1ZP0C

Crystal structure of mitochondrial respiratory complex ii bound with 3-nitropropionate and 2-thenoyltrifluoroacetone
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zp0C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zp0C02
3AEDD 3ABVD 3P4RD 1YQ4C 4YTPC 4YTMC 1E7PC 4YTPD 4YXDC 2H89D 4YTMD 4YXDD 3SFDD 2G3AA 2BS3C 3SFEC 3AE3C 1ZOYC 3P4SC 3SFED 2ACZD 3AE2C 5C3JD 3P4SD 3AE5C 3AE8D 4YTNC 3P4PD 3VRAC 3AE5D 2BS4C 2WQYC 2B76C 3VRAD 1NEKD 1YQ3D 2B76D 2WQYD 4KX6C 3P4QD 1PV3A 2WDVD 3AEAC 3VRBC 1NENC 1YQ4D 1KF6C 3AEAD 4YSXC 1NEND 2BS2C 1KF6D 1ZP0C 3AE9C 3CIRC 3B71A 1ZP0D 3CIRD 3AE3D 1ZOYD 1K05A 3AECC 1QLBC 3AE2D 3VR9C 4YTND 2H88C 1OW8A 5C2TC 4KX6D 2H88D 1KFYC 3AE6C 5C2TD 3AEGC 3AE4C 3AEGD 2WS3C 3VRBD 1KTMA 1OW6A 1K04A 3AE7C 4YSXD 3AE7D 4YSYC 3VR8C 3AE9D 4YSYD 3AEFC 2ACZC 3AEFD 3AEDC 4YT0C 3AECD 3ABVC 3P4RC 4YT0D 3VR9D 3AE1C 2H89C 2WDQC 3AE1D 3AEEC 2WP9C 2WDQD 2FBWC 3AEED 3SFDC 2WP9D 1L0VC 1KFYD 3AE6D 2FBWD 1L0VD 3AE4D 2WS3D 5C3JC 2WU2C 1OW7A 3AEBC 3AE8C 2WU5C 2WU2D 3P4PC 3AEBD 2WU5D 4YSZC 1NEKC 1YQ3C 2WDRC 3VR8D 4YSZD 3P4QC 2WDRD 2WDVC 3S9OA
chains in the Genus database with same CATH superfamily
2QJPC 4YTPC 1IK7A 1LT9A 2QVAA 2QJYC 1M1JA 1SFCB 1NTZJ 4LC1A 3SFEC 3D6YA 1NU1D 1Z56A 1PP9G 2WQYC 5L8RJ 1YQ3D 2M0BA 3EWKA 4NPFX 3A5TA 1JMBA 1S1CX 5KKZB 3IR9A 5B5EH 1PP9J 5KLVD 3LIDA 2BS2C 4GOFA 3JCUH 3FXEA 4L76A 1KB9H 2C9NY 2W83C 5KLIB 3VP9A 3H1LE 3H32A 3PJSK 3RK2D 3CXHD 3G3ZA 2OTKE 5KAIE 4Y99C 1FZEA 1FJPA 3H1JJ 1BE3D 4CPGA 4OH8B 3AE9D 1YIJP 1GK6A 3HE4B 1SFCD 3G6EP 3AEEC 3CCEP 1HUCA 1SQPK 1H89A 1BGYE 2B89A 3V5BA 4JF7A 5KJ7C 3Q3DA 1FZFA 3CWBG 1HVVA 1JTHB 1U7MA 2A06D 2Q5UA 3CWBJ 4K35A 1USEA 2B9BA 1LTJB 3VYIA 1GL2C 3A0HH 1EDLA 3F5HA 4H0LC 4YXDC 4YTMD 2ZYDA 2KZJA 4JYCA 2N1TB 2HFED 1JY2N 2LR2A 3AE3C 2B88A 3CC7P 4B86A 1NTME 3H1LD 1NU1G 2O01H 3KZIH 2WDVD 3G4SP 2KOGA 2A45I 2KLUA 2KYVA 4AQRD 1QEXA 1NU1J 5AW3B 1IFIA 2VRSA 5APSA 3ITKA 2UWJE 5KLVG 3AE2D 1X8YA 1U7JA 1JNMA 2JP3A 2CK3H 1T2KC 3D70A 1KTMA 1J1DC 3HUSB 1RE3C 2FFDC 2WSSH 3H1KE 3AEFC 4DDIA 3O8ZA 3RK3C 1N7SB 5APXA 3K5BA 2N1TD 3ZDMA 1JY2O 3AE1C 5AW6B 1XTGB 4ZNCA 1CW5A 4L75A 3NFQA 5CHXA 4JQ0D 3R4YA 5APWA 1P84H 2JKVA 1L2PA 2YIUB 2Y0CA 1YQ3C 4WWIA 1XTCC 3HE5B 2Q3EA 3AEDD 1TFFA 1OWAA 1AQ5A 1SQBD 1RQUA 4WY4B 1VQMP 1SQVJ 2A06G 2W6JH 3H1IE 2E75B 4JBZA 4OWFA 1OVUA 3L73J 2B87B 2K9JB 4PD4E 3CCUP 2W6BA 3RK2C 1RF1C 3VRAC 3PLNA 3GHGC 2KS1A 3P4QD 1PV3A 2R5DA 2FYUD 3CCVP 1RH5B 2NZ2A 3CX5I 1KILB 1YQ4D 3H1LG 1QVGO 1GW4A 3L74E 2Y9YA 3AE9C 3L75J 3CIRC 2G8YA 2YKOA 1SFCC 2YXRB 1URQA 4UB8H 3H1KD 1RE4A 4FJVA 1SVFA 1FDMA 4JPZB 1LTIC 1SQXE 5C2TC 1NU1K 1CI6B 2KK7A 1K04A 1L0NE 2QE7H 5KKZC 1VDFA 3MUDA 1EQ7A 3U59A 1R5LA 3W67A 1T3JA 2J58A 2OYHA 1T8ZA 3CPWO 3RL0D 1YHQP 4WY4D 3AECD 3L70G 3HTKA 1KD1Q 2WSEH 5KLIC 2NRGA 3SWKA 3C1LA 3L70J 1NHLA 3VTPC 3GF7A 4XA4A 2K1AA 2R44A 2P10A 2WU5C 4XFJA 3H1ID 3KPEA 1Q86Q 3I56P 2FYNB 4PD4D 2WDRC 1IO4A 3V6IA 2WDVC 2ZJSE 2XNXA 4HYTB 1JUNA 3MZWB 3II6A 1KZUB 4W7ZA 4YXWH 2IYPA 1W2BO 4H13D 3P4SC 3BCCE 1SQBG 3AE2C 1KYOH 2PP6A 2HPCA 4GKGA 1SQBJ 3OA7A 1HBWA 5CJ4A 4L73A 2YKQA 1SQVK 1SQXD 3F89A 1NEND 2FYUG 3U1AA 1LTJC 1R8EA 4U3FE 1LTGC 1L0ND 2ZFYA 1S5LH 5E79H 2N1TC 1X79B 2FYUJ 2KSEA 4U7JA 1GD2E 1OW8A 1VQKP 5KAFE 1VQ8P 1PGJA 2AEFA 4LDTA 1NTZE 1AJYA 5CCHD 1FZGA 1BDCA 5C39A 1JY3O 2N9BA 1FDIA 5AVZB 5AW0B 2FXMA 1JCDA 3V2NA 1HGZA 1N2DC 3OW2O 1NAYA 3H1HJ 1L0VC 1FU1A 3MIWA 5AVRB 4UB6H 2V7QH 2WPSA 2D2CD 5KJ7A 3CLQA 2E74D 3HUSC 3P4QC 3Q5PA 1VF5D 3H1IG 5CCGC 2BASA 4IL6H 2E42A 1YQ4C 1E7PC 3GW6A 1L4AB 5GTHH 1GL2A 2KSJA 1BCCE 3WMM0 2YMKA 2WSCH 3M9HA 1S72P 1FZAA 1ZMEC 1LTBC 1M57D 1NEKD 2FXOA 1M8OB 1DEEG 2YIUC 4GOEA 1AVYA 1YBKA 1NKNA 1FS0E 