1ZP0C

Crystal structure of mitochondrial respiratory complex ii bound with 3-nitropropionate and 2-thenoyltrifluoroacetone
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule keywords FAD-binding protein
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zp0C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zp0C02
2FBWC 3AEBD 4YTPD 3VRAD 1K04A 1QLBC 3VRBD 4KX6C 4YXDD 1ZOYC 3AEBC 2WS3C 3AEDD 4YSYD 4YT0C 1YQ4C 3AEEC 3SFEC 3AE5D 2WDRD 5C2TD 4YSYC 1L0VD 5C2TC 3AE9C 3AECD 2BS3C 1L0VC 3AE4C 5C3JD 3AE1D 4YSZC 3P4RD 3AE8C 3VR8C 2WU5C 3AEGD 1NEKC 4YTND 3B71A 3ABVD 2BS4C 2WQYC 1KFYD 3AEAD 3P4RC 2H88C 1OW8A 1KTMA 4YTPC 3VRAC 2WDVD 3VRBC 4YXDC 1KFYC 3AEAC 3CIRD 3AEDC 3AE7D 3P4PD 1YQ3D 3S9OA 3AE5C 2WDRC 2WDQD 2B76D 3AE2D 3P4QD 1E7PC 4YSXD 2B76C 2WU2D 3AECC 3SFDD 1ZP0D 2WP9D 2G3AA 5C3JC 3AE1C 1NEND 3VR9D 1PV3A 1KF6D 4YTMD 3AEGC 4YTNC 3ABVC 2H89D 3AE3D 4YTMC 3AE6D 2WDVC 2ACZD 2FBWD 3AEFD 3CIRC 4KX6D 3AE7C 3P4PC 1OW6A 1ZOYD 1YQ3C 2WS3D 1K05A 3AEFC 2WDQC 3AE2C 4YT0D 1YQ4D 3P4QC 3AEED 3SFED 4YSXC 2WU2C 2BS2C 1OW7A 3SFDC 1ZP0C 2WP9C 3P4SD 3AE9D 1NENC 3VR9C 1KF6C 3AE4D 4YSZD 3P4SC 3AE8D 3VR8D 2WQYD 2WU5D 2H89C 3AE3C 1NEKD 3AE6C 2H88D 2ACZC
chains in the Genus database with same CATH superfamily
4GT1A 4ZNCA 3VRBD 1MUUA 4HJGH 1FAVA 3I56P 2KS1A 3NMDA 4KT0J 1LGHB 1KB9I 5KJ7A 1NTZK 4R4MA 3VMZA 1NWQA 2QA4P 3H1IE 3CWBG 1KILA 2I8DA 5AW5B 4Y99C 2QSIA 2BASA 4IFFA 4TT3H 1PPJD 2FXOA 1L4AD 2J5UA 1FJKA 1HJBA 2E74B 3L72D 3VRBC 5AVXB 3AEAC 3CX5E 2C0XA 3CPWO 3WUVA 1FZFA 3P4PD 1M1JA 3TK1A 1BGYG 2O01N 3P4QD 2ZYGA 4WWIA 2WSFH 3Q2YA 1N2DC 1GDTA 1SQBE 3KZIE 1ZP0D 1M7LA 3BCCD 2PGDA 3CCJP 1JO5A 4ZKPA 1L4AC 1PZQA 3AE3D 3TF5A 1OFCX 4YTMC 1CSBA 3CWBJ 3AEFD 2J59M 2XKMA 3P4PC 4EI2A 3P8MC 3P4QC 1SFCB 3LIEA 3PTZA 4RESB 2ZJSE 1ZP0C 3AE4D 4BXLA 2YIUC 2B87A 5K5GB 2WT7A 3USSA 3V5BA 4DDIA 3AE3C 1OMIA 4WVZA 3L71J 4D6TG 3F89A 2AXTH 1BE3E 1JMMA 1G1IA 3B5ND 5KJ7D 1KQGB 5H2FH 2FYUD 1ZR2A 4PD4I 4BRYB 1X8YA 2RH0A 1OX3A 1VDFA 1LWUB 3AE4C 3W68A 1E79H 3CCQP 3V2NA 4RKUJ 3P8CE 5GTIH 1IFNA 1U7JA 4K35A 1LTIC 1JUNA 4KHXA 1FC2C 4L75A 2HODA 3H1JG 4HKZH 4I6MC 3L37A 3OAKA 2B76D 2E75B 5KJ7C 2KB7P 2K9JA 4D6TJ 1VF5D 1SQPD 3EWKA 1NO4A 4H0LB 1LT9C 2JKVA 3HTKA 3GHGB 5GTHE 3H1HE 3H32B 2KOGA 3HE5B 3NTNA 3TGUG 1YJWP 1J1EB 1M1JC 5AW4B 1VQ8P 4N78D 2YKQA 4MN4C 3H25A 3OW2O 3ZDMA 3AEED 1VF5C 2CK3H 3H1KG 1KILB 2FYUK 2B88A 1EZVG 2D2CB 2Y9YA 1PP9D 1L2PA 2C9NY 1EDKA 1KV4A 3B4SA 3SSUA 1T6AA 1NTZE 3L71E 1SS1A 3AEEC 1M56D 3IAOA 2P10A 3KYQA 3U1CA 3WUTA 1AQ5A 1OVVA 3G9RA 2V4HA 1GU4A 1ZMEC 3H1KJ 3O6QA 1ZRTD 4I7ZC 2Z5HA 3H1LE 5AW8B 1JTHB 2NPSA 4NPDA 4PJ0H 4GOEA 1PFIA 4U3FD 1EDLA 2O3JA 2PP6A 3FGAD 2WTYA 3C9IA 3TNUA 4W7YA 3D71A 1BCCD 1P84I 1VQ5P 3CD6P 2E76D 2I1JA 4WB4A 1T3UA 3PLNA 1USEA 3CLQA 3A2AA 2WZ7A 3H6PA 3PH0A 4DJGA 3L74D 5APUA 1E5WA 1PPJE 2M5AA 1JB0J 5DJUB 1SQVD 5KAIH 1GL2B 2E76C 1G2CA 2ZVNB 5B5EE 1KQLA 3L72E 1USDA 3AEBD 2ZFYA 4YXDD 2A45I 3W67A 4YSYD 2KUBA 1VQ4P 2OYIA 4XE5B 2ZAEB 3S4RA 1JMBA 3BCCE 1HVVA 4N6JA 3L73D 4WY4B 1T2KD 4UB6E 2IFNA 1VQOP 4YXDC 3PJSK 2N9BA 2G8YA 1S9KD 1VQNP 1FZBA 4OGQD 3P32A 3D70A 1PP9J 2P7JA 5KLVG 3RK3B 5AW7B 1KQSO 2Z4EA 3RK2B 4C7NA 3RL0D 2NPSC 1T2KC 1SQVK 2ZFCA 1HTLC 2WS3D 1EDJA 1NU1D 4OGQC 1FZCB 2FYUE 2DW3A 3V2PA 3P4SD 3BATA 4PV1B 2LXCB 3A5TA 1WT6A 5KKZB 3RL0C 5KAFE 5KLVJ 1FOSE 3VONA 2IX7C 3L75E 3VRAD 4UB8E 1BCCJ 2Q5UA 3O8ZA 1AV1A 4BWNA 2WS3C 1NTKG 1SQPE 1HBWA 3CCVP 1NOHA 1SQBG 2R44A 1ZW0A 4EDFA 2OTLP 1U57A 1QL1A 2BS4C 1ZR4A 2NRGA 1KFYD 1R5LA 3CX5I 3VRAC 2QJPC 5APTA 3MP7B 3H1IJ 4N78E 1FDOA 2Y0CA 1RE3A 2OYIC 3OJAB 2O1JA 2YKOA 1SQVJ 1X22A 1Z56A 2Y9ZA 1AVOA 1FDIA 2BEZF 1Q86Q 3VR9D 3MTUE 1KF6D 4XA4A 1NKNA 2A06D 3VMYA 1PP9E 