1ZP4A

Glu28gln mutant of e. coli methylenetetrahydrofolate reductase (oxidized) complex with methyltetrahydrofolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
282
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFQFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPGPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 5,10-methylenetetrahydrofolate reductase
total genus 92
structure length 282
sequence length 292
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zp4A00
2FZNA 4O8AA 1V93A 2FMOA 3FSUA 1ZP4A 1TJ0A 1ZPTA 3APTA 1ZP3A 3E2SA 3E2QA 1TJ2A 1B5TA 2FZMA 1ZRQA 3E2RA 1TIWA 3IJDA 4JNYA 3FSTA 3APYA 4JNZA 2FMNA 3ITGA 1TJ1A
chains in the Genus database with same CATH superfamily
1OZQA 1TMLA 5EKYA 5LA0A 1KD0A 3V16A 1UPMB 2WWDA 1VJSA 5G1TA 3TK7A 1JYWA 3QC0A 4H00A 4LUSB 5B7YA 3UZZA 1B30A 2ODOA 4JQ2A 1FDYA 2CZ5A 4RV8A 3VD9A 4MHBA 2P3EA 4LALA 2X8RA 3P82A 1IEQA 4JNZA 3P3BA 5AZ1A 3RCMA 3AZSA 3MC5A 3FA5A 4C90A 5H91A 3WMCA 4GY0A 4UTHA 3M0YA 3AIQA 1OINA 1Z3NA 2QGHA 5E1QA 4Z2IA 4HGXA 1XYZA 4B5WA 5BRPA 1HJXA 1Y5WA 4TR9A 4AXNA 4IL0A 4AD1A 3P8IA 3IANA 3EB3A 5DF0A 1OCJA 4RDYA 4HHMA 4WJ8A 1OYBA 3W1AA 4CUCA 1DORA 3C2YA 7ODCA 1BVZA 3RPMA 5DN1A 3SCPA 1M53A 4UZSA 4PR4A 8TIMA 1LRNA 5AY7A 4WQ6A 1GJWA 1BGAA 1OFOA 3SUUA 2YXGA 3NQEA 1HJQA 3TFCA 2SFPA 4GI6A 3N2OA 1XC4A 2XH7A 3ALFA 3F4NA 3PWGA 1T6MA 3B4UA 1V0NA 3C3NA 3AS0A 2ZZ2A 3O05A 2IQDA 1KBKA 4HT3A 1FP8A 3HPSA 1TREA 4BEUA 3TIMA 2I7GA 1US2A 4L64A 3S1GA 2YDAA 4NRRA 2CC0A 4KCTA 3VKCA 4ML4A 1VYRA 3PG9A 3EWCA 4O16A 4U31A 3IPWA 3H21A 1B4EA 3CGTA 1VP5A 3QMTA 3T08A 2E09A 1EC7A 2QKFA 2Z1KA 4NZ5A 2I57A 3IGSA 1R30A 3LQGA 1UD6A 5BU9A 4I9AA 1HL9A 4H9ZA 4S3DA 1VEPA 1CXKA 2C7FA 1KTNA 2OYMA 2CESA 1ADDA 2VOMA 3IS4A 1R2RA 1JYNA 4WVXA 5AHFA 1F8MA 2PDHA 4GD0A 4AZBA 4O52A 4UTFA 2OZ8A 3BAIA 1YKWA 5LXEA 1RSCA 1UC4A 4QDPA 4Q8VA 1Y5VA 1G67A 2DSWA 3REQA 4LUTA 4AAJA 4MADA 3XISA 4D72A 2JE8A 4BWLC 3TJ4A 4HN4A 4TVDA 1K6AA 2NVCA 2Q3OA 4R33A 1RAKA 4M8UA 3PZTA 1PCKA 4CKQA 4NYUA 1Q2RA 2J7FA 4GMEA 5T9CE 4G6CA 3LHWA 3L4YA 4YCOA 1X7IA 3OO2A 3I6RA 3WQ4A 1QPOA 2VOTA 1DJNA 3RR4A 3PZUA 4LQ1A 4ERGA 7ENLA 1MEWA 4XISA 2ACRA 3KBMA 3PJWA 4UOJA 1GVYA 2VM8A 1QBBA 3GX9A 4JNYA 1ELSA 1NWUA 4UQEA 2XGZA 1EHNA 1PYMA 5A95A 5DXYA 5AVHA 3FLUA 3LPFA 4GG9A 1OGBA 3B8VA 2J77A 3UPWA 3ARYA 2VX5A 2PB1A 3CUXA 5I3IA 4LU0A 2DZVA 1CBGA 4HA3A 3PBYA 3DENA 1DHPA 4TXEA 3TCSA 4QJ5B 4G7EA 1E6ZA 4IISA 4PUJA 3AIRA 4DIAA 3LHVA 1XDJA 5EMLA 3F03K 4PUUA 4EF9A 3QW4B 3B9NA 1DOSA 1RPXA 2WHJA 3EB2A 5DLCA 2Y62A 1VYSX 1B3WA 1LBFA 4YVPA 2QCLA 3I6TA 1YBQB 3GXTA 1CW2A 3HG2A 4D1JA 3CAVA 1GUVA 3UEQA 3WBAA 3GIQA 4M6UA 1ZBVA 1R7AA 3C2VA 3BPWA 1W3LA 1LL6A 4RKAA 4BS0A 4MKVA 4ZQOA 2CZVA 2WMHA 4HTBA 4HNTA 1KXQA 4O8AA 1FCVA 2G41A 1SJAA 1AD1A 2QGYA 3VVGA 2GK1B 3QYSA 3VOFA 1SO3A 4IMFA 1JAEA 2DJXA 4S3FA 1UBPC 3MUZ1 4A4AA 4MAZA 4O15A 5J5RA 2PLKA 3GVQA 4EVZA 1W54A 4H41A 1PWLA 4J28A 2PCQA 4Q7IA 3BSHA 4HYWA 4RDVA 1S2UA 3WD0A 3O2LA 4G7FA 2J7BA 1YEYA 3NXFA 1L6WA 4BEQA 5B80A 3DH7A 4YYCA 4DN1A 1OT1A 3CWHA 4CNPA 4LWWA 1JUEA 4XZMX 3EWXA 3LDVA 2NQHA 2E7FA 3CH9A 4ZTYA 1RA0A 2BBFA 