1ZP0C

Crystal structure of mitochondrial respiratory complex ii bound with 3-nitropropionate and 2-thenoyltrifluoroacetone
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FAD-binding protein
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zp0C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zp0C02
3P4QD 2G3AA 2H88D 2BS3C 3AEFC 4YSYC 4YTPD 2WDVD 3VRAD 1KFYC 2WDQD 3S9OA 3AEGC 4YT0D 5C2TC 2WU5D 3SFDD 3ABVC 1OW6A 1ZOYC 3AE3C 3VR8D 5C3JD 4YSXD 2WS3D 1K04A 2B76C 3P4SC 3AE5C 1KF6D 3AE4D 3P4RD 1ZP0D 1L0VC 2H88C 4KX6D 4YTNC 2WDVC 1QLBC 1YQ4C 3P4PD 1NEKC 1E7PC 1KTMA 1YQ3D 2ACZD 3AE9C 3AEBD 3B71A 3AEEC 1ZOYD 3AE3D 3VRBC 3VR8C 1K05A 1OW7A 2WS3C 3AE8C 2WU2C 4YXDD 3P4QC 3AE1C 3AEAC 3AECD 4YSZD 3VR9D 2WDRD 2WP9C 1NENC 3AEDC 2B76D 3AE5D 1OW8A 2WQYD 3AE7D 3CIRC 3AE4C 4YSYD 3P4PC 4YTMD 2BS4C 1L0VD 2H89C 4YT0C 2WU5C 3SFDC 3SFED 3AEFD 4YTPC 1KFYD 2WDQC 4YXDC 3AEGD 1YQ4D 5C2TD 3AEAD 3ABVD 3AE2D 3AEED 2BS2C 3VRAC 3AE6D 2WU2D 3AE8D 4YSXC 2FBWC 2WQYC 3AE9D 3P4RC 3AECC 1NEKD 1YQ3C 3P4SD 3AE7C 3CIRD 1PV3A 3VRBD 2H89D 2WDRC 1ZP0C 1NEND 2ACZC 3AEDD 5C3JC 4KX6C 3SFEC 4YTND 3AE2C 3AEBC 4YSZC 3AE1D 3AE6C 2WP9D 4YTMC 1KF6C 3VR9C 2FBWD
chains in the Genus database with same CATH superfamily
1SQXJ 1SFCC 1LP1A 1QVGO 1FZAA 2JO1A 1J1DC 3GHGA 1LNQA 2XNDH 1FC2C 5H2FH 1LTJC 2Z5IA 2WU5D 2FYUD 3WUTA 5CJ4A 3WUVA 2GUVA 3R4YA 3V6IA 1FDIA 5AVUB 1H0TA 1RF0A 1FZFA 3M0DA 1NU1J 3VONA 2WDVC 1QLBC 2Q5UA 3A7OA 3RK2B 1PPJE 2E75C 4HB1A 1BSNA 1PPJD 3L72D 1L4AA 4GDOA 1JO5A 2ZXXA 3P8CD 3JCUH 1SVFA 2IBZI 5GTHH 3H1JJ 3M0AA 1QEXA 1LT9A 2WWWA 1NAYA 3AE4C 3H1HG 1LTBC 2QJYC 4HYTB 3B5ND 1M90Q 4IL6H 4YTPC 4DDGA 5E79H 2FYUE 3BRTB 1ZR2A 2WSEH 3AEAD 2OYOA 2BCCE 3RL0D 1AFOA 1KQSO 1VQ4P 3G9RA 1HJ0A 3TGUD 2D2CB 1JUNA 3A2AA 2WT7A 4MN4C 2IYPA 3BCCD 1EZVG 1RE4C 3MTUE 2WSEJ 3M9QA 2J58A 2H89D 3CWBD 4DZOA 1VQKP 4YTMC 2OYIB 4H13B 1JY3O 2WDVD 1ZW0A 3EWKA 1RHZB 3VN0A 2IZ0A 1HH0A 1DD3A 1N2DC 4ZKUA 2C0XA 1ZP0D 3CC2P 4HJGH 4GT1A 1GMJA 5CCGD 2HLOA 2CPBA 3A0HH 1N73B 4ASWA 3LIDA 1SQQG 3B71A 2HFED 4YXDD 2P10A 2N1TB 1K8AQ 3U1AA 3L70E 3CCJP 2E76C 4DDIA 4QMAA 5B66E 4U7JA 1R8EA 1LT9C 2P7JA 3HD7B 3USSA 4YSYD 4GIFA 4D6TD 1N8RQ 2RN0A 4U3FJ 3B4SA 3SFDC 4OWFA 1CW5A 1QLED 2ZYAA 4YXDC 3L75G 5KLVK 1W2EA 3L72J 3VOPA 2I1KA 3S4RA 2BS2C 2IDBA 4I6LA 1NTKE 3PH0A 2J59M 1FOSE 2RKLA 1M1JA 2V7QH 2WITA 1U7MA 3Q5SA 1N7SB 3RK3E 1M7LA 1SQVJ 3AEFC 3CCUP 4IFDK 4XFJA 1BSHA 2IYOA 3RK3B 1EDKA 2SPZA 3H1JG 4WB4A 1VQNP 1Q7YQ 4L76A 1KF6D 3CX5I 1NTME 3A0HE 1L0VC 3G4SP 3CWBE 3TNUA 1SQBK 4AYCA 2GA1A 2Q3IA 5TISE 1NEKC 5AVXB 2FXMA 2POHA 2WU2C 2E74B 3GG2A 1M8OB 1JNMA 2QJPB 3VR9D 3SWKA 1MV8A 1SQXK 2KSEA 3H1KJ 4DHIB 1OW8A 5DJTB 1ZRTE 4PJ0H 2W8ZA 4C7NB 2LKMA 2QM7A 3NFQA 3MUDC 2FXPA 3SWFA 1LGHB 2PRRA 1EQ7A 3KZIE 3D6ZA 2DW3A 1XTCC 5APYA 3AE9D 4ASVA 3H6PA 4HKZH 1JCDA 1HVVA 3FGAD 1S3JA 1YQ3C 3O6QA 2FYUJ 5AVZB 2GUSA 1BE3J 2WDRC 3B5NA 2YKPA 4OGQC 2NPSB 1X9VA 1NEND 3H32A 2QEXP 2IFNA 2WP9D 1NU1D 1VQOP 1KF6C 3B8EB 5CCHD 4WY4B 1SFCA 1VDFA 3V5BA 5BVZA 2GM4A 1CI6A 4C46A 1KORA 1NTKG 1EZVD 1L2PA 1KFNA 4C7RA 2W6JH 3IFMA 3AE3C 3NXSA 2Y9ZA 2AEMA 3RBZA 1BDDA 3AE5C 3Q2YA 3BRVB 1IO4A 1LJ2A 4YTNC 4N78E 1JY2O 4N6JA 1RY3A 3E7KA 1YJ9P 3L70D 2Y9YA 1EDJA 2H7HA 3AE8C 3E1IA 2D2CD 3GHGB 1DIPA 1FZCB 5B5EH 1RF1B 2B76D 4HH2A 2J5UA 3TGUJ 3MP7B 1JTHA 4PV1D 3GMAA 3N4XA 3NTNA 2R3CA 3CX5E 1J2JB 4YTMD 3BCCJ 1KQGB 4N3YB 2P1JA 4BRYA 2MJZA 4KHXA 5KLVG 1GW4A 1Y47A 5APQA 1X79B 1X22A 4DHJA 2XNXA 3CCQP 1KFMA 1SQPJ 4WWIA 5AW6B 2YXQB 4DHZA 3CMEP 2WSFJ 3BATA 3BVHA 1N7SA 2QM8A 4RESB 1KMIZ 5M1BA 3D71A 2ZAEB 5CCGC 2ITAA 3B5NC 5KKZB 1VQ7P 2KK7A 3WU2H 1E79H 4I1LA 2W6AA 1KB9H 4RKUJ 3H25A 1KFYC 4OGQB 3SSUA 5C2TC 4NPDA 3QWOC 5KLVJ 