1ZO2A

Structure of nuclear transport factor 2 (ntf2) from cryptosporidium parvum
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
124
Chain Sequence
SINLNPQFDQIGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWEDTQFQGQANIVNKFNSLNFQRVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFNDLFRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nuclear transport factor 2
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Transport protein
total genus 38
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1zo2A00
2BMQB 3FH1A 1W02A 3ECFA 3NUVA 3CNXA 4X2HA 3K0ZA 1O7NB 4XDVA 1NWWA 4HM7B 1NDOB 2HMJB 1ASKA 5JPPA 1TP6A 2QIYA 1JB5A 3GWRA 3NHXA 4HM0B 1OHSA 3EJVA 3VGNA 2INXA 2GBWB 4HZ9B 3F40A 1UUWB 3STDA 4HM3B 4L7KA 4J9AA 3OWYA 5EVHA 2HMLB 1OGZA 4MJDA 1E3VA 3ROBA 3LZAA 3DM8A 3CNMA 5D83A 1W6YA 5AIIA 3FKAA 2STDA 3BLZA 2YFJB 2OWPA 3GZYB 3BB9A 1K41A 4GB5A 5AI1A 2F98A 3M8CA 4WYKB 4LEHA 2Z76A 1IDPA 1JB2A 4HM6B 2Z7AA 1OPYA 1E3RA 4R1KA 1W01A 1HKXA 2XSOB 1NU3A 5IF6A 2RGQA 3SOAA 1ULIB 1ZO2A 2XR8B 3DUKA 4XM4A 4R9KA 1GYBA 3NXJA 1O7MB 3G8ZA 8CHOA 4WYKA 3FF2A 3NBRA 3JUOA 3FZWA 2UX0A 2HMKB 3EX9A 4HKVB 1DMNA 1STDA 5CF2A 3EN1B 1GY5A 1O7PB 2XSHB 3EBTA 1JB4A 3T8NA 5KP4A 3RGRA 2BNGA 1JKGB 4N3VA 3H51A 4WWUC 3D9RA 3NV0B 2RCDA 3K7CA 5IG0A 3SEDA 2CKFB 2HMOB 1ISKA 2YFLB 3CU3A 5BVBA 3S5CA 3KSPA 4FCMA 3FGYA 1GY6A 3CPOA 3F7SA 2IMJA 4H3UA 5DRVA 4Q53A 4OVMA 3GRDA 5BXQA 1QMAA 1JKGA 3A76A 3I0YA 5KP3A 3JUNA 4J8TA 2CHCA 1TUHA 3UNLA 3G16A 1O7HB 5IG4A 3NV0A 3MG1A 5JPUA 5CK6A 4OUQA 4L8OA 4U13A 4XBXA 4HM2B 4R9LA 7STDA 4HM4B 3HX8A 2BMRB 3EF8A 3KE7A 5AIGA 3OV4A 1OF5B 3E99A 1WQLB 5AIFA 1VZZA 3MG2A 3RGAA 6STDA 3G0KA 2F99A 2YFIB 1Z1SA 1JN5B 3KKGA 5KP1A 3FLJA 2B1XB 5FW5A 3DZLA 4WP5A 3DMCA 3MYTA 5IENA 5IG5A 4CDLA 1E97A 3OX9A 1Q42A 1OUNA 2XRXB 4FCJA 3UJMA 4HM1B 1OF5A 5AIHA 2GXFA 3FF0A 4PEJA 4RZMA 2HMNB 1OH0A 4K1UA 1Q40B 1JN5A 5G2GA 2RFRA 3B4PA 2A15A 3JUQA 1CQSA 3MG3A 3DXOA 5CXOA 3F8XA 3ER7A 2F86B 1S5AA 3MKIA 1ULJB 1EG9B 1OHPA 4LMIA 3VSYA 3MSOA 4XDWA 1Q40A 2B24B 3FSDA 1QJGA 5IEOA 3MHEA 2GEXA 3F9SA 2K54A 4HVNA 1ZX2A 3EN8A 1OHOA 5IG3A 4X2OA 4XBTA 1O7WB 1DMQA 5AEUB 3H3HA 5D81A 5STDA 3OWSA 3WMDA 1U5OA 3EBYA 3KZTA 4STDA 1DMMA 3EQQB 1EA2A 4HM5B 5HGRA 2GBXB 3IPTA 4XB5A 4IIAA 2Z77A 3HZPA 5D82A 5TGNA 3F8HA 4L8PA 1GY7A 1GS3A 4I4KA 3NM2A 4HJLB 2QGUA 2GEYA 3T8UA 3OWUA 5CF1A 2W2CA 1A2KA 3B8LA 5AEWB 3GZRA 2PZVA 4HZBB 3OXAA 1OGXA 3B7CA 2R4IA 4KVHA 1C7HA 1BUQA 3F14A 3F7XA 3B4OA 2JQ5A 1UUVB 3JUPA 2HMMB 3GZXB 3HK4A 1O7GB 4K1VA 3SOYA 3GZBA 3EC9A 2BMOB 3LYGA 4HM8B 1OCVA 2I9WA 5CLKA 5IERA 3EHCA 4XBYA 1W00A 1SJWA 3JUMA 4ORLA 4LGQA 5IEPA 5DREA 3Q90A 1AR0A
chains in the Genus database with same CATH superfamily
2BMQB 1RLSA 1NO3A 1TFKA 1W02A 3FH1A 3G6E3 1BNRA 3AHSA 3ECFA 1RKYA 3MPHA 1BSDA 1DVDA 1CYUA 1RHLA 4N6LA 3NUVA 3CNXA 1UI8A 4O2HA 4X2HA 3X3ZA 3UL5A 1UCIA 1O7NB 2IYJA 3K0ZA 1NB5I 1FGTA 3CXC2 4XDVA 3SX1A 1PFPA 1KWIA 1NWWA 1RN4A 1LVNA 1B2MA 1J2BA 3KFQC 1K28A 4WFOA 2W03A 4HM7B 1NDOB 3SLUA 2CFDA 1N9JA 1A2PA 1BRKA 1Y4KA 2HMJB 3I553 1ASKA 1SQWA 1BOXA 1GOYA 5JPPA 3SXXA 1RJOA 1TP6A 2RSXA 1DETA 3WDGB 2CWTA 2QEX3 4NREA 3SVAA 1AVKA 2QIYA 1JB5A 1NB3I 3GWRA 3NHXA 4BTXA 4CPKA 4HM0B 1OHSA 2CK3H 1I0VA 2BIRA 1KC84 3EJVA 3VGNA 2INXA 2GBWB 4HZ9B 3X41A 3J7Yd 2F56A 1UUWB 2KRTA 1BSAA 3F40A 4GHOA 3STDA 4HM3B 3CD63 4L7KA 4NPBA 3V99A 1RRHA 5EQLA 1RGKA 4J9AA 2F5WA 3I563 3X3YA 4K90B 3URPA 1A2VA 2HOHA 4K61A 4FMBA 1SARA 3OWYA 3CME3 5EVHA 1BIRA 2HMLB 4KFEA 3FG3A 1RGCA 2CH9A 3AGOA 1IV7A 5G1KA 1QALA 2D42A 3S67A 1OGZA 4MJDA 1E3VA 3ROBA 1N8R4 3LZAA 3DM8A 1RDSA 1BNFA 3CNMA 2CFKA 5D83A 1AQZA 1W6YA 3K63A 2CW9A 3FKAA 5AIIA 2STDA 2Z6BA 2YFJB 3BLZA 2OWPA 1VQ93 3GZYB 1FW7A 1GMRA 3BB9A 1K41A 1MWRA 4GB5A 1DYUA 1MGWA 1R4YA 1Q814 1WMPA 5AI1A 3K9MC 1R4CA 2F98A 4EW5A 3M8CA 4WYKB 1ZGXA 3DGOA 1EKMA 4RNZA 5G1LA 1I3IA 4ZM8A 4LEHA 2CC3A 4EV5A 1TIJA 5AYRB 5JBSA 1GOVA 1BNGA 3S27A 9RNTA 3CCV3 2Z76A 4OK0A 1TU5A 1V74A 5RNTA 1RTUA 2IUKA 1IDPA 2WGOA 1DVCA 1JB2A 4FCZA 1FGMA 4HM6B 2P0XA 2Z7AA 3V92A 1OPYA 1BRIA 1SIHA 3RNTA 1E3RA 4R4KA 1HZ1A 4R1KA 3PS8A 1W01A 1HKXA 2YX9A 2C10A 3VF1A 1LOWA 1LOYA 2XSOB 2KAAA 2JDIH 1NU3A 2ZL8A 5IF6A 2RGQA 3SOAA 1JJ22 1LNIA 1ULIB 1ZO2A 2P05A 2XR8B 2ZA4A 3DUKA 4XM4A 3DGNA 3WOFB 4WHAA 1UUGB 1PYLA 4R9KA 5IEPA 