2N1TD 3V2QA 1M1KQ 3MIWA 5AVUB 1IZNB 2IBZE 1ZOYD 1AVYA 1YBKA 3EFGA 1L0LE 1BE3G 2RKLA 3K5BA 3SFED 4BRYA 1K8AQ 3JCUH 1YITP 1OW7A 1VL2A 1BGYD 2FFDC 1YHQP 3G4SP 3VR9C 1KF6C 1VQMP 2WU5D 1L0ND 1ZRTE 2E42A 2E74D 1KD1Q 2N1TC 1KORA 3HUSB 3CC4P 1WRGA 4U3FE 3GF7A 1ZOYC 4IL6X 1N7LA 3SFEC 2AXTE 4M3LA 1BCCE 4L76A 3GHGA 2WVRA 5C2TC 4OWFA 3AECD 5H2FE 1FZGA 5AW6B 2W8ZA 3H32A 1GW4A 1BE3J 2V7QJ 2W6AA 3HE5A 2C0WA 2GA1A 5L8RJ 2WU5C 2WSSH 5AVSB 3H1HG 2E74C 2RMZA 3AEAD 3M9QA 5GTIE 1MZ9A 1KZUB 3WMM0 1GK4A 3MD0A 1SFCD 4DT0A 2Q7CA 2QJKB 2IPPA 3AECC 1Q2NA 3L74E 3M06A 1K9MQ 2WSCH 4YTMD 1SQVE 1OVRA 2H89D 1NAYA 1S5LH 4ASWA 1L0NK 5KLIB 3NXSA 2OYOA 1RE3C 1SFCC 4LDTA 3H1HJ 3FXDA 3VP8A 1K05A 1NTZG 2QVAA 1IK9A 3L71G 1T8ZA 2WPSA 3QH9A 1HWTC 1FU1A 2KXPB 3L73E 1JTHA 2KNCB 2H89C 3TYYA 1W2EA 1BDCA 4YTPD 1EQ7A 1IFIA 2YKPA 1S9KE 2NZ2A 1R8EA 5APXA 2XNDH 4H0LD 1LWUC 3HD7B 1IC2A 1XTGB 4B86A 1VQ7P 2OTKE 3D6ZA 3SWYA 1NTZJ 4JQ0D 2M8RA 2K37A 3M9HA 2CPSA 4H13B 3CL3D 1S5LX 3KDPB 4YTPC 2HFED 3N7NA 2Q6QA 2E75C 3M9BA 3G71P 4DZOA 4PJ0E 4K3AA 2K1AA 1NU1E 1RE4C 3I55P 1M57D 4H0LC 3H1LJ 1L0NJ 5APQA 3GHGC 1KILD 2QJYB 2ZYAA 4AYCA 1LP1A 3ITKA 2D2CD 1M8OB 4LLHA 1M90Q 5AVVB 1GL2A 2AEFA 2JWDA 1PPJG 5CBOA 3L75D 1ZV8A 3L36A 2ACZD 2WSEJ 2BCCD 4KJMA 1KILC 4W80A 4EOTA 2D2CC 1N7SB 1KYOH 5B66H 3CXHH 4JF7A 5KTBA 4YSZD 4WY4A 5AW3B 5TJHA 1FE6A 1NVOA 4JYBA 5KAIE 2ACZC 1JY2P 2HYNA 1QLBC 3G6EP 2FYNB 1SQQD 2ZXEB 1HJ0A 3BASA 2KP8A 5AW0B 2QEXP 4LC1A 3Q5SA 1AQTA 3L72J 2ZT9B 3CC2P 3WU2H 3PHLA 4YSZC 2QM7A 2A06E 1N86A 3T97B 3B5NB 2Q1KA 3AEGD 2O01J 1JCCA 1KTMA 3EFFK 1LT9B 2IBZD 3BCCJ 1URQB 4GOFA 1S1CX 1L0LD 1FZCA 3S9OA 4C46A 1YJNP 2FXPA 1NTMD 1SLQA 1J1DB 2FYUG 1SQPK 1BGYE 1RQVA 4DHJA 4GDOA 1GL2D 1PV3A 3V4QA 1L0NE 3AEGC 1NJIQ 1ZLLA 1TU3F 2N9YB 2GM4A 2PRRA 4RJTA 1MV8A 3SWFA 3A0BH 2P58A 1SQQK 2BS2C 4Z1MH 1G1JA 1GL2C 4WY4D 5BVZA 2FYUJ 2SPZA 4YPCA 2M3EA 4HYTB 3GMAA 1FZAA 1W5CE 2A45G 3VTPC 1Y9BA 2Q3IA 3M0DA 1L0LK 3RK3D 1FDMA 2B9BA 1RH5B 1LP1B 1KB9H 2E5TA 4I2LC 3L75J 4N3YB 2QRXA 3HE4B 3RK2D 2IZ0A 1YTZI 1UIXA 1NTMK 5CMZA 5AVZB 2YO2A 1L0VC 5CCHA 1RY3A 4WY4C 1JEKA 1KYOD 1SQPJ 1PP9G 3B71A 2BCCJ 3CXHD 3AE7D 2HLOA 1QLED 4HB1A 3RK3C 2PFXA 1Q81Q 4IL6E 4PV1D 4YSXD 2WSCJ 3RK2C 3L70D 2WU2D 1IO4A 3RBXA 1DD4A 2WP9D 1NTKD 3PP5A 1SVFA 2NPSD 2KI7B 1JNMA 1EC5A 1SQQJ 3U59A 1GD2E 3HUSA 2H7HA 1RF1B 3GW6A 3F5HA 2WSFJ 4AUWA 2IBZI 4AQRD 2FBWD 1FZCC 4U3FG 2RN0A 2MKVA 3AE7C 3IFMA 1SQXD 2KIKA 1BSHA 1N73B 2R3SA 1NHLA 4GKGA 2FY8A 4PV1C 4YSXC 3BRTB 2WU2C 1BCCG 3I5CA 1LT1A 2WP9C 3JCUE 1HGVA 2K9YA 1BSNA 1K73Q 1L0LJ 2AXCA 3L35A 1YIJP 2QE7H 1NEKD 2FKWB 2YNYA 1QVGO 1GZLA 3P4RD 1KFNA 4EYYQ 2FBWC 2KZJA 1IK7A 3KPEA 3R2PA 2B89A 2O1KA 3E1RA 1KILE 1H0TB 1FS0E 4PD4H 1AFOA 3H1IG 3FWLA 4U3FJ 2JO1A 2BS3C 1GU5A 2I1KA 5APVA 3L74G 3LW5H 2AEJA 2P1JA 1AJYA 1LTBC 1SQVG 1NEKC 2WPVB 4LGDE 1S72P 2P2UA 1Y8AA 3P4RC 1JCDA 1D7MA 2WPRA 5APSA 2XDJA 2WDVD 2R3CA 3M0DC 4GIFA 2BCCE 2H43A 1LTAC 3AE2D 2CPBA 2M3BA 1SQXK 1T3JA 2W6JH 1S2EA 3CCRP 3CCLP 3IN6A 3WUUA 5CCGA 1KB9D 1NEND 1AA0A 2KNCA 1FJPA 1YJ9P 1KYOI 2FYZA 1LTJB 1HH0A 2L5GB 3L74J 3N4XA 4IL6H 2WDVC 3G3ZA 2C9LY 1SQQE 1S5LE 3RL0B 3HD7A 1NU1K 3CMEP 3AE2C 1DIPA 1NYHA 3L4FA 2OARA 1NENC 3M91A 3HUSC 3CWBD 3VR8D 1Q90D 3RBZA 2OGUA 1H88A 2H88D 1KFMA 2HR3A 1L4AA 4DHIB 3L73J 2GUSA 1NTME 4OH8B 2R32A 5C2TD 2OYHB 3A0HH 1W2BO 3LIDA 1KN7A 2WPQA 1S3JA 3BRVB 4IOIH 5BU5A 1EXJA 3VR8C 1SQXJ 2H88C 3GG2A 1PGJA 2KSJA 4R4LA 5AVWB 1GW3A 2WDQD 1N7SA 2P67A 3RL0g 5CCGD 5AW2B 2G3AA 1P84H 1NU1J 1LTSC 4PD4D 1QVFO 1YYCA 1LNQA 3B8EB 1PGQA 2ITAA 3RGUA 3AE6D 3NFQA 4H44B 4D6TD 2L91A 1BDDA 3HD7D 3RK3E 2WDQC 1YQ4D 2N1TB 1H89A 4W7ZA 2W6BA 1RF0A 1IFPA 1YI2P 2PAJA 1OXZA 5CCGC 3T97A 1FOSF 3B5NA 4H13D 1KYOE 