1ONRA 3OVQA 4Q3MA 3MKCA 3UNTA 2E5CA 3T6CA 1P0BA 2WJEA 3FGCB 3P5YA 4IL2A 2EKGA 4FHAA 3PZNA 2YW3A 1UIPA 4JFTA 3B8IA 1ZJBA 4LC6A 3DC0A 1VHCA 3QPZA 4I5UA 3KTXA 4AUBA 4L56A 3PJXA 3NPWA 4Y7EA 4PUNA 4A8LA 2WVVB 1UC5A 5TAOA 3LMZA 4H19A 3SY5A 1V02E 3MKVA 3G8EA 1QDSA 1UIOA 3M0LA 1SZGA 1F61A 2YPIA 3IIOA 2PTXA 2FB3A 4AMCA 1AUSL 2ZDSA 2PE4A 1J6OA 1T41A 2XGIA 3SIMA 3IGUA 3MBDA 4BQ4A 2PF0A 1XH1A 1GQLA 1CI1A 2R91A 2RAGA 2O0TA 3EWWA 1GYLA 3T81A 5HQEA 2ATSA 1NWTA 1T8QA 1JYVA 3BJSA 4LGXA 1R3WA 5LIYX 3CPUA 3FSUA 3WLMA 2WLZA 4PRTA 1RALA 1R3YA 2VEKA 1IYXA 4JIRA 3T78A 3N17A 5AFDA 3CL6A 2A3EA 4L80A 3W00A 4V1YA 1FRBA 1U1HA 3O6AA 1O4UA 1AZ2A 3LZ3A 4E2BA 3UZ5A 4EKJA 4FLQA 3DI0A 2ZX7A 2Z4GA 2GUBA 1D2KA 1XQLA 3AI0A 4CCDA 1KM1A 3U7BA 3P74A 2W27A 2QJMA 3AYVA 4NX0A 1FFRA 1LT7A 5C6MA 2C13A 3FKKA 1BXNA 3A3XA 4DQWA 1POKA 1CZ1A 3NURA 3VK5A 1QI3A 1UOKA 1LM1A 3W2LA 1Q63A 1HL8A 3Q2DA 5HBFA 1V02A 3H8AA 3IWPA 2ALDA 3M43A 3N2XA 1F05A 4Y9NA 1TA3B 2E67A 2ESCA 3FX4A 4Z0SA 3N34A 3DGRA 4Q6JA 5FL1A 4Y9MA 1QHOA 3SY1A 1TIMA 3C0QA 2W5FA 3GBDA 2E28A 4KGJA 4WLCA 2ANUA 2OGJA 2PA6A 3LNMA 4E5TA 5HUOA 1VEOA 1XDLA 4FALA 3NDYA 5G1YA 4BI5A 3RHGA 4HMEA 2BVWA 1PZ0A 2V0TA 4HNUA 4AF0A 1VGAA 5EMKA 4MJMA 4DHGA 4I6KA 3WLPA 3DOPA 1IEIA 1F8IA 2CLIA 4ERAA 1YX1A 4DM1A 1GYNA 1PKYA 1I1XA 1A5MC 3ARUA 3THQA 5LIKX 2YCJA 4OZOA 4R7JA 4KWSA 3LXCA 3P62A 4C1KA 1MDRA 3T42A 3HQNA 3BMWA 2G3IA 1E0XA 3EPMA 3S1WA 4PB4A 1JJKA 1JZ5A 4HPNA 1GCYA 3E0FA 2GDQA 2WO5A 3WFAA 1IHIA 5DCBA 1V3LA 3PNZA 5U4NA 4MM1A 4H2CA 4AMAA 2PURA 3OW1A 1DHKA 1QHZA 1DWFM 1VJIA 1T5AA 4LYRA 5BXTA 4JHZA 4GIEA 4HU3A 3K2GA 4NAEB 4RX0A 1GGOA 1P43A 2VUNA 1TX0A 1XIEA 3ITTA 5C2GA 2YR1A 4H6RA 1RJQA 1F07A 3GDLA 2XG9A 3LEPA 1D7FA 4MNJA 4DJEA 1EBGA 1J5SA 2WBKA 1V0MA 1JUBA 3BLOA 2HXUA 3CJPA 2ZYFA 3M46A 3NL5A 2XM2A 4YN5A 2IKIA 4PE8A 1DJQA 1QJWA 4QRNA 1ME8A 1UR8A 4FR1A 2BNJA 3OHIA 2CHOA 3UJ2A 4AHOA 4K6AA 1AH3A 4GJIA 1Q6OA 3CLMA 2P76A 2AQVA 4PMNA 1BYDA 3KDNA 4TMBA 2ZADA 3C8NA 2V81A 3BZGA 1DJHA 4PMYA 5HMDA 2PPGA 3TZNA 1HKIA 4XIAA 3POCA 2OFJA 3VTRA 3APYA 1L9WA 1EIXA 1WX0A 4C6IA 4ASTA 2Y7DA 2WMGA 3ONBA 2Q8ZA 1BVNP 3HFTA 4V2XA 4UFMA 2GOUA 5JBFA 3DX5A 1ZY9A 3DERA 4NILA 1GOKA 5E93A 2WKJA 2X42A 3C2RA 1QCWA 3SSZA 1B3ZA 9XIMA 2VR4A 3LBCA 3AIBA 5I0DA 1LG1A 1PZ3A 4R9XA 3TKFA 3MUXA 1ZP3A 2V82A 4O18A 4O11A 4W85A 5DBTA 1CLVA 4E3VA 1KCXA 1C8VA 3W2JA 1P0DA 1CNVA 1ZAJA 4ZB0A 4WOQA 1EO7A 1V0KA 3F2DA 3EDFA 1QI0A 3BQ5A 4FB7A 3UZJA 1HP5A 3UQNA 4UNLA 4MNKA 1QOQA 3ES8A 3H2FA 5FJTA 4AZCA 5AYZA 3A64A 1W9XA 1GVOA 2I5GA 4JL2A 4AW7A 2VO5A 5CGTA 2FZ8A 5C9XA 3AS2A 3KCOA 2XH0A 3B8UA 2PDUA 3W22A 4ERIA 1R2SA 3G8RA 3IV8A 1OYAA 1AK5A 3QTPA 3ENLA 4HQVA 1GJPA 4OOZA 4RJEA 1KTBA 5ABFB 1KGWA 2RDTA 4QR6A 4AC1X 1MO0A 2PDQA 1UKOA 5BXPA 3WQ6A 3TYUA 3KOZA 3CZGA 3VABA 1PKLA 3IIXA 4KETA 3W2KA 4XK2A 2A21A 3P80A 5I5RA 1TPB1 3LNPA 3QR3A 5CKSA 4M6QA 2EJ1A 1V6UA 3L4VA 3FSTA 3W71A 4ATWA 2WZMA 3OA3A 1VPYA 3SM0A 2OZ0A 5C2XA 1R6WA 4K37A 3AQUA 3K8KA 1L6GA 5JMUA 2E4TA 1EWEA 4O10A 4HIBA 1BSIA 5U7SA 2QJNA 3W7HA 1KFEA 1UWTA 1XLHA 4OUIA 3PJTA 2XSBA 4KEVA 1EX5A 7REQA 5ABTA 1LQAA 1TPH1 4QITA 2EXOA 3UZXA 