2W04A 1GYBA 2OTL3 3NXJA 3HI7A 1O7MB 1MNLA 2XGLA 1UCLA 3G8ZA 1W6GA 3K5TA 3PZWA 5LC7A 1FUTA 8CHOA 1BRGA 1I2GA 3LT9A 2QA43 2F4YA 4WYKA 1A90A 3FF2A 3NBRA 2CX1A 3JUOA 1TTOA 3FZWA 2UX0A 1ROVA 4HBRA 2HMKB 3EX9A 1MOLA 1BUJA 3Q2PA 2CX0A 3BIRA 3WOEB 1C54A 4HKVB 1BANA 1DMNA 4R80A 5AYSC 6RNTA 2RNTA 3LTCA 1STDA 4LZIA 1SPUA 1JZOA 5CF2A 3QRDA 2GSPA 3EN1B 1YGEA 3AHWA 3V98A 3D79A 5GSPA 3NM7A 1GD4A 1GY5A 1O7PB 1RRLA 3NBBA 2XSHB 3EBTA 1JB4A 3G713 4KZ1A 1D6UA 1VQ83 3T8NA 2ML6A 3LOYA 4JRFA 1X1WA 2E2UA 1PU4A 1B27A 7GSPA 3RGRA 5KP4A 2BNGA 3KN4A 4FMDA 1JKGB 1AY7A 2KF3A 4N3VA 3H51A 1IT7A 2P09A 4WWUC 3LT8A 1Q864 1RNTA 2UUGC 2OQEA 3D9RA 3X3XA 3CCR3 4HAAA 3NV0B 1JBTA 3SYUA 1K9M4 2L1SA 3WHOA 1M904 1GOUA 2RCDA 3BNBA 3K7CA 5IG0A 4FMAA 1VQK3 1UCJA 3EE1A 2BHMA 4CCVA 3WODG 2GU1A 2OOVC 3SEDA 2CKFB 3NQZA 3ZG5A 2OTJ3 2CFWA 5M19A 1HU9A 1LNHA 1TJDA 2HMOB 2OQEC 1ISKA 2YFLB 4IT7A 1I2FA 3PCRA 1FZUA 1UDII 3X42A 3CU3A 3UB1A 5BVBA 4NHFA 3S5CA 6GSPA 2KF6A 3KSPA 3ALAA 3FGYA 2FNQA 4FCMA 1GY6A 1M1K4 3CPOA 1VQO3 1LQMB 2C11A 4KFFA 4BL2A 1TRQA 3CCS3 2W56B 3F7SA 2IMJA 4G1MB 4H3UA 4N6OB 5DRVA 4Q53A 1A67A 3CPW2 2H0IA 4OVMA 2KF5A 3GRDA 2ML5A 3AGNA 5BXQA 1QMAA 3CCE3 1JKGA 3A76A 3I0YA 5KP3A 3JUNA 4J8TA 2CHCA 1YVSA 2KCDA 3N8BA 1TUHA 3UNLA 3BNCA 2WGQA 2ZDJA 3G16A 1O7HB 1L5GB 1T2IA 3BNEA 2O9UX 5IG4A 3NV0A 3MG1A 3ZG0A 4N6V0 2CG0A 2BU4A 1I70A 3D4AA 3N9HA 4BTYA 5BIRA 5CK6A 5JPUA 1B20A 1FUSA 1SIIA 3LH4A 4OUQA 3LTAA 4L8OA 1JZDA 4FR9A 2XFSA 3BU4A 4U13A 2RBIA 1IQXA 2CIUA 4XBXA 4HM2B 3RDEA 1AVLA 2AAEA 3G4S3 2CWVA 3Q1CA 1KSIA 3T0UA 3OW22 1W4NA 2GU3A 3NQYA 2CG1A 1UW1A 4R9LA 5IW9A 1RGAA 1FUWA 7STDA 5ELUA 4HM4B 1BSBA 3HX8A 2BMRB 7RNTA 2LQVA 2OCTA 2W56A 2E2VA 3EF8A 3FG4A 3KE7A 1RNBA 1BSCA 2PNCA 5AIGA 3AMOB 3LMLA 3DGMA 3LTBA 1EQKA 2FGTA 1W6CA 3EB8A 3JVCA 1MWTA 1Q7HA 3QK9A 3OV4A 1GMQA 1OF5B 3E99A 1WQLB 5AIFA 1VZZA 3CCM3 3MG2A 1UGHI 3RGAA 6STDA 3G0KA 2XH9A 1BNJA 2F99A 1JV2B 2KF4A 2YFIB 4AKYA 1BSEA 1RSNA 2BT3A 1Z1SA 1FGQA 1JN5B 3KKGA 1JNQA 1B21A 3HIIA 5HOHA 4N6TA 1W5ZA 5KP1A 3IJEB 1IQYA 1RMSA 1LOXA 1BRHA 3BNDA 2V1LA 2WOFA 1STFI 3HIGA 1IVUA 3FLJA 4TX4A 2B1XB 3GAXA 2SBLA 5FW5A 3DZLA 4MMYB 4WP5A 1BVIA 4J5KA 3DMCA 3MYTA 4O8SA 3Q90A 5IENA 3CCL3 1VQ53 2J8XB 5IG5A 4O02B 1E97A 4CDLA 1US1A 5I97A 4EV2A 1B2ZA 3D5IA 1S723 5M18A 1YIJ3 2W6JH 3OX9A 2W9QA 1Q42A 2XFTA 1OUNA 2XRXB 1QVG2 3WA3A 1RGGA 3AMOA 1VQL3 4FCJA 2W0QA 3DGYA 3UJMA 4HM1B 1OF5A 4DKIA 3DGLA 2P38A 5AIHA 3LTDA 1W2B2 2FXTA 2GXFA 3FF0A 3KSED 4HOHA 4PEJA 5ELJA 4RZMA 1GD3A 4KT3B 2HMNB 1OH0A 5FGOA 2IUJA 1LQGC 1N5HA 4K1UA 1RCLA 1Q40B 3PCSA 1JN5A 1M1XB 1DE3A 2D1WA 4KFDA 1BU4A 4LYLB 2OOVA 1IYYA 1FYSA 5G2GA 3PXMA 1UGIA 2RFRA 1BNIA 5LC6A 1IU7A 1EUIC 2KXGA 2ZHXB 1UCKA 1BRSA 3ZFZA 3B4PA 1Q9EA 2A15A 4O3VA 3JUQA 1K734 3HOHA 1CQSA 3FG1A 4BTWA 1NNVA 3MWZA 1B2XA 4GSPA 3TDGA 1ZS7A 1VQ43 3WA2X 1I0XA 2E2TA 1G02A 3MG3A 1FGOA 1RGFA 1V58A 3DXOA 1BRJA 5CXOA 1RGLA 2CFLA 3F8XA 3PYJA 3ER7A 1U8CB 2F86B 3D3LA 2F5MA 1N8QA 2W9PA 1BGSA 3GSPA 1YJ93 1QAFA 1BNEA 1S5AA 3L0RA 3MKIA 1IT8A 1ULJB 1EG9B 1OHPA 1M9GA 4LMIA 1MWUA 3VSYA 3MSOA 1WMOA 4XDWA 4CJNA 1Q40A 1RCKA 2B24B 2WOHA 3FSDA 1G96A 1QJGA 5IEOA 1JBRA 1NJI4 4MEIA 1B2SA 1IQ8A 1CH0A 1LOVA 3MHEA 2GEXA 3F9SA 3NBJA 4LSOA 2K54A 1CYVA 1VQ73 1ROAA 1JRQA 2Y74A 3O8YA 4HVNA 1MWSA 3U97A 1ZX2A 1N5PA 3EN8A 4N6MA 1BNSA 1OHOA 5IG3A 1BRNL 1VQP3 4X2OA 4XBTA 1O7WB 1CEWI 1DMQA 1D6ZA 1VQN3 1WTHA 5AEUB 3FCSB 3CCU3 3H3HA 5D81A 2XGNA 5STDA 3OWSA 3WMDA 1U5OA 4RNTA 3EBYA 1I2EA 3KZTA 2LYXA 4RBNA 4STDA 1DMMA 3EQQB 1K8A4 1IVXA 4EBGA 1EA2A 1B2UA 2WO0A 1WMNA 1QAKA 1TRPA 4EXRA 1RN7A 1T3BA 4HM5B 5HGRA 3PGBA 2GBXB 1RGHA 2H0GA 3IPTA 4MMXB 4XB5A 4IIAA 1YI23 2Z77A 3HZPA 4IPBA 1Q7Y4 3CCQ3 1YHQ3 2C4BA 5D82A 2AADA 5TGNA 2IA7A 3F8HA 4L8PA 3CC43 4AKZA 1WNHA 3U1WA 1X1YA 1MGRA 4BL3A 2O3OA 4HYZA 1I3FA 3KCHA 2SARA 1YJN3 1GY7A 3IMAB 3A5EA 1GS3A 1T5YA 1N9EA 4FMCA 4I4KA 4JF8A 3D5GA 3NM2A 1FA3A 4HJLB 2QGUA 1VQ63 2GEYA 3T8UA 3OWUA 1D6YA 1BAOA 2W2CA 5CF1A 2UGIA 1FGRA 4I5QA 1IK3A 1VQM3 1B3SA 3CMA3 1A2KA 3B8LA 3S29A 4BU4A 5AEWB 1F8NA 3N54B 1EEJA 1V57A 1OACA 1IVVA 2CWUA 2R41A 3GZRA 1RGEA 3CCJ3 1UI7A 2PZVA 1X1XA 3UL6A 4HZBB 3OXAA 2H0HA 4J5GA 1GMPA 1W7CA 1OGXA 3B7CA 4QWTA 2R4IA 2IY2A 2Y73A 4N6UA 4KVHA 4RNYA 2BO9B 4MMZB 1YGWA 4N6NB 1C7HA 1IVWA 4H61A 1Q824 1BUQA 1TFOA 3F14A 3F7XA 2K3DA 2Q07A 1LRAA 1LXEA 4AEQA 1W2ZA 3X40A 1T2HA 3B4OA 1X1UA 1JBSA 2JQ5A 2L4VA 1I8VA 1UUVB 5BU4A 1QVF2 3JUPA 3S28A 1KD14 2HMMB 1PY3A 2M7OA 2XF3A 1HYFA 3GZXB 1O7GB 3HK4A 5A0OB 4K1VA 3SOYA 1IV9A 8RNTA 4ILFA 3DY5A 3GZBA 3EC9A 1AV4A 2BMOB 3LYGA 3NX0A 1YJW3 1YVBI 2CFGA 4HM8B 1YIT3 1OCVA 2I9WA 4GL6A 5CLKA 1GSPA 3WR2A 5M1AA 2P0MA 5IERA 3EHCA 4XBYA 1VQQA 4BIRA 3CC73 1RN1A 1W00A 1SJWA 1YNVX 3JUMA 1G0TA 3KIIA 4LGQA 4ORLA 2K0MA 4EC6A 4EYCA 2XEPA 5EEOA 3CC23 3DH2A 1KQS2 5DREA 3Q3FA 3LXUX 2MF7A 2MC8A 1AR0A