5B66E 2A06G 3D6YA 4A7PA 3CXHE 2IDBA 3VMAA 3CCMP 3U1AA 4ASVA 1LT9A 1NKZB 1JY2N 3BVHA 1URQA 5E79H 2WQYC 3AE6C 1VQ6P 2KLVA 3C1LA 3KXDA 2LXBA 1OVUA 2HPCB 1OWAA 3H1JD 3HD7C 2A45H 3AEDD 3II6A 1YQ4C 5TISH 3CCEP 3L70E 1NTKE 3VMXA 4H13C 1CI6B 3S1KA 2FXMA 3WU2E 3H1LG 1JOCA 1L0NG 1QX8A 2E75D 5APYA 1KQFB 1FZEA 3TGUD 4Y99B 3GF3A 5CJ0A 3CIRD 1SQXE 1CW5A 3AEDC 2QJYC 1N7SD 2WITA 5AVTB 1MFZA 3H1KD 1DH3A 1EZVD 1IJDB 1VPCA 3FXEA 3EQ2A 1BGYJ 4DDGA 3MUDA 2KK7A 3E7KA 1L4AB 3CIRC 3JSVC 1H8AA 4KX6D 2XZRA 2ZT9D 3AEFC 2KZIA 2POHA 2XNXA 4YT0D 1N7SC 3A0BE 4DHZA 3HE4A 1QGKB 3SWKA 5BU8B 4CPGA 2QG4A 4TLFA 1J1EC 1GTWA 1JY3P 1EDIA 2M0BA 3L72G 1P84D 3KQGA 1URQD 2FYNC 1ZXGA 2YIUB 4RO0A 1K04A 4KX6C 1LJ2A 4JBZA 2ZT9C 4YT0C 2JEEA 2WDRD 1RF0C 2YMKA 3LW5J 3BCCG 3B5NC 1KB9E 1RF1A 1URQC 4FJVA 1VQLP 3P7KA 3M0AA 4C7RA 1CZQA 3CX5H 2WMMA 2JP3A 3HRNA 1J1DC 1N73A 1N8RQ 4U7JA 2KYVA 2WDRC 5CHXA 5AW1B 1S4XA 3KZIH 2B76C 2KS1B 1TFFA 3CWBE 1MFTA 3H1JJ 1A02F 2YMYA 2XV5A 2R5BA 3VYIA 3A7OA 1NAFA 3PRJA 2K3RA 1H0TA 1M1JB 2W27A 3TSIA 2MJZA 3TGUJ 3AE9D 1VF5B 3Q3DA 1EZVI 4EIJA 4JYCA 2IFMA 2YXQB 3AE8D 1NGMB 2UWJE 2XU6A 3L75G 3MUDC 1DD3A 1VQPP 4L74A 3VN0A 2KLUA 3IF4A 2V7QH 1EXIA 3V2RA 1SQPG 3V6IA 1J2JB 2BCCG 1UIIA 3AE5D 2GUVA 1L0VD 5KLVD 2YO3A 3AE9C 4NPEA 2KSEA 4PD4E 1JY3O 1R5SA 1DX7A 3AE1D 1LTJA 3AE8C 2YXRB 3TDKA 4YTND 2B87B 2WT7B 2OQQA 3QWOC 1Q82Q 4D6TE 3CCUP 2K88A 1SQQG 4I7ZB 4I1LA 2W83C 1YQ3D 3AE5C 3VOPA 3MHVA 3VP9A 2AEMA 4Y28J 3SFDD 5GTHH 3AE1C 1RF1C 2OTJP 1JY2O 3H1ID 4ZKUA 4YTNC 2E5YA 3FWNA 2BEQD 4DCKA 3Q5RA 2IBZG 3GLMA 3CI9A 3FX0A 2IYOA 1N73C 3H1JE 1L0LG 3MGNA 3CX5D 1YQ3C 2ZVOB 2HODB 2OYHA 1VQKP 1NTMG 1IFJA 3KHUA 3SFDC 2K9JB 1SQBD 1KC8Q 2VRSA 1X9VA 5KLVK 3HTKB 1QEXA 2Y0EA 4I6LA 3TGUE 1DEBA 1Q7YQ 2E76B 3AEBC 5KKZC 1X0TA 1QL2A 4YSYC 3H1KE 5M1BA 3A0HE 2LKMA 1EZVE 1YTZT 1NTMJ 2FFDA 3Q1MA 3Q5PA 2ZYDA 1Y47A 1HUCA 2N1TA 4XFJA 1BE3D 5CCHD 1IFMA 1E7PC 4WBAA 2W90A 1NTKK 5EFWB 1LTJC 3IR9A 2JJLA 5CJ4A 1HGZA 2WSEH 1P84E 1SQBK 3P8CD 1VQ9P 1X79B 1XTCC 3OA7A 2HPCA 3O6QB 1ZN5A 2NPSB 2IZ1A 4IFMA 1RQUA 1OW6A 1RHZB 5CCHC 4QMAA 5CBNA 3E1IA 3L70G 1CI6A 3TNUB 4GODA 4OGQB 1OIPA 4ZMDA 3L73G 3R4YA 3CXHI 4NPFX 1GK6A 2JWAA 4O9BA 4YXWH 3P4SC 2E43A 5B5EH 1PL5A 1U7MA 3H1HD 1PGOA 2Z5IA 1DEEG 5E79E 1PGPA 2OYHC 1SQXG 2JR8A 2O01H 1SFCA 5TISE 1NH4A 2J58A 5AVRB 5C3JD 2Y0DA 5C39A 4H44D 3L70J 2HG5D 2QIWA 4UB6H 1A02J 3ABVD 3JC22 2M5AB 2ZXXA 1NTKJ 1OW8A 1FBMA 1NU1G 2JDIH 1G2CB 1KFYC 3C8VA 2Q9IA 1HF9A 1SQBJ 2QM8A 2QJPB 1NTZD 3L71D 2R5DA 1SP4A 5AVYB 3V4WA 4IFDK 2H8PD 2OYIB 4JPZB 5C3JC 3A3YB 3CCSP 1LWUA 1IFDA 1PIXA 4L73A 2Q3EA 3CMAP 4H44C 2IYPA 1LTGC 3ABVC 5DJTB 1OZHA 3H1LD 2QJKC 1WMKA 3CC7P 1GMJA 4DOJA 2LR2A 5AVQB 1MKMA 1KMIZ 1LTTC 3UIAA 2WWWA 5KLVE 3MZWB 5APWA 5AW9B 5KLIC 1RE4A 1JY3N 5KAFH 1JM0A 2FFDB 2WQYD 4OVNF 4C7NB 4HH2A 4UB8H
chains in the Genus database with same CATH topology
2FBWC 3AEBD 4YTPD 3VRAD 1K04A 1IK7A 3GF7A 1QLBC 1EXIA 4KX6C 3VRBD 4YXDD 2E76B 2NZ2A 1ZOYC 1R8EA 2ZT9C 3AEBC 4IL6X 1Y9BA 2WS3C 3AEDD 4YSYD 4YT0C 5KKZC 1YQ4C 3AEEC 3SFEC 3AE5D 3IAOA 1HJ0A 2WDRD 5C2TD 4H0LD 1KILE 2P10A 3Q5SA 2YMKA 4KT0J 4YSYC 1L0VD 1KQGB 3LW5J 2ZT9B 4R4MA 5C2TC 2JO1A 3AE9C 5M1BA 1UIXA 2BS3C 3G9RA 3AECD 1L0VC 3AE4C 4H13C 3D6ZA 5C3JD 3AE1D 2V7QJ 4YSZC 1EXJA 1ZMEC 3P4RD 4RKUJ 3AE8C 5L8RJ 3T97B 1AJYA 3VR8C 2WU5C 1U57A 2QSIA 3AEGD 2E74C 1NEKC 3B71A 4H44D 4TT3H 2QIWA 2WPVB 3ABVD 2O01J 3O6QA 4H13B 2BS4C 2E75D 3AE6C 4I7ZC 1KQFB 1KFYD 2OQQA 3AEAD 2H88C 1S5LX 2J5UA 1OW8A 3Q1MA 1KTMA 4YTPC 3P4RC 3VRAC 2QJPC 3Q5PA 2E74B 2E75C 2WDVD 3VRBC 4YXDC 1S1CX 2JP3A 3C8VA 3AEAC 3GF3A 4R4LA 1HF9A 4I7ZB 1KFYC 1FDOA 3CIRD 2G8YA 3AEDC 2QJYC 3AE7D 3P4PD 4XFJA 1YQ3D 3S9OA 3AE5C 4U7JA 2WDRC 2WDQD 