 A;  2N50 A;  5HVC A;  1NJI Q;  4QNB A;  3RG2 A;  1YIT P;  2NO8 A;  2MF4 A;  1CEI A;  1UNK A;  2K0Y A;  2PNG A;  2FHS C;  2VLO A;  2JYG A;  3CME P;  4XFY A;  5KP6 B;  2KGD A;  1F80 D;  2MD9 A;  1YIJ P;  1VQL P;  3NY7 B;  2JB0 A;  1EOQ A;  5EJD A;  1IMQ A;  2E1M A;  2XZ1 C;  3G6E P;  2CNR A;  1GXG A;  1EMV A;  2GZF A;  2QNW A;  2X2B A;  4XRQ A;  1X3O A;  1E0H A;  1UJZ A;  2N6Z A;  2Z45 A;  3P05 A;  3CD6 P;  2JO0 A;  2QEX P;  5HGL A;  2LIW A;  2OAR A;  2KGC A;  2LKI A;  3CCE P;  1K73 Q;  3B4Q A;  2LML A;  3GJN A;  4M0I A;  2K2Q A;  4GR2 A;  2GDY A;  1VQP P;  2VLN A;  3B5I A;  1KC8 Q;  1RO0 A;  2N6Y A;  2OTJ P;  3WBH A;  4R0M A;  3CC2 P;  3CCQ P;  2ONT A;  4F37 A;  3G0V A;  1AYI A;  4H2Y C;  1KQS O;  2MR8 A;  2GZE A;  2K94 A;  2FVE A;  2K92 A;  2CG5 B;  1QVF O;  4U0A A;  4BPF A;  2M8P A;  3I56 P;  2L22 A;  4U0C A;  3EJD A;  3DS3 A;  2PEI A;  1Q7Y Q;  3H0D A;  4U0E A;  4IZ6 A;  1YJW P;  2FAE A;  3LRY A;  2OTL P;  1K9M Q;  1VHN A;  2FQ1 A;  1IMP A;  3Q20 A;  2JBG A;  3HYB A;  4PH1 A;  2LOL A;  2KG8 A;  2GZG A;  3H4E A;  3CC4 P;  2L9F A;  3EJE A;  1GPJ A;  2N5H A;  4PXH B;  1DV5 A;  1KD1 Q;  2L4B A;  3NTE A;  2JU2 A;  2GZJ A;  5CZD B;  2GZI A;  2EIA A;  2AFD A;  1VQ5 P;  1VQK P;  2K0X A;  2M5R A;  1M6N A;  2K0D X;  2ROQ A;  2CWO A;  2FQ2 A;  3G71 P;  4XFZ A;  2KOQ A;  2K5X A;  1L0I A;  3G4S P;  4PH0 A;  2XZ0 D;  1T8K A;  2PEO A;  5HV8 A;  1Q81 Q;  2Z44 A;  3LMO A;  3DPH A;  4H2W C;  1VQ7 P;  1M74 A;  2WPT A;  4XFX A;  1L0H A;  2LL8 A;  3OW2 O;  1VQN P;  1Q82 Q;  3CCU P;  4COC A;  2BUO A;  2FAC A;  2EG5 A;  5JPA A;  2VLQ A;  4QKO A;  3VRL C;  1OR5 A;  4COP A;  3CCJ P;  2ERH A;  3HZQ A;  2PY8 A;  2GDW A;  1NQ4 A;  1VQ9 P;  3GZM A;  2AF8 A;  4CA3 A;  2LIU A;  3EJB A;  3E2D A;  3RG6 C;  3M1M A;  4IPY A;  1S72 P;  2M8L A;  2N98 A;  5BS2 A;  1IUQ A;  1VQO P;  2M8N A;  4HKG A;  4U0B A;  2JYL A;  2CQ8 A;  1YJN P;  2XV6 A;  1W2B O;  2LTE A;  1ZMB A;  2JGP A;  5EW5 E;  2KGE A;  1A43 A;  2MVV A;  4BPG A;  4XRO A;  2KG6 A;  3CCV P;  2GYK A;  5F2O A;  4UHP B;  3CCM P;  2LPK A;  1BXI A;  1AUM A;  2KOO A;  1KLP A;  3CCL P;  1VQ8 P;  2Z46 A;  1QRJ A;  2KR5 A;  2P9X A;  2MVU A;  2EHS A;  5BS1 A;  2KG9 A;  1M1K Q;  1VQM P;  1A8O A;  4H2X C;  1FR2 A;  1EIA A;  2KOP A; 
#chains in the Genus database with same CATH homology
 1IMQ A;  2VLQ A;  4UHP B;  3GJN A;  4QKO A;  3U43 A;  1BXI A;  2GZE A;  1MZ8 A;  2NO8 A;  1GXG A;  1EMV A;  1ZNV A;  2K0D X;  1CEI A;  1UNK A;  2GZF A;  3GKL C;  2ERH A;  1IMP A;  1E0H A;  1UJZ A;  2VLN A;  2WPT A;  2GZJ A;  1GXH A;  2JBG A;  5EW5 E;  2VLO A;  2VLP A;  2GZI A;  2K5X A;  2GZG A;  1FR2 A;  2JAZ A;  7CEI A;  2GYK A;  4F37 A;  1AYI A;  2JB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...