chains in the Genus database with same CATH topology
2BMQB 1NO3A 1TFKA 1W02A 3FH1A 3G6E3 3ECFA 1DVDA 1RKYA 3MPHA 1CYUA 4N6LA 3NUVA 3CNXA 1UI8A 4O2HA 4X2HA 3X3ZA 3UL5A 3K0ZA 1O7NB 1NB5I 1FGTA 3CXC2 4XDVA 3SX1A 1PFPA 1KWIA 1NWWA 1J2BA 1LVNA 3KFQC 1K28A 4WFOA 2W03A 4HM7B 1NDOB 3SLUA 2CFDA 1N9JA 2HMJB 1Y4KA 3I553 1ASKA 1SQWA 5JPPA 3SXXA 1RJOA 1TP6A 2RSXA 3WDGB 2CWTA 2QEX3 4NREA 3SVAA 1AVKA 2QIYA 1JB5A 1NB3I 3GWRA 3NHXA 4BTXA 4HM0B 1OHSA 2CK3H 1KC84 3EJVA 3VGNA 2INXA 2GBWB 4HZ9B 3X41A 3J7Yd 2KRTA 1UUWB 3F40A 3STDA 4HM3B 3CD63 4L7KA 3V99A 1RRHA 5EQLA 4J9AA 3I563 3X3YA 4K90B 1A2VA 4K61A 4FMBA 3CME3 3OWYA 5EVHA 2HMLB 4KFEA 3FG3A 2CH9A 1IV7A 1QALA 2D42A 3S67A 1OGZA 4MJDA 1E3VA 3ROBA 1N8R4 3LZAA 3DM8A 3CNMA 2CFKA 5D83A 1W6YA 3K63A 2CW9A 3FKAA 5AIIA 2STDA 2Z6BA 2YFJB 3BLZA 2OWPA 1VQ93 3GZYB 3BB9A 1K41A 4GB5A 1DYUA 1Q814 1WMPA 5AI1A 3K9MC 1R4CA 2F98A 3M8CA 4WYKB 3DGOA 1EKMA 4RNZA 4ZM8A 4LEHA 2CC3A 4EV5A 1TIJA 5AYRB 5JBSA 3S27A 3CCV3 2Z76A 4OK0A 1TU5A 1V74A 2IUKA 1IDPA 2WGOA 1DVCA 1JB2A 4FCZA 1FGMA 4HM6B 2P0XA 2Z7AA 3V92A 1OPYA 1SIHA 1E3RA 4R4KA 4R1KA 3VF1A 3PS8A 1W01A 1HKXA 2YX9A 2C10A 2XSOB 2JDIH 1NU3A 2ZL8A 5IF6A 2RGQA 3SOAA 1JJ22 1ULIB 1ZO2A 2P05A 2XR8B 3DUKA 4XM4A 3DGNA 3WOFB 4WHAA 4R9KA 2W04A 1GYBA 2OTL3 3NXJA 3HI7A 1O7MB 1MNLA 2XGLA 3G8ZA 1W6GA 3K5TA 3PZWA 5LC7A 8CHOA 2QA43 3LT9A 4WYKA 1A90A 3FF2A 3NBRA 3JUOA 3FZWA 2UX0A 1ROVA 4HBRA 2HMKB 3EX9A 1MOLA 3Q2PA 3WOEB 4HKVB 1DMNA 4R80A 5AYSC 3LTCA 1STDA 4LZIA 1SPUA 5CF2A 3QRDA 3EN1B 1YGEA 3V98A 3NM7A 1GD4A 1GY5A 1O7PB 1RRLA 3NBBA 2XSHB 3EBTA 1JB4A 3G713 4KZ1A 1D6UA 1VQ83 3T8NA 2ML6A 3LOYA 4JRFA 2E2UA 1PU4A 5KP4A 3RGRA 2BNGA 3KN4A 4FMDA 1JKGB 4N3VA 3H51A 1IT7A 2P09A 4WWUC 3LT8A 1Q864 2OQEA 3D9RA 3X3XA 3CCR3 3NV0B 1K9M4 1M904 2RCDA 3BNBA 3K7CA 5IG0A 4FMAA 1VQK3 3EE1A 2BHMA 4CCVA 3WODG 2GU1A 2OOVC 3SEDA 2CKFB 3NQZA 2OTJ3 2CFWA 1HU9A 1LNHA 2HMOB 2OQEC 1ISKA 2YFLB 4IT7A 3PCRA 3X42A 3CU3A 3UB1A 5BVBA 4NHFA 3S5CA 3KSPA 3ALAA 3FGYA 2FNQA 4FCMA 1GY6A 1M1K4 3CPOA 1VQO3 2C11A 4KFFA 3CCS3 2W56B 3F7SA 2IMJA 4G1MB 4H3UA 4N6OB 5DRVA 4Q53A 1A67A 3CPW2 4OVMA 3GRDA 2ML5A 5BXQA 1QMAA 3CCE3 1JKGA 3A76A 3I0YA 5KP3A 3JUNA 4J8TA 2CHCA 2KCDA 3N8BA 1TUHA 3UNLA 3BNCA 2WGQA 2ZDJA 3G16A 1O7HB 1L5GB 3BNEA 2O9UX 5IG4A 3NV0A 3MG1A 4N6V0 2CG0A 3N9HA 4BTYA 5JPUA 5CK6A 1SIIA 3LH4A 4OUQA 3LTAA 4L8OA 4FR9A 2XFSA 4U13A 3RDEA 1IQXA 2CIUA 4XBXA 4HM2B 1AVLA 3G4S3 2CWVA 3Q1CA 1KSIA 3T0UA 3OW22 1W4NA 2GU3A 3NQYA 2CG1A 1UW1A 4R9LA 5IW9A 1FUWA 7STDA 5ELUA 4HM4B 3HX8A 2BMRB 2LQVA 2OCTA 2W56A 2E2VA 3EF8A 3FG4A 3KE7A 2PNCA 5AIGA 3AMOB 3LMLA 3DGMA 3LTBA 1EQKA 2FGTA 1W6CA 3EB8A 3JVCA 3QK9A 3OV4A 1OF5B 3E99A 1WQLB 5AIFA 1VZZA 3CCM3 3MG2A 3RGAA 6STDA 3G0KA 2XH9A 2F99A 1JV2B 2YFIB 4AKYA 2BT3A 1Z1SA 1FGQA 1JN5B 3KKGA 1JNQA 3HIIA 5KP1A 4N6TA 1W5ZA 3IJEB 1IQYA 3BNDA 1LOXA 2V1LA 2WOFA 1STFI 3HIGA 1IVUA 3FLJA 4TX4A 2B1XB 3GAXA 2SBLA 5FW5A 3DZLA 4MMYB 4WP5A 3CCL3 3DMCA 3MYTA 4O8SA 3Q90A 5IENA 1VQ53 5IG5A 4O02B 1E97A 4CDLA 1US1A 5I97A 4EV2A 1S723 1YIJ3 2W6JH 3OX9A 2W9QA 1Q42A 2XFTA 1OUNA 2XRXB 1QVG2 3WA3A 3AMOA 1VQL3 4FCJA 2W0QA 3UJMA 4HM1B 1OF5A 3DGLA 2P38A 5AIHA 3LTDA 1W2B2 2FXTA 2GXFA 3FF0A 3KSED 4PEJA 5ELJA 4RZMA 1GD3A 2HMNB 1OH0A 5FGOA 2IUJA 1N5HA 4K1UA 3PCSA 1Q40B 1JN5A 1M1XB 2D1WA 4KFDA 2OOVA 5G2GA 3PXMA 2RFRA 5LC6A 1IU7A 2KXGA 3B4PA 2A15A 4O3VA 3JUQA 1K734 1CQSA 3FG1A 4BTWA 3MWZA 3TDGA 1VQ43 3WA2X 2E2TA 3MG3A 1FGOA 3DXOA 5CXOA 2CFLA 3F8XA 3PYJA 3ER7A 1U8CB 2F86B 3D3LA 1N8QA 2W9PA 1YJ93 1QAFA 1S5AA 3L0RA 3MKIA 1IT8A 1ULJB 1EG9B 1OHPA 1M9GA 4LMIA 3VSYA 3MSOA 1WMOA 4XDWA 1Q40A 2B24B 2WOHA 3FSDA 1G96A 1QJGA 5IEOA 1NJI4 4MEIA 1IQ8A 3MHEA 3NBJA 2GEXA 3F9SA 4LSOA 1VQ73 2K54A 1CYVA 1YI23 1ROAA 1JRQA 2Y74A 3O8YA 4HVNA 3U97A 1ZX2A 1N5PA 3EN8A 