1ZN5A 2QA4P 1BE3D 1WMKA 1JCCA 1K04A 2B76C 3P4SC 4R4MA 3CCSP 3TGUG 2BASA 3VMXA 2HODA 4PV1B 1RE3A 1ZR4A 3H1IE 1J1EC 4OH8B 1FE6A 3HUSB 3A3YB 2WS3C 1NAFA 3TYYA 3KQGA 1T6AA 3G71P 2R3SA 2OTLP 1KILB 2FFDC 1S1CX 1CZQA 2RMZA 1P84E 2BS4C 3CC4P 1PIXA 5APTA 2FXOA 2QJKC 4CPGA 1Q90D 4UB8E 3O6QB 5APXA 4GOFA 5AVSB 2N1TC 1Y9BA 2RH0A 2WQYC 4A7PA 2BCCJ 4PJ0E 1VQ5P 1CI6B 2KB7P 4O9BA 3P4SD 1RQUA 3JCUE 2KNCB 4ZKPA 3T97A 1LTAC 2FBWD 3CXHI 3TSIA 4YSYC 4H44B 1YI2P 4H0LB 1OXZA 1IFIA 2H8PD 2YIUB 2A45H 3IF4A 3E1RA 4JQ0D 2M5AB 3RL0g 3CC7P 2WSFH 2KS1B 3H1KD 3L73D 1S72P 1AVYA 1NHLA 1GL2D 2Q7CA 1XTGB 1NOHA 2ACZD 3KPEA 4K35A 5KLVD 2P58A 3GW6A 2Y0EA 1NTKK 2B9BA 3L36A 2WDRD 2KI7B 3VP9A 2WPQA 4JF7A 2HPCA 1S4XA 2ZXEB 4YT0C 4DCKA 3L75E 1URQB 3AEGD 4JYBA 1L0LK 5E79E 1DD4A 3B5NB 1T8ZA 2FY8A 4YSXC 1H89A 2FKWB 1BCCJ 4D6TE 3V4WA 1R5LA 5KJ7A 3VRBD 1JMMA 2YO3A 3FX0A 5H2FE 2QJPC 3IN6A 1KQFB 4YSZC 1LWUA 1AVOA 5AVTB 2B88A 1KILE 3Q3DA 4GKGA 4L74A 3M9HA 2BCCD 1A02J 3HTKA 5KJ7D 1SQQD 3S9OA 2CPSA 1YITP 3L70J 1PL5A 3RK2C 1VF5C 5AW2B 2WMMA 1YIJP 3PTZA 1NJIQ 4NPEA 4H44C 2ZT9D 4DJGA 1AV1A 3IR9A 3CCEP 1SQXG 1Q81Q 1FZCC 1IFNA 3OW2O 3HRNA 1YTZI 1X8YA 1WT6A 2XU6A 4PD4H 3VRBC 1IC2A 3VMAA 3CX5H 3WUUA 1SP4A 3AE1C 2KLUA 1S5LE 2QJKB 5AW9B 1SQPD 3L73J 1IK7A 3LW5J 1TU3F 3P4PC 1PGJA 2W83C 1LWUC 2MKVA 1PZQA 2R32A 3ZDMA 1ZXGA 3ABVD 1BGYE 1LTGC 3AE8D 2ZT9C 3S1KA 1E5WA 1VL2A 1UIIA 1DEBA 3U59A 2Y0DA 2NPSC 1HGZA 1EDIA 1L4AB 4WVZA 2ACZC 4M3LA 1GL2C 1SQXE 1N7SD 4YTPD 1BE3G 2JKVA 2BEQD 3AEGC 3VYIA 1LT1A 1BCCD 1Q82Q 4UB8H 1KN7A 1OW6A 2KP8A 3MUDA 2C0WA 3TF5A 2WVRA 2C9NY 1L0LE 1KYOE 2QRXA 3F89A 4TT3H 1UIXA 3L74J 2HR3A 5AW5B 1SQQJ 1R5SA 1VPCA 5AVYB 1M57D 1GK4A 1YJNP 3AE3D 1KB9E 2QIWA 5B5EE 3CCVP 3P4QC 2AEFA 1HGVA 1LP1B 1S5LX 3AECD 2FYUK 5APSA 2OYHA 1IFMA 3AEDC 4D6TG 4JPZB 1W2BO 2WTYA 2Z4EA 4L75A 5BU5A 2B87B 1JMBA 1KYOI 3HE5B 2WU5C 3MHVA 5KAFE 5KAIH 1VF5D 1VQPP 2E5TA 1ZLLA 3H1LJ 5AVRB 2KUBA 3CXHE 5CHXA 4PV1C 1NTMK 2V4HA 2N1TA 2R5DA 2A06G 3P32A 3CL3D 4LGDE 1URQD 1GDTA 1YBKA 1SQVK 2AXCA 2A45G 4YTND 1NH4A 1GL2A 3V2NA 2KS1A 2YIUC 4I7ZC 2H88D 2BS3C 2M5AA 1GTWA 1SLQA 1KV4A 4YT0D 2XZRA 4UB6E 2ZFCA 3BCCE 1MZ9A 1PGPA 4L73A 1OWAA 1M1JC 1L4AD 4R4LA 3RL0B 2PP6A 3L75J 2ZYDA 1TFFA 2QVAA 3WU2E 2NRGA 2ZJSE 3II6A 1IFDA 1RF1A 3EFFK 3C9IA 1NU1G 2JEEA 2K88A 1BCCE 3WMM0 1SS1A 3L73G 3L74D 4W7ZA 3I55P 1L0VD 1DH3A 3HD7A 1LTJB 5TJHA 1FU1A 1T2KC 1OVRA 3HD7D 2IPPA 3L73E 3KXDA 5AW1B 1N7LA 1NTMJ 3K5BA 3PRJA 1YTZT 1NTZK 1LTSC 1JY3N 2FYNC 4DOJA 1GD2E 1EZVE 2D2CC 2M8RA 1L0NE 3MGNA 1BGYJ 1EZVI 5C3JC 2AXTE 1VF5B 2BCCG 4FJVA 2NZ2A 4IFMA 3L74G 3VRAD 2K9YA 5EFWB 3CPWO 1GU4A 2WPVB 4N78D 5CBNA 3ABVC 2ZFYA 4XA4A 5C3JD 2JP3A 3VMZA 4IL6X 2HODB 4PD4E 1NU1E 4BXLA 3MIWA 3TDKA 4Y99B 1NKZB 1RF1C 1N73C 4DT0A 1PGOA 4UB6H 1E7PC 1YQ3D 4LC1A 5KLIC 3CWBG 1PP9J 3RL0C 1IJDB 1BE3E 4RJTA 1OFCX 3AEAC 5BU8B 5AVQB 3AE5D 5CCGA 1SQQE 3QH9A 3IAOA 3L75D 2OYIA 2K9JB 3H1ID 1PP9E 1KFYD 1SQBD 1FJKA 1QX8A 3P8CE 1YHQP 2YKQA 2PGDA 4I6MC 5AW7B 2FBWC 1G2CA 3GLMA 1NTZJ 2WSCH 1GL2B 2FYUG 3N7NA 2YKOA 4W80A 3AE7C 3CIRD 2V7QJ 4KX6C 2VRSA 2NPSA 1LT9B 2Z5HA 1HJBA 2KZIA 2NPSD 1S9KD 4BWNA 1PPJG 3MD0A 3VR8D 2LR2A 2B89A 3L70G 3RK3D 1VQ9P 4NPFX 2W90A 2JDIH 5CCHA 3H1HD 1JM0A 1VQ6P 2B87A 3H1HE 3P4PD 1KTMA 3JSVC 1T3JA 3AEEC 3H32B 3VR8C 1K05A 2WT7B 1T3UA 2OQQA 3H1LD 2ZVOB 2YMYA 1HUCA 1KQLA 3HE4A 3VP8A 1G1JA 2KXPB 1LTTC 1Y8AA 3V2PA 3CCLP 4EI2A 3EFGA 4IFFA 5C2TD 1GK6A 1MKMA 5AVVB 1KZUB 3AE2D 2PAJA 3VRAC 2YMKA 5CCHC 3O8ZA 1AQTA 3AECC 4AUWA 3H1IJ 1SQBJ 3CLQA 3VMYA 1K73Q 1L0NK 3ITKA 3SFEC 2E75D 2E74C 3LW5H 4LDTA 3HTKB 1P84I 1JOCA 2WPRA 1FDOA 1T2KD 1USDA 3SFDD 3D70A 2K37A 2WSSH 1FZGA 1JB0J 1KB9I 4YSXD 1DX7A 1ZRTD 1NTZG 3W67A 2H88C 