1ZP4A

Glu28gln mutant of e. coli methylenetetrahydrofolate reductase (oxidized) complex with methyltetrahydrofolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
282
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFQFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPGPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 282
sequence length 292
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zp4A00
1TIWA 3APTA 3E2RA 2FMOA 3IJDA 2FZMA 4O8AA 4JNYA 3APYA 1ZPTA 2FMNA 3FSUA 4JNZA 2FZNA 3ITGA 1V93A 1ZP3A 3E2SA 1B5TA 1TJ1A 3FSTA 1TJ2A 3E2QA 1ZRQA 1ZP4A 1TJ0A
chains in the Genus database with same CATH superfamily
1GJWA 1SZRA 3K1DA 4KS0A 2MANA 1NOUA 2QLYA 5EMJA 3B97A 1XPYA 3UPWA 1UIPA 3LXBA 3LM7A 5HAOA 1PE1A 1PHQA 1X6NA 2D0HA 4GNVA 1W5OA 5E5CA 4NASA 1WP6A 3FA5A 2HVMA 3HTWA 3F2CA 1B3OA 2A85A 3PUEA 1Z9AA 1F4HA 4C6KA 3SFKA 1DJGA 3CQ0A 5FAGA 4ZR8A 1X96A 2KZHA 4N2YA 2TPSA 4Q7IA 3BLDA 1Y7VA 1YPFA 4GJJA 1XX1A 5JBEA 3BCDA 3WFLA 4WKAA 1UBPC 2NX3A 5C2CA 1JF6A 2F9RA 1R46A 1Q7MA 4HCDA 3Q65A 1JAKA 1I75A 5A6MA 1H2JA 1MFUA 2VKZG 2KX9A 4C6MA 4MB5A 3TR2A 9RUBA 2WB5A 2CLHA 2WSRA 3QMTA 4B5XA 4S3DA 1PTAA 4M1RA 1M7XA 1DJHA 4MHBA 2NUWA 1NWUA 3VX1A 3GDMA 1UP0A 1O7AA 3CUXA 1FTXA 1YXCA 3CUIA 4E8DA 1ZBWA 4DYKA 3SCSA 5F1VA 4Q8TA 2W67A 1XL9A 3MUY1 3TC6A 1F07A 3B40A 2BX7A 2R6OA 2GVYA 4QLLA 5JH2A 3TA9A 4NXSA 5I07A 1XBYA 1S1PA 3F2BA 2BZNA 5ECVA 1LBLA 1HKMA 3P82A 5G4HC 1GVFA 2ZA3A 2V3EA 3P0WA 4C6FA 1AK5A 5E0FA 2DJLA 1SO3A 5E1QA 1MQPA 2ZZ3A 1PYFA 1K9DA 1A5UA 1XR2A 1AUSL 1PS9A 1U5VA 2Q8ZA 3FSUA 3VZXA 1VCGA 2PDFA 4ZE4A 2F7FA 4DWSC 3K5XA 5C5YA 3G24A 3BOFA 2WM0A 1FDJA 4KW2A 4DPPA 3GG0A 2Y8VA 3QHOA 2YA2A 2Z29A 3EWBX 4X2PA 1D8WA 1EUAA 1GQIA 3T42A 1R3YA 4IIEA 2QW5A 3MUZ1 1JCLA 1LCOA 3S2LA 1WDPA 4IT1A 4IP5A 4W7UA 5EMKA 1Z48A 3KOXA 1JCTA 3O7UA 3LHVA 1BD0A 4B3ZA 2WLZA 1SW0A 2A6NA 2ZUSA 4Y7EA 3UYIA 1EA9C 1M9HA 1JGIA 2W6RA 3QC0A 1REQB 3UGRA 3GR8A 1I0DA 3WYZA 3G1RA 2PLMA 4M7TA 3WENA 3AYTA 1WUFA 1AL7A 1UZDA 1GTEA 3M46A 3S5SA 4H7VA 1O4UA 2WLYA 1JYNA 1HJQA 4L56A 1GK8A 3MP3A 1WB0A 4PRRA 5F4SA 1L6SA 1G7UA 3SRKA 2EPOA 4RX0A 1GQKA 2GJXA 2VGGA 3D3AA 1AQ0A 5LGZA 3KWSA 5KSWA 2INZA 5IBXA 3W72A 1UH2A 3BOLA 1KFWA 3NO1A 3O0FA 3I4KA 1J5SA 1IWPA 3W2LA 1Q8AA 1H1ZA 2R82A 2CZFA 3NQ8A 1N82A 3GR7A 2QF7A 3RYSA 3TA6A 3BJTA 1YEYA 4AZHA 5BXTA 2VD8A 4LY4A 3RMJA 4Z1AA 2QUTA 3TWBA 2OSWA 2WVVB 4NI8A 2VZUA 3C8NA 3U9IA 1VBJA 3C8FA 5A1AA 1UWAA 3DFOA 5G1TA 3PNZA 2A79A 2HK0A 4M56A 4ES4A 1P0EA 4O0KA 1L2UA 3EBVA 4KPLA 3C3NA 1XIBA 3WH7A 2C0HA 2W92A 5E93A 1VCFA 1Q2SA 2NQ5A 4N02A 1PEZA 3BQ5A 4B2DA 2GL5A 3PG9A 4JKMA 2FPYA 1PDYA 2XH2A 5CJMA 2VEIA 3PZNA 4L4MA 3TXVA 4LB3A 1PX8A 1EP3A 8TIMA 1XBVA 3M6YA 4UNKA 3UWVA 4XZIA 1J96A 4YVPA 3VIGA 2F61A 4AQLA 4WUIA 1CIUA 1RVGA 3HGJA 3I6RA 1TV7A 3U2EA 2NVAA 1TMLA 1JZ5A 1EJSC 3O6CA 1JRBA 2OEMA 3LENA 2YL9A 2D0FA 1P6BA 2VEMA 1JPKA 2BY1A 5A8PA 2CLFA 1DJXA 4QLKA 4X0VA 5KMYA 1YBQA 2ASHA 1V79A 5FA5A 3KBMA 1WE5A 1HT6A 1N8IA 3UXAA 3EYPA 1OX4A 3AS1A 1O12A 4UFLA 3PF3A 2Y2WA 2EPLX 4AZ5A 7ODCA 1Q7QA 4LEQA 5B7YA 5CPSA 5D03A 1OM0A 1SZGA 2YCIX 2EO7A 3C5QA 1V0KA 4JIQA 4KT2A 3KTCA 1X6LA 3OQEA 3TN5A 4QHRA 3CHEA 4IWWA 1GYLA 1E6RA 3M44A 4GZIA 5K7JA 1KW1A 3VKBA 3L2LA 1LORA 1O66A 2V69A 4Y9OA 3CO8A 4PTXA 5HJLA 2XWEA 1M03A 3T6CA 5FD0A 4E6MA 2UY3A 3NFUA 4AVOA 3WD2A 2D2HA 3WF1A 1DIEA 2QV5A 3GSMA 2Y85A 1A5NC 4B3KA 3ZVHB 2PWHA 3CAQA 5K9CA 3AS2A 3EX2A 1WZMA 3ONCA 3MHGA 4CCZA 6PTDA 2ISSA 1H09A 4W7WA 3DENA 1TJPA 4ICCX 4WR3A 1EBHA 1V3LA 2Z27A 2J6VA 3W1TA 4IMAA 1W5NA 4YTQA 4GOAA 2GOUA 3QHNA 5GQBA 4C60A 2O9PA 1GKQA 1XBXA 3HG3A 3RUBL 5E9AA 7CGTA 3MDUA 3W01A 4WGHA 3E9AA 3HFYA 2WNWA 3UCQA 2YCJA 2DSWA 3KLLA 3SQMA 3QPYA 4M8UA 2ZADA 4FNTA 3T7VA 1SJAA 3DGBA 1K7EA 1L8PA 3C52A 4XBKA 4Z1BA 3UT0A 1RCXB 1QJWA 4LUSB 4JFWA 2WWDA 2I17A 3G3MA 3WX7A 1ICPA 2Q02A 2QDDA 5D02A 1KNWA 3NNTA 4AVFA 4MTVA 3CNYA 4REQB 3WQWA 3TCEA 4IFKA 1HF6A 4XKYA 1E1EA 4DLFA 3MYPA 2FTWA 1V0MA 3GX9A 3U0HA 4TX6A 4PCTA 4NZCA 4PZVA 3BMWA 3VKKA 1IEIA 1G69A 4BR1A 4XAZA 1OD0A 3QGAC 4JYEA 3AJ7A 4S2CA 1V02E 5CH9A 3PULA 3LA4A 3POCA 1LUCA 5JXQA 1EEPA 4D6EA 1JZ2A 3UEQA 2BP1A 2WCAA 1O5QA 1D7KA 1HKIA 1S2CA 1SZEA 3CV7A 3FAWA 4FXSA 2X16A 5I3KA 4IJBA 5BMWA 5ABEA 4EXBA 4QM1A 4DXKA 3WLHA 5ABFA 2QF8A 2BODX 3R79A 4AH7A 1CWYA 5H8UA 2P88A 1VEOA 4K39A 1T8XA 3PB2A 1JJKA 2D73A 3CJPA 3CTTA 3QEZA 1OCNA 2XG9A 3O06A 1XLFA 3AC0A 5AHIA 3H26A 4PMRA 4FP1A 5EKYA 2QJMA 2I7GA 4X0NA 4AX6A 1ECEA 2A2IA 4B16A 2PD9A 3K30A 2JIEA 4L9YA 3AROA 1UWSA 2QCDA 4LF1A 1Q6RA 4HKPA 4UBPC 1D7FA 1AW5A 2CESA 1LP6A 1OWQA 3N2TA 4LAKA 1DJNA 1I2QA 3B0UX 4XKMA 3W81A 2V9DA 2PDUA 1D3CA 2BXVA 2REQB 3ZZ1A 4IG2A 4ZFMA 3GFXA 2YB1A 1OCJA 3NM1A 2VGBA 2PWEA 3E5BA 4PYSA 4YIWA 3B3DA 4IF2A 1S2TA 2YSWA 2NQHA 5IDIA 3V35A 3TK7A 1X6UA 4C1NB 3ALGA 3T0AA 3I7SA 1MEIA 1Y5VA 3AIVA 1W3LA 3D6NA 4R34A 2BTMA 4QS5A 4MOZA 4JTIA 2HVOA 2A7RA 4GCXA 4ICNA 5IDZA 5HNUA 1PKMA 1A3HA 3NQFA 1A5BA 3TIMA 5GNXA 1FCVA 4R5EA 4HNLA 4NJJA 3IS4A 2O7SA 4B4HA 2W79A 3VU2A 4D6JA 2Q8XA 3G18A 2NZLA 4CNTA 3GAKA 4O8AA 1IXQA 2HPIA 1CLVA 2PDNA 