4N6MA 1OHOA 5IG3A 1VQP3 4X2OA 4XBTA 1O7WB 1CEWI 1DMQA 1D6ZA 1VQN3 1WTHA 5AEUB 3FCSB 3CCU3 3H3HA 5D81A 2XGNA 5STDA 3OWSA 3WMDA 1U5OA 3EBYA 3KZTA 2LYXA 4RBNA 4STDA 1DMMA 3EQQB 1K8A4 1IVXA 4EBGA 1EA2A 2WO0A 1WMNA 1QAKA 4EXRA 1RN7A 4HM5B 5HGRA 3PGBA 2GBXB 3IPTA 4MMXB 4XB5A 4IIAA 2Z77A 3HZPA 4IPBA 1Q7Y4 3CCQ3 1YHQ3 5D82A 5TGNA 2IA7A 3F8HA 4L8PA 3CC43 4AKZA 1WNHA 3U1WA 2O3OA 4HYZA 1YJN3 1GY7A 3IMAB 1GS3A 1T5YA 1N9EA 4FMCA 4I4KA 4JF8A 3NM2A 1FA3A 4HJLB 2QGUA 1VQ63 2GEYA 3T8UA 3OWUA 1D6YA 5CF1A 2W2CA 1VQM3 1FGRA 1IK3A 3CMA3 1A2KA 3B8LA 3S29A 5AEWB 1F8NA 3N54B 2CWUA 3GZRA 1OACA 1IVVA 3CCJ3 1UI7A 2PZVA 3UL6A 4HZBB 3OXAA 1W7CA 1OGXA 3B7CA 4QWTA 2R4IA 2Y73A 4N6UA 4KVHA 4RNYA 2BO9B 4MMZB 4N6NB 1C7HA 1IVWA 4H61A 1Q824 1BUQA 1TFOA 3F14A 3F7XA 2Q07A 1LXEA 4AEQA 1W2ZA 3X40A 3B4OA 2JQ5A 2L4VA 1UUVB 1QVF2 3JUPA 3S28A 1KD14 2HMMB 2M7OA 2XF3A 3GZXB 3HK4A 1O7GB 5A0OB 4K1VA 3SOYA 1IV9A 3DY5A 3GZBA 3EC9A 1AV4A 2BMOB 3LYGA 3NX0A 1YJW3 1YVBI 2CFGA 4HM8B 1YIT3 1OCVA 2I9WA 4GL6A 5CLKA 2P0MA 5IERA 3EHCA 4XBYA 3CC73 1W00A 3KIIA 1SJWA 3JUMA 4ORLA 4LGQA 4EC6A 5IEPA 4EYCA 2K0MA 3CC23 2XEPA 5EEOA 1KQS2 5DREA 3LXUX 2MF7A 2MC8A 1AR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMQ B;  3FH1 A;  1W02 A;  3ECF A;  3NUV A;  3CNX A;  4X2H A;  3K0Z A;  1O7N B;  4XDV A;  1NWW A;  4HM7 B;  1NDO B;  2HMJ B;  1ASK A;  5JPP A;  1TP6 A;  2QIY A;  1JB5 A;  3GWR A;  3NHX A;  4HM0 B;  1OHS A;  3EJV A;  3VGN A;  2INX A;  2GBW B;  4HZ9 B;  3F40 A;  1UUW B;  3STD A;  4HM3 B;  4L7K A;  4J9A A;  3OWY A;  5EVH A;  2HML B;  1OGZ A;  4MJD A;  1E3V A;  3ROB A;  3LZA A;  3DM8 A;  3CNM A;  5D83 A;  1W6Y A;  5AII A;  3FKA A;  2STD A;  3BLZ A;  2YFJ B;  2OWP A;  3GZY B;  3BB9 A;  1K41 A;  4GB5 A;  5AI1 A;  2F98 A;  3M8C A;  4WYK B;  4LEH A;  2Z76 A;  1IDP A;  1JB2 A;  4HM6 B;  2Z7A A;  1OPY A;  1E3R A;  4R1K A;  1W01 A;  1HKX A;  2XSO B;  1NU3 A;  5IF6 A;  2RGQ A;  3SOA A;  1ULI B;  1ZO2 A;  2XR8 B;  3DUK A;  4XM4 A;  4R9K A;  1GYB A;  3NXJ A;  1O7M B;  3G8Z A;  8CHO A;  4WYK A;  3FF2 A;  3NBR A;  3JUO A;  3FZW A;  2UX0 A;  2HMK B;  3EX9 A;  4HKV B;  1DMN A;  1STD A;  5CF2 A;  3EN1 B;  1GY5 A;  1O7P B;  2XSH B;  3EBT A;  1JB4 A;  3T8N A;  5KP4 A;  3RGR A;  2BNG A;  1JKG B;  4N3V A;  3H51 A;  4WWU C;  3D9R A;  3NV0 B;  2RCD A;  3K7C A;  5IG0 A;  3SED A;  2CKF B;  2HMO B;  1ISK A;  2YFL B;  3CU3 A;  5BVB A;  3S5C A;  3KSP A;  4FCM A;  3FGY A;  1GY6 A;  3CPO A;  3F7S A;  2IMJ A;  4H3U A;  5DRV A;  4Q53 A;  4OVM A;  3GRD A;  5BXQ A;  1QMA A;  1JKG A;  3A76 A;  3I0Y A;  5KP3 A;  3JUN A;  4J8T A;  2CHC A;  1TUH A;  3UNL A;  3G16 A;  1O7H B;  5IG4 A;  3NV0 A;  3MG1 A;  5JPU A;  5CK6 A;  4OUQ A;  4L8O A;  4U13 A;  4XBX A;  4HM2 B;  4R9L A;  7STD A;  4HM4 B;  3HX8 A;  2BMR B;  3EF8 A;  3KE7 A;  5AIG A;  3OV4 A;  1OF5 B;  3E99 A;  1WQL B;  5AIF A;  1VZZ A;  3MG2 A;  3RGA A;  6STD A;  3G0K A;  2F99 A;  2YFI B;  1Z1S A;  1JN5 B;  3KKG A;  5KP1 A;  3FLJ A;  2B1X B;  5FW5 A;  3DZL A;  4WP5 A;  3DMC A;  3MYT A;  5IEN A;  5IG5 A;  4CDL A;  1E97 A;  3OX9 A;  1Q42 A;  1OUN A;  2XRX B;  4FCJ A;  3UJM A;  4HM1 B;  1OF5 A;  5AIH A;  2GXF A;  3FF0 A;  4PEJ A;  4RZM A;  2HMN B;  1OH0 A;  4K1U A;  1Q40 B;  1JN5 A;  5G2G A;  2RFR A;  3B4P A;  2A15 A;  3JUQ A;  1CQS A;  3MG3 A;  3DXO A;  5CXO A;  3F8X A;  3ER7 A;  2F86 B;  1S5A A;  3MKI A;  1ULJ B;  1EG9 B;  1OHP A;  4LMI A;  3VSY A;  3MSO A;  4XDW A;  1Q40 A;  2B24 B;  3FSD A;  1QJG A;  5IEO A;  3MHE A;  2GEX A;  3F9S A;  2K54 A;  4HVN A;  1ZX2 A;  3EN8 A;  1OHO A;  5IG3 A;  4X2O A;  4XBT A;  1O7W B;  1DMQ A;  5AEU B;  3H3H A;  5D81 A;  5STD A;  3OWS A;  3WMD A;  1U5O A;  3EBY A;  3KZT A;  4STD A;  1DMM A;  3EQQ B;  1EA2 A;  4HM5 B;  5HGR A;  2GBX B;  3IPT A;  4XB5 A;  4IIA A;  2Z77 A;  3HZP A;  5D82 A;  5TGN A;  3F8H A;  4L8P A;  1GY7 A;  1GS3 A;  4I4K A;  3NM2 A;  4HJL B;  2QGU A;  2GEY A;  3T8U A;  3OWU A;  5CF1 A;  2W2C A;  1A2K A;  3B8L A;  5AEW B;  3GZR A;  2PZV A;  4HZB B;  3OXA A;  1OGX A;  3B7C A;  2R4I A;  4KVH A;  1C7H A;  1BUQ A;  3F14 A;  3F7X A;  3B4O A;  2JQ5 A;  1UUV B;  3JUP A;  2HMM B;  3GZX B;  3HK4 A;  1O7G B;  4K1V A;  3SOY A;  3GZB A;  3EC9 A;  2BMO B;  3LYG A;  4HM8 B;  1OCV A;  2I9W A;  5CLK A;  5IER A;  3EHC A;  4XBY A;  1W00 A;  1SJW A;  3JUM A;  4ORL A;  4LGQ A;  5IEP A;  5DRE A;  3Q90 A;  1AR0 A; 