2R32A 1YITP 4BRYB 5B66H 1SQXG 1IJDB 1ZP0D 2HYNA 1ZOYD 3AECC 4WY4C 4GODA 2Y0EA 3PRJA 1SQBK 2E75C 5DJUB 1OX3A 1Q2NA 1VQ6P 2WSEJ 3RBZA 1PGQA 4K3AA 1NGMB 2V4HA 3MD0A 4LGDE 3U1CA 3I5CA 2P1JA 4N6JA 3AE7C 3PHLA 3RK3B 1KILC 1RE3A 2FFDA 2FYUK 2O3JA 3B5ND 2BEZF 3NTNA 2FYZA 2FBWC 4I6LA 4H13C 2PFXA 2WS3D 1BCCD 4D6TE 4ZMDA 1OVRA 5AVYB 1KQSO 5CJ0A 1MFTA 2E5YA 2Q3IA 2WT7A 4EDFA 2XU6A 3RK2B 1EDJA 3USSA 3L72D 4I7ZB 2PRRA 3CXHH 1NTKE 3AE5C 3O6QB 1LJ2A 5AVWB 1RF1A 3GHGA 2WITA 4N3YB 2FYNC 1FZCA 2YXQB 2ZT9B 2AXTE 3A2AA 5K5GB 3AEAD 5H2FH 3V2QA 3VOPA 3WU2H 5GTIE 4OGQB 3H6PA 5KTBA 2OTLP 3NMDA 1SFCA 2ZXEB 2WVRA 2HODB 3L36A 3FWNA 1YTZI 1WT6A 3L71G 3TGUE 3CCLP 3L73E 1G2CB 4RO0A 4PV1D 1ZW0A 2V7QJ 2W27A 4D6TD 1KB9E 3GMAA 3L71J 3BRTB 3TNUB 1H88A 1W2EA 1MV8A 2WDQD 1QLED 3QH9A 5DJTB 1LP1B 1R5SA 3L75E 2WU2C 1KB9I 2WSCJ 4YSZC 2ZT9D 1L0LE 1NEKC 2GM4A 1HGVA 1NTKD 3IN6A 4OGQD 5KAIH 4GDOA 3HE4A 1KQFB 3P8MC 2ZXXA 1EC5A 5AW7B 3TF5A 1ZOYC 1E5WA 2E5TA 3FXDA 3AE8D 1UIIA 1WRGA 4C7RA 5EFWB 3H25A 3L72G 2JR8A 1YJNP 1T6AA 3V2RA 1QGKB 1GU5A 1JTHA 2L5GB 4HKZH 2BCCE 3TGUD 1PL5A 1L4AC 1LTJA 2ZYGA 2N1TA 1OXZA 1S9KE 1M1KQ 1NKZB 3AEGC 2JWDA 2WS3C 5TISE 3VRBD 3VONA 1OVVA 1IFDA 4YSYD 3G71P 1E79H 4YT0C 1L0LD 1ZLLA 4D6TG 1AVOA 2IFNA 3BRVB 2WP9C 5KLVJ 4EIJA 2C9LY 3AEBC 3P7KA 1BGYD 1BE3G 2WWWA 2QA4P 4DOJA 2C0WA 2M3BA 4NPDA 1IZNB 2W8ZA 2ACZD 2ZFCA 3HUSA 3CC2P 5AW5B 1YI2P 5AW8B 3D6ZA 1G1JA 1KN7A 1BE3J 5CCGA 1NTKG 1VQ5P 1N7SA 3M06A 2YNYA 1PPJE 2AXCA 2BS3C 1NOHA 3M0AA 1VQPP 3SWFA 3FGAD 3CCQP 1N86A 4I6MC 1NTMD 3E1RA 1S9KD 3H1HE 3IF4A 3C9IA 3VP8A 2KIKA 3CX5E 3RL0B 3A0BE 3HE5A 2RMZA 4YPCA 1KF6D 2M5AB 2IX7C 4WBAA 1SQQE 3GLMA 4WY4A 4I7ZC 3TGUG 2QJKB 2B87A 2K9JA 2YMYA 2WPRA 2HLOA 4PD4H 1VQ9P 1IC2A 2ZT9C 1FOSF 1MFZA 3Q5SA 1RY3A 1KILA 2L91A 1M7LA 3H1LJ 4OGQC 1GZLA 1FOSE 5AVUB 4H13B 1NYHA 1VL2A 5AW9B 3N4XA 1M1JC 2RKLA 2KLVA 2JWAA 1L0LG 3AE6D 2QSIA 3AE4D 4EYYQ 3AE8C 1PPJD 2CPBA 5APVA 1DIPA 1CI6A 5KLVK 3BVHA 1BGYG 2K3RA 4YTMC 1KMIZ 2YO3A 1HJBA 1YJ9P 3CX5D 3RGUA 2IBZE 1JMMA 2KZIA 2KXPB 5C3JD 2OYIB 2A45G 4TLFA 1SQQD 3HD7B 1Y9BA 1LWUB 2B76D 1Q7YQ 3M0DC 1H0TB 2QM7A 3CD6P 1JY3N 4ASVA 3VRBC 4I2LC 1NTMG 2IBZI 2P2UA 3KHUA 1JM0A 2WSFH 1SQPE 1ZN5A 3L74D 1DX7A 2IYOA 3T97B 1A02F 3FWLA 2YKPA 2QM8A 2H88D 2D2CB 2WPVB 2E74B 4NPEA 1KQGB 3JSVC 4XE5B 4ASWA 4HB1A 4YSXD 1KFNA 1EZVE 1VF5B 1J2JB 4WVZA 2ACZC 5AVSB 3L37A 2P58A 5AW1B 3FX0A 1JB0J 4DDGA 1FBMA 3H1KG 1OMIA 3HD7D 1GU4A 1EZVI 1S4XA 3H1KJ 1EDKA 3G9RA 3VMYA 3P8CE 3AEDC 1AA0A 2QRXA 4YTPD 1PP9E 1WMKA 1CSBA 2I1KA 4KHXA 4C46A 5CBOA 1N73B 4ZKPA 3KXDA 4QMAA 3SFED 1SQPD 3P4PD 2H7HA 3BCCD 3A3YB 3PH0A 2WQYD 1D7MA 1SQQG 3H1JE 3B5NB 4N78E 2CPSA 3H1IJ 2ITAA 3W68A 4C7NB 1HF9A 4O9BA 1L4AA 4U3FD 2O01N 4HH2A 2NPSB 3VMXA 3L74G 5AVTB 3AE6C 4I1LA 1BDDA 3AE4C 1QX8A 3P32A 1GW3A 3A7OA 1NTZD 3JC22 1NTMK 3RL0C 4R4MA 2XNDH 4RKUJ 3CCJP 4BRYA 4PJ0E 1SQXJ 3P8CD 1L0NG 3CWBE 3AEED 2WZ7A 1K8AQ 2P67A 3C8VA 1KV4A 2QJKC 1PP9D 1L0NJ 5C3JC 2QIWA 1HH0A 4DT0A 1DEBA 5KJ7D 3RK3E 3VR8D 2POHA 3ABVD 2WMMA 3P4RD 3L35A 3UIAA 1OZHA 2H89D 1GL2D 4H0LD 4YXDD 1NU1E 2G3AA 2N9YB 3H1JD 4N78D 2NPSD 2SPZA 1EXJA 4ZKUA 2WSFJ 3LW5H 1FZBA 2DW3A 4IFFA 1FAVA 2LXCB 1ZXGA 1SQPG 4PV1B 3BCCG 1G1IA 1NENC 4IFMA 4YSXC 1KQLA 4L74A 2KNCB 5TJHA 3BASA 2ZVNB 2XZRA 3BCCJ 2OYHC 3V4QA 1JO5A 5CBNA 4DHJA 2MKVA 2LKMA 2IFMA 2AEMA 2K37A 2OYIC 4KX6D 4U3FG 2IDBA 3HD7C 3WUTA 3O6QA 1LWUC 2R3SA 3CWBD 5CCHC 3CMEP 1T2KD 1S3JA 5H2FE 2GA1A 4U3FJ 1JEKA 2QEXP 3E7KA 1LT9B 2GUVA 1EXIA 1M1JB 1K73Q 3AEFD 1NTZG 1X9VA 2ZAEB 4IFDK 1AQTA 3VR9D 2GUSA 3AE1D 2AXTH 5AVXB 3V2PA 5B5EE 5GTIH 4TT3H 1SQVE 2HODA 1VQ7P 4HJGH 3JCUE 2W6AA 2O1JA 1OW7A 2D2CC 3P4PC 2E74C 4GT1A 2A06E 3S1KA 1SQXK 1VF5C 1M90Q 