1ZNZA

Crystal structure of the reduced form of mycobacterium tuberculosis guanylate kinase in complex with gdp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
183
structure length
183
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 59
structure length 183
sequence length 183
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znzA01
2JJ1A 1VIYA 5FBLB 3QG5A 3DMNA 3NEYA 1II0A 2FG5A 2XGJA 4FMDB 2DB3A 1OXSC 3BH6A 3QBTA 4KAXA 4XWAA 1U9IC 3VR6A 4C2TA 2LWIA 5HZHA 2F1IA 1Z8FA 3L82B 3EIQA 4Q7MB 4PHTA 2FE4A 5FUYA 4B6FA 5LD2C 1F2UB 1VECA 1E9CA 2C5LA 2NG1A 4LJ4A 4M1OA 3TR5A 1T5IA 4L9SA 3TW4A 2A3RA 3A1UA 2G3YA 5A4JA 2IW3A 1JNYA 3NEJA 1TMKA 1W5SA 1DAMA 2BC9A 3VHLB 3SNHA 1OFIA 3CRMA 4X8OA 2ZTSA 3BJIC 5UKDA 2UVQA 3CONA 3F8TA 2ZJ8A 2AFHE 521PA 3C8UA 1OKKD 4XD7D 1OH5A 5DN6A 4C2UA 3OFNA 3B1ZA 3N2EA 1II8B 1S9HA 4HUQB 1NN3A 2O52A 3EWAA 4NPHA 3HU1A 4M1TA 1OYYA 1G8PA 5FPKA 3HPRA 3MWKA 1MRSA 2C9YA 1Q1QA 3QJYA 1F60A 2I3BA 1IAQA 1WE2A 1IBRA 5DI9A 4EDHA 4WBSA 3V9PA 2Q9BA 1T6NA 3FB4A 3QVUA 1BOFA 3OHMA 2ZQ5A 4U02A 4URZR 2V6JA 2WHXA 2VA8A 2HYIC 2Q3FA 2ZPTX 3C15C 4PAMA 4D25A 4WAUA 2DWPA 2ZYUX 4V0OA 3U4QB 3TUIC 4ZDJA 4BEJA 5G3YA 1W47A 5IDVA 4B43A 1WDTA 4Q48A 1J2JA 4ARZB 1FMJA 2W2XA 4H1UA 4EPYA 4ZCMA 2P6RA 2DR3A 4HB4A 4UJ5A 4PSAA 1F6BA 3DO6A 1ZD1A 4Q01A 3AVXA 1A4RA 2C95A 1OFHA 4Q4HB 5KPJA 1Y3AA 721PA 1NLFA 2VHJA 2CL0X 2GESA 1C9KA 1VCNA 2ZI7A 3F0TA 1G4AE 1PV4A 1Q12A 3THXB 1CBUA 1DBSA 1WMSA 3C4JA 3G82C 4G0NA 2TMKA 4LX0A 1W48A 4MGZR 3FYHA 4TSFD 3TKLA 1TF2A 3ICQB 3N70A 3IIKA 1E9BA 3R9IA 4CVNA 4HI0E 3PUVA 3CF6R 5KUTA 2ZRPA 2QGNA 3BC1A 5FPYA 1SHKA 2Q3HA 1F2TA 4BFSA 5AUNB 1AQUA 3PG5A 4EJSA 1COWA 1JR3A 2YOFA 2XZOA 4TTPA 3TSOA 3ZGXA 2HEIA 2QRNA 2CDNA 1XJQA 4JKIA 2WWFA 4RZUA 3SU8A 4AY2A 2QM7A 3AUXA 1ELOA 3RRNA 2OESA 1OB5A 5DI3B 5FPSA 1DAHA 3CPJB 3SJBA 4UNQA 4OI0A 2ZYWX 4FIDA 2ZAOA 1OYWA 4XVQA 2GJ9A 2CNWA 4LYAA 4Q4AA 1NNEA 4DLYA 3L8YA 1IOZA 2WWXA 3Q5DA 2OZEA 4TYPA 4YONB 3GLGA 4IDPA 3ND8A 1Z83A 4R9UC 2YZ2A 3G0HA 4RD0A 4B75A 1HT1E 3ZVRA 4JLPA 3QPUA 4I1UA 4MRPA 1G7TA 1VDZA 2Z4SA 1J70A 5JEDA 4M8NE 2V7QD 4ZIRA 1V43A 3PV0A 4B6EA 2QORA 2ZRNA 5JRJA 3AKEA 5C4GB 3RANA 1GILA 4TMWA 2HF9A 4HZUB 2ZI5A 4ZKDA 4NKRA 4Q7JB 1GIAA 1TUIA 1B0UA 1O87A 2WWIA 2CE7A 2D74A 2VP5A 3TW8B 5FL7A 4KYIB 3Q7PA 3WBJA 1L8QA 5KPDA 4CDGA 5JS8A 2GNOA 4M1SA 2DPXA 1N6NA 1G7CA 4JLBA 4DB2A 2IS1A 2XX3A 4EPTA 2L0XA 5CLQA 4BASA 1RYHA 2BMFA 1UKVY 2AK3A 1ZM2A 3K0CC 3ZDQA 1T3LA 4Q00A 2LKDA 3GJ5A 4BZXA 2OV2A 3B78A 1G3MA 3Q7QA 4ACAA 1BKDR 2YWGA 3AGQA 1TF7A 1NLYA 2R62A 2G6BA 3ECCA 4HDCA 1IN6A 4ZDIA 4MH0R 3B9QA 2BM0A 3QY0A 2GHIA 3WMFA 3K70B 3GJXC 2ANBA 2UKDA 4DKXA 1KJZA 1CULC 2JLRA 5BN5A 1T9HA 1PLLA 2NOAA 1S96A 2BMDA 2GKSA 2GEUA 3DMDA 1KDTA 2GXUA 4N0DA 1TQDA 4K81B 4YXWD 1J8MF 1XD8A 1YU9A 1XJCA 3QUSA 3THWA 2OXRA 1S9DA 1IQPA 4TMTA 2PZEA 2O8CB 1KAGA 3ZD7A 4GT1A 3N2IA 4LY6A 4CIDA 2PEYA 5AJXA 4NH0A 1IN4A 5AJVB 5GJCA 2ZSEA 2MSCB 2WICA 3CH4B 3UKDA 3L8ZA 1YZKA 2WV9A 4KLZA 3UANA 1LF5A 1EG7A 3ADKA 2IYLD 3LLMA 2ZREA 3RS2A 4DUGD 1NVWQ 1WXQA 1XEFA 5TB5A 3B8HA 4JSYA 5FTJA 5E7JA 1JAIA 1TX4B 4PPQA 2R9VA 4XVRA 1E0SA 3ADBA 2FF7A 3FVQA 2GWHA 1FOEB 2EFGA 2ERXA 4HLUC 3K09C 2WMOB 1JR3E 1NLZA 2BDTA 4PHHA 1KI1A 4PC3A 5LB4A 1E79A 1E6CA 1E9SA 1P3JA 1RIFA 2QE7D 4IFEA 3MGCA 2Z0MA 3KXLA 4ASUA 1KYIA 4BLTA 4BQSA 3A37A 1W4RA 4NCIA 4AWXA 4WW0A 3DDCA 3FKQA 4OI2A 4RD2A 3VNVA 4Q21A 2B21A 2BKEA 2JLVA 3KKQA 2JDIA 1ONBA 2GILA 1DAIA 3VAAA 4BWYA 2O8FB 1TEXA 3TQFA 2D2EA 3EXAA 4N1AA 4EUNA 1W0JA 1SGWA 4QJ4A 1XPOA 1F5NA 1ZU4A 1UJ2A 2Q3MA 2QMUA 3Q3JB 2WPDD 4DSOA 3EX7C 5E3HA 4D0LB 1KJYA 1W49A 2DFTA 3RLFA 4TWZA 4WA7A 2JLYA 2RGBA 4AK9A 1G19A 1TNDA 2RKOA 5EJEA 3EW9A 4IXMA 4QL3A 4DC9A 4JMPA 1Z6YA 4PSVA 3T5DA 1U8YA 3PIRA 1GG2A 2FJUA 4HSEA 5KOYA 1RJ9B 4V0KA 4D4KA 3T1TA 1P2VA 1QF9A 1WRBA 2AXNA 2VP0A 2JATA 4WZ6A 2B92A 1G8GA 3SBDA 2DBYA 4OHXA 1II9A 4ZDKA 3QI2A 3LBHA 3K0AB 3KKPA 2YNMA 4Q4JB 1MO4A 2OFXA 2CHGA 4E22A 5HKKA 2Z83A 1G18A 1XZPA 2D06A 3EZ9A 2RGGA 5J5CA 2KBFA 1ZCAA 2R8RA 4LPSA 3VMFA 2RAPA 2KWIA 3QKTA 4ERNA 3KQLA 3GMTA 2ZSFA 1MABB 2QQ0A 4MRNA 4OQLA 4GI7A 1E9DA 1Z0DA 1Z6GA 2ZYVX 4CEHB 1MT0A 2OFOA 3W5IA 4DDVA 4URUR 2CEAA 3EPHA 1R8QA 4EJSC 2QAGB 2HCBA 2F3RA 4LOAA 4XH9B 1J7KA 3NHAA 1SQ5A 4JLMA 1EXMA 4PO1A 3HJNA 3CKLA 4I81A 2G9NA 3NBXX 3RAPR 3U3MA 2QROA 4DDTA 1EFUA 1M2OB 1RC8A 4QBIA 2ZIAA 1CEEA 4DIDA 2DY1A 3A36A 1Z6TA 1SXJE 1XX6A 4GSYA 4A2PA 1ZNYA 4X8HA 5DO9A 2REXB 4FMDF 1BIFA 2ZJ5A 5BN3A 1NVVR 1W0JD 1BYUA 3U7HB 2FPLA 2R6AA 4NBSA 4O0MA 5DE3A 1JPJA 3I4LA 2MSEB 5FOXA 4P4UA 2C04A 3DL0A 2IS4A 1ESNA 2OXCA 5BXQC 1E2HA 3IQWA 3V00A 1GOTA 4ACBA 4BFTA 2NZ8A 4ZI2A 5D3MB 3KKOA 2IEYA 4GRAA 4RVCA 4URVR 5F9HA 2ZUDA 2A5JA 2H17A 3PEUA 5ELXA 3K9LA 1XFAA 3R7WA 3KQUA 1OXXK 4A8JA 2VBCA 4LJ8A 3FKSD 2ZRMA 1QHHB 3LQRA 3VQTA 3OEHD 1WB9A 1OB2A 2MMCA 2ZRBA 3UG6A 1IXSB 4DWJA 5FUWA 4PO9A 1ESMA 2R6CA 4ZI3A 2O8BB 4IOLA 3B7GA 1E98A 4Q4JA 3CNNA 2P5SA 1KO1A 1OFTA 3ZH9B 1EGAA 1H8HD 2J7KA 3FDIA 1TQ4A 1M6NA 3IIMA 3TH5A 3MCAA 3PFIA 2WJJA 3LD9A 3MSXA 3ZQ6A 2AK2A 5EE0A 4RFVA 1JR6A 