1ZP3A

E. coli methylenetetrahydrofolate reductase (oxidized)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
284
Chain Sequence
b'FHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 284
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zp3A00
1TJ2A 1B5TA 2FZMA 1TIWA 4JNYA 3IJDA 4O8AA 1TJ0A 1ZP4A 2FZNA 2FMNA 3FSTA 3E2RA 3APYA 3E2QA 1TJ1A 2FMOA 3FSUA 1ZP3A 3E2SA 1V93A 1ZPTA 1ZRQA 3APTA 3ITGA 4JNZA
chains in the Genus database with same CATH superfamily
1P0NA 1W9XA 1VFOA 1KNWA 3GS6A 4RR4A 3PJTA 4WKAA 5IM51 2ZDRA 2CITA 2ESCA 5JH2A 4HOXA 3QLLA 3GH4A 4OQVA 2Z1BA 3P84A 4DJED 4OOZA 1QBAA 1W37A 3GXTA 2OVLA 3TC7A 3IIXA 3BV7A 5I6SA 3DI1A 4DZAA 3Q37A 1M01A 3G1HA 2VEFA 3T1GA 3LD5A 2BLEA 1OYAA 1Z6KA 2D0FA 1EGVA 2EKCA 3WLOA 2GUUA 1C7SA 3WSUA 4JTFA 4Z2IA 2VURA 3FEMA 1V93A 3BICA 2PU0A 2Y7EA 2UY2A 5F4WA 3UYIA 1B4KA 3ATZA 4LBRA 4BF9A 3VOFA 3EOUA 2QV4A 2HROA 2R24A 4HN4A 2C16A 2WQDA 3BLKA 2FH6A 2L5HA 3N4AA 5HPOA 1TZZA 3PSVA 1SJBA 3K4WA 4JBRA 1G6CA 4E2BA 2UBPC 3FGCA 3P7YA 2QJHA 1DP0A 3TJIA 2GJRA 3CLMA 3T44A 3IPWA 3TYBA 4DM1A 1XFCA 2CHOA 4U4MA 4GE8A 3AYRA 3PZQA 3BCFA 3NVDA 4EACA 3WNPA 5REQB 3LHUA 2V5LA 2VGBA 2V69A 3KHDA 5BU9A 4JTHA 1HVQA 2J24A 4PMZA 2DW6A 5FACA 2E5DA 4F9DA 3KBJA 4B91A 3N18A 4NJGA 3WQ4A 4BCEA 3BAXA 2ADAA 4AWEA 3GU9A 3CV1A 1PXGA 1TZ7A 4GNVA 3KWSA 3AMGA 4JTKA 1L8NA 4L6OA 5C0QA 3XINA 4XIMA 1AW5A 4JN8A 4E2VA 4Q8NA 5D8WA 1XBZA 4FX7A 2GOUA 4HBKA 3R13A 1XYFA 4UQCA 3BLLA 1QW9A 3W7DA 1FXPA 1GG1A 2IMRA 3KL0A 3LUTA 1QNOA 4DELA 3LMYA 4ZOEA 1LP6A 2R1PA 1I2OA 3BW3A 4JFTA 3RPMA 4UR7A 2GGIA 2BMBA 4D2JA 1F05A 2HEJA 1BRLA 1GORA 5TF0A 3NCOA 5CZTA 3V1PA 1PTDA 3RCMA 4OVXA 3MDUA 2DSUA 5K7JA 3T8QA 4KWVA 3N19B 3H2MA 1TQJA 3LTPA 4WJ8A 1SPQA 3GZAA 2RHGA 1O4UA 4PMUA 3BW2A 4GBUA 3JU2A 4LCQA 3VU2A 1W3NA 4JQ3A 1TX0A 3W72A 3BQ5A 4Q6JA 1TB3A 1MO0A 2PE4A 4I90A 2OEKA 4QX4A 5ABEA 1D3CA 1NSJA 4JTGA 3W1NA 4PUMA 1VF8A 3VKCA 4ZEPA 5AOUA 2BODX 4BQ4A 1LLOA 1PKYA 3UG3A 4XSMA 2GJXB 1PZ1A 4EPEC 1O5QA 3LZ5A 3EXTA 4UOJA 4DO7A 2W4XA 1ODZA 2D24A 2DU2A 3MUXA 3SCOA 4P7QA 3TSBA 1LWJA 2VQTA 1PZ0A 1VEMA 2X1TA 4JD4A 1ITXA 4QQ3A 4LCRA 1WE5A 3W7KA 4TV6A 2E6YA 5JBEA 4GACA 3GHUA 3AXMA 4CQ9A 4QSFA 1PBGA 1TG7A 4QLJA 4J4KA 2ICSA 3MY9A 1OK6A 3OU8A 2EG7A 3MSGA 4L64A 4JNYA 1A53A 3QZAA 2ALDA 4GVFA 5CG7A 2VGGA 1QO2A 3OBKA 2OKOA 1X6LA 4B4FA 3Q94A 3LNPA 4MDPA 1GQJA 3W82A 1J0ZA 1HW6A 3CT2A 8CGTA 3CZJA 1YE4A 3UFYA 1QHPA 2YOCA 4US6A 4Q4PA 4X9YA 5BXRA 2XVLA 1JCJA 2KX9A 1J93A 3GG8A 2YCEA 1C29A 3V0UA 3W6MA 5A6MA 3SCSA 2WCSA 2DZWA 1QNVA 3FW6A 1JJKA 1VPYA 1PKLA 4BZYA 3W1AA 4LRTA 4FOUA 3CQ0A 4PUKA 4B5TA 4AHOA 1JF6A 4LYKA 2DV0A 2FVLA 3IJ8A 4FK9A 4FXJA 3ARUA 3GNXA 2XVKA 4LX4A 1PS9A 3ZFHA 1DWAM 3U5UA 3FGCB 3QW3A 3GC2A 2H9AA 3VKBA 1NDYA 4X61A 1TPVA 2QEZA 3VDGA 4HMDA 3VD3A 4QDPA 3EMZA 1ZBKA 4HPNA 5CSYA 4AIOA 2A3LA 4XD3A 1I2QA 5CPSA 4NYYA 4PEKA 3MKKA 2EKGA 5FCZA 3ZR5A 3VNKA 2EG6A 1SM9A 5XIAA 2QCNA 5L9FA 3L4TA 3R1ZA 1RA0A 1TV5A 1XHGA 2D2GA 4J40A 3N17A 1DXEA 2OWWA 4IUOA 1XYMA 3GR7A 4PMNA 4P5UA 1PIIA 3SBFA 3VCNA 5M17A 2NXHA 4XG1A 3CQKA 1T96A 4JICA 1Q6FA 2VRKA 3U6WA 4MWAE 2ZX6A 5FF0A 4KMQA 1PSCA 2WOQA 4S2CA 3HFYA 2QLYA 3UD6A 4GFIA 2VX6A 2P8BA 1E0TA 3KRUA 1OT1A 5DY2A 3RR1A 3DBPA 2WKGA 4QAIA 3NUKA 2WKJA 1XYAA 2QJMA 3MMTA 3WENA 3O8AA 5CZJA 4AZ5A 2GFTA 6PTDA 1VZWA 2POTA 2OB3A 3LM7A 1N8FA 1S39A 4LBUA 2VGFA 3CO8A 4YWIA 4KEZA 3CZKA 4PCTA 3M1ZA 3MDWA 2E0PA 3IS4A 4ZQMA 1B3WA 1V3LA 4I7VA 1E72M 1EOMA 3MJMA 1OGBA 5KZDA 3B0XA 4WSHA 3ARQA 4IL0A 3CAVA 4H19A 2PCEA 4X2RA 2CWNA 2AL2A 3W7JA 3FJLA 4DPPA 4L1GA 6ENLA 3WN6A 4BA0A 1T7LA 3W7MA 1XLHA 2WLZA 1QNQA 4ZXOA 2JIWA 4XAGA 1UR4A 3W37A 2O92A 4JFSA 2GVEA 1TZ9A 4WOQA 3QGVA 4CVUA 4LY8A 2VDHA 3CM4A 1DTNA 3T0DA 1ZHAA 3M0HA 3W1UA 3OGRA 1J79A 1JXKA 3H2EA 3EKGA 3UF9A 1Y5XA 1A4LA 4FOJA 4I5RA 2G3MA 4PCFA 2YIHA 1TUFA 2IQ0A 4HSNA 2OJPA 4GGBA 2PP1A 4H9YA 4AY1A 3WMSA 4PMJA 4HU0A 1JNDA 4G2DA 4WLCA 5T8GA 3VMOA 3GD6A 3HO8A 1KCXA 1R6WA 2YBTA 2I16A 1K7EA 4Z0JA 3LBMA 2BSLA 1JL8A 1W1YA 6CGTA 1NJJA 4ZGYA 1SFSA 2WMFA 2YXOA 5FJPA 3TNBA 3II1A 4C7DA 1OD8A 3TYUA 4JAWA 2VTFA 4UCFA 5FJRA 3WEOA 3W01A 4LC6A 3F5LA 2WHJA 4YWSA 4JIQA 2QPXA 4IOTA 5IHSA 1K8XA 2PWFA 5HNUA 4IQLA 3TN5A 2OLAA 1RALA 3T4WA 5I24A 2AGTA 5FEZA 1EHNA 3G3MA 2E1WA 2E9LA 4ES4A 1HZYA 4HNCA 2Z7KA 3WELA 2OT1A 2VCAA 3DECA 2HMCA 3H12A 3CK5A 1XRVA 3HJZA 1IEXA 4ICCX 2Y89A 3QC3A 4HP5A 2PBGA 2O9PA 4ZSUA 3UGRA 1H7XA 1JCTA 3DKLA 2SFPA 1UOKA 4X0VA 2QYGA 4QFUA 3L7RA 1GCYA 4CU6A 4R85A 1OFAA 4MB4A 3VO0A 2CPUA 2VI0A 3H24A 4JTUA 4D71A 3EWXA 2JGQA 4GRSA 3PNUA 3E12A 5HATA 1GPFA 2ANUA 3WJXA 4NIRA 1L2QA 2HVNA 4CD4A 2H9AB 3TQPA 1ICSA 3B9DA 3QRHA 4I3GA 1U1UA 4CQAA 5I3FA 3PBVA 1TQXA 4ENLA 4DWDA 3AFBA 1OC6A 4XKYA 3VIOA 1EJXC 1KFJA 4AWSA 1Y5VA 3HQPA 4W8LA 3GHRA 2Q02A 3T05A 1KQZA 4IMDA 5K9DA 2XFYA 4H8VA 1LCOA 4DUVA 5LZLA 3KHJA 3PBYA 1EEXA 3UY7A 4P7NA 1EPXA 1NF7A 1TPEA 5F1VA 4EK7A 2FZDA 3DHUA 4G1NA 3TWBA 4Q22A 3SSZA 4GQ0A 3DZ1A 4NZCA 5F4SA 1KO0A 3UU0A 2BFGA 1KLZA 5BZAA 2IPWA 1CXIA 3DH7A 1AFSA 2ZWYA 1U22A 1W1PA 5I0DA 2DUXA 3NA8A 1E3ZA 