1SSGA 3NL3A 1HGWA 4NUWA 4WY0F 3WMBA 4G5DA 3WDHA 1XDMA 3TFCA 4JHMA 2ATMA 5D33A 3USZA 5HMDA 4ZZ9A 4O8RA 2Z1BA 1YMYA 1Z6KA 4KWUA 3RM8A 2NUXA 1U30A 2G3MA 2D3LA 1Q65A 4Q6XA 3APGA 1UROA 2BOGX 2V0TA 4AD3A 1V03A 4GUIA 4YVVA 1Q13A 3LLDA 2HK1A 2XSXA 2Z1KA 3PFRA 4S3KA 1KM2A 4H7ZA 4LVBA 3LEPA 4EIVA 4C5ZA 1NDYA 3N9RA 3CS2A 1EH9A 5REQA 2Y88A 3MS8A 5I03A 3RFAA 3UFYA 1GWJA 3E74A 3Q67A 2PDCA 4YTUA 2RHGA 4NAFA 2PLKA 4QJ3B 4MWAB 4A8IA 1OFEA 5AYYA 1WZLA 4TMCA 3QKEA 1VFLA 2GQ8A 3NZRA 1SFSA 1AQFA 3LNMA 3BVJA 5CZKA 1YDOA 2WM1A 3N2BA 4Z0SA 2B7QA 5CSYA 4UCFA 3JW7A 4AZ7A 5D2XA 3B8IA 2J24A 4F0MA 4O57A 1VENA 1W17A 1EEXA 3LYEA 1JZ3A 1MWOA 4OVXA 1KBLA 2CLPA 2JGQA 5IRPA 1XLMA 1KCZA 1NWTA 1YKWA 3FV9A 2Z00A 3S1WA 1H51A 3E6EA 4QE4A 2OEJA 1UWQA 2BOEX 3ITVA 2VFGA 3VCCA 2PU0A 4FS9A 5M5DA 3RO8A 1XYMA 3H7UA 3OTRA 1GOKA 2POTA 1OC5A 2YFOA 5D2WA 4PEKA 4DY1A 1KQZA 4I8DA 4ERIA 2X09A 3AUOA 5BU6A 4NAEB 2ALDA 4TTGA 1OFPA 1F6YA 4BA0A 3QC3A 2CETA 3GU2A 4XSMA 3WNLA 1E15A 2OB3A 2VZSA 1E4LA 2BSLA 2O7QA 2OTDA 1UWRA 3A3XA 5M2FX 1YRRA 1A5SA 1KRBC 4IMEA 5A2CA 3TDFA 1L8NA 4JN7A 4D8ZA 1UC4A 1R38A 5XIAA 3B8UA 5KZEA 1OF8A 1DWHM 3I6TA 4KKXA 1BYAA 3K8MA 4L1WA 4H7CA 4DM2A 1OEPA 1W1PA 1QPOA 1A3XA 1U5JA 2XFFA 5CPMA 1FRBA 3PSVA 3N6JA 3PUDA 4GI4A 4ATWA 1NFBA 1BXCA 4H9XA 5AYBA 1CB2A 4JTJA 4MZYA 3WD3A 3G77A 3KBVA 2E6YA 3VA8A 3UPBA 4F0LA 1PTGA 1Z89A 2DSUA 1JIBA 3BG9A 2EG7A 2E5CA 3KHJA 3MMWA 3EWCA 3DHFA 2DV0A 1NSJA 2ZZ2A 3QOMA 1NP2A 3OHIA 2PU1A 3I68A 4RV8A 5AHNA 3T4WA 4OQVA 5CBJA 1H7NA 2FYMA 1WAUA 2AAMA 1XFBA 3BJFA 4QFUA 3GU9A 2IKJA 4FOKA 1WV2A 1R47A 1BG4A 5T8GA 1VFUA 2V38A 5LHEA 1KBIA 1QHZA 3HQPA 2NV2A 2CC0A 1EKOA 3EB4A 5HDRA 1EO7A 4QCFA 1S3HA 4GCAA 3GUWA 2JQXA 1IXOA 1WKYA 2VFIA 4UZSA 4C91A 2GJPA 3TC7A 2E1DA 3KBWA 4XVDA 3TW7A 1ESWA 2FHFA 3HG2A 4QQUA 1OFRA 1W3TA 3M5YA 5LHFA 3CHFA 3AMKA 3GZ3A 4BEUA 1NFPA 3LG3A 1ODUA 2GDVA 3W7PA 5J04A 1YLVA 1TJ1A 3CUGA 3LBOA 3R5EA 2QR6A 1REQA 3VK5A 3IAPA 3ITYA 3LK6A 1VBRA 1K7FA 1HXJA 3GTFA 2XIOA 4EK7A 2BVYA 1VQTA 2FFCA 2XYLA 4Z1YA 3BV4A 4ALDA 1F2JA 3CV6A 4JX6A 1K8XA 1DJYA 2D2JA 4GYKA 1MEHA 4GXMA 4DXVA 2GGEA 3ITTA 1XYCA 5HJYA 4K8EA 1PZ3A 4QR6A 9XIMA 1W1IE 5HPCA 3NR0A 4XAFA 5E0CA 4EACA 4BK9A 5C8BB 5AHLA 1TTIA 2PPGA 4HOXA 5AC8A 3ABRA 3GHUA 1AW2A 5IHRA 1XYAA 2FHBA 5DY3A 4J27A 2PTWA 2WJEA 1QT1A 3OIHA 1GOXA 3HMCA 1KD0A 1ZUAX 3OGVA 3ZQ9A 4CD5A 2WAGA 2QZRA 3W7EA 4Q6JA 1ITXA 5EA9A 3VDBA 4GUJA 3LZ5A 5AVNA 2WVVA 4J3WA 3V5FA 4GVIA 4TVDA 1YNYA 2VOMA 1H1NA 3ZT7A 3O8AA 2C1HA 4O17A 2J8GA 4JHZA 3PANA 2ADAA 3FN9A 4S3AA 4QXIA 3P61A 3IJQA 3CMJA 4B4FA 4FX8A 4LS1A 2GGGA 5D30A 3KZPA 4AVNA 5M17A 3SR7A 3MA8A 1HQTA 1RPXA 1H11A 3MV11 1M1BA 4HPXA 2VRQA 4DYEA 1Q6EA 3A4WA 4IPNB 1WDSA 3KEHA 2PBGA 2BY2A 3MWCA 1X97A 1HO1A 3VKAA 4RDZA 2GVEA 1AJZA 3LZ3A 1DXIA 2ACUA 1V3JA 1OIFA 4P8WA 3BGGA 3N34A 3W70A 3VNZA 3LCHA 4KRTA 1T96A 5A8GA 1ZPTA 3RM4A 1JCJA 2WPBA 1H7WA 2Z24A 4LBRA 3A5VA 2MUCA 1EYEA 2XUCA 4MMWA 1GOOA 3NJ3A 4F0KA 3TC3A 3RG6A 5CSSA 1POJA 2I9EA 2V2DA 1U33A 4S3GA 1XGZA 4XQ6A 5F4WA 3TQKA 6XIMA 1JPIA 3HU7A 2PP1A 4RL3A 3M4HA 3KOFA 3P0XA 4DN1A 1M7JA 3E0LA 1GZGA 3W23A 3BAYA 3CXOA 4NX5A 5GJPA 3PZVA 3H22A 3UQNA 4C7DA 1ZCOA 2DW7A 2PUZA 3TQ0A 3F7JA 2V2CA 3S6DA 2GSEA 2WZIA 2ZC8A 4EAYA 1GOIA 2Y70A 1G1YA 1PKYA 4MYXA 1LQ0A 1TO3A 3NVTA 3RXZA 4GC3A 3BTNA 4NILA 3TW9A 4MZ8A 1T40A 2ZWZA 2EQDA 1SJDA 4FNRA 2QUVA 1RLDA 1DWIM 3WDRA 5DQPA 4LU0A 4S2BA 4Z2KA 3QXBA 4O11A 3LPGA 1G0CA 3G8EA 1UA3A 4H6KA 4YWSA 2A1YA 3QF0A 3QKZA 3AHVA 4XO7A 1A50A 1X1NA 2F8QA 3WZ0E 3W2JA 5AOUA 2G37A 2DP3A 3AZSA 3KRSA 2FFIA 4PMVA 3AIQA 2DIEA 4IIHA 4K38A 5A8OA 1FCBA 4HPJA 2Y7EA 3MMUA 3UPMA 4HHMA 4AC1X 1HKVA 3WEMA 1J5TA 1AQHA 4FEZA 3THQA 3GDTA 4UTIA 3W1PA 1KTNA 4S3BA 2QNEA 3GTHA 3ARZA 2H3DA 4V2XA 1QK2A 3NGJA 4RW3A 5F2MA 3E49A 4IHCA 3P5ZA 4EAMA 2WJDA 3VDAA 3TTOA 2ACQA 4WDWA 1TQJA 3ARUA 3BOXA 2GZXA 5J8LA 3O9NA 1QW7A 1X98A 4LUSA 2NXIA 1MQQA 2VZOA 3VVGA 3OU8A 3A4JA 1NIUA 1EF2A 3PTQA 4EF8A 3NA8A 2BB0A 3PBYA 3R6IA 4XZMX 2AQWA 1S5VA 2Z2BA 4M6PA 3I3DA 1EGMA 2A6LA 4CEUC 2PB1A 4HTYA 1UKOA 4O1FA 1ELSA 1GONA 2HISA 4JQ3A 3S5OA 1FHUA 1XFCA 1Q6LA 3AXIA 1DBTA 3L4TA 3EMQA 3OYZA 3A3HA 3URBA 2DUZA 1ONEA 1FWGC 1RBAA 1XINA 4PL1A 3G2GA 3G8RA 4JOMA 1AG1O 1MXDA 2BASA 3ZR5A 5CPOA 1PWMA 3VNYA 3QR0A 3DHPA 3ARSA 2WMHA 3T2OA 3LV6A 1US2A 4CN4A 5A3HA 2V5DA 3ZLGA 1V3MA 3N2XA 4WQ6A 3WBYA 4Q32A 1IEQA 3DFTA 3KVKA 2PWFA 1HKWA 1BTMA 4KRZA 3SCWA 4GVHA 3TOYA 4UTJA 4MFEA 1X1OA 3PSWA 1A53A 3H12A 3STCA 4GNKB 4DHGA 3K4DA 4JQAA 1KC7A 1E9ZB 4FNUA 2C79A 1NDWA 5K9DA 2ZX8A 1GKRA 1F3EA 2E8ZA 1A80A 1F3WA 1LOSA 5HWNA 5CPLA 5G4EA 1UWTA 3N04A 1QI0A 3VMOA 3L4UA 2GOKA 2YBTA 4UTLA 3A4AA 2O4QA 3QQWA 3TYUA 2VFHA 2VEKA 5A94A 3N6HA 3M6DA 2BHYA 3OO2A 1ME8A 4Q4SA 2YDRA 2VZVA 3OIXA 2J9ZA 1SVDA 4EXQA 3B4YA 4IQJA 2EGZA 4CEXC 1OABA 3UXIA 4IFOA 3WBAA 5BCAA 4FOJA 2CERA 4UMBA 4O1BA 2RKXA 1GZJA 5HQLA 2XH4A 1PZ0A 1PX3A 4MKNA 5AN7A 1OFDA 2D3NA 4HYRA 2I5QA 2PLCA 1OGGA 3OVGA 4C1NA 1FH9A 1E4IA 2RJHA 1ONRA 1LWHA 4B2DD 4E3VA 1EWEA 2G3JA 4R9XA 3M07A 3UWUA 4R27A 4ROPA 3ITOA 1CLKA 4JTQA 3BLLA 1DVJA 4QGCA 1R3WA 