1MABA 4UQOA 3AV0B 3QXHA 3RS7A 1DELA 5BN4A 4RCZA 3GQBA 4EQ6B 1N0VC 1HE1C 4BFYA 3IEUA 5DISB 2RGEA 2AX4A 3RABA 4MYUA 1U0JA 1FQJA 2ZU0C 3EZ2A 2VTKA 2BBSA 2QAGA 1G16A 4LBWA 2GA8A 1KI2A 4F4JA 1DTSA 2IT1A 4B2PA 4DXAA 1FX0B 2I1QA 4LC1A 3SEAA 1FUUA 1X6VA 3BFXA 3SZRA 1J8YF 5IHPA 3TUZC 3CO5A 2PLRA 3CZPA 4Z51A 4Z8XA 1JBKA 4A82A 3RS4A 2V7QA 3H2YA 1Z29A 2EFCB 1YZUA 5JRZA 3FTQA 2RCNA 2E1RA 3THOA 1NIJA 1CR4A 3T34A 1G8HA 2REOA 3UXMA 4JLNA 1NBMD 1ZVQA 2EWWA 2WOOA 3S1AB 1UPTA 2WMNB 4OHVA 3AVTA 1RPZA 1P75A 4EKDA 4A0RA 4HUQA 3AP3A 3AM1A 1GRQA 3QIAA 1KDPA 3PEYA 3CRW1 3I8SA 2ZS9A 4ZCLA 1XWIA 1SHZA 2J9RA 4J0QA 4B32A 4LSGA 4KSBA 4TMZA 3U5ZB 1E1RA 5D3MA 1P9WA 2WBLC 4M1WA 5HZKA 4M9SA 2RH5A 4LJ5A 3JZMA 3PUWA 621PA 5HR5A 4MITA 1G8FA 1ZD9A 4KO8A 2FZLA 2GCPA 3M6AA 1XTIA 4NYJR 2O8DA 2GRJA 3QNUA 4NCHA 4A8JB 4CT5A 4YQFA 3TSZA 3ADDA 1N2CE 1T0HB 1GWNA 3RVBA 1SKYE 1BO6A 3ZZ0A 1US8A 4IDQA 1XDBA 4AYTA 3QXSA 1R0WA 2P6UA 4II7A 1P2SA 2BEJA 5A0FA 4Y0AA 1NRJB 1CP2A 2Q9CA 3OEHA 5C46F 2ZI4A 1ZINA 1OPXA 1P9NA 2BCJQ 1E2KA 4US0R 4DLUA 3GFOA 3A4NA 4Q4HA 3B60A 5DGXA 3WMEA 1NVXQ 3KXIA 4DSUA 1KMQA 4WXRA 4ZO4A 4BRUA 3LRPA 3HU2A 2W83A 3K09A 2WJHA 1FTSA 5KSZA 5FI0B 3MWYW 3CWQA 4PHFA 2ZUBA 3NTUA 3GP8A 3OZXA 3D7MA 4GDFA 1JPNA 4BRWA 2X19A 3OE7D 4KI0A 3VR1A 1MO3A 1GVNB 1OV4A 2ZR0A 1R10A 3AQ4A 1LF0A 2YC2C 3HYRA 1LS1A 4B71A 3GLIB 2LCFA 4MDEA 1CIPA 3AF3A 1QHYA 4TL8A 2CE2X 3OEEA 4PZYA 3GLFE 2D3WA 4JZKA 2RHMA 3RNLA 2PEZA 2VP2A 2YYZA 3QENA 2PMKA 2WKQA 3LWNA 2JDID 3O8BA 3N5CA 1UBEA 2FFAA 4JBYA 2GK6A 2OO7A 3CR8A 2NO1A 4CYMA 3L2OB 4B48A 1GDDA 1RRGA 4IHQA 3MWLA 4Q47A 3EPJA 1G9XA 3NC0C 4PPFA 2W0MA 3AVUA 2GTPA 3B2EA 5AJYA 2BVNA 3ZZUA 2IYXA 1Q57A 3OEED 1AN0A 2F43B 2H7VA 1UBGA 2VEDA 2WOJA 4OK5A 2AR7A 3R20A 3CF0A 2GCOB 1G6HA 2Z5FA 1RFLA 1ZM7A 1XEWY 2YKGA 1XD2A 3MUFA 1YR6A 3RRZA 4U00A 1KO7A 4F7WA 5CIQA 5EE3A 1E3MA 1IONA 1QHIA 1H8HA 3EC1A 4UJ3A 5FOSA 3GJ8A 5DN6D 3SE0A 1D9XA 3WNDA 5C18A 2BBWA 1JECA 3OIVA 4A2WA 1U8ZA 2QTHA 5KHOC 4L5BA 2ODNA 1HV8A 1CLUA 3W3ZB 3SQXA 5FBQB 1EFHA 1N6LA 3GLGE 1KJWA 3FGNA 4KVGA 1VIAA 3AVQA 3H4MA 5F9FA 4MRRA 5AK0A 5JWOA 1NF3A 4Z1MD 2C2HA 2XSZA 2F6RA 2YJTD 2G77B 4Q1BA 3IQXA 2WIBA 3MG9A 3SFVA 3VR3A 1R4AA 1D9ZA 2VQSA 3GLFA 1HEIA 3AVOA 1PUIA 1ZUIA 4G5SA 4ZPXA 2GZHA 5K8UA 1AK2A 1G8YA 5KSPA 4QM7A 1N5LA 5FTLA 3WHLA 5TARA 1RW4A 2EFDB 2WAYA 1JB1A 2D62A 4GOXA 3EAQA 4TTRA 3H1TA 4PANA 4UXIA 1IY1A 3LW7A 4C9BA 3NKVA 2QP3A 2VF8A 1D5CA 2IHBA 4DT1B 2WSSA 4HATA 2DCUA 2PLFA 2BBOA 5JHHB 3VFDA 1LNZA 2GVZC 3QF4B 4DLZA 4ESVA 3B82A 3THWB 4MRSA 2QTVB 4I99A 1VYUA 3IDQA 4M53A 2HT6A 3KFVA 3HPQA 4XD7A 2B6HA 2WAXA 4TL6A 5DYGA 5C4MA 3K70D 2F55A 4I1SA 3D8BA 4MUBA 2AKAB 2O5VA 1P7CA 3WMGA 4EPXA 5E95A 4FI3C 1EFRA 2F43A 2JJ1D 2XJ4A 2B8WA 5EZ5A 3PUZA 2A78A 1P61B 5JI2E 3QKSA 3TAHA 3NDBB 1CR1A 3R8CA 2FWRA 2JLUA 4P31A 5H70A 1DAFA 1ODFA 1N6OA 3CF2A 3VU9B 1DS6A 3AVWA 5JFGA 1HH4A 1KK0A 4IDOA 3JZAA 3U7FB 4PPGA 3PJRA 1KNQA 3QEJA 4OHZA 3W6PA 821PA 1OIWA 3SHWA 2O8EB 2E87A 4D0GA 1L7VC 3K0EA 4QXAA 3SDZA 2B8TA 4BLQA 2C98A 4MYTA 1K5GA 2QP9X 2RHDA 4OQXA 5FUXA 2EFHB 4B3CA 4OI4A 4LJAA 3ADCA 3E2IA 4BLPA 2PT5A 4Q7LA 1G17A 3ZLJA 3UWOA 1TF5A 1I4TD 4CRWB 1YZLA 2C8VA 1TADA 1G4UR 2ZJAA 4FWIB 5D3QA 3PR1A 1NY6A 3AVVA 3K0FA 5B30A 2OCAA 3PVSA 2JLWA 1XMSA 4FMBB 4AG6A 3SYLA 5JJKA 1GZSA 4DLVA 5KSOA 1KIMA 1E2DA 1SKYB 2B7CA 2J5XA 3A8TA 4ZDWA 4RZ2A 1G3IA 5JSZB 5FR1A 4QBGB 2AXPA 2RGAA 3QBVA 3PCRB 1Z06A 3VR5A 3ZS9A 4RFSB 1EFTA 4MGIR 2VYFA 2WWWA 2JEOA 3TR0A 2IC5A 4EPRA 5GJVC 2ZRKA 1T91A 1UKZA 2J0UA 1II8A 3FWYA 5KSYA 2BKUA 4OYHA 2FPMA 4DCUA 2BMJA 1AKYA 4CEIA 5CDFA 1N6KA 1NBMA 3AB3A 3NH9A 1KMHA 2NPFA 3PUYA 4TMVA 3P32A 4QHTA 1KKMA 3DEFA 2X77A 1AIPA 4CEHA 1E9AA 5HE8A 3W6OA 4JLAA 2NZJA 3VR4A 4URWR 3IBGA 4JT4A 1U8AA 2JA1A 3T5GA 1XF9A 3CRQA 2FDCA 3WP0A 2WJYA 1FZQA 1KY3A 1YE8A 4XSGA 8OHMA 3NBFA 4LYJA 2HLDD 1GAJA 2GJ8A 4JS0A 3CPEA 3TJZA 4JL8A 1T4GA 2NO6A 5FUVA 4DLSA 2HDNB 1G291 1A5TA 1G20E 1ZM3A 2XB2A 3WP1B 4IOJA 4E07A 2CMKA 1EESA 2NTYC 4LPKA 4D81A 4C30A 2QM8A 1UKEA 2N42A 2VP9A 4W7SA 2FH5B 2WJIA 2Z4RA 2JLSA 2ODBA 1E2PA 2XZPA 5H68A 5B58C 4B47A 3HP1A 5LBIA 5BQ5A 4R98A 4NYIQ 3RDPA 5BYKA 1TTTA 1OXUA 4JLDA 4DHEA 2ZJBA 4YMWA 2GXSA 4QGGA 1SXJA 1YKSA 2ZRAA 3WNCA 2XNSA 4FCVA 5HCNA 3P4YA 1VPLA 2OCPA 2PL3A 4M2LA 2I1VB 3NDPA 1VHLA 3VR2A 4DZZA 1XTSA 4M9XA 3E5HA 4EAQA 2V1UA 1F2TB 1E2GA 2PX0A 3A1WA 2EFEB 5KU1A 3NH6A 4C0BA 1E1QA 4RFSA 1XRJA 2DYKA 1UADA 4B73A 5FOVA 1UAAA 1UDXA 5J47A 2ATVA 3SJZA 4PHGA 2J46A 3Q5EA 4MKGA 4ILEA 4AI6A 1ZU5A 3A4LA 2HXSA 4OJKA 3MWJA 3M0EA 2YV5A 5FOUA 2HXYA 3VTKA 4D82A 1KKLA 4CEIB 4D2IA 5FBRB 4OI1A 4BFXA 3BBPA 2N1BA 1KY2A 3B6EA 3IO5A 4Q18A 1FL9A 4MUAA 3I61A 5F3WB 4QNRA 4UNPA 3QKRB 2AWNA 3K8YA 1P62B 4ZIRB 3SHFA 3X1ZA 1K5DA 1M7GA 3K9HA 1BH2A 1FX0A 2AHOA 2VIIA 1KSGA 1AZSC 2DHRA 2O0JA 2GF0A 1IJEA 1SVKA 2J1LA 2JIZA 2KI5A 2PCLA 3AF0A 3FMIA 1NVUQ 4P4SB 3LNCA 4PAOA 1AJEA 1E96A 2J0VA 1KDOA 3SN6A 2IHYA 2A5FA 3BOSA 3U2QA 5CB6A 4X8MA 4LDJA 1KAOA 2BMEA 3GFPA 1FPMA 1NSFA 5EZ6B 1YR8A 1G1MA 2J7PA 1NVVQ 4KXFB 1U94A 3KDSE 1OH7A 1QHGA 1NBME 