1ZP3A

E. coli methylenetetrahydrofolate reductase (oxidized)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
284
Chain Sequence
FHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 284
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zp3A00
2FMNA 3APTA 1ZPTA 3FSUA 1ZP3A 4JNZA 3E2RA 3APYA 3FSTA 1TJ0A 2FZNA 3IJDA 1TIWA 1TJ1A 1V93A 3E2SA 3ITGA 1ZP4A 2FMOA 1TJ2A 3E2QA 4O8AA 1ZRQA 4JNYA 1B5TA 2FZMA
chains in the Genus database with same CATH superfamily
1ZBWA 1FRBA 1GPFA 2CLPA 4J28A 1U83A 4XX6A 2Z1KA 2PDGA 4YN5A 3WEMA 4C1NB 3APYA 4XKMA 3N14A 2OELA 5K7JA 2C16A 3H53A 9XIAA 1GW9A 3TQVA 3LNPA 4JFTA 2DQXA 4C6QA 4LANA 2DUXA 3CC1A 1KM0A 2PP0A 3ZWTA 5LGZA 3S1VA 4AZ7A 4O18A 4JKMA 3UG3A 3WNPA 3UZJA 1R86A 2WMIB 4DXKA 1V93A 3L12A 1KTBA 5KZMA 4L64A 4C6DA 3TU9A 5T8GA 1RJPA 5CJNA 4E0CA 1WKFA 5JVLA 4NXKA 4W8BA 3WBEA 1PE1A 4UB9A 3PK7A 2OT1A 4M6QA 3BXWA 1HJUA 1JRCA 2QKFA 4CNPA 4UCFA 1CDGA 1LT8A 5E6ZA 5EMKA 1LCOA 3KZSA 2CLIA 3W6MA 6A3HA 2WCAA 4AY7A 1VHNA 4YS1A 5M17A 1U5HA 4B5WA 3MPGA 4JTFA 2NVCA 1V6VA 2UY2A 2L5HA 2NVDA 4IQEA 1RSCA 3KBSA 1IXQA 2CU0A 3UG4A 3KRSA 2XN1A 1UZ4A 1RLDA 3Q45A 3LPFA 4PGLA 3RPMA 3WH7A 5E0KA 2DT0A 4C1NA 3IUIA 1UKQA 3RX4A 2RDTA 5AB3A 1V6WA 2INEA 3V3WA 1FWWA 9RUBA 4ZQRA 4GIRA 4XZWA 2H3DA 3O3RA 4CKQA 1Q6LA 3CH0A 1GG0A 5DX7A 5AC5A 3U5UA 3L0KA 3AIVA 3PPHA 2HISA 4L9XA 4M1RA 4YWSA 4CQBA 1DJGA 1K7XA 1ZFJA 2FQIA 2VCBA 4KRZA 2JE8A 3VIFA 2PLCA 2EPLX 1LL4A 3GDLA 1MZHA 4A3UA 1B57A 1B3VA 1V3MA 2VM8A 3WH6A 4MPQA 4L9ZA 1UASA 1ZS2A 1B3OA 3UZ5A 1C29A 4Q7NA 3W7RA 3TN3A 1G94A 3M1ZA 1EQPA 3S5NA 3BAXA 1JAKA 3STFA 4GACA 3ZJ6A 4LY4A 3QHOA 5IDIA 1TELA 4UCGA 1BVZA 3P5YA 4GPNA 4KW2A 2YZ5A 3WQ6A 1O68A 4GCXA 4BQ2A 4LY8A 3RILA 3VMNA 4GINA 5HR6A 5LA0A 1LLOA 4S3FA 3EWWA 3LY0A 2IPGA 1LTDA 5KINA 3SUWA 2PDJA 4CCDA 1TSIA 3AUOA 2WHLA 1RV8A 4Q4SA 2BVWA 4ML4A 1W5NA 1GONA 1QU4A 3OB8A 2ZUTA 4CQCA 2OSWA 3LHZA 1A5LC 1SFTA 1T8QA 2DGAA 3RG6A 3ARWA 3G3MA 3BVJA 3BURA 1AW1A 3GTNA 3MHGA 3W25A 3UVIA 3HPFA 1M65A 4MJ2A 1R85A 1XRVA 1TV8A 2WCSA 3NM1A 4O19A 4RZ6A 1BEUA 1YDYA 3C56A 5CLWA 1T96A 2PDFA 2ACSA 2NQLA 4GA8A 1ZCOA 4K37A 4LNCA 3OLIA 1UR2A 3UA3A 4K38A 5BU6A 3SAZA 5I78A 4HCHA 4UR9A 3T2QA 4J35A 3K46A 1S2UA 3RLHA 3STCA 3EAUA 4ZE4A 4MLJA 4GQQA 2JF7A 1Q8AA 2Y24A 3OLEA 4JTRA 3F2DA 2EPNA 4AEEA 4URIA 3WJWA 3GBDA 4E4PA 4OV4A 3T4WA 2C0AA 1NOFA 1KLYA 3KDNA 2XH7A 3CZKA 1PIIA 3N12A 1Z44A 4JN6A 4XKYA 4YNGA 4QSHA 2HE8A 4DWSC 1FCQA 4GD0A 5C9ZA 2X0YA 1P4CA 1E4IA 1PKMA 3S9YA 3EDEA 3NQBA 4IGNA 1LUCA 3CIWA 4X2RA 2ZRWA 4JTCA 2GOKA 4A3QA 1QHOA 4F0KA 1X98A 4LUJA 3LPPA 1LQAA 3UU0A 1UWUA 3CT7A 3GIPA 4QQUA 3URAA 3W53A 4BI7A 2OJPA 1FCBA 3N2XA 4YTUA 2PDXA 4ERAA 2R8WA 4EVZA 1IEQA 1TUXA 1A3HA 4LBRA 1E71M 2YLLA 1ZSXA 4AZGA 3SN0A 2C18A 2PDLA 2WZIA 3H7UA 3JZEA 4JPGA 4Y9OA 1DEDA 4G6CA 3VZZA 2VX6A 4KT2A 3DZ1A 3LB0A 3W22A 1WXZA 1XX1A 3M9YA 1F6PA 2PZNA 3AFBA 4NZCA 1JYWA 4RZ4A 5HPOA 1BAGA 5LIKX 2BWGA 3WLRA 1YXCA 1HL8A 1PB0A 2D24A 3FXGA 3QZEA 3OIHA 4UTFA 4DAIA 3GW0A 1BLIA 2VFGA 2CLMA 3GSMA 3J7HA 3UZZA 4D6JA 5JBEA 5A69A 3DN5A 4HPJA 4V1YA 4UTJA 2DZBA 1AZ2A 4GZIA 3BG3A 1YDVA 2VL4A 1J18A 3CL8A 1GQLA 4IOTA 3ARTA 1FFQA 3D5HA 4GYPA 1HT6A 3CL6A 1UH3A 2DZPA 3OP2A 1O60A 3W0KA 1JL8A 3SGUA 1GGOA 3GZAA 4D72A 3NO3A 1TJPA 3LLFA 3CIXA 2F38A 3GAYA 5I2UA 3U7VA 3C2FA 1B1YA 2GQ3A 2P0OA 1GVRA 4B5NA 2P88A 4MFEA 1EO5A 1WCGA 3NIYA 2A3EA 4ICMA 1LP6A 3G1AA 3VNLA 1QRQA 2ZQ0A 1MUMA 1SZRA 1DV7A 2QR6A 3FLUA 2QMKA 2CZDA 1VIZA 1JUKA 1JZ4A 4OWGA 1LLWA 2DT2A 4GUGA 1M9HA 1TREA 4HSNA 2YXXA 2OLHA 4M1BA 4HZMA 5C7VA 4J2MA 4BQ3A 3P8IA 3IJLA 4HPHA 4KKXA 1BKSA 1QI3A 2IXUA 3VFCA 3VZXA 1W9XA 1PSCA 4RPQA 3WNKA 4OV9A 4L1WA 2GQ8A 5B80A 3LI0A 3TTOA 1C8XA 1W17A 1KR1A 3SY5A 3DFSA 4GQGA 3BGAA 3A9BA 1O5XA 3C2VA 4K8HA 3A24A 3T2OA 3LGEA 1XIGA 3GXTA 3LCFA 4UTWA 3GG7A 4I8DA 1CTNA 4FF5A 1XG4A 1W5PA 4ATLA 1XXXA 4AY8A 1Z6KA 1EHNA 3D3AA 1M7PA 4JAWA 1SFSA 4JHZA 3SCRA 4J3SA 1HXJA 3PBMA 1K77A 1FKWA 1UH2A 1W32A 2WQPA 1LJYA 3IGUA 2H9AB 5HUPA 3U4FA 1DIOA 2C1IA 4X3ZA 2OKTA 3LU2A 1ZP3A 3P0XA 2NWRA 3FEMA 1TV2A 3GAKA 2QUUA 6TAAA 3A6OA 4BI6A 1GK8A 3PB2A 4AMCA 3WMBA 3I7SA 4DX3A 2A3CA 1AJZA 4KH2A 4A3YA 4ROQA 5A94A 3U2OA 1DXEA 1PEZA 4QLJA 3CHFA 3M5ZA 1EJWC 4OJYA 3M0MA 4ACYA 1IYXA 1M6JA 4JTHA 1R3WA 4GG9A 4F0RA 1FY6A 1OM0A 3ZJ7A 1QJWA 4Q32A 3MT1A 4TVCA 2J66A 5C2XA 4GYJA 4G5DA 4XAZA 4AD0A 1P5BA 2NQZA 1YKWA 3OVQA 4K36A 2X16A 3WMSA 3QGVA 3NQAA 3PS7A 1JPHA 1UCWA 3LHTA 3CU2A 1T41A 1UC5A 2G3NA 1TZ7A 1C8YA 3H2OA 4AXNA 1NVMA 1JQXA 3M0IA 3MSRA 2A1YA 2H9AA 3VGDA 6CGTA 3DBPA 3GU9A 2GVYA 4FR1A 2E3ZA 1AA1B 3AIUA 3QBUA 1OQFA 4GWEA 5KZDA 3ALGA 3TK7A 3E3HA 1H09A 4H6RA 3R5EA 3AMKA 5LZLA 4YVPA 4D8LA 2FDMA 4HN4A 4B5TA 3C2EA 1AD1A 3AAMA 2J9XA 4GKTA 3KBJA 3NSNA 2A79A 2BG5A 1LBFA 2O4MA 2D3NA 1FWNA 4AZHA 4UR8A 1B90A 2C79A 4FOKA 1EEXA 3W7MA 3WX7A 3MKCA 1ZJAA 2YIHA 3R13A 1BVWA 1H49A 2O4QA 2VHLA 3IIOA 3IAQA 3KW3A 5CG7A 1ZRQA 2X1UA 3IVSA 2PODA 4OQVA 4MWAD 4INFA 4GBDA 4IUGA 1LWHA 1UZDA 5HXMA 4DJEC 4QHRA 2D2HA 4XVDA 1MXGA 5CBBA 5B7ZA 3SADA 2O92A 3WLLA 7CGTA 3UPBA 1WDSA 