3LM7A 1SO5A 4HSNA 3UXDA 3ZS4A 5FL0A 3W7NA 5A6TC 3E1F1 4V28A 2BOGX 3IJ6A 5DMNA 4DYEA 1UWSA 1G7VA 3MHFA 1J0HA 3AXHA 2XPKA 1XUUA 5A8PA 3W6MA 1RBLA 1TVLA 1S5NA 4TO8A 1K8YA 4UTWA 2GGJA 2YSWA 4H04A 3UG5A 1HZYA 4HU0A 1KM0A 1NF7A 1TMQA 1EWDA 2VZSA 3BMVA 2FGLA 1W3KA 4XTDA 2XIBA 2OJPA 3JZEA 3W7KA 3I3BA 3PUDA 3LOTA 2YDSA 4AD2A 3VKKA 3WLLA 1FH8A 4YPJA 1ISVA 5HUPA 4FAMA 1S5MA 1E6RA 4B90A 3S0CA 4J3VA 2D69A 1HFBA 4IMGA 3U3HA 1LRQA 4NSBA 2DZWA 5CPTA 4TV5A 2Z27A 3V5FA 4PCFA 1UR2A 3EGJA 3WQVA 3NO1A 3GG7A 3S1XA 2J9XA 1E40A 1XRFA 3BAKA 2W9MA 1TE6A 2VEFA 4A8NA 1WE5A 3PSWA 4DJFD 1I2PA 2QQ6A 3RX3A 4Y2WA 4Q4KA 2Z0IA 4M6PA 1OX6A 2WMIA 4N9EA 3AHYA 3WL0A 2F6UA 3U5YA 2A3CA 1KB3A 1WKYA 1FVPA 4E2DA 5HWJA 1RBOB 1BGGA 5FSEC 3AIUA 3DYMA 4YJ5A 4GINA 2ZUVA 5AC5A 3K8LA 2FLIA 3LYEA 1BTMA 2PSNA 1EEPA 1T7LA 1EFZA 4QJ1A 4BZYA 3NQ7A 4P8UA 1FWSA 4GUGA 3A24A 2YDQA 5T9BG 4EPBC 2VDIA 3S3GA 1C8XA 1XM3A 1FUYA 1RXOB 2F2HA 3GNDA 3CHDA 1GKQA 3EKGA 3IIPA 2QF7A 3LQLA 2GDVA 4JTAA 3PVFA 5MKGA 3ZM8A 1JR1A 1M41A 4OUEA 4WD0A 1VR6A 4Y9PA 4E38A 4TTUA 1L0PA 4FOUA 4XO6A 1OD8A 4NJJA 3S6OA 3URBA 2ZE0A 1BG9A 4B5SA 2D20A 4RDZA 2PF8A 3V35A 3DG6A 4ROPA 3L4TA 1TJRA 3GSMA 3QH2A 1XR2A 4LRTA 1IEWA 4A22A 2DEPA 3NQGA 4C7FA 1U5JA 1UBSA 4MZYA 1CEOA 3LM3A 3MUCA 2RJGA 1V7AA 4UTJA 2V3DA 1ZU8A 2JF7A 4K7VA 1O5KA 3LSBA 3SY8A 3OG3A 4HU8A 3ARQA 4F0KA 4C6OA 1MFVA 2YBUA 3QTGA 2C15A 2GUYA 2FMOA 3N4AA 3DGBA 1C92A 4AZGA 2YZRA 2WC4A 3MT1A 1GEQA 3VGFA 3W87A 1WOBA 3LCHA 3LBMA 1MVYA 4UFKA 2Y24A 4OT7A 3VPLA 4WOZA 2WZHA 1IGWA 4E0CA 1OZMA 1SPQA 2V30A 4DNMA 3WQPA 1ZJAA 2AKZA 1YTKA 1S2WA 4Q7BA 4PSPA 2C91A 4CN4A 3WDPP 3HQPA 3TXZA 1XIBA 1VAHA 2QJGA 3HV9A 4YTUA 5DEZA 5CSRA 3UXIA 4Z0JA 1RJRA 1YE6A 3WLIA 2AQOA 3FHAA 1LL7A 4IJCA 3QQ0A 1UWUA 1E4LA 1XPYA 4KFNA 1SJDA 4PTXA 3RIKA 2XFFA 2G95A 4XVDA 2F8QA 2XN2A 1EGZA 2UY3A 1J10A 3BC9A 2QDEA 4IMDA 5BROA 4O1AA 5A8OA 3L5AA 1Q8JA 1VENA 3EXRA 3PPGA 3TE9A 3V5CA 2VL4A 2BSLA 4C1NB 2W0UA 2GGEA 1B2YA 3G1XA 1H41A 5AHMA 5H8MA 5I3KA 3WNMA 3CAKA 1ODUA 2PS2A 2VWSA 2PEVA 3KOXA 2VGGA 3N9SA 1XCWA 1Y8BA 2J88A 5CZJA 3TTEA 3SJNA 4YYFA 4A3RA 2EQDA 2Z2BA 3NQ8A 3KDOA 4Z1YA 1LORA 2C6QA 3DESA 2QCHA 2X30A 4NAFA 2ZXBA 2RKXA 3NO5A 4E3TA 4ZA0A 2GPTA 2WOQA 1UR9A 5I23A 4QNEA 1VQTA 5CXPA 1PZ1A 3HPAA 4OBRA 4RW3A 4FXRA 3C52A 2Y88A 4XUGA 2F84A 1CIUA 4WIWA 3TQVA 4QQ3A 4AU0A 2QV4A 1ZALA 3IUDA 1Q6FA 1JZ3A 4WSJA 1S5TA 2PU0A 5BRBA 1X1NA 1QXLA 2AL2A 4ZVJA 2A7PA 3OEXA 1Q85A 4KIRA 1OT2A 3BLIA 4WK9A 2ZUNA 3MVTA 4NZ1A 2Y7GA 4XD6A 1VB9A 1EZ2A 4FNPA 3BGAA 2YCLB 2CXGA 1MDLA 4CD8A 2E6FA 3K4AA 3R1ZA 1IZCA 2WSPA 4W89A 3DG7A 4GYPA 3HJEA 1A53A 3W1NA 4QQUA 5AZ0A 1O12A 4QS6A 4YVVA 4POCA 4LVFA 3H7VA 3KEHA 1SJCA 5HOSA 4IQEA 1YPFA 1ZTVA 3IIVA 2UV8G 3W1LA 4W7WA 1JZ4A 2YKKA 1YNYA 1J5TA 2NQLA 3ARZA 4P8XA 1T96A 3G3DA 4NJIA 1E5JA 1WNOA 3S9IA 4GVHA 1QWKA 4AWUA 4A2RA 4KWWA 1VCGA 9CGTA 3GNXA 5ABEA 5IXEA 3E0LA 1CXEA 1ZNNA 4L6DA 2Z2UA 3SCSA 2JK2A 3N25A 3BCFA 2OT0A 4J3TA 3CZ8A 4H9MA 4DUOA 2FPTA 1ZSXA 3TA9A 1YTDA 3AALA 4LYQA 1I8JA 1L2UA 1VPQA 1R47A 2VZTA 4GX8A 2CLHA 4Q4MA 4DWDA 5PTDA 1LBMA 4FLRA 3INPA 2WCSA 4D6JA 4PCTA 5A6MA 3S1VA 3ITVA 