1IFPA 3MZWB 3FXEA 1AQ5A 1WRGA 2KOGA 3Q5RA 1AA0A 1P84H 1HWTC 2K1AA 4I7ZB 1LTIC 3FWLA 5GTHE 1D7MA 2WP9C 1JTHB 1OX3A 1SQVE 1A02F 3GHGC 1NTMD 2FYZA 3TK1A 3AE7D 3CIRC 4WY4A 3V4QA 2OTJP 5GTIE 1BCCG 4BRYB 1NU1K 1QL2A 3KHUA 1BGYD 1K9MQ 2L5GB 1M56D 4H13C 3KZIH 1L0LJ 1EXJA 2O01N 2OGUA 1NYHA 4EIJA 3L74E 4Z1MH 3R2PA 3I5CA 3FWNA 3L72G 4EDFA 1FOSF 2HPCB 3H1JE 3EQ2A 3H1KE 2KNCA 3OJAB 4H13D 5GTIH 3P4RC 3VR9C 5CMZA 1NTZE 5CJ0A 1RQVA 2N1TD 2YO2A 4W7YA 1U7JA 2O1KA 3UIAA 4WBAA 3M06A 1GW3A 1PP9D 3C1LA 2OTKE 2FYNB 1HBWA 5KAIE 2G8YA 5KLIB 1Q86Q 4KT0J 2FFDA 2Q1KA 2R5BA 1NGMB 3Q5PA 4KX6D 4OVNF 3HUSC 3HE4B 4PD4I 2QG4A 2XDJA 1JY2N 1N73A 1G1IA 3KDPB 2IBZD 1NENC 2O3JA 2ZT9B 1IZNB 3CD6P 2JWDA 2WQYD 1KYOD 1FZBA 1NTZD 1SFCB 3L71G 1MFZA 4AQRD 5KTBA 2IBZG 3AEFD 2QJYB 4JBZA 3RK3C 1VQMP 1EDLA 1EC5A 4RO0A 2E5YA 1IK9A 1OIPA 1SQPE 2Q9IA 3VTPC 3U1CA 1OVUA 4K3AA 2WZ7A 5AW8B 5K5GB 1S2EA 4IOIH 1NTKD 1P84D 1CSBA 2P2UA 1PV3A 2M3BA 1FS0E 2ZVNB 1L0LG 3H1IG 2E75B 3T97B 3RGUA 5DJUB 3V2RA 3AEDD 3AEBC 2E42A 1LTJA 2K9JA 3C8VA 1L4AC 3TGUE 2OARA 1L0LD 1OVVA 1FZCA 3P4QD 3H1HJ 4H0LC 1H8AA 4EOTA 2OYHC 4JYCA 2LXCB 4KJMA 3L71E 3F5HA 1ZOYC 3CCMP 2WS3D 1GU5A 1JY2P 2XKMA 2H43A 1RF0C 4IL6E 3AE4D 4GODA 2YNYA 2KZJA 4WY4C 1JEKA 2N9YB 2L91A 2Y0CA 1YQ4C 1NVOA 5AVWB 4I2LC 1X0TA 2IX7C 1NKNA 3AE9C 3L71J 1BGYG 1ZOYD 4TLFA 1PGQA 1N86A 1M1JB 1Z56A 2E76B 3P8MC 4H0LD 1URQC 4H44D 2KLVA 2H89C 1W5CE 5B66H 1FBMA 5KLVE 3OAKA 3W68A 3CI9A 1SFCD 5L8RJ 3AEED 2WU2D 1SQBG 2CK3H 1NEKD 1BDCA 4YPCA 1FDMA 1FZEA 3NMDA 3GF7A 1KD1Q 3GF3A 3AE2C 1PFIA 2E76D 3AE6C 5KAFH 2LXBA 1MUUA 1QL1A 3CXHD 2W6BA 2R44A 1QGKB 2WDQD 2M0BA 3SWYA 2N9BA 5KKZC 1HF9A 1URQA 4PD4D 3CWBJ 1FJPA 2E74D 2HG5D 3HD7C 3G3ZA 1J1EB 2WSCJ 2IBZE 2BEZF 1DEEG 5C39A 2O1JA 2IFMA 2I8DA 3G6EP 3M9BA 1PP9G 1QVFO 4YSZD 1NWQA 1N7SC 1LWUB 2JR8A 2OYHB 1J1DB 2QSIA 4EYYQ 2O01J 2W27A 1VQLP 1NO4A 3CX5D 3H1LG 3D6YA 1HTLC 3L71D 3RK2D 2P67A 2Q3EA 1L0ND 4OGQD 1YYCA 3L37A 3A0BH 1RE3C 1G2CB 1SQQK 2O01H 2Q6QA 3H1LE 4U3FG 1Q2NA 1USEA 3AE6D 2I1JA 1KYOH 1SQXD 1ZMEC 3RBXA 1KB9D 4D6TJ 1MFTA 2AEJA 4U3FD 5AW4B 3I56P 3TNUB 3PP5A 5APWA 5APUA 1RH5B 1ZP0C 3H1KG 5APVA 3FXDA 1S5LH 2HYNA 2YXRB 1SQPG 3LIEA 1EXIA 2KYVA 3JC22 3L72E 3AE1D 3P7KA 2E43A 1OZHA 1KILC 2FFDB 2G3AA 1NTMG 4Y99C 1YJWP 3PHLA 1S9KE 3V2QA 3BCCG 1L0NG 1SQPK 1GZLA 4C7NA 4B86A 5AW3B 3P4RD 2OYIC 3H1JD 2WPSA 1AJYA 1U57A 2M3EA 1SQVD 5CBOA 3CXHH 4LLHA 4YXWH 2A06D 3AEBD 1FAVA 4U3FE 1ZV8A 2QE7H 5AW0B 1SQVG 1M1KQ 1OW7A 2A06E 2C9LY 4ZMDA 3CMAP 5TISH 3Q1MA 5KJ7C 3HUSA 1OMIA 3HE5A 1KILA 1SQBE 1NTKJ 1KC8Q 3OA7A 3A0BE 3KYQA 3SFED 2KIKA 1IFJA 2WDQC 3A5TA 3L4FA 2JWAA 1YQ4D 2PFXA 3M0DC 2K3RA 2JJLA 4WY4D 2XV5A 1KILD 4GOEA 3PLNA 2UWJE 2ZYGA 1VQ8P 3M91A 4XE5B 1JY3P 3PJSK 2A45I 3CCRP 2KSJA 1L0NJ 4Y28J 1H0TB 3BASA 2AXTH 2IZ1A 1H88A 1RE4A 4ZNCA 3L35A
chains in the Genus database with same CATH topology
1KILE 2YIUC 3P4QD 2G3AA 2NZ2A 4I7ZC 4H0LC 4RKUJ 2JO1A 3Q3DA 2BS3C 4H13B 2H88D 3AEFC 4YSYC 1FDOA 1RQVA 2WDVD 4YTPD 3VRAD 2K9YA 3H25A 1KFYC 2WDQD 1KORA 2BEQD 3AEGC 4H44B 4OGQB 3S9OA 4YT0D 3EWKA 4H0LB 4XFJA 3CIRC 5C2TC 2WPVB 1PL5A 2WU5D 3SFDD 1OW6A 3ABVC 1VF5C 3R4YA 3D70A 5KKZC 1WMKA 1ZOYC 3AE3C 1HF9A 5C3JD 3VR8D 2G8YA 1JB0J 1FDIA 1K04A 2JP3A 2WS3D 4YSXD 1DD3A 2B76C 3P4SC 3AE5C 2E74D 4IL6X 3RL0g 4R4MA 3Q2YA 1KF6D 4H44C 4R4LA 2ZT9D 3AE4D 4KT0J 3P4RD 1ZP0D 1L0VC 2H88C 1NGMB 4TT3H 2WSCJ 3Q5PA 4KX6D 1UIXA 4YTNC 1AJYA 1U57A 2WDVC 1QLBC 2BEZF 1GMJA 1YQ4C 4PV1B 3P4PD 3Q5RA 1NEKC 1E7PC 1KTMA 1YQ3D 2ACZD 3AE9C 3AEBD 2E75C 3B71A 5KLIC 3AEEC 1ZOYD 3AE3D 2QIWA 3VRBC 3VR8C 1K05A 1OW7A 2WS3C 3AE8C 2WU2C 4YXDD 2E74B 2P10A 3P4QC 2D2CD 2OQQA 4GDOA 2E76C 3AE1C 3AEAC 1DIPA 4I7ZB 1S5LX 3AECD 4YSZD 3Q1MA 3VR9D 