6XIMA 2X05A 1MXDA 2A3LA 4QDWA 8CGTA 4QEHA 3UWZA 7ODCA 4OUIA 1VFLA 4NASA 4AYGA 1PWMA 1D3GA 3M0HA 4HMDA 4DBEA 4Y6GA 2VNCA 3OBAA 1C7SA 3ZOAA 4W86A 3TSMA 1XW8A 8XIAA 1NU5A 4ML9A 2I56A 2PDQA 3R10A 1FX6A 1JNDA 1FWGC 4D8ZA 3EXRA 3MI6A 1DJXA 1A4MA 2BHYA 3A3HA 5A1AA 3EX3A 3THAA 1UD3A 2BBFA 3WNLA 1KM6A 3OGRA 4H9TA 4HBKA 2VC6A 1THFD 1GVOA 4UQ9A 3NA8A 2VFDA 1B3WA 3HJZA 1UKSA 4JTTA 1WP6A 2XIJA 3P84A 3AXIA 3QZAA 4HIBA 3NYDA 1ZB5A 1R3SA 1EXBA 4UMAA 3ERPA 1XQLA 3HGSA 1XIBA 3M7WA 3L4UA 4BEUA 5CEWA 1UR9A 3MI3A 3E2QA 1SSGA 4HHHA 4BEQA 1J2WA 3RCYA 2ODOA 4X0NA 5A6BD 3GKAA 4C5ZA 1KBBA 3EX1A 2OQLA 5KZEA 3PZNA 3B9AA 1LQ2A 1JUEA 3FV9A 5FL1A 2HNHA 4B2DD 3WF0A 3N6QA 1XLLA 3SECA 4D71A 2X2GA 4KESA 5FSEC 3P80A 3UR2A 1G01A 3F03K 3TOYA 4MNKA 5EBAA 3KBVA 1JDAA 3WQFA 5FESA 4Y9MA 4OGZA 1HL2A 2ATSA 2ZCGA 1FTXA 1H60A 1OFRA 1VHCA 3LS9A 3VUSA 2ACRA 4YTTA 4Q4KA 4HA3A 2VX7A 1TIMA 4MZ8A 2WK2A 2J75A 8A3HA 3HOJA 2CBUA 2QULA 4F0LA 4JICA 1YXYA 1HP5A 4I7VA 1JCXA 4DPQA 2V2DA 1Q6GA 1Q6QA 4IGMA 4M19A 2Y7EA 1VS1A 1R2TA 3PWIA 2G8ZA 1CXEA 5FF7A 1NDYA 3DUGA 5BWFA 3IJDA 3RX2A 3WJYA 1L2UA 5AOUA 4PMDA 2ASHA 3T05A 3GLCA 4R27A 5TD4A 1X1ZA 2QV4A 4J4KA 2GSJA 4R33A 1I2RA 1UWSA 3W2LA 2GL5A 2J74A 4QE5A 3MMUA 3DYMA 2QGYA 1UH4A 3LM7A 3W1UA 2EPMX 4Q22A 3MY9A 1RJQA 3AXXA 5H1WA 2SFPA 5DCBA 4Y7EA 2PWGA 5GJNA 1XC4A 3KP0A 2I5QA 4IXXA 4WCJA 1LG1A 1JZ6A 2A0NA 2IUZA 5GNZA 5DANA 5HQLA 1XLCA 1UD2A 1VRXA 4M7SA 4EXAA 4DZ5A 2BY1A 4NQ1A 3O06A 2BGNE 4LXFA 3V5CA 2XYLA 2NW0A 3WDRA 4BZYA 3D3FA 2FFCA 1KRCC 4GABA 3NGJA 2GDVA 1AZ1A 2IQTA 1XGEA 2TPSA 1EDTA 3U4AA 2ADAA 1V4YA 3FAWA 3T44A 3CNYA 1ZNNA 4NRSA 2E40A 3KRZA 4U3AA 4NJGA 4UTLA 2NQ5A 2FVMA 4LF1A 4WVXA 4A22A 4GH3A 3G24A 4F66A 3ZR5A 3OIXA 1W9DM 4WRHA 3BLKA 4DXXA 3EWZA 4HN8A 4PRWA 2YBVA 3OLDA 2VXNA 2IKGA 3N2BA 2WSYA 4K2SA 2OO6A 4W84A 1O95A 2NXIA 1SO4A 4GVGA 1SPQA 3GFZA 2UBPC 1FWBC 2ZRUA 4PTDA 3JVAA 4ASTA 3D47A 3O16A 4PMYA 1L8PA 3MQTA 3MV01 2POZA 1OCJA 2RFGA 3WLIA 4K7VA 4X22A 3T7VA 1KCLA 4PB4A 3LZ3A 1J11A 4HMCA 5HR7A 1DE6A 2DZSA 3LM3A 1FWDC 2V5LA 1WV2A 5EU9A 3BLIA 4L9YA 3NURA 1K7FA 1QHPA 4GNKB 4ZFMA 4PC8A 3LD5A 1TVNA 3H6OA 2J9YA 1OYAA 3DENA 4QS6A 1OK4A 1PX3A 1A5UA 4CVWA 4GIEA 4U28A 2FHCA 3KCJA 5D2XA 4H8HA 9CGTA 1P0KA 4UBPC 1TFVA 4FIRA 2DV0A 4Y8FA 1E72M 5A8OA 3LBMA 2A7RA 3R0UA 1O6IA 2JGYA 3VKDA 4M82A 2EJ1A 3R79A 5FF3A 3FVMA 4U2ZA 3M43A 4ZGYA 4CD5A 1EZWA 2FB3A 3F4NA 2ZX9A 4PN2A 4HPXA 3AMDA 4H9YA 1GWJA 2ZOXA 4AWEA 4RDWA 5G5IA 2WNQA 1ISWA 2ZTKA 3L4YA 2PDUA 3MUAA 4Z2KA 3E38A 1E1CA 3WNOA 4AY1A 3NQGA 3GVGA 2ISDA 2G5WA 4BI5A 3B0YA 3QVQA 5M5DA 3PZ9A 3GNXA 1J6PA 1V3IA 3TEVA 4IMGA 4PTMA 4DELA 1PAMA 3EOUA 1HJWA 1T8XA 4KIEA 2QJGA 2PWVA 1DTNA 4A3RA 2GJXB 2OR2A 3FS2A 5HMEA 1WA3A 5EL1A 4MYAA 5A3HA 3M0ZA 3M44A 1QOQA 5DBUA 3PTDA 1T7LA 1HL9A 4WIWA 4DM2A 2E09A 4XD5A 3SIZA 2VEIA 4FIQA 2WWDA 2ZDSA 3A4AA 1W37A 2QCFA 1MFVA 4C6NA 1UWIA 4MZYA 1A53A 1I6NA 4Y9PA 3TMLA 3QHNA 1XDJA 2VD9A 3CGTA 4HNCA 1MFUA 1KM3A 4KRTA 4UTKA 1FH9A 3N4EA 2A3AA 3UPMA 4TMCA 1D8CA 1F3WA 1UR1A 1UROA 2GK1B 3I6TA 4HYRA 5GNYA 5FCZA 1NH6A 4CNUA 4MB5A 3WDJA 1ZAJA 4E2DA 2BTMA 2OWXA 4R7WA 2QDDA 1OIMA 1W3NA 4MSSA 3PNZA 4L6HA 3T2PA 2DIKA 2PTWA 2VZTA 1G0CA 2B7OA 4RX0A 1JXKA 1GVSA 4A8LA 1FP9A 2FTWA 4JFVA 4AEOA 3UXIA 2I5IA 2AQOA 1WKYA 4LAOA 3CBWA 5CSYA 1X97A 1VIWA 1FUYA 2GJXA 4YTRA 2DW6A 4I90A 2B0MA 3QPYA 4ZB2A 4L61A 3N9KA 3P93A 1SZFA 1XLKA 3VTRA 5LNUA 2Y61A 1TWWA 1TPUA 4B9YA 5AC6A 1PTGA 5M2FX 2ABBA 2Q09A 3PY2A 1A5AA 1XS2A 1H5VA 3N18A 3W2KA 2B7NA 2W62A 1N8WA 5D8WA 4JCMA 3DU0A 1G69A 3O9NA 2ZX8A 3OG2A 3W7LA 3YPIA 1K8ZA 4O10A 1X38A 2VYOA 2CHRA 3QGAC 4S38A 4E8GA 3LMYA 4NX0A 2HROA 4XQ6A 3BLOA 3ANUA 2E9MA 4Q4RA 3UVAA 1UPPA 2OVLA 2Z7GA 3WQCA 3M0VA 3DECA 3KTXA 4LC8A 1N2VA 2XFWA 4RE3A 2ICSA 5I06A 3BE7A 4N02A 3W73A 4LAKA 4H3DA 1V3HA 3R8HA 3TYZA 4H8NA 1XGZA 1UA3A 3VNJA 3WDIA 1W5QA 2H3BA 3N9RA 5MHBA 2ZC1A 3LHWA 1CGWA 3T8QA 2WMHA 4Q6XA 1ZL1A 1UZHA 5A6TC 3NQ7A 3AYVA 2Q71A 3HQPA 3PB0A 1F07A 3BMXA 2D0HA 1KFJA 1R0MA 4CCEA 1N82A 3QFWA 3S2JA 5E6YA 2XH4A 1CI1A 3LENA 3WQEA 5HWJA 4FX7A 1HO4A 1HGWA 3WDHA 4DF0A 3ZFHA 1UKPA 1CBGA 1DE5A 1PJ9A 2QIIA 3UGRA 4N9DA 2JALA 2CEQA 4MG4A 3TNBA 2C3ZA 1U1UA 3AMCA 1WDRA 3KE0A 1V0NA 1PHWA 1Z69A 3W6YA 3FJ6A 4CN1A 5I23A 4BS0A 3S1XA 1KBIA 2YDQA 1NWUA 5AVHA 1XD1A 3A9IA 3O0KA 5FKYA 5BCAA 3FGCB 1PWLA 3CEUA 1XLAA 5D03A 5XIMA 1MQRA 1F05A 1XUZA 2I1OA 3TNOA 2D1ZA 4GFSA 1DQUA 3WENA 4MADA 4XAYA 5DCDA 2YR1A 1H7XA 4KIRA 2H6RA 3QKZA 4AVOA 2VCCA 4HTYA 5C71A 3UCDA 2ZYFA 4Z2IA 6TIMA 3UWVA 3AZSA 1WZKA 2BX7A 1POKA 1SR9A 1VYPX 2PUZA 4S1FA 3LXBA 4J3UA 3HV8A 1UWTA 1J0KA 2HDJA 3W7DA 3SM0A 3WDPP 1W3IA 5FL0A 4NI3A 2QT3A 3MI2A 1IT8A 4BF9A 1LG2A 1GVFA 2C8NA 2ZTJA 1QPQA 1AMYA 3TC7A 1ZJIA 4C7DA 3BV7A 3CHVA 1FWJC 4BWLC 3PAJA 1Q45A 3UQNA 2P5NA 3H4WA 2Y89A 3OA3A 3DDMA 4H6EA 3R25A 1RD6A 2I57A 2WBGA 4JIEA 3KVKA 1IF2A 3DGRA 1NEYA 2H8ZA 3VE7A 2YCJA 3W07A 2P10A 2VX5A 4NAFA 4JZ5A 4L56A 4ZB0A 3FGCA 1F6YA 3GX9A 3TTYA 4LYPA 4ZQNA 2YBUA 3NL6A 3HV9A 1I8JA 2PCEA 4DNHA 1S5NA 1GOMA 3BLEA 1KXVA 4HCLA 5F2LA 4J1OA 4XBKA 4M8UA 