#chains in the Genus database with same CATH topology
 2BMQ B;  1RLS A;  1NO3 A;  1TFK A;  1W02 A;  3FH1 A;  3G6E 3;  1BNR A;  3AHS A;  3ECF A;  1RKY A;  3MPH A;  1BSD A;  1DVD A;  1CYU A;  1RHL A;  4N6L A;  3NUV A;  3CNX A;  1UI8 A;  4O2H A;  4X2H A;  3X3Z A;  3UL5 A;  1UCI A;  1O7N B;  2IYJ A;  3K0Z A;  1NB5 I;  1FGT A;  3CXC 2;  4XDV A;  3SX1 A;  1PFP A;  1KWI A;  1NWW A;  1RN4 A;  1LVN A;  1B2M A;  1J2B A;  3KFQ C;  1K28 A;  4WFO A;  2W03 A;  4HM7 B;  1NDO B;  3SLU A;  2CFD A;  1N9J A;  1A2P A;  1BRK A;  1Y4K A;  2HMJ B;  3I55 3;  1ASK A;  1SQW A;  1BOX A;  1GOY A;  5JPP A;  3SXX A;  1RJO A;  1TP6 A;  2RSX A;  1DET A;  3WDG B;  2CWT A;  2QEX 3;  4NRE A;  3SVA A;  1AVK A;  2QIY A;  1JB5 A;  1NB3 I;  3GWR A;  3NHX A;  4BTX A;  4CPK A;  4HM0 B;  1OHS A;  2CK3 H;  1I0V A;  2BIR A;  1KC8 4;  3EJV A;  3VGN A;  2INX A;  2GBW B;  4HZ9 B;  3X41 A;  3J7Y d;  2F56 A;  1UUW B;  2KRT A;  1BSA A;  3F40 A;  4GHO A;  3STD A;  4HM3 B;  3CD6 3;  4L7K A;  4NPB A;  3V99 A;  1RRH A;  5EQL A;  1RGK A;  4J9A A;  2F5W A;  3I56 3;  3X3Y A;  4K90 B;  3URP A;  1A2V A;  2HOH A;  4K61 A;  4FMB A;  1SAR A;  3OWY A;  3CME 3;  5EVH A;  1BIR A;  2HML B;  4KFE A;  3FG3 A;  1RGC A;  2CH9 A;  3AGO A;  1IV7 A;  5G1K A;  1QAL A;  2D42 A;  3S67 A;  1OGZ A;  4MJD A;  1E3V A;  3ROB A;  1N8R 4;  3LZA A;  3DM8 A;  1RDS A;  1BNF A;  3CNM A;  2CFK A;  5D83 A;  1AQZ A;  1W6Y A;  3K63 A;  2CW9 A;  3FKA A;  5AII A;  2STD A;  2Z6B A;  2YFJ B;  3BLZ A;  2OWP A;  1VQ9 3;  3GZY B;  1FW7 A;  1GMR A;  3BB9 A;  1K41 A;  1MWR A;  4GB5 A;  1DYU A;  1MGW A;  1R4Y A;  1Q81 4;  1WMP A;  5AI1 A;  3K9M C;  1R4C A;  2F98 A;  4EW5 A;  3M8C A;  4WYK B;  1ZGX A;  3DGO A;  1EKM A;  4RNZ A;  5G1L A;  1I3I A;  4ZM8 A;  4LEH A;  2CC3 A;  4EV5 A;  1TIJ A;  5AYR B;  5JBS A;  1GOV A;  1BNG A;  3S27 A;  9RNT A;  3CCV 3;  2Z76 A;  4OK0 A;  1TU5 A;  1V74 A;  5RNT A;  1RTU A;  2IUK A;  1IDP A;  2WGO A;  1DVC A;  1JB2 A;  4FCZ A;  1FGM A;  4HM6 B;  2P0X A;  2Z7A A;  3V92 A;  1OPY A;  1BRI A;  1SIH A;  3RNT A;  1E3R A;  4R4K A;  1HZ1 A;  4R1K A;  3PS8 A;  1W01 A;  1HKX A;  2YX9 A;  2C10 A;  3VF1 A;  1LOW A;  1LOY A;  2XSO B;  2KAA A;  2JDI H;  1NU3 A;  2ZL8 A;  5IF6 A;  2RGQ A;  3SOA A;  1JJ2 2;  1LNI A;  1ULI B;  1ZO2 A;  2P05 A;  2XR8 B;  2ZA4 A;  3DUK A;  4XM4 A;  3DGN A;  3WOF B;  4WHA A;  1UUG B;  1PYL A;  4R9K A;  5IEP A;  2W04 A;  1GYB A;  2OTL 3;  3NXJ A;  3HI7 A;  1O7M B;  1MNL A;  2XGL A;  1UCL A;  3G8Z A;  1W6G A;  3K5T A;  3PZW A;  5LC7 A;  1FUT A;  8CHO A;  1BRG A;  1I2G A;  3LT9 A;  2QA4 3;  2F4Y A;  4WYK A;  1A90 A;  3FF2 A;  3NBR A;  2CX1 A;  3JUO A;  1TTO A;  3FZW A;  2UX0 A;  1ROV A;  4HBR A;  2HMK B;  3EX9 A;  1MOL A;  1BUJ A;  3Q2P A;  2CX0 A;  3BIR A;  3WOE B;  1C54 A;  4HKV B;  1BAN A;  1DMN A;  4R80 A;  5AYS C;  6RNT A;  2RNT A;  3LTC A;  1STD A;  4LZI A;  1SPU A;  1JZO A;  5CF2 A;  3QRD A;  2GSP A;  3EN1 B;  1YGE A;  3AHW A;  3V98 A;  3D79 A;  5GSP A;  3NM7 A;  1GD4 A;  1GY5 A;  1O7P B;  1RRL A;  3NBB A;  2XSH B;  3EBT A;  1JB4 A;  3G71 3;  4KZ1 A;  1D6U A;  1VQ8 3;  3T8N A;  2ML6 A;  3LOY A;  4JRF A;  1X1W A;  2E2U A;  1PU4 A;  1B27 A;  7GSP A;  3RGR A;  5KP4 A;  2BNG A;  3KN4 A;  4FMD A;  1JKG B;  1AY7 A;  2KF3 A;  4N3V A;  3H51 A;  1IT7 A;  2P09 A;  4WWU C;  3LT8 A;  1Q86 4;  1RNT A;  2UUG C;  2OQE A;  3D9R A;  3X3X A;  3CCR 3;  4HAA A;  3NV0 B;  1JBT A;  3SYU A;  1K9M 4;  2L1S A;  3WHO A;  1M90 4;  1GOU A;  2RCD A;  3BNB A;  3K7C A;  5IG0 A;  4FMA A;  1VQK 3;  1UCJ A;  3EE1 A;  2BHM A;  4CCV A;  3WOD G;  2GU1 A;  2OOV C;  3SED A;  2CKF B;  3NQZ A;  3ZG5 A;  2OTJ 3;  2CFW A;  5M19 A;  1HU9 A;  1LNH A;  1TJD A;  2HMO B;  2OQE C;  1ISK A;  2YFL B;  4IT7 A;  1I2F A;  3PCR A;  1FZU A;  1UDI I;  3X42 A;  3CU3 A;  3UB1 A;  5BVB A;  4NHF A;  3S5C A;  6GSP A;  2KF6 A;  3KSP A;  3ALA A;  3FGY A;  2FNQ A;  4FCM A;  1GY6 A;  1M1K 4;  3CPO A;  1VQO 3;  1LQM B;  2C11 A;  4KFF A;  4BL2 A;  1TRQ A;  3CCS 3;  2W56 B;  3F7S A;  2IMJ A;  4G1M B;  4H3U A;  4N6O B;  5DRV A;  4Q53 A;  1A67 A;  3CPW 2;  2H0I A;  4OVM A;  2KF5 A;  3GRD A;  2ML5 A;  3AGN A;  5BXQ A;  1QMA A;  3CCE 3;  1JKG A;  