1ZP0C

Crystal structure of mitochondrial respiratory complex ii bound with 3-nitropropionate and 2-thenoyltrifluoroacetone
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zp0C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zp0C02
1OW6A 4YTPD 3AEBD 1ZOYC 2WU5C 3AECD 1L0VC 3AEDD 3AE2C 3VR9D 1NENC 4YXDC 1E7PC 2BS4C 3AEAD 5C2TD 5C3JD 3SFEC 4YSZC 4YT0D 1PV3A 3AE9C 3P4RD 3AECC 3AE5D 2WU5D 1L0VD 3VR8D 3VR9C 3AE2D 3AEAC 1KTMA 1NEND 4YXDD 3AE1D 3CIRD 1QLBC 2WDQC 4YT0C 2BS3C 3SFED 4YSZD 3P4RC 2B76D 3AE5C 3AE9D 4KX6C 1YQ3C 3VR8C 3AE6C 1K04A 3AE1C 3CIRC 1KF6C 3AE7D 3AE8C 3AEFD 2WDQD 2WU2D 2B76C 1K05A 1YQ4D 4KX6D 4YTNC 2WQYC 1YQ3D 3AEED 3AEGD 4YTMD 3AE4C 3AE6D 3SFDC 2FBWD 3AE7C 1KF6D 3AEFC 3AE8D 2WU2C 2H88C 1YQ4C 1NEKC 3AEEC 3AEGC 4YTMC 4YTND 2WQYD 2BS2C 1KFYC 3AE4D 3P4SD 4YSYD 2FBWC 2WDRD 3SFDD 3AE3D 4YSXC 1ZP0C 2H88D 1NEKD 3VRBD 2WP9D 1OW7A 2H89D 3P4SC 1KFYD 2G3AA 4YSYC 2WDRC 2WS3C 3ABVD 3AE3C 3S9OA 4YSXD 1ZP0D 2WDVD 3P4QC 2ACZD 3P4PC 3VRBC 2WP9C 3VRAC 2H89C 4YTPC 3AEBC 2WS3D 3ABVC 1ZOYD 3AEDC 2WDVC 1OW8A 2ACZC 3P4QD 3P4PD 5C3JC 5C2TC 3VRAD 3B71A
chains in the Genus database with same CATH superfamily
2E76D 5K5GB 4OGQD 3Q5PA 1NENC 1NTMJ 1E7PC 4BWNA 1S1CX 2AXTE 2WPSA 1GMJA 2WSFJ 4OH8B 2OGUA 3L73D 1JM0A 4K3AA 3G6EP 2BASA 2OYHC 2DW3A 1VQPP 1JY3N 3CWBD 1NTKE 1VQMP 5TISH 3PP5A 1YTZT 1L4AD 3HUSA 3L75E 3VR8C 2K9JB 1QVGO 3HE4A 2CPSA 3AE6C 3H1JE 3M06A 3L74G 1JY2P 3E7KA 3AEFD 1EDJA 3CMAP 1XTCC 3TNUA 3B4SA 3V2NA 5KAIH 2W8ZA 3T97B 4ZNCA 2E43A 2PRRA 4DHJA 4I7ZC 1YIJP 1S5LH 1LTTC 2QIWA 4YTND 2IYPA 2ZT9B 3USSA 2XKMA 4WB4A 2JWDA 2KSEA 1ZRTD 4WY4B 2H88D 1PP9G 4W7YA 2H43A 4EYYQ 4OWFA 1EXJA 3CCRP 1JB0J 3TGUD 2OTKE 1J1EC 5CCGC 1QLED 4B86A 1T8ZA 2MKVA 3CCUP 1R5SA 1L0LJ 2Q6QA 5AW5B 1NTKK 1S5LX 4Y99C 1KILC 1QX8A 1PGJA 3H1HG 1P84D 4KHXA 2B88A 1NTME 2NPSA 3KYQA 1LTBC 2KIKA 1FOSE 1BSHA 1S3JA 3KHUA 3JCUE 1BE3G 1IJDB 1PL5A 1M1JA 3CIRD 4Z1MH 3CXHD 1HH0A 5B5EE 2L5GB 4WBAA 1CSBA 1LGHB 2K9YA 2CK3H 5AVYB 1FJPA 2BCCJ 4IFDK 1VPCA 4H13D 5KJ7C 4IL6X 1HJBA 3PRJA 2Q3EA 1LJ2A 1N86A 1KF6D 4ZKUA 3L72J 3H1IG 4O9BA 3SWKA 1E5WA 3BCCD 3MZWB 1NWQA 1NTZJ 1MUUA 3O8ZA 3FXEA 1OW7A 3M91A 4H44B 3VMAA 1EC5A 5TISE 1NTMK 2W27A 3M0AA 3EFFK 4JF7A 2P1JA 3VRAC 4C7NA 1R5LA 1L0LE 2W6AA 3FGAD 2Y0DA 3HTKB 3V2QA 2YO3A 2WDVC 1FE6A 5KAIE 1BGYJ 2WVRA 1SQPJ 5APUA 5AVZB 1LTJB 2KZIA 3UIAA 1M7LA 3AECD 2RMZA 1HTLC 1S5LE 3N7NA 2OYOA 3L71G 2P7JA 1FZEA 2XU6A 3G4SP 3IR9A 1KV4A 5KTBA 1M90Q 2POHA 1JTHA 1NOHA 4WY4C 3P4RC 1T2KC 3WUUA 1U7MA 1GU4A 3HD7D 1VF5D 4HYTB 2KS1B 2BCCE 2YO2A 2WPRA 2M3BA 3KXDA 3F5HA 3CL3D 2C9LY 1YJ9P 2ZVOB 3L72E 2WPVB 4GOEA 2E75B 1L0LK 2HODB 2WDRD 2WSEH 2HYNA 3H1JG 1FC2C 1FZCA 4N6JA 3HE5B 1FDMA 3W68A 3RK2D 3EQ2A 1KQSO 2R3CA 1ZLLA 3VRBC 4AQRD 1VQKP 2LR2A 1KQGB 1GL2C 2Y0EA 4OVNF 2ZYGA 1MZ9A 2Y9YA 5AVQB 3NTNA 1IZNB 2FYZA 1L0NJ 4HJGH 2GUSA 1Y47A 5CCHD 4H0LD 3HD7A 1LNQA 4UB6H 3CCEP 2KLUA 4YXDC 3L70J 1EZVI 1VL2A 4YXWH 2WSEJ 2QA4P 1LTIC 2JP3A 1OVRA 3M0DC 2HPCB 2B9BA 4D6TJ 3AE1D 1Q7YQ 4XE5B 5CJ4A 4N78D 1LWUA 1SP4A 1KILA 1GK4A 1N7SD 2XV5A 2E42A 1NTMG 4H44C 3CCQP 2Z5HA 3HRNA 3AE4C 3ZDMA 2R5BA 2FBWD 3PJSK 4JQ0D 1FU1A 3PLNA 3TK1A 1FJKA 4U3FJ 3FWLA 4GDOA 3WU2H 1NAYA 2QJKB 3SFDD 1LTJC 1JCCA 3E1RA 1PP9E 1ZP0C 2E74D 2IX7C 2M8RA 1JO5A 1HJ0A 1H88A 5CCHA 1N73B 1G1IA 4BRYB 1JCDA 1BDCA 2OYHB 2WP9C 1BCCD 1K9MQ 1QVFO 1W2BO 5KLVJ 4YPCA 1IFJA 1KORA 4OGQC 2A06D 1G2CB 1YITP 2QVAA 1SQBD 3P4QD 3B5ND 1L0NE 5CBNA 1SFCB 2D2CD 3MUDC 2YIUC 3L70E 2OQQA 4ZKPA 4I7ZB 1MV8A 1L0LG 3VR9C 3C9IA 3E1IA 3K5BA 3GMAA 1PIXA 4D6TE 1RE3A 3U1CA 4DT0A 1KYOD 2B76D 1Q2NA 1OMIA 2K9JA 1NJIQ 3R4YA 4CPGA 1K04A 3H1LD 3L4FA 5B66H 2N1TD 1FS0E 2C0XA 4YTNC 3T97A 1N2DC 2H88C 