4K39A 3UR5A 3CB8A 3QQ1A 1OJXA 5AVNA 1UR0A 2Y7DA 5A6JA 2CXGA 3C3NA 2YCKX 1IEIA 4BHYA 3W24A 4REQB 4UTTA 3K8MA 4WQ6A 4ZR8A 5G1MA 3W4RA 2XN0A 1OSEA 1S1PA 3IWPA 2GQ9A 3B3DA 4W8LA 4QM1A 3GIYA 3QGKC 1EJXC 4KWUA 3WLNA 4A2RA 1W1A1 3T40A 3F4DA 4AH7A 1DJYA 4TMBA 5F4SA 3WK3A 1XIJA 3A64A 5DXXA 2QDGA 4B5UA 3L9CA 3O2LA 1O1HA 1DJWA 5CXPA 3PBYA 1TTPA 3SSZA 1ZGDA 4PUKA 3QHMA 1T40A 2E0PA 4O50A 1UR3M 1PX4A 3VKAA 4NT0A 3DG6A 4B91A 3W7OA 2ISWA 2XVPA 1KGXA 2VGGA 1KB3A 3THDA 1YPIA 1HFBA 1EC8A 4YLWA 1EH9A 3L7RA 4OBRA 4UMCA 2OQHA 4J3TA 4OOZA 4AC7C 3HPSA 2VR2A 4U31A 2UY3A 3DKJA 1ONXA 3TYDA 3ZXWA 4C90A 3W7JA 3MTWA 3TC3A 5F7UA 3GNRA 4PB5A 1UKOA 2NWSA 2V3DA 2OGYA 5A8PA 1I45A 3FIGA 1W3LA 4S3JA 3S9ZA 1NAL1 3QY6A 1EX1A 4GLEA 3NFUA 1QI5A 1KFWA 2C14A 4AX6A 2ZZ2A 4PB3A 3S47A 2EO7A 4JTDA 3GVVA 3T78A 4IH3A 2PMQA 2G4FA 3RPDA 3UERA 4GZJA 4MY9A 3B4UA 5GJPA 2YDAA 4DYKA 1VFFA 4C6MA 3WLSA 1SJAA 3OA5A 1RBAA 4B3KA 4F48A 1W5OA 1YLVA 1IZJA 2JKPA 3HMJG 2ZFAA 3MSYA 1TQXA 3KTCA 4LCQA 4FOUA 3BL3A 4MMWA 2NLIA 2WJFA 5I3HA 1CW2A 2XFYA 1BWLA 5D37A 1SO6A 4BK9A 1XCXA 1E1FA 5C8BB 2ZZ3A 2XIQA 1ZENA 4YL2A 3RMEA 1PKNA 1DWIM 2Y63A 1BXBA 2R14A 4BR1A 2EPKX 3SCTA 4NU7A 3BAJA 1PZ1A 1IT7A 2GJPA 2YPIA 3QY8A 1S5TA 3ISIX 3BLFA 4LUIA 4PCNA 3K1GA 1XG3A 3V1HA 2WKLA 1PUDA 3QRHA 3N6HA 2OSXA 1T0OA 5CPQA 4D6HA 1YPXA 1FH8A 1R3TA 3GDTA 3WF2A 5BU9A 2CZVA 5CZ0A 4HTBA 3AI0A 3WEOA 2UWFA 3LV6A 2B81A 2CFFA 1GHRA 3EOOA 1QTWA 4MKVA 3MW7A 1J0ZA 4DI9A 4GI4A 3TUUA 1CB2A 1GVYA 4M3PA 3K2GA 4F79A 3QOMA 2PC4A 4N2YA 5A6LA 3NQVA 3T4CA 3WLJA 3G77A 1PTDA 3VNDA 3WYZA 3WF1A 5BXRA 3PSWA 1JYXA 1RQBA 1GNXA 2QCGA 3LBOA 1S2AA 1PV8A 4KWWA 5LHFA 5D2VA 1YMYA 3WD3A 5CC6A 4F0SA 1WBJA 3N17A 1DQWA 1TVPA 1NQ6A 2YJQA 3NQ6A 4KRUA 1B0IA 1RH9A 4N7QA 1EO7A 2GVGA 3WD1A 4IHCA 3TJ4A 5AZ0A 3ZJKA 4GQRA 3FJ4A 3LTPA 2QVNA 3HZ3A 3AIWA 3I68A 3LXAA 3N73A 5EMLA 2V30A 2DVXA 1KW1A 1VPXA 1MVYA 1E0WA 3UWWA 2CZFA 2ISVA 4MY1A 4RXGA 2ZZ6A 4IQJA 3CQHA 4WZHA 4IJBA 4IT1A 1AODA 4PSRA 4XZIA 2NSOA 1A0DA 4GOAA 3K1DA 1CNVA 1GOQA 3BJSA 1RR2A 1M1BA 4QE1A 1Y7VA 2BS9A 2WJZA 2XGIA 3FHQA 4DWDA 3NGFA 3TMQA 2E6AA 4WGHA 4YVVA 3KP1A 4FPSA 3G0SA 3ZS4A 4Z1BA 2C91A 4HNTA 2OEKA 2Z1XA 1RAKA 2AQWA 5HNTA 3CIVA 2KZHA 1WUEA 4IMCA 1GTHA 1XYFA 4H9MA 1F8MA 1KQYA 3S1WA 4R88A 1EJVC 1TVLA 3NVTA 4H7ZA 4OBSA 2GGHA 5CSUA 4R9OA 1HJVA 4C1KA 1SM9A 1TTQA 3DFQA 4PH6A 2V3GA 1UW9A 2PGWA 3FYPA 2NQJA 1XRTA 1J10A 3GHSA 4MJMA 3R43A 3IV3A 3QOKA 4C60A 1LQ0A 4H8VA 4UQCA 3EDFA 4W9TA 5KMYA 4AB4A 3LCHA 2WZTA 4I7UA 1YDOA 4YYFA 5AECA 5K4XA 2WC4A 4GRSA 4LT9A 2EG8A 3AYRA 3JU2A 1C90A 5GQBA 2WLZA 4OECA 1D7KA 2BVDA 5D05A 5LIXX 4XTDA 3B04A 2Y8KA 2G3JA 2I9EA 3WLHA 1RQHA 3VILA 3T8LA 3HTWA 1G9HA 3HQNA 4DWSD 4PFHA 3ATYA 3W00A 1KD0A 3D6NA 4B3ZA 2CLFA 1M5WA 5CPTA 3NQMA 3BMWA 1EEPA 1EIBA 2J8GA 2QCHA 3APTA 3SURA 4AIBA 1LORA 1G4EA 1W54A 3A5VA 3C3UA 2QF7A 1RY0A 1DP0A 1V6XA 2J6VA 4HGXA 3IIPA 1JR1A 3UZXA 1IT0A 3IJ7A 1BKHA 1K02A 4NZ1A 3Q94A 4LVAA 1BRLB 1NOWA 4WX2A 4YTQA 4PMNA 5D2WA 1EJRC 2V0TA 3ENLA 2EGZA 1XLBA 4MGGA 3EKGA 4J9JA 2VEPA 3KOXA 2HTMA 3RM4A 2DU2A 4E2VA 3V0SA 2V5KA 3FOKA 2VEMA 3LYEA 5DY2A 2FZBA 3O07A 1OYCA 4AZ5A 1FHVA 3BOFA 3ITTA 3O63A 3CO8A 2XFRA 1ITCA 4O0QA 1R3RA 4Z1DA 3ITLA 4FZIA 4PE8A 1FP8A 3GXFA 1TPDA 2QPXA 3IV8A 3W2UA 2OTDA 1AQHA 3RN6A 1JYVA 1NFGA 4JTJA 4NX5A 1JCLA 3GVQA 3AWOA 4W93A 1W1ZA 3GDRA 4M6UA 3RIKA 3ZLHA 1OG0A 1F2JA 2CZEA 1ME9A 3MSDA 3EX2A 2DFAA 3TIMA 3C0LA 5DLCA 2VI0A 2VD8A 2DZAA 5CPLA 3KOFA 1RZMA 3VU2A 5CG0A 5I0DA 1NM9A 2ESCA 2RGMA 1VKFA 1JULA 4EWND 2DJLA 4MWAB 1XD0A 4KQNA 3N19B 4PMOA 3FCPA 3WD2A 3SW6A 2PGEA 1GQJA 2F2KA 2PDWA 1QO5A 3MCOA 3E0FA 1WE5A 5C2GA 2VFHA 3AXMA 3G1SA 4EXBA 1F7BA 1R5YA 1GJWA 2Y7GA 3GG8A 4K7YA 3NSXA 1GORA 3N13A 3AWNA 4PBEA 3LPGA 3AISA 1J9YA 2PB1A 1YEYA 2PU1A 1IQ8A 3E5PA 4DBSA 1TKKA 4KS0A 2J8FA 2G3MA 3GYEA 3WMCA 1JD7A 1I2OA 3N4AA 2VZOA 4LYQA 3FEQA 4MYXA 2GJNA 2OX4A 2R6OA 1VD6A 3CLMA 3KL0A 1HJQA 3N4FA 3EDDA 4LBSA 3G5EA 3V7PA 1A0EA 1FDZA 2INFA 1SR0A 2J4GA 4DO6A 3HN3A 1HO1A 4JR5A 3MDUA 1J96A 3HA1A 3ID7A 4ALDA 3EX4A 4F9JA 4WK9A 4Q7IA 1EDGA 3E2SA 1VFSA 2WZHA 4PCTA 1SVDA 4L1GA 2R1KA 4S23A 2OYLA 5FJPA 3TVAA 1BYBA 3PZGA 4IMDA 5M03A 1W2VA 1KFCA 3IGXA 1AW5A 1KBJA 2PFHA 3FSUA 4RPPA 2F8QA 3UJRA 3CUFA 4K1WA 2OZ8A 3SUUA 2QJJA 5U4NA 1CYGA 4WKAA 5A5WA 4Q8OA 3ORWA 3S0CA 1JZ7A 2PF8A 2PD9A 2VOTA 3NZRA 5L9FA 2VEKA 4U10A 4UOQA 2UZ9A 3W1AA 1DHPA 4IF2A 4AD1A 2CW6A 4DYEA 3TJIA 2X41A 3TP4A 5J5RA 4Z0SA 6ALDA 2W63A 4PRTA 3ONCA 1GOKA 1WKDA 3TN5A 4XSMA 3INPA 3TROA 2WMJA 4QJ1A 3VD4A 2WNWA 3L4TA 4PTWA 3VCCA 3UR8A 3BMVA 4XZBA 3WN6A 3I65A 3QTPA 1H63A 4GC4A 5G2IA 4MB3A 3C0SA 3T0CA 5HPCA 4NJJA 1YXDA 4WJ8A 2QV5A 4EPBC 1K9DA 4HHLA 4A05A 1QNPA 2R9RA 2BVYA 4P7QA 3WK2A 2I16A 2POTA 5DBTA 1BXNA 3CAQA 1EFZA 3I7RA 4JQ3A 3BUVA 1M7OA 3I6RA 3GR4A 3MMWA 2Q3RA 2REQB 4XBSA 3P0WA 3UA4A 4F2UA 2E25A 3SR7A 2P8CA 3MVTA 1KM1A 3B06A 7PTDA 3ZWSA 3PZOA 2V67A 4IX0A 2Z7KA 3WK1A 3A13A 2I9UA 1NIUA 3BQ6A 1P1XA 3S6DA 3S5ZA 2ZZ4A 3NXFA 5A6BA 1R3YA 2CWXA 1G7UA 2ZZ7A 4Q8WA 2X1RA 3VNKA 4JTIA 4MM1A 4L4MA 3LHVA 2Y6ZA 2YYTA 