1G2CA 3E1IA 3TDKA 1RF0C 1L0NK 5AVVB 3H32B 1LNQA 3TNUA 1BSNA 3I55P 2OTJP 3H1JG 2BS4C 3VRAD 3MTUE 1LP1A 1BCCG 1DH3A 1MKMA 3M0DA 3SSUA 5APTA 3S4RA 3WUVA 1BCCJ 1YYCA 3M9BA 4EOTA 3L4FA 1ZP0C 2Q7CA 3B71A 1IFMA 3CIRD 3PP5A 3HRNA 1VQ4P 4KJMA 1N73C 1S2EA 2PAJA 1OFCX 4YTND 4JYBA 5C2TD 3A0HE 2Z5IA 3L70E 3L72J 3KQGA 1SQVD 3TK1A 3B5NC 3VR8C 3L73D 1OIPA 3ABVC 1KB9D 4MN4C 3P4RC 3MHVA 2C0XA 2H89C 2Z5HA 3KZIE 2A45H 2E43A 2NPSC 2OGUA 3IAOA 1Q90D 3EFGA 1S5LX 2WU5D 2Q1KA 3L75D 1MZ9A 3BATA 2WDRD 3LW5J 4A7PA 1N7LA 1SQBE 1NTZK 5TISH 1H8AA 1FDOA 2ZYAA 1SLQA 2M3EA 2KB7P 4DJGA 4D6TJ 3P4SD 4WB4A 2FYUE 1NO4A 4KX6C 3M91A 4BWNA 1FC2C 1JOCA 1PGOA 3CC4P 3AEAC 4GIFA 3L70D 1X22A 1JCCA 1CZQA 1P84E 2HG5D 1NTKJ 1NH4A 2BCCD 2FKWB 3VR9C 5M1BA 2RH0A 5AVQB 4DCKA 4IL6X 2J5UA 1JY2P 2Q6QA 2O1KA 2XV5A 5AW4B 4PV1C 1HWTC 1P84I 1IFNA 5APQA 2ZVOB 3M9QA 1N8RQ 1SQVG 1USDA 2M5AA 3LIEA 3EQ2A 3L73G 2WDQC 1U57A 3CX5H 3A0BH 3CCMP 1KFYD 2W90A 1L0VD 3CMAP 3TGUJ 2KS1B 3TSIA 1KILE 3CCSP 4UB8E 1FZCC 1KFMA 3L75G 1LT9C 5CCGD 3OAKA 3B8EB 1URQB 5BU5A 1N7SD 3SFDD 1T3UA 4AUWA 4PD4I 2E76B 1ZRTE 2IPPA 1L0LJ 4YTNC 1P84D 3CCRP 1DD3A 3OJAB 1LTAC 3EFFK 1GDTA 1KC8Q 2MJZA 2XDJA 5BVZA 2OYHB 1J1EB 1Q81Q 3H1HD 2R5BA 3VMZA 4OVNF 1YJWP 3HTKB 3CI9A 1BGYJ 1QLBC 2E75D 4IOIH 5APUA 2RN0A 5APYA 1GTWA 1ZV8A 2BCCG 2OYIA 5AW2B 3HD7A 1NJIQ 1LWUA 5CCHA 4H44B 1H0TA 1NTKK 4BXLA 3AE7D 2BCCJ 2J59M 4YSYC 1KILD 2JJLA 2QJPB 3RL0g 1URQD 2OQQA 2WPQA 1KYOE 1W5CE 1NTMJ 2QJYB 2IZ0A 2H43A 2O01J 2P7JA 2E76D 2WTYA 2FBWD 1IFJA 2HPCB 1AV1A 1GK4A 3T97A 1ZR4A 1KYOI 1S5LE 1ZRTD 5E79E 2LXBA 1Q82Q 4RJTA 3N7NA 2Y0DA 1PIXA 2KP8A 1BSHA 1PGPA 1RF0A 5BU8B 2K9YA 2AEJA 1HJ0A 2IBZD 3AE5D 4Y99B 4H44D 1PPJG 2FY8A 4Y28J 1UIXA 3Q1MA 5KAFH 4LLHA 1K9MQ 3VN0A 1KF6C 1LTSC 1DD4A 1KORA 1VQNP 1IFPA 1VQLP 1L0LK 2Y9ZA 1RHZB 4UB6E 3MP7B 2I8DA 3H1HG 3L71E 1N73A 4M3LA 1KYOD 1JY3P 3V4WA 1KFYC 4IL6E 2XKMA 4DZOA 5GTHE 1PFIA 1SP4A 3SWYA 2H8PD 2OARA 1SQQJ 1EZVD 3B5NA 3D71A 1GL2B 4H0LB 2BEQD 3Q5RA 1LTTC 1LGHB 4C7NA 1N7SC 3SFDC 1FE6A 1QL2A 1RQVA 2JO1A 2NPSA 1NAFA 3L74J 5B66E 2KI7B 1QL1A 2WU2D 2HR3A 4YSZD 3PTZA 3S9OA 4DHZA 3L72E 1GMJA 1Y47A 4EI2A 1YTZT 1Y8AA 5CMZA 1LT1A 3NXSA 3RBXA 2B76C 3GF3A 3IFMA 4PJ0H 3L71D 1J1DB 4RESB 2IBZG 2Q9IA 1VPCA 2FFDB 2I1JA 1TU3F 1NWQA 1SS1A 2YO2A 4Z1MH 2JDIH 1URQC 3KDPB 3QWOC 3AE3D 1K05A 1L4AD 1RE4C 1X0TA 4R4LA 2QG4A 1AFOA 2E76C 2H88C 4W7YA 5KLVE 1NVOA 4W80A 2JEEA 3AEGD 2R3CA 1FJKA 2Z4EA 1OW6A 3MUDC 1VQOP 3Q2YA 2WT7B 3GG2A 1SQPJ 1J1EC 3CXHE 2FXPA 2KUBA 4AYCA 2KNCA 4YT0D 1EDIA 3B4SA 1BE3E 1EZVG 4DHIB 3R2PA 1M56D 3CL3D 2WP9D 1MUUA 2IZ1A 1A02J 4KT0J 1RF1B 1SQQK 3GHGB 3WU2E 3KYQA 3AEBD 1FZCB 3CXHI 3WUUA 3MGNA 1IK9A 1HTLC 1ZR2A 4H44C 3TYYA 1PZQA 2K88A 2OYOA 2M8RA 2PGDA 3VMAA 1QVFO 3RK3D
chains in the Genus database with same CATH topology
4OGQD 1VF5D 3AEDD 2QJPC 3ABVD 3D6ZA 3P4RD 1YQ4C 4YTPC 4YTMC 1KMIZ 1PIXA 4GDOA 1IK7A 1E7PC 4YTPD 4H0LC 4YXDC 2H89D 4YTMD 1WMKA 2QJYC 1RQUA 1FDOA 1KQFB 4H0LD 4YXDD 3SFDD 1GMJA 2G3AA 4H13D 2BS3C 3SFEC 2E75B 3D6YA 1EXJA 3AE3C 1ZOYC 4I7ZB 3P4SC 2YMKA 2K9YA 3SFED 2ACZD 2E76B 3AE2C 5C3JD 1ZRTE 3P4SD 2WSFJ 1HJ0A 3AE5C 3AE8D 4YTNC 1ZMEC 3FGAD 3H25A 3P4PD 3VRAC 3AE5D 1DD3A 1Y9BA 2WQYC 2B76C 2BS4C 3VRAD 1NEKD 3GF3A 5L8RJ 1YQ3D 3EWKA 2B76D 4H44D 2WQYD 4KX6C 3P4QD 1MKMA 4Y28J 1PV3A 1S1CX 2WDVD 2YIUC 1UIXA 2FYNC 3Q1MA 4PV1B 2NZ2A 2ZT9B 3AEAC 3VRBC 1NENC 1YQ4D 1TU3F 1KF6C 3AEAD 4YSXC 1NEND 2BS2C 1DD4A 1KF6D 1KORA 4OGQB 1ZP0C 3AE9C 4Z1MH 1R8EA 3CIRC 3B71A 1PL5A 1ZP0D 1HF9A 2G8YA 3CIRD 3AE3D 1ZOYD 1K05A 3AECC 1QLBC 2MKVA 4R4LA 3AE2D 3GLMA 3VR9C 2E75C 4YTND 5M1BA 4U7JA 4I7ZC 2E75D 2E76C 2H88C 3T97B 1OW8A 2WDVC 5C2TC 4KX6D 2H88D 4IL6X 1KFYC 2WSEJ 3AE6C 