3POHA 4P8XA 3A4XA 1SZNA 3TTSA 5FL1A 1I60A 4R33A 1QK2A 2GOKA 3E2QA 5HNNA 2EO7A 4DF1A 5CGQA 3U2CA 1M7XA 5K4ZA 3ZLFA 4HTBA 1YDVA 3PZGA 1ISVA 1AMYA 4JIRA 3M9YA 1GVSA 3BLEA 4HNLA 3S1UA 1M65A 2YLLA 4B5VA 4KGJA 1OFDA 4N2YA 4H41A 4BY3A 1ZPTA 1P6CA 3WF0A 3LA4A 3NL5A 4J5NA 3V75A 1CI1A 2JKAA 1V6VA 1M3UA 3FV9A 4EPKA 3U57A 1BKSA 3B4YA 3K46A 4DF2A 3KW3A 2J74A 3SW6A 4ZFMA 3H7RA 1BSIA 3W71A 2AL2B 4H9XA 4ATDA 1KFEA 4RW3A 2CLFA 2QW5A 3SSJA 4WXYA 3PJXA 2OCZA 4JHMA 1CPUA 2E5BA 3CMFA 3VZZA 5XIMA 3EWUA 4FP1A 2NVCA 2FHFA 1X38A 1FFRA 3W02A 3W1XA 4BHYA 1S5TA 4EX4A 2V5BA 3AHXA 4C65A 3PULA 4B5XA 5U7SA 5DN1A 5M1TA 3M5VA 3PJUA 4E4UA 3DC8A 5M5DA 3H8AA 3ITGA 1A5MC 2Y5EA 4AC1X 4ADUA 1JPDX 4IMGA 2NV1A 3EDFA 2CLPA 4H8UA 4TX6A 1XD0A 3TA6A 1JUBA 4C1NA 1A3XA 1KBIA 1L6YA 1JRBA 2D2OA 1U1JA 2QHAA 5KEZA 3GUGA 5C71A 4RZ4A 5LSMA 4M1BA 4ZXLA 5CLTA 2EHHA 3O6CA 2XFFA 5EFDA 1K70A 4PTXA 3QKZA 2DSKA 1YTDA 4BI5A 4GQBA 4KW2A 2FDMA 4WIWA 3UZXA 4GISA 1E0XA 5EY5A 1Q6EA 5A6SA 3DKJA 3CZLA 4Q3MA 2INZA 5HAOA 1ITCA 1OFBA 3MP3A 3TNOA 2WMIA 2DT1A 3BJFA 4CNOA 1FHUA 1UA3A 3KX6A 1CCWB 1QCWA 4X0NA 3LERA 2WCGA 1E4NA 4G6CA 4M80A 1P1XA 2PWDA 1GHSA 2NSOA 2QCCA 4C6BA 3DFQA 4ICMA 4QNWA 4QTGA 3ZWTA 3OVQA 5L6UA 2YGYA 2DP3A 4A3HA 1LJYA 1HGWA 1J6OA 1WDSA 3GB6A 3DG7A 1P0EA 1ESWA 4QJ1A 2TODA 4P7OA 4CQBA 2I9EA 2ZCGA 4B3KA 4GZEA 4RDZA 4P2VA 1C9DA 3SN1A 3R8RA 4YU1A 4GUIA 1KFBA 2HVOA 1T41A 2OEMA 3RR4A 1GJWA 1GJPA 3P5YA 1I1WA 3MSRA 2PDGA 4B15A 2DUAA 2OXNA 2G4JA 1Z69A 3KBSA 4OJYA 4DM2A 2A79A 2V81A 5CPOA 3PTKA 3GU1A 3VOHA 3TROA 5EMUA 2BVWA 1XQLA 1UR8A 2NLIA 3M64A 2Z2BA 1TTJA 3SIMA 3BGJA 2YFNA 1H7RA 2PDFA 4LS2A 1C90A 5AECA 4MLJA 1FWHC 4NZ5A 3RPTA 3AI0A 2WWCA 4GO9A 2FGLA 3ECQA 4F4RA 3AS1A 4TXEA 1KRAC 1V02E 3RM8A 4I8YA 1J0KA 1RD6A 3AYVA 4NNAA 4PUEA 1SU5A 3VC6A 4ZO6A 4JIIX 5TNVA 1XCWA 2FZMA 3USBA 2J9YA 2W6RA 1VHCA 2Y5SA 3LBCA 3L4XA 2C1GA 3CWOX 2DZUA 2XZ7A 4RNJA 1HKWA 1NDZA 1NDWA 4JNMA 1H61A 1RR2A 3GH5A 1R8LA 4AYSA 2DT0A 5E70A 3DHPA 3OIXA 4ML4A 3ZJ6A 5M2FX 3IJ7A 3GYEA 1XG3A 4B16A 2CIPA 5BWFA 3W4RA 1OBAA 3SCWA 4PMDA 1TSIA 1TMQA 5AY7A 1H63A 4IFRA 1EP3A 4F2BA 1J0YA 2X41A 4NI8A 1UKTA 2V9DA 4Q4QA 5D2XA 4OZOA 1FCUA 2W3ZA 1ISYA 1UA7A 3AO0A 5KTLA 1OABA 1MXSA 4EIVA 3XISA 4M3PA 4NZ3A 5JUVA 2BVTA 1M9HA 3GWQA 3SN0A 2Z29A 1E71M 1LQ2A 1G0CA 3AHTA 4DWSC 3WJYA 1EUAA 2R1NA 4QRNA 2OQHA 5CJNA 3KBWA 4V27A 1UW9A 2PDKA 2VELA 3WZ0E 1GGOA 1KFKA 1TVPA 2EPLX 1RXOB 4DF0A 1SSGA 2Y85A 4Y8FA 4GGHA 3DX5A 1M68A 3P74A 4C1NB 2O9TA 4QLLA 3PPHA 1AH3A 1ZP4A 1HKMA 4C7GA 2J8FA 4O13A 3PWAA 4UWMA 4XBKA 2DDXA 5I23A 1IE7C 3SY8A 5I7GA 4AD4A 1MVYA 4L4LA 2VC9A 1P7TA 3K8MA 4CQ8A 3GYCA 3ZM8A 2HDJA 4B90A 3FAXA 1TVLA 4QS6A 5FEXA 4IP5A 4HPXA 4QJ3B 1UQZA 4D6JA 1M6JA 2WMIB 2B0MA 3OLGA 1JCNA 4HSOA 3VYLA 1Q6CA 3QOKA 1FWWA 4UNKA 5D9NA 3AUJA 3N6HA 3WF3A 4HCDA 3H2AA 3IIOA 1DE6A 2DIJA 4AZ7A 1KR0A 5AC8A 3CUJA 2E8YA 5DF0A 1LBLA 2YW4A 4GIAA 3QQ1A 3GDRA 2PODA 4O50A 3IV8A 2QQ6A 4LV9A 4LAOA 4C6QA 5HQMA 2JIEA 3M07A 4YVXA 3MV01 1UWIA 4TQTA 2DZXA 2HXUA 4GUGA 1WKFA 4JTIA 3VZYA 2CESA 6XIAA 1JPHA 3KXQA 4IPPA 1RD5A 2NQ5A 1UWTA 3H7UA 1UCWA 2QPSA 4C6MA 4OOUA 2HPMA 4PH6A 2X0YA 3HFTA 2UZ9A 2X0SA 3MBFA 4S3EA 4LT9A 1XLAA 3BJTA 1I8JA 4ZB2A 1SGJA 2TRSA 3EKLA 1RY0A 4QCFA 4WEVX 1PAMA 4FIQA 2A6LA 3B9NA 3E0LA 4O0ZA 4MNMA 4HOWA 3AZTA 4FF5A 3BANA 3THAA 2ZTKA 2DT3A 2ZUVA 2WSRA 3B0VC 3KS6A 1RHCA 1GEHA 1GTEA 3WYZA 4Q33A 3GVVA 1H7NA 2CC0A 3KM8A 3S5NA 1FDYA 3MHFA 1A5LC 3MWAA 1SFTA 2IPJA 1TKKA 3ZLHA 3PUEA 3I4KA 3A12A 3TQ0A 5J04A 4I9AA 4MF4A 2BVDA 4MWAA 1AL8A 1XIBA 2BY1A 1JYWA 1LBFA 4UZSA 4K7YA 1FQ0A 3GXPA 4RZBA 2XN1A 4UR9A 1XH0A 5HDRA 4N6FA 3C8NA 4XKMA 2BHZA 4A3RA 5H1WA 3VNIA 2ZUMA 4AHQA 4NJHA 3WFZA 3TTQA 3LB0A 3LOTA 1UD3A 2PDWA 1FHDA 1EC8A 3UCDA 1WUEA 2R9RA 4GBDA 3PWIA 2AAMA 5JVLA 2IS7A 4GI8A 2OYMA 4HA1A 2ISWA 3AICA 3KEHA 3BPWA 1FWTA 4BWLC 2JKPA 1W31A 4Q8PA 3HJEA 2A7PA 4ERGA 4HK5A 3M5XA 3ITOA 4S3DA 4E3TA 4ATWA 1QOPA 1TPUA 2OQYA 3ARYA 1O60A 1EX5A 3NQCA 1QPNA 1ZY9A 4PN2A 2GJLA 5I07A 4CD7A 4YYFA 1XSIA 4ZTXA 1O6IA 5CAHA 1O95A 1E1FA 3I4EA 3W2KA 3W75A 4D8AA 3S2LA 5CSSA 1R0MA 4AD1A 1F07A 3TVAA 4A35A 3KOYA 1E70M 3WJZA 1F3EA 5DMLA 4QEHA 9XIAA 4H7ZA 2ZA1A 2G5WA 1QI3A 3URAA 5I3KA 2Q3RA 4J3UA 1KRMA 2W0UA 2NUYA 3WG6A 5IRPA 3TN4A 1F6YA 3PPCA 3S9YA 1OFQA 3W84A 3BH4A 5JH1A 4AEFA 3PAOA 1XLJA 3T0AA 3WQGA 5LGXA 1KV5A 4JKKA 1EBGA 1TJ0A 3J7HA 2XGZA 3NFUA 2YCKX 1HKIA 1SJDA 4FNSA 4ZQRA 3R89A 2JF6A 1P7TB 5AVNA 2O0TA 1ZBVA 5DCBA 4W89A 5HJYA 1NWUA 4JNZA 1TFVA 3OGSA 5F2MA 3NG3A 4F40A 1JZ6A 1QUMA 5G2IA 4ACYA 3FNDA 5AHLA 3UXIA 3MO7A 4LPCA 2YR1A 1QO5A 2VCBA 2Z24A 2J7BA 2X7VA 1H0GA 4M7SA 1HP4A 5BW6A 4XAYA 1UROA 3IUDA 1ZL1A 3MJYA 3LSCA 4IGNA 2FFCA 2IXVA 1IV8A 2NVDA 3WLMA 1KBKA 3N25A 2JEPA 1SW3A 2EJ1A 2XFWA 2PWHA 4XZMX 1X1NA 3U3HA 3TZNA 3L9CA 3GHSA 3IIVA 1OX6A 4A2SA 4Y8EA 1R7OA 2W66A 2J13A 1W9DM 5JIPA 1UWAA 1YNPA 5C55A 2PCQA 4GX8A 3P93A 2X1UA 1YBQA 4ECLA 4JHZA 1OX4A 1QOQA 4J3ZA 3NTYA 4PODA 5B80A 4ZL1A 2GDUA 1JR1A 4KRTA 3C2RA 1A3HA 1KGXA 4QJ5B 3LK6A 2BXVA 1CGYA 3RHGA 3K8KA 2BXYA 2C18A 4CD6A 1SO4A 