2WDRD 2WP9C 4U7JA 1NENC 3AEDC 1IK7A 1R8EA 1OMIA 2ZT9B 2B76D 3AE5D 1OW8A 2E76B 3LW5J 2J5UA 4H0LD 1ZRTE 1S1CX 3GMAA 3IAOA 1TU3F 2QSIA 3AE4C 4H44D 4PV1D 2O01J 2WQYD 2QJYC 2BS4C 3P4PC 1L0VD 2H89C 4YSYD 4YTMD 3AE7D 2WU5C 4YT0C 1KQGB 3SFDC 3D6YA 3SFED 3AEFD 4YTPC 1PIXA 2MKVA 1KFYD 2WDQC 4YXDC 3AEGD 1VF5D 1YQ4D 1DD4A 5C2TD 4OGQD 3AEAD 1MKMA 2FXPA 2QJKC 3ABVD 1Q90D 3AE2D 5L8RJ 3AEED 2BS2C 3VRAC 4H13C 2IDBA 3AE6D 2YMKA 2WU2D 2ZT9C 1Y9BA 3AE8D 3D6ZA 4YSXC 3G9RA 1HJ0A 1EXJA 2FBWC 1ZMEC 2WQYC 4PV1C 2WSFJ 3AE9D 3GLMA 2D2CB 3P4RC 3AECC 1VL2A 1NEKD 2FYNC 3FGAD 1NYHA 1YQ3C 2WSEJ 3P4SD 3O6QA 2D2CC 1KMIZ 5M1BA 3D71A 4Z1MH 1RQUA 3AE7C 1PV3A 3CIRD 3VRBD 2H89D 2WDRC 3GF7A 1ZP0C 4OGQC 2E75B 2QJPC 3T97B 4Y28J 3GF3A 1NEND 2V7QJ 2ACZC 3AEDD 4KX6C 5C3JC 3SFEC 4YTND 3AE2C 3AEBC 2E75D 3Q5SA 3IN6A 1KQFB 4YSZC 2E74C 4H13D 2E76D 1VF5B 3AE6C 3C8VA 3RK3E 1EXIA 2WP9D 3AE1D 4YTMC 1KF6C 3VR9C 2FBWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4Q D;  2G3A A;  2H88 D;  2BS3 C;  3AEF C;  4YSY C;  4YTP D;  2WDV D;  3VRA D;  1KFY C;  2WDQ D;  3S9O A;  3AEG C;  4YT0 D;  5C2T C;  2WU5 D;  3SFD D;  3ABV C;  1OW6 A;  1ZOY C;  3AE3 C;  3VR8 D;  5C3J D;  4YSX D;  2WS3 D;  1K04 A;  2B76 C;  3P4S C;  3AE5 C;  1KF6 D;  3AE4 D;  3P4R D;  1ZP0 D;  1L0V C;  2H88 C;  4KX6 D;  4YTN C;  2WDV C;  1QLB C;  1YQ4 C;  3P4P D;  1NEK C;  1E7P C;  1KTM A;  1YQ3 D;  2ACZ D;  3AE9 C;  3AEB D;  3B71 A;  3AEE C;  1ZOY D;  3AE3 D;  3VRB C;  3VR8 C;  1K05 A;  1OW7 A;  2WS3 C;  3AE8 C;  2WU2 C;  4YXD D;  3P4Q C;  3AE1 C;  3AEA C;  3AEC D;  4YSZ D;  3VR9 D;  2WDR D;  2WP9 C;  1NEN C;  3AED C;  2B76 D;  3AE5 D;  1OW8 A;  2WQY D;  3AE7 D;  3CIR C;  3AE4 C;  4YSY D;  3P4P C;  4YTM D;  2BS4 C;  1L0V D;  2H89 C;  4YT0 C;  2WU5 C;  3SFD C;  3SFE D;  3AEF D;  4YTP C;  1KFY D;  2WDQ C;  4YXD C;  3AEG D;  1YQ4 D;  5C2T D;  3AEA D;  3ABV D;  3AE2 D;  3AEE D;  2BS2 C;  3VRA C;  3AE6 D;  2WU2 D;  3AE8 D;  4YSX C;  2FBW C;  2WQY C;  3AE9 D;  3P4R C;  3AEC C;  1NEK D;  1YQ3 C;  3P4S D;  3AE7 C;  3CIR D;  1PV3 A;  3VRB D;  2H89 D;  2WDR C;  1ZP0 C;  1NEN D;  2ACZ C;  3AED D;  5C3J C;  4KX6 C;  3SFE C;  4YTN D;  3AE2 C;  3AEB C;  4YSZ C;  3AE1 D;  3AE6 C;  2WP9 D;  4YTM C;  1KF6 C;  3VR9 C;  2FBW D; 
#chains in the Genus database with same CATH topology
 1SQX J;  1SFC C;  1LP1 A;  1QVG O;  1FZA A;  2JO1 A;  1J1D C;  3GHG A;  1LNQ A;  2XND H;  1FC2 C;  5H2F H;  1LTJ C;  2Z5I A;  2WU5 D;  2FYU D;  3WUT A;  5CJ4 A;  3WUV A;  2GUV A;  3R4Y A;  3V6I A;  1FDI A;  5AVU B;  1H0T A;  1RF0 A;  1FZF A;  3M0D A;  1NU1 J;  3VON A;  2WDV C;  1QLB C;  2Q5U A;  3A7O A;  3RK2 B;  1PPJ E;  2E75 C;  4HB1 A;  1BSN A;  1PPJ D;  3L72 D;  1L4A A;  4GDO A;  1JO5 A;  2ZXX A;  3P8C D;  3JCU H;  1SVF A;  2IBZ I;  5GTH H;  3H1J J;  3M0A A;  1QEX A;  1LT9 A;  2WWW A;  1NAY A;  3AE4 C;  3H1H G;  1LTB C;  2QJY C;  4HYT B;  3B5N D;  1M90 Q;  4IL6 H;  4YTP C;  4DDG A;  5E79 H;  2FYU E;  3BRT B;  1ZR2 A;  2WSE H;  3AEA D;  2OYO A;  2BCC E;  3RL0 D;  1AFO A;  1KQS O;  1VQ4 P;  3G9R A;  1HJ0 A;  3TGU D;  2D2C B;  1JUN A;  3A2A A;  2WT7 A;  4MN4 C;  2IYP A;  3BCC D;  1EZV G;  1RE4 C;  3MTU E;  2WSE J;  3M9Q A;  2J58 A;  2H89 D;  3CWB D;  4DZO A;  1VQK P;  4YTM C;  2OYI B;  4H13 B;  1JY3 O;  2WDV D;  1ZW0 A;  3EWK A;  1RHZ B;  3VN0 A;  2IZ0 A;  1HH0 A;  1DD3 A;  1N2D C;  4ZKU A;  2C0X A;  1ZP0 D;  3CC2 P;  4HJG H;  4GT1 A;  1GMJ A;  5CCG D;  2HLO A;  2CPB A;  3A0H H;  1N73 B;  4ASW A;  3LID A;  1SQQ G;  3B71 A;  2HFE D;  4YXD D;  2P10 A;  2N1T B;  1K8A Q;  3U1A A;  3L70 E;  3CCJ P;  2E76 C;  4DDI A;  4QMA A;  5B66 E;  4U7J A;  1R8E A;  1LT9 C;  2P7J A;  3HD7 B;  3USS A;  4YSY D;  