2JP3A 5C2TD 2IDBA 2J5UA 3O6QA 2D2CB 2WPVB 3AEGC 3AE4C 3D70A 2E74B 1NGMB 1KQGB 3AEGD 2WS3C 1AJYA 3VRBD 1KTMA 4H44B 1OW6A 1K04A 3AE7C 4YSXD 4PV1C 5KKZC 3Q2YA 3AE7D 1VF5B 2ZT9C 4PV1D 4YSYC 2V7QJ 1FDIA 3Q5SA 3VR8C 3AE9D 4YSYD 3AEFC 3RL0g 3D71A 2OQQA 1EXIA 2ACZC 2FXPA 3GMAA 3AEFD 2BEZF 4H0LB 4OGQC 4R4MA 4RKUJ 4YT0C 3AECD 2BEQD 3ABVC 3P4RC 4H13B 3Q5RA 4YT0D 1NYHA 3VR9D 3AE1C 1VL2A 2H89C 2O01J 5KLIC 1JB0J 2WDQC 3AEEC 3AE1D 2WP9C 2E76D 2WDQD 2FBWC 1U57A 3SFDC 2WP9D 1L0VC 3AEED 1KFYD 4H13C 3AE6D 2FBWD 1L0VD 1OMIA 3C8VA 4TT3H 1RQVA 2QJKC 2QSIA 4KT0J 3AE4D 3GF7A 2JO1A 3R4YA 3IAOA 2WS3D 5C3JC 1KILE 1Q90D 2P10A 1OW7A 2WU2C 3AEBC 3AE8C 2D2CC 2QIWA 3S9OA 4XFJA 2WU2D 2E74C 2WU5C 3AEBD 3P4PC 2D2CD 3Q3DA 2WSCJ 1S5LX 3RK3E 2ZT9D 3G9RA 2E74D 1YQ3C 1DIPA 1NEKC 2WU5D 4YSZC 2WDRC 4H44C 3VR8D 4YSZD 3P4QC 3IN6A 2WDRD 3LW5J 3Q5PA 1VF5C 3AEDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED D;  3ABV D;  3P4R D;  1YQ4 C;  4YTP C;  4YTM C;  1E7P C;  4YTP D;  4YXD C;  2H89 D;  4YTM D;  4YXD D;  3SFD D;  2G3A A;  2BS3 C;  3SFE C;  3AE3 C;  1ZOY C;  3P4S C;  3SFE D;  2ACZ D;  3AE2 C;  5C3J D;  3P4S D;  3AE5 C;  3AE8 D;  4YTN C;  3P4P D;  3VRA C;  3AE5 D;  2BS4 C;  2WQY C;  2B76 C;  3VRA D;  1NEK D;  1YQ3 D;  2B76 D;  2WQY D;  4KX6 C;  3P4Q D;  1PV3 A;  2WDV D;  3AEA C;  3VRB C;  1NEN C;  1YQ4 D;  1KF6 C;  3AEA D;  4YSX C;  1NEN D;  2BS2 C;  1KF6 D;  1ZP0 C;  3AE9 C;  3CIR C;  3B71 A;  1ZP0 D;  3CIR D;  3AE3 D;  1ZOY D;  1K05 A;  3AEC C;  1QLB C;  3AE2 D;  3VR9 C;  4YTN D;  2H88 C;  1OW8 A;  5C2T C;  4KX6 D;  2H88 D;  1KFY C;  3AE6 C;  5C2T D;  3AEG C;  3AE4 C;  3AEG D;  2WS3 C;  3VRB D;  1KTM A;  1OW6 A;  1K04 A;  3AE7 C;  4YSX D;  3AE7 D;  4YSY C;  3VR8 C;  3AE9 D;  4YSY D;  3AEF C;  2ACZ C;  3AEF D;  3AED C;  4YT0 C;  3AEC D;  3ABV C;  3P4R C;  4YT0 D;  3VR9 D;  3AE1 C;  2H89 C;  2WDQ C;  3AE1 D;  3AEE C;  2WP9 C;  2WDQ D;  2FBW C;  3AEE D;  3SFD C;  2WP9 D;  1L0V C;  1KFY D;  3AE6 D;  2FBW D;  1L0V D;  3AE4 D;  2WS3 D;  5C3J C;  2WU2 C;  1OW7 A;  3AEB C;  3AE8 C;  2WU5 C;  2WU2 D;  3P4P C;  3AEB D;  2WU5 D;  4YSZ C;  1NEK C;  1YQ3 C;  2WDR C;  3VR8 D;  4YSZ D;  3P4Q C;  2WDR D;  2WDV C;  3S9O A; 
#chains in the Genus database with same CATH topology
 2QJP C;  4YTP C;  1IK7 A;  1LT9 A;  2QVA A;  2QJY C;  1M1J A;  1SFC B;  1NTZ J;  4LC1 A;  3SFE C;  3D6Y A;  1NU1 D;  1Z56 A;  1PP9 G;  2WQY C;  5L8R J;  1YQ3 D;  2M0B A;  3EWK A;  4NPF X;  3A5T A;  1JMB A;  1S1C X;  5KKZ B;  3IR9 A;  5B5E H;  1PP9 J;  5KLV D;  3LID A;  2BS2 C;  4GOF A;  3JCU H;  3FXE A;  4L76 A;  1KB9 H;  2C9N Y;  2W83 C;  5KLI B;  3VP9 A;  3H1L E;  3H32 A;  3PJS K;  3RK2 D;  3CXH D;  3G3Z A;  2OTK E;  5KAI E;  4Y99 C;  1FZE A;  1FJP A;  3H1J J;  1BE3 D;  4CPG A;  4OH8 B;  3AE9 D;  1YIJ P;  1GK6 A;  3HE4 B;  1SFC D;  3G6E P;  3AEE C;  3CCE P;  1HUC A;  1SQP K;  1H89 A;  1BGY E;  2B89 A;  3V5B A;  4JF7 A;  5KJ7 C;  3Q3D A;  1FZF A;  3CWB G;  1HVV A;  1JTH B;  1U7M A;  2A06 D;  2Q5U A;  3CWB J;  4K35 A;  1USE A;  2B9B A;  1LTJ B;  3VYI A;  1GL2 C;  3A0H H;  1EDL A;  3F5H A;  4H0L C;  4YXD C;  4YTM D;  2ZYD A;  2KZJ A;  4JYC A;  2N1T B;  2HFE D;  1JY2 N;  2LR2 A;  3AE3 C;  2B88 A;  3CC7 P;  4B86 A;  1NTM E;  3H1L D;  1NU1 G;  2O01 H;  3KZI H;  2WDV D;  3G4S P;  2KOG A;  2A45 I;  2KLU A;  2KYV A;  4AQR D;  1QEX A;  1NU1 J;  5AW3 B;  1IFI A;  2VRS A;  5APS A;  3ITK A;  2UWJ E;  5KLV G;  3AE2 D;  1X8Y A;  1U7J A;  1JNM A;  2JP3 A;  2CK3 H;  1T2K C;  3D70 A;  1KTM A;  1J1D C;  3HUS B;  1RE3 C;  2FFD C;  2WSS H;  3H1K E;  3AEF C;  4DDI A;  3O8Z A;  3RK3 C;  1N7S B;  5APX A;  3K5B A;  2N1T D;  3ZDM A;  1JY2 O;  3AE1 C;  