2M5AB 3RL0g 1YQ4C 4U3FE 4UB6E 2Q7CA 4Y99B 4WY4A 2YXRB 3G9RA 5CMZA 4AUWA 2Q5UA 1L0NK 2BCCG 1KN7A 2WSCJ 4YSYC 2H8PD 3Q5RA 3FWNA 1HF9A 5TJHA 1JY3P 1GDTA 1NGMB 4UB8H 5KLVE 4JPZB 1OW8A 3V2RA 1EZVE 1NTZG 2LXCB 1OW6A 1NAFA 2OYIC 1NTKD 5AW4B 3L71E 3Q1MA 3L75D 4DCKA 3WU2E 2MJZA 5C2TD 2J59M 3L73J 1P84I 4NPFX 2BEQD 1L0VD 3CWBJ 2FYNB 2UWJE 2O01N 2QJKC 1Q90D 1BGYG 1SQPG 1AV1A 3AE5C 4H13C 1J1DC 3CPWO 1KB9D 1IK9A 3OA7A 1KFNA 3RK3B 1KF6C 2IBZD 3CXHI 3FXDA 3CCSP 2W6JH 2IZ0A 1N73C 2IYOA 1P84H 1IO4A 1LP1B 2KNCB 1VQ8P 5BU5A 1RF0A 2ZJSE 1HGVA 2XNDH 5KLVK 1M8OB 2NPSD 3PTZA 2AEMA 2I8DA 2ZAEB 1FZBA 1SFCC 3GF3A 2FFDA 5KAFH 1EDIA 1USDA 1NEKD 2H89D 2L91A 5APTA 2Y0CA 1S9KD 1GD2E 2I1KA 1DD3A 5B66E 3HTKA 3MHVA 5KKZB 2IDBA 1A02F 1IFDA 1VQOP 1PPJD 4YTPD 1ZOYC 3BVHA 1WT6A 2J58A 2KOGA 1T6AA 1VQ5P 1K73Q 1SQQD 3L73E 1LT9A 4IOIH 1JMBA 3VN0A 1QL1A 3JSVC 4HH2A 1KFMA 4YT0C 4IL6H 1L0NG 3AE9D 3IN6A 1AA0A 2KS1A 3VONA 3AE7D 4UB8E 3L70G 2GUVA 5CJ0A 4KX6D 4GIFA 3R2PA 3AEED 3VMYA 2LXBA 1K8AQ 4BXLA 4D6TG 2B87B 1RQUA 3BCCJ 1TU3F 3P32A 3AEGC 1GL2B 1ZRTE 2HODA 5AW6B 3KPEA 3P7KA 1NU1G 1WRGA 3RK2C 3H1KG 1YTZI 2G8YA 4RJTA 3HE5A 3P4SC 3RL0D 2G3AA 1JMMA 1URQB 3D6YA 1SLQA 3S1KA 2FKWB 2W6BA 2FYNC 2W83C 2V7QJ 4U3FG 2ITAA 3QH9A 3CX5D 2JR8A 4H0LC 2WZ7A 4KT0J 3CCLP 1X8YA 5GTIE 1P84E 3RK3C 1RH5B 2FYUD 3SWYA 3AEBD 1OIPA 5AW3B 2KXPB 3AEDD 1EXIA 3II6A 3TSIA 1FOSF 4I1LA 5AVXB 2P10A 4PJ0H 3VR8D 2BCCD 3GF7A 5KLVG 1FZGA 2HPCA 1N7SC 3AEAC 5KAFE 3A0HH 1EZVG 3A0BH 2P2UA 1YHQP 5AVWB 3L72D 4GOFA 1GK6A 1DH3A 2HR3A 2Y9ZA 2KP8A 2IFMA 1CI6B 4LC1A 1PGPA 5KLIB 1AVOA 4PV1B 2VRSA 3JC22 3SFDC 2FXPA 1NYHA 1TFFA 1RE4C 2XDJA 2E76B 2WU2C 1KMIZ 4OGQB 5AW0B 3BCCE 4YTMC 5E79H 1JUNA 5KKZC 1LT1A 3U59A 3U1AA 5CCGD 4WWIA 1SQXD 2YIUB 2N9BA 1SQVD 3MD0A 1L4AB 4IL6E 1N73A 4DHIB 1FZAA 2YXQB 3SWFA 1GZLA 4BRYA 3GHGB 3GLMA 2OYHA 3P4QC 1DX7A 2FY8A 2K37A 1KILD 2XNXA 4ASVA 2WS3D 1FBMA 2D2CC 1G2CA 4RKUJ 1NTZE 1RF1B 2ACZC 1EDKA 2OTJP 1H0TB 3MTUE 2SPZA 1M56D 5AW2B 2Z5IA 5C3JD 1NHLA 2KYVA 3L74D 4LLHA 5BVZA 2QJPC 5AVRB 3WMM0 1H89A 5APXA 1AFOA 1OVVA 1BGYE 1PGQA 1SQPE 1KQFB 1DEEG 2RKLA 4YSZD 4QMAA 5KJ7D 2RH0A 3M9BA 1KYOI 1S2EA 2A45I 3F89A 4ZMDA 5CCGA 1URQC 3L73G 1DIPA 4W80A 2IPPA 2QG4A 1PP9D 3CI9A 3CWBG 2V4HA 3AE8D 1KQLA 4IFFA 3P8CD 2C0WA 2BS2C 1NU1J 1NTZK 3SSUA 3H1KJ 2ZXXA 4R4LA 2OYIB 4PJ0E 3HUSC 1ZMEC 4EOTA 3A0HE 3MP7B 3A0BE 3AE3C 1JOCA 1BCCJ 4YSXD 3H1HD 2WDVD 2KI7B 4EI2A 2JDIH 2JO1A 3ABVC 1SQBJ 4H13B 1SQPK 1J1DB 2KLVA 2R44A 2FXOA 3P4PD 5C2TC 1BE3D 3B71A 1X0TA 3VMZA 2RN0A 4JYBA 1MFTA 1Q82Q 1L0VC 5KJ7A 3W67A 5KLIC 4PV1C 3RK3E 4W7ZA 1ZW0A 4DOJA 5E79E 1YI2P 2ZT9D 1PV3A 4WY4D 2KUBA 2E76C 3P4RD 2QE7H 1IFPA 2LKMA 4N78E 1LTAC 2P58A 1CZQA 3H1LJ 2K88A 3I56P 4JBZA 3H1ID 1KB9I 1L4AC 2OARA 1YQ3D 3L37A 1USEA 3GHGC 1FZCB 1ZV8A 1LP1A 4I2LC 2IBZI 4DHZA 2I1JA 2WSCH 3CCMP 1RQVA 2NPSC 3AEFC 1AQTA 1NEKC 4AYCA 1RF1C 3N4XA 2FXMA 1NU1E 1VDFA 3P8MC 1ZN5A 3H1KE 3BRTB 3TF5A 1OX3A 3CD6P 1X22A 3VRBD 2QJYC 1KB9H 1EZVD 4PD4D 1S72P 3HD7B 4NPDA 2ZFYA 3KQGA 1VF5B 3BCCG 2A06E 4YTPC 3L71D 3C8VA 2YMKA 3GW6A 1NTKJ 4U7JA 1IK7A 3L75J 3LIEA 1YJWP 4A7PA 2YKQA 2BS4C 2C9NY 3H32B 1GU5A 1YYCA 2QRXA 1W5CE 3AE9C 2WU5D 2O1KA 4XA4A 4H44D 5EFWB 1Q81Q 3RK2B 1NO4A 1NU1K 4KX6C 3H1LE 3V2PA 5GTHH 3A3YB 1AQ5A 3CIRC 1JEKA 4LGDE 4L75A 2P67A 3TDKA 3I5CA 3H1JD 2WTYA 1JY2O 1Y8AA 3EWKA 4WVZA 3V4WA 5H2FH 3NMDA 2YKPA 3RBXA 2B87A 4H0LB 1GL2A 2WQYD 1NKNA 1W2EA 2PGDA 2JEEA 3G71P 1SS1A 2HLOA 1IFNA 2WP9D 5GTIH 1KC8Q 1KFYD 3M9QA 1URQA 2PP6A 1VQLP 1U7JA 3M0DA 1N7SB 1XTGB 2H7HA 3AEBC 2KZJA 3QWOC 2O3JA 4JYCA 3AEDC 3TGUJ 2GM4A 2ZVNB 3CXHH 3CX5I 1HBWA 1SQQJ 3VR9D 1FZCC 2E75D 1R8EA 3A5TA 1G1JA 1Y9BA 1NTMD 3AECC 5APYA 1CW5A 3VMXA 4GKGA 