3TAUA 2QMEA 3L0PA 2OT3B 3LFUA 4U7DA 3OIYA 4HLCA 5L3RA 5IK2D 2ZAMA 4KHZA 2QAJA 5L3SA 4C4PA 2HT1A 2GBLA 4IEIA 1TQ6A 1D6JA 4TLAA 1MRNA 1UM8A 4D4MA 1CJKC 1G5PA 5TDHA 5FOTA 1RZ3A 5GVRA 4D80A 3T61A 1Z0JA 1ZYUA 3NWJA 1Q44A 2PZGA 1YVDA 2J59A 1SVIA 2W6JA 3EIEA 4P4TA 4QFMA 3RYTC 2D4HA 1ZMXA 1DG1G 2HCJB 2JLQA 5IK2A 4U5XA 4XVUA 1O3YA 4LC0A 4TZ6A 4B74A 1T8TA 3W6NA 1JR3D 1COWD 2BEKA 1NG1A 1GL9B 3FFBA 2FGKA 4Q1CA 1S0UA 4C0SA 4QGHA 1X1SA 3WNBA 4AKIA 2H8KA 2WSSD 5LB2A 2FFHA 1AGPA 4JVLA 4HLQB 4QGAA 4QHYA 2JJ2D 2F1JA 5DSZA 4PFSA 2KB0A 5AR1A 4C0KA 3EARA 3KKMA 5L3QA 4TYNA 3EC2A 4EFLA 3THXA 4GMDA 1HQYE 1FTNA 2FX3A 3QKRA 1W4AA 2ORWA 2J0QA 4Q5IA 1R7RA 1XEXB 1GNPA 1XNJA 2Q6TA 2HUPA 2XSZD 1IY2A 4WXPA 2GDJA 4PXAA 5FBWB 5KYKA 3ZIAD 4P4SA 3IPXA 3TNFA 1LY1A 1IJFA 1KK3A 1OW3B 2ASEA 2O0KA 3DPUA 1U0HC 3IIJA 3MFYA 2A30A 3U3KA 2NO0A 1T3HA 3KQNA 2ONJA 2F7SA 3LXRA 2JIZD 1NN0A 2IXEA 3CRRA 1GTVA 2FFQA 2WWYA 2R2AA 1VMAA 1XMVA 1OF1A 2P2LA 5B2ZA 3WY9A 4X8LA 3GLGB 5B57C 1XB2A 3KTAA 2Z6VA 4LWZA 1E0JA 2CCJA 2YINC 2ODEA 4C0JA 4A0FA 3MJRA 3U3RA 3HYTA 4GNKA 1W1WA 2VHQA 2VHTA 2XTZA 4BFVA 2GCOA 3LXXA 4L16A 2ZI3A 2FA9A 4F38A 1Z2AA 1CKEA 1G41A 3UPUA 3FKSA 4D0NA 4NE2A 4V0ME 4HAWA 1U90A 421PA 3E1SA 1JQLB 4KFUA 1ZIOA 1VCOA 3BAFA 1UEIA 4Q9LA 3K0SA 1YR7A 2IYUA 1U0LA 1Z63A 4M22A 3CBQA 1KGDA 3LBNA 3P27A 3A1VA 4LJ9A 4M1YA 5EXXA 3VHXA 4YMVA 1LV7A 3UWKA 3I5YA 3ASYA 3ZQJA 3W9YA 5L8VA 3KZ1E 3GLFB 2FMXA 1AS2A 1SVOA 1OT3A 3C14C 1RRFA 3KB2A 3I5XA 4FWTA 2NGRA 1F3OA 1T3SA 4GOJA 3UIEA 4W5HA 4IRUB 2QI9C 5FL7D 5TXGA 2X2EA 5K8IA 1BS1A 2ZRJA 1XEXA 3KUDA 1E2NA 1K6MA 5F98A 2D7DA 1E94E 2DFNA 1G21E 4CT4B 3ZD6A 1GFIA 2C03A 1LS6A 3W8RA 4CEJB 4IVQA 3TGPA 1FP7A 2ZI9A 1Z0AA 3A1TA 4PAQA 4ASUD 1P2TA 2ZU6A 2ZR9A 5JS7A 3U60B 5AJWA 2GBLC 3QF4A 3SJAA 3EPLA 3IHWA 2OSBA 3VKWA 5JWRA 2QGZA 3OF5A 2G88A 4M9ZA 4G5QA 1KZ7B 2HJGA 3UMRA 1MV5A 3LBIA 1CXZA 2ECKA 2IYSA 1N0WA 5EXPA 3HDTA 1E2JA 1NKSA 4KFTA 4KU4A 1E2MA 1OXTA 4DRZA 3L0IB 3GJ0A 4G01B 4R71A 1EWRA 3GLIE 3BXZA 2OBMA 3NXSA 3GJ3A 5DHAA 2I4IA 1QZXA 5FBVB 3B1WA 2A5YB 2OBLA 5FL3A 2IS6A 2QQEA 3QKSB 3SOPA 4Z1MA 1JEDA 1ZUHA 3FMFA 3DM5A 1HT2E 4OK3A 1ZC4A 3I72A 2IX3A 2V9PA 1QHHA 1Q1ZA 1OSNA 4JSTA 1SKQA 1WP9A 2MMGA 2IA5A 4TN1A 3QXCA 1E4VA 2C9OA 5DH9A 1WQ1R 2YWEA 3K9GA 3I32A 4V0LA 1JAHA 4B2IA 5JCPA 1WA5A 1IN7A 2C78A 3KL4A 4A36A 4RZ3A 4GL2A 4HZIA 2H18A 3CX6A 3HR8A 3IPYA 3K1JA 3O47A 3ZIAA 4B2LA 2CLSA 3PUXA 1GKIA 2AD5A 1DARA 3ONWA 2QBYB 5C1BA 4DVGA 2O0HA 4F91B 1SZPA 1CF4A 3GLHE 3RSLA 3B9PA 1KO8A 2VHUA 4EQ6A 2QY9A 4TL7A 1ZNZA 1XZQA 2ATXA 3DKPA 4JLKA 2EU8A 4B76A 2XXAB 1NL3A 1T5LA 1R6BX 1FMLA 2ZROA 1EK0A 4QC2A 2G83A 3FFAA 3X1XA 4IDHA 2HLDA 1ZUNB 2BBTA 1G64A 4FCTA 5CK5A 4YDHB 4NU0A 1R5BA 3IUYA 4CEJA 3T1OA 3NIBA 3DHWC 3IO3A 3KJGA 1S3GA 4QM6A 2Q0HA 1CJTC 5JSZA 1SXJC 4QHSA 4S35A 2C9CA 4HUTA 3G5UA 1NMZA 3I3SR 1LFDB 1Q20A 4OJQA 1MO6A 2J45A 4AYWA 4S2EA 2V54A 5FTMA 5HPYB 1R0ZA 1WBDA 2WPDA 4O25A 3S1AA 4DLTA 4B3BA 2PT7A 4PR0A 2Y8EA 3KJIA 4G5OA 2XNDA 1KI4A 3IEVA 1W2GA 2VO1A 4TT3D 4Q9HA 4NCNA 4BLSA 2NO7A 4RJLA 1MKYA 3T12A 4MKHA 4TSFA 5AJZA 4FXPA 5JLJA 5EUMA 1KK2A 4RY2A 3NBZC 3MAAC 1KI3A 4B3XA 2X2FA 4MYCA 2IS2A 3RWMB 2WKPA 3FMPB 3M4YA 3T35A 1DAGA 3TE6A 4BZPA 2P67A 1KI6B 3GLHA 1DO0A 4DDWA 5KDDA 5HKKD 1CTQA 2V4ZA 1S4QA 5J4KA 2BOVA 3KQHA 5AUPB 4P32A 4MQBA 1OFUX 4PQFA 5EP1A 2XITA 5KDOA 3NHBA 3WYFA 1UDWA 1US8B 4URYR 3O8RA 1YZQA 5AUOB 1B23P 3GEHA 1EX6A 2IF2A 4Q66C 2P5TB 2ZE5A 1E2FA 3EG5A 2P0EA 3FOZA 4IOKA 2XB4A 4NONA 4UXHA 4D6PA 2QBYA 3L0OA 3H86A 4P3YA 4XSHA 1XJ0A 2VP4A 3ICEA 3UMSA 1NMYA 3QPWA 1Q1BA 1E2QA 4FW9A 4JL5A 2CVHA 2PMDA 3CX7A 3OAAA 2XXAA 4Y0VA 4AKGA 3CLVA 1RYFA 4I1VA 2JJ2A 1H8ED 4KLNA 5DHFA 1GRNA 1F2UA 2RGNC 3EA5A 4DSNA 1J90A 4JLVA 2FOLA 4F93B 1ZW6A 2JASA 4HDQB 1S8FA 5HE9A 1KO4A 2NIPA 1E9EA 2CHQA 1ZP6A 3FHTA 4DBLC 4OKSA 2XZLA 2ONKA 1MH1A 2FSGA 1M7HA 1DG3A 4A1FA 1D2NA 4RD6A 1KTVA 2X8AA 3TMKA 4F4IA 2QENA 1IM2A 2BJVA 1ZM9A 3V4RA 2IYRA 4FMCB 4Q1FA 1Z47A 4TT3A 1CRPA 2R6FA 5FH9A 4HAZA 3IBYA 1G6OA 4CZ2A 2VLIA 5LDDC 1IXRC 4KBGA 3C5CA 3CNLA 3DZ8A 1XCPA 2ZRGA 4JBWA 4Q4LA 3BERA 2D7CA 3LX8A 4AG5A 3FPAA 2FZ4A 1VCIA 4BE7B 2GAAA 2FNAA 4LI0A 2AKYA 5JECA 3LVQE 1SVWA 4JLOA 2RB4A 2NQ2C 3SR0A 3RHFA 2ZVPX 1OE0A 2QN6A 2WKRA 2J0SA 3TUJC 1E9FA 1DADA 2G0TA 1Z28A 4OBEA 4DCSA 5JZVA 4D26A 4IOMA 5E4FA 4RCYA 1GNQA 2MSDB 2IF0A 3VX4A 121PA 5GJBA 2QP4A 3Q72A 1LTQA 2RGCA 3AF4A 1N6RA 2RMKA 3TIFA 1BYIA 3KFXA 4ARZA 4DCVA 4DB4A 4LYFA 4JT2A 3ND9A 1TU4A 4A0HA 2RGDA 4Q1DA 5AWFC 1MOZA 3P26A 1A2KC 4TLBA 3CH5A 4TLCA 4QJ3A 1MO5A 4URXR 5H8WA 1E1QD 1NI3A 5G40A 4PC7A 3WYAA 1J99A 2V55B 5L3SB 4NYIR 3PITA 3QSYA 1GUAA 1E2EA 2C99A 2OFWA 1NY5A 2ZJOA 1OH8A 5GADl 2IUSA 2R65A 2ZRFA 2IUUA 2O8DB 4AKHA 4LHVA 4XWOA 1X1RA 3CZQA 4DLRA 3ETLA 1ZD8A 2UZ3A 4GP7A 3QXJA 4CGZA 3D3QA 3I8XA 3AGPA 4LCBA 4DT1A 4EJSB 2PJRA 3D6TB 3MMPA 4AYXA 1RE0A 1XP8A 2A5GA 2K5UA 4PO8A 5EXSA 1OLOA 4WOPA 4NL4H 2PX3A 3R9XA 2ZE7A 4V03A 4OQFA 1AZTA 3RWOA 5JI3E 3VNUA 2DFKB 1XTKA 1SXJD 4BUJA 1XCGB 2REBA 1N5IA 5CB8A 1XXHB 2IL1A 1EFCA 4KVAA 4KFSA 4HAXA 3SC3A 1OKKA 1R8SA 