1B2YA 2R94A 5C55A 4KCTA 3NL2A 1ECEA 1AQMA 4JHMA 3ZT6A 5EA9A 1KFKA 3JR2A 4RNJA 1J2BA 1L6YA 3ARVA 4AUBA 1TJ1A 2ZRXA 5JH1A 4X9SA 4B92A 5LA1A 4LYKA 4YMZA 2V2CA 4WEVX 3I4KA 4UNIA 3RDKA 4UQEA 3GFYA 4DIAA 4JS3A 3SO7A 5HQMA 3NVDA 4ZQCA 3USZA 2EPHA 5AHNA 3TW6A 4D6DA 1EPXA 2VFEA 1S1RA 2ZVIA 3C4UA 1JEZA 5CJMA 4EWJA 3DI0A 3AS3A 1UD6A 1XIIA 5DMYA 4WKHA 5JIPA 2J7FA 5LSMA 1PXGA 4KGJA 2P3ZA 4DJED 2EQDA 3EX6A 3C8NA 2REQA 2W0UA 4K1GA 2D2OA 4O1DA 4JDYA 1H62A 3PUDA 3O6YX 1S3TC 3EOEA 1JQVA 3Q65A 4ZTXA 4C7GA 3HQ1A 2V5BA 2IKJA 1TZ9A 2WVTA 3WH8A 1QUMA 4RZBA 4MNMA 1GEHA 4GIAA 1KXTA 2XHYA 4DN1A 4FSAA 1KBKA 2FIQA 1VLWA 4O1CA 3PNUA 4FI4A 5AYBA 1W8GA 4KCVA 3A22A 4N4PA 3A3XA 5C9UA 2OX1A 2VGIA 1QVBA 3BCJA 3TTQA 2WNNA 3W2NA 5IFPA 1CXLA 1VLIA 2XM1A 1US0A 1HP4A 1MW1A 2WO5A 3W2MA 1S2WA 2OFJA 1P0BA 1YADA 2ZUUA 5J8LA 1FWSA 3GNPA 1KXQA 4H7VA 1TPB1 2Y4SA 4N9CA 4FAMA 2BNJA 1SMDA 3VX0A 1TA3B 1DL3A 1REQB 3V18A 3N25A 1ML1A 4NI8A 3LTSA 2WMFA 1U1HA 4Q8UA 3WIJA 4QCEA 1ZZMA 4D8AA 1SFLA 4EPKA 3P61A 4H9VA 1P6WA 4NYUA 3ZR6A 2VURA 5G4HC 3F5JA 4N42A 1QI4A 4KCWA 2FZNA 1X96A 2YDRA 1SJCA 5I02A 3N2MA 3VGGA 4AYSA 4HK6A 4IMEA 5HWNA 4BQ5A 3NQCA 3W7NA 4Q6JA 3ZVHB 1E0UA 2ONEA 3BW3A 1NY1A 5ABHA 1GKPA 1QPOA 1LL6A 3SN1A 1K7EA 4Q8PA 3H7VA 3QN3A 2Y5EA 4ZB5A 5EFDA 3WLMA 5GNXA 4C6JA 4FNQA 1Q4WA 1QBAA 2B7QA 3QC3A 4YHEA 4O1AA 3L2IA 4O14A 3IJ8A 1MMFA 1OX5A 4U3CA 1KRAC 2Y88A 1IEVA 3UY7A 1XYMA 2KX9A 2R1NA 3OEXA 1XIFA 4E2OA 3S8HA 4V2XA 3W3OA 3IGSA 5A8NA 4IG2B 5BROA 4TIMA 2ZX6A 1Q6CA 4AWTA 5G4EA 4RR4A 4WLCA 4I5UA 3SQMA 5FF0A 3W7HA 3AOFA 4UFJA 3VOHA 5E0FA 3O6DA 2NVAA 4R5EA 4E2BA 1VC4A 3LHYA 4Y90A 3K30A 4L4LA 3EPMA 1TA3A 1OF8A 5EMMA 4PCFA 3W1RA 2X30A 1XSKA 1WUFA 1REQA 2BHZA 3G1VA 2CCRA 3G6LA 4NJKA 2Y7FA 1LBLA 2PD5A 2Z2AA 3CV6A 2OYKA 1UWRA 1CGYA 3H12A 1JD9A 3LQLA 3SFKA 3AIBA 2RGLA 4CU7A 1XC6A 2YXGA 3AIQA 1I0BA 3FX4A 1H7NA 3RJXA 5ABFB 3DHUA 4NZ4A 3VDAA 4NIRA 1PKYA 1U2YA 1JF6A 3E96A 2QXWA 4S2BA 3COTA 4LV9A 2BASA 3LGDA 5JUVA 1E73M 2GZXA 1ITXA 3R11A 3FKKA 5D32A 4NNBA 3IJ9A 4GMEA 2FVKA 5HUOA 1B3XA 6REQA 3DI1A 1E43A 2GVLA 4C91A 3NZ1A 1BQGA 4UMBA 1EC9A 3QMTA 4NZ3A 1XSIA 1W1PA 3EMCA 4IQLA 1MW2A 4E3VA 5AC7A 1Z3NA 2OB3A 5M1TA 1E6QM 4DF1A 3NPUA 3E2VA 2ZADA 5G4WA 2WC7A 4IPIA 4QAIA 1E70M 2VCAA 4DBWA 1XDMA 4DPPA 1A3XA 1J0IA 3TA9A 3LCGA 1ODUA 1UBSA 2P53A 8RUCA 2BSLA 1WXYA 5KITA 5TBOA 1TE6A 2A2IA 5I3FA 4WSJA 3R6IA 3NG3A 4IPNB 3H2CA 2NV1A 1F74A 4V15A 1OGSA 4I7WA 1XV8A 2JKEA 2PP3A 3P3BA 4NILA 1ECQA 3O6CA 3PVFA 5DT7A 3FJNA 1EYWA 3ABZA 2PA6A 5BOOA 3CQIA 4QR6A 1LLZA 2PRMA 3OQ8A 1QI0A 5EYWA 1ME8A 4JTUA 5LIWX 1ENUA 1KRBC 2PPGA 5HULA 1WDPA 5IBXA 3VMPA 4KWSA 2BOFX 3WJZA 1E9YB 2JEPA 4POCA 4C5YA 2F61A 3NOYA 2ZXQA 3BAIA 3CMGA 5T26A 3WF3A 3VA8A 3DGBA 2E5BA 5JU6A 1PKLA 1E51A 1KCZA 3E0IA 5J5DA 2GJRA 4TTGA 3T1GA 2F6KA 3S2LA 1Q2RA 7A3HA 3QV7A 2QYGA 4HMNA 3EWDA 1LYXA 2QF8A 4UC5A 3W86A 1W9PA 2Z29A 5TAOA 1S3HA 2PWEA 4LH8A 1TR1A 4JYDA 3W87A 1E6RA 3EYPA 3A23A 4H6KA 1Q7QA 4W7WA 2RH9A 1DWAM 4HT3A 1CXFA 1V02E 3SCVA 3W7GA 1P6CA 3BOXA 4LVGA 2ZA2A 4H04A 4M81A 4IIEA 3TV8A 3K5XA 5IXEA 4H2CA 4H9ZA 4AHPA 1Y8BA 3TAKA 4AZBA 4IMAA 2QAFA 1H50A 1IE7C 1OABA 3CPRA 4WY0B 3FY1A 4CVUA 1W3JA 3W9ZA 3HM7A 3TYCA 4DEFA 3A12A 2J24A 3CL7A 1JCYA 1VB9A 3M64A 4GFIA 1G5AA 1IZKA 2PCQA 2DY3A 2NX1A 2Z1WA 3IAPA 1XLHA 1J12A 1EPVA 4JTQA 2E6YA 2PDIA 2XGZA 3VGFA 3IVUA 4HHPA 1BF2A 1EJUC 1K8CA 1EGMA 5E9AA 5FD0A 2O9OA 3HGOA 2FYMA 5CBJA 3NEVA 3C0QA 4WXYA 3VIOA 4PA8A 4NXSA 1W9UA 4FXJA 1OZQA 5HNUA 5BMWA 2HVNA 3G1FA 1GQIA 3ONBA 5FOOA 1ALDA 2QHAA 4IIHA 1JGIA 4HU3A 1PYMA 2GOUA 4TO8A 4HZ6A 4BY3A 2FTYA 5K9CA 5B7YA 2Y5SA 3P82A 2ACUA 2ZUVA 2V5DA 4DJDC 2GUUA 1RJRA 2QUMA 4OBTA 4OKDA 5H8MA 4R9XA 2FZMA 4YYCA 3P67A 2V82A 3VNIA 1UP0A 4Q8QA 5AY7A 2VDIA 3GHUA 3IARA 1D3HA 4A21A 1XYCA 4MFDA 2EG6A 2J88A 4QNWA 1QXLA 3VIHA 3GUWA 1A4LA 3M16A 3W1MA 1S5VA 3H22A 3H54A 2YW3A 4EX4A 2XSXA 5HMFA 3GD6A 1OB0A 1AJ2A 1K70A 1RHCA 1JUBA 1IR1A 2IQDA 4FLRA 4CNSA 4Q33A 1QW9A 3GDMA 4CNTA 1J01A 4A3HA 4LFYA 1LL7A 3GH7A 1RQEA 2ZIDA 3WELA 4B15A 8TIMA 2GDQA 2PRHA 3OQEA 2ABAA 3VD3A 3MUZ1 2HRWA 4XIAA 2WKJA 2RJGA 3BDKA 4LUTB 4EIVA 1V6TA 3Q37A 2FPVA 1QOPA 2FPTA 1XH1A 2WMIA 3QR1A 1KR0A 3LCLA 4GQBA 4PCSA 4ADSA 2I17A 4AWUA 3RU8X 1FHUA 2ON3A 2RDXA 4RE4A 2J6XA 4IGHA 3RO6A 4O0ZA 4GUIA 3CAWA 4LF2A 3CASA 3MYPA 2J25A 2NXHA 1XLGA 3RITA 5D33A 4FS9A 3QR3A 1C9DA 3NL5A 3UJEA 4TQTA 1GOWA 4HA0A 3G0XA 1ZBVA 1QT1A 1XM3A 2CNCA 3CH9A 5GJMA 5I3GA 4PTVA 3HG2A 2X0SA 1GOXA 5FACA 2P1FA 3VKBA 3WLOA 3L0NA 2GDUA 2O9RA 1QW7A 2OGJA 3M46A 4RE0A 4WDUA 1L6WA 4IL0A 1C8VA 3N2TA 1Q6OA 4BF7A 3L67A 3KX6A 3GNOA 4XBJA 4NKCA 2ATMA 3GIQA 3SUVA 2XFFA 2DUAA 4F9DA 5HOSA 4UFIA 4IXHA 4LUTA 5HWMA 5E5CA 3SZ8A 5CJ5A 2V38A 4JQ4A 3ANYA 1TV3A 3EZ4A 2WC3A 3GNDA 3DFOA 5L6UA 3ARRA 5FJOA 2XSAA 2YFNA 3IS4A 4W7VA 1TB3A 5H2ZA 1QO2A 3BQ5A 2YA1A 2BDQA 3GKFA 3UEQA 5ABEA 1GYMA 4LAZA 2I5GA 4ZA0A 4F2TA 4D6CA 4AD2A 3TXZA 4LWWA 4NJHA 1AD4A 1AL7A 1V79A 1W1VA 1AFSA 6ENLA 1FWFC 4MDOA 1R46A 2YL8A 1OCQA 3F5LA 3G0UA 4JKLA 3R89A 4WHBA 4QDPA 5K2ZA 2AL2B 4GNVA 2P3EA 1KNWA 