3AE2D 2E74B 3CCJP 1EDLA 3VOPA 4IFMA 1LTJA 1QL2A 3M9HA 1MKMA 2NZ2A 3VP8A 1KB9E 4EDFA 3SFED 2BS3C 2AEJA 2IBZE 3CX5H 2KSJA 1KD1Q 1X9VA 2WDQD 1CI6A 3WUTA 2Q9IA 3HD7C 1YQ4D 3CWBE 3B5NB 1VF5C 3C1LA 5APSA 2KB7P 1J2JB 2D2CB 4YSYD 2V7QH 3IF4A 2WITA 3PH0A 2WPQA 2K3RA 1LWUC 3MUDA 1AVYA 4RO0A 2WT7B 1H8AA 1S9KE 2WDRC 2AXCA 2WS3C 1RHZB 1L4AA 1JY2N 2R32A 1VQ9P 1NH4A 2QJPB 3GHGA 1ZXGA 1QEXA 3OAKA 5GTHE 1GW4A 4L74A 1HGZA 2HFED 3O6QB 2XZRA 2N1TB 1RY3A 1VQ4P 5AVTB 1RF1A 1S4XA 3TGUE 2FYUJ 1PPJE 1KZUB 1L0LD 1N7LA 5C3JC 1H0TA 1Z56A 5H2FE 2O01H 3V5BA 3V4QA 1DD4A 1SQQE 1BCCG 2KK7A 3MIWA 4YSZC 3IFMA 2A06G 2JJLA 5CCHC 3AE5D 1SQBG 1NEND 2AEFA 4R4MA 1QLBC 4GODA 3HUSB 3LW5H 3HE4B 4XFJA 3AE1C 3AE8C 4HB1A 3OW2O 2QSIA 2O1JA 2FFDB 3AE6D 3TNUB 2A45G 3CXHE 2O01J 1PZQA 1ZR2A 1SFCD 3H1LG 1UIIA 2FBWC 1HWTC 1RE3C 3EFGA 2OYIA 4YSXC 1SQXJ 3OJAB 5AVSB 4Y28J 3D6ZA 3Q2YA 4K35A 1SQVJ 1NTZD 3L35A 1SQQK 1M1KQ 1IC2A 1OVUA 1LTSC 3I55P 4L73A 3CX5E 3P4PC 3LW5J 3BRVB 2E74C 2OTLP 2M3EA 1LT9B 1ZOYD 3A2AA 1NKZB 2FYUE 2Q1KA 1GTWA 1T3UA 2ZT9C 3KZIH 3VP9A 4LDTA 5DJTB 1BGYD 1SQPD 2QEXP 3L74J 2M0BA 3VYIA 3B5NC 2WMMA 2Z4EA 2NPSB 4YT0D 1UIXA 3CC2P 1M1JB 1NTKG 2YNYA 3CC4P 1SFCA 1YQ3C 5AW7B 3L75G 2QJYB 3TYYA 1PP9J 3B8EB 2YKOA 3CC7P 2B76C 2ZFCA 2IZ1A 1Q86Q 3AEGD 5M1BA 1VQ6P 3IAOA 3BATA 1M57D 3CCVP 4NPEA 2N1TC 1OZHA 5CHXA 4RESB 2IBZG 3P4SD 2FYUK 5AW9B 1SQXE 1X79B 1SQVE 3RBZA 3WUVA 3H1HJ 1FZFA 1FAVA 1IFIA 2J5UA 3A7OA 5APWA 2M5AA 1KILE 2HG5D 1SVFA 2K1AA 4PD4I 3RK3D 4HKZH 4KJMA 1NVOA 4C7NB 1BE3J 1RF0C 1KYOH 2A45H 2E5TA 3VRAD 4EIJA 1L2PA 2WU5C 1YBKA 3H25A 1L0ND 4MN4C 5DJUB 1BSNA 3L74E 2FFDC 3AEAD 2R3SA 5APQA 3H32A 3V6IA 3L70D 3KDPB 4PD4H 3TGUG 3RL0B 2CPBA 1PPJG 3H1IJ 1JTHB 5AVUB 3NXSA 4D6TD 3L36A 1JNMA 1SQXK 5AW8B 1PGOA 1SQQG 3ITKA 1SQVK 2WU2D 1NU1D 2W90A 4I6LA 1T2KD 1K05A 3H1KD 2WQYC 4YTMD 5BU8B 1D7MA 3KZIE 2QM7A 1LTGC 3P8CE 1LT9C 1OXZA 3LIDA 4L76A 1N8RQ 5L8RJ 1KFYC 2AXTH 2WWWA 1ZR4A 2BEZF 4U3FD 1BDDA 3CMEP 1MFZA 4N3YB 3BASA 1HVVA 1GW3A 2KNCA 4GT1A 3H1HE 4FJVA 4TLFA 5AW1B 2IFNA 1EQ7A 2JKVA 1U57A 3L71J 2PAJA 1N7SA 2ACZD 2H89C 2N9YB 1M1JC 1VQNP 3FX0A 1JY3O 1IFMA 5APVA 1AJYA 4DZOA 4C46A 1BE3E 4DJGA 2ZYDA 2WSSH 2E75C 5KLVD 4M3LA 5C39A 1A02J 1BCCE 3AE2C 1GL2D 2NRGA 3Q5SA 1PFIA 1RE4A 3SFEC 1J1EB 1VQ7P 1SQBE 2GA1A 1OFCX 1FDOA 1HUCA 2Q3IA 1KTMA 4YXDD 2FYUG 3Q3DA 3VTPC 2WDQC 3H1IE 3G3ZA 1URQD 4DDGA 1LWUB 4TT3H 3CLQA 3H1JJ 1KILB 5AVVB 3RGUA 3D70A 4I6MC 4ASWA 2QM8A 3GG2A 5CBOA 3B5NA 1KYOE 1YJNP 3AE7C 4DDIA 2PFXA 3L72G 1WMKA 2E5YA 1E79H 3AEEC 3AE4D 4C7RA 2R5DA 3AE3D 2WSFH 2ZYAA 3JCUH 4PD4E 2WT7A 1OWAA 2ZXEB 3D71A 3ABVD 3S9OA 5B5EH 3NFQA 1ZP0D 3PHLA 1FDIA 1SQBK 3O6QA 3RL0C 1QGKB 2N1TA 2YMYA 2B89A 3S4RA 3H6PA 2JWAA 4PV1D 1SQXG 1T3JA 3MGNA 1SQVG 1DEBA
chains in the Genus database with same CATH topology
1OW6A 4YTPD 4U7JA 3AEBD 1ZOYC 1IK7A 2WU5C 3H25A 3AECD 2E76D 1L0VC 1DD4A 4H0LD 2D2CD 4OGQD 5KLIC 3AEDD 3AE2C 4PV1C 3Q5PA 3RK3E 1EXIA 3VR9D 3Q1MA 2E75D 4YXDC 1E7PC 2YIUC 1R8EA 1NENC 2BS4C 3AEAD 3Q5SA 1S1CX 5C3JD 2ZT9D 1VL2A 2OQQA 3SFEC 5C2TD 4YSZC 1Y9BA 4YT0D 2WSEJ 1PV3A 2BEQD 2P10A 3AE9C 3P4RD 3AECC 2E76C 3AE5D 2WU5D 1UIXA 2QJPC 1L0VD 4I7ZB 1GMJA 2WSFJ 3VR8D 2JP3A 1FDOA 3GF7A 3VR9C 3AE2D 3AEAC 1KTMA 2E74B 1PIXA 3GMAA 1PL5A 1NEND 3AE1D 4YXDD 3Q3DA 3CIRD 4R4MA 2NZ2A 2QJKC 1MKMA 1KQFB 4Z1MH 4H44D 1QLBC 2BS3C 1Q90D 2WDQC 4YT0C 3SFED 4YSZD 3P4RC 2B76D 3AE5C 3AE9D 1OMIA 4H13C 4KX6C 1YQ3C 3VR8C 4TT3H 3IN6A 3AE6C 3R4YA 2K9YA 1VF5D 4XFJA 1K04A 3AE1C 3CIRC 1KF6C 3AE7D 3AE8C 4H44C 3AEFD 2WDQD 3D70A 2B76C 2WU2D 2QSIA 1DIPA 1K05A 4H13D 1YQ4D 4PV1B 4KX6D 2WQYC 4IL6X 1YQ3D 3AEED 3EWKA 3AEGD 4YTNC 4YTMD 3AE4C 5M1BA 3AE6D 1VF5C 3SFDC 2FXPA 3T97B 1NYHA 