1VG8A 3VKHA 3TLXA 4XTCS 3C5HA 5DNYB 3QQ5A 3RC3A 2OHFA 2A9KA 3B1VA 4GPTA 1R5OA 2W6IA 3TVTA 1W4BA 1XEWX 2P6NA 3HU3A 4NYMR 4LBZA 4YMSA 4M4SA 1AS3A 2EYQA 2ZJZA 3CM0A 3F5FA 3HWSA 4B44A 2WVJA 2AN9A 2GAOA 1NMXA 1VHTA 2IYWA 4JVNA 2KE5A 5HTKA 1HURA 2GF9A 4WZAE 2CJWB 4HLUA 2CNWD 2FEOA 2FV8A 3P1JA 3Q8XB 2EW1A 1CJMA 1L2TA 1H8EA 4LV6A 2G1JA 2GCNA 1JEEA 3T1QA 1U9IA 5EE9A 5JBQA 2IWHA 3EZ7A 4HDOB 5LD2B 5EQTA 1E4YA 5JEEA 4IVRA 3LY5A 3DVLA 5J4VA 1EFRD 4OL0A 3KJHA 1W4CA 4IFBA 1A7JA 3SI7A 3WBKA 1QHSA 1FNNA 2ZS7A 1W0KA 3U7GA 2DWQA 3ZS8A 1AA9A 1UKYA 4JIMA 2QUZA 1TU3A 4EPWA 1TL7C 3U4QA 3FHOA 2IXGA 2V1XA 4A92A 1CJUC 4QOSA 4DUGA 3QPVA 2OEPA 3T15A 4LHXA 4HEJA 1YJ5A 1W7AA 5HCIA 5A5GA 3DM9B 2CK3D 4JL6A 3SS8A 5CYPA 2Z43A 2VH5R 3BWDD 2FFBA 1XTQA 3C7KA 3CUEF 4B3GA 4DCNA 1XXHA 1FP6A 2QZ4A 5F2EA 2N46A 2QEQA 3JVVA 4QG7A 1N0UA 1PLJA 2XAUA 2PCJA 1DEKA 3PQCA 3RS5A 1IHUA 4LYHA 4V02A 1PUJA 2VRWA 1IN5A 5CM8B 4PSKA 4UKDA 4BLRA 2OAQ1 2WIAA 3DOFA 4LJ7A 3K0CA 1PJRA 1A82A 5C2JB 1AKEA 4PQYA 3VKGA 1M74A 3UK6A 2CL6X 1N3BA 3C41J 2W2TA 2GVDC 1W2HA 3K53A 3RSOA 4AIIA 1NN1A 3GFTA 3OIWA 4YDSA 3U3JA 4EPVA 5CITA 4L9WA 2V8OA 2GJAA 3ASZA 4YC7A 1S1MA 1KSFX 3GD7A 1M34E 3EWSA 3FMOB 2QT1A 3L43A 1RVDA 3MJHA 4JVMA 1GKYA 2CL7X 5EP2A 1ZC3A 4KJZA 4UNSA 4Q4AB 5KDLA 1QG4A 2FPKA 4FINA 4TMXA 2J7PD 5FPHA 2XTNA 4K46A 4C0AC 4D4LA 3SFZA 1VKJA 1KI7A 1DO2A 4RD3A 1G7SA 4RSGA 4DEYA 2J87A 1P6XA 4NMMA 3WYGA 4MKFA 3NVAA 1RRPA 1CR2A 3BIFA 1W36C 2CCKA 1ZBDA 1ZCBA 1Z07A 1HQCA 5AUQA 4XJXA 2F9LA 4QNMA 4TTQA 4HB2A 1M7BA 3DOEA 3LVRE 4DDUA 3BGWA 4AKEA 1Z5ZA 1LB1B 3U6KA 4XOIA 1FW6A 4NZYA 2P65A 3ZVLA 2BWJA 1G3RA 1GSIA 2O8EA 3W5JA 3CRVA 1I2MA 4A4DA 1VYVA 2ZM5A 1SVLA 4QBHA 3B5JA 2PZFA 4OK6A 3AEZA 2QMOA 1Q1EA 1LVGA 2DWOA 3REGA 3C16C 2AWOA 3OFND 1E69A 2GZAA 4R7ZA 4Q9KA 1QG2A 1R5NA 4K8OA 5CLLA 4I4LA 1VG1A 4TYQA 4CF7A 1KSJA 2ODWA 4LRWA 4LUCA 1GM5A 1A2BA 1KHTA 3P4XA 3I1FA 4JYCA 1TQ2A 3GJ7A 2AL7A 4GMXA 1ZNXA 1X8KA 3AF1A 3KXKA 1Z6AA 2QPAA 2ZRLA 4O2LA 5EXTA 4A0GA 4BEBA 2IBMA 2ZJYA 1S1CA 2IUTA 3L0SA 4P33A 1NJGA 2OBNA 1ZNWA 2XOKA 2FU5C 2NPIA 2QRZA 2YOGA 2KBEA 3B85A 1RKBA 2ZRIA 1CU1A 2VL7A 4QBFA 4A8JC 1XD9A 2J3EA 1FNMA 4MGYR 2QPOA 1KO5A 5H1YA 2YVUA 5E7IA 1Q3TA 5SZIA 2VSFA 3IILA 4LJYA 3TBKA 1A1VA 1YZGA 4G5GA 2YWFA 5FPTA 1ZIPA 2BHRA 4B35A 1TPZA 3SQWA 4QRHA 3REFA 2HV8A 2J0UB 1GRRA 1XXHE 2BM1A 3KB1A 2IXFA 2QPTA 5JMTA 1E2LA 1HTWA 4DJTA 3BB4A 2JJ8A 1P5ZB 1KMHB 1W0KD 1MR3F 4XTRA 1Q0UA 6Q21A 4ESHA 4Q19A 2F1RA 3BFKA 1E0AA 3O8CA 1HE8B 2ZEJA 3BK7A 2GEDA 2VF7A 5GVSA 3OE7A 2ZI6A 3EASA 2QT0A 2ZANA 4G5RA 3KJEA 3QF7A 4XWKA 1GL7A 1KI6A 1TUEA 3GLHB 2J41A 4RD4A 2FSHA 1GKUB 5KNBA 3PEWA 3R7WB 4PZZA 5EUQB 1AGRA 4ZV4A 4DSTA 1XCMA 5J40A 5DIFA 2PBRA 1L4UA 1AM4D 1IXZA 5FFMA 3CB4A 1QDEA 3GEEA 1X3SA 2H1LA 1OIVA 4H9GA 1VTKA 3U3OA 3E70C 2WWGA 1F48A 1EX7A 2AD1A 2H57A 1KI8A 2C96A 2O8FA 2IYYA 1R0YA 4DEXA 1WCV1 1UFQA 1XU4A 1DAEA 3P20A 3B1YA 5CDFE 3NC1C 4Q7KA 3FHCB 2QU8A 1CR0A 1KZGB 1N6PA 2QSZA 5G3ZA 2EQBA 2XOKD 1BMFD 1E79D 2G0NA 2GK7A 1ZAKA 2IEZA 3QXXA 3EPKA 2AFIE 1VYTA 4ITRC 1U99A 4TQAA 3NG1A 4GP6A 4LHZA 4B33A 1QBKC 4B3DA 1XBTA 1RJ9A 4TZ0A 2KSQA 4TLEA 1X8JA 4TQUS 1OHHD 3RC8A 1X8LA 2ZS8A 1PLKA 4N3NA 3QOFA 1E9RA 2BV3A 1I4DD 2WSMA 1QRAA 5G41A 3K0AA 4M0LA 2V3CC 1V5WA 3KKNA 3LW8A 4HAUA 4QGFA 1Z0IA 2NO9A 1P73A 2ZRCA 3GJ6A 2ZYTX 2OAP1 2D2FA 1IN8A 4HYYA 2CLCX 2H92A 3MD0A 2QTFA 2W0SA 3LLUA 1N25A 3WRXC 3TVDA 2YWHA 1BMFA 3H0KA 5BW8A 2JCSA 4DCTA 3AUYA 4OQMA 4TL9A 2YHSA 3AP2A 4E09A 1P2UA 4KYUA 2P3SA 1T0JB 4W5JA 5IT5A 2KJQA 4BLOA 4O3MA 2GZDA 2JGNA 1HA3A 4F4CA 2F1HA 2CVFA 1L4YA 2FN4A 4LBVA 5EE5B 2WWHA 1NP6A 3OAAD 1KNXA 3BB1A 3AKDA 3A58B 1S2MA 5KNDA 4KV9A 5CJ2A 5CYOA 1DPFA 5SZKB 1D2MA 4JJZA 2XNDD 4KCGA 221PA 5JJIA 2W6ID 3CNOA 1JXMA 5CIWA 3CR7A 2G1KA 5IRCD 2EVWX 3B1XA 1M8PA 4BGDA 1E2IA 3BH7A 3ZZTA 3LH5A 3OESA 3RS3A 3TQCA 2HJVA 1U81A 5FR2A 1N5KA 2CK3A 2ORVA 1EWQA 2OUKA 4Q1EA 4TQ9A 4C7OB 1JJ7A 5K8LA 5KNCA 2X1VA 3LO5A 3GJ4A 1VCMA 3MLEA 4Z8YA 1R0XA 2ZSDA 1TAGA 4V0NA 1CRQA 3AKCA 3DKVA 4A6PA 4BZQA 1CS4C 4QKQA 4IEEA 3SBEA 3V4FA 4HLDA 4BFUA 3FE2A 3TSWA 4WVFA 2XTMA 1U98A 4Q02A 2R44A 4US1R 4PTLA 1Z3IX 1I2DA 4US2R 4LHWA 4MYHA 1M1YE 3EIHA 2O8BA 2YC4C 4YMTA 2WTUA 2A7QA 4B34A 4DLXA 2ZXUA 1Z0FA 5DI3A 4L4UA 3TK1A 1UBCA 2HYDA 4M21A 3LV8A 1N6HA 4Q9IA 2ZSBA 4GZLA 1OH6A 2CLDX 4A2QA 2V6IA 4KODA 2QMHA 1Z6XA 4MA4A 3W3AA 5L3QB 3GPLA 1DAKA 1FQKA 4YMUA 1JJVA 1Q3HA 3W90A 2CHVA 4QJ5A 3GCGA 4GFDA 4L15A 3PENA 5J4YA 1KSHA 3AH8A 4HAYA 2ZR7A 1T8UA 4TMKA 4IKEA 3IKJA 1DOAA 4GBMA 4NP6A 5FOWA 4HZUA 3BH0A 1P9RA 1QHNA 5J4LA 1G3QA 4LK2A 4DIEA 5EE1A 1AQYA 4FCWA 1QVAA 5TY0A 4RKFA 3U6BA 4E5UA 5LPNA 2GETA 2FSIA 4Z54A 1YZTA 2OLJA 1K8RA 5CK4A 3WHKA 2RGXA 3I73A 1C1YA 4C3ZA 2NMVA 2HF8A 1ZM4A 2GJKA 2VPPA 2CJWA 2BJWA 1XMIA 4Q03A 5DLQC 2IYVA 1E99A 1WF3A 5J4HA 1H65A 2QSYA 3KTAB 2WJGA 1NN5A 4KITB 5GJWC 4TLDA 2YOHA 1UEJA 2QG6A 5BWMA 3U61B 4C7OA 1OXVA 3KX2A 4BPBA 3QVVA 3BE4A 2QL6A 1KK1A 1KOFA 3BD9A 3RS0A 4PC1A 3WRYC 5B64A 5JHGB 4HAVA 1E32A 1XPUA 5EP4A 3SYKA 3DZDA 3ZVMA 4GOKA 3X2SA 2GEVA 1Q21A 2QA5A 1JALA 