2B76D 2E75B 4H0LC 3AE2D 2FXPA 3P4QD 4OGQD 3FGAD 3D70A 1VF5D 4PV1D 3Q2YA 1RQVA 3EWKA 2WSCJ 1E7PC 4YSXD 2B76C 2WU2D 3D71A 1FDIA 3AECC 4Y28J 2D2CD 3RL0g 3SFDD 3IN6A 1DD4A 4H0LB 1ZP0D 2BEZF 2G3AA 2WP9D 5C3JC 3AE1C 4GDOA 1NEND 3VR9D 1PV3A 1KF6D 4YTMD 1PIXA 3AEGC 4YTNC 4H44C 3ABVC 1TU3F 2H89D 3AE3D 4YTMC 2E76D 2BEQD 2WSFJ 3Q5RA 2QJKC 3GLMA 3AE6D 2WDVC 2ACZD 2FBWD 1WMKA 4H44B 1GMJA 3AEFD 3CIRC 2MKVA 1RQUA 4KX6D 3AE7C 3P4PC 1OW6A 1ZOYD 1MKMA 1YQ3C 2ZT9D 2WS3D 3RK3E 1K05A 2WSEJ 3AEFC 1KMIZ 3AE2C 2WDQC 4YT0D 3H25A 4OGQC 1YQ4D 3AEED 3P4QC 3SFED 1DIPA 4YTND 1VF5C 4PV1C 1NYHA 4YSXC 2WU2C 2BS2C 1OW7A 1VL2A 2D2CC 3SFDC 1ZP0C 4Z1MH 2WP9C 3P4SD 4OGQB 5KLIC 3AE9D 1NENC 2K9YA 3R4YA 3VR9C 1VF5B 4PV1B 1KF6C 4H13D 3AE4D 3Q3DA 4YSZD 3P4SC 2D2CB 2YIUC 3D6YA 3AE8D 3VR8D 1NGMB 2IDBA 2WQYD 1JB0J 1Q90D 2WU5D 1PL5A 1ZRTE 2H89C 2E74D 1OMIA 1DD3A 3AE3C 1NEKD 2E76C 2FYNC 1KORA 2WQYC 2H88D 3GMAA 2ACZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW C;  3AEB D;  4YTP D;  3VRA D;  1K04 A;  1QLB C;  3VRB D;  4KX6 C;  4YXD D;  1ZOY C;  3AEB C;  2WS3 C;  3AED D;  4YSY D;  4YT0 C;  1YQ4 C;  3AEE C;  3SFE C;  3AE5 D;  2WDR D;  5C2T D;  4YSY C;  1L0V D;  5C2T C;  3AE9 C;  3AEC D;  2BS3 C;  1L0V C;  3AE4 C;  5C3J D;  3AE1 D;  4YSZ C;  3P4R D;  3AE8 C;  3VR8 C;  2WU5 C;  3AEG D;  1NEK C;  4YTN D;  3B71 A;  3ABV D;  2BS4 C;  2WQY C;  1KFY D;  3AEA D;  3P4R C;  2H88 C;  1OW8 A;  1KTM A;  4YTP C;  3VRA C;  2WDV D;  3VRB C;  4YXD C;  1KFY C;  3AEA C;  3CIR D;  3AED C;  3AE7 D;  3P4P D;  1YQ3 D;  3S9O A;  3AE5 C;  2WDR C;  2WDQ D;  2B76 D;  3AE2 D;  3P4Q D;  1E7P C;  4YSX D;  2B76 C;  2WU2 D;  3AEC C;  3SFD D;  1ZP0 D;  2WP9 D;  2G3A A;  5C3J C;  3AE1 C;  1NEN D;  3VR9 D;  1PV3 A;  1KF6 D;  4YTM D;  3AEG C;  4YTN C;  3ABV C;  2H89 D;  3AE3 D;  4YTM C;  3AE6 D;  2WDV C;  2ACZ D;  2FBW D;  3AEF D;  3CIR C;  4KX6 D;  3AE7 C;  3P4P C;  1OW6 A;  1ZOY D;  1YQ3 C;  2WS3 D;  1K05 A;  3AEF C;  2WDQ C;  3AE2 C;  4YT0 D;  1YQ4 D;  3P4Q C;  3AEE D;  3SFE D;  4YSX C;  2WU2 C;  2BS2 C;  1OW7 A;  3SFD C;  1ZP0 C;  2WP9 C;  3P4S D;  3AE9 D;  1NEN C;  3VR9 C;  1KF6 C;  3AE4 D;  4YSZ D;  3P4S C;  3AE8 D;  3VR8 D;  2WQY D;  2WU5 D;  2H89 C;  3AE3 C;  1NEK D;  3AE6 C;  2H88 D;  2ACZ C; 
#chains in the Genus database with same CATH topology
 4GT1 A;  4ZNC A;  3VRB D;  1MUU A;  4HJG H;  1FAV A;  3I56 P;  2KS1 A;  3NMD A;  4KT0 J;  1LGH B;  1KB9 I;  5KJ7 A;  1NTZ K;  4R4M A;  3VMZ A;  1NWQ A;  2QA4 P;  3H1I E;  3CWB G;  1KIL A;  2I8D A;  5AW5 B;  4Y99 C;  2QSI A;  2BAS A;  4IFF A;  4TT3 H;  1PPJ D;  2FXO A;  1L4A D;  2J5U A;  1FJK A;  1HJB A;  2E74 B;  3L72 D;  3VRB C;  5AVX B;  3AEA C;  3CX5 E;  2C0X A;  3CPW O;  3WUV A;  1FZF A;  3P4P D;  1M1J A;  3TK1 A;  1BGY G;  2O01 N;  3P4Q D;  2ZYG A;  4WWI A;  2WSF H;  3Q2Y A;  1N2D C;  1GDT A;  1SQB E;  3KZI E;  1ZP0 D;  1M7L A;  3BCC D;  2PGD A;  3CCJ P;  1JO5 A;  4ZKP A;  1L4A C;  1PZQ A;  3AE3 D;  3TF5 A;  1OFC X;  4YTM C;  1CSB A;  3CWB J;  3AEF D;  2J59 M;  2XKM A;  3P4P C;  4EI2 A;  3P8M C;  3P4Q C;  1SFC B;  3LIE A;  3PTZ A;  4RES B;  2ZJS E;  1ZP0 C;  3AE4 D;  4BXL A;  2YIU C;  2B87 A;  5K5G B;  2WT7 A;  3USS A;  3V5B A;  4DDI A;  3AE3 C;  1OMI A;  4WVZ A;  3L71 J;  4D6T G;  3F89 A;  2AXT H;  1BE3 E;  1JMM A;  1G1I A;  3B5N D;  5KJ7 D;  1KQG B;  5H2F H;  2FYU D;  1ZR2 A;  4PD4 I;  4BRY B;  1X8Y A;  2RH0 A;  1OX3 A;  1VDF A;  1LWU B;  3AE4 C;  3W68 A;  1E79 H;  3CCQ P;  3V2N A;  4RKU J;  3P8C E;  5GTI H;  1IFN A;  1U7J A;  4K35 A;  1LTI C;  1JUN A;  4KHX A;  1FC2 C;  4L75 A;  2HOD A;  3H1J G;  4HKZ H;  4I6M C;  3L37 A;  3OAK A;  2B76 D;  2E75 B;  5KJ7 C;  2KB7 P;  2K9J A;  