2FBWD 3IAOA 1RQVA 2O01J 3AE7C 1KF6D 3AEFC 3AE8D 2E76B 2WU2C 2H88C 4H0LB 1KMIZ 2D2CB 4I7ZC 1RQUA 3RL0g 4OGQB 2WPVB 1WMKA 1YQ4C 1TU3F 1NEKC 3AEEC 3AEGC 4YTMC 2QIWA 2E75B 2WQYD 2BS2C 5L8RJ 4YTND 1ZRTE 4GDOA 1KFYC 3AE4D 3P4SD 5KKZC 2ZT9B 4YSYD 2FBWC 2BEZF 2WDRD 3SFDD 3AE3D 4R4LA 4YSXC 3G9RA 1ZP0C 4Y28J 1ZMEC 3D6ZA 2H88D 3Q2YA 3GF3A 1NEKD 3VRBD 2WP9D 2QJYC 2G8YA 1EXJA 1OW7A 2WSCJ 2H89D 1JB0J 2E74D 2G3AA 1KFYD 2WDRC 3P4SC 4YSYC 2WS3C 4H44B 3D71A 3Q5RA 1HJ0A 3ABVD 2J5UA 3AE3C 3D6YA 1HF9A 3S9OA 4YSXD 1U57A 1ZP0D 1KILE 2WDVD 2MKVA 3GLMA 3P4QC 2ACZD 2FYNC 3P4PC 1FDIA 3LW5J 1VF5B 2WP9C 3VRBC 3VRAC 2H89C 2E74C 3O6QA 2V7QJ 1NGMB 4YTPC 3AEBC 2JO1A 2WS3D 3ABVC 1ZOYD 3C8VA 1DD3A 1KQGB 4H0LC 2D2CC 1KORA 3FGAD 4KT0J 4RKUJ 1AJYA 4OGQC 3AEDC 4H13B 2WDVC 1OW8A 4PV1D 2E75C 2ACZC 3P4QD 3P4PD 2YMKA 2ZT9C 5C3JC 5C2TC 3VRAD 2IDBA 1S5LX 3B71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW6 A;  4YTP D;  3AEB D;  1ZOY C;  2WU5 C;  3AEC D;  1L0V C;  3AED D;  3AE2 C;  3VR9 D;  1NEN C;  4YXD C;  1E7P C;  2BS4 C;  3AEA D;  5C2T D;  5C3J D;  3SFE C;  4YSZ C;  4YT0 D;  1PV3 A;  3AE9 C;  3P4R D;  3AEC C;  3AE5 D;  2WU5 D;  1L0V D;  3VR8 D;  3VR9 C;  3AE2 D;  3AEA C;  1KTM A;  1NEN D;  4YXD D;  3AE1 D;  3CIR D;  1QLB C;  2WDQ C;  4YT0 C;  2BS3 C;  3SFE D;  4YSZ D;  3P4R C;  2B76 D;  3AE5 C;  3AE9 D;  4KX6 C;  1YQ3 C;  3VR8 C;  3AE6 C;  1K04 A;  3AE1 C;  3CIR C;  1KF6 C;  3AE7 D;  3AE8 C;  3AEF D;  2WDQ D;  2WU2 D;  2B76 C;  1K05 A;  1YQ4 D;  4KX6 D;  4YTN C;  2WQY C;  1YQ3 D;  3AEE D;  3AEG D;  4YTM D;  3AE4 C;  3AE6 D;  3SFD C;  2FBW D;  3AE7 C;  1KF6 D;  3AEF C;  3AE8 D;  2WU2 C;  2H88 C;  1YQ4 C;  1NEK C;  3AEE C;  3AEG C;  4YTM C;  4YTN D;  2WQY D;  2BS2 C;  1KFY C;  3AE4 D;  3P4S D;  4YSY D;  2FBW C;  2WDR D;  3SFD D;  3AE3 D;  4YSX C;  1ZP0 C;  2H88 D;  1NEK D;  3VRB D;  2WP9 D;  1OW7 A;  2H89 D;  3P4S C;  1KFY D;  2G3A A;  4YSY C;  2WDR C;  2WS3 C;  3ABV D;  3AE3 C;  3S9O A;  4YSX D;  1ZP0 D;  2WDV D;  3P4Q C;  2ACZ D;  3P4P C;  3VRB C;  2WP9 C;  3VRA C;  2H89 C;  4YTP C;  3AEB C;  2WS3 D;  3ABV C;  1ZOY D;  3AED C;  2WDV C;  1OW8 A;  2ACZ C;  3P4Q D;  3P4P D;  5C3J C;  5C2T C;  3VRA D;  3B71 A; 
#chains in the Genus database with same CATH topology
 2E76 D;  5K5G B;  4OGQ D;  3Q5P A;  1NEN C;  1NTM J;  1E7P C;  4BWN A;  1S1C X;  2AXT E;  2WPS A;  1GMJ A;  2WSF J;  4OH8 B;  2OGU A;  3L73 D;  1JM0 A;  4K3A A;  3G6E P;  2BAS A;  2OYH C;  2DW3 A;  1VQP P;  1JY3 N;  3CWB D;  1NTK E;  1VQM P;  5TIS H;  3PP5 A;  1YTZ T;  1L4A D;  3HUS A;  3L75 E;  3VR8 C;  2K9J B;  1QVG O;  3HE4 A;  2CPS A;  3AE6 C;  3H1J E;  3M06 A;  3L74 G;  1JY2 P;  3E7K A;  3AEF D;  1EDJ A;  3CMA P;  1XTC C;  3TNU A;  3B4S A;  3V2N A;  5KAI H;  2W8Z A;  3T97 B;  4ZNC A;  2E43 A;  2PRR A;  4DHJ A;  4I7Z C;  1YIJ P;  1S5L H;  1LTT C;  2QIW A;  4YTN D;  2IYP A;  2ZT9 B;  3USS A;  2XKM A;  4WB4 A;  2JWD A;  2KSE A;  1ZRT D;  4WY4 B;  2H88 D;  1PP9 G;  4W7Y A;  2H43 A;  4EYY Q;  4OWF A;  1EXJ A;  3CCR P;  1JB0 J;  3TGU D;  2OTK E;  1J1E C;  5CCG C;  1QLE D;  4B86 A;  1T8Z A;  2MKV A;  3CCU P;  1R5S A;  1L0L J;  2Q6Q A;  5AW5 B;  1NTK K;  1S5L X;  4Y99 C;  1KIL C;  1QX8 A;  1PGJ A;  3H1H G;  1P84 D;  4KHX A;  2B88 A;  1NTM E;  2NPS A;  3KYQ A;  1LTB C;  2KIK A;  1FOS E;  1BSH A;  1S3J A;  3KHU A;  3JCU E;  1BE3 G;  1IJD B;  1PL5 A;  1M1J A;  3CIR D;  4Z1M H;  3CXH D;  1HH0 A;  5B5E E;  2L5G B;  4WBA A;  1CSB A;  1LGH B;  2K9Y A;  2CK3 H;  5AVY B;  1FJP A;  2BCC J;  4IFD K;  1VPC A;  4H13 D;  5KJ7 C;  4IL6 X;  1HJB A;  3PRJ A;  2Q3E A;  1LJ2 A;  1N86 A;  1KF6 D;  4ZKU A;  3L72 J;  3H1I G;  4O9B A;  3SWK A;  1E5W A;  