2WZQA 3D31A 4I1OA 4LHYA 1OJLA 4OQNA 3BRWD 3VX3A 3X1DA 5JCZA 4LZZA 5M04A 1UF9A 1Y63A 4JYBA 4B3FX 2C77A 2QAGC 5JWHA 3R9WA 4O2RA 4YLGA 4M1MA 4C0HA 4LV5B 1JI0A 2ZUCA 3O8DA 2JLZA 1Z08A 2O8CA 3LDAA 4CW7A 1Q22A 1YRAA 4EFMA 4M9QA 3OIUA 4MKIA 2CXXA 5TMPA 2OLKA 1GITA 4Q9JA 4UNRA 2F3TA 4F92B 3J81k 4AURA 2FEMA 3X1WA 3SJCA 4HB0A 2XEXA 3BS4A 1VG9B 5G53C 1WBBA 1W5TA 2ZSAA 3A4MA 1DVRA 1KI9A 4LBYA 4ZKEA 3CPHA 5CJPA 2ORIA 3KQKA 4POAA 2DFLA 1ETUA 1GP2A 3NBYC 4UNNA 1RRCA 2A2ZA 3AVYA 5P21A 2CCGA 2OCBA 2ZE6A 1IY0A 5JJLA 5SZHB 3ZJYA 2ZITA 2IWRA 5FI1B 1S3SA 4NYMQ 3VU9A 4NCKA 1YR9A 1G3UA 2ZRDA 3GLIA 1QVRA 1XTRA 4Q1AA 4GZMA 4ZCIA 3THYB 3LQQA 4G3XA 4BFZA 4PX9A 1D8TA 1W44A 2QNRA 1XMJA 5L3VA 2CBZA 2JLXA 4H1VA 2ANCA 4OHWA 2W2VA 2ZVQX 4WZBE 4NDZA 3IGFA 5TV2A 5KTYA 3AF2A 3CIOA 3EZ6A 3QKUA 4AC9A 1NKTA 2FGJA 2ZETA 5E7MA 3UMFA 1W46A 3GEIA 2SHKA 5FTKA 3R8FA 3BB3A 1CJVC 1W36D 4RD1A 2RGNA 3T06B 2W6JD 1PZNA 2OILA 1LW7A 4FMCF 3EZFA 2JAQA 3HR7A 2PJZA 2BIFA 1G7RA 2BCGY 2ZE8A 3B13B 1OIXA 1U2RA 3LA6A 4L8GA 4R2IA 1PVOA 2H5EA 4RKEA 1SVSA 1HUQA 5SZJA 5IF9A 2WM9B 3K0FB 3AP1A 1XD2B 2GXQA 3BFVA 1X86B 2XJ9A 4V0MA 4JJKA 4NHOA 1ANKA 2H16A 4LV8B 4M1KA 3UATA 3W8NA 4D4JA 1ZRHA 1NIPA 3ZVNA 2GXAA 4KFRA 2IYZA 1TEVA 2VSOA 4W5WA 3UG7A 1DE0A 2Q9AA 1N6IA 3F3YA 4UXJA 2QE7A 4YXWA 2VP6A 1JXOA 5CM9C 1GL6A 4PZLA 4BFWA 4KSCA 4IW3B 4KBFA 1OHHA 1JQJC 1ZJ6A 3SYNA 4HB3A 4ABYA 3RRYA 4IJMA 3MRSA 4W9MC 3U44B 1P60A 2WJVA 4C0LA 3RRMA 4FD2A 4TYWA 4P0TA 5ANRB 5K8TA 1VG0B 1NJFA 2VHCA 3Q85A 4PPNA 2IK8A 5EP3A 4AD8A 4E03A 3QG1A 4JLJA 1P72A 1D2EA 1E0KA 4NTZA 4MGKR 4A15A 2EYUA 1YQTA 3H84A 3ZYCA 5BYJA 2OG2A 3EA0A 4EIWA 4N0EA 3K70C 4XIGS 2ZJ2A 3W34A 4C0QC 2OM2A 4ON9A 3QE0A 4IXNA 4DLWA 4BECA 3K9NA 3THYA 1E1RD 5TVKA 5FTNA 1XPRA 4OHYA 3CX8A 3M1IA 2W00A 3PEVA 4FN5A 3BORA 4LJ6A 2IYTA 2A5DA 2EWVA 2LKCA 2Q21A 4PC2A 3LX5A 1FFHA 2OE2A 4G1UC 1I4LD 3A1SA 4NCJA 4A9AA 3WXMA 2VSXA 3JVUA 3CWZA 1Z2CA 2W58A 4JBXA 4IDNA 2R6GA 1HY3A 2FSFA 2UZIR 1XTJA 3Q9LA 1Z0KA 3A6PC 2ERYA 4TYYA 4A6XA 3AKYA 1FUKA 2B7BA 2GJSA 1W36B 3QEOA 1YRBA 3X1YA 1QHXA 4NYJQ 4MRVA 3U7EB 4EFNA 1SXJB 3I92A 3CW2A 1NG9A 1SVMA 1C4OA 3PXGA 1NSTA 4PC6A 3KUCA 3LAWA 4R2HA 2ZRHA 1SULA 4RZXA 2F9MA 4MDFA 4PQRA 1N5JA 1UBFA 1AS0A 1G5RA 3I62A 1YZNA 2R6DA 3AVPA 2OCYC 1KDRA 4JKYA 4IVPA 4JVSB 4WIAA 1GNRA 1Z22A 1R2QA 1HYQA 5KO2A 2E9SA 5DYIA 2PH1A 2IYQA 1G5TA 1YHNA 4LGMA 3T1VA 3U44A 1P4SA 3TRFA 3IHLA
chains in the Genus database with same CATH superfamily
1C0EA 3NBQA 1VIYA 1RI4A 3DMNA 1HTBA 2O3UA 3SSNA 2OA0A 5HILA 5C5DA 1MT3A 1OXSC 5LR6A 3DO5A 1P29A 1FNSA 4OQYA 1PSZA 3VR6A 2AVNA 4C2TA 4UHJA 1SUSA 3VNSA 1Q1GA 2FE4A 3GPCA 3HJBA 4B6FA 1F2UB 1EVYA 1VECA 4M1OA 3TR5A 2WHYA 4PN3A 2XCTB 4F2HA 3AR2A 4NWIA 3T7EA 2A3RA 3A1UA 3SLGA 1V7CA 2G3YA 1SXPA 1V2GA 4HAIA 5A4JA 2IW3A 3WDLA 3HL0A 1B6TA 3R7NA 1QK5A 3EDYA 3KSUA 2BC9A 3ZUGA 3CHYA 1NYRA 2HA7A 2JBHA 4EYGA 4YP5A 2ET6A 2HQSA 3SICE 3U7RA 1S7GA 1T9AA 2CVPA 2OSVA 3H3XA 4JITA 2NVWA 2QVXX 1NNLA 3UJBA 3UWMA 1VMEA 4HUJA 2ZJ8A 2AFHE 2IGTA 5I9TA 4P4NA 1UPCA 521PA 3WGYA 5H59A 1YZHA 4MHSA 3QX3A 2JKYA 1PTJC 4Y2UA 3A4TA 3ZWDA 3OFNA 2UYCA 4KKVA 4BX0A 2H0QA 1ZOPA 4NPHA 4JB2A 4ND6A 1G8PA 4NS1A 3GB9A 3VR0A 1MRSA 1RYNA 4EM6A 5FPKA 1E0DA 3HUUA 4QVIA 3UJDA 2AC2A 3O74A 1F60A 4MJ3A 1IAQA 4INAA 1NC3A 3PPVA 1UBKS 2RJ3A 3KKLA 4FFWA 3V42A 3ZPXA 2CXRA 2C97A 2FX2A 3V9PA 4FLEA 1JDPA 5C0OE 4Z6KA 3TW0A 1Y9JA 3C7DB 3CW9A 3COSA 2Q6VA 3FCOA 2ZPAA 3FGZA 3INGA 4U02A 4URZR 5JZ9A 5KYWB 4EA8A 1K2VN 5ALJA 2HYIC 3WFZA 3LK6A 2VDJA 4YDRA 2TECE 2VDWA 5AW4A 2WE7A 3UA4A 4QARA 4BEJA 5G0UA 4ZDJA 4A8HA 1DZIA 2GD6A 1XJWA 2JGDA 3QHAA 4C20A 2DE0X 1H69A 2Q4BA 3MFQA 4O0LA 1LVHA 4B43A 4Q48A 1WAMA 3UT5A 1XQ6A 3AR9A 2ZKLA 1TZ2A 1LPPA 2WUEA 2G04A 4GMFA 1PR2A 2ISSD 4IJWA 3UAVA 2QTZA 4EPYA 1RHJA 1MJHA 4ZCMA 1C1DB 4QFCA 1Y5RA 3DO6A 3JYHA 3N28A 4PGGA 5F3DA 1COZA 4YV7A 2AEEA 4UC0A 3VI4B 5HRUA 3AVXA 1XALA 3C8MA 4CKBB 1NWCA 1PQUA 5KPJA 2VHJA 4I1YA 3SSOA 2CYCA 2EWMA 2WPNA 1P4HA 2XPCA 1RQNA 2HLNA 3VGJA 3GVCA 3F0TA 4IGAA 3KT3A 2GPSA 2J6CA 3QITA 3FPSA 4IIXA 5IABA 3WZLA 2FR8A 1YQEA 1DBSA 2I1WA 2MT9A 3BMOA 3G82C 3MXOA 1NE2A 3N7UA 5T41A 4AY3A 1UP4A 1JFLA 3FYHA 4TSFD 1KVRA 1H5UA 3ZDXB 1R6AA 4C4RA 2JJYA 1E9BA 1OZAA 4CVNA 1QWSA 4QSHA 3TOSA 2PHZA 3CF6R 3D3WB 1HL3A 1PWEA 2C00A 1GPDG 1JLKA 3TIXB 1OXMA 1SHKA 4AZVA 1PV1A 1M6VA 4IHJA 1AQUA 5TPZA 5AUNB 1JT9A 1FLAA 3BULA 1KJJA 3QMMA 3VPXA 3ZGXA 2ZIZA 1H2XA 2QRNA 3CB2A 5CCBA 3LBYA 2O4CA 1WVIA 5HOEA 2FRDA 1T1JA 5A03A 2NXCA 3LK7A 5DI3B 4HDMB 3HHEA 5FPSA 1CVIA 1MBZA 3GA0A 4UNQA 1P4GA 4OI0A 4FIDA 2WM3A 3H1BA 1BE8A 3LHFA 2ZAOA 3I2HA 4RGYA 4EY8A 4XVQA 1QE5A 1JI3A 3M5DA 4FBLA 1WSBA 1FFGA 4LYAA 4Q4AA 2H4ZA 2PYZA 3W8EA 5IN4A 4DLYA 4MVYA 1IOZA 1KERA 5HRCA 2OZEA 3GLGA 1V7PC 1M8FA 1NQUA 4W9NA 1TTPB 3ND8A 2XEDA 1Z83A 3WO1A 1Y4AE 3P0HA 1KF0A 1C9EA 1JH9A 3O5AA 1K7XB 4ROSA 8ABPA 1J70A 4ZIRA 2V7VA 4I3FA 2AIRA 3N7TA 4XRGA 1MQAA 2P3QA 3GVHA 4GI2A 5EQJB 4B8ZA 4NKRA 1B7GO 1PEAA 4P3NA 2XWJI 2OLEA 1G66A 1O87A 1THZA 3ANLA 4JJFA 2WWIA 2D74A 1DINA 2VP5A 5HVNA 1ABEA 4QUGA 2QD4A 5LP6F 