1V3KA 2OWCA 1VFHA 3U2EA 3S83A 4IFRA 4Q7BA 5I79A 4W8AA 4UTUA 3WD4A 3NPVA 2HZGA 4TV5A 3ZT7A 4ZSUA 3EA1A 3VOFA 1F8IA 1J0JA 4US5D 2YA2A 2HVMA 4DJFC 3PPFA 3EB2A 3PANA 3GFXA 2R1PA 5HDRA 4HPGA 4LSBA 5AFDA 2WANA 3KXQA 3W1QA 1UOKA 1KQZA 5DQPA 3W81A 2AGKA 1Y5VA 2ZBTA 2ANUA 2ISFA 5ECUA 3E5BA 5DMNA 2BP1A 1T6MA 5DEZA 5LA2A 1ZLPA 1NF7A 4O53A 1GT8A 1DJNA 1QWKA 5FSDC 4G1NA 4YPJA 4NZJA 1ZTVA 4AAJA 4FALA 3AZTA 3VNZA 4L4PA 3B4YA 2XVGA 4I5XA 4HMEA 3S3GA 1ONRA 3O1NA 3TR2A 1E40A 5K4ZA 5C54A 3STGA 3L2MA 2ZC8A 2HS6A 3EGJA 3HG3A 1XLJA 2WM1A 2X7VA 2XIIA 4M7TA 4X9YA 4GCAA 4U2YA 3S1GA 3ALFA 4MNJA 4O8AA 4Y9AA 2YCEA 3HG5A 1BD0A 4H9UA 2P0IA 3W29A 4AG0A 4ES4A 2BOEX 1ITUA 2XUCA 3OHIA 1YIXA 1J6OA 3VOCA 2QJHA 2WSPA 5BOFA 1YDNA 5I03A 3HBLA 5LYRA 4J27A 2ZUMA 1VBRA 3U8GA 2O9PA 1SFJA 4XD6A 4CNNA 3PR2A 2ZXDA 3UYCA 4IZGA 3CLWA 4PMVA 1Y5WA 4IP4A 1CWYA 4QIUA 1QATA 3QZ6A 4CCZA 3FA3A 2OXNA 3U3HA 5HINA 1FH7A 1BWVA 1H7OA 5TF0A 4XUGA 1OBAA 4E4FA 1ICQA 4FXFA 3KOWA 3IUDA 1UWQA 1Z7AA 2Z1SA 4M51A 1V7AA 1TTJA 3T09A 2G97A 4UFLA 4EANA 4NP7A 2CHNA 4O1EA 3GG1A 3LCWA 2GGJA 4AIOA 3B8SA 3WK0A 3VDHA 2IKHA 4DWSB 2VDHA 3LPOA 5CAHA 7ENLA 4WUIA 3RU6A 2YXOA 5GVJA 3M07A 3VOJA 2V8ZA 4DAFA 2C0HA 4WJEA 1A5CA 2PDNA 2VC9A 3FFSA 4NNAA 3CZLA 3WQVA 2J7BA 3GTXA 1W6TA 3WY1A 1A5BA 3MCNA 2WBKA 3AYSA 3NWRA 1GOOA 5FF4A 3K4AA 3BZJA 3JUGA 4H7CA 1MW0A 2BV9A 2PDKA 3P8JA 1GYLA 1HGYA 1TG7A 2DORA 2WPBA 2ZUNA 1CZ1A 2PZ0A 3PBWA 1QFEA 3CV2A 1W1YA 5CZSA 3LMZA 4BJHA 4EOUA 3ECQA 2CERA 4JKKA 1UD4A 4IJCA 4LB4A 4Z08A 1CEOA 1AJ0A 3RCMA 3FW6A 3WF4A 1PO9A 2Y8UA 4KEUA 1OFAA 3F2BA 3GR7A 4YIWA 5BXPA 2W79A 1TQJA 4D2JA 1BYCA 3WH5A 5CPMA 1XGDA 4S3CA 5GPRA 3E9AA 3NSMA 4HZ7A 4AD4A 3AICA 1YPFA 3W27A 3ZJ8A 3ZSSA 5FA5A 1LDCA 3HGJA 5CC7A 1HJSA 2WMKA 3T0BA 3EPOA 3IK2A 2Z2UA 2D0GA 1E0VA 1EX5A 4DWSA 2FKPA 3FYOA 1I75A 1L6SA 1FXQA 4AZ6A 1SU5A 3GTIA 4F0MA 1OCNA 4ZODA 1DJIA 1ODZA 4PBFA 1PTAA 1EP1A 2CITA 3T9PA 4C6CA 3WKZA 1ICPA 4WD0A 4GUFA 1M7XA 4G1KA 2D2JA 4Z1AA 1V0MA 4HYVA 5D8ZA 3ITVA 3PN8A 2QCEA 2V6AA 5REQB 5D30A 1JPMA 2IMRA 2OCZA 3BJTA 4ZE5A 1AMKA 3CUIA 3S6TA 4ENLA 1TWIA 3RX3A 4LEQA 3H2AA 5CPSA 1MEIA 2QCDB 4MIMA 4TU1A 3G22A 4B9ZA 1K03A 3BJFA 4L65A 4XISA 2NQ9A 3G2GA 3PG8A 3VIKA 3O8AA 4JIIX 4O12A 4AFYA 2B7PA 1OFEA 4EE9A 1OF6A 1PCKA 1VYSX 2ACQA 4P61A 3B0PA 3V1PA 1BSLA 3MANA 3GG0A 5AC4A 1G67A 1PZ3A 1WKEA 1GKQA 2HXTA 4G7FA 2X1TA 3MP4A 2EPOA 4NNCA 1LWIA 4L6DA 5BOEA 2PBGA 4OU1A 2AKMA 2W5FA 1NSJA 1HG3A 4N9BA 1FWRA 4ORMA 3U2CA 4JNMA 3AYTA 1SO3A 3AXHA 2FH8A 2WM0A 3MBDA 3B0VC 3GK0A 4BA0A 1W2PA 3RAOA 3TCEA 1IGSA 3EWCA 1SZGA 1R87A 4XAFA 3TQ0A 4XO6A 4MTVA 1XYAA 5E09A 5REQA 3ABRA 3IIZA 1JPDX 3L68A 1ESWA 3UXKA 2G0WA 3CJPA 4WOZA 3WG6A 5EY5A 4YVXA 4UFKA 4UWMA 3PUEA 4O13A 1XIMA 2VX4A 1JCNA 4HZ8A 4FEZA 3RLGA 3WJXA 3CAVA 3MCMA 1IV8A 3PC0A 4LV4A 1EJSC 3SRDA 1V3JA 2DDXA 2R91A 3RRAA 1UZ1A 1CLVA 1R7OA 4B5VA 2CYGA 3NZQA 1C8QA 4GXMA 3VOGA 4B5SA 2FZDA 3RR4A 4RUBA 3GQYA 4AIEA 1EBHA 2OSYA 2HEJA 1XKYA 1UWAA 1MDLA 2YA0A 4QLLA 4JGDA 4KWOA 3WZ0E 1PS9A 3GC5A 5TIMA 1J5SA 3PWGA 4O0KA 3R1ZA 4LVFA 3ITCA 1WXJA 1RALA 2PGRA 1BXCA 2J7CA 5D2TA 5D9MA 4DZAA 4K8EA 5BXTA 3UJSA 5C6MA 3ATZA 2Y8VA 2I14A 4A8NA 4KWVA 1OFPA 3TA6A 3MS8A 3VXGA 1KGUA 3CMFA 4GQ0A 3PHAA 4J3VA 3CXOA 4WXZA 4XAGA 1QCWA 4ERGA 2Z1VA 1YW1A 1F9CA 3BLDA 2PE4A 1GQKA 3DYPA 3GB6A 1L9WA 3PG9A 3TLQA 1OVDA 1GPWA 4LPCA 3FKRA 3W01A 1DIDA 4PMXA 5TQLA 4ATWA 1HUVA 4LCRA 4JIRA 3L5AA 4MWAE 3S42A 1E56A 3C0JA 4HNOA 3U9IA 4ADTA 1F6KA 3POCA 2V81A 3BG5A 4RL3A 1P0DA 3VDGA 5JBFA 2AOSA 5DXYA 3SY1A 3R0DA 1KA9F 2VR5A 1SQ7A 3EWYA 3ITXA 2X40A 5BYWA 1TIWA 4CEXC 3BAWA 1QR7A 2DVTA 5D02A 4H83A 3EKLA 4Z2LA 3LXCA 2RDUA 2WMGA 1YNQA 1FWEC 3WQ4A 3LV5A 4DVOA 1CECA 4L1XA 1OT2A 1Q6EA 2A3BA 1PDZA 3SQLA 1HKKA 2ZX7A 4MY8A 3RXZA 4O15A 4E4UA 3RK8A 2AMXA 4L4OA 3UW6A 1G4TA 1KTNA 2QJIA 1RP9A 2E28A 4A8RA 2PDPA 3THQA 3BO9A 4ZO7A 4ZENA 3MP3A 2O7SA 4O1FA 1H61A 3N29A 1H1ZA 4LUYA 5FEPA 3PTQA 5AHLA 2HK0A 4DZHA 2D69A 4LTSA 4UIOA 4AEFA 3MP5A 3LRLA 5DMLA 1GJUA 3WLPA 3RLVA 4TR9A 4UTMA 1MI3A 2JF6A 3BSHA 1FDJA 2QUTA 1TPVA 1NDWA 3KZPA 2O7QA 2ZUWA 3IUHA 4XZ9A 1C93A 5KTLA 4F2BA 4JYEA 4I3GA 2Q8XA 2FTPA 3KRBA 1KV5A 2FHBA 4YWIA 2PTZA 5AHMA 2OT0A 3R4IA 4Y8EA 4XD4A 1E6XM 2CIPA 3MUY1 1ZCCA 1XPGA 4UNLA 4UXDA 4EKJA 1BFNA 3GRIA 5CGQA 4DM1A 1CGXA 1DORA 1FHLA 2DJXA 1E55A 5LKYA 1WO2A 3G8EA 3WQOA 2GGGA 4GI6A 4N6EA 1IIGA 3B97A 1MEWA 1OFOA 5JQ9A 2A6NA 1VENA 1ZUAX 1E5JA 1IXNA 4JTSA 3SB0A 1DWHM 3ZQ9A 4D6IA 2AGTA 2VMFA 2XN2A 2FGBA 2H8XA 1DXFA 3VE9A 4BCEA 1UC4A 2G41A 4DHGA 2PBOA 3UETA 1JFHA 4FX8A 2G50A 2BHUA 2ZX5A 3AXKA 2A7PA 4GUHA 3QH2A 3E02A 2QS8A 1P43A 3TC6A 3QV8A 3SJNA 5CZJA 4Z2GA 3DC8A 4MPKA 4O57A 2X2YA 3XIMA 1EF3A 2PDYA 3ARUA 3W1LA 1FFRA 1AUSL 3B8WA 3VKKA 1EL3A 4LRSA 1UQZA 3EWXA 4HNVA 3KLLA 2ZA3A 4TUFA 2KAUC 4K68A 3N11A 4J3XA 3P7YA 3EXSA 3R2GA 2VQUA 2IPFA 3WUEA 2WXDM 3W1PA 1JF5A 5RUBA 3L4XA 1SSDA 3LBCA 1W1IE 3C2RA 3GDKA 2YOCA 2IQ0A 5CZTA 1JCJA 2WHJA 5MKGB 2G3FA 4E5TA 1QNOA 3ARZA 3H2MA 5A95A 5JIWA 2OOFA 3TYUA 1R9XA 2VRKA 4U5KA 1B9ZA 2BLEA 4D9PA 3S2CA 3NXLA 