3BCC D;  3MZW B;  1NWQ A;  1NTZ J;  1MUU A;  3O8Z A;  3FXE A;  1OW7 A;  3M91 A;  4H44 B;  3VMA A;  1EC5 A;  5TIS E;  1NTM K;  2W27 A;  3M0A A;  3EFF K;  4JF7 A;  2P1J A;  3VRA C;  4C7N A;  1R5L A;  1L0L E;  2W6A A;  3FGA D;  2Y0D A;  3HTK B;  3V2Q A;  2YO3 A;  2WDV C;  1FE6 A;  5KAI E;  1BGY J;  2WVR A;  1SQP J;  5APU A;  5AVZ B;  1LTJ B;  2KZI A;  3UIA A;  1M7L A;  3AEC D;  2RMZ A;  1HTL C;  1S5L E;  3N7N A;  2OYO A;  3L71 G;  2P7J A;  1FZE A;  2XU6 A;  3G4S P;  3IR9 A;  1KV4 A;  5KTB A;  1M90 Q;  2POH A;  1JTH A;  1NOH A;  4WY4 C;  3P4R C;  1T2K C;  3WUU A;  1U7M A;  1GU4 A;  3HD7 D;  1VF5 D;  4HYT B;  2KS1 B;  2BCC E;  2YO2 A;  2WPR A;  2M3B A;  3KXD A;  3F5H A;  3CL3 D;  2C9L Y;  1YJ9 P;  2ZVO B;  3L72 E;  2WPV B;  4GOE A;  2E75 B;  1L0L K;  2HOD B;  2WDR D;  2WSE H;  2HYN A;  3H1J G;  1FC2 C;  1FZC A;  4N6J A;  3HE5 B;  1FDM A;  3W68 A;  3RK2 D;  3EQ2 A;  1KQS O;  2R3C A;  1ZLL A;  3VRB C;  4AQR D;  1VQK P;  2LR2 A;  1KQG B;  1GL2 C;  2Y0E A;  4OVN F;  2ZYG A;  1MZ9 A;  2Y9Y A;  5AVQ B;  3NTN A;  1IZN B;  2FYZ A;  1L0N J;  4HJG H;  2GUS A;  1Y47 A;  5CCH D;  4H0L D;  3HD7 A;  1LNQ A;  4UB6 H;  3CCE P;  2KLU A;  4YXD C;  3L70 J;  1EZV I;  1VL2 A;  4YXW H;  2WSE J;  2QA4 P;  1LTI C;  2JP3 A;  1OVR A;  3M0D C;  2HPC B;  2B9B A;  4D6T J;  3AE1 D;  1Q7Y Q;  4XE5 B;  5CJ4 A;  4N78 D;  1LWU A;  1SP4 A;  1KIL A;  1GK4 A;  1N7S D;  2XV5 A;  2E42 A;  1NTM G;  4H44 C;  3CCQ P;  2Z5H A;  3HRN A;  3AE4 C;  3ZDM A;  2R5B A;  2FBW D;  3PJS K;  4JQ0 D;  1FU1 A;  3PLN A;  3TK1 A;  1FJK A;  4U3F J;  3FWL A;  4GDO A;  3WU2 H;  1NAY A;  2QJK B;  3SFD D;  1LTJ C;  1JCC A;  3E1R A;  1PP9 E;  1ZP0 C;  2E74 D;  2IX7 C;  2M8R A;  1JO5 A;  1HJ0 A;  1H88 A;  5CCH A;  1N73 B;  1G1I A;  4BRY B;  1JCD A;  1BDC A;  2OYH B;  2WP9 C;  1BCC D;  1K9M Q;  1QVF O;  1W2B O;  5KLV J;  4YPC A;  1IFJ A;  1KOR A;  4OGQ C;  2A06 D;  1G2C B;  1YIT P;  2QVA A;  1SQB D;  3P4Q D;  3B5N D;  1L0N E;  5CBN A;  1SFC B;  2D2C D;  3MUD C;  2YIU C;  3L70 E;  2OQQ A;  4ZKP A;  4I7Z B;  1MV8 A;  1L0L G;  3VR9 C;  3C9I A;  3E1I A;  3K5B A;  3GMA A;  1PIX A;  4D6T E;  1RE3 A;  3U1C A;  4DT0 A;  1KYO D;  2B76 D;  1Q2N A;  1OMI A;  2K9J A;  1NJI Q;  3R4Y A;  4CPG A;  1K04 A;  3H1L D;  3L4F A;  5B66 H;  2N1T D;  1FS0 E;  2C0X A;  4YTN C;  3T97 A;  1N2D C;  2H88 C;  2M5A B;  3RL0 g;  1YQ4 C;  4U3F E;  4UB6 E;  2Q7C A;  4Y99 B;  4WY4 A;  2YXR B;  3G9R A;  5CMZ A;  4AUW A;  2Q5U A;  1L0N K;  2BCC G;  1KN7 A;  2WSC J;  4YSY C;  2H8P D;  3Q5R A;  3FWN A;  1HF9 A;  5TJH A;  1JY3 P;  1GDT A;  1NGM B;  4UB8 H;  5KLV E;  4JPZ B;  1OW8 A;  3V2R A;  1EZV E;  1NTZ G;  2LXC B;  1OW6 A;  1NAF A;  2OYI C;  1NTK D;  5AW4 B;  3L71 E;  3Q1M A;  3L75 D;  4DCK A;  3WU2 E;  2MJZ A;  5C2T D;  2J59 M;  3L73 J;  1P84 I;  4NPF X;  2BEQ D;  1L0V D;  3CWB J;  2FYN B;  2UWJ E;  2O01 N;  2QJK C;  1Q90 D;  1BGY G;  1SQP G;  1AV1 A;  3AE5 C;  4H13 C;  1J1D C;  3CPW O;  1KB9 D;  1IK9 A;  3OA7 A;  1KFN A;  3RK3 B;  1KF6 C;  2IBZ D;  3CXH I;  3FXD A;  3CCS P;  2W6J H;  2IZ0 A;  1N73 C;  2IYO A;  1P84 H;  1IO4 A;  1LP1 B;  2KNC B;  1VQ8 P;  5BU5 A;  1RF0 A;  2ZJS E;  1HGV A;  2XND H;  5KLV K;  1M8O B;  2NPS D;  3PTZ A;  2AEM A;  2I8D A;  2ZAE B;  1FZB A;  1SFC C;  3GF3 A;  2FFD A;  5KAF H;  1EDI A;  1USD A;  1NEK D;  2H89 D;  2L91 A;  5APT A;  2Y0C A;  1S9K D;  1GD2 E;  2I1K A;  1DD3 A;  5B66 E;  3HTK A;  3MHV A;  5KKZ B;  2IDB A;  1A02 F;  1IFD A;  1VQO P;  1PPJ D;  4YTP D;  1ZOY C;  3BVH A;  1WT6 A;  2J58 A;  2KOG A;  1T6A A;  1VQ5 P;  1K73 Q;  1SQQ D;  3L73 E;  1LT9 A;  4IOI H;  1JMB A;  3VN0 A;  1QL1 A;  3JSV C;  4HH2 A;  1KFM A;  4YT0 