3WCZA 3EWZA 3F5KA 4GACA 3ZSTA 2PODA 1S46A 4AIOA 4QISA 4TMCA 1PYFA 4GIAA 3S5SA 3E6EA 3W4RA 4A35A 4RPQA 2JBMA 4QAWA 2Y8KA 3MKKA 2DH3A 5FEWA 5JU6A 1UZ4A 3WG6A 3TXVA 5BWAA 2POZA 1W2PA 4C1LA 1UMYA 1CGVA 3WL1A 3UGRA 3WENA 1HJWA 5EMMA 4R5EA 1IWAA 3HM7A 3QY7A 1IT7A 4ACYA 2G3JA 3BLKA 2FPVA 3VIKA 1IZKA 3TYCA 1EXPA 1XFCA 1P1XA 1LL4A 5HQMA 4IX2A 2GVYA 3TZFA 4E4UA 1UUOA 2PDIA 2BY3A 2DZXA 3R10A 1TE1A 2QMKA 2VWTA 4KW2A 1LQ0A 4UCGA 3MVIA 1OFDA 2NT1A 1PS9A 1OABA 3TQKA 3UJSA 2DH2A 2EF9A 3FVMA 1QO5A 3BG9A 5BCAA 3KHDA 2ON3A 2DGAA 3MP4A 3VNKA 1YDNA 3F4DA 1HQTA 3P8JA 4F2UA 1R0MA 3IJ8A 3NEVA 3BAXA 3GRIA 3JRKA 4PCNA 1O1HA 3MYPA 4NT0A 4QG6A 1OQFA 4XZWA 3OLEA 3RGTA 1XWYA 2HRWA 5I3FA 2XHYA 5MKGB 1GK8A 4BK9A 3H4WA 3DAQA 1QVBA 2W61A 2YDRA 1HX0A 4LAOA 3O63A 5AHNA 1TV4A 3FHQA 1XV8A 2PMQA 2X7WA 3WH5A 4O1BA 1HKJA 4FXJA 2F2KA 2WNZA 1B9ZA 1H7OA 3RX2A 1BYCA 3NOEA 3K30A 2WAGA 2ZVRA 4FK9A 3B9DA 3SGZA 3W38A 1MYRA 3UA4A 2WPBA 2QR6A 5KMYA 1CX9A 4GNKB 4MYXA 1U1UA 1GHRA 3AMGA 2WNNA 3DUGA 4KT2A 3W29A 1TYGA 1H50A 4S3BA 5JXQA 4IT1A 5AYBA 2FQIA 1AJ2A 5KTLA 3GNRA 3VAVA 1JCTA 1DPMA 3EXTA 3MY9A 2ZX6A 3HQOA 1EKOA 4FX8A 2YL5A 3DU0A 4HNCA 4X61A 4XV0A 4JQ3A 2OOGA 3SW6A 3QOMA 3NPUA 1KR1A 3QSRA 1TUXA 4RXGA 1JAKA 1C9WA 1N8WA 2AQWA 3N29A 3P2VA 2CKRA 3ZXWA 3REQB 3M47A 4DF0A 2J75A 1VC4A 2F9RA 4LJ3A 4ZO9A 1P7TB 4XBJA 3MWAA 3ZLGA 3R0KA 1J6PA 3COTA 1V93A 1OCQA 3U48A 3MU7A 4LF2A 3GR4A 4ACZB 3PBVA 1SZEA 3STEA 4HVXA 3EX3A 2ZUWA 3DFHA 4IJBA 2YXXA 3GXIA 3F7JA 3A13A 4X63A 3QPYA 3MANA 3NR0A 4HCHA 4S3JA 4K1GA 1E3ZA 3VOHA 1QU4A 1V6YA 2VRQA 5C7VA 3VIPA 5XIAA 1XIMA 3T44A 3G0UA 2Y70A 4F2TA 5FAJA 2Y1HA 3IRSA 3OQ8A 2DIKA 8RUCA 1OX4A 3UWYA 4UMBA 2DUXA 3BAWA 3MHUA 1F3TA 8A3HA 2YA0A 2XTKA 4S1FA 4FEZA 3QMRA 5J04A 1H7XA 3DZ1A 4I8DA 2PLMA 4PMXA 3VXGA 4U2YA 4MUZA 1QNSA 2ONEA 2QVNA 3O9NA 3TVAA 4J3SA 2VFGA 4AZCB 4ZMGA 3NWRA 1C93A 4Z1CA 3L12A 1NVMA 4H9YA 1TQXA 5F2LA 1FHLA 3DDMA 1EXBA 4DVOA 4C91A 3GTNA 4WXZA 4Y90A 2R8WA 4WRHA 2PZNA 3KBSA 3KCLA 1X1OA 3QXBA 3N6QA 1KKOA 1ISZA 1AA1B 3B40A 3T4WA 2XSXA 2BWGA 5HR7A 3K1DA 3TTYA 3S46A 4BHYA 3ARPA 2J66A 4KRTA 1EOMA 3QGAC 1OK6A 5LGXA 4AWTA 4NZ3A 3ARRA 1LP6A 3DYPA 1SR9A 1WBJA 3NQ2A 1R2TA 3O0KA 1TPWA 2PI6A 1PAMA 4LS2A 5E6ZA 3G1HA 3H2NA 4W88A 2E6YA 1XRSA 3WSUA 1N2VA 1LWHA 4LUIA 4EIVA 2IPJA 4GIRA 5LNUA 3C0LA 3W27A 2HWGA 2QUVA 4MFEA 4A05A 3AJXA 3BANA 5AC7A 1SSGA 3W7IA 2UZ9A 4CCCA 1AQ0A 2Z26A 5A2BA 4MYAA 2BVDA 2VELA 5DO8A 4MZ1A 3WF0A 1ZP4A 4JKLA 1JRBA 2XH2A 5DT7A 4REQA 5EY5A 5A2AA 1J18A 4C6BA 3QY8A 4ZOEA 3MW7A 4IWWA 4Y9OA 2GJLA 3W7CA 4YTRA 4JS3A 3EDJA 1V3IA 4D6CA 2DPEA 3R13A 4GYPC 5FJUA 3M1ZA 2E1DA 4NUWA 2A3HA 4GVFA 4K8GA 1YADA 3CAQA 1OBAA 3W7RA 1M7XA 3OZOA 3G3MA 4R9OA 1Y7VA 3WH7A 2VZVA 4G1NA 4Z2LA 1VF8A 2PD9A 2Y63A 4AWSA 2CBUA 2F38A 1FWNA 3M16A 3F4WA 2B4GA 1EUAA 4ZCWA 5K9DA 6CGTA 2WMFA 3VKBA 2OQHA 1TVNA 3GAYA 3R2GA 2DDXA 3ZZ1A 1VRXA 2ZZ1A 5D33A 1WXJA 1P48A 2B7PA 5CSYA 3RPTA 4JCMA 3TUUA 1UKQA 4PMVA 4EOUA 4O50A 2VX6A 1FY6A 1Q65A 1ISWA 4AISA 3TYEA 4JL1A 2GUUA 1ISYA 1JPKA 1VIWA 2NZLA 3W1RA 4WJXA 1VRDA 1MXGA 1KXHA 1A49A 4XZLX 3CUIA 4I5XA 4U3AA 3WLOA 3OTRA 5BRQA 2EHHA 4FX7A 