5AW6 B;  1XTG B;  4ZNC A;  1CW5 A;  4L75 A;  3NFQ A;  5CHX A;  4JQ0 D;  3R4Y A;  5APW A;  1P84 H;  2JKV A;  1L2P A;  2YIU B;  2Y0C A;  1YQ3 C;  4WWI A;  1XTC C;  3HE5 B;  2Q3E A;  3AED D;  1TFF A;  1OWA A;  1AQ5 A;  1SQB D;  1RQU A;  4WY4 B;  1VQM P;  1SQV J;  2A06 G;  2W6J H;  3H1I E;  2E75 B;  4JBZ A;  4OWF A;  1OVU A;  3L73 J;  2B87 B;  2K9J B;  4PD4 E;  3CCU P;  2W6B A;  3RK2 C;  1RF1 C;  3VRA C;  3PLN A;  3GHG C;  2KS1 A;  3P4Q D;  1PV3 A;  2R5D A;  2FYU D;  3CCV P;  1RH5 B;  2NZ2 A;  3CX5 I;  1KIL B;  1YQ4 D;  3H1L G;  1QVG O;  1GW4 A;  3L74 E;  2Y9Y A;  3AE9 C;  3L75 J;  3CIR C;  2G8Y A;  2YKO A;  1SFC C;  2YXR B;  1URQ A;  4UB8 H;  3H1K D;  1RE4 A;  4FJV A;  1SVF A;  1FDM A;  4JPZ B;  1LTI C;  1SQX E;  5C2T C;  1NU1 K;  1CI6 B;  2KK7 A;  1K04 A;  1L0N E;  2QE7 H;  5KKZ C;  1VDF A;  3MUD A;  1EQ7 A;  3U59 A;  1R5L A;  3W67 A;  1T3J A;  2J58 A;  2OYH A;  1T8Z A;  3CPW O;  3RL0 D;  1YHQ P;  4WY4 D;  3AEC D;  3L70 G;  3HTK A;  1KD1 Q;  2WSE H;  5KLI C;  2NRG A;  3SWK A;  3C1L A;  3L70 J;  1NHL A;  3VTP C;  3GF7 A;  4XA4 A;  2K1A A;  2R44 A;  2P10 A;  2WU5 C;  4XFJ A;  3H1I D;  3KPE A;  1Q86 Q;  3I56 P;  2FYN B;  4PD4 D;  2WDR C;  1IO4 A;  3V6I A;  2WDV C;  2ZJS E;  2XNX A;  4HYT B;  1JUN A;  3MZW B;  3II6 A;  1KZU B;  4W7Z A;  4YXW H;  2IYP A;  1W2B O;  4H13 D;  3P4S C;  3BCC E;  1SQB G;  3AE2 C;  1KYO H;  2PP6 A;  2HPC A;  4GKG A;  1SQB J;  3OA7 A;  1HBW A;  5CJ4 A;  4L73 A;  2YKQ A;  1SQV K;  1SQX D;  3F89 A;  1NEN D;  2FYU G;  3U1A A;  1LTJ C;  1R8E A;  4U3F E;  1LTG C;  1L0N D;  2ZFY A;  1S5L H;  5E79 H;  2N1T C;  1X79 B;  2FYU J;  2KSE A;  4U7J A;  1GD2 E;  1OW8 A;  1VQK P;  5KAF E;  1VQ8 P;  1PGJ A;  2AEF A;  4LDT A;  1NTZ E;  1AJY A;  5CCH D;  1FZG A;  1BDC A;  5C39 A;  1JY3 O;  2N9B A;  1FDI A;  5AVZ B;  5AW0 B;  2FXM A;  1JCD A;  3V2N A;  1HGZ A;  1N2D C;  3OW2 O;  1NAY A;  3H1H J;  1L0V C;  1FU1 A;  3MIW A;  5AVR B;  4UB6 H;  2V7Q H;  2WPS A;  2D2C D;  5KJ7 A;  3CLQ A;  2E74 D;  3HUS C;  3P4Q C;  3Q5P A;  1VF5 D;  3H1I G;  5CCG C;  2BAS A;  4IL6 H;  2E42 A;  1YQ4 C;  1E7P C;  3GW6 A;  1L4A B;  5GTH H;  1GL2 A;  2KSJ A;  1BCC E;  3WMM 0;  2YMK A;  2WSC H;  3M9H A;  1S72 P;  1FZA A;  1ZME C;  1LTB C;  1M57 D;  1NEK D;  2FXO A;  1M8O B;  1DEE G;  2YIU C;  4GOE A;  1AVY A;  1YBK A;  1NKN A;  1FS0 E;  2R32 A;  1YIT P;  4BRY B;  5B66 H;  1SQX G;  1IJD B;  1ZP0 D;  2HYN A;  1ZOY D;  3AEC C;  4WY4 C;  4GOD A;  2Y0E A;  3PRJ A;  1SQB K;  2E75 C;  5DJU B;  1OX3 A;  1Q2N A;  1VQ6 P;  2WSE J;  3RBZ A;  1PGQ A;  4K3A A;  1NGM B;  2V4H A;  3MD0 A;  4LGD E;  3U1C A;  3I5C A;  2P1J A;  4N6J A;  3AE7 C;  3PHL A;  3RK3 B;  1KIL C;  1RE3 A;  2FFD A;  2FYU K;  2O3J A;  3B5N D;  2BEZ F;  3NTN A;  2FYZ A;  2FBW C;  4I6L A;  4H13 C;  2PFX A;  2WS3 D;  1BCC D;  4D6T E;  4ZMD A;  1OVR A;  5AVY B;  1KQS O;  5CJ0 A;  1MFT A;  2E5Y A;  2Q3I A;  2WT7 A;  4EDF A;  2XU6 A;  3RK2 B;  1EDJ A;  3USS A;  3L72 D;  4I7Z B;  2PRR A;  3CXH H;  1NTK E;  3AE5 C;  3O6Q B;  1LJ2 A;  5AVW B;  1RF1 A;  3GHG A;  2WIT A;  4N3Y B;  2FYN C;  1FZC A;  2YXQ B;  2ZT9 B;  2AXT E;  3A2A A;  5K5G B;  3AEA D;  5H2F H;  3V2Q A;  3VOP A;  3WU2 H;  5GTI E;  4OGQ B;  3H6P A;  5KTB A;  2OTL P;  3NMD A;  1SFC A;  2ZXE B;  2WVR A;  2HOD B;  3L36 A;  3FWN A;  1YTZ I;  1WT6 A;  3L71 G;  3TGU E;  3CCL P;  3L73 E;  1G2C B;  4RO0 A;  4PV1 D;  1ZW0 A;  2V7Q J;  2W27 A;  4D6T D;  1KB9 E;  3GMA A;  3L71 J;  3BRT B;  3TNU B;  1H88 A;  1W2E A;  1MV8 A;  2WDQ D;  1QLE D;  3QH9 A;  5DJT B;  1LP1 B;  1R5S A;  3L75 E;  2WU2 C;  1KB9 I;  2WSC J;  4YSZ C;  2ZT9 D;  1L0L E;  1NEK C;  2GM4 A;  1HGV A;  1NTK D;  3IN6 A;  