4GIF A;  4D6T D;  1N8R Q;  2RN0 A;  4U3F J;  3B4S A;  3SFD C;  4OWF A;  1CW5 A;  1QLE D;  2ZYA A;  4YXD C;  3L75 G;  5KLV K;  1W2E A;  3L72 J;  3VOP A;  2I1K A;  3S4R A;  2BS2 C;  2IDB A;  4I6L A;  1NTK E;  3PH0 A;  2J59 M;  1FOS E;  2RKL A;  1M1J A;  2V7Q H;  2WIT A;  1U7M A;  3Q5S A;  1N7S B;  3RK3 E;  1M7L A;  1SQV J;  3AEF C;  3CCU P;  4IFD K;  4XFJ A;  1BSH A;  2IYO A;  3RK3 B;  1EDK A;  2SPZ A;  3H1J G;  4WB4 A;  1VQN P;  1Q7Y Q;  4L76 A;  1KF6 D;  3CX5 I;  1NTM E;  3A0H E;  1L0V C;  3G4S P;  3CWB E;  3TNU A;  1SQB K;  4AYC A;  2GA1 A;  2Q3I A;  5TIS E;  1NEK C;  5AVX B;  2FXM A;  2POH A;  2WU2 C;  2E74 B;  3GG2 A;  1M8O B;  1JNM A;  2QJP B;  3VR9 D;  3SWK A;  1MV8 A;  1SQX K;  2KSE A;  3H1K J;  4DHI B;  1OW8 A;  5DJT B;  1ZRT E;  4PJ0 H;  2W8Z A;  4C7N B;  2LKM A;  2QM7 A;  3NFQ A;  3MUD C;  2FXP A;  3SWF A;  1LGH B;  2PRR A;  1EQ7 A;  3KZI E;  3D6Z A;  2DW3 A;  1XTC C;  5APY A;  3AE9 D;  4ASV A;  3H6P A;  4HKZ H;  1JCD A;  1HVV A;  3FGA D;  1S3J A;  1YQ3 C;  3O6Q A;  2FYU J;  5AVZ B;  2GUS A;  1BE3 J;  2WDR C;  3B5N A;  2YKP A;  4OGQ C;  2NPS B;  1X9V A;  1NEN D;  3H32 A;  2QEX P;  2IFN A;  2WP9 D;  1NU1 D;  1VQO P;  1KF6 C;  3B8E B;  5CCH D;  4WY4 B;  1SFC A;  1VDF A;  3V5B A;  5BVZ A;  2GM4 A;  1CI6 A;  4C46 A;  1KOR A;  1NTK G;  1EZV D;  1L2P A;  1KFN A;  4C7R A;  2W6J H;  3IFM A;  3AE3 C;  3NXS A;  2Y9Z A;  2AEM A;  3RBZ A;  1BDD A;  3AE5 C;  3Q2Y A;  3BRV B;  1IO4 A;  1LJ2 A;  4YTN C;  4N78 E;  1JY2 O;  4N6J A;  1RY3 A;  3E7K A;  1YJ9 P;  3L70 D;  2Y9Y A;  1EDJ A;  2H7H A;  3AE8 C;  3E1I A;  2D2C D;  3GHG B;  1DIP A;  1FZC B;  5B5E H;  1RF1 B;  2B76 D;  4HH2 A;  2J5U A;  3TGU J;  3MP7 B;  1JTH A;  4PV1 D;  3GMA A;  3N4X A;  3NTN A;  2R3C A;  3CX5 E;  1J2J B;  4YTM D;  3BCC J;  1KQG B;  4N3Y B;  2P1J A;  4BRY A;  2MJZ A;  4KHX A;  5KLV G;  1GW4 A;  1Y47 A;  5APQ A;  1X79 B;  1X22 A;  4DHJ A;  2XNX A;  3CCQ P;  1KFM A;  1SQP J;  4WWI A;  5AW6 B;  2YXQ B;  4DHZ A;  3CME P;  2WSF J;  3BAT A;  3BVH A;  1N7S A;  2QM8 A;  4RES B;  1KMI Z;  5M1B A;  3D71 A;  2ZAE B;  5CCG C;  2ITA A;  3B5N C;  5KKZ B;  1VQ7 P;  2KK7 A;  3WU2 H;  1E79 H;  4I1L A;  2W6A A;  1KB9 H;  4RKU J;  3H25 A;  1KFY C;  4OGQ B;  3SSU A;  5C2T C;  4NPD A;  3QWO C;  5KLV J;  1ZN5 A;  2QA4 P;  1BE3 D;  1WMK A;  1JCC A;  1K04 A;  2B76 C;  3P4S C;  4R4M A;  3CCS P;  3TGU G;  2BAS A;  3VMX A;  2HOD A;  4PV1 B;  1RE3 A;  1ZR4 A;  3H1I E;  1J1E C;  4OH8 B;  1FE6 A;  3HUS B;  3A3Y B;  2WS3 C;  1NAF A;  3TYY A;  3KQG A;  1T6A A;  3G71 P;  2R3S A;  2OTL P;  1KIL B;  2FFD C;  1S1C X;  1CZQ A;  2RMZ A;  1P84 E;  2BS4 C;  3CC4 P;  1PIX A;  5APT A;  2FXO A;  2QJK C;  4CPG A;  1Q90 D;  4UB8 E;  3O6Q B;  5APX A;  4GOF A;  5AVS B;  2N1T C;  1Y9B A;  2RH0 A;  2WQY C;  4A7P A;  2BCC J;  4PJ0 E;  1VQ5 P;  1CI6 B;  2KB7 P;  4O9B A;  3P4S D;  1RQU A;  3JCU E;  2KNC B;  4ZKP A;  3T97 A;  1LTA C;  2FBW D;  3CXH I;  3TSI A;  4YSY C;  4H44 B;  1YI2 P;  4H0L B;  1OXZ A;  1IFI A;  2H8P D;  2YIU B;  2A45 H;  3IF4 A;  3E1R A;  4JQ0 D;  2M5A B;  3RL0 g;  3CC7 P;  2WSF H;  2KS1 B;  3H1K D;  3L73 D;  1S72 P;  1AVY A;  1NHL A;  1GL2 D;  2Q7C A;  1XTG B;  1NOH A;  2ACZ D;  3KPE A;  4K35 A;  5KLV D;  2P58 A;  3GW6 A;  2Y0E A;  1NTK K;  2B9B A;  3L36 A;  2WDR D;  2KI7 B;  3VP9 A;  2WPQ A;  4JF7 A;  2HPC A;  1S4X A;  2ZXE B;  4YT0 C;  4DCK A;  3L75 E;  1URQ B;  3AEG D;  4JYB A;  1L0L K;  5E79 E;  1DD4 A;  3B5N B;  1T8Z A;  2FY8 A;  4YSX C;  1H89 A;  2FKW B;  1BCC J;  4D6T E;  3V4W A;  1R5L A;  5KJ7 A;  3VRB D;  1JMM A;  2YO3 A;  3FX0 A;  5H2F E;  2QJP C;  3IN6 A;  1KQF B;  4YSZ C;  1LWU A;  1AVO A;  5AVT B;  2B88 A;  1KIL