4RE2A 1OGGA 1U2YA 1AW2A 1MZRA 1DWGM 2NX3A 5ABHA 4P2VA 5KZEA 3DFSA 4QP0A 1KFWA 1SZRA 3VNJA 3PB2A 2V67A 4O28A 3G22A 1A5AA 3E2VA 3T09A 1DKWA 1YPXA 2WHLA 4RLIA 1A5OC 6ALDA 1WKDA 2J4GA 4I5RA 3HG5A 4AZHA 4WHBA 4E4PA 3ZO9A 4GHRA 4IX0A 3LA4A 3LERA 4HYRA 5LNRA 3NEHA 3IACA 5CEWA 4KCUA 4AF0B 3BLFA 3ZR4A 4LV9A 5F2MA 1KCZA 4UB9A 3PJUA 5JIPA 1KGUA 3PBWA 3HJZA 2CWNA 3RCNA 1WV2A 5M1TA 3CV6A 1KQZA 1A50A 3BOLA 4DBWA 4YXGA 4KCVA 1E55A 3VDAA 1B3OA 2O9OA 1V0LA 1GVEA 2FGZA 1FXPA 1G4EA 1Q6CA 4HHHA 1AMKA 4DBEA 3CUZA 3QC3A 1NFPA 3G6MA 3FV9A 3N4FA 3UESA 1V6WA 1SYTA 1PIFA 7TAAA 4E8GA 1A4LA 2WM0A 1E3XA 2BHUA 3S1UA 4AIBA 4EACA 1PPIA 2H3BA 4QLLA 4YL2A 1UG6A 2IPGA 1NDVA 2J7GA 1XL9A 1FHUA 1KGXA 1HN1A 3MCNA 4PTNA 1XRVA 3BJFA 4DUXA 1DJXA 2XH4A 5HNNA 4CEXC 1AL7A 5M3WA 1XCXA 1S1RA 4KEZA 1H63A 1T8XA 4DPQA 2VFDA 5D9NA 1Q6RA 4H2HA 1M3UA 2XM1A 5HJYA 4LBSA 4AY8A 5HR6A 1EDTA 2VCCA 1JRCA 3A5FA 3GG1A 1J93A 3MMTA 4M51A 2EJAA 2XISA 2XFYA 4BKNA 3OP2A 3S5NA 3M07A 3ITCA 1I4NA 3D46A 1ZBWA 3SN4A 3ABSA 3THDA 3OLGA 1GYMA 1UKSA 3H54A 3LHZA 1ZAIA 5BMWA 4B5VA 4X60A 3F5JA 4GX9A 2OQLA 2E8YA 2GQ3A 2ADAA 2NUWA 2VHLA 1QMLA 4GBUA 4UC5A 3BV7A 4LFYA 2CERA 1H2JA 1X39A 4XZIA 4S2CA 4PUKA 2DT1A 2P3ZA 5D9OA 3IJ9A 3AIWA 4H4IA 4LAKA 2FZMA 3K46A 3NIYA 2HVNA 3AXKA 3NOYA 4IFOA 1Q45A 3GW0A 2OWCA 1F4HA 2YCEA 2GOKA 1C8QA 1EQPA 1D3CA 1K8XA 5GJNA 4O53A 3W2MA 4MZ8A 4FOJA 3GFZA 5DRCA 5LSMA 4PULA 1IIGA 3BK0A 2ABAA 3VX1A 3GTIA 4R7WA 3WEZA 2IXVA 5CBJA 4H6QA 3S2MA 3LHTA 4KPLA 1YE4A 3BARA 2GGGA 1W5NA 2B31A 1KFCA 1E6NA 3T9PA 2XFWA 1W5PA 5E0CA 2P0OA 3G1AA 3AUOA 1PX8A 2V5KA 1Z69A 4H6EA 3VGHA 1T99A 1RCQA 5CCZA 3KP0A 1H7WA 1HVQA 3MP3A 4CGTA 4Z2KA 3R0DA 2WSQA 1CCWB 3USZA 1VIZA 3PAOA 4FOKA 5HANA 4WDUA 2JIWA 3WUEA 4GOAA 3T07A 5CLTA 3VU2A 4G2DA 1EDGA 4F0MA 4GRSA 3URAA 3VDGA 4Q22A 4N2YA 3VKJA 5FA5A 3ZJ7A 2CYGA 4LY8A 4JIEA 3S8HA 1BFNA 2RDUA 3KOWA 1ZAHA 2FTWA 2VFIA 1H60A 5AC4A 3LPPA 2WJDA 1H0GA 3WO8A 1NJJA 1EP3A 1S1PA 1QATA 2ZDRA 4S38A 2FDMA 2VC5A 3OBEA 2R82A 1VFUA 3AYSA 1KBLA 3FJ4A 3SUSA 4UTLA 4H6KA 4EP8C 5F7UA 4N02A 1GG0A 5JBEA 2J27A 3W6YA 2J9ZA 5TQLA 1UCWA 5I06A 1YIXA 2PDMA 3VMPA 2WHMA 3W1XA 4DJEC 4AWEA 1W17A 3SRFA 2VCAA 4IMAA 2NV1A 4UTTC 3GO2A 4B2DA 3L2LA 4ICMA 3PZIA 1RK6A 4D71A 5D04C 2XWEA 2VFFA 3K13A 3TP4A 3LG3A 2O9PA 1RH9A 4J5NA 1I2RA 1HKWA 1W8GA 4N7QA 3I65A 3RM9A 1EJTC 4PN2A 5AB3A 2PRHA 4PCPA 4EK7A 2V5JA 3H2MA 1Q6EA 3M5VA 4KF1A 1CENA 4CQAA 2CU0A 3AZRA 3BURA 3B97A 3KRBA 3F4VA 5LIXX 1BWLA 3SURA 1U22A 4HPHA 1Y5XA 1DJGA 5KINA 5CZ0A 4GVGA 2G3FA 3OJGA 5F4WA 3TN5A 1WDDA 2ZKMX 1E0VA 1UH2A 2HS6A 1KBJA 5A6SA 1OY0A 1L6YA 3WY1A 1XYAA 4HMDA 2ZBTA 3AICA 2GK1A 3EWUA 4KKXA 3UG8A 2A6NA 2YX0A 3S9YA 1XQKA 2QUNA 3WQEA 2CLPA 3NXLA 5I3HA 3WBEA 1DE6A 1TVPA 4Y8FA 1T40A 1H5VA 3G0XA 1B3YA 4OV4A 2AKMA 2GSJA 4O1FA 4NHVA 4F0RA 3N6HA 4GPNA 3S42A 4ZL1A 2O56A 1K1DA 4RR4A 5HNUA 1FH9A 4DBUA 3S6DA 1IZJA 4DI9A 4A3HA 2CW6A 2IQ0A 2EGZA 3VA8A 3PZ9A 4LCQA 1XGZA 4QM1A 3GNNA 2XVNA 1B90A 4CQCA 4G7EB 3TMLA 3D0CA 1EJWC 1J0IA 4DYKA 2BOFX 1IV8A 3SCUA 4B5UA 3ELFA 3TLLA 3TA6A 1DWHM 3FY1A 3SZ8A 2J6VA 4R88A 4UWMA 3TQPA 5D2WA 1W56A 2VXNA 4ZEPA 3SCWA 