2XIBA 5M1TA 4ECLA 1FWSA 3EXSA 3LCIA 3HFTA 4W4QA 1WKEA 1E6XM 4KIEA 3W87A 4FK9A 2ZDRA 3BK0A 2GGJA 2A3LA 3CAVA 4Z2IA 2ZYFA 3OYXA 3BZGA 3DOPA 5E09A 1P6WA 4V33A 1P0DA 3B8WA 3NQBA 4MNLA 3ICJA 5D2TA 3MUAA 4LOCA 4KEZA 3WDJA 2W63A 4C1LA 3THAA 4PMUA 4DF0A 2WXDM 2PD5A 4IFRA 4RXFA 2A3CA 3GIYA 4AX7A 2OJPA 3WK0A 1YYAA 3LRKA 4IOTA 1YXDA 1H3GA 2A3BA 1BVZA 2C16A 4FSAA 4XBSA 1DTUA 3MZNA 4PCPA 3VNIA 5CQ1A 3CL7A 3STGA 1B9BA 1NARA 3CPGA 4GQGA 1S3TC 2PDJA 3A24A 3URAA 1XICA 1VR6A 2ZCGA 2RJGA 2DSVA 3G1XA 2ZZ1A 4YU1A 3WQDA 1RP9A 1E56A 1WXYA 1MSSA 4HNNA 1WYIA 1GEHA 4W84A 3JZUA 5HWJA 4A21A 4GC4A 4LJ3A 3V16A 2YW4A 3GY1A 3RRAA 1SU5A 4WEVX 2ATSA 7TAAA 1E3ZA 1EC9A 1FA2A 1YW1A 4JR5A 4RDYA 5JVLA 3TR9A 1SW7A 4JQ4A 3M64A 3EEGA 4MWAA 5D05A 4PR4A 3W83A 4AAJA 1IE7C 4WJ8A 4QP0A 3M0XA 1K6WA 3FAXA 3P2VA 2ZXAA 3H70A 4PUEA 2EAWA 1PVNA 2GQ3A 2QPXA 3TAKA 4LV9A 3BSGA 4J2PA 4MNJA 3CWOX 2HSAA 2Q3RA 4HU3A 1G4PA 1XGEA 3P8IA 4TUFA 1MEWA 3EZ4A 4UIOA 1KA9F 3KFTA 2QUUA 3MSGA 2WMIA 1CXLA 2EPMX 1QOPA 4ZOAA 4XX6A 3BCJA 3Q45A 3WLOA 4Q8PA 3NYDA 1PKNA 1DQUA 4GUFA 4LY8A 3D5HA 3P7YA 4JTAA 4WGXA 4TX9A 3VUSA 2B7PA 4NAEA 3S42A 3T8QA 3QPZA 2I9UA 3DHDA 4W93A 5XINA 3NG3A 3VINA 3W7OA 1XCFA 3ES8A 3CH0A 1GVRA 2OWXA 2C18A 2FVLA 3E0FA 5EU9A 3WF4A 1N7KA 1Q45A 3WCZA 2CLKA 4PSRA 4YMZA 3R89A 1OQFA 4ZVJA 1TIWA 2PDLA 5IOBA 2J7EA 1DP0A 2B0MA 1DOSA 1Z7AA 2E6AA 1V4YA 1Z69A 4UOJA 4KEVA 3LBMA 4HU0A 2PAJA 1CLXA 3W1QA 4RE2A 3MPGA 4FX7A 4Q8OA 1XCXA 3KP0A 4BI6A 4A2SA 1JXKA 4H1ZA 4DBDA 5JQ9A 1O1HA 4XZHA 4B9ZA 1UD8A 4B9YA 3RITA 1X1ZA 5CG0A 2INFA 5FI8A 3M5XA 3B0XA 3JU2A 4BFAA 1G94A 3EWWA 4DO7A 3LSCA 3OW1A 2VMFA 4OTKA 1HW6A 4TR9A 3CM4A 4MG4A 5FJJA 3C0LA 2ZZ4A 4FX6M 4NYUA 4H00A 2OKTA 2R91A 2D2OA 2OPJA 1FBAA 3GXMA 4I6VA 3VZZA 3W2MA 2DUAA 3IARA 1DHPA 3R58A 4V1XA 1E9LA 3DG6A 4PH6A 3WUBA 3EA2A 2RH9A 1QO2A 3GXPA 5CAKA 3CTLA 3GTIA 3QTGA 4MVAA 2E8YA 2EF9A 1TZZA 3DHUA 4UQEA 3GW3A 3R13A 3RPDA 1RVKA 5JIWA 3E02A 2FMOA 1HJSA 1QU4A 2X42A 3LGGA 3G5EA 1JNEA 5I06A 2Q3OA 4PA8A 4PUKA 4H04A 4J3UA 3MANA 4Q4MA 1B4KA 4LRTA 3PTDA 5LIYX 1JUBA 6CGTA 3VC5A 4GFSA 3OVPA 5EFFA 3EOOA 2PGWA 4HD5A 2QHAA 4Y9MA 1G5AA 3ANYA 3M5ZA 1TFVA 2YCEA 3YPIA 4E4FA 1WDRA 3B9EA 3OB8A 3TYBA 3M1ZA 3UG5A 3W28A 3WDIA 5BRQA 3VI2A 5IBXC 2G3FA 3TUUA 1W2VA 4P8UA 1G9HA 5HPOA 4DJDA 3TU9A 3RF9A 5I23A 1KCLA 1YTKA 1W1TA 4UFIA 3RLUA 5F1UA 3P84A 5CLTA 1UUQA 3VM5A 1ZAHA 5L6UA 3T1GA 1VAHA 1W5PA 2INEA 3BGJA 5TD4A 3ZSTA 1THFD 2V2HA 3SRDA 3SGZA 5DT7A 3SM0A 3RJXA 2J7HA 2VX7A 4HT3A 2WMFA 3FYOA 1XUZA 2E3ZA 2QJIA 3PTKA 2OLSA 1I4NA 3AMCA 1XUUA 4GI9A 1W6TA 3H4XA 5ABHA 2ISWA 1E4NA 1Q6FA 2XN0A 2VJXA 4A35A 1JQXA 1Q85A 4PMNA 4CNOA 3QPEA 3T0BA 4IX2A 1XH0A 5U4NA 5G2IA 1XSJA 1ZQ5A 3KRBA 3R7MA 4INFA 3CUZA 4FLRA 5U7SA 1SFTA 3WNKA 3H23A 4AD1A 5C55A 4UZUA 2J78A 4JN6A 2I5GA 3K13A 3UZZA 5GVJA 1KRMA 4CD4A 4Y90A 2ZXQA 3AALA 2VZTA 1UP2A 4ATDA 2VM8A 5I0DA 2G95A 3T78A 1W1B1 1HVQA 4BI5A 1IT7A 3GE7A 2JKPA 1TVPA 1UKQA 5BWAA 2O0TA 3BARA 4HK7A 2QIIA 3WMLA 3BLEA 1A0CA 1KKRA 2ACSA 1J8VA 2V68A 3M0VA 3FY1A 4HJWA 3GVQA 4ZTYA 1W3KA 3PBMA 3UWYA 3LCGA 1S39A 1HVXA 3WLKX 4HNOA 1F8MA 3O6YX 7ENLA 4U3AA 2J66A 2X1SA 3QYQA 1IR2A 3H2NA 3LTSA 1U5HA 3S47A 1HN1A 4G1NA 2J75A 3ZS4A 1IV8A 2BY0A 4ORMA 4U2YA 1ZBVA 4UTMA 2LLEA 4A6GA 2Y0FA 3QRHA 4J3SA 1SO6A 3ZMRA 2CBVA 4O14A 5J5RA 4NP7A 2E5BA 3KL0A 1XLEA 3MV01 1F9CA 3OBKA 1B57A 1RXOB 1CT5A 3HA1A 3LI1A 1MW2A 4M19A 1JPDX 4RK8A 4OV4A 3N25A 1XIFA 3LD5A 4NY2A 4ZE5A 3SUSA 1CXEA 1R0MA 2AKMA 4AXKA 1LM1A 2Y8KA 1XLDA 2NW0A 3FA3A 1FWTA 2C0AA 3TV8A 2R14A 1SM9A 5F4XA 3KRUA 3HGSA 3NDZA 1EJTC 1KM0A 4QITA 1NP0A 4H6RA 3L67A 3A12A 3WK1A 2WPGA 4J3TA 5EFDA 3H2EA 1UR8A 4GQ0A 1VJSA 3DERA 3W7CA 3MMTA 4IL0A 3CGTA 4GPNA 1VBHA 2WHLA 3EOSA 3MDWA 1R3QA 4HMEA 4P7RA 4YLWA 4Y2WA 4JX5A 3BW2A 1B3XA 3I3EA 3CZKA 2PRHA 4OT7A 1FWNA 1BKSA 3VPLA 3A13A 1PWLA 4FF5A 3SECA 1U83A 1VLIA 2JALA 5C2XA 1RH9A 4QCEA 1BYBA 4JIEA 4HIBA 1Q6DA 2FB3A 3TLQA 2ZUNA 1GW9A 3EDJA 3GZAA 4KWOA 1X7FA 2TSYA 5CSUA 1YDYA 1EO5A 4L65A 1RR2A 3UCDA 4LALA 1BSIA 3RK8A 5BW6A 1KM1A 4L4LA 4JD4A 3T8LA 1JDAA 3M43A 1BQCA 1H62A 1EXPA 4AIBA 1IWAA 1OG6A 3SDOA 3EA3A 2PCQA 1TPWA 1K8YA 2G4JA 5DBTA 4K2SA 3EMZA 1B4EA 1ZJAA 2A7PA 4Q4OA 4NF7A 1X7IA 4O52A 4ZOBA 3NPUA 2A0NA 2G0WA 5GJNA 3UP8A 2J47A 3LPPA 3A64A 3M41A 4GH1A 2VRKA 1TA3B 3XINA 4X3ZA 3ZVIA 1K70A 4C6QA 1H63A 1UWIA 1B3VA 1KFLA 4HCLA 2Z26A 4JTLA 1TPC1 1Z42A 5CPNA 4O4WA 1R6WA 3FVDA 4EPBC 5LIKX 3NQVA 1YTDA 3KDNA 2XDFA 1FKXA 3NZPA 1WUEA 3O6DA 4J3VA 2C19A 3AQUA 4IP7A 1VFTA 2QV4A 3SFWA 4HU8A 4CCEA 1R5YA 4I5XA 4XZWA 1VFOA 2ODOA 2Z28A 3BAKA 3R8RA 1ADDA 5C54A 3P8JA 3BL3A 5FF4A 2Y61A 4H8HA 1KB3A 1IHIA 3USBA 2PRMA 3E2RA 2G3NA 5D9NA 1A5OC 3TSMA 4AZGA 5A6LA 4MKVA 3ZJ6A 2V5LA 2VWTA 3CLMA 2EKCA 3WQPA 1AL8A 2VCBA 1S5WA 4JIIX 1C7SA 2GJLA 3NQAA 3VIMA 4B5SA 4IGMA 4XK2A 3EWUA 2B4GA 4DLMA 3I10A 5E0KA 1FH8A 3BW4A 3TQPA 4RJEA 1W9XA 5BOFA 1BYCA 4F0SA 4QSFA 1GZ1A 1J2BA 1J10A 4PMJA 3WN6A 4ZQCA 1OJXA 1O6IA 1TV4A 3NWRA 3VD9A 3AIWA 2O92A 3URNA 1R9XA 1AH4A 1K9FA 4LC8A 3WH5A 2NXHA 4PFHA 4QAWA 3E12A 3K8KA 2ALRA 4QROA 5EMMA 1JXJA 3BURA 