2XGBA 1V5XA 3BLDA 5LGZA 2GQAA 4NJIA 4UTWA 3W1PA 1JI2A 2CWXA 2F8QA 1RBLA 2G37A 3V4BA 1Q6RA 3R11A 1H1NA 1QPKA 4XBSA 4O52A 4ZO8A 2BVYA 4YCOA 4PZVA 2YW3A 1FKXA 2IKJA 2V63A 4BS0A 1REQA 3WUBA 1TV4A 4WQ6A 1YTEA 1GYNA 4Y6GA 1IGWA 2XM2A 2JK2A 2VGIA 3C8FA 4F8XA 1K9FA 1FKWA 3PM6A 4ICNA 5JXQA 4TTUA 2PDLA 4MWAB 1ZFJA 2FJKA 1UBPC 1MNZA 4LFYA 1R30A 1VB9A 3NYDA 2Y8VA 4V2XA 4RZ5A 3ZOAA 3EOLA 5H6HA 3LHWA 1E6XM 2FTWA 2INEA 3ZYZA 2VEPA 3ZR6A 4D6CA 1V6UA 4PYSA 1XIMA 1E0WA 1FWAC 4JHOA 4UTWC 3P3BA 1KM2A 3VIPA 5I00A 1IEQA 2G0WA 4AZBA 1ONEA 1QPOA 1A47A 1WO2A 3NVTA 1NP2A 2P88A 4Q4OA 2VL4A 3OZMA 1JGIA 5AN7A 4AQLA 3RO6A 4HU4A 2QVHA 3D5HA 2ZUNA 3VIMA 1GQLA 3EWWA 1NIUA 1RQBA 2YZRA 4W84A 3BE7A 2J7HA 4S3CA 3AS0A 4G1KA 4MNLA 4JY9A 3VK5A 2VZOA 1F4AA 4A21A 2QPUA 5E5CA 4A3QA 4O4WA 1M1BA 3VGDA 4IPIA 4QNEA 1B3YA 2E77A 3CEUA 1PUDA 1JYNA 3R79A 3AC0A 4WVXA 3AISA 1KFCA 2RDUA 2DPEA 1KQYA 2X16A 3ABXA 2CBIA 2OZTA 1TVNA 3W23A 3S0CA 3FN9A 4PTNA 5LIUX 4MFDA 3W2UA 2IQDA 4G5DA 1AJ2A 3FHQA 1EYWA 1JIBA 4FNPA 4QDMA 4HZ7A 3H6OA 4JIHA 4DJFD 3MW7A 4HPGA 5K4XA 4PRWA 2PD9A 4KIEA 2CU0A 1XLKA 3GTIA 9XIMA 4O18A 4M19A 4X2PA 4HYRA 3OJGA 2WZMA 1RCXB 1UPPA 1I0BA 2PF0A 4DO6A 5KITA 1EEPA 1FWNA 4JTEA 3W70A 1C91A 3SCVA 3UWVA 4WR3A 1DHKA 3NURA 1ZQ5A 4GABA 3MMWA 4HNNA 3TJXA 4MAVA 3N6QA 1KTCA 4FS9A 4N0RA 1BFNA 1CBGA 5I79A 2OSYA 1XINA 4PMYA 1XC4A 2RJGA 1B30A 2G50A 2LLEA 2W63A 4P8UA 2A3EA 2ISDA 3TQKA 5FJIA 2ZX5A 2X40A 4PCNA 5LHEA 2ABBA 3EWBX 3V5CA 4I9MA 4I9TA 3N2XA 2D3LA 1G5AA 1UD6A 2HBXA 1YBQB 4NYUA 1XIIA 2J4GA 3BLPX 1UH3A 4N9BA 1OX4B 4L1WA 3HMJG 5AYBA 3LCIA 5TBOA 4OGZA 5BRQA 3VNLA 2WSPA 1XBYA 1MDLA 1OK4A 1VJSA 3S6TA 3T6CA 2PDPA 3WK0A 1N2VA 1E6PA 1LYXA 3E9AA 3S5YA 3GU2A 4HB7A 4J9JA 3MP4A 2CBJA 1DYSA 4IWWA 4S2BA 3NGJA 1A5OC 4RJEA 3B4UA 4IGHA 4WY0F 4L4MA 1TELA 5E09A 5LNRA 2DT2A 1QI4A 1B57A 4GQGA 4UQBA 4UFMA 5ENLA 3FK4A 2XVGA 1JZ7A 1ZTVA 2CLEA 3TE9A 4JFUA 3NYZA 1OYBA 3C5QA 2PDUA 4LYRA 3L4WA 1KV8A 3L23A 4K7VA 8RUCA 3O06A 1WDDA 4A8LA 1X8FA 4LCSA 1Q7ZA 3LGEA 3PTMA 1TPB1 3QZ6A 1FRBA 2ACRA 2J6XA 1PTGA 2F6KA 2VFGA 3P0XA 3PUGA 4NY2A 2CLKA 4IM4A 1BVNP 1DJXA 4R7OA 5TD4A 3QN3A 5KZMA 1YW1A 2JGYA 3B06A 1C7TA 2Z1VA 3PJWA 1D8WA 3RLVA 1J8VA 4C6CA 3G18A 3SGUA 1XLLA 1PTAA 4HCHA 4S3KA 3S1WA 4OE7A 4WOZA 2V67A 3EWDA 3IV3A 4L4PA 4QITA 3UY8A 3WO8A 3PFMA 3LENA 2PURA 3T0CA 1K7XA 4RUBA 5HOSA 4M82A 5EFFA 1J10A 3CZGA 2F38A 4AFYA 2V38A 2D0GA 3WQ5A 4K37A 3BLIA 5LIYX 4O10A 4N4QA 2CLLA 1VCGA 3SR7A 1JPKA 3QR0A 4MTVA 3N34A 4IIGA 2WMKA 1U83A 2X42A 1D8CA 3IJ9A 4IJCA 3RX2A 3SAZA 1DQXA 4DBSA 1XDMA 4Z2GA 1RA5A 4YN5A 3LXAA 3AIWA 3H4GA 4V28A 1K4GA 1IWAA 3WQ6A 1P43A 1K9EA 2FKPA 4PMOA 2FHBA 2W5FA 4L1XA 4LF2A 1X97A 3MHGA 3MI3A 4RE3A 3WFLA 1UUQA 3UJRA 1PYMA 4A22A 1IR1A 1B5TA 4KERA 1H50A 4DLMA 4H3DA 3W38A 2IQTA 3B8TA 5BU6A 3V7PA 4TX9A 4WKHA 2GPTA 2PZ0A 1P6WA 4Q32A 3ITTA 4INFA 4FXSA 3EX6A 1C8YA 1XGZA 4DYEA 1YDYA 4CGTA 1XM3A 3T09A 3SCPA 5A6BA 3SECA 1A49A 1J2WA 4MPKA 2YL5A 4WX2A 4CNTA 4D8ZA 1V51A 5CPMA 2VENA 1KBBA 4GY1A 3VX1A 3KCJA 3AU2A 3TSMA 3S42A 3BUVA 2GSEA 4H8NA 5MF5A 3A5FA 3G1FA 3L21A 3QV8A 2R94A 2TPSA 3GR8A 4OKDA 1MFUA 3WBEA 4MKVA 1LL4A 4GH3A 3UR7A 4DLFA 1DORA 2XH2A 1C8XA 2PP3A 4ZO7A 1BWLA 5AZ1A 2F2KA 1AJZA 4NILA 1T40A 1KRBC 1MUCA 2WNNA 1QXLA 1VPQA 3OYXA 1IXQA 3Q2DA 2WHKA 4PRTA 3URQA 3QYQA 2WBKA 3CAKA 2B7QA 4DPQA 3BJSA 5A8QA 3MYPA 1WOAA 3UPBA 3WNLA 4B9YA 5EBUA 3KE0A 3STPA 4C1LA 3B97A 4JXCA 3CB8A 4MY1A 2EPMX 1AL7A 1W8SA 3AMLA 4BQ5A 2I14A 4Y2WA 3SQLA 4HA4A 3JRKA 4D1IA 5I09A 2Y24A 3ALGA 2XIOA 5HK4A 3EB2A 3BO9A 1PIGA 1XIGA 2GGHA 1F3WA 2XFRA 3L67A 5CBBA 1SMAA 1XBXA 3IAQA 3BLFA 4AY8A 3GBEA 3QEZA 1VJZA 1DVJA 4F2UA 4M8UA 2PTWA 4KT2A 3P82A 4X3ZA 5T9BG 1S38A 4HKPA 4I6VA 5EA9A 4H8HA 4CU8A 4LUYA 1LL7A 3O16A 4LEQA 3O05A 4OFCA 1PX3A 3W1LA 1VBJA 4LTSA 1K6AA 4Q7IA 4D6IA 1YNQA 3E2SA 3LCHA 4LV4A 3UZJA 3L0GA 2HK1A 4IX2A 4TO8A 3U0HA 2BY2A 3HPFA 1Y65A 3W22A 3QW4B 1KGUA 3EMQA 3ITLA 1GVRA 2QCLA 1PKMA 4GUJA 4HMNA 4UQAA 1NH6A 2BOFX 1MEHA 3EA2A 4CEXC 4JZ5A 1NQKA 4DXKA 5DT7A 1YX1A 2RKXA 2IKIA 2G96A 1EA0A 1YRRA 4UTTA 4DJDA 3KRZA 2DH3A 1HX0A 4K36A 3KS5A 1TJ2A 3QVQA 1ZS2A 3R5EA 3EPMA 3SRKA 3IJ6A 3HF3A 3TC6A 1UD2A 1UP3A 3TTYA 3MUCA 1SJCA 3ITYA 3B9OA 5HNTA 4MNKA 1GTHA 1QFEA 3V3WA 2W27A 4LANA 1AW1A 3ANYA 1HKJA 3OTRA 3RU6A 4LS0A 3WBXA 5I3DA 1JRCA 2VOMA 4KKXA 2WVUA 4EAMA 1N8WA 4CVWA 1T5AA 1U5HA 3WNMA 4GLEA 4QG9A 4HHMA 3KDOA 3TW6A 3JUGA 4UFHA 4UTTC 3S5OA 4TMCA 2D1ZA 2QCFA 1E1CB 3I6TA 3UCQA 3GDMA 1TTIA 1M7OA 4Z0SA 1YTKA 1IEVA 4CQDA 4AD5A 1PCWA 6A3HA 1EA9C 1J96A 3QSRA 3MV11 4LH8A 8XIAA 3PUOA 1K9DA 1BGGA 2E67A 3BG9A 1K9TA 1OWQA 4JTCA 5CQ1A 2QF8A 4IPJA 1UASA 4UTLA 1Q45A 4YTRA 1AJ0A 2E9BA 1QRQA 3A47A 1XWYA 3VKAA 1E6NA 1TCDA 4N9EA 1I2NA 2CETA 3H7VA 4GINA 2OOFA 1PDYA 4AX6A 1TJ1A 4GI9A 2VFHA 4I5XA 1TREA 1W1IE 1XGEA 1KFWA 1ZJAA 1PHWA 3NIYA 2ZBTA 3P80A 4FB7A 3FHAA 1MXGA 5GJMA 2FB2A 1Q8JA 1GOXA 2FHCA 3LQLA 5HANA 3DXIA 4HNOA 4JDYA 3LHTA 2W9MA 2J7FA 3M4HA 3VOIA 4WF7A 3F4CA 3U48A 1OZQA 2AMXA 3KUMA 3KLKA 3AIUA 2PLMA 4OU1A 4MPQA 3KFTA 3WFAA 3NO3A 3MS8A 3SIZA 