3WEMA 1K70A 4MUPA 1L6FA 3FN9A 1OF6A 4WXYA 3II1A 2QCCA 3BICA 4JTQA 4LUSA 2GVLA 3CUHA 4J40A 3OGRA 1BF2A 4I6VA 3GXNA 4DBDA 4JHOA 4QSHA 4REQB 2GJXB 4JXCA 1RP8A 5DCEA 4O8RA 4OGZA 1RQEA 2QDDA 2GDUA 4NXSA 4CD7A 4AVOA 1FWAC 3L7RA 6TAAA 1KR0A 3GDKA 4X0NA 1AMYA 1GHSA 4MB1A 1GOWA 2G37A 3LRMA 3NDOA 4G5DA 4DUVA 4JN7A 2X2YA 2Q6ZA 3L4ZA 5C2CA 4CU8A 2B7QA 2IPWA 2VZUA 1GVQA 5K4XA 2VDHA 5EMYA 3VNLA 5HINA 2J7EA 2GSHA 1L8PA 1PTAA 4HK6A 3H12A 2BXZA 4CNUA 1JI2A 5ENLA 4DZIA 3L65A 2E25A 4ZENA 1ZCCA 3BMXA 4K38A 2W63A 5G4HC 1H5YA 4ZODA 4WKHA 1MUWA 2NT0A 3OLIA 1UPPA 3SUWA 1AFSA 1QW8A 2P88A 3KXQA 3CO8A 2GJRA 3VD4A 1ONWA 1M6JA 4L65A 2OSWA 4B9YA 3F1QA 1L2QA 2INZA 2X41A 1S2TA 3R0UA 5LIUX 4LANA 1EC8A 2GVEA 2XN0A 4PMQA 3KOYA 3T40A 1W0MA 1H7NA 2FFCA 2NSXA 3CUJA 1SVDA 1TPUA 4U5KA 2ISFA 3PB0A 2PRMA 4DO4A 2YBTA 2XIJA 4BQ2A 3HB9A 1WZMA 2VEGA 4O57A 2J78A 3NCOA 3R5EA 1XH2A 4A3QA 1OFQA 2E6DA 1CGYA 4B4HA 3S5YA 1E9ZB 3VIOA 3B8DA 3V36A 1UUQA 3VILA 4DPPA 1SFJA 1X6UA 4XKYB 1M01A 4JDBA 5G4WA 1QK0A 2XFRA 1B4KA 1EPXA 3UR8A 2P53A 1B3VA 1BXBA 3KBVA 1E4MM 1KXVA 1XLMA 3H23A 4PSRA 1ME9A 3O6CA 3WQGA 1I0DA 1QR7A 3JW7A 1WB0A 3R4IA 3LK6A 3UGVA 2DT0A 5I07A 5FF3A 4PB5A 1S3TC 3FNDA 1YXCA 1IIHA 3KRSA 4C6NA 1W31A 4XD4A 3CZLA 1YDVA 5D03A 2DSKA 1N7KA 2E1WA 4ACZA 4L1XA 4AD5A 1UUMA 2FMNA 1XIFA 3EOOA 4TIMA 4UNIA 4H83A 4BR1A 4MOZA 1E1FA 1TB3A 1TO3A 4JTRA 2RJHA 3C0JA 1C91A 3ARTA 5A6KA 4AD4A 1EP1A 2WJZA 5FKYA 2DQXA 2A7NA 2UY5A 4IP7A 2EG6A 3EAUA 2ZA3A 3PZQA 3LGGA 1EYEA 4J2MA 5LA2A 4AZ7A 4DAFA 4MY1A 4FNRA 3B9AA 4B3LA 2QLYA 4HNLA 1BYBA 3ECQA 2RDXA 5IM51 5BYWA 1F6KA 4LF1A 2ZX8A 4RNHA 2Y6ZA 1LOLA 3MP5A 4EF8A 3CUGA 1XGDA 2D3NA 4LVBA 5DMLA 5MHBA 5DQPA 3RRAA 1ZBCA 1FKXA 3N12A 3L0NA 1WPCA 4MWAE 5F2GA 2GQ9A 3N4EA 2VI0A 3PZGA 1VLIA 5H8UA 1PIGA 1MQPA 4XBSA 4MB4A 2YLLA 3SECA 3A5VA 4HA1A 2QPUA 3B8WA 4K36A 1PX4A 2PGRA 4UFLA 3H24A 3B3DA 5K9XA 1K8ZA 2DZUA 3EB4A 1FWBC 3VFLA 3P81A 1V6XA 3L66A 4MB3A 3VCCA 2VURA 3BL3A 1XINA 4DRSA 2WVUA 3ZWSA 1TQJA 5CC5A 1R9ZA 1F2JA 2PDBA 1AZ1A 1IE7C 2BGNE 1UOZA 4FNQA 4J1OA 3WLNA 2JEQA 2HVOA 1TRIA 4KBXA 3DHFA 1PDZA 4DI8A 3S2NA 2EPOA 3B05A 1ISXA 4H9XA 4LX4A 1PV8A 3LCLA 1B57A 4QCFA 5F2IA 1M04A 2DW7A 2XVLA 3M0ZA 4DXKA 2OODA 2Z24A 4X2PA 1E6QM 2WSRA 5E9AA 2C0HA 2YA2A 1NQ6A 3CZJA 4RNFA 3KE0A 1QNVA 3Q4DA 4N6FA 2HCVA 1JULA 1BF6A 1LROA 4IZGA 1LUCA 2Q01A 1OJXA 1V3HA 5I79A 2PWGA 4GQBA 3S2CA 2YOCA 5LA1A 5ECVA 4DZ5A 1IR1A 5A6LA 1DWIM 8XIMA 4EAYA 5LXXA 4RNJA 1EX1A 5LYRA 4AVNA 4ML9A 3W1PA 1LLZA 5FF4A 4JTDA 4XZNX 4UFHA 1E73M 1PL9A 5F4XA 1NDZA 3CQ0A 2VTFA 1WZLA 1FXQA 4L9YA 2WM1A 3VKDA 2JF6A 5D9PA 1OIFA 2CBIA 4Q32A 3OB8A 1UH3A 2WVSA 3CMGA 2QAFA 4W9TA 4HMNA 1GVIA 2VD9A 1TPEA 3VIGA 3DFPA 3VNZA 2GQAA 4YCPA 5IDIA 3GXDA 4YMZA 4Z1DA 1SGJA 4M7SA 4E8DA 4I7VA 3CT2A 3O0FA 2FZNA 1WQ5A 2J62A 4FNSA 4PBEA 3G1DA 1KRBC 2WKLA 3PY2A 1Q2SA 3KVMA 2BG5A 3PWIA 2G96A 3KVKA 3NQ6A 4GGBA 1REQB 1YXYA 3GLCA 1IT0A 4CVUA 1F7BA 1WAUA 3CH0A 1UQYA 2C19A 8CGTA 1ZZMA 2BY1A 2GGHA 5A8GA 4DELA 4RCXA 3QV7A 2PDKA 4N9CA 2D0FA 2YLAA 1UR0A 3SFKA 2QIWA 5DX7A 1EYWA 3C8FA 3SADA 5AHEA 4LBRA 1JG9A 3AHVA 1RCOB 3HGSA 3VM7A 4V1XA 3N15A 