2UBPC 3CZGA 4N9BA 3E2QA 3ZWSA 2C71A 4D1JA 4DI9A 2C91A 1MNSA 5FJPA 3B8VA 3WDQA 1EPVA 3L4VA 2Z1WA 3HMJG 1QFEA 1QO5A 3RHGA 1AFSA 4HSHA 3NEVA 1VPXA 2XWDA 2JGYA 2CZ5A 4HN4A 3FK4A 4LW7A 3W29A 2BVDA 1VRDA 4HNTA 4S3JA 1IGWA 3KVJA 3P62A 4JN8A 2VDHA 2QQ6A 2YX0A 3M7SA 3NO5A 2DIJA 4D72A 5C7VA 3UG4A 3NQGA 1MRQA 3NIYA 2DQWA 5CGQA 1GVEA 5KTLA 1E71M 3PJWA 1AH3A 3SY5A 1OD8A 3TW6A 2OR2A 2PFHA 1S38A 1EIBA 1LL7A 1UKPA 5DEZA 3G0UA 2TODA 2XM2A 3B8TA 3QGKC 4J5NA 1Q5MA 4O50A 1HL9A 3M5VA 4P8VA 3RJYA 2E9BA 2WZTA 1EL3A 1QNSA 1WOBA 2NWRA 2XIQA 2OXNA 1J9YA 1LLZA 2OGYA 1EJ7L 4AZCB 2OLAA 2QCNA 1UC5A 1UQYA 1FWDC 3QZEA 3S2JA 4O28A 3PTMA 4GVFA 2PDWA 3VOCA 4R7WA 1XLIA 1P6CA 1ZFJA 4HHHA 2P76A 1DJZA 1RY0A 4LYQA 1X38A 3E0IA 5A69A 3U3HA 1RQBA 4UTUA 2CXEA 3WQEA 1J93A 1H4PA 5FF2A 1VEMA 1KXTA 1CXHA 1D2KA 2WNQA 1SMAA 4DBEA 1Y5WA 1UUOA 2PC4A 3QV8A 3UWEA 3M0LA 3PHAA 1KGUA 2ZX7A 5FF7A 3T81A 4BF5A 4KF1A 1XRTA 2J8TA 3BZJA 3T08A 2YLLA 2PTDA 3GM8A 3OLEA 1JFXA 1XC6A 4CU7A 1GT8A 3EX1A 2DZUA 4Z42C 3ZSSA 1F7BA 4MDOA 1ICQA 1KKOA 2DFAA 3G1DA 1BLIA 4JCMA 1K77A 2IW0A 3TP4A 4AD5A 2NQJA 4RR4A 1BGGA 3IJ7A 1ME7A 4P61A 4UMAA 4Q22A 1YE6A 2XIIA 3N9SA 4LCSA 3ZJKA 1TPFA 1UD5A 3GC4A 1M53A 1EPXA 1OGBA 2B7OA 4S1FA 4MDPA 3M0ZA 4MIMA 4JX4A 1DXFA 4LT9A 3DEQA 4JTHA 2FHCA 4ZXOA 4A05A 3B9DA 4UTKA 4UFMA 1J0ZA 3LPFA 1KLZA 4DWSA 3HPSA 4Y9NA 1AH0A 4Z1CA 2CWNA 4IIGA 2WSKA 3CL8A 3VGFA 3BPWA 2XJ7A 1EX5A 4PBEA 4HNUA 3UJRA 5HNTA 4L5ZA 4EPEC 5DT5A 1RA5A 3TVAA 4HQVA 1Q6GA 4IFKB 4HZ8A 3KBJA 4A8LA 3TYDA 2HZGA 3EX6A 3GXIA 2YIHA 5CG7A 4WF7A 1ME9A 4RDWA 3F4NA 3LI0A 1AVAA 2DGAA 5FEWA 4IXHA 3SCTA 1C8QA 3QMSA 2V67A 4G6CA 1JZ7A 3WJZA 5A6JA 1D3HA 3CQJA 4OBRA 3QSTA 3SO7A 1NTHA 1RQEA 1XSIA 4A3RA 1GJPA 3L66A 3G3DA 1GORA 1SSDA 5JMUA 3KM8A 3H2CA 3WJYA 2DVXA 5ABFB 2QJJA 3PS7A 4GH3A 2JKEA 1E9IA 1T41A 3ATYA 1FCUA 2AKZA 3PG8A 1ZNNA 1VIWA 4M7SA 3TTYA 3MTWA 1EB3A 4AWSA 2C1GA 2DQXA 3HGOA 1WZKA 1E3XA 3WG6A 2GSHA 2XIJA 1FXQA 4YCOA 2DVUA 2EPKX 4FLOA 4PUDA 1FVPA 5FF0A 2FVMA 3N19B 4PUJA 2H9AB 3C56A 2C6QA 3P80A 2ZOXA 4BQ5A 4GKLA 1IXNA 3SUUA 4GIYA 3GS6A 2XHYA 5EBAA 3DFNA 3WQ4A 4KWWA 1ZS2A 1KM5A 4KCVA 5HANA 3HJEA 3W7NA 3W37A 1RLCL 2HWGA 1E5NA 5A2BA 3SCQA 4QTGA 4L6HA 2HS6A 1OY0A 1GG1A 2IQTA 2P3EA 3TTQA 1WA3A 3VE9A 3EPOA 2QAPA 3SQLA 1ECQA 1H1YA 4O1DA 3GU1A 4HNCA 2OWCA 4E2VA 2NVDA 3B04A 4I5RA 2IMRA 1PSCA 3V5OA 1K03A 4ASTA 1CXIA 4ZCWA 3THUA 3PWIA 2XINA 4A3UA 1BEUA 1LTDA 1ZGDA 3VD4A 1JPHA 2XISA 4UR8A 3XIMA 3LM3A 1KQYA 1NM9A 3CZEA 3QLLA 3GRIA 1OB0A 4PMXA 4R88A 1ISWA 2DZTA 2ZX9A 4AISA 1ITCA 5IFTA 2O4MA 4NU7A 1V0LA 1B1YA 4N6FA 1I45A 1E0UA 3N15A 5CCZA 3L4XA 1WDDA 1AZ2A 3T40A 2XFRA 5A6SA 5KZDA 1IQ8A 2EEXA 5AYZA 1G6CA 3POHA 4MJMA 3CMFA 4GIAA 3LNPA 3PZTA 3NQMA 3N3TA 1E51A 3U7BA 1A49A 1TYGA 2QJHA 3JS3A 4XAGA 3VOFA 4K37A 3A9IA 1JRCA 4Q4PA 2WNNA 3RX2A 3VGHA 1PCWA 2WWCA 3PZGA 4CD7A 4GD0A 4MNKA 1CGUA 1WX0A 1O5XA 2IPGA 3RU6A 3VD7A 3W76A 3E96A 4GBDA 3AU6A 1NH6A 3PZQA 3T4CA 5EY5A 4LNYA 1IF2A 4B91A 1A5LC 5FJTA 2J7BA 2ZXBA 2VX5A 1W3JA 3DBNA 3FJLA 3NYZA 2NV1A 3GDRA 1DIOA 1XJBA 4MWAD 1TCDA 3MVIA 4KH2A 5REQB 1JCYA 4M81A 3BQ6A 2Y7GA 4H4IA 1WKFA 3ZWTA 4J7RA 3FCPA 5D8WA 3U5UA 1EOKA 3GQYA 3GKFA 2XSAA 3JVAA 4WKHA 3GNRA 4P5UA 4G8TA 4MKSA 4HNVA 2CKSA 3FEMA 1C7TA 3BLOA 1V8EA 1F73A 1W9DM 2BGQA 5LXXA 3GKAA 3VIKA 2JFEX 5LIXX 3QH2A 3FHAA 1LRQA 3OOQA 3N12A 2BHZA 4L6DA 3PZUA 3UJ2A 1EBGA 2VOTA 3EOLA 3PZIA 5FJRA 4AZ6A 1K02A 4W8BA 4QDPA 3V1PA 1RQHA 4UNIA 5D4YA 2CHRA 3WH9A 2FZ9A 4IMCA 2W61A 2V5KA 2OEKA 2W91A 3RRXA 3LHZA 1JCMP 3UERA 3SN0A 4UR9A 3L2MA 2G4FA 2YCKX 3RMEA 2FH8A 4UUIA 1R8LA 5DCBA 2ZKMX 1SQ7A 1XQLA 3LMYA 3TJ4A 3M0KA 4N6EA 1F05A 3CV1A 1RP8A 5T91A 5MF5A 3BSHA 4WXZA 1QHPA 5C70A 2PC8A 1XIHA 2HDJA 4M5PA 4RKAA 4HSOA 3JRKA 4QS6A 1TE1A 1DWGM 4RW5A 5D38A 6A3HA 3V3WA 3GWQA 1TRDA 4US5D 5BYWA 1PPIA 1JPMA 2G8ZA 3SIZA 2E9LA 3VGGA 1F74A 2ZTJA 3RO6A 3EOUA 4DO5A 1RALA 1RY8A 2QCCA 3DI1A 1CGWA 2PDKA 5G5IA 1V77A 3G6MA 2XVLA 5FESA 4PULA 3L5LA 1NU5A 2X2YA 4NVTA 4BF7A 1H49A 4EXAA 1CYGA 3VD3A 3MY9A 2FJUB 3H2OA 5E6YA 1R7AA 3MUXA 3TMQA 4B15A 4P7QA 4HYVA 1WNOA 4I6KA 4HPGA 3ZIZA 1VEPA 4O0QA 4CCDA 1GVOA 3CLWA 3R10A 3VUPA 3W1UA 4EF9A 4N0RA 1BKHA 1A0DA 3AMDA 4FIRA 3AOFA 3E38A 1F4AA 2OGJA 3DFQA 3WJWA 4XZ9A 3W7QA 3S5NA 3CO4A 3NTYA 2HPMA 4I90A 4M6VA 2ZFAA 3VOHA 3RNDA 3AMLA 3OP2A 2WNZA 1UBSA 3H2FA 4C6PA 1TA3A 7TIMA 4N9CA 1CB7B 2R94A 4BQ4A 4NJIA 1GQJA 1PX4A 4ZODA 4H2HA 5CAHA 3KAOA 4U5IA 1ZTVA 3UA3A 1S2VA 1PTDA 3VXGA 4CQCA 4XD5A 5DCEA 5MKGA 4UNLA 2J27A 3WLTA 3OZPA 2H6RA 3UVIA 5KITA 3CHDA 1GJUA 1DE5A 4XD4A 1MVYA 1S46A 2GQ9A 3MSYA 4DJDD 3R0KA 3VOGA 4HVXA 1TUXA 2NX1A 3ARQA 2G50A 1A4LA 1XCWA 4BHYA 2HCVA 3G1AA 1TVLA 2ZTKA 3V36A 2ZVIA 1B0IA 4PMOA 1TG7A 2E4TA 4NG3A 1C8XA 4Z2LA 1XGDA 3P81A 3GHTA 4QNEA 3RAOA 2IQ0A 2XU2A 5D2VA 1C3FA 1OSEA 8RUCA 3LQLA 4Y9AA 3FDKA 5SWUA 1V08A 1SJBA 3N9KA 1A0EA 1P1XA 5IHSA 1KFKA 2PMQA 4GJ1A 1VBUA 3LHUA 3PN8A 4UOQA 4C6JA 1QWGA 1B3WA 1SR9A 4BF9A 1W9BM 1QHOA 3DC8A 3VOJA 4AHOA 1IEXA 3U7VA 1K4HA 3FA4A 3WBXA 4ZO7A 3B0VC 1VD6A 3APYA 1KWGA 2R24A 1MRAA 2NLYA 3DFHA 3LTYA 4JIPA 2PS2A 