4D6T J;  1VF5 D;  1SQP D;  3EWK A;  1NO4 A;  4H0L B;  1LT9 C;  2JKV A;  3HTK A;  3GHG B;  5GTH E;  3H1H E;  3H32 B;  2KOG A;  3HE5 B;  3NTN A;  3TGU G;  1YJW P;  1J1E B;  1M1J C;  5AW4 B;  1VQ8 P;  4N78 D;  2YKQ A;  4MN4 C;  3H25 A;  3OW2 O;  3ZDM A;  3AEE D;  1VF5 C;  2CK3 H;  3H1K G;  1KIL B;  2FYU K;  2B88 A;  1EZV G;  2D2C B;  2Y9Y A;  1PP9 D;  1L2P A;  2C9N Y;  1EDK A;  1KV4 A;  3B4S A;  3SSU A;  1T6A A;  1NTZ E;  3L71 E;  1SS1 A;  3AEE C;  1M56 D;  3IAO A;  2P10 A;  3KYQ A;  3U1C A;  3WUT A;  1AQ5 A;  1OVV A;  3G9R A;  2V4H A;  1GU4 A;  1ZME C;  3H1K J;  3O6Q A;  1ZRT D;  4I7Z C;  2Z5H A;  3H1L E;  5AW8 B;  1JTH B;  2NPS A;  4NPD A;  4PJ0 H;  4GOE A;  1PFI A;  4U3F D;  1EDL A;  2O3J A;  2PP6 A;  3FGA D;  2WTY A;  3C9I A;  3TNU A;  4W7Y A;  3D71 A;  1BCC D;  1P84 I;  1VQ5 P;  3CD6 P;  2E76 D;  2I1J A;  4WB4 A;  1T3U A;  3PLN A;  1USE A;  3CLQ A;  3A2A A;  2WZ7 A;  3H6P A;  3PH0 A;  4DJG A;  3L74 D;  5APU A;  1E5W A;  1PPJ E;  2M5A A;  1JB0 J;  5DJU B;  1SQV D;  5KAI H;  1GL2 B;  2E76 C;  1G2C A;  2ZVN B;  5B5E E;  1KQL A;  3L72 E;  1USD A;  3AEB D;  2ZFY A;  4YXD D;  2A45 I;  3W67 A;  4YSY D;  2KUB A;  1VQ4 P;  2OYI A;  4XE5 B;  2ZAE B;  3S4R A;  1JMB A;  3BCC E;  1HVV A;  4N6J A;  3L73 D;  4WY4 B;  1T2K D;  4UB6 E;  2IFN A;  1VQO P;  4YXD C;  3PJS K;  2N9B A;  2G8Y A;  1S9K D;  1VQN P;  1FZB A;  4OGQ D;  3P32 A;  3D70 A;  1PP9 J;  2P7J A;  5KLV G;  3RK3 B;  5AW7 B;  1KQS O;  2Z4E A;  3RK2 B;  4C7N A;  3RL0 D;  2NPS C;  1T2K C;  1SQV K;  2ZFC A;  1HTL C;  2WS3 D;  1EDJ A;  1NU1 D;  4OGQ C;  1FZC B;  2FYU E;  2DW3 A;  3V2P A;  3P4S D;  3BAT A;  4PV1 B;  2LXC B;  3A5T A;  1WT6 A;  5KKZ B;  3RL0 C;  5KAF E;  5KLV J;  1FOS E;  3VON A;  2IX7 C;  3L75 E;  3VRA D;  4UB8 E;  1BCC J;  2Q5U A;  3O8Z A;  1AV1 A;  4BWN A;  2WS3 C;  1NTK G;  1SQP E;  1HBW A;  3CCV P;  1NOH A;  1SQB G;  2R44 A;  1ZW0 A;  4EDF A;  2OTL P;  1U57 A;  1QL1 A;  2BS4 C;  1ZR4 A;  2NRG A;  1KFY D;  1R5L A;  3CX5 I;  3VRA C;  2QJP C;  5APT A;  3MP7 B;  3H1I J;  4N78 E;  1FDO A;  2Y0C A;  1RE3 A;  2OYI C;  3OJA B;  2O1J A;  2YKO A;  1SQV J;  1X22 A;  1Z56 A;  2Y9Z A;  1AVO A;  1FDI A;  2BEZ F;  1Q86 Q;  3VR9 D;  3MTU E;  1KF6 D;  4XA4 A;  1NKN A;  2A06 D;  3VMY A;  1PP9 E;  2N1T D;  3V2Q A;  1M1K Q;  3MIW A;  5AVU B;  1IZN B;  2IBZ E;  1ZOY D;  1AVY A;  1YBK A;  3EFG A;  1L0L E;  1BE3 G;  2RKL A;  3K5B A;  3SFE D;  4BRY A;  1K8A Q;  3JCU H;  1YIT P;  1OW7 A;  1VL2 A;  1BGY D;  2FFD C;  1YHQ P;  3G4S P;  3VR9 C;  1KF6 C;  1VQM P;  2WU5 D;  1L0N D;  1ZRT E;  2E42 A;  2E74 D;  1KD1 Q;  2N1T C;  1KOR A;  3HUS B;  3CC4 P;  1WRG A;  4U3F E;  3GF7 A;  1ZOY C;  4IL6 X;  1N7L A;  3SFE C;  2AXT E;  4M3L A;  1BCC E;  4L76 A;  3GHG A;  2WVR A;  5C2T C;  4OWF A;  3AEC D;  5H2F E;  1FZG A;  5AW6 B;  2W8Z A;  3H32 A;  1GW4 A;  1BE3 J;  2V7Q J;  2W6A A;  3HE5 A;  2C0W A;  2GA1 A;  5L8R J;  2WU5 C;  2WSS H;  5AVS B;  3H1H G;  2E74 C;  2RMZ A;  3AEA D;  3M9Q A;  5GTI E;  1MZ9 A;  1KZU B;  3WMM 0;  1GK4 A;  3MD0 A;  1SFC D;  4DT0 A;  2Q7C A;  2QJK B;  2IPP A;  3AEC C;  1Q2N A;  3L74 E;  3M06 A;  1K9M Q;  2WSC H;  4YTM D;  1SQV E;  1OVR A;  2H89 D;  1NAY A;  1S5L H;  4ASW A;  1L0N K;  5KLI B;  3NXS A;  2OYO A;  1RE3 C;  1SFC C;  4LDT A;  3H1H J;  3FXD A;  3VP8 A;  1K05 A;  1NTZ G;  2QVA A;  1IK9 A;  3L71 G;  1T8Z A;  2WPS A;  3QH9 A;  1HWT C;  1FU1 A;  2KXP B;  3L73 E;  1JTH A;  2KNC B;  2H89 C;  3TYY A;  1W2E A;  1BDC A;  4YTP D;  1EQ7 A;  1IFI A;  2YKP A;  1S9K E;  2NZ2 A;  1R8E A;  5APX A;  2XND H;  4H0L D;  1LWU C;  3HD7 B;  1IC2 A;  1XTG B;  4B86 A;  1VQ7 P;  2OTK E;  3D6Z A;  3SWY A;  1NTZ J;  4JQ0 D;  2M8R A;  