3Q7PA 5C4IA 1L8QA 2GNOA 3MTJA 4I36A 5J43A 3CUUA 1XT6A 2HW8A 4CLEA 4MVJA 4JLBA 1S3FA 5M7EA 2C2OA 2V6MA 2L0XA 5CLQA 1OR8A 3L7OA 2K4MA 2YTZA 4QICA 4XM0A 1RYHA 2PZKA 4OAOA 4Y9SA 1E18A 1ZM2A 2JFVA 2QIPA 4U2FA 3BFPA 2LZ0A 4ME6A 2DETA 4B83A 1N33B 1JKJA 5JS2A 1F4VA 4GR4A 4ZCRA 1MGOA 1PK8A 2ONZA 3UV6A 4ZYXA 1TQHA 5A5VA 4RK7A 2C9DA 3NIGB 3B78A 3NHWA 3TTYA 4AZTA 3KG2A 1LQTA 3GEPA 3Q6NA 2WVGA 5DOVA 2QVGA 4ZI5A 3ZV6A 1QAOA 4QLBA 1U7ZA 2G6BA 3EGEA 3V8BA 3WWCA 3DO8A 1X87A 3B9QA 3I37X 1YVRA 1PVVA 2BW0A 3BXOA 4KZPA 2XMBA 4E6EA 2ANBA 4UEQA 2DJ5A 4JYMA 1KJZA 4G9BA 1CULC 4YAWA 1YGPA 1KFCB 2JLRA 1BFDA 4RV4A 5BN5A 3PFWO 3BCRA 3EEIA 4JLUA 1PLLA 2P9CA 5FLKA 3E53A 1UT5A 2WJWA 3OVMA 3DMDA 3H1FA 4N0DA 2GXUA 1TQDA 1XQ1A 3TIIA 1TEZA 4MS1B 3FLBA 1YU9A 1XJCA 4N48A 3THWA 2BGLA 3E58A 2OXRA 5AK5A 3JWIA 4RF5A 4F8JA 3PC3A 4ER0A 4F6RB 1YCGA 2LRHA 3KE8A 3ZD7A 5LFAA 3IBFA 1B73A 1NA5A 1BWQA 1DJQA 2YNMD 4LIPD 4NH0A 1IN4A 1HEYA 5DW0A 5AJVB 4DM3A 1QIKA 2ZSEA 1PFYA 3FNHA 4G9GA 4LOJA 2MSCB 4YBRA 4DR5B 3CH4B 3UKDA 3LVBA 5KNCD 2EW2A 1XI2A 2WV9A 1JHMA 4KDRA 2VQFB 2JCYA 3ADKA 3E4DA 3H4IA 2Q2WA 1IVSA 5JAPA 1W75A 1Z8HA 4EJ0A 2C3UA 1SXQA 1XEFA 4X71A 1ORHA 1FYXA 2YICA 3CISA 1VJTA 3F4BA 5E7JA 5FADA 2HQOA 2FEKA 4L0MA 3TL2A 4DQKA 2CF6A 2NXJA 2PUHA 4DR4B 3ZC3A 1F6WA 2R9VA 5CLFA 4XVRA 1F4LA 1E0SA 4YGXB 1JDBB 2EZ8A 2XKBA 4XYMA 3R40A 3UENA 3K09C 2W98A 1JR3E 2XNCA 4PC3A 4R1SA 1E6CA 1E9SA 1RIFA 1Z39A 2QE7D 4FSDA 5JD3A 2Z0MA 4BLTA 1KYIA 5AK4A 3TBHA 4AWXA 2N9UA 4RJJA 4NBLA 4WW0A 2XMSA 2ACVA 2DQ4A 1K8ZB 3DDCA 4O4IF 3KQMA 1KQOA 2Q5LA 2YBEA 3L7AA 4L4XA 1VHJA 3C45A 5CB4A 5IKMA 2JDIA 4G0YA 3OA0A 4KAFA 1ONBA 2GILA 4QQRA 2FEWB 4EUFA 4G86A 1L7OA 4ILKA 1BD4A 1X7WA 5G4LA 3OCYA 3OCXA 1RBZA 1W0JA 4P83A 5SICE 2XIJA 1XPOA 4BNZA 4I3GA 3EX7C 2PSDA 3KQVA 3VDQA 2AW3A 3Q9SA 1K5HA 4TV9B 4D0LB 4JNKA 5DX1A 5A3SA 3N0VA 1T36A 3TFWA 4Y2YA 4HCJA 1PR3A 4I9FA 3RLFA 4ZEOA 4HNVA 3KJNA 2ATIA 1S01A 4BPRA 1TNDA 5I4IA 3DCNA 1RKXA 4DC9A 3PT5A 4JMPA 1OASA 3B36A 1U8YA 1RJ9B 4D4KA 3DPIA 4KXXA 1P2VA 1PWZA 3ELDA 4NJEA 1U3TA 1YR2A 1JEQA 4R6WA 2JATA 1CIJA 1JSCA 1GD1O 1NRXA 1NXPA 3CCCA 4G81A 2DBYA 4BN4A 4OHXA 3DE4X 3EVDA 2YNMA 5I7RA 5HKKA 3PDCA 3LXMA 4UAJA 4YJ3F 2D06A 3LS2A 2RGGA 4BFXA 2KBFA 1ZCAA 1C81A 2KWIA 1NC1A 4MP8A 1OOEA 4YP1A 3FDFA 3SVLA 3QKTA 4RMNA 5T6MA 4DPMA 1CG6A 1MABB 1Z34A 3PE3A 3TAXA 4MRNA 3RUHA 1PD1A 2VHXA 1Z0DA 4AF8A 1Z6GA 3UB4A 4J3NA 1MT0A 3DKRA 1S2LA 5TGZA 4URUR 3F97A 3DDZX 2RAFA 3GGGA 4NAHA 3EPHA 3KYDB 1W25A 3MT0A 4EJSC 4YMLA 3QVKA 2WQ7A 2O6HA 2EBUA 2JIQA 3IXMA 1BQ4A 4MUFA 5IXSA 1ZLYA 4R9NA 3UCXA 1BRTA 4JLMA 1EXMA 4YI5A 3RF7A 2PWPA 1VPDA 1W5AA 2J3KA 3NBXX 3T3MB 6YASA 1ZNQO 1ZCZA 1O0SA 2HSZA 2QROA 3CA8A 3ETNA 2XI4A 3U3MA 3VAYA 4CIAA 5KJ1A 1UDAA 3RUIA 4GZ6A 1I5RA 3WIEA 1CZOA 2WM2A 1C9DB 2ZIAA 4X54A 3A36A 2B99A 3G2NA 1TA4A 4IO0A 1WMDA 4D99A 1E3EA 2HQRA 2ZJ6A 1ZNYA 3L7JA 1X9HA 3TF5A 3Q98A 3DF7A 1NM5A 5BO5A 3A3KA 3AEUB 1H3EA 1NVVR 2EJWA 1YSCA 2R6AA 1IPEA 4UUNA 1EGMB 2FZGA 3RRXA 4NBSA 3LPLA 4O0MA 3SM9A 2VNIA 2MSEB 3C5WP 2GM4A 3FWKA 3WDMA 5IAJA 2C04A 2NM0A 2VZLA 1ZR2A 2E4UA 3JWPA 1X1QA 1HQDA 3C7CB 1OLUA 1W9MA 1S5PA 3IAHA 4ACBA 5D3MB 4JOSA 3C6KA 3ROFA 3DFUA 2X9QA 4GRAA 2A14A 1U0SY 4YO7A 2A5JA 3OUZA 1E58A 5JG7A 5AJHA 1LLFA 1XFAA 2F4NA 1WY7A 3I42A 1OXXK 3I2FA 2GN9A 2VBCA 4WACA 3PA6A 4HYTA 3IAS1 2ZRMA 2AUTA 1QHHB 4IICA 3LQRA 5AKEA 1RADA 4E12A 5KX5A 3K72B 3OEHD 2WUGA 1F6DA 4ALLA 3I5UA 2MMCA 3K05A 3RAEC 4Y9DA 3UG6A 4OM8A 1IXSB 1HTTA 5FUWA 1FQWA 2PAFA 2ALJA 3OURA 3SXJA 2JJMA 3OQ6A 2O8BB 4IUYA 3B7GA 4KOAA 2D6FA 3IQFA 3CNNA 1TT5B 1FFXA 1T4CA 3FBGA 1KO1A 3JW8A 4RAOA 3U4DA 1EGAA 2QTMA 5DM1A 3FDIA 3ZH9B 4Y6PA 3MCAA 1GR1A 3GRFA 1UT6A 3IOMA 3MSXA 3E27A 5INTA 3H9BA 4RFVA 3GUZA 5J2TB 3JQ8A 1VPWA 1Y37A 3A1EA 4UQOA 2VJQA 3DNFA 3QXHA 4RCZA 3NFYA 1NKVA 2ZW9A 3O0TA 1VE5A 3V1TC 2PRYA 2YN4A 4Z7QB 4UATA 1ND5A 3ET4A 2AX4A 5LWHA 1FQJA 4PIMA 1M8KA 2BBSA 2QAGA 3PIDA 1VKNA 2F48A 2GZRA 2HMSA 4LBWA 4RF4A 1LSUA 1O4WA 4K3VA 5K3SA 1GUYA 1VA5A 4MRMA 2YIVX 2NACA 4F4JA 1MC8A 1DTSA 1U7XA 2EP7A 2X13A 3OQJA 5CVCA 4GC5A 1E4OA 2O48X 3E3OA 4C5AA 1FX0B 5JXJA 4LC1A 3SEAA 4AS2A 1X6VA 2OQIA 1PT6A 1J8YF 2CNNA 3O1HB 4LF5B 5JFTA 4Z8XA 5K03A 4B1FA 4I4NA 1JBKA 3RS4A 3D3JA 3VSEA 1Z29A 1Q84A 2EFCB 3LC2O 3Q2OA 4GR5A 3FTQA 2P5YA 5FBZA 4BQQA 2Q1SA 1CR4A 4B87A 3KJQA 4HMOA 4OBXA 1QYWA 3UXMA 2WB2A 1ZH0A 1GY8A 1ZVQA 2EWWA 3S1AB 1NDHA 3OCJA 1IUOA 1UPTA 2IEIA 4R31A 1SOMA 3UMGA 4OHVA 2OB1A 3FTFA 3NWBA 3TOCA 4D9GA 4EKDA 1IY9A 4RVNA 5LQMA 1E1DA 3UPDA 3QIAA 3QSGA 1DC3A 1ISRA 4QU0A 5DGCA 4U6NA 1XWIA 5GIPE 2Q9UA 1RHKA 3EUEA 3R6DA 2WYWA 1F5SA 2VBFA 3AJEA 1ZHHA 3C3WA 4TMZA 1G9TA 1P9WA 3TQIA 4M1WA 4PVDA 3ZXIA 5HZKA 2V0CA 4RX1A 2HA0A 2Q45A 1ZHFA 4FW8A 3UA3A 2O54A 1AF4A 4EMSA 3MELA 5IVKA 1W36B 4KO8A 5LOVA 4P36A 3HVRA 4NYJR 3I53A 3EYWA 3VC3A 2GRJA 3QNUA 4NCHA 4YQFA 4P5EA 4BVLA 4F04A 3RVOA 1UZNA 3GRVA 4XUDA 3K2BA 4NJMA 3RVBA 4L74A 3ZKAA 1SKYE 2WWVD 3I6ZA 1O8BA 1NTRA 1AQLA 2YWBA 1XDBA 2XXBA 3RVKA 1WXEA 3QWAA 4QT0A 4FUTA 3PUIA 3V3KA 1RWMA 3ORQA 5A0FA 1TD1A 5LDGA 3CTPA 