C;  4IL6 H;  1L0N G;  3AE9 D;  3IN6 A;  1AA0 A;  2KS1 A;  3VON A;  3AE7 D;  4UB8 E;  3L70 G;  2GUV A;  5CJ0 A;  4KX6 D;  4GIF A;  3R2P A;  3AEE D;  3VMY A;  2LXB A;  1K8A Q;  4BXL A;  4D6T G;  2B87 B;  1RQU A;  3BCC J;  1TU3 F;  3P32 A;  3AEG C;  1GL2 B;  1ZRT E;  2HOD A;  5AW6 B;  3KPE A;  3P7K A;  1NU1 G;  1WRG A;  3RK2 C;  3H1K G;  1YTZ I;  2G8Y A;  4RJT A;  3HE5 A;  3P4S C;  3RL0 D;  2G3A A;  1JMM A;  1URQ B;  3D6Y A;  1SLQ A;  3S1K A;  2FKW B;  2W6B A;  2FYN C;  2W83 C;  2V7Q J;  4U3F G;  2ITA A;  3QH9 A;  3CX5 D;  2JR8 A;  4H0L C;  2WZ7 A;  4KT0 J;  3CCL P;  1X8Y A;  5GTI E;  1P84 E;  3RK3 C;  1RH5 B;  2FYU D;  3SWY A;  3AEB D;  1OIP A;  5AW3 B;  2KXP B;  3AED D;  1EXI A;  3II6 A;  3TSI A;  1FOS F;  4I1L A;  5AVX B;  2P10 A;  4PJ0 H;  3VR8 D;  2BCC D;  3GF7 A;  5KLV G;  1FZG A;  2HPC A;  1N7S C;  3AEA C;  5KAF E;  3A0H H;  1EZV G;  3A0B H;  2P2U A;  1YHQ P;  5AVW B;  3L72 D;  4GOF A;  1GK6 A;  1DH3 A;  2HR3 A;  2Y9Z A;  2KP8 A;  2IFM A;  1CI6 B;  4LC1 A;  1PGP A;  5KLI B;  1AVO A;  4PV1 B;  2VRS A;  3JC2 2;  3SFD C;  2FXP A;  1NYH A;  1TFF A;  1RE4 C;  2XDJ A;  2E76 B;  2WU2 C;  1KMI Z;  4OGQ B;  5AW0 B;  3BCC E;  4YTM C;  5E79 H;  1JUN A;  5KKZ C;  1LT1 A;  3U59 A;  3U1A A;  5CCG D;  4WWI A;  1SQX D;  2YIU B;  2N9B A;  1SQV D;  3MD0 A;  1L4A B;  4IL6 E;  1N73 A;  4DHI B;  1FZA A;  2YXQ B;  3SWF A;  1GZL A;  4BRY A;  3GHG B;  3GLM A;  2OYH A;  3P4Q C;  1DX7 A;  2FY8 A;  2K37 A;  1KIL D;  2XNX A;  4ASV A;  2WS3 D;  1FBM A;  2D2C C;  1G2C A;  4RKU J;  1NTZ E;  1RF1 B;  2ACZ C;  1EDK A;  2OTJ P;  1H0T B;  3MTU E;  2SPZ A;  1M56 D;  5AW2 B;  2Z5I A;  5C3J D;  1NHL A;  2KYV A;  3L74 D;  4LLH A;  5BVZ A;  2QJP C;  5AVR B;  3WMM 0;  1H89 A;  5APX A;  1AFO A;  1OVV A;  1BGY E;  1PGQ A;  1SQP E;  1KQF B;  1DEE G;  2RKL A;  4YSZ D;  4QMA A;  5KJ7 D;  2RH0 A;  3M9B A;  1KYO I;  1S2E A;  2A45 I;  3F89 A;  4ZMD A;  5CCG A;  1URQ C;  3L73 G;  1DIP A;  4W80 A;  2IPP A;  2QG4 A;  1PP9 D;  3CI9 A;  3CWB G;  2V4H A;  3AE8 D;  1KQL A;  4IFF A;  3P8C D;  2C0W A;  2BS2 C;  1NU1 J;  1NTZ K;  3SSU A;  3H1K J;  2ZXX A;  4R4L A;  2OYI B;  4PJ0 E;  3HUS C;  1ZME C;  4EOT A;  3A0H E;  3MP7 B;  3A0B E;  3AE3 C;  1JOC A;  1BCC J;  4YSX D;  3H1H D;  2WDV D;  2KI7 B;  4EI2 A;  2JDI H;  2JO1 A;  3ABV C;  1SQB J;  4H13 B;  1SQP K;  1J1D B;  2KLV A;  2R44 A;  2FXO A;  3P4P D;  5C2T C;  1BE3 D;  3B71 A;  1X0T A;  3VMZ A;  2RN0 A;  4JYB A;  1MFT A;  1Q82 Q;  1L0V C;  5KJ7 A;  3W67 A;  5KLI C;  4PV1 C;  3RK3 E;  4W7Z A;  1ZW0 A;  4DOJ A;  5E79 E;  1YI2 P;  2ZT9 D;  1PV3 A;  4WY4 D;  2KUB A;  2E76 C;  3P4R D;  2QE7 H;  1IFP A;  2LKM A;  4N78 E;  1LTA C;  2P58 A;  1CZQ A;  3H1L J;  2K88 A;  3I56 P;  4JBZ A;  3H1I D;  1KB9 I;  1L4A C;  2OAR A;  1YQ3 D;  3L37 A;  1USE A;  3GHG C;  1FZC B;  1ZV8 A;  1LP1 A;  4I2L C;  2IBZ I;  4DHZ A;  2I1J A;  2WSC H;  3CCM P;  1RQV A;  2NPS C;  3AEF C;  1AQT A;  1NEK C;  4AYC A;  1RF1 C;  3N4X A;  2FXM A;  1NU1 E;  1VDF A;  3P8M C;  1ZN5 A;  3H1K E;  3BRT B;  3TF5 A;  1OX3 A;  3CD6 P;  1X22 A;  3VRB D;  2QJY C;  1KB9 H;  1EZV D;  4PD4 D;  1S72 P;  3HD7 B;  4NPD A;  2ZFY A;  3KQG A;  1VF5 B;  3BCC G;  2A06 E;  4YTP C;  3L71 D;  3C8V A;  2YMK A;  3GW6 A;  1NTK J;  4U7J A;  1IK7 A;  3L75 J;  3LIE A;  1YJW P;  4A7P A;  2YKQ A;  2BS4 C;  2C9N Y;  3H32 B;  1GU5 A;  1YYC A;  2QRX A;  1W5C E;  3AE9 C;  2WU5 D;  2O1K A;  4XA4 A;  4H44 D;  5EFW B;  1Q81 Q;  3RK2 B;  1NO4 A;  1NU1 K;  4KX6 C;  3H1L E;  3V2P A;  5GTH H;  3A3Y B;  1AQ5 A;  3CIR C;  1JEK A;  4LGD E;  4L75 A;  2P67 A;  3TDK A;  3I5C A;  3H1J D;  2WTY A;  1JY2 O;  1Y8A A;  3EWK A;  4WVZ A;  3V4W A;  5H2F