4OGQ D;  5KAI H;  4GDO A;  3HE4 A;  1KQF B;  3P8M C;  2ZXX A;  1EC5 A;  5AW7 B;  3TF5 A;  1ZOY C;  1E5W A;  2E5T A;  3FXD A;  3AE8 D;  1UII A;  1WRG A;  4C7R A;  5EFW B;  3H25 A;  3L72 G;  2JR8 A;  1YJN P;  1T6A A;  3V2R A;  1QGK B;  1GU5 A;  1JTH A;  2L5G B;  4HKZ H;  2BCC E;  3TGU D;  1PL5 A;  1L4A C;  1LTJ A;  2ZYG A;  2N1T A;  1OXZ A;  1S9K E;  1M1K Q;  1NKZ B;  3AEG C;  2JWD A;  2WS3 C;  5TIS E;  3VRB D;  3VON A;  1OVV A;  1IFD A;  4YSY D;  3G71 P;  1E79 H;  4YT0 C;  1L0L D;  1ZLL A;  4D6T G;  1AVO A;  2IFN A;  3BRV B;  2WP9 C;  5KLV J;  4EIJ A;  2C9L Y;  3AEB C;  3P7K A;  1BGY D;  1BE3 G;  2WWW A;  2QA4 P;  4DOJ A;  2C0W A;  2M3B A;  4NPD A;  1IZN B;  2W8Z A;  2ACZ D;  2ZFC A;  3HUS A;  3CC2 P;  5AW5 B;  1YI2 P;  5AW8 B;  3D6Z A;  1G1J A;  1KN7 A;  1BE3 J;  5CCG A;  1NTK G;  1VQ5 P;  1N7S A;  3M06 A;  2YNY A;  1PPJ E;  2AXC A;  2BS3 C;  1NOH A;  3M0A A;  1VQP P;  3SWF A;  3FGA D;  3CCQ P;  1N86 A;  4I6M C;  1NTM D;  3E1R A;  1S9K D;  3H1H E;  3IF4 A;  3C9I A;  3VP8 A;  2KIK A;  3CX5 E;  3RL0 B;  3A0B E;  3HE5 A;  2RMZ A;  4YPC A;  1KF6 D;  2M5A B;  2IX7 C;  4WBA A;  1SQQ E;  3GLM A;  4WY4 A;  4I7Z C;  3TGU G;  2QJK B;  2B87 A;  2K9J A;  2YMY A;  2WPR A;  2HLO A;  4PD4 H;  1VQ9 P;  1IC2 A;  2ZT9 C;  1FOS F;  1MFZ A;  3Q5S A;  1RY3 A;  1KIL A;  2L91 A;  1M7L A;  3H1L J;  4OGQ C;  1GZL A;  1FOS E;  5AVU B;  4H13 B;  1NYH A;  1VL2 A;  5AW9 B;  3N4X A;  1M1J C;  2RKL A;  2KLV A;  2JWA A;  1L0L G;  3AE6 D;  2QSI A;  3AE4 D;  4EYY Q;  3AE8 C;  1PPJ D;  2CPB A;  5APV A;  1DIP A;  1CI6 A;  5KLV K;  3BVH A;  1BGY G;  2K3R A;  4YTM C;  1KMI Z;  2YO3 A;  1HJB A;  1YJ9 P;  3CX5 D;  3RGU A;  2IBZ E;  1JMM A;  2KZI A;  2KXP B;  5C3J D;  2OYI B;  2A45 G;  4TLF A;  1SQQ D;  3HD7 B;  1Y9B A;  1LWU B;  2B76 D;  1Q7Y Q;  3M0D C;  1H0T B;  2QM7 A;  3CD6 P;  1JY3 N;  4ASV A;  3VRB C;  4I2L C;  1NTM G;  2IBZ I;  2P2U A;  3KHU A;  1JM0 A;  2WSF H;  1SQP E;  1ZN5 A;  3L74 D;  1DX7 A;  2IYO A;  3T97 B;  1A02 F;  3FWL A;  2YKP A;  2QM8 A;  2H88 D;  2D2C B;  2WPV B;  2E74 B;  4NPE A;  1KQG B;  3JSV C;  4XE5 B;  4ASW A;  4HB1 A;  4YSX D;  1KFN A;  1EZV E;  1VF5 B;  1J2J B;  4WVZ A;  2ACZ C;  5AVS B;  3L37 A;  2P58 A;  5AW1 B;  3FX0 A;  1JB0 J;  4DDG A;  1FBM A;  3H1K G;  1OMI A;  3HD7 D;  1GU4 A;  1EZV I;  1S4X A;  3H1K J;  1EDK A;  3G9R A;  3VMY A;  3P8C E;  3AED C;  1AA0 A;  2QRX A;  4YTP D;  1PP9 E;  1WMK A;  1CSB A;  2I1K A;  4KHX A;  4C46 A;  5CBO A;  1N73 B;  4ZKP A;  3KXD A;  4QMA A;  3SFE D;  1SQP D;  3P4P D;  2H7H A;  3BCC D;  3A3Y B;  3PH0 A;  2WQY D;  1D7M A;  1SQQ G;  3H1J E;  3B5N B;  4N78 E;  2CPS A;  3H1I J;  2ITA A;  3W68 A;  4C7N B;  1HF9 A;  4O9B A;  1L4A A;  4U3F D;  2O01 N;  4HH2 A;  2NPS B;  3VMX A;  3L74 G;  5AVT B;  3AE6 C;  4I1L A;  1BDD A;  3AE4 C;  1QX8 A;  3P32 A;  1GW3 A;  3A7O A;  1NTZ D;  3JC2 2;  1NTM K;  3RL0 C;  4R4M A;  2XND H;  4RKU J;  3CCJ P;  4BRY A;  4PJ0 E;  1SQX J;  3P8C D;  1L0N G;  3CWB E;  3AEE D;  2WZ7 A;  1K8A Q;  2P67 A;  3C8V A;  1KV4 A;  2QJK C;  1PP9 D;  1L0N J;  5C3J C;  2QIW A;  1HH0 A;  4DT0 A;  1DEB A;  5KJ7 D;  3RK3 E;  3VR8 D;  2POH A;  3ABV D;  2WMM A;  3P4R D;  3L35 A;  3UIA A;  1OZH A;  2H89 D;  1GL2 D;  4H0L D;  4YXD D;  1NU1 E;  2G3A A;  2N9Y B;  3H1J D;  4N78 D;  2NPS D;  2SPZ A;  1EXJ A;  4ZKU A;  2WSF J;  3LW5 H;  1FZB A;  2DW3 A;  4IFF A;  1FAV A;  2LXC B;  1ZXG A;  1SQP G;  4PV1 B;  3BCC G;  1G1I A;  1NEN C;  4IFM A;  4YSX C;  1KQL A;  4L74 A;  2KNC B;  5TJH A;  3BAS A;  2ZVN B;  2XZR A;  3BCC J;  2OYH C;  3V4Q A;  1JO5 A;  5CBN A;  4DHJ A;  2MKV A;  2LKM A;  2IFM A;  2AEM A;  2K37 A;  2OYI C;  4KX6 D;  4U3F