3C6YA 3UUEA 3OEHA 5C46F 3LX4A 2ZI4A 2GPYA 1OCEA 1JXAA 2Q3EA 2QYHA 1KVQA 3G9QA 4PR3A 4RPLA 3H99A 3TD6A 1KYZA 4O08A 5REQA 2SBTA 2W8ZA 5DGXA 2FX5A 1NVXQ 2MR5A 3P5SA 4PLZA 4DSUA 2EOAA 3NJ4A 3WO0A 5BRAA 5MFZA 1KMQA 3AEQA 4RHYA 3SQNA 3T1NA 2DMRA 1FCJA 1IYZA 1PL0A 3LRPA 3OOHA 2WIFA 2HY7A 2VXBA 3VR2D 4BRZA 2ATEA 1I3OA 3R44A 4H4CA 2W6ZA 2X9GA 4PM4A 1Y7PA 1P31A 1XLTC 2CJXA 1EZ4A 2J3JA 2ZUBA 3LLSA 4E14A 5DCLA 3FVRA 2VF5X 2HU8A 3D7MA 1WY5A 4AMVA 2J6IA 2X19A 3GAZA 3OE7D 3VR1A 3P4UA 1MO3A 5HF5A 1GAXA 5IF3A 2HO4A 3L7YA 1T2AA 3H6GA 2YC2C 4DCCA 3HYRA 1LS1A 1M6VB 4IHJB 5T4EA 4MDEA 5ESDA 1ABBA 1IZ9A 1DAOA 2RCYA 1QHYA 3AF3A 4PWYA 3GAMA 4G8DA 1ILEA 3WWYA 5CB4F 3ID6C 1ZGHA 3OPXA 2W6NA 1NJ2A 3LGAA 1L5LA 1XMPA 1YK0A 3QYJA 2YMMA 3GT7A 4L0DA 1TM5E 5B12A 4FN4A 3N8NA 1VGVA 2JDID 4R9SA 4PAGA 2FPXA 3S81A 1IAVA 1O77A 3FCEA 4JBYA 2ZJ4A 3QLEA 2OCDA 1TEHA 1R8XA 3EGCA 3A1FA 4G36A 2GBIA 1G9XA 5TRTA 2G36A 3GG2A 3VJKA 5EHXA 4ZHQA 4M1ZA 2Z04A 5IJXA 2W0MA 3RM3A 2X9LA 3B2EA 2JG3A 4CMIB 2ZWOA 1AN0A 1NV8A 3EF0A 2CV1A 4OK5A 3CF0A 3Q0TA 1HM5A 3LUCA 4G4SO 1R6TA 3UJNA 1C3JA 1XD2A 4UFOA 2CY0A 2ZFUA 5CIQA 5BW4A 2BR3A 3EC1A 4ZO6A 1BDBA 1F3LA 4QA9A 4AF6A 1DDIA 3SE0A 5C18A 2HB6A 2CFSA 4A2WA 3RAFC 2QTHA 2RK4A 5D8DA 3RWBA 5IAAA 3RV4A 3PLAE 2JI8A 1N6LA 2PU5A 5CFNA 3TTSA 3A6DA 3GLGE 4F45A 4IDGA 2QRMA 1EM8A 3F90A 3AVQA 4UEWA 4WK4B 5F52A 5L6LB 3N0WA 1EQUA 2V3WA 4MRRA 1JS1X 1MXHA 3V5NA 4BJHB 2AKEA 2Y1WA 1REQB 3UCFA 4ETWA 3NV9A 3H11A 4Z1MD 2RGUA 4GPEA 1HC7A 3SFVA 3IQXA 3A27A 4UMFA 3F46A 3W4KA 1GPNA 3IAFA 4DMRA 4JVMA 1OTYA 2WY2D 3M3DA 3VR6D 2GX6A 5C51B 1J2EA 4ZMRA 2GZHA 4YCNA 2FK7A 1G8YA 1PF7E 3EXHA 3PFCA 4QM7A 4I9NA 3DBRA 3VZRA 2EFDB 4LGVA 3OWOA 2D62A 1Y98A 2D0DA 3H1TA 4CGYA 1J00A 1GT6A 1IWPB 4KDFA 2Q41A 4AS1A 4QU8A 4YRCA 5HG0A 3TOXA 4AJJA 1D5CA 5LQUA 1LZLA 3EA4A 4FE4A 4L57A 4NK5A 4P9NA 4R1TA 3SNKA 4DT1B 1GV1A 3HCCA 1O03A 2GEFA 5NLLA 5B7QA 3AKZA 1U11A 4EW1A 2V03A 2KM1A 2GVZC 3OC0A 5E3JA 3THWB 5JYBA 2FETA 2VJPA 4F6RA 1ZAYA 1T8YA 1VYUA 4BMSA 1OD6A 3TS1A 3VJRA 5A4IS 4X91A 3NCTA 5JAZA 2B6HA 2WAXA 3V8EA 4AXBA 5LXTF 1P7PA 1PDWA 3K94A 1U8XX 1PZHA 2FI1A 4MUBA 3H17A 2AKAB 2O5VA 1O9GA 1B1CA 3B6ZA 5E95A 5G0VA 4FI3C 1FRFS 3K8OE 5A6SA 5F5XA 1PAUA 4CF4A 4HTFB 2Y2VA 3VNRA 2DZDA 2DTXA 2NQ8A 3PQ3A 4P31A 3MN1A 1DAFA 3B6KA 4RANA 3GDOA 1N6OA 1DS6A 1BDIA 1L5VA 5DV9A 5FI3A 1KK0A 4ENRA 4KO1S 2QVYX 2VPIA 4X1KB 5E1MA 3GMIA 4ODIA 3C24A 1CNMA 2GTIA 1OIWA 3DTNA 2O8EB 4D0GA 1L7VC 4MX8A 5IXYA 4CMBA 4QXAA 3C0KA 3A6KA 2C98A 3EFOA 1DJMA 5FUXA 2EFHB 1PZFA 1N2JA 4M9RA 4OOEA 2RAUA 3LHIA 1EKXA 2GYWA 4KYTA 4QFBA 4RH3A 1G17A 3ORHA 1C30A 3HLTA 4HN9A 4OGLA 1GEEA 1ZEJA 2IOFA 1I4TD 2Z5VA 1KYYA 1S8OA 1YZLA 4B0PA 4D8YA 3PK0A 5JAOA 4J16A 1SVUA 1QOQB 1VJ0A 2ZT7A 2ZYAA 3SR3A 5KKAA 1NY6A 1YS2X 3ROQA 2DUUA 3H5OA 2X5XA 3N5KA 3P96A 3EQZA 1N9KA 1N5MA 3PVSA 5AHWA 2X9NA 1O6GA 4CM1A 4G97A 5KSOA 3SZMA 2GI4A 3A8TA 3D8UA 3UB3A 1YIOA 4RZ2A 1EP1B 4D42A 2AXQA 4LRQA 2AXPA 2DWCA 4X7RA 4BCCA 3PCRB 1Z06A 1XN4A 4GAEA 2X3FA 2GCIA 2IY7A 1EFTA 4G09A 4XEHA 3ZXXA 3JASB 3D6AA 4OQQA 1NT2A 1FFBA 1PR9A 1N7GA 4R1MA 3OMLA 4ZT7A 2IH4A 4EPRA 2WUFA 1AKVA 1SO8A 4JHLA 2ZRKA 3TNYA 4IIYA 2JK1A 3TPZA 4DYHA 1USIA 2J0UA 2BKUA 4DCUA 1SKBA 3E8MA 1BE6A 1Z5VA 4FYMA 3RQSA 1N6KA 2A3NA 2ZYDA 1Y6JA 3AB3A 3NH9A 3V7YA 4D9MA 3PUYA 4TMVA 3OO0A 3REOA 3BMQB 4QHTA 1WXHA 2ISQA 3DEFA 3F6RA 4U9UA 1URPA 4DHWA 4FNGA 5HE8A 3W6OA 4YI3A 1QF6A 2W70A 1AOXA 2NZJA 4URWR 3Q3CA 3GZNA 4TKVB 1SURA 1U8AA 1JQ3A 1WLSA 1O5OA 1NUUA 3CRQA 2P35A 4ZJYA 2WJYA 4FWBA 4RMHA 2AOTA 4Z4EA 1VLVA 3HDJA 4ALKA 3KHKA 1FUIA 3CF4G 2OAEA 3I2JA 3TJZA 2EX4A 4JL8A 3ZW9A 4QXMA 1YQQA 2OQRA 3VYVA 3RC7A 1CUSA 2XB2A 1FS6A 2P2GA 3QGMA 1Y4DE 2R97A 4D5EA 4JEIA 2RBEA 3BMCB 2CMKA 4E07A 1R16A 5GZ1A 4KR3A 4W5NA 1QIJA 5C1IA 4D81A 3ZQ4A 3O4GA 1T9GS 1L5FA 10MHA 3ER9A 1N2XA 1QFXA 2FH5B 5DNVA 2WJIA 4HEQA 2E7ZA 2ODBA 4B6QA 4YIHA 3LECA 1MJGA 4IV8A 3FH0A 1PT5A 1YOBA 4AZWA 4AMZA 1SC4A 5HM8A 2W2KB 2PKCA 5DWDA 2VK4A 1KYTA 3ABOB 2IY9A 2Z9CA 2JI9A 1JL3A 2ZUEA 4UOEA 2GAJA 4C6TB 3BGIA 1C8LA 2QTLA 2W2LD 4LYYA 1P6QA 1NJ5A 1ZK4A 2HRDA 4NPAA 3DLAA 3SD7A 3TINA 3TLKA 2XNSA 3WNVA 1JFSA 4YRSA 5HCNA 4GBGA 1VPLA 4M2LA 5IJZA 4II3A 5JW6A 1OQAA 3CFYA 1VMDA 4TM7A 3ZDZB 4DZZA 5CVEA 4B7UA 3N8GA 2YIMA 2Q3BA 4ED9A 3TMYA 1E2GA 1MC5A 2WVHA 3MMZA 3S2FA 3BK1A 5KU1A 4RFSA 3LC7O 1XZLA 1QPBA 3R0JA 5TLSA 4PYNA 1DPGA 1DC6A 1HLFA 4N49A 5IJAA 5FOVA 2VWGA 1UDXA 5J47A 1JEYB 3SJZA 1DEHA 4PHGA 2FG7C 2J46A 2O14A 5F1OA 2C7QA 2G28A 1TC1A 1Y8QB 4ILEA 3A4LA 2LNDA 4KFCA 3MWJA 1NQWA 2JLCA 3G6KA 2FK8A 2HXYA 3VTKA 1F2VA 1UODA 2TSYB 3BILA 4DRXB 4CEIB 2IRWA 4KQGA 4TVKA 4D2IA 4R2WA 1J8QA 2G5GX 1A9TA 4Q18A 1FL9A 4F0JA 3IA7A 3P2YA 3MGKA 1LEHA 3C1TA 3ISVA 3TLMA 1RYYA 2BSAA 3CZMA 3L8MA 1ZKMA 3KFLA 4IBOA 2AWNA 1XOIA 3PHIA 3K8YA 3E15A 1P62B 1L8LA 3SHFA 3X1ZA 2YWXA 3N8KA 3IPAA 2FSVA 2RGRA 1FX0A 4E08A 4OBBA 1KSGA 4OXRA 1AZSC 2HJHA 2G80A 1P0MA 4KDCA 3WJ7A 2J1LA 1JHVA 2B78A 3U7JA 2XT9A 2JD1A 5G1OA 2EC5A 3EZLA 1T5DX 5KKCA 5IVDA 3VDMA 4PAOA 3PJGA 4IDCA 1XUOA 5K5EA 1KC3A 1SZCA 3DAPA 3V1NA 