E;  3Q3D A;  4GKG A;  4L74 A;  3M9H A;  2BCC D;  1A02 J;  3HTK A;  5KJ7 D;  1SQQ D;  3S9O A;  2CPS A;  1YIT P;  3L70 J;  1PL5 A;  3RK2 C;  1VF5 C;  5AW2 B;  2WMM A;  1YIJ P;  3PTZ A;  1NJI Q;  4NPE A;  4H44 C;  2ZT9 D;  4DJG A;  1AV1 A;  3IR9 A;  3CCE P;  1SQX G;  1Q81 Q;  1FZC C;  1IFN A;  3OW2 O;  3HRN A;  1YTZ I;  1X8Y A;  1WT6 A;  2XU6 A;  4PD4 H;  3VRB C;  1IC2 A;  3VMA A;  3CX5 H;  3WUU A;  1SP4 A;  3AE1 C;  2KLU A;  1S5L E;  2QJK B;  5AW9 B;  1SQP D;  3L73 J;  1IK7 A;  3LW5 J;  1TU3 F;  3P4P C;  1PGJ A;  2W83 C;  1LWU C;  2MKV A;  1PZQ A;  2R32 A;  3ZDM A;  1ZXG A;  3ABV D;  1BGY E;  1LTG C;  3AE8 D;  2ZT9 C;  3S1K A;  1E5W A;  1VL2 A;  1UII A;  1DEB A;  3U59 A;  2Y0D A;  2NPS C;  1HGZ A;  1EDI A;  1L4A B;  4WVZ A;  2ACZ C;  4M3L A;  1GL2 C;  1SQX E;  1N7S D;  4YTP D;  1BE3 G;  2JKV A;  2BEQ D;  3AEG C;  3VYI A;  1LT1 A;  1BCC D;  1Q82 Q;  4UB8 H;  1KN7 A;  1OW6 A;  2KP8 A;  3MUD A;  2C0W A;  3TF5 A;  2WVR A;  2C9N Y;  1L0L E;  1KYO E;  2QRX A;  3F89 A;  4TT3 H;  1UIX A;  3L74 J;  2HR3 A;  5AW5 B;  1SQQ J;  1R5S A;  1VPC A;  5AVY B;  1M57 D;  1GK4 A;  1YJN P;  3AE3 D;  1KB9 E;  2QIW A;  5B5E E;  3CCV P;  3P4Q C;  2AEF A;  1HGV A;  1LP1 B;  1S5L X;  3AEC D;  2FYU K;  5APS A;  2OYH A;  1IFM A;  3AED C;  4D6T G;  4JPZ B;  1W2B O;  2WTY A;  2Z4E A;  4L75 A;  5BU5 A;  2B87 B;  1JMB A;  1KYO I;  3HE5 B;  2WU5 C;  3MHV A;  5KAF E;  5KAI H;  1VF5 D;  1VQP P;  2E5T A;  1ZLL A;  3H1L J;  5AVR B;  2KUB A;  3CXH E;  5CHX A;  4PV1 C;  1NTM K;  2V4H A;  2N1T A;  2R5D A;  2A06 G;  3P32 A;  3CL3 D;  4LGD E;  1URQ D;  1GDT A;  1YBK A;  1SQV K;  2AXC A;  2A45 G;  4YTN D;  1NH4 A;  1GL2 A;  3V2N A;  2KS1 A;  2YIU C;  4I7Z C;  2H88 D;  2BS3 C;  2M5A A;  1GTW A;  1SLQ A;  1KV4 A;  4YT0 D;  2XZR A;  4UB6 E;  2ZFC A;  3BCC E;  1MZ9 A;  1PGP A;  4L73 A;  1OWA A;  1M1J C;  1L4A D;  4R4L A;  3RL0 B;  2PP6 A;  3L75 J;  2ZYD A;  1TFF A;  2QVA A;  3WU2 E;  2NRG A;  2ZJS E;  3II6 A;  1IFD A;  1RF1 A;  3EFF K;  3C9I A;  1NU1 G;  2JEE A;  2K88 A;  1BCC E;  3WMM 0;  1SS1 A;  3L73 G;  3L74 D;  4W7Z A;  3I55 P;  1L0V D;  1DH3 A;  3HD7 A;  1LTJ B;  5TJH A;  1FU1 A;  1T2K C;  1OVR A;  3HD7 D;  2IPP A;  3L73 E;  3KXD A;  5AW1 B;  1N7L A;  1NTM J;  3K5B A;  3PRJ A;  1YTZ T;  1NTZ K;  1LTS C;  1JY3 N;  2FYN C;  4DOJ A;  1GD2 E;  1EZV E;  2D2C C;  2M8R A;  1L0N E;  3MGN A;  1BGY J;  1EZV I;  5C3J C;  2AXT E;  1VF5 B;  2BCC G;  4FJV A;  2NZ2 A;  4IFM A;  3L74 G;  3VRA D;  2K9Y A;  5EFW B;  3CPW O;  1GU4 A;  2WPV B;  4N78 D;  5CBN A;  3ABV C;  2ZFY A;  4XA4 A;  5C3J D;  2JP3 A;  3VMZ A;  4IL6 X;  2HOD B;  4PD4 E;  1NU1 E;  4BXL A;  3MIW A;  3TDK A;  4Y99 B;  1NKZ B;  1RF1 C;  1N73 C;  4DT0 A;  1PGO A;  4UB6 H;  1E7P C;  1YQ3 D;  4LC1 A;  5KLI C;  3CWB G;  1PP9 J;  3RL0 C;  1IJD B;  1BE3 E;  4RJT A;  1OFC X;  3AEA C;  5BU8 B;  5AVQ B;  3AE5 D;  5CCG A;  1SQQ E;  3QH9 A;  3IAO A;  3L75 D;  2OYI A;  2K9J B;  3H1I D;  1PP9 E;  1KFY D;  1SQB D;  1FJK A;  1QX8 A;  3P8C E;  1YHQ P;  2YKQ A;  2PGD A;  4I6M C;  5AW7 B;  2FBW C;  1G2C A;  3GLM A;  1NTZ J;  2WSC H;  1GL2 B;  2FYU G;  3N7N A;  2YKO A;  4W80 A;  3AE7 C;  3CIR D;  2V7Q J;  4KX6 C;  2VRS A;  2NPS A;  1LT9 B;  2Z5H A;  1HJB A;  2KZI A;  2NPS D;  1S9K D;  4BWN A;  1PPJ G;  3MD0 A;  3VR8 D;  2LR2 A;  2B89 A;  3L70 G;  3RK3 D;  1VQ9 P;  4NPF X;  2W90 A;  2JDI H;  5CCH A;  3H1H D;  1JM0 A;  1VQ6 P;  2B87 A;  3H1H E;  3P4P D;  1KTM A;  3JSV C;  1T3J A;  3AEE C;  3H32 B;  3VR8 C;  1K05 A;  2WT7 B;  1T3U A;  2OQQ A;  3H1L D;  2ZVO B;  2YMY A;  1HUC A;  1KQL A;  3HE4 A;  3VP8 A;  1G1J A;  2KXP B;  1LTT C;  1Y8A A;  3V2P A;  3CCL P;  4EI2 A;  3EFG A;  4IFF