2K37 A;  3M9H A;  2CPS A;  4H13 B;  3CL3 D;  1S5L X;  3KDP B;  4YTP C;  2HFE D;  3N7N A;  2Q6Q A;  2E75 C;  3M9B A;  3G71 P;  4DZO A;  4PJ0 E;  4K3A A;  2K1A A;  1NU1 E;  1RE4 C;  3I55 P;  1M57 D;  4H0L C;  3H1L J;  1L0N J;  5APQ A;  3GHG C;  1KIL D;  2QJY B;  2ZYA A;  4AYC A;  1LP1 A;  3ITK A;  2D2C D;  1M8O B;  4LLH A;  1M90 Q;  5AVV B;  1GL2 A;  2AEF A;  2JWD A;  1PPJ G;  5CBO A;  3L75 D;  1ZV8 A;  3L36 A;  2ACZ D;  2WSE J;  2BCC D;  4KJM A;  1KIL C;  4W80 A;  4EOT A;  2D2C C;  1N7S B;  1KYO H;  5B66 H;  3CXH H;  4JF7 A;  5KTB A;  4YSZ D;  4WY4 A;  5AW3 B;  5TJH A;  1FE6 A;  1NVO A;  4JYB A;  5KAI E;  2ACZ C;  1JY2 P;  2HYN A;  1QLB C;  3G6E P;  2FYN B;  1SQQ D;  2ZXE B;  1HJ0 A;  3BAS A;  2KP8 A;  5AW0 B;  2QEX P;  4LC1 A;  3Q5S A;  1AQT A;  3L72 J;  2ZT9 B;  3CC2 P;  3WU2 H;  3PHL A;  4YSZ C;  2QM7 A;  2A06 E;  1N86 A;  3T97 B;  3B5N B;  2Q1K A;  3AEG D;  2O01 J;  1JCC A;  1KTM A;  3EFF K;  1LT9 B;  2IBZ D;  3BCC J;  1URQ B;  4GOF A;  1S1C X;  1L0L D;  1FZC A;  3S9O A;  4C46 A;  1YJN P;  2FXP A;  1NTM D;  1SLQ A;  1J1D B;  2FYU G;  1SQP K;  1BGY E;  1RQV A;  4DHJ A;  4GDO A;  1GL2 D;  1PV3 A;  3V4Q A;  1L0N E;  3AEG C;  1NJI Q;  1ZLL A;  1TU3 F;  2N9Y B;  2GM4 A;  2PRR A;  4RJT A;  1MV8 A;  3SWF A;  3A0B H;  2P58 A;  1SQQ K;  2BS2 C;  4Z1M H;  1G1J A;  1GL2 C;  4WY4 D;  5BVZ A;  2FYU J;  2SPZ A;  4YPC A;  2M3E A;  4HYT B;  3GMA A;  1FZA A;  1W5C E;  2A45 G;  3VTP C;  1Y9B A;  2Q3I A;  3M0D A;  1L0L K;  3RK3 D;  1FDM A;  2B9B A;  1RH5 B;  1LP1 B;  1KB9 H;  2E5T A;  4I2L C;  3L75 J;  4N3Y B;  2QRX A;  3HE4 B;  3RK2 D;  2IZ0 A;  1YTZ I;  1UIX A;  1NTM K;  5CMZ A;  5AVZ B;  2YO2 A;  1L0V C;  5CCH A;  1RY3 A;  4WY4 C;  1JEK A;  1KYO D;  1SQP J;  1PP9 G;  3B71 A;  2BCC J;  3CXH D;  3AE7 D;  2HLO A;  1QLE D;  4HB1 A;  3RK3 C;  2PFX A;  1Q81 Q;  4IL6 E;  4PV1 D;  4YSX D;  2WSC J;  3RK2 C;  3L70 D;  2WU2 D;  1IO4 A;  3RBX A;  1DD4 A;  2WP9 D;  1NTK D;  3PP5 A;  1SVF A;  2NPS D;  2KI7 B;  1JNM A;  1EC5 A;  1SQQ J;  3U59 A;  1GD2 E;  3HUS A;  2H7H A;  1RF1 B;  3GW6 A;  3F5H A;  2WSF J;  4AUW A;  2IBZ I;  4AQR D;  2FBW D;  1FZC C;  4U3F G;  2RN0 A;  2MKV A;  3AE7 C;  3IFM A;  1SQX D;  2KIK A;  1BSH A;  1N73 B;  2R3S A;  1NHL A;  4GKG A;  2FY8 A;  4PV1 C;  4YSX C;  3BRT B;  2WU2 C;  1BCC G;  3I5C A;  1LT1 A;  2WP9 C;  3JCU E;  1HGV A;  2K9Y A;  1BSN A;  1K73 Q;  1L0L J;  2AXC A;  3L35 A;  1YIJ P;  2QE7 H;  1NEK D;  2FKW B;  2YNY A;  1QVG O;  1GZL A;  3P4R D;  1KFN A;  4EYY Q;  2FBW C;  2KZJ A;  1IK7 A;  3KPE A;  3R2P A;  2B89 A;  2O1K A;  3E1R A;  1KIL E;  1H0T B;  1FS0 E;  4PD4 H;  1AFO A;  3H1I G;  3FWL A;  4U3F J;  2JO1 A;  2BS3 C;  1GU5 A;  2I1K A;  5APV A;  3L74 G;  3LW5 H;  2AEJ A;  2P1J A;  1AJY A;  1LTB C;  1SQV G;  1NEK C;  2WPV B;  4LGD E;  1S72 P;  2P2U A;  1Y8A A;  3P4R C;  1JCD A;  1D7M A;  2WPR A;  5APS A;  2XDJ A;  2WDV D;  2R3C A;  3M0D C;  4GIF A;  2BCC E;  2H43 A;  1LTA C;  3AE2 D;  2CPB A;  2M3B A;  1SQX K;  1T3J A;  2W6J H;  1S2E A;  3CCR P;  3CCL P;  3IN6 A;  3WUU A;  5CCG A;  1KB9 D;  1NEN D;  1AA0 A;  2KNC A;  1FJP A;  1YJ9 P;  1KYO I;  2FYZ A;  1LTJ B;  1HH0 A;  2L5G B;  3L74 J;  3N4X A;  4IL6 H;  2WDV C;  3G3Z A;  2C9L Y;  1SQQ E;  1S5L E;  3RL0 B;  3HD7 A;  1NU1 K;  3CME P;  3AE2 C;  1DIP A;  1NYH A;  3L4F A;  2OAR A;  1NEN C;  3M91 A;  3HUS C;  3CWB D;  3VR8 D;  1Q90 D;  3RBZ A;  2OGU A;  1H88 A;  2H88 D;  1KFM A;  2HR3 A;  1L4A A;  4DHI B;  3L73 J;  2GUS A;  1NTM E;  4OH8 B;  2R32 A;  5C2T D;  2OYH B;  3A0H H;  1W2B O;  3LID A;  1KN7 A;  2WPQ A;  1S3J A;  3BRV B;  4IOI H;  5BU5 A;  1EXJ A;  3VR8 C;  1SQX J;  2H88 C;  3GG2 A;  1PGJ A;  2KSJ A;  