G;  2IDB A;  3HD7 C;  3WUT A;  3O6Q A;  1LWU C;  2R3S A;  3CWB D;  5CCH C;  3CME P;  1T2K D;  1S3J A;  5H2F E;  2GA1 A;  4U3F J;  1JEK A;  2QEX P;  3E7K A;  1LT9 B;  2GUV A;  1EXI A;  1M1J B;  1K73 Q;  3AEF D;  1NTZ G;  1X9V A;  2ZAE B;  4IFD K;  1AQT A;  3VR9 D;  2GUS A;  3AE1 D;  2AXT H;  5AVX B;  3V2P A;  5B5E E;  5GTI H;  4TT3 H;  1SQV E;  2HOD A;  1VQ7 P;  4HJG H;  3JCU E;  2W6A A;  2O1J A;  1OW7 A;  2D2C C;  3P4P C;  2E74 C;  4GT1 A;  2A06 E;  3S1K A;  1SQX K;  1VF5 C;  1M90 Q;  1G2C A;  3E1I A;  3TDK A;  1RF0 C;  1L0N K;  5AVV B;  3H32 B;  1LNQ A;  3TNU A;  1BSN A;  3I55 P;  2OTJ P;  3H1J G;  2BS4 C;  3VRA D;  3MTU E;  1LP1 A;  1BCC G;  1DH3 A;  1MKM A;  3M0D A;  3SSU A;  5APT A;  3S4R A;  3WUV A;  1BCC J;  1YYC A;  3M9B A;  4EOT A;  3L4F A;  1ZP0 C;  2Q7C A;  3B71 A;  1IFM A;  3CIR D;  3PP5 A;  3HRN A;  1VQ4 P;  4KJM A;  1N73 C;  1S2E A;  2PAJ A;  1OFC X;  4YTN D;  4JYB A;  5C2T D;  3A0H E;  2Z5I A;  3L70 E;  3L72 J;  3KQG A;  1SQV D;  3TK1 A;  3B5N C;  3VR8 C;  3L73 D;  1OIP A;  3ABV C;  1KB9 D;  4MN4 C;  3P4R C;  3MHV A;  2C0X A;  2H89 C;  2Z5H A;  3KZI E;  2A45 H;  2E43 A;  2NPS C;  2OGU A;  3IAO A;  1Q90 D;  3EFG A;  1S5L X;  2WU5 D;  2Q1K A;  3L75 D;  1MZ9 A;  3BAT A;  2WDR D;  3LW5 J;  4A7P A;  1N7L A;  1SQB E;  1NTZ K;  5TIS H;  1H8A A;  1FDO A;  2ZYA A;  1SLQ A;  2M3E A;  2KB7 P;  4DJG A;  4D6T J;  3P4S D;  4WB4 A;  2FYU E;  1NO4 A;  4KX6 C;  3M91 A;  4BWN A;  1FC2 C;  1JOC A;  1PGO A;  3CC4 P;  3AEA C;  4GIF A;  3L70 D;  1X22 A;  1JCC A;  1CZQ A;  1P84 E;  2HG5 D;  1NTK J;  1NH4 A;  2BCC D;  2FKW B;  3VR9 C;  5M1B A;  2RH0 A;  5AVQ B;  4DCK A;  4IL6 X;  2J5U A;  1JY2 P;  2Q6Q A;  2O1K A;  2XV5 A;  5AW4 B;  4PV1 C;  1HWT C;  1P84 I;  1IFN A;  5APQ A;  2ZVO B;  3M9Q A;  1N8R Q;  1SQV G;  1USD A;  2M5A A;  3LIE A;  3EQ2 A;  3L73 G;  2WDQ C;  1U57 A;  3CX5 H;  3A0B H;  3CCM P;  1KFY D;  2W90 A;  1L0V D;  3CMA P;  3TGU J;  2KS1 B;  3TSI A;  1KIL E;  3CCS P;  4UB8 E;  1FZC C;  1KFM A;  3L75 G;  1LT9 C;  5CCG D;  3OAK A;  3B8E B;  1URQ B;  5BU5 A;  1N7S D;  3SFD D;  1T3U A;  4AUW A;  4PD4 I;  2E76 B;  1ZRT E;  2IPP A;  1L0L J;  4YTN C;  1P84 D;  3CCR P;  1DD3 A;  3OJA B;  1LTA C;  3EFF K;  1GDT A;  1KC8 Q;  2MJZ A;  2XDJ A;  5BVZ A;  2OYH B;  1J1E B;  1Q81 Q;  3H1H D;  2R5B A;  3VMZ A;  4OVN F;  1YJW P;  3HTK B;  3CI9 A;  1BGY J;  1QLB C;  2E75 D;  4IOI H;  5APU A;  2RN0 A;  5APY A;  1GTW A;  1ZV8 A;  2BCC G;  2OYI A;  5AW2 B;  3HD7 A;  1NJI Q;  1LWU A;  5CCH A;  4H44 B;  1H0T A;  1NTK K;  4BXL A;  3AE7 D;  2BCC J;  2J59 M;  4YSY C;  1KIL D;  2JJL A;  2QJP B;  3RL0 g;  1URQ D;  2OQQ A;  2WPQ A;  1KYO E;  1W5C E;  1NTM J;  2QJY B;  2IZ0 A;  2H43 A;  2O01 J;  2P7J A;  2E76 D;  2WTY A;  2FBW D;  1IFJ A;  2HPC B;  1AV1 A;  1GK4 A;  3T97 A;  1ZR4 A;  1KYO I;  1S5L E;  1ZRT D;  5E79 E;  2LXB A;  1Q82 Q;  4RJT A;  3N7N A;  2Y0D A;  1PIX A;  2KP8 A;  1BSH A;  1PGP A;  1RF0 A;  5BU8 B;  2K9Y A;  2AEJ A;  1HJ0 A;  2IBZ D;  3AE5 D;  4Y99 B;  4H44 D;  1PPJ G;  2FY8 A;  4Y28 J;  1UIX A;  3Q1M A;  5KAF H;  4LLH A;  1K9M Q;  3VN0 A;  1KF6 C;  1LTS C;  1DD4 A;  1KOR A;  1VQN P;  1IFP A;  1VQL P;  1L0L K;  2Y9Z A;  1RHZ B;  4UB6 E;  3MP7 B;  2I8D A;  3H1H G;  3L71 E;  1N73 A;  4M3L A;  1KYO D;  1JY3 P;  3V4W A;  1KFY C;  4IL6 E;  2XKM A;  4DZO A;  5GTH E;  1PFI A;  1SP4 A;  3SWY A;  2H8P D;  2OAR A;  1SQQ J;  1EZV D;  3B5N A;  3D71 A;  1GL2 B;  4H0L B;  2BEQ D;  3Q5R A;  1LTT C;  1LGH B;  4C7N A;  1N7S C;  3SFD C;  1FE6 A;  1QL2 A;  1RQV A;  2JO1 A;  2NPS A;  1NAF A;  3L74 J;  5B66 E;  2KI7 B;  1QL1 A;  2WU2 D;  2HR3 A;  4YSZ D;  3PTZ A;  3S9O A;  4DHZ A;  