3F5JA 3PZVA 3C0LA 4MGGA 1HXJA 1JXJA 4O1EA 3VIFA 4O1BA 1UBSA 4UOQA 3HM7A 4IICA 2OT0A 4F0HA 1BQCA 3NQEA 4PEEA 4G7EA 3UWEA 3GTHA 1WPCA 1ISWA 4X60A 3UWWA 3CYJA 1XIHA 7REQA 1JNEA 3AHYA 4JYEA 3DDMA 4XISA 4DJEA 3FFSA 1TPFA 4M6PA 1LRNA 2QCHA 4CNSA 2PMQA 1VRXA 3ARSA 3NZ1A 5CLWA 2FZ8A 2BP1A 3HG4A 5K2ZA 1B90A 2YX0A 1UQYA 3WL0A 1HJXA 4Y9MA 1VYPX 3ZIZA 2ZKMX 1V3KA 5C8BB 3VIKA 2NUWA 4H6RA 4PMVA 1PJ9A 2IUZA 3C52A 3A3HA 3GDTA 1Q6DA 2QV5A 5F2IA 1HKKA 1W3LA 4ADSA 3LPOA 4NL1A 4EF9A 3LG3A 1D3HA 2NQJA 5GQBA 3D47A 3SQMA 4BF7A 3VKDA 3FA3A 2J9ZA 4RXGA 1CECA 1K02A 4PA8A 3GFXA 3KTCA 3UJFA 3OLIA 2PWGA 1C9WA 2WC7A 4QE5A 1J6PA 4PRRA 4DAFA 2FGZA 5E0FA 1R85A 2FVKA 1B9BA 2TMDA 4DJEC 2QCGA 1GOMA 3GXDA 4QEEA 2NQLA 5A95A 4AXNA 5CAKA 3KLLA 4AD2A 3LM3A 3TAOA 1LT8A 5D2VA 3NQBA 3IK2A 4Q8WA 5EMYA 1O5XA 5HMEA 3QM3A 3N2MA 1SZFA 3HTWA 1GOIA 3B8VA 3H22A 2BGQA 1AZ1A 1BTCA 2CBUA 4PTWA 3TYDA 3N4EA 5HPCA 3GSMA 2GVJA 2EJAA 3CUHA 3LPPA 3GVRA 4UTIA 1EJSC 3G8EA 1IXPA 1DJGA 1W56A 1ZENA 3G2GA 1H1YA 3UJSA 2VVNA 3TN6A 2YXXA 1DIEA 5DXXA 2Y4SA 4R7WA 3R58A 4LNCA 1F7BA 4AIEA 3IJQA 3HZ3A 3K13A 4I7UA 1IEWA 2OYLA 5SWUA 4RKAA 4MY9A 3BGGA 3EPNA 2VR4A 3BSHA 1O66A 1J01A 3N13A 3ARPA 2CFFA 2PLJA 2Z1SA 3F4NA 4ZB5A 4FR6A 3URNA 1JULA 1WX0A 4J2MA 1G4TA 1G7UA 3BOXA 3L5LA 4WCJA 3TSDA 2WZTA 1HO4A 2Q09A 2XINA 4GC4A 3NL2A 2DZSA 3EDDA 1LQAA 1Y0EA 4A6GA 3JS3A 2B7PA 1K8CA 3L2IA 4AEOA 5D9MA 2ZRUA 1JCXA 3LRMA 4AH7A 1IEIA 1YYAA 1BG9A 1M04A 4GIYA 1RQHA 1XPGA 3EX2A 5HUPA 4GKLA 5AHFA 3GXIA 5BRPA 2E1DA 5I78A 2OYKA 3A3WA 1UJPA 2F84A 4H9VA 3PANA 1GVYA 1GYMA 4NJJA 2GQ8A 4MG4A 1LOQA 1EQCA 1IWPA 1FWRA 3N2TA 1NP0A 1WBHA 3WNOA 4IGMA 2BS9A 2HWGA 4IMAA 2DIEA 4R5EA 3E0IA 2VX7A 4HN8A 2P8CA 4O11A 3AU6A 3GQYA 4EPBC 1J0JA 3FA4A 3JZUA 1K77A 4BQ3A 2ACQA 4K1WA 1R46A 3BK0A 5FF7A 1Z7AA 1RJPA 3HPXA 3G1RA 1OC7A 4AMCA 3W28A 3LCGA 3QHOA 3AROA 3W74A 3SY1A 1NQ6A 2NWRA 4PUJA 4FMVA 4XIAA 4W5ZA 1FVPA 3DHDA 4C6PA 1FA2A 1XV8A 1XRSA 3GG1A 4I5UA 3CUXA 3GH7A 4G7EB 3B9EA 2P53A 2YDRA 4BQ2A 2POZA 1P5BA 1XCFA 3ELFA 3SCNA 3GY1A 3ZSSA 3SJ3A 2I57A 4RDYA 2ON3A 3LI0A 4M81A 1XRFA 3GAKA 4KGLA 3OQEA 2ZUUA 3IGHX 3RNDA 5JBFA 1ECEA 1QASA 3EMCA 5A2CA 2WPBA 2Y0FA 1DHPA 2B81A 4E4PA 2AL1A 1UP2A 3PZNA 3W81A 4R3UA 3MQTA 4NHVA 3VMPA 2HJPA 3K5XA 5I02A 4G8TA 1A0DA 2QKFA 2XN2A 4POCA 4A3UA 1R2SA 5AKQA 3BSMA 4PBEA 4UC5A 1CLXA 4W8AA 4DI8A 4C6DA 2HXTA 3VD5A 3MO4A 1TV8A 4HPHA 5MKGA 5AYZA 3NZQA 3WLPA 5ECVA 4GYPC 5G4EA 4GO8A 3QC0A 1KGWA 4GCAA 5BROA 1S5NA 4UOZA 2WNQA 3QTPA 4NUWA 1PB0A 2NQHA 1XUZA 2ONEA 1Q63A 1EJVC 4ERIA 2Y1HA 2QUUA 3W07A 1JDCA 4L6HA 3O1NA 1UR3M 3D3AA 4HHLA 4GUFA 1CGWA 2GK1B 3SURA 4AY7A 2ZYFA 2A0NA 3MP5A 2GVLA 1V3JA 1UD8A 1OX5A 4UQ9A 5A8PA 5AB3A 3VX0A 3BAWA 1GQNA 2ZFAA 3A9IA 4CEUC 4RLIA 4US5D 1F2JA 1HJUA 1YKWA 4AVNA 5CPQA 3FAWA 4O4VA 4GC3A 5C7VA 2E40A 3INPA 2ZE3A 3KOFA 3UETA 2YYUA 1ME8A 2X05A 3TWAA 4KRZA 4L5ZA 3C0QA 1NY1A 2XVNA 1CENA 3L4UA 3W0KA 1FDJA 1R3QA 3CC1A 4LQ1A 1FH8A 4LS1A 3B8WA 5EPDA 3HQOA 2E7FA 1GZGA 3TYCA 3NSNA 1EJRC 2PTYA 3UZZA 1DV7A 2OX1A 3AMDA 4I6KA 1WDRA 4E2OA 1A5NC 4MWAD 2XU2A 4O15A 1OG0A 1PV8A 4GIEA 3ES7A 3WQFA 3CH9A 3WNKA 1L2UA 3W9ZA 4K8GA 3TJLA 4CD5A 4PL2A 3S83A 5GNXA 1SW7A 4FLSA 2BXZA 5BCAA 4FHAA 1SR0A 3QMSA 2VX5A 2BTMA 2W61A 1H60A 2WPGA 4DNMA 1ZGDA 4LVAA 2ZVRA 4DVOA 2E6DA 3N3MA 1JPIA 2D73A 4D6EA 2AKMA 2GDQA 1QJWA 2EEXA 3GNPA 2FFIA 2PGWA 3S1VA 1EXBA 1TPC1 5KZEA 4KQNA 4W93A 4GYKA 4OV9A 3EB4A 5ABGA 2PTZA 1PWMA 3LGDA 3M7SA 3IJIA 1F8MA 2DJXA 1TRDA 4HQVA 4QBXA 1F3XA 4GXPA 2DSZA 4O57A 4P8VA 2YZ5A 4XAFA 2VWSA 1HP5A 5AYYA 2WM1A 4XVEA 1XSKA 3B0YA 2CEQA 3RDKA 1VFMA 5EB8A 8A3HA 2NQ9A 1AK5A 3ITCA 3ZSTA 5D37A 3CUFA 1E0VA 2GJNA 2Z25A 2Z1KA 3LGGA 5HQEA 1V0MA 1Z48A 2EGZA 4WGXA 3DFSA 3WBYA 1UMYA 1W91A 3SCUA 3ZJ8A 4HA0A 3KL5A 1I75A 3DG3A 5KINA 4NAEB 4UBPC 4TX8A 3MUIA 4UTFA 2HQAA 3KCLA 4B2DD 3USZA 2E09A 4MLRA 2WJFA 2VHLA 3AHZA 4MZ8A 4S23A 3VKKA 3M44A 2I56A 2Y70A 2A5HA 4RPQA 2P3EA 3LPFA 3C6CA 1OB0A 1YE6A 3G6LA 4EOUA 2P50A 1PHQA 2FB3A 1VP5A 5DCEA 4MJZA 1Z32X 4YVVA 1PE1A 3IAPA 3LTYA 3WKZA 1V08A 1KM4A 2Y62A 5IDIA 2ZE0A 1HL8A 2V68A 2E4TA 1R2RA 3EPOA 1SQ7A 1JYVA 1WZLA 3REQA 3OG2A 3FVMA 1WDQA 3PAJA 4J35A 3VUSA 1O1ZA 4Y7EA 4AB4A 1OD0A 1ZUAX 3TMLA 1VLIA 4RX0A 4LNYA 2JALA 1XLCA 3B8IA 3NSXA 4C6OA 1RP9A 1BYDA 1KTBA 2RDWA 4JYDA 4Z1YA 2H3BA 4JX4A 4EPDC 4AHPA 4WZHA 5HA7A 2UY4A 1UUMA 5HWMA 1KD0A 5U4NA 3RRXA 4IF2A 2BGNE 3N3TA 4M56A 4L9XA 4E38A 3SUWA 1XIFA 2PGFA 4AUBA 2F7FA 3O63A 1ZZMA 2AQVA 3APYA 4H2HA 1QVBA 2ZZ6A 3LS9A 4RCXA 2WK2A 2J7CA 4U3AA 1HJSA 1H4PA 3TOYA 2CCRA 1CLKA 3N14A 3WBWA 3SRHA 1VRDA 3I68A 2C8NA 3W00A 1WV2A 4A4AA 1PVNA 2WW5A 4IIHA 5G4HC 1CGXA 3FOKA 5JIWA 4XX6A 2VEMA 3AIRA 1Q66A 1SVDA 5F1UA 3VFCA 2BZNA 7TIMA 3WJSA 3MZNA 3QJAA 1XDLA 1PKNA 4C1KA 3C0SA 2XH7A 2XHYA 1QHZA 4GNJA 5A6AA 3DFOA 3BW4A 1US0A 3SUUA 1MWOA 3RU8X 3EB3A 3A3XA 3BMVA 4PCPA 3EEZA 4FX6M 3TLQA 2WVSA 1C8VA 2GWNA 4DYKA 3SO7A 2NX1A 4Z1CA 1JDEA 3CZ8A 2J47A 1Y7VA 4XZLX 4B92A 3EYPA 4QM1A 1S2AA 4UMBA 5HBFA 1EIXA 1P4CA 3VM5A 1UWRA 5H8MA 3APTA 3KZPA 4O28A 3M5ZA 3SB0A 1SO6A 