4R4L A;  5AVW B;  1GW3 A;  2WDQ D;  1N7S A;  2P67 A;  3RL0 g;  5CCG D;  5AW2 B;  2G3A A;  1P84 H;  1NU1 J;  1LTS C;  4PD4 D;  1QVF O;  1YYC A;  1LNQ A;  3B8E B;  1PGQ A;  2ITA A;  3RGU A;  3AE6 D;  3NFQ A;  4H44 B;  4D6T D;  2L91 A;  1BDD A;  3HD7 D;  3RK3 E;  2WDQ C;  1YQ4 D;  2N1T B;  1H89 A;  4W7Z A;  2W6B A;  1RF0 A;  1IFP A;  1YI2 P;  2PAJ A;  1OXZ A;  5CCG C;  3T97 A;  1FOS F;  3B5N A;  4H13 D;  1KYO E;  5B66 E;  2A06 G;  3D6Y A;  4A7P A;  3CXH E;  2IDB A;  3VMA A;  3CCM P;  3U1A A;  4ASV A;  1LT9 A;  1NKZ B;  1JY2 N;  3BVH A;  1URQ A;  5E79 H;  2WQY C;  3AE6 C;  1VQ6 P;  2KLV A;  3C1L A;  3KXD A;  2LXB A;  1OVU A;  2HPC B;  1OWA A;  3H1J D;  3HD7 C;  2A45 H;  3AED D;  3II6 A;  1YQ4 C;  5TIS H;  3CCE P;  3L70 E;  1NTK E;  3VMX A;  4H13 C;  1CI6 B;  3S1K A;  2FXM A;  3WU2 E;  3H1L G;  1JOC A;  1L0N G;  1QX8 A;  2E75 D;  5APY A;  1KQF B;  1FZE A;  3TGU D;  4Y99 B;  3GF3 A;  5CJ0 A;  3CIR D;  1SQX E;  1CW5 A;  3AED C;  2QJY C;  1N7S D;  2WIT A;  5AVT B;  1MFZ A;  3H1K D;  1DH3 A;  1EZV D;  1IJD B;  1VPC A;  3FXE A;  3EQ2 A;  1BGY J;  4DDG A;  3MUD A;  2KK7 A;  3E7K A;  1L4A B;  3CIR C;  3JSV C;  1H8A A;  4KX6 D;  2XZR A;  2ZT9 D;  3AEF C;  2KZI A;  2POH A;  2XNX A;  4YT0 D;  1N7S C;  3A0B E;  4DHZ A;  3HE4 A;  1QGK B;  3SWK A;  5BU8 B;  4CPG A;  2QG4 A;  4TLF A;  1J1E C;  1GTW A;  1JY3 P;  1EDI A;  2M0B A;  3L72 G;  1P84 D;  3KQG A;  1URQ D;  2FYN C;  1ZXG A;  2YIU B;  4RO0 A;  1K04 A;  4KX6 C;  1LJ2 A;  4JBZ A;  2ZT9 C;  4YT0 C;  2JEE A;  2WDR D;  1RF0 C;  2YMK A;  3LW5 J;  3BCC G;  3B5N C;  1KB9 E;  1RF1 A;  1URQ C;  4FJV A;  1VQL P;  3P7K A;  3M0A A;  4C7R A;  1CZQ A;  3CX5 H;  2WMM A;  2JP3 A;  3HRN A;  1J1D C;  1N73 A;  1N8R Q;  4U7J A;  2KYV A;  2WDR C;  5CHX A;  5AW1 B;  1S4X A;  3KZI H;  2B76 C;  2KS1 B;  1TFF A;  3CWB E;  1MFT A;  3H1J J;  1A02 F;  2YMY A;  2XV5 A;  2R5B A;  3VYI A;  3A7O A;  1NAF A;  3PRJ A;  2K3R A;  1H0T A;  1M1J B;  2W27 A;  3TSI A;  2MJZ A;  3TGU J;  3AE9 D;  1VF5 B;  3Q3D A;  1EZV I;  4EIJ A;  4JYC A;  2IFM A;  2YXQ B;  3AE8 D;  1NGM B;  2UWJ E;  2XU6 A;  3L75 G;  3MUD C;  1DD3 A;  1VQP P;  4L74 A;  3VN0 A;  2KLU A;  3IF4 A;  2V7Q H;  1EXI A;  3V2R A;  1SQP G;  3V6I A;  1J2J B;  2BCC G;  1UII A;  3AE5 D;  2GUV A;  1L0V D;  5KLV D;  2YO3 A;  3AE9 C;  4NPE A;  2KSE A;  4PD4 E;  1JY3 O;  1R5S A;  1DX7 A;  3AE1 D;  1LTJ A;  3AE8 C;  2YXR B;  3TDK A;  4YTN D;  2B87 B;  2WT7 B;  2OQQ A;  3QWO C;  1Q82 Q;  4D6T E;  3CCU P;  2K88 A;  1SQQ G;  4I7Z B;  4I1L A;  2W83 C;  1YQ3 D;  3AE5 C;  3VOP A;  3MHV A;  3VP9 A;  2AEM A;  4Y28 J;  3SFD D;  5GTH H;  3AE1 C;  1RF1 C;  2OTJ P;  1JY2 O;  3H1I D;  4ZKU A;  4YTN C;  2E5Y A;  3FWN A;  2BEQ D;  4DCK A;  3Q5R A;  2IBZ G;  3GLM A;  3CI9 A;  3FX0 A;  2IYO A;  1N73 C;  3H1J E;  1L0L G;  3MGN A;  3CX5 D;  1YQ3 C;  2ZVO B;  2HOD B;  2OYH A;  1VQK P;  1NTM G;  1IFJ A;  3KHU A;  3SFD C;  2K9J B;  1SQB D;  1KC8 Q;  2VRS A;  1X9V A;  5KLV K;  3HTK B;  1QEX A;  2Y0E A;  4I6L A;  3TGU E;  1DEB A;  1Q7Y Q;  2E76 B;  3AEB C;  5KKZ C;  1X0T A;  1QL2 A;  4YSY C;  3H1K E;  5M1B A;  3A0H E;  2LKM A;  1EZV E;  1YTZ T;  1NTM J;  2FFD A;  3Q1M A;  3Q5P A;  2ZYD A;  1Y47 A;  1HUC A;  2N1T A;  4XFJ A;  1BE3 D;  5CCH D;  1IFM A;  1E7P C;  4WBA A;  2W90 A;  1NTK K;  5EFW B;  1LTJ C;  3IR9 A;  2JJL A;  5CJ4 A;  1HGZ A;  2WSE H;  1P84 E;  1SQB K;  3P8C D;  1VQ9 P;  1X79 B;  1XTC C;  3OA7 A;  2HPC A;  3O6Q B;  1ZN5 A;  2NPS B;  2IZ1 A;  4IFM A;  1RQU A;  1OW6 A;  1RHZ B;  5CCH C;  4QMA A;  5CBN A;  3E1I A;  3L70 G;  1CI6 A;  3TNU B;  4GOD A;  4OGQ B;  1OIP A;  4ZMD A;  3L73 G;  3R4Y A;  3CXH I;  4NPF X;  1GK6 A;  2JWA A;  