3A76 A;  3I0Y A;  5KP3 A;  3JUN A;  4J8T A;  2CHC A;  1YVS A;  2KCD A;  3N8B A;  1TUH A;  3UNL A;  3BNC A;  2WGQ A;  2ZDJ A;  3G16 A;  1O7H B;  1L5G B;  1T2I A;  3BNE A;  2O9U X;  5IG4 A;  3NV0 A;  3MG1 A;  3ZG0 A;  4N6V 0;  2CG0 A;  2BU4 A;  1I70 A;  3D4A A;  3N9H A;  4BTY A;  5BIR A;  5CK6 A;  5JPU A;  1B20 A;  1FUS A;  1SII A;  3LH4 A;  4OUQ A;  3LTA A;  4L8O A;  1JZD A;  4FR9 A;  2XFS A;  3BU4 A;  4U13 A;  2RBI A;  1IQX A;  2CIU A;  4XBX A;  4HM2 B;  3RDE A;  1AVL A;  2AAE A;  3G4S 3;  2CWV A;  3Q1C A;  1KSI A;  3T0U A;  3OW2 2;  1W4N A;  2GU3 A;  3NQY A;  2CG1 A;  1UW1 A;  4R9L A;  5IW9 A;  1RGA A;  1FUW A;  7STD A;  5ELU A;  4HM4 B;  1BSB A;  3HX8 A;  2BMR B;  7RNT A;  2LQV A;  2OCT A;  2W56 A;  2E2V A;  3EF8 A;  3FG4 A;  3KE7 A;  1RNB A;  1BSC A;  2PNC A;  5AIG A;  3AMO B;  3LML A;  3DGM A;  3LTB A;  1EQK A;  2FGT A;  1W6C A;  3EB8 A;  3JVC A;  1MWT A;  1Q7H A;  3QK9 A;  3OV4 A;  1GMQ A;  1OF5 B;  3E99 A;  1WQL B;  5AIF A;  1VZZ A;  3CCM 3;  3MG2 A;  1UGH I;  3RGA A;  6STD A;  3G0K A;  2XH9 A;  1BNJ A;  2F99 A;  1JV2 B;  2KF4 A;  2YFI B;  4AKY A;  1BSE A;  1RSN A;  2BT3 A;  1Z1S A;  1FGQ A;  1JN5 B;  3KKG A;  1JNQ A;  1B21 A;  3HII A;  5HOH A;  4N6T A;  1W5Z A;  5KP1 A;  3IJE B;  1IQY A;  1RMS A;  1LOX A;  1BRH A;  3BND A;  2V1L A;  2WOF A;  1STF I;  3HIG A;  1IVU A;  3FLJ A;  4TX4 A;  2B1X B;  3GAX A;  2SBL A;  5FW5 A;  3DZL A;  4MMY B;  4WP5 A;  1BVI A;  4J5K A;  3DMC A;  3MYT A;  4O8S A;  3Q90 A;  5IEN A;  3CCL 3;  1VQ5 3;  2J8X B;  5IG5 A;  4O02 B;  1E97 A;  4CDL A;  1US1 A;  5I97 A;  4EV2 A;  1B2Z A;  3D5I A;  1S72 3;  5M18 A;  1YIJ 3;  2W6J H;  3OX9 A;  2W9Q A;  1Q42 A;  2XFT A;  1OUN A;  2XRX B;  1QVG 2;  3WA3 A;  1RGG A;  3AMO A;  1VQL 3;  4FCJ A;  2W0Q A;  3DGY A;  3UJM A;  4HM1 B;  1OF5 A;  4DKI A;  3DGL A;  2P38 A;  5AIH A;  3LTD A;  1W2B 2;  2FXT A;  2GXF A;  3FF0 A;  3KSE D;  4HOH A;  4PEJ A;  5ELJ A;  4RZM A;  1GD3 A;  4KT3 B;  2HMN B;  1OH0 A;  5FGO A;  2IUJ A;  1LQG C;  1N5H A;  4K1U A;  1RCL A;  1Q40 B;  3PCS A;  1JN5 A;  1M1X B;  1DE3 A;  2D1W A;  4KFD A;  1BU4 A;  4LYL B;  2OOV A;  1IYY A;  1FYS A;  5G2G A;  3PXM A;  1UGI A;  2RFR A;  1BNI A;  5LC6 A;  1IU7 A;  1EUI C;  2KXG A;  2ZHX B;  1UCK A;  1BRS A;  3ZFZ A;  3B4P A;  1Q9E A;  2A15 A;  4O3V A;  3JUQ A;  1K73 4;  3HOH A;  1CQS A;  3FG1 A;  4BTW A;  1NNV A;  3MWZ A;  1B2X A;  4GSP A;  3TDG A;  1ZS7 A;  1VQ4 3;  3WA2 X;  1I0X A;  2E2T A;  1G02 A;  3MG3 A;  1FGO A;  1RGF A;  1V58 A;  3DXO A;  1BRJ A;  5CXO A;  1RGL A;  2CFL A;  3F8X A;  3PYJ A;  3ER7 A;  1U8C B;  2F86 B;  3D3L A;  2F5M A;  1N8Q A;  2W9P A;  1BGS A;  3GSP A;  1YJ9 3;  1QAF A;  1BNE A;  1S5A A;  3L0R A;  3MKI A;  1IT8 A;  1ULJ B;  1EG9 B;  1OHP A;  1M9G A;  4LMI A;  1MWU A;  3VSY A;  3MSO A;  1WMO A;  4XDW A;  4CJN A;  1Q40 A;  1RCK A;  2B24 B;  2WOH A;  3FSD A;  1G96 A;  1QJG A;  5IEO A;  1JBR A;  1NJI 4;  4MEI A;  1B2S A;  1IQ8 A;  1CH0 A;  1LOV A;  3MHE A;  2GEX A;  3F9S A;  3NBJ A;  4LSO A;  2K54 A;  1CYV A;  1VQ7 3;  1ROA A;  1JRQ A;  2Y74 A;  3O8Y A;  4HVN A;  1MWS A;  3U97 A;  1ZX2 A;  1N5P A;  3EN8 A;  4N6M A;  1BNS A;  1OHO A;  5IG3 A;  1BRN L;  1VQP 3;  4X2O A;  4XBT A;  1O7W B;  1CEW I;  1DMQ A;  1D6Z A;  1VQN 3;  1WTH A;  5AEU B;  3FCS B;  3CCU 3;  3H3H A;  5D81 A;  2XGN A;  5STD A;  3OWS A;  3WMD A;  1U5O A;  4RNT A;  3EBY A;  1I2E A;  3KZT A;  2LYX A;  4RBN A;  4STD A;  1DMM A;  3EQQ B;  1K8A 4;  1IVX A;  4EBG A;  1EA2 A;  1B2U A;  2WO0 A;  1WMN A;  1QAK A;  1TRP A;  4EXR A;  1RN7 A;  1T3B A;  4HM5 B;  5HGR A;  3PGB A;  2GBX B;  1RGH A;  2H0G A;  3IPT A;  4MMX B;  4XB5 A;  4IIA A;  1YI2 3;  2Z77 A;  3HZP A;  4IPB A;  1Q7Y 4;  3CCQ 3;  1YHQ 3;  2C4B A;  5D82 A;  2AAD A;  5TGN A;  2IA7 A;  3F8H A;  4L8P A;  3CC4 3;  4AKZ A;  1WNH A;  3U1W A;  1X1Y A;  1MGR A;  4BL3 A;  2O3O A;  4HYZ A;  1I3F A;  3KCH A;  2SAR A;  1YJN 3;  1GY7 A;  3IMA B;  3A5E A;  1GS3 A;  1T5Y A;  1N9E A;  4FMC A;  4I4K A;  4JF8 A;  3D5G A;  3NM2 A;  1FA3 A;  4HJL B;  2QGU A;  1VQ6 3;  2GEY A;  3T8U A;  3OWU A;  1D6Y A;  1BAO A;  2W2C A;  5CF1 A;  2UGI A;  1FGR A;  4I5Q A;  1IK3 A;  1VQM 3;  1B3S A;  3CMA 3;  1A2K A;  3B8L A;  3S29 A;  4BU4 A;  5AEW B;  1F8N A;  3N54 B;  1EEJ A;  1V57 A;  