4P8VA 1HKJA 1FDYA 5IOBA 1V51A 3EDKA 2WAGA 3FDKA 4FHAA 1VFTA 2WJDA 2E7FA 2HK1A 2QCNA 2XPKA 1NWRA 1BQCA 4UZSA 3O7UA 1XLMA 2O56A 1MNZA 5HANA 3H26A 3NPXA 4PEKA 3AO0A 3VAVA 1F3XA 5BRBA 3VUPA 4M0XA 4PMUA 1L6FA 2WV8A 2OKOA 3ARYA 3PJWA 5I7GA 1RPKA 4LNYA 3OTRA 1AG1O 4IIDA 4KETA 4GYFA 2G4JA 3PJXA 4GC3A 1XIEA 4K3ZA 2GVEA 3T55A 2W4XA 4H2HA 3T0AA 4AQLA 3S9IA 2EG7A 3OPSA 2IS7A 2QCCA 1DYSA 3W76A 4HSOA 5I3KA 4RXFA 1XLEA 3W1NA 3FSTA 3ES8A 4V27A 4H19A 5MKGA 3NR0A 1QK2A 2EKCA 9XIMA 1CXIA 3R0KA 1KWKA 3WLKX 4ACZB 5E0CA 4IM4A 3HIJA 1TMLA 1W91A 1QDSA 3DBNA 4S3AA 4DO5A 4O28A 3DC0A 4IGSA 1TJRA 3LCXA 2CKSA 4PUJA 1XYLA 3CV7A 2WHMA 1OC7A 2CLHA 1JXJA 2WSKA 3IVTA 1OZMA 1U30A 1WOAA 4W5UA 2VEGA 2RHGA 4B90A 1OC5A 4FLOA 5BWAA 5DRIA 2HMCA 1QPRA 1EQCA 2OEMA 2Z4GA 4IMFA 4PMJA 3IRSA 4CN6A 3VIPA 1G4SA 3NPWA 1IZCA 1LRTA 2JEQA 1P48A 1VAHA 4I8YA 4E8DA 1O5RA 3LOTA 1ISZA 2AL1A 2QAPA 2CPUA 2WNZA 3W72A 1G7VA 3P5ZA 3TCSA 3P14A 3L5MA 3CWOX 1E1EA 4QAWA 5BW6A 5FIPA 1R7AA 1X6NA 3WBAA 5HJXA 3CTLA 5SWUA 1XBYA 1DIKA 4HHMA 4ACZA 1DWGM 4FOJA 2FH6A 4PUUA 1PPIA 4HJFA 4R34A 4ORIA 3E74A 1JCMP 5D09A 4ICNA 1N8FA 1RLCL 3EXTA 3TZFA 3Q58A 2Z26A 4AF0B 4QE4A 1F61A 5F2IA 1HF6A 2GUBA 4PCPA 1V02A 5BMXA 5A6KA 1UMYA 1B3YA 2GK1A 3F1QA 1K9EA 1A5OC 3WFAA 5JMUA 2E77A 1YNPA 1Z42A 3CV1A 4HU0A 3VC6A 3DFHA 1Q2SA 2R1LA 4XUYA 1RCQA 4Z1CA 1LOQA 4XZNX 2Z1BA 3LQGA 3IIVA 3P74A 3G1XA 1H0IA 3B8TA 3UR7A 2JK2A 3SUSA 1NP0A 3U5YA 5EFFA 1FCVA 4QBXA 4Z17A 2RUSA 4AC1X 4F40A 1H41A 4GYPC 1B9BA 1TJ2A 4GY0A 4XKYB 4HB7A 3GC2A 1W1B1 4DXVA 3SRHA 3VCNA 3VMOA 3M0KA 3EWBX 2NUXA 5I00A 4HSHA 4JXCA 3FK4A 1LUCB 2E9LA 5EMUA 4E38A 5AYIA 1WQ5A 3EDJA 5A2CA 1OY0A 1FWIC 4PYSA 4NUWA 1HIZA 1E4LA 3T07A 2XIMA 4PMQA 1FWHC 4WR3A 2OO0A 4LUSB 4AF0A 1TWDA 4MVAA 3KRUA 1IEWA 4QFUA 4R7OA 3TX9A 4QTGA 1K8YA 4D6FA 2RKXA 1B4KA 5CGTA 5CKSA 3ME3A 3RUBL 3CYVA 3M5VA 2R1MA 2WZEA 3OYXA 1H5YA 3AHZA 4US6A 1U22A 4MB4A 4RNHA 3BAKA 3RGTA 3KFTA 7REQB 1XBZA 1E4MM 1TJ0A 1LWJA 4ZQOA 4HJWA 2OPJA 4UTWC 3E0LA 1QNRA 4H6QA 2E8YA 1TPH1 2Z24A 4NY2A 1O5KA 1KWGA 1OINA 3O6AA 4H1ZA 5TNVA 4X2PA 1JIBA 3TZNA 1EB3A 3DHPA 4YJ5A 2C1GA 2VRJA 2V9DA 3QQWA 2Z25A 3IIXA 3S5SA 1V08A 1W3HA 3SCWA 3TW9A 3M0YA 1WNOA 3BAYA 3MWAA 3B8IA 4KCUA 2NT0A 1UP2A 4IJRA 4C6OA 4PEEA 2VENA 3QW3A 2X1IA 5JH2A 4GHRA 3MHUA 2E68A 4PUNA 2Z28A 4IPLA 3F4VA 3S2NA 4I9TA 2Y85A 1KFEA 2DQWA 3H2NA 1JZ8A 1F76A 4G9PA 1PVNA 5J04A 4O11A 1KCKA 2CBJA 4LUSA 1JPKA 4AU0A 1V7YA 3LERA 4U4MA 1M7JA 3OBKA 1FHDA 1TV4A 4I5RA 2QMJA 5BZAA 3ITOA 4M6PA 3W6LA 3OHMB 3QV9A 1SZNA 4Q4MA 3PAOA 3OO2A 1E3ZA 1VYRA 3G18A 4WDTA 1YRRA 5A8QA 4C7FA 3LX9A 5HMSA 1E6PA 2HBXA 1KTCA 1OX4B 3GW3A 2FZ8A 4ZQMA 3WBXA 7REQA 3B8UA 1HJXA 4V28A 3TYBA 1OHLA 4JNYA 5I09A 4FNRA 4GBUA 2F7FA 4QJ4B 1ZHAA 3PF3A 1K1DA 2YKKA 1VRDA 3M0JA 1U33A 1O12A 4GISA 4CNOA 4AVFA 3L23A 5KSWA 3VIGA 2XWDA 3ZSTA 4AX7A 1WB0A 4J3WA 4C1LA 1RCXB 3BICA 3TTEA 4F3HA 2NX3A 4JTAA 2NV2A 1S2TA 3EB4A 3MKKA 2OOGA 1Q3NA 4GK8A 2PGFA 2ZRZA 5DFAA 2WVVB 4ZXLA 3FAXA 5F1UA 5AYXA 4XWUA 1YYAA 1OK6A 4A35A 4FK9A 1CXKA 2FMNA 3QSTA 4QJ3B 2VDGA 3U6WA 1D2KA 3DHDA 4WF7A 3E6EA 4O1BA 2HS8A 3S5YA 2WWCA 4JEQA 3BW4A 3SRKA 4CD7A 1FXPA 5JBDA 2B31A 4IIFA 5CQ1A 3BCDA 1QHZA 1TE1A 3HPAA 3OGSA 1OX4A 4LCSA 4F8XA 1EXPA 4GZEA 5AKQA 1TYGA 1WYIA 2TAAA 2X42A 1NDZA 1T5AA 4GZ7A 5CSSA 3TSDA 2CLOA 2F6UA 3RCNA 1KCXA 5IHRA 2XG9A 1FOBA 4UTIA 3VNYA 4FNPA 1J93A 4OFCA 5F4WA 1VJSA 1WDQA 3WQGA 4REQA 1I2NA 3H21A 4D6GA 4PSPA 3CMJA 4DYJA 5A2AA 4HOXA 2WVVA 2C19A 4MAZA 4Q4QA 1XYZA 4Y96A 4GO9A 4JTLA 2DSWA 5HBFA 4B5XA 4JDBA 1ZJBA 2MUCA 1EYEA 5I77A 1RA5A 4PR4A 1KO0A 4JD4A 3H2EA 3GU2A 2PU0A 4DJDD 2F2HA 4RKAA 3OZYA 2OLAA 4PMRA 3CHDA 3KL3A 1M68A 3LSBA 2VGFA 1QW8A 3FHAA 4WGXA 1IWPA 1O4UA 2GGEA 3W7PA 4GVHA 3TDFA 3NQ8A 1DIEA 3OVRA 4J3ZA 2Y1HA 1ZQ5A 2YCLB 4BWLA 7TIMA 1NWTA 1XBVA 1UJPA 4PZVA 4A8IA 4U5IA 3VIIA 2VTFA 2PC8A 4TX6A 3W38A 1SZEA 3T0TA 4JIQA 3IJQA 4YCPA 4QDMA 2Z27A 4PRRA 1G4PA 3HF3A 1VR6A 2FJUB 4CQDA 1W9BM 2O0TA 3T08A 4TV6A 4QISA 4ZCWA 2Y0FA 5CPNA 1M04A 3NEHA 1FVPA 5LHEA 1VEPA 2F9RA 4US5A 5ENLA 1MYRA 3V5OA 3I6EA 1Q13A 1M53A 1ISYA 5C0QA 3EOLA 3UCQA 3AHYA 2FGLA 4MKSA 2BFGA 5DY3A 4R53A 4DUWA 4W89A 3W02A 5G2HA 2DH2A 1KV8A 2OU4A 3PJTA 2J27A 2CZ5A 1F5ZA 1EKOA 1A3WA 3PZTA 4X60A 4QP0A 5U7SA 2C6QA 2NSXA 3LGGA 5AYYA 4XK2A 1UKTA 4MF4A 5D38A 2AMGA 2YCLA 4KFOA 3W70A 4C6EA 3V16A 4ZMGA 4P7LA 4GXPA 1TPWA 2HV5A 4O4WA 5FAJA 4XSLA 2Q8LA 1Z32X 5DO8A 1SO5A 4G7EB 2VO5A 3E0WA 2C71A 5LNRA 3UG8A 3V75A 3M6YA 1ZJHA 1Q4NX 2GJLA 1XH2A 4B4FA 4Q8MA 1LM1A 2OWWA 3GXDA 1XCWA 2INZA 2TODA 5AN7A 5ECVA 4AISA 4P8UA 1M41A 2G95A 3PFRA 4CUCA 3U7BA 1PCWA 4B16A 3L4VA 1BGGA 3CWHA 1XLIA 3VABA 4GGBA 4UFHA 4JTGA 4IWWA 2E6DA 3BC9A 3HFTA 4MDPA 3V35A 3THUA 3RO8A 2VP8A 2YBTA 4KEMA 3GY1A 1XLDA 4L7ZA 3UBPC 3MJYA 3SCQA 2X1SA 3H55A 3WBWA 4R85A 3MKVA 1P1MA 7XIMA 4IICA 2TYSA 3O05A 1EBGA 4JX4A 3C61A 5FJRA 3GNNA 3S6OA 2QNEA 3KS5A 2OZ3A 3C6CA 1UPMB 1TX0A 1U1JA 1F3EA 4GI9A 2GVJA 1I0DA 2X0HA 2WYSA 3W28A 4GJ1A 4AHQA 3CHEA 1X6UA 1NTHA 2YDSA 4X61A 2YB4A 4GO8A 3BLLA 3KEHA 4G7EA 4ZOAA 4S3DA 1UQYA 