3L72 E;  1GMJ A;  1Y47 A;  4EI2 A;  1YTZ T;  1Y8A A;  5CMZ A;  1LT1 A;  3NXS A;  3RBX A;  2B76 C;  3GF3 A;  3IFM A;  4PJ0 H;  3L71 D;  1J1D B;  4RES B;  2IBZ G;  2Q9I A;  1VPC A;  2FFD B;  2I1J A;  1TU3 F;  1NWQ A;  1SS1 A;  2YO2 A;  4Z1M H;  2JDI H;  1URQ C;  3KDP B;  3QWO C;  3AE3 D;  1K05 A;  1L4A D;  1RE4 C;  1X0T A;  4R4L A;  2QG4 A;  1AFO A;  2E76 C;  2H88 C;  4W7Y A;  5KLV E;  1NVO A;  4W80 A;  2JEE A;  3AEG D;  2R3C A;  1FJK A;  2Z4E A;  1OW6 A;  3MUD C;  1VQO P;  3Q2Y A;  2WT7 B;  3GG2 A;  1SQP J;  1J1E C;  3CXH E;  2FXP A;  2KUB A;  4AYC A;  2KNC A;  4YT0 D;  1EDI A;  3B4S A;  1BE3 E;  1EZV G;  4DHI B;  3R2P A;  1M56 D;  3CL3 D;  2WP9 D;  1MUU A;  2IZ1 A;  1A02 J;  4KT0 J;  1RF1 B;  1SQQ K;  3GHG B;  3WU2 E;  3KYQ A;  3AEB D;  1FZC B;  3CXH I;  3WUU A;  3MGN A;  1IK9 A;  1HTL C;  1ZR2 A;  4H44 C;  3TYY A;  1PZQ A;  2K88 A;  2OYO A;  2M8R A;  2PGD A;  3VMA A;  1QVF O;  3RK3 D; 
#chains in the Genus database with same CATH homology
 4OGQ D;  1VF5 D;  3AED D;  2QJP C;  3ABV D;  3D6Z A;  3P4R D;  1YQ4 C;  4YTP C;  4YTM C;  1KMI Z;  1PIX A;  4GDO A;  1IK7 A;  1E7P C;  4YTP D;  4H0L C;  4YXD C;  2H89 D;  4YTM D;  1WMK A;  2QJY C;  1RQU A;  1FDO A;  1KQF B;  4H0L D;  4YXD D;  3SFD D;  1GMJ A;  2G3A A;  4H13 D;  2BS3 C;  3SFE C;  2E75 B;  3D6Y A;  1EXJ A;  3AE3 C;  1ZOY C;  4I7Z B;  3P4S C;  2YMK A;  2K9Y A;  3SFE D;  2ACZ D;  2E76 B;  3AE2 C;  5C3J D;  1ZRT E;  3P4S D;  2WSF J;  1HJ0 A;  3AE5 C;  3AE8 D;  4YTN C;  1ZME C;  3FGA D;  3H25 A;  3P4P D;  3VRA C;  3AE5 D;  1DD3 A;  1Y9B A;  2WQY C;  2B76 C;  2BS4 C;  3VRA D;  1NEK D;  3GF3 A;  5L8R J;  1YQ3 D;  3EWK A;  2B76 D;  4H44 D;  2WQY D;  4KX6 C;  3P4Q D;  1MKM A;  4Y28 J;  1PV3 A;  1S1C X;  2WDV D;  2YIU C;  1UIX A;  2FYN C;  3Q1M A;  4PV1 B;  2NZ2 A;  2ZT9 B;  3AEA C;  3VRB C;  1NEN C;  1YQ4 D;  1TU3 F;  1KF6 C;  3AEA D;  4YSX C;  1NEN D;  2BS2 C;  1DD4 A;  1KF6 D;  1KOR A;  4OGQ B;  1ZP0 C;  3AE9 C;  4Z1M H;  1R8E A;  3CIR C;  3B71 A;  1PL5 A;  1ZP0 D;  1HF9 A;  2G8Y A;  3CIR D;  3AE3 D;  1ZOY D;  1K05 A;  3AEC C;  1QLB C;  2MKV A;  4R4L A;  3AE2 D;  3GLM A;  3VR9 C;  2E75 C;  4YTN D;  5M1B A;  4U7J A;  4I7Z C;  2E75 D;  2E76 C;  2H88 C;  3T97 B;  1OW8 A;  2WDV C;  5C2T C;  4KX6 D;  2H88 D;  4IL6 X;  1KFY C;  2WSE J;  3AE6 C;  2JP3 A;  5C2T D;  2IDB A;  2J5U A;  3O6Q A;  2D2C B;  2WPV B;  3AEG C;  3AE4 C;  3D70 A;  2E74 B;  1NGM B;  1KQG B;  3AEG D;  2WS3 C;  1AJY A;  3VRB D;  1KTM A;  4H44 B;  1OW6 A;  1K04 A;  3AE7 C;  4YSX D;  4PV1 C;  5KKZ C;  3Q2Y A;  3AE7 D;  1VF5 B;  2ZT9 C;  4PV1 D;  4YSY C;  2V7Q J;  1FDI A;  3Q5S A;  3VR8 C;  3AE9 D;  4YSY D;  3AEF C;  3RL0 g;  3D71 A;  2OQQ A;  1EXI A;  2ACZ C;  2FXP A;  3GMA A;  3AEF D;  2BEZ F;  4H0L B;  4OGQ C;  4R4M A;  4RKU J;  4YT0 C;  3AEC D;  2BEQ D;  3ABV C;  3P4R C;  4H13 B;  3Q5R A;  4YT0 D;  1NYH A;  3VR9 D;  3AE1 C;  1VL2 A;  2H89 C;  2O01 J;  5KLI C;  1JB0 J;  2WDQ C;  3AEE C;  3AE1 D;  2WP9 C;  2E76 D;  2WDQ D;  2FBW C;  1U57 A;  3SFD C;  2WP9 D;  1L0V C;  3AEE D;  1KFY D;  4H13 C;  3AE6 D;  2FBW D;  1L0V D;  1OMI A;  3C8V A;  4TT3 H;  1RQV A;  2QJK C;  2QSI A;  4KT0 J;  3AE4 D;  3GF7 A;  2JO1 A;  3R4Y A;  3IAO A;  2WS3 D;  5C3J C;  1KIL E;  1Q90 D;  2P10 A;  1OW7 A;  2WU2 C;  3AEB C;  3AE8 C;  2D2C C;  2QIW A;  3S9O A;  4XFJ A;  2WU2 D;  2E74 C;  2WU5 C;  3AEB D;  3P4P C;  2D2C D;  3Q3D A;  2WSC J;  1S5L X;  3RK3 E;  2ZT9 D;  3G9R A;  2E74 D;  1YQ3 C;  1DIP A;  1NEK C;  2WU5 D;  4YSZ C;  2WDR C;  4H44 C;  3VR8 D;  4YSZ D;  3P4Q C;  3IN6 A;  2WDR D;  3LW5 J;  3Q5P A;  1VF5 C;  3AED C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...