2TMDA 1HZYA 3LUTA 2W4XA 3UZWA 3Q94A 1QCWA 2J7FA 2E77A 3L68A 4QSHA 1OG0A 3BMVA 4LAZA 1E72M 2WC7A 3SRHA 4A8RA 3VNKA 2NLIA 6TAAA 3KRZA 2GGIA 4B3LA 2YJQA 2NQ9A 1C91A 4R9OA 2P8BA 4ONVA 3S8HA 4NI3A 1YIXA 1S2WA 1TWWA 1K8ZA 5TQLA 3CT7A 3TJIA 2BWGA 4GX9A 3QSRA 1I6NA 3H4GA 3F4DA 3SW6A 4KMQA 1ZBCA 2F84A 1K6AA 5C71A 2VFEA 2Y5EA 4CN6A 3ITLA 1JUKA 1IWBA 1T7LA 4FB7A 1UR9A 5H6HA 1L2QA 3LHWA 5K9XA 4GLEA 3AICA 1HJWA 1P0NA 3RIKA 4GIEA 5FCZA 1V6YA 2BHUA 5M3WA 4XZNX 1FXPA 3WMSA 1KR0A 2AOSA 3ARVA 4JAWA 4X61A 3NXLA 1DXEA 3B8DA 1KFEA 4EPKA 1KLYA 3TKFA 3W74A 1WO2A 2QULA 4FHAA 1KV5A 5HQEA 4NQ1A 4HSNA 2DY3A 1J18A 4MWAC 3H8AA 2ZA2A 1A5CA 1R30A 4PB3A 3HQNA 2RDUA 1ALDA 3CQKA 3VKDA 3CU2A 1W3IA 3HJZA 4AZCA 4M29A 1TMHA 3ITGA 3QV9A 4M80A 1R3SA 5DMYA 1W5MA 1ZJIA 4PODA 4JY9A 1KXHA 1RD5A 4I3GA 2R1KA 3S1GA 1EHAA 3ZLHA 3ABZA 1A5AA 1M6JA 2WC4A 5CC3A 1JYWA 3SCOA 4XV0A 4HHLA 4F9DA 3PP7A 2V6AA 1PZ2A 3QTPA 3QYSA 1XRSA 4CVWA 3BAXA 1JZ6A 2Z2AA 2PWVA 1LG2A 2FJKA 4AMCA 2I16A 3QR3A 2H8ZA 1QI5A 1QMLA 3NO3A 4X9SA 1ONXA 5AFDA 4PFMA 2FMNA 4HZ6A 3ZM8A 4IPLA 5HMSA 5A5WA 3ZOAA 3LQGA 2X1RA 2VELA 2XVPA 4DB7A 2HVNA 5I7GA 1LLOA 3OZYA 1LROA 2WVUA 4LVAA 1C29A 2R1MA 3WLQA 4D6FA 2QGYA 3WQCA 4A29A 3R12A 1JDCA 3UU0A 3NPXA 1KO0A 2O9RA 1ISZA 1TPDA 3RLVA 4BQ2A 4JEJA 3PR2A 5XIMA 4JTKA 1A47A 1H7PA 1IT0A 4GZ7A 1WZAA 3RU8X 3WDPP 1UOZA 4ZMGA 3EXTA 1DE6A 2ZRYA 4MAZA 3T44A 1FQ0A 5FSDC 1YE4A 1WXJA 4HA3A 4LC6A 1V3HA 3SSJA 1DIDA 2XFYA 2X05A 5DRCA 4FXRA 2DZVA 4WJEA 4W5UA 1EP2A 3REQB 4DZ5A 3CAKA 3G0SA 2Z6JA 4XTIA 2PBOA 4NRSA 2XVKA 3A3WA 4FMVA 3GD6A 1NOWA 2WBGA 3LSBA 4HHPA 2DZXA 4UTHA 4GABA 3MHUA 5HOSA 2CWXA 3L7RA 2UV8G 3CEUA 1EZ2A 1GCYA 2P10A 3EWYA 4P7NA 3TOPA 4A4AA 3BJSA 2VUYA 2X1IA 5A6TC 3AIBA 4LF2A 5LNRA 5BMXA 2NV9A 4YS1A 5I6SA 3MC5A 1JI1A 2ZVRA 4U31A 3ARWA 4H01A 4GQBA 2IS7A 3BICA 3S9ZA 3KCJA 1YPIA 2P53A 3NDOA 3B9OA 4O1CA 4CGTA 4AMAA 1TQXA 4N4QA 3PJUA 4GZEA 2ZIDA 2WZMA 3LGEA 4KCTA 2PDQA 4NZFA 3GO2A 3WQGA 3IJ6A 4UTWA 4IIBA 2ABBA 3C2OA 4EWJA 3B0PA 2FQIA 2QKFA 3GIQA 4X63A 1VYRA 4XIMA 3K4AA 4DJDC 2FH6A 4WY0A 4PTWA 1Y5XA 1GYMA 2HMCA 4LFYA 1CGYA 1XH1A 3CHVA 2BNJA 3ALFA 1IGSA 3MYOA 4GY1A 1QW9A 2DZSA 3WNPA 1BTCA 4BJHA 3PUGA 3LCWA 4GMEA 1AMKA 3EWZA 3CASA 3LCLA 1E1CB 4FLSA 1VFSA 2H9AA 1QASA 3TLLA 4K6AA 3LB0A 4TVCA 3LS9A 1W32A 3Q37A 1G01A 4FNPA 3C0JA 2PF8A 1I1WA 1BF6A 3UCCA 3H4WA 3I6EA 4GWEA 1I2PA 4DAIA 2FGZA 1N2VA 3WH8A 1FDYA 1UYQA 4UB9A 2YDQA 3NGFA 4DJEA 1OINA 2D69A 3FKRA 1LOQA 1KFCA 5BXRA 5GNYA 2F38A 4QG6A 4IIFA 3UF9A 2AMGA 4O54A 3MVTA 3UY7A 2NWSA 5K2ZA 4GK8A 3KOWA 3IIPA 1ISYA 4YYFA 1VRXA 3CIWA 3MBFA 1ZAJA 4QAIA 4C6NA 2G3IA 1FHLA 1V6WA 3IVUA 2E9MA 2J13A 4E3TA 3FVMA 1FWCC 3ATZA 1R9YA 5T9CE 5H8PA 4PB4A 4NNAA 3CWHA 2YOCA 3LTPA 4ZOEA 3OZMA 4RZBA 4ZQRA 3ONBA 2BS9A 3SJ3A 2HTMA 4H8VA 1XD0A 2OQHA 4YTSA 1UA7A 3NPVA 2V5BA 3M47A 1CI1A 4O1EA 3KLKA 3F4VA 2VEPA 3W00A 1OFBA 1RJPA 5DANA 3M0JA 4WDXA 7PTDA 4E2DA 3WK2A 1RBOB 5D8ZA 3NURA 3W53A 1W37A 3V0UA 3PK7A 4K8GA 4C6EA 5CZJA 3OHMB 4NKCA 4AXNA 3N13A 2ZA1A 1EZWA 2EXOA 4FOUA 3H2MA 1D8CA 3WSUA 3SN1A 1Z41A 2IUZA 2VVSA 4JGDA 1QVBA 4Q8WA 3RN6A 3LGDA 2OX1A 3PPCA 4NNCA 4GO8A 4GY7A 4HZ7A 2Z7GA 4WJXA 1YXYA 5E9XA 1RV8A 1R9ZA 4GISA 3H7RA 4TOQA 3P60A 1H41A 1I8JA 1NWSA 2E6DA 1KXVA 4J35A 5DCDA 3FNDA 1FWAC 4XSLA 1NF0A 3STPA 4WD0A 1J01A 5C0QA 1T5AA 5CC5A 4JFUA 4TO8A 2XN1A 5C6MA 1J0HA 2DZAA 3TNBA 5C9ZA 4GIRA 2BVWA 1KBBA 3R0UA 3GDLA 2VC9A 1W3NA 3VIHA 4K8HA 4F2UA 2OZ0A 1ZJBA 1R2SA 4QDMA 1Y0EA 4QNWA 3FJNA 3SCUA 4WK9A 4YHEA 3L9CA 4GUHA 4L64A 4FXFA 1RJQA 2GDUA 2WVSA 1P0BA 1NY1A 5DFAA 5C2GA 1UH4A 1AJ2A 4DXXA 5A6BA 3PPGA 3BLKA 3M7WA 4MAVA 1TZ9A 1JNDA 2HROA 2CU0A 5HULA 4L9ZA 2QCHA 3TCSA 4DWSD 3D47A 4DBUA 2WMIB 2CEQA 4KWVA 4DQWA 3DUGA 1E0TA 3R8HA 2P5NA 2J79A 3I7RA 4EKJA 3E0WA 1G4SA 2H8XA 3DYOA 4LUYA 4DZHA 3RILA 1QPKA 1P7TB 4ZQMA 5A95A 4ATLA 1UHVA 3LRMA 2Y7DA 5BU9A 4AZBA 2Y6ZA 3KCLA 1XF0A 1D3GA 1TB3A 2QT3A 4GY0A 4C6CA 5FKYA 4QIUA 3S3GA 3DFYA 4Q8MA 2VR2A 4NZ3A 3GHSA 1WDWA 1VBGA 3Q2DA 4E4UA 4IX0A 1ZSXA 1QOXA 3IK2A 1GOMA 3BLFA 3HB9A 4V1YA 3EWXA 3MCOA 2OYKA 4RE3A 2PTYA 1R86A 4M82A 1G4EA 1KBJA 1EQCA 4TV5A 1BWLA 3NDYA 3TTEA 3ELFA 4B5VA 2GQAA 2DVTA 3W25A 2ZBTA 4NT0A 5DXXA 3JR2A 5D9PA 3GLCA 3SCVA 4S38A 4P8XA 1MUMA 2B31A 3WF2A 1OZQA 1SUXA 1FFRA 1HJUA 1NDZA 1H0GA 4I9TA 1PDZA 4I7WA 3R8GA 5AHEA 3F1QA 3VNDA 3FGCB 5DF0A 3W7MA 7XIMA 2HV5A 4MSSA 2OWWA 2XVNA 4JTGA 2J8FA 2ZRVA 3C2RA 2E28A 3IAQA 5HUPA 4J4KA 2ANUA 1RPKA 2QEZA 3LCXA 3PAOA 4ZBCA 2L5HA 3SZ8A 3EDEA 1DV7A 4RDVA 5A8QA 4O4VA 2GDQA 3MB9A 4LANA 1W1A1 5DBUA 2UWFA 4AEEA 1IIHA 3B0YA 2OYLA 2FLIA 1F76A 2BLEA 2HEJA 3BG3A 4URIA 5HNNA 3AFBA 3AI0A 2YXXA 1XV8A 4ML9A 2NSOA 4AF0B 4C6OA 4M6UA 1EUNA 2AGKA 2W9MA 1TUFA 3AO0A 1PO9A 5E6ZA 5CC6A 3BDKA 4RUBA 4PUUA 4TQTA 3W1LA 3OVQA 1QUMA 1FX6A 1PUDA 1TR9A 1JL8A 4JFVA 1QPNA 3BLIA 3QR1A 4ZSUA 4L61A 3OLDA 5LIWX 5HR7A 5I5RA 1EYWA 2IQDA 4BS0A 2V81A 5G2WA 2X0SA 3ME3A 5CPTA 4F40A 1J79A 3AXKA 3GDBA 4WRHA 1V7YA 4AIOA 2HRWA 1M7OA 3H7VA 1JQVA 3UWWA 2VTFA 4KFOA 2DJXA 4FXJA 4MM1A 3TQVA 1TMQA 1E6SM 3TZNA 1MI3A 5HMFA 1EXBA 3VDHA 4W8AA 