1O5XA 1KBBA 2IUZA 1YTEA 2Z2AA 1KBIA 3VC5A 3W6LA 3CQHA 5CC7A 3UT0A 1K02A 1MQRA 5HJXA 2WVVA 2FHCA 2YYTA 4LS0A 3WNNA 4RPPA 3R7MA 2TAAA 4HNOA 2PWDA 3IK2A 1E0WA 4E4FA 1VCFA 2VC9A 2PDJA 5EA9A 4LVDA 4B3ZA 4UFIA 1KLZA 4GUHA 1J9YA 1E6SM 2QDHA 2BX7A 3UP8A 3PC0A 4GYKA 4M56A 2R1LA 4Q33A 3ABRA 5REQA 3DYOA 1BVWA 4JX6A 1US3A 2QYGA 1SMDA 2YL9A 3FA4A 4AEFA 2XIQA 3T0BA 2QVHA 4S23A 1I2OA 3WQOA 3UJEA 1K9DA 1GWJA 4HOXA 1KRMA 3S83A 1A5CA 5FEZA 4RE0A 4CU6A 1XYBA 4K7YA 2BHZA 4FNTA 4QCEA 1V3MA 2QPXA 1LBLA 1EA9C 1GT8A 1DTUA 5CZSA 1PSCA 5JQ9A 4DJFC 3GNOA 3UR7A 4IFRA 4X3ZA 3WJXA 3LZ5A 3OYZA 4MG4A 1FHVA 4NRSA 5IDZA 2BMBA 3A12A 5HMSA 3UPMA 4DO5A 1XX1A 3N9KA 3L2IA 2GYIA 4DBSA 3PUEA 2XVKA 4GO8A 1O95A 3VGDA 4R7OA 5DELA 4GK8A 4D1IA 2BXYA 1TFVA 3I3EA 4NZCA 1FWCC 4CQ8A 3W53A 3DC8A 3CV2A 1UA7A 2J13A 3GBEA 4IMCA 4MTVA 2I5QA 2VZOA 1DE5A 4RZ6A 2V9DA 4Z2HA 5CPSA 5F1UA 5AVNA 4JTTA 1XH0A 2V38A 3HG4A 1PO9A 3FVDA 2EBNA 4TX8A 3PANA 1TV8A 2A0NA 2GWGA 1HO1A 1ODZA 4H7VA 4BF5A 4WCJA 1R5YA 4QBXA 4PH6A 4ZO7A 1R38A 5FJIA 5LHFA 4IPPA 3TROA 3GIPA 2G97A 1ALDA 3A4JA 4HPJA 1HTIA 2O9TA 2Z1VA 4B16A 3W84A 2WANA 2XWDA 1P4CA 1SM9A 4ZQRA 1UD8A 4CEUC 4ZOBA 1OD0A 3HMJG 4QG9A 2AMGA 5T91A 3OGVA 5I09A 1P6BA 3IJIA 2DZAA 2NW0A 2ISDA 2E9LA 4AXKA 1O60A 1M65A 1XLKA 5HWMA 1O7AA 3CV7A 1XCFA 1Z48A 3CQKA 4GH1A 3V18A 3KRUA 2Y0FA 3A4AA 1A5NC 3QGKC 4OBSA 1XIDA 4C6LA 4JTSA 3HPXA 2WVTA 4PYSA 3VMNA 1V08A 3FDGA 2BY2A 4W8AA 2R24A 3TCEA 5D4YA 5AC8A 1OVDA 5FJJA 2DZSA 5FIPA 5JH1A 3WH9A 3MMWA 2DSVA 1J79A 2D1ZA 4N6EA 4XAGA 3TTSA 3OA5A 3WUBA 1FWRA 3H2AA 2YFNA 3PTKA 3WX7A 3TOPA 1XLBA 4HTYA 3I68A 3GIYA 3OZYA 3QGVA 2FDSA 4IXXA 4J3XA 2RDWA 1F3XA 1EJXC 1QFEA 5T8GA 4ZSTA 1TTJA 1R8LA 5BZAA 1QNQA 3MI2A 1F9CA 3K1GA 5XINA 4JNMA 4L4OA 1MRQA 4L5ZA 5A94A 4JTJA 5CBIA 4PODA 4ILSA 1ONXA 3KVJA 1GZ1A 4JGDA 3EEGA 1XLIA 2O4QA 2CFFA 3CIXA 2HE8A 4NNBA 3TR9A 4HP5A 2JIEA 3FCPA 4O0QA 2J47A 2HZGA 4HB7A 1Q8AA 3W70A 3TJXA 1JL8A 3B0VC 5I3DA 1A47A 1PE1A 1JVNA 3VM5A 2QW5A 5C55A 4AG0A 3K4WA 5CJNA 4GZIA 5C0QA 5LNSA 4MGGA 2X1TA 1A3HA 1QPQA 3VUPA 2ZCGA 2DT3A 4I90A 3W81A 3N3MA 3WK0A 5H8PA 3ALGA 5KZ6A 4DWSD 3PPFA 4IUGA 3VNMA 3F2BA 3N3TA 3RYSA 2FJUB 4INFA 1PWMA 3U6WA 2JQXA 6REQA 3FS2A 4LV4A 1F3WA 3ORWA 4DJDC 4PMOA 2QCFA 3GH4A 2P1FA 3QR0A 1JGMA 3EEZA 5LGZA 4RE3A 1TV2A 4QE5A 4GQQA 3V1HA 1WYIA 3IAQA 1LF1A 5FEPA 5HWNA 3W7MA 3M41A 2GWNA 3ANYA 3HOJA 3MQTA 4M1RA 5DMMA 4JY8A 3RU8X 3ZVHA 1RLCL 4M19A 3W2UA 3D3AA 3ZJ6A 1EOKA 3GQYA 4W7VA 5FJOA 2D22A 1JZ8A 1ITCA 2GQ8A 2PC8A 2HE5A 2W3ZA 3VE7A 1WDRA 1D8CA 1NAL1 1EUNA 4MNLA 1WZAA 3QQ1A 3HURA 2X0HA 3NVDA 1YRRA 4RXFA 2VNCA 2WB5A 2POTA 3SAZA 1VCVA 3TYDA 4LT9A 1EH9A 1G7UA 2OLHA 3GXMA 3FYOA 3S5OA 3HFYA 3GHSA 2Y85A 1NWSA 4UXDA 1C7TA 3WD3A 1XIHA 2DU2A 3W75A 4AD3A 2G3NA 4ONVA 1I0BA 2QDGA 3AMCA 1F4AA 1E43A 3QW3A 3W72A 3UFYA 3PTMA 4M82A 1ML1A 5AOUA 5D37A 2QJIA 3N2CA 3NZQA 1X6NA 3V4BA 3OZMA 3EWDA 2C3ZA 3N73A 4AZIA 1U5HA 2P8BA 4X9YA 4S2BA 3URQA 1HJVA 1BWKA 5D2VA 1TIWA 1XLEA 3W01A 1LQ2A 1WA3A 1X96A 3VOJA 1KFKA 1WXYA 1RD6A 2PBOA 4A2SA 1Z42A 1UD5A 3NQMA 1IQ8A 4P7LA 1J0KA 2I9UA 3MBFA 3PS7A 1OADA 4TOQA 3P67A 1QUMA 4FS9A 2ZRXA 