3S2CA 1I6NA 2PDCA 4RE2A 3HV9A 5I3JA 5DQPA 4IJRA 1NDVA 4EWND 4IPNB 2IXUA 1LOSA 2PZNA 1J0HA 4EWJA 2Z4GA 3CQHA 5EMMA 4QE1A 3AMCA 3RMEA 1JGMA 1U5VA 3G1YA 4WD0A 5TAOA 4HMEA 2F6XA 3WLLA 3NOEA 3NM1A 3FIGA 1QW8A 1TYGA 2GGEA 1R9ZA 2WJZA 1XCXA 5FA5A 3BMWA 5D33A 1SO3A 4XV0A 1TA3A 1XR2A 2J6VA 2PC8A 4Y9NA 5AHMA 3ZJ7A 4XUGA 4PUDA 4UTKA 4D6FA 1R3WA 1UKSA 3V0TA 2WM0A 3BZGA 3WLTA 1LM1A 3QR1A 3HG5A 4OHQA 1AODA 2I9UA 2P76A 3HIJA 4NNBA 4GH1A 1WDPA 4V1YA 3W7QA 4AF0A 2XPKA 3TW9A 1F6KA 1OQFA 3T81A 4GZJA 2WHMA 1TR1A 2OQLA 3ITVA 4D72A 2NT1A 4KWOA 1W9VA 1JI1A 3OGVA 4YPJA 3VGBA 3LDVA 3WLHA 3MSDA 3UR2A 2NQZA 2PS2A 4M6QA 3WQPA 3S5ZA 1Z41A 5HMSA 3F2DA 4URIA 1GEQA 4BEUA 3W88A 1W1A1 1E9LA 4GOAA 4QISA 3HGRA 3TN3A 1AD4A 1BRLB 4U5KA 2JFEX 1R9XA 4GZ7A 3WLNA 1JD7A 3G0SA 1Q2SA 3C2EA 1CEOA 1ONXA 2V8ZA 4WDUA 4FO4A 1UR1A 2Y8KA 3REQB 4MFEA 1DWFM 4GFSA 4HOZA 3ISIX 1VFTA 5E1QA 4OWGA 4ZQOA 5GNZA 1ME9A 4PUWA 4DUXA 4DRSA 3W7NA 1MW3A 1K1DA 3PZOA 3UJ2A 5FAGA 1XC6A 4MZYA 4WKFA 4DBUA 2WAGA 4Z42C 3M0IA 2FZ9A 4JL2A 4OECA 4JGDA 3ZWSA 3F03K 1OT2A 1XKYA 1ZP3A 2W91A 3CMGA 1U5JA 3GX9A 3N4FA 4XAZA 1QW7A 3VNZA 1TMHA 1EF2A 1UP0A 3RILA 4EKJA 3OZOA 5D02A 2YBVA 2XH4A 3VNYA 3O0FA 3DC0A 5CH9A 5B7ZA 3GW0A 4AZCA 4GHRA 2Y2WA 3WF4A 1W8GA 4GKTA 2V5DA 3ME3A 3RX4A 1RCQA 2D20A 4U5IA 4U2YA 3VOCA 2DQWA 1Q3NA 3S46A 4F3HA 4IMEA 1LLZA 1H7OA 4YJ5A 3RJYA 4ZQCA 4FZIA 1CNVA 1SO5A 1IZCA 1YPIA 4DI9A 3N2CA 1PDZA 1UB3A 3QH2A 3QSTA 3G1DA 1Q65A 1TRIA 3DU0A 4PGLA 1S5VA 1Q8AA 1AA1B 3N73A 2Y7DA 3JZEA 4GUHA 1THFD 4LB3A 2Q8LA 1YXYA 4MAZA 4MADA 2PRHA 3W7OA 2CKRA 2YB4A 4PMRA 2XSAA 3V0SA 3U2EA 3NDOA 3TW7A 4XO6A 1ZLPA 1RH9A 4LRSA 3T2QA 4EAYA 3QQWA 1EZWA 2V82A 3VMNA 3PPGA 4GG9A 1TX2A 3RGTA 3SFWA 1CB7B 2ATMA 2WJEA 3GFYA 3FY1A 4WXZA 1VEOA 3EDKA 3R6IA 4UUIA 5CG0A 3G0XA 4H6EA 5HXMA 2C71A 3THDA 3Q4DA 5LYRA 4CNPA 3ABQA 5GJPA 3MYOA 1S2CA 3GIYA 2INFA 5HULA 2GVYA 2J7DA 3SEPA 4O1AA 3CL7A 2X1IA 4PE8A 3SCRA 2I7GA 1R3VA 3UWUA 1ZJHA 3N9KA 1MEWA 3OBAA 4ATLA 1LF1A 2YDSA 2QDEA 3PP7A 2E6FA 2ZOXA 4QG8A 1UKQA 1J4EA 3CIWA 2PPGA 5FESA 4BI7A 2DVTA 4XTDA 4ZA0A 3UJEA 1TA3B 5FEPA 3TR9A 2NV2A 3RITA 1I9CB 1DIKA 3LHYA 3VABA 1E4LA 5A6KA 1DTUA 1OYCA 4JTLA 4B5SA 1J11A 5XINA 5LNUA 1M53A 2VQUA 1IHIA 1XIDA 2GGJA 5DO8A 1F5ZA 3W27A 3TYZA 4M0XA 3BTNA 5IXEA 7ENLA 4AF0B 2UV8G 4ZTYA 4AXKA 2B31A 3IRSA 2GSJA 3ZT5A 3G8RA 2QGHA 4W4QA 1G9HA 3TMQA 1V7AA 1KXHA 4JKLA 3R0DA 5BNKA 2BX7A 1KFLA 3G6MA 5AYIA 1HL2A 3A23A 2KAUC 1L0PA 4W7VA 4QXIA 4CUCA 3IUIA 1K6WA 1T0OA 1WNOA 1GQIA 4ROQA 4XZBA 3HV8A 3TYEA 1OFOA 4AVOA 3S6OA 5FF4A 2C15A 3GM8A 3RCYA 1E73M 4J3WA 1EP2A 3SY5A 1E9ZB 1EP1A 5CPLA 3W1QA 3C4UA 3IWPA 5DMNA 3O07A 2OEJA 4DZ5A 3TCSA 3PK7A 3BURA 1F9CA 4GQQA 3HOJA 1DOSA 5I3IA 4C6LA 5FD0A 2PDNA 1Q2RA 3LZ3A 4MJ4A 2WVVA 4XD5A 1H49A 2A3BA 2OOGA 4S3GA 4YL2A 4UQEA 2VM8A 1X96A 3CHFA 1BPLB 5BMWA 4Q7BA 1UKPA 1V6TA 2HTMA 8TIMA 3CAWA 3CQIA 3G1AA 1ITQA 4MJ2A 2ZC8A 5G2HA 5C9UA 1S2WA 1XP3A 3PPFA 4C90A 1WZMA 3UBPC 1JF5A 3I7QA 1YXCA 4LWWA 3U5YA 5JU6A 4PUNA 2ZZ7A 4Q6XA 5LIWX 5FI8A 5BOEA 3H2FA 4YHEA 3GIQA 3WK2A 4AZCB 3H53A 1BD0A 3RPDA 3QHNA 2WMGA 3HB9A 4QGCA 5C2GA 1ZALA 4PTMA 5D32A 2D23A 3E96A 3S4TA 3VD4A 3UXLA 1UIOA 4LEFA 2XZ9A 1XYZA 1TWSA 3EX1A 1NFGA 2DFAA 3GRIA 3V5OA 4JTRA 1EHAA 4BEQA 3BCJA 5HWNA 3EZ4A 4UFLA 3IVTA 1O5RA 4GVHA 4Y9AA 4PC8A 3LXCA 4CD8A 1XLGA 1LWHA 3WK3A 2CLMA 3ZJKA 1LWIA 2OSWA 5M3WA 2PFHA 3UQNA 3PHAA 1VEPA 4YLWA 4JY8A 1IXNA 4K38A 3U7BA 3WH8A 4L61A 1FCVA 1V7YA 4IG2A 2XWDA 3UXAA 3GTFA 3E74A 3AS3A 2VRQA 2EAWA 2GZXA 3FA5A 4JL1A 1E51A 5LNSA 2GWGA 4YNGA 3L65A 5E93A 3CV2A 3NQVA 3LI1A 1Z42A 3T08A 3ARWA 4NXKA 4KEMA 4HU3A 1EC9A 4J27A 3CB3A 4S3FA 4X63A 1AQFA 4GZIA 3HQNA 4GXWA 2QGYA 1HKVA 5LNVA 4XKYB 3CJPA 3PNZA 4YTSA 5CEWA 4IP7A 5D03A 2O9OA 3NO1A 4W7UA 3WH6A 4NQ1A 3PS7A 4Q4RA 5CKSA 4K8HA 1W5NA 1W9PA 2PDQA 4HZ8A 4A05A 2BV9A 3DGBA 1UD5A 4GI4A 2Z2UA 5FKYA 1ZNNA 3UA4A 1RY8A 4EVZA 3L2MA 3QHMA 5CBIA 1ZSXA 4GJIA 4JTQA 2EPKX 2J88A 2V2DA 4PMXA 3LXBA 1G4EA 1NEYA 3UWQA 4N4PA 2C3ZA 2C1IA 2EPHA 2V5CA 1XKJA 3W7LA 1T99A 4ZENA 5CCZA 5EMLA 1XIEA 1DJZA 4WJEA 4NT0A 4JCMA 1FOBA 2Q8ZA 4AD3A 1MUMA 1CYGA 4DEFA 1W2VA 3M43A 4TUFA 3LLFA 5DBTA 4K1GA 2ZZ4A 4UTHA 5TQLA 4F0MA 1PX4A 3ITXA 3STEA 4NRSA 4UCGA 3NR0A 1GKPA 1MQRA 3I7RA 3UESA 1A5UA 1IF2A 2XIBA 2H3DA 2A4AA 3DN5A 2FZNA 3OIHA 4DWSA 1DKWA 1G01A 3O2LA 1ZAIA 3B8SA 3NSMA 4PB5A 1LZOA 3AXKA 3EWYA 4ACZA 3WLQA 2WMHA 4IL2A 1WB0A 1HUVA 4JTSA 2QMKA 1R38A 3E02A 3G1VA 2WVVB 4H01A 4U33A 4MKNA 2J7GA 4I7WA 4R34A 3MMDA 5FSDC 5ABTA 1EZ2A 3NEHA 5AHEA 3UW6A 5DY3A 4Q7NA 1EPVA 2VYOA 4JEQA 2BHYA 1QMLA 1VKFA 4NI3A 1O1HA 4AIUA 3C3UA 1KA9F 3N9RA 3ONCA 3EBVA 3QGKC 4G7FA 3ZVHA 1Z44A 1P0BA 2VZTA 1Q6OA 2J79A 1IT8A 4L56A 4DBDA 5DRIA 3MKVA 3C86A 2WV8A 2ZUSA 2V3FA 3KTXA 3H54A 5DT5A 1VCVA 4O14A 5CBJA 2ZX9A 1R2TA 4IJBA 5EMKA 4WHBA 3EWCA 3WMCA 3HMCA 4L6DA 1Y8BA 2ZUTA 2C13A 4OIFA 1AZ2A 1E6RA 2NXIA 2P0OA 5A6TC 3PF3A 4RXFA 2PTDA 1K8YA 4H00A 4MB3A 5JBDA 4O8RA 4IIDA 3SCTA 5K3VA 5A8MA 3CEPA 1NTHA 3CIVA 1VCFA 1YDNA 2WNWA 3KP1A 4O0QA 2PDBA 4IXHA 1RVKA 4KH2A 4GVIA 2QDHA 4LAMA 