3BANA 4RNIA 2WKJA 1K1DA 2G96A 2XZ7A 1XLBA 2VURA 4Q4KA 1DIKA 4JCLA 5EB8A 4NJKA 1E0WA 2WHJA 3C0SA 4OWGA 1KR1A 4O19A 4KFPA 1N55A 4D6CA 4JFSA 1FOBA 1JYVA 3W1NA 3WK3A 5EYWA 4IQDA 2CLLA 3VIFA 8A3HA 4WXYA 2VX4A 3BAIA 3G0XA 2PDPA 4JZ5A 3S46A 2CXGA 3GFYA 3T9PA 2OZ8A 4QEEA 1XRVA 5CEWA 5G1YA 2XH0A 5K3VA 2QPSA 4B5NA 1TPUA 4QRNA 4I7VA 2HE8A 4PGLA 3N4AA 2AL2A 3W7LA 5AC7A 1DJWA 4RNFA 3WNNA 1EJXC 3WD1A 4GX8A 3M0IA 4GA8A 2E0PA 3QV6A 4ZB5A 4BZYA 1H0IA 4ZO6A 2QDGA 1YQ2A 2QMKA 4C6BA 3H2AA 1IYXA 4C6IA 2Y5SA 3VMNA 1UJPA 1W8SA 4IH3A 4XISA 3THCA 4F8XA 1E70M 2O9OA 2YW3A 1UR0A 3GTXA 3PPFA 4Q8UA 2DT1A 4UR7A 3MSDA 4RXGA 2FZNA 4WOZA 1OFOA 2GVLA 2WMJA 3QY7A 1M3UA 2ONEA 4EOUA 2DUXA 4R85A 1MDRA 3CZLA 6REQB 4BWLC 3BGAA 3IPWA 5K4XA 2ISVA 1FWHC 4WX2A 3TSBA 3O1NA 2ZE0A 1ZRQA 5C9RA 2OOFA 1Q4NX 3R43A 3EEZA 3PBGA 2WO5A 2V3FA 3A9BA 3SQSA 1BSLA 4ADTA 3CHCA 3CZJA 3VDCA 3CT2A 1J0JA 2NSXA 1KM4A 2QCFA 3LX9A 1EP1A 2ZRZA 3FYPA 4PUNA 3STEA 4Z2HA 1KCKA 1B30A 2GWNA 4NNBA 4ZL1A 1BFNA 3AHZA 5T26A 1HO4A 2A21A 3VNMA 3W7JA 3GXDA 4UQCA 1SPQA 1CGVA 4KWSA 1LQAA 2J7CA 4P2VA 3KVMA 1SJCA 1ZLPA 2YYUA 3I7QA 1QNQA 1J11A 2CZVA 2YGYA 1CDGA 4Z1DA 2X7WA 4FA3A 3U4AA 1TR1A 1QTWA 3WF0A 2Y24A 4OUIA 3AWOA 4ERGA 3II1A 1QXLA 1K8CA 3HBLA 2Q8LA 4DJFA 1KGXA 4U4MA 3CYJA 4O0ZA 4ZTXA 1B2YA 6ALDA 1OK4A 2V30A 4LAOA 4Q7NA 1ISVA 1VCVA 2AL1A 1OYCA 3SY1A 3S6OA 3SN4A 1SFJA 2FPVA 1BHGA 3CQIA 2PDMA 3NCOA 2Y1HA 3PJTA 5EMYA 4FNQA 4JPGA 3HO8A 4F9JA 1QK0A 3SUWA 2XSBA 2ZDSA 1FUYA 1GKPA 3V18A 3UETA 1H61A 1BRLA 1H7OA 1VS1A 1X8CA 1KBKA 4GACA 2E40A 2PE4A 4FO4A 4ADUA 2WKLA 4E38A 1VFFA 5DN1A 4UQ9A 2PDXA 4BY3A 3HQOA 5LNVA 4JXCA 3W22A 2A5HA 4AWTA 3GTNA 4TIMA 1UR2A 4DZAA 3REQA 4DZIA 2PURA 3LPOA 4MLRA 3G1FA 2Y7FA 3OBEA 5D9OA 1EDGA 4FNSA 2SFPA 4K7VA 4B92A 4V28A 3WLIA 3IJLA 3VFLA 4ML4A 1UASA 2VC5A 3AU2A 2ZUTA 4NZJA 3U6WA 4F79A 1MW1A 4FF7A 4RPQA 3MI2A 2WBKA 3WLJA 3TXZA 1TPH1 4Z2JA 4YPJA 4IQEA 1LOLA 1HKJA 4MY9A 1C90A 1SZNA 4RZ5A 4AG0A 1OVDA 1VJIA 3GBDA 1GOQA 1ENUA 5AY7A 1SGJA 3S4TA 3GAYA 4GBUA 4XWUA 2WZEA 1DORA 1WCGA 2PDHA 1LQ2A 4JIHA 1G7VA 4N9DA 4M3PA 3OGRA 2WC3A 3ENLA 2DZBA 1LL4A 1PHWA 4A3YA 4CLMA 3AYVA 2VXNA 3K8LA 1UD4A 4OGZA 2OMAA 1XISA 5H2ZA 3SCNA 3DU0A 4IMDA 1RK5A 3IIZA 4RCXA 2DT0A 1JI2A 1ZBKA 3Q4DA 1RAKA 1LF1A 1Y8BA 1PJ9A 3KW3A 3AHTA 1FCQA 1WKDA 5F2GA 1GQNA 5DMLA 2ZZ5A 2PP3A 3W9ZA 4CQBA 4M51A 4POCA 1UOKA 3MU7A 4WZHA 3L23A 4MJ2A 3TYEA 1KTBA 3IUHA 1XLLA 3CC1A 4DO6A 5RUBA 3NQEA 4W89A 5ABTA 1E1CA 3NVDA 2CLMA 1KCXA 1K7XA 1TRIA 3LHYA 1JDFA 2QCGA 5I00A 4GI6A 3LHTA 4CKQA 4S3EA 2JKAA 1VYSX 3VIOA 2ZWYA 3W7KA 4HJFA 6XIAA 1FH7A 2GK1B 3BG5A 4LCQA 5JH1A 3V75A 5DMNA 4JYDA 4CU8A 3ZT6A 1JZ4A 1UMYA 3G1HA 2XIMA 4D8LA 2QYGA 1EJWC 1UZ1A 3FX4A 1Q6OA 3SCRA 4PCFA 2C8NA 4Y96A 3AUJA 1BXNA 1OIMA 4GXWA 4Z2GA 3C2EA 1Z3NA 1OC7A 2F6KA 5CJ5A 3WQ5A 1W8GA 4Q4RA 3GH4A 3UNTA 3H53A 3GB6A 3T2QA 2FZMA 1QI2A 1SMDA 3LMZA 4JHOA 4L80A 3MI3A 1A3WA 3B03A 4N4PA 1PIGA 2YBVA 4I7UA 4DUXA 1OYAA 4DUWA 4QJ1A 3CIXA 2Y89A 3RCYA 3N4EA 2CW6A 1OC6A 4A2RA 3P14A 3SURA 1EA0A 1U1HA 1QATA 1R7OA 1V6TA 2W5FA 1UR3M 1VIZA 1AMYA 2EJAA 1R3RA 4XAYA 2GFTA 3TH6A 3E3HA 1AD4A 2R8WA 4PC8A 1JD9A 3SGUA 1BQGA 3VGEA 4AHPA 1E73M 3BAWA 1FP9A 3ARYA 3NZ1A 3HURA 5HQMA 4PRWA 1VHNA 1MUCA 1XW8A 4PTMA 4OECA 4PMQA 3VAVA 4AEOA 1POKA 4X60A 3ABXA 3WMCA 1BVWA 2VQTA 3W71A 1XIMA 3GYCA 1HJVA 3LLFA 3AIRA 3T2PA 1MZHA 3PY2A 1XDLA 3ANUA 3DZ1A 2DORA 3GVVA 2QVNA 4LUTB 4XUYA 2W3ZA 4Q8QA 4WDUA 4PUMA 5AC4A 4E4PA 4P7LA 1XKYA 4IUGA 3A6OA 1S1RA 1ZY9A 2TRSA 1IIGA 4L7ZA 2Z25A 5CXPA 4KFNA 2ISDA 4FR6A 1O68A 4H41A 2HJPA 4NHVA 1E0VA 2WVTA 3QZ6A 1X8FA 4FR1A 4PN2A 4LNCA 3LOTA 4KGLA 3IGUA 4K3ZA 4MY8A 4ZB0A 4K36A 2CNCA 4JTDA 3COTA 1V02A 5I02A 5JUVA 3FDGA 1GYNA 3LERA 4MWAE 2PRLA 1Q63A 3EDFA 3UGVA 5BRBA 4B5TA 4W5ZA 1OCQA 4WHBA 4UQDA 4LYPA 1TTQA 1AZ1A 1UD3A 2X0HA 5HJXA 5LA0A 1BWKA 1R2TA 3G22A 5JBFA 1MFVA 3TN4A 3NXFA 2WV8A 4GHRA 2EPNA 1BWVA 1UG6A 3ZYZA 3O0KA 4H6EA 2PGEA 3N1AA 4EANA 1BGAA 4GKTA 1C9WA 3EKGA 2HNHA 1P7TA 2ZZ7A 3AMGA 3K1GA 3LV5A 4I9MA 1OK6A 4DWSB 3IRDA 5JBDA 5JU6A 1DWAM 2OELA 4AIEA 3FKKA 3P5YA 2E68A 2HE5A 4YTRA 1KXQA 3DGRA 4MZ1A 2PZ0A 1CPUA 3BWWA 2RFGA 1K9EA 4IMFA 1RUSA 1IZCA 3HM7A 2WJFA 1EDTA 3BO9A 2A3HA 3PBWA 4NZ5A 3NQ7A 1Z44A 4OBTA 3W27A 3EMCA 4LH8A 4US5A 1GEQA 1XM3A 3UXDA 1L6FA 1L6YA 2P3ZA 2YBUA 4GG9A 4M6QA 4XTDA 5FEPA 3UG8A 1JG9A 1Z8AA 4K68A 2J74A 2VD9A 3DBPA 1J6OA 1XHGA 2BGSA 3O2LA 1HX0A 3HV8A 3IJDA 3EX4A 3DG3A 4N7QA 3C0QA 1UMLA 3AWNA 3IJ9A 3MKVA 5CZ0A 4RNHA 5BNKA 2O55A 3IJ8A 4YN5A 1CENA 1HUVA 1EJVC 3FGCA 2PTZA 2NQZA 4G1KA 2BGNE 2J7GA 3LLXA 4HYWA 1XIEA 3T05A 2TYSA 3WH6A 4UCGA 4ZENA 5GNZA 4MJ4A 4MFDA 1TWIA 2WW5A 4BQ3A 4CNSA 4XBJA 3VGBA 3VM7A 4WIWA 4HK5A 1FP8A 3L4WA 2BV9A 3W82A 5LNUA 1AW1A 3TWAA 3UESA 4AF0A 4DJED 3S5ZA 4NRRA 3WLMA 5B7ZA 4Q8NA 2HQAA 5DXYA 4IM4A 2PSNA 2BDQA 5IXEA 3AJXA 2VFDA 3CUHA 2ICSA 5A8NA 5A6AA 2DSKA 7REQB 1UH3A 1P0KA 1M68A 5D2YA 3E1F1 3VKCA 4MUPA 1FKWA 4AY1A 1UP3A 1Y65A 1WQ5A 2B7NA 4OOUA 4DYJA 4ADSA 4F0HA 3CAWA 4XB3A 5LSMA 3G1VA 3FSTA 3UBPC 4KEUA 2YLAA 5I2UA 3IGSA 1KGWA 1M5WA 1NVMA 3NOEA 1LT8A 