1OAC A;  1IVV A;  2CWU A;  2R41 A;  3GZR A;  1RGE A;  3CCJ 3;  1UI7 A;  2PZV A;  1X1X A;  3UL6 A;  4HZB B;  3OXA A;  2H0H A;  4J5G A;  1GMP A;  1W7C A;  1OGX A;  3B7C A;  4QWT A;  2R4I A;  2IY2 A;  2Y73 A;  4N6U A;  4KVH A;  4RNY A;  2BO9 B;  4MMZ B;  1YGW A;  4N6N B;  1C7H A;  1IVW A;  4H61 A;  1Q82 4;  1BUQ A;  1TFO A;  3F14 A;  3F7X A;  2K3D A;  2Q07 A;  1LRA A;  1LXE A;  4AEQ A;  1W2Z A;  3X40 A;  1T2H A;  3B4O A;  1X1U A;  1JBS A;  2JQ5 A;  2L4V A;  1I8V A;  1UUV B;  5BU4 A;  1QVF 2;  3JUP A;  3S28 A;  1KD1 4;  2HMM B;  1PY3 A;  2M7O A;  2XF3 A;  1HYF A;  3GZX B;  1O7G B;  3HK4 A;  5A0O B;  4K1V A;  3SOY A;  1IV9 A;  8RNT A;  4ILF A;  3DY5 A;  3GZB A;  3EC9 A;  1AV4 A;  2BMO B;  3LYG A;  3NX0 A;  1YJW 3;  1YVB I;  2CFG A;  4HM8 B;  1YIT 3;  1OCV A;  2I9W A;  4GL6 A;  5CLK A;  1GSP A;  3WR2 A;  5M1A A;  2P0M A;  5IER A;  3EHC A;  4XBY A;  1VQQ A;  4BIR A;  3CC7 3;  1RN1 A;  1W00 A;  1SJW A;  1YNV X;  3JUM A;  1G0T A;  3KII A;  4LGQ A;  4ORL A;  2K0M A;  4EC6 A;  4EYC A;  2XEP A;  5EEO A;  3CC2 3;  3DH2 A;  1KQS 2;  5DRE A;  3Q3F A;  3LXU X;  2MF7 A;  2MC8 A;  1AR0 A; 
#chains in the Genus database with same CATH homology
 2BMQ B;  1NO3 A;  1TFK A;  1W02 A;  3FH1 A;  3G6E 3;  3ECF A;  1DVD A;  1RKY A;  3MPH A;  1CYU A;  4N6L A;  3NUV A;  3CNX A;  1UI8 A;  4O2H A;  4X2H A;  3X3Z A;  3UL5 A;  3K0Z A;  1O7N B;  1NB5 I;  1FGT A;  3CXC 2;  4XDV A;  3SX1 A;  1PFP A;  1KWI A;  1NWW A;  1J2B A;  1LVN A;  3KFQ C;  1K28 A;  4WFO A;  2W03 A;  4HM7 B;  1NDO B;  3SLU A;  2CFD A;  1N9J A;  2HMJ B;  1Y4K A;  3I55 3;  1ASK A;  1SQW A;  5JPP A;  3SXX A;  1RJO A;  1TP6 A;  2RSX A;  3WDG B;  2CWT A;  2QEX 3;  4NRE A;  3SVA A;  1AVK A;  2QIY A;  1JB5 A;  1NB3 I;  3GWR A;  3NHX A;  4BTX A;  4HM0 B;  1OHS A;  2CK3 H;  1KC8 4;  3EJV A;  3VGN A;  2INX A;  2GBW B;  4HZ9 B;  3X41 A;  3J7Y d;  2KRT A;  1UUW B;  3F40 A;  3STD A;  4HM3 B;  3CD6 3;  4L7K A;  3V99 A;  1RRH A;  5EQL A;  4J9A A;  3I56 3;  3X3Y A;  4K90 B;  1A2V A;  4K61 A;  4FMB A;  3CME 3;  3OWY A;  5EVH A;  2HML B;  4KFE A;  3FG3 A;  2CH9 A;  1IV7 A;  1QAL A;  2D42 A;  3S67 A;  1OGZ A;  4MJD A;  1E3V A;  3ROB A;  1N8R 4;  3LZA A;  3DM8 A;  3CNM A;  2CFK A;  5D83 A;  1W6Y A;  3K63 A;  2CW9 A;  3FKA A;  5AII A;  2STD A;  2Z6B A;  2YFJ B;  3BLZ A;  2OWP A;  1VQ9 3;  3GZY B;  3BB9 A;  1K41 A;  4GB5 A;  1DYU A;  1Q81 4;  1WMP A;  5AI1 A;  3K9M C;  1R4C A;  2F98 A;  3M8C A;  4WYK B;  3DGO A;  1EKM A;  4RNZ A;  4ZM8 A;  4LEH A;  2CC3 A;  4EV5 A;  1TIJ A;  5AYR B;  5JBS A;  3S27 A;  3CCV 3;  2Z76 A;  4OK0 A;  1TU5 A;  1V74 A;  2IUK A;  1IDP A;  2WGO A;  1DVC A;  1JB2 A;  4FCZ A;  1FGM A;  4HM6 B;  2P0X A;  2Z7A A;  3V92 A;  1OPY A;  1SIH A;  1E3R A;  4R4K A;  4R1K A;  3VF1 A;  3PS8 A;  1W01 A;  1HKX A;  2YX9 A;  2C10 A;  2XSO B;  2JDI H;  1NU3 A;  2ZL8 A;  5IF6 A;  2RGQ A;  3SOA A;  1JJ2 2;  1ULI B;  1ZO2 A;  2P05 A;  2XR8 B;  3DUK A;  4XM4 A;  3DGN A;  3WOF B;  4WHA A;  4R9K A;  2W04 A;  1GYB A;  2OTL 3;  3NXJ A;  3HI7 A;  1O7M B;  1MNL A;  2XGL A;  3G8Z A;  1W6G A;  3K5T A;  3PZW A;  5LC7 A;  8CHO A;  2QA4 3;  3LT9 A;  4WYK A;  1A90 A;  3FF2 A;  3NBR A;  3JUO A;  3FZW A;  2UX0 A;  1ROV A;  4HBR A;  2HMK B;  3EX9 A;  1MOL A;  3Q2P A;  3WOE B;  4HKV B;  1DMN A;  4R80 A;  5AYS C;  3LTC A;  1STD A;  4LZI A;  1SPU A;  5CF2 A;  3QRD A;  3EN1 B;  1YGE A;  3V98 A;  3NM7 A;  1GD4 A;  1GY5 A;  1O7P B;  1RRL A;  3NBB A;  2XSH B;  3EBT A;  1JB4 A;  3G71 3;  4KZ1 A;  1D6U A;  1VQ8 3;  3T8N A;  2ML6 A;  3LOY A;  4JRF A;  2E2U A;  1PU4 A;  5KP4 A;  3RGR A;  2BNG A;  3KN4 A;  4FMD A;  1JKG B;  4N3V A;  3H51 A;  1IT7 A;  2P09 A;  4WWU C;  3LT8 A;  1Q86 4;  2OQE A;  3D9R A;  3X3X A;  3CCR 3;  3NV0 B;  1K9M 4;  1M90 4;  2RCD A;  3BNB A;  3K7C A;  5IG0 A;  4FMA A;  1VQK 3;  3EE1 A;  2BHM A;  4CCV A;  3WOD G;  2GU1 A;  2OOV C;  3SED A;  2CKF B;  3NQZ A;  2OTJ 3;  2CFW A;  1HU9 A;  1LNH A;  2HMO B;  2OQE C;  1ISK A;  2YFL B;  4IT7 A;  3PCR A;  3X42 A;  3CU3 A;  3UB1 A;  5BVB A;  4NHF A;  3S5C A;  3KSP A;  3ALA A;  3FGY A;  2FNQ A;  4FCM A;  1GY6 A;  1M1K 4;  3CPO A;  1VQO 3;  2C11 A;  4KFF A;  3CCS 3;  2W56 B;  3F7S A;  2IMJ A;  4G1M B;  4H3U A;  4N6O B;  5DRV A;  4Q53 A;  1A67 A;  3CPW 2;  4OVM