H;  3NMD A;  2YKP A;  3RBX A;  2B87 A;  4H0L B;  1GL2 A;  2WQY D;  1NKN A;  1W2E A;  2PGD A;  2JEE A;  3G71 P;  1SS1 A;  2HLO A;  1IFN A;  2WP9 D;  5GTI H;  1KC8 Q;  1KFY D;  3M9Q A;  1URQ A;  2PP6 A;  1VQL P;  1U7J A;  3M0D A;  1N7S B;  1XTG B;  2H7H A;  3AEB C;  2KZJ A;  3QWO C;  2O3J A;  4JYC A;  3AED C;  3TGU J;  2GM4 A;  2ZVN B;  3CXH H;  3CX5 I;  1HBW A;  1SQQ J;  3VR9 D;  1FZC C;  2E75 D;  1R8E A;  3A5T A;  1G1J A;  1Y9B A;  1NTM D;  3AEC C;  5APY A;  1CW5 A;  3VMX A;  4GKG A;  3AE2 D;  2E74 B;  3CCJ P;  1EDL A;  3VOP A;  4IFM A;  1LTJ A;  1QL2 A;  3M9H A;  1MKM A;  2NZ2 A;  3VP8 A;  1KB9 E;  4EDF A;  3SFE D;  2BS3 C;  2AEJ A;  2IBZ E;  3CX5 H;  2KSJ A;  1KD1 Q;  1X9V A;  2WDQ D;  1CI6 A;  3WUT A;  2Q9I A;  3HD7 C;  1YQ4 D;  3CWB E;  3B5N B;  1VF5 C;  3C1L A;  5APS A;  2KB7 P;  1J2J B;  2D2C B;  4YSY D;  2V7Q H;  3IF4 A;  2WIT A;  3PH0 A;  2WPQ A;  2K3R A;  1LWU C;  3MUD A;  1AVY A;  4RO0 A;  2WT7 B;  1H8A A;  1S9K E;  2WDR C;  2AXC A;  2WS3 C;  1RHZ B;  1L4A A;  1JY2 N;  2R32 A;  1VQ9 P;  1NH4 A;  2QJP B;  3GHG A;  1ZXG A;  1QEX A;  3OAK A;  5GTH E;  1GW4 A;  4L74 A;  1HGZ A;  2HFE D;  3O6Q B;  2XZR A;  2N1T B;  1RY3 A;  1VQ4 P;  5AVT B;  1RF1 A;  1S4X A;  3TGU E;  2FYU J;  1PPJ E;  1KZU B;  1L0L D;  1N7L A;  5C3J C;  1H0T A;  1Z56 A;  5H2F E;  2O01 H;  3V5B A;  3V4Q A;  1DD4 A;  1SQQ E;  1BCC G;  2KK7 A;  3MIW A;  4YSZ C;  3IFM A;  2A06 G;  2JJL A;  5CCH C;  3AE5 D;  1SQB G;  1NEN D;  2AEF A;  4R4M A;  1QLB C;  4GOD A;  3HUS B;  3LW5 H;  3HE4 B;  4XFJ A;  3AE1 C;  3AE8 C;  4HB1 A;  3OW2 O;  2QSI A;  2O1J A;  2FFD B;  3AE6 D;  3TNU B;  2A45 G;  3CXH E;  2O01 J;  1PZQ A;  1ZR2 A;  1SFC D;  3H1L G;  1UII A;  2FBW C;  1HWT C;  1RE3 C;  3EFG A;  2OYI A;  4YSX C;  1SQX J;  3OJA B;  5AVS B;  4Y28 J;  3D6Z A;  3Q2Y A;  4K35 A;  1SQV J;  1NTZ D;  3L35 A;  1SQQ K;  1M1K Q;  1IC2 A;  1OVU A;  1LTS C;  3I55 P;  4L73 A;  3CX5 E;  3P4P C;  3LW5 J;  3BRV B;  2E74 C;  2OTL P;  2M3E A;  1LT9 B;  1ZOY D;  3A2A A;  1NKZ B;  2FYU E;  2Q1K A;  1GTW A;  1T3U A;  2ZT9 C;  3KZI H;  3VP9 A;  4LDT A;  5DJT B;  1BGY D;  1SQP D;  2QEX P;  3L74 J;  2M0B A;  3VYI A;  3B5N C;  2WMM A;  2Z4E A;  2NPS B;  4YT0 D;  1UIX A;  3CC2 P;  1M1J B;  1NTK G;  2YNY A;  3CC4 P;  1SFC A;  1YQ3 C;  5AW7 B;  3L75 G;  2QJY B;  3TYY A;  1PP9 J;  3B8E B;  2YKO A;  3CC7 P;  2B76 C;  2ZFC A;  2IZ1 A;  1Q86 Q;  3AEG D;  5M1B A;  1VQ6 P;  3IAO A;  3BAT A;  1M57 D;  3CCV P;  4NPE A;  2N1T C;  1OZH A;  5CHX A;  4RES B;  2IBZ G;  3P4S D;  2FYU K;  5AW9 B;  1SQX E;  1X79 B;  1SQV E;  3RBZ A;  3WUV A;  3H1H J;  1FZF A;  1FAV A;  1IFI A;  2J5U A;  3A7O A;  5APW A;  2M5A A;  1KIL E;  2HG5 D;  1SVF A;  2K1A A;  4PD4 I;  3RK3 D;  4HKZ H;  4KJM A;  1NVO A;  4C7N B;  1BE3 J;  1RF0 C;  1KYO H;  2A45 H;  2E5T A;  3VRA D;  4EIJ A;  1L2P A;  2WU5 C;  1YBK A;  3H25 A;  1L0N D;  4MN4 C;  5DJU B;  1BSN A;  3L74 E;  2FFD C;  3AEA D;  2R3S A;  5APQ A;  3H32 A;  3V6I A;  3L70 D;  3KDP B;  4PD4 H;  3TGU G;  3RL0 B;  2CPB A;  1PPJ G;  3H1I J;  1JTH B;  5AVU B;  3NXS A;  4D6T D;  3L36 A;  1JNM A;  1SQX K;  5AW8 B;  1PGO A;  1SQQ G;  3ITK A;  1SQV K;  2WU2 D;  1NU1 D;  2W90 A;  4I6L A;  1T2K D;  1K05 A;  3H1K D;  2WQY C;  4YTM D;  5BU8 B;  1D7M A;  3KZI E;  2QM7 A;  1LTG C;  3P8C E;  1LT9 C;  1OXZ A;  3LID A;  4L76 A;  1N8R Q;  5L8R J;  1KFY C;  2AXT H;  2WWW A;  1ZR4 A;  2BEZ F;  4U3F D;  1BDD A;  3CME P;  1MFZ A;  4N3Y B;  3BAS A;  1HVV A;  1GW3 A;  2KNC A;  4GT1 A;  3H1H E;  4FJV A;  4TLF A;  5AW1 B;  2IFN A;  1EQ7 A;  2JKV A;  1U57 A;  3L71 J;  2PAJ A;  1N7S A;  2ACZ D;  2H89 C;  2N9Y B;  1M1J C;  1VQN P;  3FX0 A;  