1H7RA 4KERA 2OCZA 1H5VA 3N18A 4GI8A 5FL1A 3KHDA 4PTNA 4LQ1A 2UY2A 2WHMA 4LYKA 1BPLB 4UQAA 5FSEC 1J4EA 2VCAA 4OIFA 1O60A 4P7OA 5EMLA 2KAUC 1TELA 1TWSA 4OKDA 2NVCA 3S9YA 2J6XA 3IVSA 1GPFA 2C7FA 3RPTA 2FPTA 3EPMA 1VPQA 1BAGA 4ZXLA 5LIUX 1GW1A 3W84A 1AD1A 5LA2A 4OJYA 3MSRA 2A3AA 1TV2A 4MY1A 3IUIA 2V8ZA 1V6UA 3T0TA 1KV8A 3L0NA 4H3DA 4F66A 4BKNA 2PTXA 1XLCA 4RV3A 4GNJA 2GUYA 1VLWA 4LVGA 1P48A 1DWJM 3E2SA 4ACZB 2YXOA 3QQ1A 2GPTA 2CLIA 2V82A 1DWFM 4R33A 1O5KA 5CC7A 3O6AA 7A3HA 3AZTA 1JD7A 3WLSA 8CGTA 3F03K 1A5KC 2QUMA 1W0MA 2O9TA 2QUNA 4CNUA 2OYMA 4HK6A 2ZC1A 4CD6A 2NUYA 5B80A 2H90A 3W7HA 4J40A 1M65A 2XH7A 4NX0A 3KZSA 3LRLA 3PAJA 3GNPA 4H9YA 2QVHA 1WBHA 3MKCA 4H6QA 4WDTA 5CSRA 3T0CA 1KM6A 4KIRA 5I24A 2FIQA 2QCLA 4X9YA 2E6FA 2HNEA 3ARTA 3N17A 3OA3A 3T07A 8XIAA 1QAPA 3SRFA 4XIAA 2GVGA 2PEVA 4YCPA 3ZJ8A 3TYAA 2WANA 2EG6A 4WSHA 5LGXA 3R1ZA 3OVRA 2JEQA 3N2CA 4IJRA 4I8YA 1UB3A 1JULA 6REQA 3S1UA 3ZT5A 5A6BD 5KZMA 3W1XA 1LBFA 4MPKA 2CPUA 2ZUUA 2E25A 1XPGA 1US0A 3DKLA 1TTJA 2D24A 2GGHA 3NZQA 3BE7A 1RK6A 3MCMA 5BROA 4D1IA 3QOKA 1F6KA 4HU4A 1WXZA 2VT0A 1E6NA 3GXNA 5BWFA 4G2DA 4W8LA 5HA7A 4DNMA 4JEQA 4IXXA 3HV9A 1FFQA 2E5DA 2ZRWA 3MUIA 4UFKA 3DFPA 4MUZA 4K1WA 2Z1XA 3NAVA 4DWDA 3J7HA 1TV5A 4FPSA 4AUBA 1MNZA 3H21A 4WOQA 1GNXA 4Y6GA 3AHXA 5LNSA 1B9ZA 4L4OA 3W7DA 2D20A 2FZDA 5EGRA 4OZOA 1W1VA 3AS3A 3TTSA 1Z32X 2R1LA 4DM1A 4C7FA 4XZLX 4ENLA 1ZL1A 3TAOA 1CECA 1YDNA 2Z2UA 4IJCA 5LA1A 4X22A 3ITXA 4UFHA 1J0YA 1GOWA 3GXFA 4OUEA 1VH7A 3AXHA 3WLPA 2DZPA 5L9FA 4KRUA 5HWMA 3UJSA 1XDJA 3W1RA 1LWJA 3FJ4A 3IIXA 2C1IA 3I65A 2CITA 2VO5A 1NDVA 1RSCA 3HPZA 3RX3A 3O15A 3NUKA 3INPA 4QEHA 2FGLA 3GNOA 2JF6A 4GZJA 2CKRA 4Z08A 2V5CA 4ACYA 1YHTA 4LUJA 1H7XA 3GDKA 3NL5A 1P4CA 1DTNA 1O95A 1OT2A 1VC4A 2Q09A 5TIMA 3URQA 5D9MA 3LY0A 3R2GA 4C6LA 1OYBA 3BAJA 3MI6A 2XTKA 3V0SA 1DPMA 3B9AA 1W91A 1M01A 4LPCA 3CV2A 2GUUA 4A22A 5TF0A 4JTEA 4GYPA 4H9UA 3N4FA 4F48A 3NQCA 1O5RA 2UZ9A 2YZ5A 2OZ3A 3PVFA 1N8WA 4UOZA 1VF8A 3MKKA 3QZAA 1ISXA 3B05A 1JYXA 2ZX6A 1DEDA 4CN1A 3LN3A 4OOZA 3HGRA 4HN8A 3AHYA 3W1MA 4UTWC 1UR1A 4UC5A 2P50A 3RCMA 5MKGB 4MYAA 2VC7A 4D6DA 3U2CA 1EJRC 3VDGA 1DJIA 1PL9A 3TONA 4PCSA 1SR0A 1QRQA 4CQAA 4EP8C 3KL3A 3A47A 4HB7A 3EXRA 5G1MA 4HGXA 4W87A 3V5CA 1VFHA 1OHLA 1TX2A 5AKQA 3GG1A 4LBUA 3WNOA 4R53A 4K7YA 1F3TA 1XYBA 2JEPA 2PODA 1B54A 5EMUA 3I3BA 1UIOA 4L1XA 3E0VA 4AYSA 3H54A 5AHMA 4PBGA 3PFMA 4AD2A 2AQVA 2V3GA 3ARXA 3S9IA 3S2MA 4E5TA 3A22A 1TWZA 2QCEA 3RLHA 5PTDA 3FXGA 2RAGA 1B90A 3O16A 4DJEC 4FI4A 2DZWA 3EB2A 4LSBA 5GJMA 3PWGA 4QE1A 2IXUA 2Q71A 3BXWA 1Q2RA 2CLOA 4IGHA 5F7UA 4O53A 3KX6A 3TROA 3PC0A 2IKIA 4LS0A 2CYGA 2G97A 1PCKA 3WFZA 4RE4A 5IM51 2QJNA 2R1PA 3F5KA 3H24A 4AYGA 3FHQA 4D8AA 3V7PA 4FZIA 3TMLA 3VFCA 4PEEA 1V93A 1VPYA 3NPWA 3GR4A 4QG9A 4WSKA 4XAPA 3U48A 3ZR4A 3UW6A 2NQLA 3W1AA 4NZ1A 3WUEA 1RCQA 4HPNA 1HP4A 1TPVA 4PL2A 3CPUA 3ABOA 4NJHA 3DN5A 3EOEA 3S83A 2GK1A 1OZMA 2NXGA 3EX3A 3NEHA 4XVEA 4LB4A 2Z4GA 3JUGA 3UWQA 4E8CA 2VHLA 1B5TA 1FWIC 4OBSA 4JY8A 3HG5A 1W54A 5GPRA 3CH9A 5H1WA 1L0PA 3WD0A 3BCFA 9CGTA 3NQ6A 2VYOA 3B4UA 1MO0A 4JYFA 3VC6A 2PCEA 5A2AA 4O1AA 5I78A 2IXVA 4JTRA 4AD4A 5I3GA 3WLRA 2YFNA 2EJ1A 2ZRXA 3SI9A 2OKOA 1UD6A 2PWGA 1E6ZA 1LZOA 3SJNA 3UR5A 4G7EB 3N73A 1LL6A 2Y5JA 4E8GA 3FIGA 5HNRA 4HA1A 1E9YB 8XIMA 1LRNA 1GVSA 3IWPA 2WHKA 1OF6A 1EGVA 3FLUA 1T99A 1QWKA 1MUWA 1RJRA 4UTTA 1TTPA 3V0TA 1KWKA 1P43A 1XQKA 2O56A 4W7VA 2OZTA 1J6PA 1E40A 4ILSA 2IKHA 1XG4A 2POZA 1HIZA 1H5YA 3QQ0A 1J12A 4IIDA 1CGTA 1E6PA 2J88A 1CXFA 3QGVA 4MB3A 1E5JA 2OO6A 3ZVHA 3T0DA 4FIQA 4DI8A 4XZBA 3OGSA 2HXTA 2ZUVA 4F2BA 1NQ6A 5TAOA 4Q4QA 5K4ZA 3FYYA 4Y8EA 3WL1A 4QDWA 4EVZA 1HL2A 2F6UA 2VQUA 1V7AA 3F2DA 3UJFA 3FOKA 3LBCA 1LDCA 2YKKA 9XIAA 1CW2A 3NSXA 1R3TA 4ZB2A 1Q6QA 4KCUA 5J5DA 1P1MA 4QQ3A 4U10A 3WF3A 4LUTA 3VD5A 4V15A 1GHSA 3VCRA 1ODZA 3IK4A 4IPPA 1FWEC 2EBNA 1QR7A 3EPNA 4DJFD 1ITUA 3DKJA 5D09A 3IGHX 4JNYA 4GVGA 3BW3A 4DAFA 1ZHAA 4S3CA 4DF1A 1ML1A 1S5TA 4LRSA 4JTFA 1C93A 3PZMA 4REQA 1TV3A 4IICA 2PDIA 6TIMA 3W75A 4NL1A 3GFZA 2ZICA 2C3ZA 3CL6A 5LZLA 4KETA 4LCRA 2IPWA 2PGFA 1LT7A 1DKWA 3NL2A 1XWYA 3PNUA 2X8RA 3IV3A 1ADSA 1UQZA 1V3KA 1C92A 2X7VA 3WQVA 2CZEA 1ONWA 5DRIA 3QLDA 3F4CA 3U8GA 4BEQA 3L4ZA 4O13A 2OFJA 4GQQA 3W7GA 5I3FA 1YTEA 5CZTA 4TX8A 4O10A 3SCPA 1TSIA 4IQLA 3M9YA 2YZRA 1GHRA 2BXYA 4H9ZA 3GNXA 4M24A 2XPKA 4JKKA 3DCPA 3ABSA 1U1JA 3EGJA 4HMCA 4JICA 2DDXA 3ORWA 2P1FA 4DPQA 4I9JA 2WOQA 2G41A 4QE5A 3RDKA 3MMDA 4J28A 1MW3A 3S1VA 4D2JA 4UXDA 3DESA 1IZJA 3TJLA 1R87A 2BMBA 4ZGYA 1NJJA 3HPFA 1GVIA 2VVNA 2CBUA 2PA6A 5FAJA 4IPJA 3IACA 2MNRA 3BH4A 3ISIX 3NL6A 3P6LA 4W9TA 1DQXA 2DT2A 2PDBA 1RBLA 3WELA 4LAUA 4JBRA 5ECUA 1TPB1 1J0KA 4Q33A 2REQA 2V3DA 3U2ZA 3WIJA 2CHNA 3AZRA 2HBVA 1GGOA 1B3YA 3DI0A 2HBXA 3PJXA 4S3FA 3LCFA 4ERAA 5HATA 4QG8A 3WD4A 4B5WA 1LRTA 2VENA 2DIKA 3A5FA 2YPIA 3GH7A 3QFEA 5KETA 1NFGA 4JTSA 1JR1A 1T8QA 2QJGA 1F8IA 4LVDA 4WY0B 3UXKA 4CCCA 2P0OA 4PMDA 4XUGA 5I3DA 2FZ8A 3FJ6A 3MJYA 4H83A 5ENLA 1PKLA 3L5AA 4AC7C 3QY8A 2VR4A 5D32A 2D1ZA 3RM9A 2VUNA 4YYCA 4JDBA 3BUVA 