3OP1A 1SBNE 2A5FA 1RKQA 2IFTA 3BOSA 1A7UA 3B2NA 4JJEA 4OGGA 3RE1A 3RVNA 4WK6A 1NSFA 4UOQA 3LPNA 4JWTA 4KMRA 5EZ6B 5HEKA 1WMAA 5ENVA 4MUIA 4BVHA 3AOEC 1LJUA 2F3PA 3L04A 1PFQA 1OH7A 1QHGA 1R9MA 2X5OA 1RMYA 2C83A 3EF1A 3DMTC 1UBSB 1C0IA 4PAWA 1N2GA 3SHVA 4GDMA 4GD3Q 4TUYF 5AM1A 5BQFA 1NUQA 2EIXA 4KOEC 1P9OA 2MINA 1KJNA 4A1OA 1W87A 4C4PA 5K0FA 5L3SA 5ISMA 3NKFA 2AI2A 1KR5A 2L19A 4LOHA 2GSWA 3STUA 1WKVA 1UJNA 4GVLA 2MYTA 3T99A 3WHIA 5IDXA 3GRAA 1RZ3A 2O5RA 4DY6A 3L4EA 1T9KA 3NWJA 1YVDA 2BT4A 1H9AA 3INRA 3LUAA 3I2KA 4CIBA 4QFMA 1Y1RA 2D4HA 4OYRA 2FR0A 1ZW1A 5AO9A 3Q87B 3RVDA 1U7UA 3HO6A 4NXNB 1ONOA 3KHSA 3TFOA 2EKBA 5KOJB 2LDBA 3ZY3A 2FGKA 1IUPA 4QGHA 1X1SA 1I4EB 2P77A 3IJEB 2V7BA 1HFWA 2H8KA 2JL1A 5LB2A 2QN2A 1AGPA 4I8DA 1USVA 1ORVA 4DNOA 2WF9A 3DZCA 3MGAA 4HFJA 4Q15A 4R01A 2JJ2D 4UU1A 5COQA 4KK3A 4WN3A 4JC4A 1HI9A 3EARA 1SZDA 4MV7A 3OT5A 2P8SA 4P2BA 4UZFA 2EKDA 2P3OA 1QJCA 3JWGA 4EFLA 4GMDA 1MIHA 1HQYE 1UMDA 2QK4A 3IB3A 3SPXA 3WB9A 3QKRA 1HYEA 3GR6A 4QUBA 4BC1A 1UDRA 3HN6A 5JNSA 4QPNA 4F12A 1QIHA 5CCEA 4K88A 3R7LA 5K0TA 3FFTA 1PT7A 2I99A 4JI1B 3SS7X 3FNBA 3CLRD 3IRVA 1L4BA 2ENWA 1WVGA 2GDJA 4JGGA 4WXPA 3TEMA 5FBWB 2O7VA 1SUEA 2RHWA 1UOEA 4IFIA 1OROA 3IPXA 1MCZA 1LY1A 2AZMA 1KK3A 4L8FA 4OMUA 4YMIA 3R5FA 3OQ1A 2WF8A 3UO8B 4EL5A 5MGBA 4I55A 5K3FA 2LUOA 3ZLUA 3OU6A 4P08A 1N5DA 3IESA 2ONJA 5LKRA 3ZK9A 5FA5A 1O95A 4BUCA 4NVRA 1Q95A 1FC0A 1O94C 3IUBA 2LPMA 3CRRA 5CVUA 5ITZA 1NI4B 2FFQA 3AR3A 2XAAA 1XMVA 4B46A 2P2LA 4MW5A 1AGNA 2JH9A 2AQKA 2B2XA 1TYCA 4ZVRA 5B57C 2Z6VA 4RXMA 4RIHA 2BFEA 2FR8C 1Y4UA 2CCJA 2YINC 4I4TA 2R87A 5DTQA 2I4NA 4G07A 2LGJA 4IIBA 5CAEB 3T9CA 5HXAA 3FPLA 3VVMA 1NV9A 3I4CA 4GXRA 4MWGA 4UAUA 3T3PB 1YVPA 4W8OA 1W1WA 2VHQA 2XTZA 3BJEA 2NSLA 3OE1A 2JFHA 3P97A 3UW3A 3WWDA 2FA9A 4F38A 2UU9B 3PHBE 4F6LA 4PICA 3ZY5A 3K31A 2RH8A 2ZIXB 4FZVA 5H7XA 1GEGA 3WK8A 5D7NA 3FGPA 1DI0A 1TCAA 2EKZA 2QRJA 2R8OA 4BVAA 4ZICA 3GRCA 4N7RA 3WADA 2BFDA 2ZIWB 2C8JA 3GLQA 1EB9A 5T3YA 3AG6A 2ZYGA 2ZZMA 1BWPA 4D9IA 3K0SA 1YR7A 1H1TA 1U0LA 1K5PA 3SE7A 5JYCA 3DQQA 3JV7A 5CD1A 1DCFA 2FVXA 4G8JA 1YAHA 4YACA 2XIQA 3LBNA 1MIOA 3P27A 1T2EA 5DBIA 3SX0A 4QQFA 1I01A 5LMNB 2JGIA 4PYRA 4LJ9A 4Q12A 1XZDA 3VHXA 5JD5A 3L6UA 4Q4DA 1R4MB 3F5DA 3I5YA 1YKGA 3ZQJA 2ZP1A 2Y67A 3H9QA 1RJGA 3W9YA 5DTJA 5I4BA 1Z4KA 1WCIB 5CYFA 5JAIA 1H5QA 1OT3A 4PGHA 4HNTA 1YCDA 1BJRE 5CT9A 2XECA 4ZYTA 1T3SA 3QUCA 4FWTA 4W5HA 4IRUB 3R3VA 5IC5A 2IDKA 4FFVA 5EPEA 5K8IA 2WABA 2Q3JA 4Z4HA 5FWXB 4WFJA 1K6MA 4GOOD 5LC1A 1Y5MA 1Z12A 4IS3A 5F98A 3I3OA 3ZD6A 2IPXA 2Y1KA 2W2NA 1LLQA 1GFIA 2IDZA 2WZCA 1IZZA 1CIVA 3ED5A 4TVOA 3GIDA 3OLQA 3I58A 1M2OA 2O57A 2G70A 4BUZA 3TG2A 1ZGBA 5E4JA 4ASUD 3U60B 3K1TA 1H93A 5H3CA 4C6HA 1D4OA 3EGDA 2HXGA 3EPLA 1IM5A 1I13A 1VL6A 3V3TA 5HIJA 3RIXA 1M2FA 3OF5A 2O7RA 1UZLA 4Q24A 2A1UA 2C3PA 3IP7A 4LDQA 1VKZA 2A4MA 1MV5A 3LBIA 4AFNA 2D4AA 2EIHA 3BGVA 2X5JO 1QIMA 2IH5A 1V9SA 7MDHA 5KJEA 1PJQA 4XLLA 4N40A 1E2MA 1OXTA 4DRZA 3L0IB 2BE7A 3GJ0A 5KWEA 1OLUB 1EWRA 3GLIE 4IGFA 3I9V1 2QJWA 3EEFA 5DCWA 2HK9A 4R9RA 5FBVB 1FJHA 4HTFA 4EY3A 4YP7A 2QQEA 4J7CA 2VRCA 4MKRA 4X5OA 3NNNA 5JVDA 1DCTA 1UK7A 2I80A 1QHHA 5KX5B 2YXLA 1RU3A 2G25A 4M55A 4O4LA 2MMGA 4GQBA 5EJ2A 1X14A 4TN1A 4C3OB 1ZN7A 3QXCA 5MN6A 3UK7A 1E4VA 3VH4A 1JIXA 1WQ1R 1Z26A 2QU7A 1AZLA 3HB5X 4U6QA 4B2IA 4RVHA 2J3IA 4CDNA 8LDHA 1ZD3A 3KL4A 3OY7A 4YHHB 2YHAA 4GL2A 2H18A 3CX6A 3K1JA 4B2LA 3ENZA 4DQUA 3EFBA 2CLSA 4CQLB 2EEZA 3TM5A 3FFWA 1DARA 1SUCA 1X7WB 3IUJA 4GYWA 1C2YA 4N3GA 4C7XA 4F91B 1IE3A 2VHUA 4U7HA 4KE8A 3OOJA 1FYVA 4EQ6A 4KQKA 4NZPA 4YPOA 3DKPA 5DWVA 1T6BY 3E9CA 3ZHQA 3W4JA 4WINA 5SYNA 3UHAA 1T5LA 2YY7A 3H6KA 1R6BX 4CMEA 2XXAB 4LMPA 3DLIA 3F3SA 2JFFA 4QC2A 4ES6A 3FFAA 3KVOA 2PUTA 3BE6A 4YRLA 5CK5A 5KMGB 3QPCA 5KNBD 1ECFA 1EP2B 1RABA 3WK4A 2OPBA 2JH8A 2VJOA 1ZK2A 3OP4A 4DG9A 4UBLA 3HCEA 3OTIA 3UAGA 2WWRA 1P74A 3CEAA 3K2QA 1CUWA 4M37A 2Q0HA 1CJTC 4B31A 2WQ6A 4D3YA 5H9WA 2BDUA 3PI7A 1I7DA 1E5DA 3IE0A 4RLHA 1NFQA 4Y67A 4CR8A 4PX2A 1WS6A 3KZVA 2QRGA 3E7DA 1P19A 2V54A 3HNPA 5FTMA 3SDBA 4O25A 5IBRA 4YB8A 5DB4A 2IPAB 3AEKA 1JVNA 3AETB 2PT7A 2CLIB 4L8WB 3HCFA 4WZAB 5ELLA 2IUFA 5SY6A 4TT3D 2XUHA 1LX6A 2XWQA 2Y1GA 1RI3A 4MV9A 2FSSA 5ALQA 3EFHA 3GNLA 3JQ9A 4TSFA 2G1AA 1YU6A 4FXPA 2GZSA 1T6YA 2EGUA 4RPGA 6AT1A 1OC4A 1FVXA 4RY2A 2D54A 3MAAC 3IDZA 4YUYA 1T5HX 1I0ZA 3LX6A 3S29A 4O6VA 4BJ3A 2RI6A 3M4YA 2RI0A 2XCUA 2BPOA 3TE6A 1P44A 2AC7A 2P67A 4BZPA 1DO0A 2BMAA 3FZYA 1X7HA 1XSEA 4G84A 2H2IA 3EG9B 4GWGA 4MGEA 3O6VA 4NNPA 2TS1A 5U4XA 3ZU5A 3HRKA 5HKKD 4N6GA 4G0WA 5J4KA 1DT3A 4PQFA 1KC1A 4JH0A 2XITA 5EP1A 4FDUA 4UHEA 4Y2RA 4URYR 1B0PA 2AFHA 1YZQA 1B23P 3DV0A 1EX6A 4RJIA 4F2WA 3NYQA 3KOYA 3W8FA 1T10A 1V16A 3QVTA 3RKRA 3CNHA 3EG5A 2J67A 3II6X 5JQGA 1PFWA 2BFMA 2VTDA 4UM8B 4NONA 1K7YA 1XP5A 2GMWA 2OFPA 2PVPA 4NBWA 3OLYA 4P3YA 1B41A 4FVTA 1EDBA 2G40A 5AVWA 4IIJB 2A33A 3CLUD 1NVDA 4NH4A 3ICEA 2QTGA 1NMYA 4WTOA 4LF8B 4ZQBA 3AFMA 1Q1BA 2BM8A 1E2QA 4JEUA 4FW9A 4JL5A 4L9RA 4TS9A 1H6AA 1D03A 2PMDA 5BR8B 1KFEB 4CM3A 2I33A 3G