1JY3 O;  1IFM A;  5APV A;  1AJY A;  4DZO A;  4C46 A;  1BE3 E;  4DJG A;  2ZYD A;  2WSS H;  2E75 C;  5KLV D;  4M3L A;  5C39 A;  1A02 J;  1BCC E;  3AE2 C;  1GL2 D;  2NRG A;  3Q5S A;  1PFI A;  1RE4 A;  3SFE C;  1J1E B;  1VQ7 P;  1SQB E;  2GA1 A;  1OFC X;  1FDO A;  1HUC A;  2Q3I A;  1KTM A;  4YXD D;  2FYU G;  3Q3D A;  3VTP C;  2WDQ C;  3H1I E;  3G3Z A;  1URQ D;  4DDG A;  1LWU B;  4TT3 H;  3CLQ A;  3H1J J;  1KIL B;  5AVV B;  3RGU A;  3D70 A;  4I6M C;  4ASW A;  2QM8 A;  3GG2 A;  5CBO A;  3B5N A;  1KYO E;  1YJN P;  3AE7 C;  4DDI A;  2PFX A;  3L72 G;  1WMK A;  2E5Y A;  1E79 H;  3AEE C;  3AE4 D;  4C7R A;  2R5D A;  3AE3 D;  2WSF H;  2ZYA A;  3JCU H;  4PD4 E;  2WT7 A;  1OWA A;  2ZXE B;  3D71 A;  3ABV D;  3S9O A;  5B5E H;  3NFQ A;  1ZP0 D;  3PHL A;  1FDI A;  1SQB K;  3O6Q A;  3RL0 C;  1QGK B;  2N1T A;  2YMY A;  2B89 A;  3S4R A;  3H6P A;  2JWA A;  4PV1 D;  1SQX G;  1T3J A;  3MGN A;  1SQV G;  1DEB A; 
#chains in the Genus database with same CATH homology
 1OW6 A;  4YTP D;  4U7J A;  3AEB D;  1ZOY C;  1IK7 A;  2WU5 C;  3H25 A;  3AEC D;  2E76 D;  1L0V C;  1DD4 A;  4H0L D;  2D2C D;  4OGQ D;  5KLI C;  3AED D;  3AE2 C;  4PV1 C;  3Q5P A;  3RK3 E;  1EXI A;  3VR9 D;  3Q1M A;  2E75 D;  4YXD C;  1E7P C;  2YIU C;  1R8E A;  1NEN C;  2BS4 C;  3AEA D;  3Q5S A;  1S1C X;  5C3J D;  2ZT9 D;  1VL2 A;  2OQQ A;  3SFE C;  5C2T D;  4YSZ C;  1Y9B A;  4YT0 D;  2WSE J;  1PV3 A;  2BEQ D;  2P10 A;  3AE9 C;  3P4R D;  3AEC C;  2E76 C;  3AE5 D;  2WU5 D;  1UIX A;  2QJP C;  1L0V D;  4I7Z B;  1GMJ A;  2WSF J;  3VR8 D;  2JP3 A;  1FDO A;  3GF7 A;  3VR9 C;  3AE2 D;  3AEA C;  1KTM A;  2E74 B;  1PIX A;  3GMA A;  1PL5 A;  1NEN D;  3AE1 D;  4YXD D;  3Q3D A;  3CIR D;  4R4M A;  2NZ2 A;  2QJK C;  1MKM A;  1KQF B;  4Z1M H;  4H44 D;  1QLB C;  2BS3 C;  1Q90 D;  2WDQ C;  4YT0 C;  3SFE D;  4YSZ D;  3P4R C;  2B76 D;  3AE5 C;  3AE9 D;  1OMI A;  4H13 C;  4KX6 C;  1YQ3 C;  3VR8 C;  4TT3 H;  3IN6 A;  3AE6 C;  3R4Y A;  2K9Y A;  1VF5 D;  4XFJ A;  1K04 A;  3AE1 C;  3CIR C;  1KF6 C;  3AE7 D;  3AE8 C;  4H44 C;  3AEF D;  2WDQ D;  3D70 A;  2B76 C;  2WU2 D;  2QSI A;  1DIP A;  1K05 A;  4H13 D;  1YQ4 D;  4PV1 B;  4KX6 D;  2WQY C;  4IL6 X;  1YQ3 D;  3AEE D;  3EWK A;  3AEG D;  4YTN C;  4YTM D;  3AE4 C;  5M1B A;  3AE6 D;  1VF5 C;  3SFD C;  2FXP A;  3T97 B;  1NYH A;  2FBW D;  3IAO A;  1RQV A;  2O01 J;  3AE7 C;  1KF6 D;  3AEF C;  3AE8 D;  2E76 B;  2WU2 C;  2H88 C;  4H0L B;  1KMI Z;  2D2C B;  4I7Z C;  1RQU A;  3RL0 g;  4OGQ B;  2WPV B;  1WMK A;  1YQ4 C;  1TU3 F;  1NEK C;  3AEE C;  3AEG C;  4YTM C;  2QIW A;  2E75 B;  2WQY D;  2BS2 C;  5L8R J;  4YTN D;  1ZRT E;  4GDO A;  1KFY C;  3AE4 D;  3P4S D;  5KKZ C;  2ZT9 B;  4YSY D;  2FBW C;  2BEZ F;  2WDR D;  3SFD D;  3AE3 D;  4R4L A;  4YSX C;  3G9R A;  1ZP0 C;  4Y28 J;  1ZME C;  3D6Z A;  2H88 D;  3Q2Y A;  3GF3 A;  1NEK D;  3VRB D;  2WP9 D;  2QJY C;  2G8Y A;  1EXJ A;  1OW7 A;  2WSC J;  2H89 D;  1JB0 J;  2E74 D;  2G3A A;  1KFY D;  2WDR C;  3P4S C;  4YSY C;  2WS3 C;  4H44 B;  3D71 A;  3Q5R A;  1HJ0 A;  3ABV D;  2J5U A;  3AE3 C;  3D6Y A;  1HF9 A;  3S9O A;  4YSX D;  1U57 A;  1ZP0 D;  1KIL E;  2WDV D;  2MKV A;  3GLM A;  3P4Q C;  2ACZ D;  2FYN C;  3P4P C;  1FDI A;  3LW5 J;  1VF5 B;  2WP9 C;  3VRB C;  3VRA C;  2H89 C;  2E74 C;  3O6Q A;  2V7Q J;  1NGM B;  4YTP C;  3AEB C;  2JO1 A;  2WS3 D;  3ABV C;  1ZOY D;  3C8V A;  1DD3 A;  1KQG B;  4H0L C;  2D2C C;  1KOR A;  3FGA D;  4KT0 J;  4RKU J;  1AJY A;  4OGQ C;  3AED C;  4H13 B;  2WDV C;  1OW8 A;  4PV1 D;  2E75 C;  2ACZ C;  3P4Q D;  3P4P D;  2YMK A;  2ZT9 C;  5C3J C;  5C2T C;  3VRA D;  2IDB A;  1S5L X;  3B71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...