2YL5A 3HQ1A 5DLCA 3DFSA 3K2GA 2E67A 3CPRA 3A21A 5KINA 2BG5A 2QPUA 4IP4A 4YWIA 4PMZA 1NELA 2A7NA 4OV9A 4J2MA 4UWMA 2RGLA 1OBAA 3QM3A 4PMYA 3CB3A 3TSDA 2GLKA 7REQA 5E70A 4J3ZA 1MZRA 1IEVA 2XM1A 4H19A 4MADA 4ZQNA 3U57A 1L6GA 3CZ8A 4XO6A 2CZDA 4DBWA 1FHDA 2YXGA 3AYSA 2VR5A 4HP5A 1DQWA 1VGAA 3PZ9A 5C9UA 3FW6A 2WZHA 3UR2A 1KTCA 2YDSA 2QCMA 4DRSA 3ZLFA 4A8NA 3EWDA 2Q01A 2C14A 1QNOA 2C13A 5AVHA 5ABGA 1ZJHA 4HTBA 1XRFA 2WSPA 4Q8VA 3W4RA 1CTNA 4G56A 3MT1A 1XP3A 3IIVA 1A5MC 1SZFA 4K1GA 2XGBA 3XISA 1CXKA 1EHNA 2OG9A 2X41A 5BOOA 3W88A 4U5KA 4B90A 1CEOA 2EG8A 2ZXDA 2QAFA 1EGZA 4RZ6A 2VX6A 4NXKA 4PRTA 1HG3A 1C9DA 1C8VA 3V1HA 1JUEA 1UJQA 4ACZA 5FJIA 5HXMA 5BXSA 2WYSA 3CEPA 1NQKA 1LJYA 4ORIA 3MO7A 4EPDC 1TZ7A 1UZ4A 4MB4A 3VTRA 3WJSA 4GE8A 4AD0A 4H9MA 4L6OA 2IKGA 1VFMA 3C86A 3MZ2A 3DYPA 5CGTA 4H2CA 1RZMA 1XXXA 4JS3A 4R7JA 2YDAA 3VILA 1HP5A 4ZO9A 4AWUA 5FJOA 1SO5A 3CYVA 4L4PA 3RGTA 5AC5A 1XSKA 2VC6A 3N29A 1S2AA 1IXPA 4NJGA 4TXEA 2YCLB 3D0CA 5C9WA 2PP0A 1KRCC 4DO4A 1XH2A 5AHFA 5F2LA 4RLIA 3ANVA 4H9TA 1M04A 1EOMA 4IISA 4LEFA 3C6CA 4GYFA 2WMKA 3ARPA 3EDDA 3VIPA 2UY5A 1I2OA 2CHOA 1W56A 3OG2A 3ECQA 4UQBA 3PM6A 1TV8A 3I4EA 5DO8A 2VNCA 3HPXA 3B8SA 4YJ5A 3AIUA 4DJFC 2WQDA 5LXEA 2NX9A 1MXSA 3PBUA 1NAL1 2WKGA 1XIIA 2OSYA 1OX5A 4W88A 3PBVA 1JDDA 2W27A 2ZQ0A 4ZO8A 3P93A 4BCEA 4AFYA 3GBEA 2PDYA 2GSJA 2WCGA 4LWWA 4RZ4A 3W85A 3EAUA 3AS0A 1KRAC 1H50A 3KDOA 3KS5A 2X40A 3GVGA 4H8NA 3S2CA 4DF2A 1JZ8A 1EC8A 3UR8A 1QDSA 1ADOA 3VCNA 2XVGA 3O3RA 3RX4A 3S1XA 5C9XA 1PZ1A 5CPQA 3QW3A 5I3JA 4GGHA 2D0GA 4DEFA 1TIMA 2P0IA 2QIWA 1W1YA 3VO0A 4GFIA 2PI6A 2PWUA 1T0OA 2XGIA 3WJXA 3DX5A 1JCXA 5A8MA 1XYLA 4N9EA 1BVNP 4M1BA 4C65A 4PE8A 3DAQA 1EWDA 4JL1A 2ACRA 4DBSA 1ZP3A 1V51A 2FVKA 1VP5A 3DC0A 1PB0A 4MB1A 3DIPA 4G7FA 4ICMA 3VKJA 3B9NA 3WFAA 1BG9A 4LS2A 1UUMA 5I3IA 1OGSA 1S2UA 4PSPA 4IGSA 1O94A 3DG7A 4J1OA 4GINA 1DL3A 1ZU8A 3ID7A 3VX0A 3TX9A 3MO4A 2FB2A 2OSXA 2Y63A 3APTA 3KCOA 4JTUA 4A3HA 5H8MA 3HN3A 2GVJA 2VWSA 3QV7A 3CBWA 1A4MA 1PBGA 3O05A 3PZOA 3LXCA 2E09A 2ZRUA 3BC9A 3IVTA 4IZGA 3NSNA 3NOYA 5T9BG 2ZE3A 2HS8A 1V5XA 2I1OA 4D9PA 1HNYA 4O18A 3IV8A 5I3HA 3IEBA 5LYRA 2I57A 2QMJA 4D6IA 3F5LA 3W7IA 4CD8A 1FWWA 3AAMA 5D37A 3E2VA 3C61A 1TJ2A 3Q58A 4ZQPA 1XLAA 1D9EA 3OQ8A 5BRPA 1XLHA 1TVNA 4CQDA 3P67A 4GRSA 4U28A 4LAMA 5JIPA 1CBGA 2FTPA 4O16A 3A23A 3OZOA 4J3XA 4OE7A 3RR4A 4MF4A 5TNVA 3VOIA 4O12A 5AC6A 3VNLA 1HGYA 4W85A 3U2OA 4C5YA 3QW4B 3G6LA 1XIJA 3L21A 3V4BA 4GXPA 3TZFA 2DH3A 2RDWA 1FWBC 2WJZA 2GWGA 1BF2A 3IIOA 2IPFA 3WL0A 4YVXA 3W2KA 1LWIA 4LVFA 4IUOA 3N3MA 3UD6A 4LBSA 3ZO9A 1XLGA 3BSMA 4HBKA 2OQYA 4Z0JA 1CCWB 3P74A 4OFCA 4AU0A 1QNPA 1Q7ZA 2ZZ6A 4GJIA 5DY2A 2JBMA 3R4IA 4HZMA 3OJGA 3QMRA 3FFSA 2D22A 3UA4A 3W2NA 1OADA 1TE6A 2ISFA 1DHKA 2VEFA 4A3QA 3F4WA 2ZUMA 2PLJA 3VGDA 3GVRA 1XIGA 3W38A 2VP8A 1GVQA 1WDQA 1FWFC 4WKFA 2BVTA 5CJNA 3SIMA 4LX4A 1S5MA 5BOEA 3ZJ7A 1XLJA 1E1FA 3M0YA 2FDSA 1N8FA 1LLWA 1ITQA 2JK2A 1H60A 4B5UA 3BMXA 3OODA 3CMGA 4KEMA 4Q7BA 2DEPA 4D6GA 3UVAA 2FGBA 1TREA 1XKJA 3D3FA 2AQOA 3F5JA 3MP4A 1JVNA 1ZCCA 3O63A 2QS8A 3TE9A 1NOFA 4ROQA 1W9VA 3SEPA 3SSZA 1WBJA 3UZXA 3NQ2A 4X2RA 3WUGA 2AL2B 4TTUA 3C2YA 3GHRA 3W24A 4F0RA 1XG3A 4G7EA 1Q66A 2BOFX 3N2MA 3WQ6A 3QY6A 1V3IA 3VIJA 2J9XA 4TVUA 1XBZA 1QPQA 3KOZA 1LG1A 3MBDA 3QJAA 1QNRA 4HMDA 4D6HA 4ZQOA 3CWNA 1TJRA 2GJNA 2CCRA 3GC2A 4J9JA 3S2NA 2J4GA 1C8YA 3ARRA 3W6MA 1PXGA 1DJQA 3T09A 4C6DA 3KP1A 1EFZA 1XLKA 3C4UA 1QOQA 3AXXA 3EKLA 5I79A 4XD6A 3S6TA 3GG7A 2OX4A 5TBOA 1TX0A 1QI3A 3ABQA 3N6QA 2X30A 1W9UA 5HINA 4TU1A 4LXFA 4G9PA 3WNMA 1VB9A 4C90A 2BY3A 2HXUA 4IPIA 5AZ1A 3KVLA 3L5MA 3SY8A 1I2RA 3LU2A 1KFBA 1JGMA 1J0IA 1B3ZA 1U1UA 4QBXA 2NT1A 2J9YA 4JTTA 3OLGA 3W3OA 3WQ8A 3H6OA 1PIIA 1Q4WA 4MPQA 3S0CA 1QBAA 4TMBA 4Y9PA 2H3BA 3OEXA 4W86A 4E0CA 4YTTA 3QN3A 3ZFHA 1UKTA 2OLHA 2ON3A 1G4TA 3N14A 2OODA 4LUIA 1JF5A 1YX1A 3OA5A 1XYFA 5C7HA 3IJIA 1XC4A 5DMMA 2F2HA 5I09A 1W2PA 2J25A 4CVUA 3THDA 1G67A 4YHGA 1XI3A 1I0BA 2RUSA 4YL2A 4CNNA 2Y4SA 3VABA 1E0XA 2VL4A 1F3XA 3ERPA 1UCWA 1OCBA 1R2RA 4O15A 2J7DA 1W1ZA 5EPDA 1EF3A 1NWRA 1EC7A 1VJZA 4R7OA 4NSBA 1YDVA 3CQHA 3RLGA 1HTIA 1E6QM 2EPHA 3RR1A 1HJXA 5I77A 3RPMA 1GG0A 1CGXA 1WOAA 3TFXA 1FHVA 2Q6ZA 1BRLB 1J2WA 2QXWA 2TAAA 4HCHA 3VYLA 1I60A 3N11A 2ZX5A 3C2FA 1W5QA 4AEFA 1QBBA 2X1TA 1UKSA 2YL8A 3W7RA 3KE0A 1WAWA 1GVYA 1ZAIA 3SGGA 4XD3A 3MUCA 3UNDA 1I2NA 3TEVA 3MHFA 2YYTA 1EX1A 3SB0A 4AB4A 5LNWA 4Q3MA 4WCJA 3VIIA 4PUWA 4FAMA 5CLWA 1PIFA 1M7PA 2EHHA 4UFJA 5DELA 2Z0IA 3ITCA 3LDVA 2PZNA 5AECA 1AQMA 4MLJA 2Z1SA 3WBEA 1OFQA 5FL0A 3NQDA 3R11A 4ZFCA 2GJXB 1OT1A 3CB8A 1AJ0A 4NZ4A 1YPXA 3UZJA 5HMEA 3MJMA 1TKKA 1MXGA 4HOZA 4KESA 2BBFA 2FKPA 4AW7A 1QNVA 3TNOA 4TV6A 1OFAA 1EJUC 4KBXA 4S23A 3SUTA 2A3EA 3JZEA 4H9VA 3L12A 3GG8A 4DNHA 3NZGA 5HK4A 3TN6A 4LGXA 4V27A 2JIWA 3AXMA 1Q3NA 1JCNA 3KXQA 4QLJA 5CKSA 4ZA0A 2AMXA 4GYJA 2DH2A 1XD1A 4AY7A 4US6A 1MQRA 5MHBA 4HMNA 4OHQA 3W73A 3GC5A 1F5ZA 4DUVA 3GXTA 1SYTA 4AIUA 4U3CA 1F6PA 1KFJA 2ESCA 3EDKA 2F2KA 4HOWA 5FEZA 4PBFA 2DPEA 2QDEA 1K3UA 1QI4A 5FACA 4OU1A 5FJUA 1VHCA