3TXVA 3QKEA 2BBFA 1N8IA 3HBLA 2OSXA 2PDJA 5DRCA 4CCEA 3ZVIA 2RGLA 1BVZA 2OGJA 3WEMA 4Q4KA 3CV6A 3SM0A 5DBUA 1GJUA 2XVPA 3GO2A 3SN4A 4AWTA 1YADA 1JZ3A 5J5RA 2XUCA 2YYTA 3CL6A 3M0JA 3V1HA 5AC4A 2Z6IA 2AKZA 2ZUWA 4IG2B 1XI3A 4FLOA 4HA3A 3WD1A 3UERA 4UIOA 3C2YA 2VZVA 1WUFA 3OO2A 4LUSA 4J7RA 4ORIA 4CNNA 5AC5A 2ZA3A 1FCBA 5A8NA 4AIBA 5FSEC 1VD6A 3S2MA 3ANUA 1OGSA 2PTXA 4W7WA 1KLYA 1FWSA 4PTDA 1OF6A 1JAEA 4MVAA 3I3BA 3W2MA 3F7JA 2XH0A 3O0KA 1DQUA 2XG9A 1S5WA 1XW8A 3BARA 3NPVA 4I8DA 1K3UA 3QY8A 1G67A 3O6AA 2ZDSA 3PY2A 4U3CA 4PULA 2WZIA 3T9PA 4E0CA 1W9BM 3GFZA 4Z1BA 3VM7A 1QAPA 3G5EA 4G56A 3B04A 4RNIA 2DZVA 2WO5A 4L80A 3SFKA 3RG6A 2WWDA 1GYLA 3N15A 2PRLA 1Q5MA 1V6YA 1C93A 3G0UA 4DXXA 4KWSA 3VVGA 1CXLA 1VPXA 1RJRA 2WC4A 2G3FA 2J66A 4MYXA 4NRRA 2ATSA 3SZ8A 4BWLA 4DJFA 4PBFA 1HGYA 2Z1XA 3OG3A 2PWVA 3GLCA 3HG3A 2X7WA 3TJ4A 5DMMA 1WKDA 3LCFA 5CPNA 1NARA 4X9SA 5G5IA 2VC7A 3L12A 2P3ZA 4DX3A 4DQWA 4J2PA 5BWAA 4HVXA 1MW0A 5I3GA 2WXDM 3GR4A 4A29A 1S5MA 4QSHA 1W5PA 2R1LA 3BC9A 4LF1A 5DANA 3GVGA 1SR9A 4Z2KA 5A5WA 2WBGA 3VZXA 4LGXA 4RPPA 3RN6A 4NF7A 4FNTA 3AAMA 4H1ZA 4XZ9A 4XAPA 4DWSB 1JQXA 3L0KA 1Q6LA 4B3ZA 2RFGA 5DMYA 4CKQA 1DL3A 3P5ZA 2OELA 1W5OA 3A22A 1US3A 4ACZB 1QI2A 2E9MA 5A1AA 3EXSA 3UXKA 1LDCA 5K9CA 1VBHA 5AFDA 3THCA 4DJFC 1QATA 2J9XA 3P67A 3MUAA 3C56A 4ZOBA 2BHUA 3STGA 1FDZA 5LNWA 3FXYA 3W2JA 1GVFA 1B4EA 3RX3A 1LRTA 4Y96A 3BDKA 3KAOA 2YCIX 4XWUA 5FAJA 5G1MA 2Q8XA 3N1AA 4O1FA 2GL5A 3ZVHB 5AVHA 1AQHA 3GHTA 4DN1A 4S3BA 4NX5A 4UTMA 3A13A 3VCCA 2AQWA 3PN8A 2YB1A 2PGRA 4CCDA 3DESA 1ZAHA 3NQDA 3PZTA 2VP8A 3WQCA 3CHDA 1R47A 2OWXA 5FJJA 3F2BA 3T0BA 3WDRA 3K1DA 3CUIA 4YTQA 3FSTA 2ZWZA 4IPLA 4HK6A 1E6QM 5E6ZA 1JVNA 2A3AA 3H4WA 3HU7A 3M7WA 1NOUA 2D22A 1NWTA 1OGGA 2VUNA 4NX0A 4IX0A 1NOFA 1ADSA 3GNNA 2ZX7A 1UZDA 4Y90A 3SDOA 1AG1O 3FVDA 1UKOA 1J18A 4P7LA 4MDOA 3PZUA 4LY4A 3CO4A 4N9CA 4N42A 1TWWA 2J8TA 5MHBA 2J8GA 2E28A 2F9RA 1TJPA 4NU7A 1R87A 3QPZA 2C79A 5DXYA 4LALA 1E55A 3S9ZA 2YCJA 5CZ0A 2D2HA 3NDZA 5CGMA 3NJ3A 2JQXA 3WLIA 3LX9A 1GVOA 3MUY1 5FIPA 1E40A 3B9AA 2X1SA 1W54A 4BF5A 3GXMA 5BRBA 4JYFA 3H70A 4C6IA 1ICPA 4R9OA 4KPLA 3K8LA 3U2OA 4HYVA 3FYYA 3TDFA 1GOKA 4B5WA 1CGUA 1CXEA 3LCXA 1R3SA 3RYSA 4O17A 1EJ7L 4LUSB 4L4OA 3DAQA 3GKFA 2ZRYA 4FA3A 2XGIA 1LLWA 1VS1A 3G1SA 3T7VA 4H6KA 2PUZA 1Z3NA 3N2OA 5GNYA 3H2OA 4DBEA 4AG0A 1UMLA 3LHVA 1PIFA 2F6UA 1EXPA 3CPUA 3GG7A 2P5NA 3S8HA 3JR2A 3GG0A 3LLDA 4RV3A 3DIPA 4D8LA 1W3TA 3E0WA 1E5JA 4NNCA 2XISA 1SZGA 3VCRA 2FJUB 2YFOA 1QBBA 1OVDA 2MUCA 3IEBA 1Q6GA 5HJXA 1D7KA 3OZPA 4AU0A 3E0FA 4UFIA 1E6ZA 3VUPA 1VBRA 1LTDA 1BLIA 1HL9A 3EA1A 5I5RA 2DZBA 2VZUA 4P8WA 2HV5A 4P61A 3RCNA 1AQMA 1EOKA 2X2YA 2VC6A 3AOFA 1H41A 3GTXA 2G4FA 4TMBA 2C0AA 1TWIA 3RXZA 4FIRA 4W8BA 5EMJA 3W87A 1I2PA 3B3DA 5FF2A 3AWOA 5C6MA 2Y5JA 1GT8A 2PBOA 4OBTA 5LXEA 1KM5A 4R9XA 1S3HA 3R43A 5E9AA 2F61A 3LNMA 3PWGA 2I5IA 4Q8UA 5J5DA 3DFYA 4UTJA 5LHFA 4NKCA 1PEZA 3BZJA 5AHIA 3V5FA 4NSBA 2W62A 5B7YA 2QAFA 4HIBA 3A4AA 2VMFA 4PB4A 1EKOA 1A5SA 4PFHA 3ATYA 1AW2A 1KM3A 3T8LA 4TTGA 1JDAA 2J62A 2OZ0A 2TSYA 3MCMA 4HJFA 5IBXA 2VR5A 3RLUA 1WOBA 3VAVA 3QY6A 2Z7GA 2VFDA 3OLEA 4Q8OA 1OJXA 3M0LA 2J75A 1LQ0A 3ABZA 1KCKA 2CXGA 5D38A 3NZGA 2PF8A 3DUGA 3PBWA 1FCQA 2OFJA 2HK0A 2QIWA 1UWSA 3MKCA 2ZXAA 2G97A 3E2VA 4XK2A 1SFJA 1RPXA 2E3ZA 2Z6JA 3V36A 2XIJA 3MPGA 1G4SA 2FLIA 3IGUA 1FP8A 3LN3A 5LXXA 1C3FA 4QS5A 2BOEX 2DW7A 3L68A 3K30A 4OUEA 2QAPA 2HNEA 2QDGA 2E68A 1HT6A 1QTWA 4MNJA 1DEDA 1DWJM 1ISXA 2H8ZA 1U2YA 5CC3A 3UZ5A 2ISVA 3HA1A 4G9PA 4JTJA 4W85A 3WQOA 5IBXC 3GTNA 4PFMA 1KWKA 2G8ZA 4UXDA 2A2IA 3QY7A 4HT3A 4L65A 5D9OA 1VQTA 2C7FA 5IDZA 4YYCA 3BLOA 2Y88A 4GY0A 4F48A 1B3ZA 3G3DA 4LB4A 5D2WA 2V30A 2OR2A 4AEEA 2Q01A 4C91A 3VI2A 3MTWA 3RFAA 1UH2A 3PZMA 7XIMA 1MDRA 3T55A 3VDCA 2R1KA 3CHEA 2CHNA 3M6YA 4OT7A 5BXPA 1FH9A 2REQA 1XS2A 1I45A 3H55A 1XDJA 3H26A 1A5KC 3LBOA 3T42A 3WQ8A 3NQFA 3RM4A 1VAHA 2IKHA 5C9XA 1OC5A 1YLVA 4FXRA 1DJIA 3KDNA 3RJXA 3S2JA 3PTQA 5ECUA 4GMEA 1XYBA 1IT7A 1GNXA 2X09A 4KS0A 3UNDA 4J3VA 4AZIA 2XSXA 1KKRA 2Y6ZA 4TOQA 2QS8A 4JOMA 5AC7A 1IYXA 1ME7A 4JX6A 1UJQA 3COTA 1FHLA 3ID7A 2XWEA 4IIEA 4LXFA 4DYJA 3QPEA 5AHNA 1FWJC 3WQEA 1A0CA 1BXNA 3LCWA 1JPMA 1OZMA 4GXMA 3CHCA 2Y7GA 3UPWA 1E4IA 1W32A 3W25A 4N9DA 3VINA 1CDGA 1J5SA 1V77A 1XPYA 2Z00A 3C3NA 4HJWA 3QYSA 3RRAA 2DZAA 3W26A 1PZ3A 1XG4A 3PZIA 1WYIA 1O5KA 2XIIA 1LORA 3M47A 4ZVJA 2DY3A 3AXIA 4MM1A 1X1OA 1YPFA 1MNSA 4ZB0A 3FYPA 2DORA 4FNQA 3PBGA 3WIJA 3CIXA 2AGKA 4C6KA 2FTPA 5IOBA 3CS2A 3MANA 4UMCA 4TIMA 3ZR4A 2TAAA 2I1OA 4IQJA 2WLYA 3E38A 2A21A 4DIAA 3EX3A 2FPYA 1LRQA 2ZZ2A 4FNRA 3UPMA 1FWBC 2J27A 2E6AA 3E3HA 1XL9A 1REQB 1X6UA 2ZZ3A 4ZE5A 3TXZA 1L6FA 3H23A 3WDQA 5I77A 1WBJA 3FKRA 1B9ZA 1RLDA 4GIRA 4H83A 3SGGA 2OX4A 3M0KA 4O0KA 3WDIA 1XJBA 1DWGM 2Y61A 4CLMA 3IGXA 3TFCA 4U28A 1Z89A 5KZ6A 3TP4A 4A8NA 3C2FA 4CQCA 4IUGA 4QDWA 4LVDA 4W87A 3EGJA 1ZJIA 1JFXA 4TU1A 3R2GA 3MA8A 1RJQA 4LVFA 4LBSA 1N55A 5HWJA 2FZBA 2WSQA 4KEVA 1GVEA 1SJAA 3E0VA 3ABRA 3STCA 2GGGA 3UG8A 1DJQA 1IIHA 4AYGA 5D30A 3VKJA 4ZR8A 