A;  5C2T D;  1GK6 A;  1MKM A;  5AVV B;  1KZU B;  3AE2 D;  2PAJ A;  3VRA C;  2YMK A;  5CCH C;  3O8Z A;  1AQT A;  3AEC C;  4AUW A;  3H1I J;  1SQB J;  3CLQ A;  3VMY A;  1K73 Q;  1L0N K;  3ITK A;  3SFE C;  2E75 D;  2E74 C;  3LW5 H;  4LDT A;  3HTK B;  1P84 I;  1JOC A;  2WPR A;  1FDO A;  1T2K D;  1USD A;  3SFD D;  3D70 A;  2K37 A;  2WSS H;  1FZG A;  1JB0 J;  1KB9 I;  4YSX D;  1DX7 A;  1ZRT D;  1NTZ G;  3W67 A;  2H88 C;  1IFP A;  3MZW B;  3FXE A;  1AQ5 A;  1WRG A;  2KOG A;  3Q5R A;  1AA0 A;  1P84 H;  1HWT C;  2K1A A;  4I7Z B;  1LTI C;  3FWL A;  5GTH E;  1D7M A;  2WP9 C;  1JTH B;  1OX3 A;  1SQV E;  1A02 F;  3GHG C;  1NTM D;  2FYZ A;  3TK1 A;  3AE7 D;  3CIR C;  4WY4 A;  3V4Q A;  2OTJ P;  5GTI E;  1BCC G;  4BRY B;  1NU1 K;  1QL2 A;  3KHU A;  1BGY D;  1K9M Q;  2L5G B;  1M56 D;  4H13 C;  3KZI H;  1L0L J;  1EXJ A;  2O01 N;  2OGU A;  1NYH A;  4EIJ A;  3L74 E;  4Z1M H;  3R2P A;  3I5C A;  3FWN A;  3L72 G;  4EDF A;  1FOS F;  2HPC B;  3H1J E;  3EQ2 A;  3H1K E;  2KNC A;  3OJA B;  4H13 D;  5GTI H;  3P4R C;  3VR9 C;  5CMZ A;  1NTZ E;  5CJ0 A;  1RQV A;  2N1T D;  2YO2 A;  4W7Y A;  1U7J A;  2O1K A;  3UIA A;  4WBA A;  3M06 A;  1GW3 A;  1PP9 D;  3C1L A;  2OTK E;  2FYN B;  1HBW A;  5KAI E;  2G8Y A;  5KLI B;  1Q86 Q;  4KT0 J;  2FFD A;  2Q1K A;  2R5B A;  1NGM B;  3Q5P A;  4KX6 D;  4OVN F;  3HUS C;  3HE4 B;  4PD4 I;  2QG4 A;  2XDJ A;  1JY2 N;  1N73 A;  1G1I A;  3KDP B;  2IBZ D;  1NEN C;  2O3J A;  2ZT9 B;  1IZN B;  3CD6 P;  2JWD A;  2WQY D;  1KYO D;  1FZB A;  1NTZ D;  1SFC B;  3L71 G;  1MFZ A;  4AQR D;  5KTB A;  2IBZ G;  3AEF D;  2QJY B;  4JBZ A;  3RK3 C;  1VQM P;  1EDL A;  1EC5 A;  4RO0 A;  2E5Y A;  1IK9 A;  1OIP A;  1SQP E;  2Q9I A;  3VTP C;  3U1C A;  1OVU A;  4K3A A;  2WZ7 A;  5AW8 B;  5K5G B;  1S2E A;  4IOI H;  1NTK D;  1P84 D;  1CSB A;  2P2U A;  1PV3 A;  2M3B A;  1FS0 E;  2ZVN B;  1L0L G;  3H1I G;  2E75 B;  3T97 B;  3RGU A;  5DJU B;  3V2R A;  3AED D;  3AEB C;  2E42 A;  1LTJ A;  2K9J A;  3C8V A;  1L4A C;  3TGU E;  2OAR A;  1L0L D;  1OVV A;  1FZC A;  3P4Q D;  3H1H J;  4H0L C;  1H8A A;  4EOT A;  2OYH C;  4JYC A;  2LXC B;  4KJM A;  3L71 E;  3F5H A;  1ZOY C;  3CCM P;  2WS3 D;  1GU5 A;  1JY2 P;  2XKM A;  2H43 A;  1RF0 C;  4IL6 E;  3AE4 D;  4GOD A;  2YNY A;  2KZJ A;  4WY4 C;  1JEK A;  2N9Y B;  2L91 A;  2Y0C A;  1YQ4 C;  1NVO A;  5AVW B;  4I2L C;  1X0T A;  2IX7 C;  1NKN A;  3AE9 C;  3L71 J;  1BGY G;  1ZOY D;  4TLF A;  1PGQ A;  1N86 A;  1M1J B;  1Z56 A;  2E76 B;  3P8M C;  4H0L D;  1URQ C;  4H44 D;  2KLV A;  2H89 C;  1W5C E;  5B66 H;  1FBM A;  5KLV E;  3OAK A;  3W68 A;  3CI9 A;  1SFC D;  5L8R J;  3AEE D;  2WU2 D;  1SQB G;  2CK3 H;  1NEK D;  1BDC A;  4YPC A;  1FDM A;  1FZE A;  3NMD A;  3GF7 A;  1KD1 Q;  3GF3 A;  3AE2 C;  1PFI A;  2E76 D;  3AE6 C;  5KAF H;  2LXB A;  1MUU A;  1QL1 A;  3CXH D;  2W6B A;  2R44 A;  1QGK B;  2WDQ D;  2M0B A;  3SWY A;  2N9B A;  5KKZ C;  1HF9 A;  1URQ A;  4PD4 D;  3CWB J;  1FJP A;  2E74 D;  2HG5 D;  3HD7 C;  3G3Z A;  1J1E B;  2WSC J;  2IBZ E;  2BEZ F;  1DEE G;  5C39 A;  2O1J A;  2IFM A;  2I8D A;  3G6E P;  3M9B A;  1PP9 G;  1QVF O;  4YSZ D;  1NWQ A;  1N7S C;  1LWU B;  2JR8 A;  2OYH B;  1J1D B;  2QSI A;  4EYY Q;  2O01 J;  2W27 A;  1VQL P;  1NO4 A;  3CX5 D;  3H1L G;  3D6Y A;  1HTL C;  3L71 D;  3RK2 D;  2P67 A;  2Q3E A;  1L0N D;  4OGQ D;  1YYC A;  3L37 A;  3A0B H;  1RE3 C;  1G2C B;  1SQQ K;  2O01 H;  2Q6Q A;  3H1L E;  4U3F G;  1Q2N A;  1USE A;  3AE6 D;  2I1J A;  1KYO H;  1SQX D;  1ZME C;  3RBX A;  1KB9 D;  4D6T J;  1MFT A;  2AEJ A;  4U3F D;  5AW4 B;  3I56 P;  3TNU B;  3PP5 A;  5APW A;  5APU A;  1RH5 B;  1ZP0 C;  3H1K G;  5APV A;  3FXD A;  1S5L H;  2HYN A;  2YXR B;  1SQP G;  