4P7OA 2XTKA 4DJFD 1KRMA 5AC8A 1POJA 3PJUA 4WDXA 3B05A 4WKFA 2W27A 4JFWA 3FXYA 1JRBA 2G96A 3NDOA 1Q85A 4WSHA 4IL2A 1US2A 2C1HA 2QUVA 3NAVA 1ME7A 4RW3A 3UXAA 3VDCA 3TN6A 2BXZA 3MO7A 3TFXA 1K8XA 4OUEA 1DJHA 4TXEA 2C13A 3NQEA 3WMLA 4AWSA 1C91A 1H0GA 2P50A 3DAQA 4CEUC 1L6GA 3DHFA 4RK8A 3CQJA 2DT3A 2FZ9A 3T42A 1XRFA 1G1YA 3TSBA 3C52A 3CK5A 4DNMA 3GH5A 1R38A 1UG6A 3B0UX 1OWQA 3CS2A 1GG1A 1SUXA 2QDEA 5EMYA 1Z8AA 2DSZA 4R7JA 1KKRA 4HP5A 1RY8A 3WUBA 1TTIA 1UMLA 1W3TA 1FWTA 4ZO8A 4YXGA 1HNYA 3EOSA 2YX0A 3AQUA 4CQ8A 1EHAA 4OIFA 3W1XA 3NJ3A 3DFTA 4UQAA 4E6MA 1HVXA 1GVIA 1XF0A 4I9JA 4B4HA 2A85A 3M0XA 4IPPA 4M29A 1P6BA 4HNNA 4PULA 1US3A 4IFKB 3AMGA 4C6PA 3K4WA 4KBXA 3AS0A 5XIAA 1XJBA 4QXIA 2OG9A 3B8DA 5FJTA 2CXEA 2D0FA 4XAPA 3AHTA 1QBBA 4KFPA 3OODA 1CXHA 3SRFA 2PEVA 1VH7A 3OOQA 4CU8A 2A7NA 3HMCA 2CBIA 2IPWA 5CC3A 3QLDA 3W84A 3RRXA 4QS5A 3W1TA 4ONVA 3NTYA 4XZMX 3QXBA 4G56A 4RW5A 4KFNA 1NOUA 3H4XA 4JX5A 2PLJA 3LTYA 3L0GA 2FVLA 3RFAA 3LRMA 3MZ2A 4K8GA 1OYBA 5AHIA 3AJXA 3STEA 4O54A 4Q3MA 3SEPA 1DPMA 3VGBA 1BRLA 3WDQA 4P2VA 4OVXA 3VK5A 3F7JA 1TV5A 1OX6A 1KM4A 3QC0A 1S5MA 3WO8A 4G8TA 1TUFA 3KVLA 1EJ7L 3DH7A 4ZEPA 2VEFA 3LCIA 2WB5A 4RNIA 1W9VA 3URNA 1GZ1A 1QI2A 1ELSA 1UIOA 4RLIA 1VCGA 5T9BG 1Q6FA 1CLXA 2YZRA 4DY1A 1X1OA 4OOUA 3CUXA 3QFEA 4PFMA 3WLQA 3WQWA 4LAMA 4ZO6A 1TV7A 4NSBA 3TR9A 4IFKA 3CUGA 3TE9A 3N9SA 2C15A 1IHIA 2VT0A 4S3BA 4XZLX 4JN7A 3PBVA 4LS2A 4JBRA 4MZ1A 3ZIZA 3GVWA 4LS0A 1R30A 1GOIA 1XWYA 1IGWA 2VOMA 3GBEA 3FNDA 3HURA 2PI6A 3AC0A 4PUWA 4QG6A 3ZMRA 1RCOB 2E1WA 3SUTA 1GHSA 1FA2A 4DB7A 4WOQA 3LLXA 2Z6IA 1E1CB 2ZDRA 4JYFA 1BF6A 3GU1A 2D23A 4JNZA 4JQAA 4H4IA 4ZVJA 1UHVA 3QW4B 1S5WA 4IP5A 4MWAA 2XSBA 2E9BA 3CPUA 1EA9C 1SJBA 3OU8A 1HKWA 1ADSA 4NVTA 4CGTA 2F6XA 4R3UA 1GZGA 5EBUA 4IISA 3SQSA 1TPFA 2Q01A 4NHVA 5E70A 1XLFA 1NQKA 3WCZA 2WCGA 2QJMA 4FO4A 4F0HA 4X0VA 3UNTA 1WZAA 4MUZA 1VBJA 2YL9A 3BARA 1H7PA 5HNNA 1V0LA 2DIEA 2DH3A 2E4TA 1E3XA 1UOZA 3LK6A 1H3GA 4NZFA 3ZT5A 3CQKA 3W71A 4OE7A 1MZRA 4M5PA 2V63A 4HU8A 3JS3A 1S46A 3KUMA 2FJKA 3DCPA 1UIPA 1NELA 3RM9A 1A80A 3M5YA 4M24A 3TFCA 4P7NA 5IFTA 4CD6A 3NO1A 1VF8A 3QMRA 4J7RA 4ECLA 1OG6A 1HVQA 1X7IA 4QLKA 2WHKA 5FF2A 3USBA 1ZBKA 4LOCA 1JDDA 3KM8A 4EAYA 3DG3A 1PL9A 4CCCA 1KFLA 1DWJM 3HGRA 3KCLA 4JEJA 2WVUA 3VGHA 1PZ2A 3EMZA 2JFEX 4UNKA 5EB8A 4FLQA 4QG9A 1S38A 1MXSA 2CWNA 1LOSA 3IEBA 1V8EA 1HKVA 2EHHA 1GZJA 1TCDA 3PUOA 1XCFA 2FB2A 3WL0A 2X8RA 1LROA 4LJ3A 4O17A 3MDWA 5AHFA 3RJYA 3SGGA 4GVFA 2DPEA 1NF0A 3ZO9A 4GE8A 4DUOA 3K8LA 5HJLA 3JW7A 4B2DA 1NFPA 2A5HA 3FN9A 1HW6A 3MSGA 1Q65A 3FYYA 3G1DA 3BANA 3RPTA 3WBYA 3PBGA 2DZTA 1VFOA 1VJIA 2Q6ZA 1HKMA 4QG8A 3MC5A 3UD6A 3CZ8A 2J8TA 1IEXA 4A4AA 3ARSA 3PZMA 1GVEA 4D6EA 1C92A 1Q6DA 1ADOA 3B9OA 4ZL1A 4ZQPA 3R8GA 3VC5A 1EWDA 3GTHA 4ERIA 4FXRA 4XVEA 1KC7A 3SCSA 1DVJA 1D3CA 4F4RA 4GYKA 2EJAA 1FWCC 2XISA 3KL5A 1KGWA 1MRQA 3XINA 2XVNA 4Q4OA 1SYTA 5FJJA 1RP8A 4ILSA 1I60A 5C2CA 2VWSA 2YLAA 1WAWA 1IXOA 3B9DA 3TAOA 3F5KA 1XQKA 5C9WA 2YL5A 3BH4A 3IPWA 2ZRVA 1EUAA 2P76A 4EF8A 4CQAA 2PWUA 4HA1A 2QJNA 1EA0A 2BY3A 1MUCA 1V03A 3NQ2A 4MNLA 4O52A 2X09A 3TYAA 1V0KA 2BXYA 3GUGA 1PBGA 1PYFA 1CENA 1BVNP 1RVGA 1P0NA 2CLEA 3APGA 3RYSA 3JZUA 3GO2A 3LHUA 1VFUA 3VOIA 4LVBA 4RDZA 3UGVA 1KBLA 4KF1A 3FDGA 2BODX 2RAGA 3P60A 5XINA 3CTTA 1TRIA 4GI8A 4TX8A 2PTXA 4GY1A 1EZ2A 4NZ5A 2PWFA 4C6LA 1E4NA 1CT5A 2VUNA 3MMDA 2EKGA 2Y62A 3PPGA 3PUGA 3HU7A 4JIHA 1EC7A 4WSKA 1NWSA 4AZIA 3BLPX 2GPTA 1JDFA 5A6SA 2XWEA 5LNWA 3QKEA 3N2CA 2FMOA 3P6LA 2ZVRA 3A4JA 1RK5A 1H2JA 1PX8A 4UTTC 1OEPA 3GWQA 3MHFA 4UQBA 2Z0IA 3MBFA 3WUFA 4LAUA 1EP3A 1KLZA 3QF0A 3MUIA 1VCFA 2ZWZA 3I3BA 1OGBA 4JQ1A 4IFOA 5C9XA 3BSGA 4HK5A 3BSMA 5IRPA 1OIFA 2W67A 4J40A 3SIMA 4D1JA 3R8RA 4MUPA 4YU1A 1A47A 1OC6A 4CD4A 1XSJA 5HNRA 2J7HA 2D3LA 3Q67A 5KZ6A 1BG4A 2NV9A 3O0FA 1JAEA 5DRCA 1XISA 2VFFA 3OLGA 3MB9A 3VYLA 3IACA 3UWQA 4NJIA 1R9YA 4E8CA 3QYQA 3WFZA 3TWBA 1E15A 2XIBA 1WOBA 4C6KA 2WZMA 2J78A 2E6FA 3A4XA 3A4WA 2XINA 4YCOA 3TXVA 3U0HA 1S2VA 1DXIA 1X7FA 4NAFB 3P81A 2ZWYA 4CQ9A 1H7WA 3LUTA 3UF9A 3W7IA 3HPXA 3IANA 3TTSA 3I3EA 1EOMA 4U33A 3EPNA 4WDWA 4HNLA 2WQDA 4UQDA 4M80A 3EB3A 1WDWA 4PMZA 4DRSA 4DQWA 3DFNA 2Q3OA 4JTKA 4FB7A 3HQOA 1XH0A 1XINA 2JGQA 4CU6A 1K4HA 5BXSA 3GZ3A 1N55A 1DWFM 2J47A 3DX5A 1EJTC 5T91A 2HSAA 4AD3A 4CN4A 1VGAA 2CESA 2HCVA 5I07A 4S3EA 2WVSA 5CBIA 4TTUA 1UBPC 1K3UA 4RV8A 3SDOA 3CPGA 2V2HA 1BYAA 1JI1A 2Z6JA 3H24A 3G1YA 3A21A 3WSUA 4GVIA 3ZVHA 3N04A 1NDVA 2PTDA 3M5XA 1JDEA 4TX9A 3MJMA 3OGVA 1GQNA 1VPQA 4N6FA 4RDYA 3H7RA 3PBUA 4QQ3A 2BY2A 4XD3A 3SBFA 1A49A 5AYZA 3RF9A 4XIMA 2BB0A 3TQPA 3LEPA 3BV4A 1H11A 5HJYA 3DFYA 4P7RA 2Y2WA 3ZZ1A 1RXOB 4JFUA 2J77A 1JDCA 3QPEA 1Q7MA 3CUZA 4IG2A 2WOQA 3BGGA 1JVNA 3AUJA 5IHSA 3NNTA 2ZXAA 1QOXA 4ZXOA 2E8ZA 2VELA 3E12A 3S1UA 5EGRA 1ZAIA 4LALA 4M56A 4HVXA 3M4HA 1VBHA 3UY8A 2W91A 4Q8TA 2W9MA 2Q8ZA 3EWUA 3WH9A 4NYYA 2D73A 3C5QA 4KERA 4PTXA 3ZLFA 5G2WA 2YL6A 4LEFA 4Q4PA 2W66A 1VBUA 1MDRA 1H1NA 2QDHA 1RA0A 3PFMA 1OGGA 3UPWA 5DMMA 3GS6A 3MMTA 3AZRA 3MZNA 5ABFA 3URBA 