3IIZA 4X22A 3AIEA 1KCZA 5D4YA 2BY3A 1KBLA 1ZAJA 2PRMA 2OTDA 3NQ7A 2WVTA 3HGOA 1V0NA 5AYXA 1B3OA 1Q85A 2R8WA 1BWVA 4MY8A 3LRKA 3AYSA 3WX7A 3V16A 2PAJA 2XJ7A 3LQGA 4GVGA 2CNCA 4LVGA 4HU8A 4ZSTA 3W76A 2WZHA 4IIBA 1IWBA 4S3AA 4NZFA 1DWIM 1LG2A 1GVQA 3QV7A 4FR1A 4MJMA 1VH7A 1IGSA 1KRCC 4B4HA 3VDBA 4GK8A 1EF3A 4LUIA 3OW1A 1E0UA 2A7NA 3DFPA 3TZFA 1EDGA 3JVAA 3P0WA 5F2LA 2D2JA 3BV4A 1RVGA 1MW2A 1KKOA 3DI0A 1EO7A 1Z8AA 3QPYA 1E5NA 4O54A 1BXCA 3DEQA 3TC3A 3OVPA 1OG6A 1QT1A 5EYWA 1UWUA 1BGAA 1RPKA 4PBGA 2CERA 3GVWA 4KWWA 3M6DA 4NASA 1IZKA 2QCMA 3T2OA 4HD5A 4XD4A 1AUSL 3VOGA 3C2OA 1JCMP 1V4YA 1V0LA 2J25A 1JZ8A 1NELA 1ADDA 4YCPA 2QUTA 3FLUA 3NZPA 4QIUA 5HR7A 2REQB 2H90A 4GJ1A 1UR0A 4KFNA 1E3XA 3PB0A 1GONA 4FF7A 4KWUA 3QR3A 4L7ZA 1EH9A 3M0ZA 1E15A 1F73A 4WDTA 1KB3A 2Z0IA 2PP0A 1FXQA 2BGSA 4WGHA 3TLLA 4JFWA 2WJDA 5T26A 1D3GA 4YVPA 3OB8A 1CWYA 2OODA 3A4WA 1TTPA 2XN0A 2OLHA 2D69A 4M1RA 5A69A 3I65A 3WQWA 4WJXA 3S5SA 3D46A 4JFVA 4DO4A 3P81A 1TPWA 2WYSA 1D2KA 5C70A 1FX6A 4YXGA 4FPSA 1OIFA 3CT7A 5A2BA 1BSLA 4WSKA 4HK7A 1DWHM 4ROPA 1OEPA 1MZRA 1NWRA 2GQ9A 2FPTA 4XZHA 2HISA 1K8ZA 3M16A 4MSSA 1N82A 1B2YA 2HPIA 2D0HA 4AX7A 3W7CA 1CZ1A 4IFOA 1CXKA 4M6VA 3TV8A 2NW0A 3Q58A 4LYQA 3APGA 3TQVA 5DELA 1HIZA 1OF8A 1VBUA 2OLSA 1RLCL 3E1F1 3B8UA 2QZRA 1CTNA 4IIFA 1EJTC 4TVUA 3AALA 1B31A 1BF2A 2FDSA 1XLBA 1V0KA 3NGFA 3A6OA 3O3RA 3WUEA 4WDWA 2G95A 1B0IA 1L6WA 3ARRA 4D9PA 1XYCA 1M41A 2PGEA 4IMCA 3AYTA 1E9IA 1WDWA 3IK4A 5CC6A 3HPSA 4A8IA 1ZRQA 2VCCA 3AS2A 3SRDA 2G3JA 4UZUA 3CTLA 4EXQA 1POKA 5K9XA 3DHFA 5E0KA 5I03A 3ZZ1A 4K68A 3EKZA 3MVTA 4MYAA 1NAL1 3NOYA 1XGDA 1A50A 1KW1A 3STFA 5BMXA 2A3CA 4UR8A 4XTIA 3ZO9A 2HBVA 4QLKA 2GJPA 4JTDA 4MB5A 1TMLA 4UQDA 1UHVA 4YS1A 3BOLA 3LU2A 1T8QA 3V18A 2O56A 2E8ZA 1D7FA 1R9YA 4WK9A 3RO8A 2Z28A 3C2VA 4C6NA 4PB3A 3AHVA 3VE7A 3MI2A 5D2TA 3KBVA 1EO5A 1FFQA 1XD1A 4GQRA 1X6NA 3W29A 2R14A 2VDGA 3NPXA 4JQ2A 1P1MA 3OLDA 3CLWA 3UZWA 3AXXA 3NQMA 4M24A 2PB1A 2BASA 4JDBA 1W3IA 4IISA 3W7IA 3E49A 4TV5A 2ZRZA 1NU5A 4J3XA 2Q3OA 4KCTA 2VDIA 2CBVA 3L0NA 4H9UA 2QJIA 3SCQA 2P1FA 5E0CA 1YNYA 1TR9A 2CZVA 4IFKA 3WF1A 3FEQA 4HSHA 3I10A 1F61A 4CU7A 3S47A 2OG9A 5AC6A 2NLYA 3M0MA 4GX9A 3P62A 3FYOA 1NOWA 2Z26A 2A85A 1BQGA 5FJOA 3LV6A 5HUOA 3GW3A 3K2GA 1JZ2A 2PWEA 5CC5A 1FTXA 3NWRA 4O1CA 2NT0A 5CZKA 4DBWA 4LYPA 3UT0A 1BYCA 1TPH1 1B54A 3IVSA 1IT0A 1QNRA 2NX9A 3BAIA 3U8GA 3H2CA 4ZOAA 3A4JA 2QJNA 3VDHA 3VDAA 1MRQA 4M29A 1W1B1 3BAKA 4DZIA 1FUYA 3QOMA 4JTTA 4DB7A 3SQSA 4PR4A 3WUGA 2XIQA 3DFHA 5D05A 5BOFA 3VNJA 1A4MA 3CQJA 3FCPA 5C2XA 5HR6A 5G1YA 5EKYA 5BXSA 3GBDA 3NPUA 4UNIA 3BWWA 1SUXA 2V5KA 2VXNA 4FLRA 3NM3A 3TONA 4HZ6A 3BL3A 4AMAA 1VFFA 3E5BA 1YHTA 2VNCA 1H7PA 4HCLA 3GNOA 4XZWA 4MB1A 3PZ9A 2ZX8A 3SRFA 1MFVA 4LUJA 3SUTA 4IGSA 1MQPA 1XLIA 2PDXA 2ACSA 3B03A 2WKLA 4ZE4A 1J5TA 4F66A 4AW7A 4RNHA 1VHNA 3DYOA 3KZSA 1TO3A 2XYLA 4FX8A 7PTDA 3BVJA 3EAUA 3OZYA 1E9YB 5I2UA 3OVGA 3B05A 3M0VA 3GVQA 3WBAA 4S39A 3VIHA 2FYMA 3K4AA 4US5A 3VGGA 3GC5A 3VE9A 1LOLA 3ARVA 1WXJA 1H1ZA 4JTAA 1W17A 1BWKA 4YMZA 3A5VA 1Q7QA 1X1ZA 4H7CA 3ARXA 5I3HA 1WKYA 3YPIA 4TVCA 3DFNA 4U10A 4Q8VA 1YPXA 4QP0A 4YIWA 2PU1A 1POJA 3BAJA 4BJHA 2YA2A 3OHMB 1JYXA 4D6GA 3OYZA 4JN6A 3R0UA 5GJNA 4JS3A 1JG9A 2CHRA 2DUZA 3S2NA 3UA3A 1AMKA 1R3TA 4RW5A 1O7AA 1QNSA 3OP2A 3AIQA 5CZSA 3W1RA 3WUFA 1ELSA 4BR1A 1LL6A 1I2RA 1R7AA 1YDOA 2VOTA 5A3HA 2QUMA 2VR2A 1VFUA 2UWFA 2YA1A 2P10A 2W67A 4EP8C 3CL8A 3ES8A 1HF6A 2A6NA 5C7HA 3L5MA 4WSJA 1OY0A 2EXOA 1WQ5A 4C60A 5DLCA 3QV6A 2DIKA 2PDMA 2BNJA 1NVMA 3MB9A 3UVIA 4NJKA 2YL6A 2ZVIA 1GWJA 3NEVA 3IUHA 5FJUA 2OU4A 5FF3A 1EDQA 1A5CA 3W53A 3L66A 1PL9A 4BK9A 2ZZ1A 5C54A 3T40A 1H62A 3NNTA 4FI4A 4REQA 1RBAA 4F0SA 5FL0A 3WDJA 1N7KA 1QU4A 3HN3A 1ENUA 4OBSA 4QQUA 1RK5A 3BCDA 5HNRA 4E2DA 1HJVA 2FQIA 1G4PA 4LSBA 4DHGA 1RP8A 5LIKX 1DPMA 2Q71A 4QCEA 4YTUA 3CMJA 4MWAC 2UY3A 2WSYA 1QWKA 1WXZA 2CW6A 1CIUA 2QF7A 2ISSA 4MMWA 3EDJA 3MHUA 4XZIA 1JQVA 3BG5A 3PVFA 3RK8A 1CW2A 4FNUA 5D2YA 2PDHA 3FSUA 3WLKX 1FWDC 4H4IA 4ZFCA 4N02A 3OA3A 1HVXA 4IFKB 4KEUA 3FS2A 4U31A 3NQ8A 2QCDA 3LYEA 3VNDA 4MOZA 1RBOB 3AWNA 5DCDA 3WLSA 1B1YA 3B0UX 4AWUA 3CWHA 3FX4A 1TJRA 3NDYA 2E5CA 5GPRA 4B2DA 4N7QA 4F0RA 4KCWA 4R88A 5EGRA 3SUSA 2YJQA 1LG1A 4GD0A 3KVKA 3ICJA 4CN6A 2GYIA 5CXPA 4WUIA 3UG5A 3ALFA 5BXTA 1UC5A 2HE5A 4RDWA 1EC7A 3M0YA 3G1XA 1XXXA 2VFFA 1CXHA 1UR9A 1FP9A 2XTKA 1Q4WA 2V2CA 1UUOA 3CNYA 2XDFA 2ZQ0A 5LIXX 1SZEA 2RH9A 2VKZG 2ZIDA 2VD8A 1OCNA 2VX4A 1NFBA 3F5KA 3EWZA 2V3DA 1R5YA 3AQUA 2FGBA 2ZXBA 3MT1A 3WY1A 3E5PA 3NXLA 1Q7MA 5FEWA 3RLGA 1G69A 4DWSD 2QCEA 1W2PA 4E8GA 3UG4A 2PWUA 1S46A 2YL8A 3PG8A 1LROA 4R27A 1W0MA 1EJWC 4J3TA 3WMLA 4C5ZA 4JQ4A 1ECQA 1EJUC 4Q8QA 2OO0A 4ZMGA 3R4IA 2WZEA 1Q6QA 3EDEA 2OKTA 2ACUA 3QXBA 3LEPA 4PL1A 3B40A 3BG3A 3KVJA 1UWQA 1F4HA 1BF6A 4ML9A 3LTSA 2R6OA 3R94A 1VFLA 3AXHA 3WH5A 3UP8A 4QR6A 3VILA 2RGMA 4O53A 2PLKA 1DXFA 3HG2A 3PG9A 3VOJA 1ALDA 3OPSA 2BY0A 1ZU8A 4FOKA 1P6BA 3R10A 4J3SA 4A3YA 3NAVA 1X39A 3ARTA 2RDTA 2Y63A 1Z9AA 3WDHA 3OQ8A 3SGZA 3GKAA 5C5YA 1S3TC 