3LIE A;  1EXI A;  2KYV A;  3JC2 2;  3L72 E;  3AE1 D;  3P7K A;  2E43 A;  1OZH A;  1KIL C;  2FFD B;  2G3A A;  1NTM G;  4Y99 C;  1YJW P;  3PHL A;  1S9K E;  3V2Q A;  3BCC G;  1L0N G;  1SQP K;  1GZL A;  4C7N A;  4B86 A;  5AW3 B;  3P4R D;  2OYI C;  3H1J D;  2WPS A;  1AJY A;  1U57 A;  2M3E A;  1SQV D;  5CBO A;  3CXH H;  4LLH A;  4YXW H;  2A06 D;  3AEB D;  1FAV A;  4U3F E;  1ZV8 A;  2QE7 H;  5AW0 B;  1SQV G;  1M1K Q;  1OW7 A;  2A06 E;  2C9L Y;  4ZMD A;  3CMA P;  5TIS H;  3Q1M A;  5KJ7 C;  3HUS A;  1OMI A;  3HE5 A;  1KIL A;  1SQB E;  1NTK J;  1KC8 Q;  3OA7 A;  3A0B E;  3KYQ A;  3SFE D;  2KIK A;  1IFJ A;  2WDQ C;  3A5T A;  3L4F A;  2JWA A;  1YQ4 D;  2PFX A;  3M0D C;  2K3R A;  2JJL A;  4WY4 D;  2XV5 A;  1KIL D;  4GOE A;  3PLN A;  2UWJ E;  2ZYG A;  1VQ8 P;  3M91 A;  4XE5 B;  1JY3 P;  3PJS K;  2A45 I;  3CCR P;  2KSJ A;  1L0N J;  4Y28 J;  1H0T B;  3BAS A;  2AXT H;  2IZ1 A;  1H88 A;  1RE4 A;  4ZNC A;  3L35 A; 
#chains in the Genus database with same CATH homology
 1KIL E;  2YIU C;  3P4Q D;  2G3A A;  2NZ2 A;  4I7Z C;  4H0L C;  4RKU J;  2JO1 A;  3Q3D A;  2BS3 C;  4H13 B;  2H88 D;  3AEF C;  4YSY C;  1FDO A;  1RQV A;  2WDV D;  4YTP D;  3VRA D;  2K9Y A;  3H25 A;  1KFY C;  2WDQ D;  1KOR A;  2BEQ D;  3AEG C;  4H44 B;  4OGQ B;  3S9O A;  4YT0 D;  3EWK A;  4H0L B;  4XFJ A;  3CIR C;  5C2T C;  2WPV B;  1PL5 A;  2WU5 D;  3SFD D;  1OW6 A;  3ABV C;  1VF5 C;  3R4Y A;  3D70 A;  5KKZ C;  1WMK A;  1ZOY C;  3AE3 C;  1HF9 A;  5C3J D;  3VR8 D;  2G8Y A;  1JB0 J;  1FDI A;  1K04 A;  2JP3 A;  2WS3 D;  4YSX D;  1DD3 A;  2B76 C;  3P4S C;  3AE5 C;  2E74 D;  4IL6 X;  3RL0 g;  4R4M A;  3Q2Y A;  1KF6 D;  4H44 C;  4R4L A;  2ZT9 D;  3AE4 D;  4KT0 J;  3P4R D;  1ZP0 D;  1L0V C;  2H88 C;  1NGM B;  4TT3 H;  2WSC J;  3Q5P A;  4KX6 D;  1UIX A;  4YTN C;  1AJY A;  1U57 A;  2WDV C;  1QLB C;  2BEZ F;  1GMJ A;  1YQ4 C;  4PV1 B;  3P4P D;  3Q5R A;  1NEK C;  1E7P C;  1KTM A;  1YQ3 D;  2ACZ D;  3AE9 C;  3AEB D;  2E75 C;  3B71 A;  5KLI C;  3AEE C;  1ZOY D;  3AE3 D;  2QIW A;  3VRB C;  3VR8 C;  1K05 A;  1OW7 A;  2WS3 C;  3AE8 C;  2WU2 C;  4YXD D;  2E74 B;  2P10 A;  3P4Q C;  2D2C D;  2OQQ A;  4GDO A;  2E76 C;  3AE1 C;  3AEA C;  1DIP A;  4I7Z B;  1S5L X;  3AEC D;  4YSZ D;  3Q1M A;  3VR9 D;  2WDR D;  2WP9 C;  4U7J A;  1NEN C;  3AED C;  1IK7 A;  1R8E A;  1OMI A;  2ZT9 B;  2B76 D;  3AE5 D;  1OW8 A;  2E76 B;  3LW5 J;  2J5U A;  4H0L D;  1ZRT E;  1S1C X;  3GMA A;  3IAO A;  1TU3 F;  2QSI A;  3AE4 C;  4H44 D;  4PV1 D;  2O01 J;  2WQY D;  2QJY C;  2BS4 C;  3P4P C;  1L0V D;  2H89 C;  4YSY D;  4YTM D;  3AE7 D;  2WU5 C;  4YT0 C;  1KQG B;  3SFD C;  3D6Y A;  3SFE D;  3AEF D;  4YTP C;  1PIX A;  2MKV A;  1KFY D;  2WDQ C;  4YXD C;  3AEG D;  1VF5 D;  1YQ4 D;  1DD4 A;  5C2T D;  4OGQ D;  3AEA D;  1MKM A;  2FXP A;  2QJK C;  3ABV D;  1Q90 D;  3AE2 D;  5L8R J;  3AEE D;  2BS2 C;  3VRA C;  4H13 C;  2IDB A;  3AE6 D;  2YMK A;  2WU2 D;  2ZT9 C;  1Y9B A;  3AE8 D;  3D6Z A;  4YSX C;  3G9R A;  1HJ0 A;  1EXJ A;  2FBW C;  1ZME C;  2WQY C;  4PV1 C;  2WSF J;  3AE9 D;  3GLM A;  2D2C B;  3P4R C;  3AEC C;  1VL2 A;  1NEK D;  2FYN C;  3FGA D;  1NYH A;  1YQ3 C;  2WSE J;  3P4S D;  3O6Q A;  2D2C C;  1KMI Z;  5M1B A;  3D71 A;  4Z1M H;  1RQU A;  3AE7 C;  1PV3 A;  3CIR D;  3VRB D;  2H89 D;  2WDR C;  3GF7 A;  1ZP0 C;  4OGQ C;  2E75 B;  2QJP C;  3T97 B;  4Y28 J;  3GF3 A;  1NEN D;  2V7Q J;  2ACZ C;  3AED D;  4KX6 C;  5C3J C;  3SFE C;  4YTN D;  3AE2 C;  3AEB C;  2E75 D;  3Q5S A;  3IN6 A;  1KQF B;  4YSZ C;  2E74 C;  4H13 D;  2E76 D;  1VF5 B;  3AE6 C;  3C8V A;  3RK3 E;  1EXI A;  2WP9 D;  3AE1 D;  4YTM C;  1KF6 C;  3VR9 C;  2FBW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...