4O9B A;  4YXW H;  3P4S C;  2E43 A;  5B5E H;  1PL5 A;  1U7M A;  3H1H D;  1PGO A;  2Z5I A;  1DEE G;  5E79 E;  1PGP A;  2OYH C;  1SQX G;  2JR8 A;  2O01 H;  1SFC A;  5TIS E;  1NH4 A;  2J58 A;  5AVR B;  5C3J D;  2Y0D A;  5C39 A;  4H44 D;  3L70 J;  2HG5 D;  2QIW A;  4UB6 H;  1A02 J;  3ABV D;  3JC2 2;  2M5A B;  2ZXX A;  1NTK J;  1OW8 A;  1FBM A;  1NU1 G;  2JDI H;  1G2C B;  1KFY C;  3C8V A;  2Q9I A;  1HF9 A;  1SQB J;  2QM8 A;  2QJP B;  1NTZ D;  3L71 D;  2R5D A;  1SP4 A;  5AVY B;  3V4W A;  4IFD K;  2H8P D;  2OYI B;  4JPZ B;  5C3J C;  3A3Y B;  3CCS P;  1LWU A;  1IFD A;  1PIX A;  4L73 A;  2Q3E A;  3CMA P;  4H44 C;  2IYP A;  1LTG C;  3ABV C;  5DJT B;  1OZH A;  3H1L D;  2QJK C;  1WMK A;  3CC7 P;  1GMJ A;  4DOJ A;  2LR2 A;  5AVQ B;  1MKM A;  1KMI Z;  1LTT C;  3UIA A;  2WWW A;  5KLV E;  3MZW B;  5APW A;  5AW9 B;  5KLI C;  1RE4 A;  1JY3 N;  5KAF H;  1JM0 A;  2FFD B;  2WQY D;  4OVN F;  4C7N B;  4HH2 A;  4UB8 H; 
#chains in the Genus database with same CATH homology
 2FBW C;  3AEB D;  4YTP D;  3VRA D;  1K04 A;  1IK7 A;  3GF7 A;  1QLB C;  1EXI A;  4KX6 C;  3VRB D;  4YXD D;  2E76 B;  2NZ2 A;  1ZOY C;  1R8E A;  2ZT9 C;  3AEB C;  4IL6 X;  1Y9B A;  2WS3 C;  3AED D;  4YSY D;  4YT0 C;  5KKZ C;  1YQ4 C;  3AEE C;  3SFE C;  3AE5 D;  3IAO A;  1HJ0 A;  2WDR D;  5C2T D;  4H0L D;  1KIL E;  2P10 A;  3Q5S A;  2YMK A;  4KT0 J;  4YSY C;  1L0V D;  1KQG B;  3LW5 J;  2ZT9 B;  4R4M A;  5C2T C;  2JO1 A;  3AE9 C;  5M1B A;  1UIX A;  2BS3 C;  3G9R A;  3AEC D;  1L0V C;  3AE4 C;  4H13 C;  3D6Z A;  5C3J D;  3AE1 D;  2V7Q J;  4YSZ C;  1EXJ A;  1ZME C;  3P4R D;  4RKU J;  3AE8 C;  5L8R J;  3T97 B;  1AJY A;  3VR8 C;  2WU5 C;  1U57 A;  2QSI A;  3AEG D;  2E74 C;  1NEK C;  3B71 A;  4H44 D;  4TT3 H;  2QIW A;  2WPV B;  3ABV D;  2O01 J;  3O6Q A;  4H13 B;  2BS4 C;  2E75 D;  3AE6 C;  4I7Z C;  1KQF B;  1KFY D;  2OQQ A;  3AEA D;  2H88 C;  1S5L X;  2J5U A;  1OW8 A;  3Q1M A;  1KTM A;  4YTP C;  3P4R C;  3VRA C;  2QJP C;  3Q5P A;  2E74 B;  2E75 C;  2WDV D;  3VRB C;  4YXD C;  1S1C X;  2JP3 A;  3C8V A;  3AEA C;  3GF3 A;  4R4L A;  1HF9 A;  4I7Z B;  1KFY C;  1FDO A;  3CIR D;  2G8Y A;  3AED C;  2QJY C;  3AE7 D;  3P4P D;  4XFJ A;  1YQ3 D;  3S9O A;  3AE5 C;  4U7J A;  2WDR C;  2WDQ D;  2B76 D;  2E75 B;  4H0L C;  3AE2 D;  2FXP A;  3P4Q D;  4OGQ D;  3FGA D;  3D70 A;  1VF5 D;  4PV1 D;  3Q2Y A;  1RQV A;  3EWK A;  2WSC J;  1E7P C;  4YSX D;  2B76 C;  2WU2 D;  3D71 A;  1FDI A;  3AEC C;  4Y28 J;  2D2C D;  3RL0 g;  3SFD D;  3IN6 A;  1DD4 A;  4H0L B;  1ZP0 D;  2BEZ F;  2G3A A;  2WP9 D;  5C3J C;  3AE1 C;  4GDO A;  1NEN D;  3VR9 D;  1PV3 A;  1KF6 D;  4YTM D;  1PIX A;  3AEG C;  4YTN C;  4H44 C;  3ABV C;  1TU3 F;  2H89 D;  3AE3 D;  4YTM C;  2E76 D;  2BEQ D;  2WSF J;  3Q5R A;  2QJK C;  3GLM A;  3AE6 D;  2WDV C;  2ACZ D;  2FBW D;  1WMK A;  4H44 B;  1GMJ A;  3AEF D;  3CIR C;  2MKV A;  1RQU A;  4KX6 D;  3AE7 C;  3P4P C;  1OW6 A;  1ZOY D;  1MKM A;  1YQ3 C;  2ZT9 D;  2WS3 D;  3RK3 E;  1K05 A;  2WSE J;  3AEF C;  1KMI Z;  3AE2 C;  2WDQ C;  4YT0 D;  3H25 A;  4OGQ C;  1YQ4 D;  3AEE D;  3P4Q C;  3SFE D;  1DIP A;  4YTN D;  1VF5 C;  4PV1 C;  1NYH A;  4YSX C;  2WU2 C;  2BS2 C;  1OW7 A;  1VL2 A;  2D2C C;  3SFD C;  1ZP0 C;  4Z1M H;  2WP9 C;  3P4S D;  4OGQ B;  5KLI C;  3AE9 D;  1NEN C;  2K9Y A;  3R4Y A;  3VR9 C;  1VF5 B;  4PV1 B;  1KF6 C;  4H13 D;  3AE4 D;  3Q3D A;  4YSZ D;  3P4S C;  2D2C B;  2YIU C;  3D6Y A;  3AE8 D;  3VR8 D;  1NGM B;  2IDB A;  2WQY D;  1JB0 J;  1Q90 D;  2WU5 D;  1PL5 A;  1ZRT E;  2H89 C;  2E74 D;  1OMI A;  1DD3 A;  3AE3 C;  1NEK D;  2E76 C;  2FYN C;  1KOR A;  2WQY C;  2H88 D;  3GMA A;  2ACZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...