1GZ1A 1KWGA 2YDQA 1GUVA 3P6LA 1TV7A 4HHPA 1JDFA 3PR2A 2CLOA 2IKGA 1OCJA 4DO5A 2ZRWA 1HO1A 3CZEA 1E4MM 4GYPA 1UR2A 2ZTJA 1QI5A 1GW1A 1ONRA 1V3IA 3W7GA 4DUWA 2PEVA 1AD1A 1V8EA 1YQ2A 7REQB 4ASTA 1OSEA 4JIEA 3GDBA 3Q45A 2AAAA 4WDXA 2V2HA 1VENA 5H8UA 3GDKA 4HNTA 1TUXA 1H5VA 4IT1A 3B8DA 4CN1A 1MRAA 1DIOA 4GA8A 1O94A 2JF7A 2O55A 3N12A 4K39A 4W88A 3T2PA 1FBAA 1SFLA 3VPLA 1QPQA 4JN7A 2VT0A 1BG4A 3OHIA 4E8DA 1IXOA 3HQ1A 4U2ZA 3RAOA 4LUTA 1EFZA 1HNYA 2Z1WA 1J9YA 1J2BA 5J8LA 1XF0A 4S38A 3QMTA 2PDYA 3P2VA 5G2WA 1XLDA 4BFAA 2UY5A 1BKHA 3DYMA 1F8IA 3KL3A 5CJMA 3TFXA 3K1GA 3VTRA 2VO5A 3WK1A 1V3HA 4ZZ9A 3HURA 4REQB 3L4VA 4EXAA 4AAJA 4ZCWA 2HS6A 1W3HA 3OEXA 1FWCC 4Z2JA 4AZ6A 4PTVA 3SJNA 3TU9A 1KCLA 3JW7A 3W1MA 4D6HA 1AQ0A 2OPJA 3QFWA 3E2RA 3FXGA 3L4ZA 5KETA 2DSVA 3AJ7A 2ALRA 5KMYA 3S3GA 2OO6A 1BHGA 3R8HA 2W92A 2Q6ZA 3KTSA 3ZT7A 1MUWA 4HMCA 4H04A 2WSKA 3MSYA 2NXGA 1V79A 1XIJA 3BAYA 5FJTA 2Y8UA 2O7SA 3P8JA 1U1HA 4JQAA 1XLEA 2G3NA 3DYPA 4LAKA 3GZ3A 1KM6A 2WB5A 3U2ZA 2WHLA 5H2ZA 3THUA 4HHHA 3XIMA 3G22A 2C6QA 1W1ZA 3UGVA 3MCOA 2QCDB 3WEZA 5H91A 2FVMA 5IHRA 2ISFA 2IPGA 2OZ8A 3KBMA 1DQWA 3FJ4A 1HFBA 4EXBA 1EX1A 3UWYA 1UG6A 1ITUA 5HMDA 9CGTA 1GOQA 1GPWA 1DE5A 2WNZA 1EWDA 2ZC1A 3IJLA 4QE4A 4V1XA 1IQ8A 1V3MA 3MBDA 1VC4A 1GZJA 1XBVA 4V15A 4DZHA 3N29A 3EXRA 1HN1A 1G94A 1H5YA 1W6TA 3LMZA 1EWEA 1BVWA 4M5PA 3W6YA 2R82A 5G1TA 3KWXA 3DBNA 5E6YA 3ZT6A 1UIPA 2PLCA 1KXQA 4ZO9A 1MZHA 3A9BA 3U4AA 2AQOA 5A6JA 3WL1A 1K4HA 3R7MA 3O9NA 4F0KA 4FSAA 2DZTA 3K4DA 4B3LA 3CUZA 3BSGA 3TX9A 4QJ4B 5CPTA 1RUSA 4GYFA 2JBMA 4ONVA 4H9ZA 3DFTA 3KRBA 4IQEA 1W3JA 2HCVA 4IZGA 1T6MA 3O7UA 2PD5A 3PC0A 4EE9A 5EBAA 6REQA 4KESA 5CC7A 3UNTA 5KSWA 3OODA 5F7UA 3B0PA 3RIKA 4KBXA 3CUGA 4HNUA 3DENA 1UC4A 3M5YA 2ZZ5A 2RDXA 2DQXA 2VVSA 1P0DA 2WQPA 7ODCA 3S9IA 2J77A 1AH0A 1JEZA 3GXNA 1XISA 1UH4A 4KFOA 3KRSA 2GQ3A 3CTTA 3MI6A 1JAKA 5DFAA 4CCCA 3MMUA 3UCCA 4LAZA 4UNLA 4NXSA 1PWLA 3L2LA 4NAFA 1RV8A 4RZ6A 3TTOA 1KXVA 3ARZA 1JFHA 4NZ4A 4FEZA 4Q4MA 4IHCA 3THQA 2EBNA 1TV2A 1S2TA 3ERPA 3N9SA 3F4WA 1FY6A 2YDAA 3WD2A 1XX1A 5LA0A 3DERA 3IACA 2HRWA 4OTKA 2EPNA 3S1GA 3VFLA 2AOSA 2C19A 1L8PA 1SZRA 5LKYA 3U7VA 2CLIA 5A94A 1TWDA 1TE1A 1GOOA 4MUPA 4P7RA 1S1PA 1GKQA 3O6DA 2BB0A 1G1YA 4O12A 1MXDA 4EANA 3BXWA 2OMAA 3AIBA 4CNUA 3WMBA 4M6UA 5EL1A 4QROA 2V3GA 2QVNA 3VGHA 1KR1A 5ABFA 2V6AA 3WF2A 2DJLA 3MZ2A 1V02A 4NZ1A 1OFRA 1UYQA 4LUTB 1D9EA 2ASHA 4F9JA 3MC5A 1VLWA 4RE0A 4ZBCA 4Z1AA 4JQ1A 3CHVA 1M7PA 2AMGA 5F4XA 2XIMA 3LY0A 3WH7A 3UR5A 5MKGB 3RUBL 4PUUA 1OCBA 4O16A 3S6DA 2NZLA 2HE8A 5CGTA 1M03A 2EQDA 2NVAA 2XSBA 1VYSX 7A3HA 1A0EA 3M41A 2HSAA 1CXFA 2DVXA 3VIGA 2YBUA 4Z08A 1H3GA 3TA9A 2GLKA 2ZXDA 2YCLA 3MUZ1 4DY1A 2QJGA 3MCNA 1JUKA 2QJJA 4JEJA 1TCMA 3TUUA 1EIBA 4IQDA 3W2NA 4PMQA 3CPRA 1CGVA 1LBMA 1V6XA 2RAGA 4K8EA 5LA1A 3G24A 1FWEC 5C9WA 1VGAA 3ZMRA 1DBTA 1UZ4A 2PA6A 2VZSA 4CN4A 2GUBA 1LT7A 4RE4A 1S2UA 3UXDA 1BAGA 3QBUA 4F2TA 4Y9PA 3F4VA 2HVMA 2BG5A 1V6WA 1L6GA 4BI6A 3FDKA 4IXXA 1PCKA 1DJNA 1A80A 1CX9A 1E1CA 2JEQA 3GAYA 3I6EA 4KIRA 3P60A 2NX3A 1NM9A 2BDQA 4XO7A 1RCOB 4AZHA 3QFEA 3W2LA 1WAWA 4C6FA 2PC4A 3N2BA 3VC5A 1I4NA 1KXTA 4LW7A 5HINA 1ADOA 3W6LA 5HMFA 3ANVA 2Y7FA 4C7FA 3CASA 3P14A 3F2CA 2X8RA 1F76A 1PO9A 1A5AA 2YL9A 1ODUA 3S1XA 4DAIA 1CLVA 3TK7A 4ZODA 1EUNA 1EDTA 1VIZA 2X2GA 1NWSA 6TAAA 1FH7A 3UR8A 1ZJBA 2CZ5A 2ZICA 5RUBA 1GOWA 4MHBA 1X7IA 2FPVA 3WJWA 4E5TA 4GI6A 1L9WA 3UYCA 1VJIA 4OV4A 5C2CA 4V33A 6REQB 1OCQA 2FMOA 3NL3A 3RF9A 1DIDA 1EGMA 1IR2A 1P0KA 2VWTA 2MNRA 2WMJA 2BOGX 2VFIA 1MMFA 3W85A 1QI0A 2B7OA 4XZNX 4AVFA 3BQ6A 2RJHA 3NQAA 3ABOA 1M5WA 3PTDA 3W1TA 2Z2AA 3Q65A 2GUYA 3ONBA 1X8CA 3HGSA 2OGYA 4LOCA 4YHGA 1C8QA 2HS8A 3WLJA 4ILSA 4XSLA 3EEGA 3CV7A 3GXFA 3ZS4A 4IMFA 4NAFB 4Y9OA 3CWNA 3LHZA 1AVAA 3BOFA 4KFPA 2DVUA 1E56A 4KCVA 1OHLA 3OA5A 1A5BA 1CT5A 1O68A 4XVDA 3TEVA 3ENLA 1PZ2A 3MWCA 4XUYA 1VBGA 1QNPA 1ZBCA 3N11A 3P8IA 1BYAA 3D0CA 1R86A 1ISZA 1KM1A 2QNEA 2GDVA 2YA0A 4F0LA 1FHVA 2IW0A 1XFBA 1KM0A 3AIVA 3VA8A 7TAAA 1DJYA 4J1OA 3ZXWA 3GIPA 4HNVA 3GE7A 3WH9A 4M7TA 3IGSA 1EBHA 2NSXA 2VEGA 3A24A 1FWGC 3OVRA 3FKKA 4TVDA 1BTMA 3AJXA 1OFEA 2VD9A 1MSSA 1U33A 2X30A 5ABFB 2EF9A 1JDDA 2F2HA 3E6EA 3OOQA 2KZHA 3RM9A 3TYAA 6TIMA 4FXFA 3I3EA 3PBMA 1XH1A 4HTYA 3TKFA 4KETA 4B5NA 4UFKA 4JKMA 2W79A 3WCZA 2V0TA 1OM0A 1IZJA 3ABSA 5A8GA 3AZRA 3TCEA 2DGAA 3R25A 4GWEA 1EB3A 3FJ6A 3CBWA 2VEIA 1JZ5A 4JR5A 7CGTA 1LUCA 4W86A 1JZ4A 3PB2A 1YMYA 1S2VA 4L9YA 4S3JA 4KRUA 1JCYA 1WCGA 1XYLA 4E3VA 5JMUA 2VFEA 3AUOA 3IJDA 2FH8A 3O6YX 4PCSA 2ZADA 2VEKA 2CZFA 4IP4A 3W83A 1ZCOA 1MQQA 2DZPA 1HJWA 2YCLB 3BMXA 3W7PA 5JQ9A 1RSCA 2PDIA 1H7WA 1CB2A 3SUVA 4W9TA 3SADA 1WXYA 4A8RA 1K7FA 2RUSA 3CAQA 3NPWA 1NFPA 4JCLA 1RK6A 3IARA 4RK8A 3GNDA 3VGEA 3VIJA 3QGAC 4AC7C 1VYRA 5GVJA 5BOOA 1X98A 2YKKA 1H51A 1YXDA 3UWZA 3TH6A 4LU0A 3AZSA 4DXVA 4NP7A 4WRHA 1BYBA 1ZB5A 3T0TA 3LSBA 1PPIA 3QZEA 1UPMB 4M51A 1E43A 1EGZA 1P48A 3W73A 3NQ6A 2DH2A 2FTYA 1MW1A 3PFRA 4F79A 1HG3A 4DJDC 4D1JA 2X1RA 4LJ3A 2C91A 1GG0A 3Q67A 2ABAA 2TYSA 3D6NA 1JCLA 4NZJA 1KC7A