2EF9A 2MNRA 1I4NA 1ONEA 3L65A 5LXEA 3F4WA 4W4QA 4I6KA 2A4AA 2XZ7A 4AIUA 1SW3A 5A8MA 2AQVA 5BRQA 4H9XA 5HMDA 4ADUA 1YQ2A 4RZ5A 4LB3A 2PWDA 2FPYA 3KVJA 2DIJA 4LYRA 1X6LA 3VVGA 5F1VA 3LN3A 3W23A 1BWKA 3DFPA 2DZXA 3WJSA 2YFOA 4UUIA 3I10A 1CGTA 4ZTYA 1E6NA 3H4GA 1R2SA 1BHGA 4A6GA 4DBDA 1WDDA 1DBTA 2VRQA 1EOKA 1AW2A 3NZGA 1DJQA 4HD5A 1WAUA 4GKLA 3W2JA 4Q8VA 2O55A 3SCNA 3ZYZA 2HXUA 2GSEA 3OYZA 1PDYA 4O16A 3PZVA 4D1IA 4W7UA 1QPKA 2AAAA 4IIBA 3V5FA 1B5TA 1S39A 1Y65A 4UOZA 1JZ5A 3VM7A 3TWAA 1XIDA 4HQVA 3GE7A 1YTEA 1VCVA 3MUXA 1YTKA 3QLLA 3UWYA 4UTHA 8XIMA 4EPEC 2XVLA 2QUNA 3HFYA 2FFIA 2A21A 4IPJA 4JCLA 1MSSA 3ICJA 1UJQA 4ZOEA 3IJIA 1PHQA 5CGMA 1GJPA 1L0PA 3NQFA 3AMLA 4PL2A 1XFCA 4IQDA 4N0RA 1BTCA 4DO7A 1R8LA 3AJ7A 4S39A 5D2YA 4QCFA 3W83A 3G1HA 3VD9A 2Z00A 2NXGA 3L66A 3SGZA 1AK5A 2E5CA 3VD5A 2QCMA 1KFBA 2BGSA 3L2LA 1GVQA 3AALA 3I4EA 2G3IA 3SFWA 4ZZ9A 3KBMA 4O8RA 3FJLA 2WJEA 4XTIA 1AH4A 3DESA 3VGEA 5I5RA 1IWAA 5FEWA 4GX8A 3U57A 3UJFA 2J7EA 1X8FA 4Q8NA 2EBNA 5HA7A 4UZUA 3I3DA 4M6VA 1HX0A 5CPOA 2IW0A 2HVOA 5AZ1A 1B30A 4LC6A 5LNSA 1OFBA 3BWWA 4BFAA 4DF2A 1R3QA 4C65A 4S3KA 3QSRA 1BG9A 1CCWB 1XDLA 4EP8C 1EGZA 3BOLA 4L6OA 3W7EA 3AU2A 3KWXA 1UR4A 3UYIA 3LA4A 1ISVA 4DUXA 1O1ZA 5PTDA 2BVTA 2IXVA 2I7GA 1I1XA 3GYCA 2Y70A 1Q5MA 3CWNA 3LDVA 1OT1A 3TQKA 1XR2A 4DUVA 1JJKA 3ES7A 2CLKA 2OYMA 1XPYA 3ABSA 2XDFA 2JIWA 5M3WA 5CAKA 3ARXA 4Z1YA 3A47A 2DP3A 3DG7A 4WY0A 3SJ3A 4AZCB 4A29A 3BZGA 4JX6A 1K6WA 3N6JA 2OODA 1RUSA 1J0YA 3STPA 2PDMA 2VC5A 4Y9NA 4FP1A 4NG3A 1OCBA 2ZXBA 3CUJA 3G6MA 5K3VA 3POHA 4ROPA 1CPUA 3D46A 4N9EA 2EAWA 1UUOA 2V68A 3RM8A 1TPEA 3U48A 2VGBA 3RNDA 2GQAA 3WNMA 3K4DA 4YHGA 4RCXA 5DCEA 2VKZG 5DN1A 4J5NA 1V5XA 3NDYA 3PZUA 1ZBCA 4MOZA 2Y5JA 1OD0A 3KAOA 4W5ZA 4JTEA 3E1F1 4FF7A 3ELFA 4QX4A 3NCOA 1CGUA 2R24A 3VPLA 4GY7A 2GUYA 3CUHA 4HYWA 5K9XA 4LRTA 3V0TA 3ARPA 3A5FA 4JOMA 2DUZA 3LZ5A 1RD5A 4DO4A 2DSUA 1DKWA 3N3MA 1MQQA 3S2MA 3MU7A 1TZZA 2YW4A 1XICA 4I9AA 2QIWA 1EGVA 1HQTA 1MNSA 2EEXA 3EEGA 2PF0A 2XH2A 1Q6RA 1IR2A 3ABXA 2GSHA 1J79A 3UZYA 2CHOA 1Q66A 1WBHA 1UUQA 2PS2A 1TO3A 2W61A 3TOPA 5DF0A 4RJEA 2E5DA 1E0XA 4AZCA 3R7MA 3VNMA 2ZICA 1JPIA 1YE6A 3L4ZA 5BNKA 3HPZA 1C9WA 1FCUA 1SGJA 1GEQA 1NP2A 1W56A 3DKLA 3Q4DA 5H6HA 3V4BA 1D9EA 2PAJA 1LRNA 3R94A 3BGJA 3B9NA 2YSWA 2VC7A 5K9DA 1ZPTA 1MWOA 1Z48A 1A0CA 2PDCA 2QGHA 2GWGA 1U5JA 3CHCA 4BKNA 4EPDC 1YX1A 2PDBA 2A3HA 1YBQB 3CAKA 3ITGA 1X39A 3HB9A 5ABTA 5DT5A 3ARQA 3HJEA 2PLMA 1XYBA 3NZPA 3S46A 3OVPA 5CLTA 1I1WA 1TWSA 4XZHA 2PURA 3W37A 4MKNA 3AIEA 2H90A 3HO8A 3W74A 4MWAC 3N15A 1DHKA 2VUYA 4O4VA 4L5ZA 1QK0A 3OVGA 3OG3A 3RHGA 4Z2JA 3C2YA 3QY7A 3C2OA 3W88A 3XISA 3GM8A 1LZOA 3ITYA 1V6UA 4TVUA 3R12A 4C6BA 1R9ZA 1JCTA 3S4TA 1VBGA 2BMBA 4AXKA 3PZIA 4QSFA 3WL1A 4LBUA 1AH0A 1GYNA 3VO0A 4ZSTA 5FJUA 3H2FA 5LIUX 4ZOBA 4WJXA 1L2QA 1O94A 1QMLA 2NLYA 1XI3A 4DJDA 2RJHA 4PODA 3EMQA 1R6WA 2NZLA 2HPMA 1E9IA 2UY5A 4UOJA 3BTNA 1UD8A 2CC0A 3Q2DA 3K8KA 2ZKMX 2CETA 1UR8A 3PZQA 4LS1A 3CQ0A 1YBQA 3CO4A 1O5QA 1HZYA 2NT1A 4FNUA 1RPXA 1GKRA 1K4GA 1N8IA 4EAMA 2XH0A 2OMAA 4I6VA 1A5NC 2PRLA 3ZLGA 2NQHA 1I2QA 5LXXA 2J13A 1MUWA 2WSRA 1BTMA 1E9ZB 4H00A 5C70A 3ZVIA 5BRPA 4OT7A 1ITQA 2PWHA 2OZ0A 3KDOA 1D7FA 1EUNA 4GXWA 2XIOA 4MJZA 3QR0A 2E1DA 3DIPA 2QQ6A 5H8PA 5H8UA 3BW2A 3PPCA 3PTKA 2J7GA 2CBVA 1TMHA 1EDQA 4KEVA 1C3FA 1ICSA 1XHGA 3NM3A 4HPNA 1M01A 1KXHA 1MW3A 1W3KA 2IKIA 3GHRA 2AL2A 2W3ZA 4JIPA 4AMAA 1BYDA 4PBGA 1WPCA 4JN8A 4NL1A 1KM5A 4ICCX 2OEJA 4MHBA 3TJLA 1TMQA 4OHQA 1H51A 5HATA 3PULA 2HWGA 3E0VA 4HK7A 3G8RA 2GYIA 4KEZA 2YB1A 3QV6A 3QTGA 3NQDA 4N4QA 3AROA 2ZRYA 1CB7B 1CGVA 3ANVA 2QVHA 2DVUA 3W26A 3NO5A 2WKGA 1QPNA 4PTNA 2F84A 3BK0A 1A5KC 3CZEA 1T99A 3AS1A 1RBLA 2QLYA 2ZUSA 2PLKA 5E9XA 3UJ2A 3QPZA 3FVDA 2HJPA 3WEZA 4KMQA 3T81A 1DJZA 4HOWA 5I6SA 2ALRA 1NARA 4B3LA 3GC4A 4MAVA 5D9PA 3SCPA 1C7TA 2JQXA 2ZE0A 3E2RA 3UCCA 4W85A 1UUMA 5I3JA 5MF5A 3P2VA 2VZSA 1A50A 1AH3A 3C8FA 5I3IA 2PDHA 4JL2A 3GXNA 4L80A 1TCMA 1TRDA 4LGXA 5CZKA 3H23A 4HU4A 1D8WA 3OZMA 1MEHA 3T0DA 1I2PA 2WSQA 3M41A 1F73A 1QNVA 2PSNA 2R82A 4RV3A 3W75A 1W31A 1W8SA 1R2RA 1JYNA 2EXOA 2Z2BA 3V0UA 3B8VA 2NX9A 3KCOA 1BGAA 2VZVA 3PM6A 2J7DA 3RMJA 3PSVA 1HN1A 3EEZA 2HNEA 1B31A 3M7SA 5F2GA 1MRAA 4OTKA 4C6FA 3IGHX 2C7FA 4KGLA 3W82A 4QROA 1Z9AA 5F4XA 4JY9A 3M0LA 4IP7A 2WW5A 5FAGA 4AW7A 2YYUA 5F2MA 1UD5A 4IX2A 1E9LA 2DW7A 5IM51 4AHOA 1AQ0A 2VFIA 1K9FA 2UY4A 2OQYA 1DTUA 1ZP4A 4AD5A 4LVDA 1M3UA 1UYQA 4QEEA 4DJFA 1G6CA 1Z41A 1XIHA 3UP8A 2VVSA 1PIFA 1E0TA 4GH1A 2XU2A 1V3LA 3WQ5A 3GDBA 4LQ1A 3DEQA 3KLKA 1V77A 5KEZA 3CZGA 1QAPA 3O15A 1Z89A 3B03A 3VX1A 1P0EA 4Z2HA 4HA4A 4MJ4A 5E1QA 3TLLA 4Z0JA 5A6AA 2DZVA 1EWEA 5HQEA 3MUCA 4JL1A 3LLDA 4W88A 3M47A 1XL9A 1Q7ZA 4PUDA 1XKJA 3R58A 1J5TA 3IRDA 3VFLA 6XIAA 1CIUA 3KBWA 5EKYA 4PUMA 2G37A 5HAOA 3AS2A 3HG4A 4IUOA 2V5CA 4GNJA 1P7TB 3PTMA 2ZA1A 1TR9A 1EIXA 1A5SA 1IXPA 1PIGA 3OBEA 4ZO9A 1EF2A 3PWAA 1X8CA 4P8XA 5D9OA 3SI9A 5FJIA 1FWAC 3UT0A 1X1NA 3VCRA 3GHTA 4V33A 3CT2A 1XRSA 3WQDA 2QW5A 5EPDA 3WQ8A 3WQPA 3NUKA 3EKZA 2W92A 1JZ2A 4TVDA