A;  3GRD A;  2ML5 A;  5BXQ A;  1QMA A;  3CCE 3;  1JKG A;  3A76 A;  3I0Y A;  5KP3 A;  3JUN A;  4J8T A;  2CHC A;  2KCD A;  3N8B A;  1TUH A;  3UNL A;  3BNC A;  2WGQ A;  2ZDJ A;  3G16 A;  1O7H B;  1L5G B;  3BNE A;  2O9U X;  5IG4 A;  3NV0 A;  3MG1 A;  4N6V 0;  2CG0 A;  3N9H A;  4BTY A;  5JPU A;  5CK6 A;  1SII A;  3LH4 A;  4OUQ A;  3LTA A;  4L8O A;  4FR9 A;  2XFS A;  4U13 A;  3RDE A;  1IQX A;  2CIU A;  4XBX A;  4HM2 B;  1AVL A;  3G4S 3;  2CWV A;  3Q1C A;  1KSI A;  3T0U A;  3OW2 2;  1W4N A;  2GU3 A;  3NQY A;  2CG1 A;  1UW1 A;  4R9L A;  5IW9 A;  1FUW A;  7STD A;  5ELU A;  4HM4 B;  3HX8 A;  2BMR B;  2LQV A;  2OCT A;  2W56 A;  2E2V A;  3EF8 A;  3FG4 A;  3KE7 A;  2PNC A;  5AIG A;  3AMO B;  3LML A;  3DGM A;  3LTB A;  1EQK A;  2FGT A;  1W6C A;  3EB8 A;  3JVC A;  3QK9 A;  3OV4 A;  1OF5 B;  3E99 A;  1WQL B;  5AIF A;  1VZZ A;  3CCM 3;  3MG2 A;  3RGA A;  6STD A;  3G0K A;  2XH9 A;  2F99 A;  1JV2 B;  2YFI B;  4AKY A;  2BT3 A;  1Z1S A;  1FGQ A;  1JN5 B;  3KKG A;  1JNQ A;  3HII A;  5KP1 A;  4N6T A;  1W5Z A;  3IJE B;  1IQY A;  3BND A;  1LOX A;  2V1L A;  2WOF A;  1STF I;  3HIG A;  1IVU A;  3FLJ A;  4TX4 A;  2B1X B;  3GAX A;  2SBL A;  5FW5 A;  3DZL A;  4MMY B;  4WP5 A;  3CCL 3;  3DMC A;  3MYT A;  4O8S A;  3Q90 A;  5IEN A;  1VQ5 3;  5IG5 A;  4O02 B;  1E97 A;  4CDL A;  1US1 A;  5I97 A;  4EV2 A;  1S72 3;  1YIJ 3;  2W6J H;  3OX9 A;  2W9Q A;  1Q42 A;  2XFT A;  1OUN A;  2XRX B;  1QVG 2;  3WA3 A;  3AMO A;  1VQL 3;  4FCJ A;  2W0Q A;  3UJM A;  4HM1 B;  1OF5 A;  3DGL A;  2P38 A;  5AIH A;  3LTD A;  1W2B 2;  2FXT A;  2GXF A;  3FF0 A;  3KSE D;  4PEJ A;  5ELJ A;  4RZM A;  1GD3 A;  2HMN B;  1OH0 A;  5FGO A;  2IUJ A;  1N5H A;  4K1U A;  3PCS A;  1Q40 B;  1JN5 A;  1M1X B;  2D1W A;  4KFD A;  2OOV A;  5G2G A;  3PXM A;  2RFR A;  5LC6 A;  1IU7 A;  2KXG A;  3B4P A;  2A15 A;  4O3V A;  3JUQ A;  1K73 4;  1CQS A;  3FG1 A;  4BTW A;  3MWZ A;  3TDG A;  1VQ4 3;  3WA2 X;  2E2T A;  3MG3 A;  1FGO A;  3DXO A;  5CXO A;  2CFL A;  3F8X A;  3PYJ A;  3ER7 A;  1U8C B;  2F86 B;  3D3L A;  1N8Q A;  2W9P A;  1YJ9 3;  1QAF A;  1S5A A;  3L0R A;  3MKI A;  1IT8 A;  1ULJ B;  1EG9 B;  1OHP A;  1M9G A;  4LMI A;  3VSY A;  3MSO A;  1WMO A;  4XDW A;  1Q40 A;  2B24 B;  2WOH A;  3FSD A;  1G96 A;  1QJG A;  5IEO A;  1NJI 4;  4MEI A;  1IQ8 A;  3MHE A;  3NBJ A;  2GEX A;  3F9S A;  4LSO A;  1VQ7 3;  2K54 A;  1CYV A;  1YI2 3;  1ROA A;  1JRQ A;  2Y74 A;  3O8Y A;  4HVN A;  3U97 A;  1ZX2 A;  1N5P A;  3EN8 A;  4N6M A;  1OHO A;  5IG3 A;  1VQP 3;  4X2O A;  4XBT A;  1O7W B;  1CEW I;  1DMQ A;  1D6Z A;  1VQN 3;  1WTH A;  5AEU B;  3FCS B;  3CCU 3;  3H3H A;  5D81 A;  2XGN A;  5STD A;  3OWS A;  3WMD A;  1U5O A;  3EBY A;  3KZT A;  2LYX A;  4RBN A;  4STD A;  1DMM A;  3EQQ B;  1K8A 4;  1IVX A;  4EBG A;  1EA2 A;  2WO0 A;  1WMN A;  1QAK A;  4EXR A;  1RN7 A;  4HM5 B;  5HGR A;  3PGB A;  2GBX B;  3IPT A;  4MMX B;  4XB5 A;  4IIA A;  2Z77 A;  3HZP A;  4IPB A;  1Q7Y 4;  3CCQ 3;  1YHQ 3;  5D82 A;  5TGN A;  2IA7 A;  3F8H A;  4L8P A;  3CC4 3;  4AKZ A;  1WNH A;  3U1W A;  2O3O A;  4HYZ A;  1YJN 3;  1GY7 A;  3IMA B;  1GS3 A;  1T5Y A;  1N9E A;  4FMC A;  4I4K A;  4JF8 A;  3NM2 A;  1FA3 A;  4HJL B;  2QGU A;  1VQ6 3;  2GEY A;  3T8U A;  3OWU A;  1D6Y A;  5CF1 A;  2W2C A;  1VQM 3;  1FGR A;  1IK3 A;  3CMA 3;  1A2K A;  3B8L A;  3S29 A;  5AEW B;  1F8N A;  3N54 B;  2CWU A;  3GZR A;  1OAC A;  1IVV A;  3CCJ 3;  1UI7 A;  2PZV A;  3UL6 A;  4HZB B;  3OXA A;  1W7C A;  1OGX A;  3B7C A;  4QWT A;  2R4I A;  2Y73 A;  4N6U A;  4KVH A;  4RNY A;  2BO9 B;  4MMZ B;  4N6N B;  1C7H A;  1IVW A;  4H61 A;  1Q82 4;  1BUQ A;  1TFO A;  3F14 A;  3F7X A;  2Q07 A;  1LXE A;  4AEQ A;  1W2Z A;  3X40 A;  3B4O A;  2JQ5 A;  2L4V A;  1UUV B;  1QVF 2;  3JUP A;  3S28 A;  1KD1 4;  2HMM B;  2M7O A;  2XF3 A;  3GZX B;  3HK4 A;  1O7G B;  5A0O B;  4K1V A;  3SOY A;  1IV9 A;  3DY5 A;  3GZB A;  3EC9 A;  1AV4 A;  2BMO B;  3LYG A;  3NX0 A;  1YJW 3;  1YVB I;  2CFG A;  4HM8 B;  1YIT 3;  1OCV A;  2I9W A;  4GL6 A;  5CLK A;  2P0M A;  5IER A;  3EHC A;  4XBY A;  3CC7 3;  1W00 A;  3KII A;  1SJW A;  3JUM A;  4ORL A;  4LGQ A;  4EC6 A;  5IEP A;  4EYC A;  2K0M A;  3CC2 3;  2XEP A;  5EEO A;  1KQS 2;  5DRE A;  3LXU X;  2MF7 A;  2MC8 A;  1AR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...