3W7OA 2Q71A 5E0KA 3UR2A 3UA3A 4AX6A 3W1TA 3W7PA 1WDQA 5B7ZA 1RY0A 3WUFA 2V3FA 3QR1A 2PDCA 1TG7A 2IKGA 3ZYZA 3PN8A 4GQRA 3RJXA 4LPCA 4L1GA 2VEMA 5XIMA 1I9CB 2WW5A 4LYKA 5FD0A 4PFHA 3P84A 2JKPA 1SFTA 1BYAA 5ABFA 1OWQA 1P0EA 5A1AA 4ZB2A 4L4LA 2GLKA 1PX3A 3HA1A 4AD0A 3ES7A 1EEXA 2P50A 4PTMA 4GZJA 1MW1A 2NQ5A 3H4XA 1Z41A 3SI9A 3G18A 1XP3A 3OQEA 1ICPA 1Q6LA 1ZRQA 3C2OA 4LVAA 3EA3A 1A5LC 4OJYA 1XBYA 3CB3A 3LMYA 3M0XA 1OFBA 4WF7A 3HPFA 2H90A 5FESA 1PHQA 4ZFMA 4FMVA 4HOWA 4QE1A 3B0PA 3NQBA 5TD4A 2V2DA 4YWIA 5EB8A 1PB0A 4HSOA 2CLFA 3ARSA 3C2FA 2CBJA 3LXBA 3NYZA 4UUIA 1HG3A 1JZ7A 1ITXA 2DUAA 4FIQA 4UMAA 1XLJA 3I7SA 5G1MA 3V5OA 3LB0A 5FEXA 4OBTA 1DXIA 2QCNA 1EL3A 4C6FA 3L67A 3GVVA 1KCLA 1FOBA 1R46A 1M5WA 2HNEA 1WDSA 1TSIA 2VJXA 2JGYA 4A21A 2X05A 3GTFA 3ZQ9A 4OTKA 1OB0A 4UR9A 3STCA 5A6BA 1CYGA 3D3FA 3S6TA 3FK4A 2MNRA 2XZ9A 3BCDA 3LCIA 3EA1A 4GYFA 2OOFA 1TX2A 3OOQA 4ZOAA 5KEZA 2VC7A 3GVRA 3L23A 1GPWA 3GUWA 2HNHA 1KFBA 3H53A 4GJ1A 4JIIX 4WR3A 4XZ9A 2ZXQA 5K7JA 1GKRA 1XS2A 3NSNA 4EPDC 3RNDA 4QX4A 3C86A 1JD7A 1A3WA 4W86A 5K9CA 4YVXA 2HEJA 2WQDA 3KS5A 4I3GA 2OQYA 1O5QA 4ZXLA 1JCNA 1IXQA 3NA8A 3GZ3A 2A7RA 4PMRA 3AISA 3EWYA 4C6DA 3LCWA 1YQ2A 1G9HA 5LIWX 1R9XA 1E70M 1ZLPA 1SZFA 1V5XA 1EA0A 2PGEA 2XIMA 3G1YA 4Z1AA 4IG2A 2WCAA 4JQ1A 1HUVA 2CIPA 3NZGA 4NAEA 1Q3NA 3GH7A 1SW0A 3QEZA 1W1TA 3BSMA 4F79A 1MMFA 4MLJA 3UWUA 1VBJA 3UBPC 1B0IA 4L4PA 2HXTA 1JCXA 3VD3A 4M80A 3Q65A 4F3HA 2HK1A 1OF8A 1ITQA 1Q4WA 3ABXA 3GR8A 4Y8EA 1UKTA 2G4JA 3AO0A 1NY1A 3FYPA 3L5LA 2ISSA 3SQMA 3RMJA 4RK8A 2IXUA 3TTQA 2D0HA 3R25A 4DWSA 2RGLA 2WJFA 3TW6A 2E6AA 3KZPA 4FF7A 5REQB 4MVAA 1G69A 4U2ZA 3M0HA 1ONEA 4D2JA 3CM4A 3W83A 4JPGA 3MUY1 3HO8A 3L0GA 2YL8A 3UNDA 4HNNA 4B92A 3PBGA 5DMYA 4ATLA 1YXDA 1EGMA 2PP1A 2OZTA 2Z28A 1THFD 3VMOA 1RJPA 3KAOA 4Q8PA 1DJWA 3U4FA 1KRCC 3T2QA 2QZRA 1UD3A 3Q45A 2CNCA 4IH3A 3ISIX 3W7LA 2PFHA 4F48A 2PTYA 3G77A 1XSJA 5BOEA 1HKMA 1V7YA 3LLXA 2AAMA 6XIMA 4E6MA 4DJED 1ZBKA 4KQNA 1K03A 2VQUA 4JCLA 2QF8A 4ZTXA 4LCRA 3LN3A 1KWGA 3NDZA 4LS1A 4X0VA 1OYCA 4IPNB 4NNAA 4ZOCA 4O0ZA 1FWEC 2I14A 2OPJA 3TDFA 3HG3A 3GR7A 2QT3A 1G4PA 1FTXA 2P0IA 1NTHA 3MA8A 1QPRA 3W88A 3ATYA 1XG4A 3BQ6A 2BB0A 1SSDA 3RAOA 4L9XA 1Y65A 3T8QA 3E12A 2C14A 3N2BA 1YHTA 1EJ7L 2PDPA 1MUMA 2V2HA 4BF9A 1KFLA 4H8VA 4DB7A 1M03A 3WNKA 1MXDA 2ALRA 1NEYA 4IGMA 2NWRA 1YW1A 2ABBA 3ARWA 3NZRA 3MZ2A 3KTCA 1B54A 2DJLA 3UETA 4RW5A 2Z7KA 3RR1A 3EMQA 4O19A 1BG4A 1LLWA 4Z17A 3PBMA 3QM3A 4ALDA 1GG1A 1BD0A 4F0HA 2IKJA 5GVJA 1MQQA 1F74A 4RNIA 2QUUA 3ITGA 2VCBA 1UP0A 3OBKA 1HIZA 3W7JA 5A8MA 4UQBA 3VIHA 3GHRA 5CZKA 1Q6GA 1MZHA 3LD5A 3NAVA 5JBDA 2BGSA 4UTTA 1XSKA 3BW3A 3NGJA 1LZOA 4JBRA 2FTPA 3E3HA 2E8ZA 1M1BA 3IJ7A 4BQ3A 1OGSA 3NPVA 1QI5A 4GI4A 4EXBA 2OZ3A 2OO0A 1AVAA 1TPDA 1XD1A 2GJNA 5CG7A 5AYYA 3QRHA 5K3VA 1TV7A 1V51A 4NP7A 2A6LA 4GKLA 3ZT5A 3T8LA 1KXTA 3H55A 2PDGA 3EOEA 3PPCA 3SCTA 4DO7A 3Q67A 2OLSA 1W3JA 3TLQA 3FEMA 3DECA 2OYLA 2ACUA 4UR7A 5HK4A 1XLDA 2YCKX 3LBOA 3WQWA 3GW3A 5D2YA 4FXFA 3J7HA 1TV5A 5DRIA 1J2BA 4B4FA 1A5KC 5C9RA 2RFGA 3IUHA 2Z29A 4LUYA 3QY6A 3GDTA 7PTDA 5HNRA 2CETA 4AZ6A 4QDWA 4H3DA 1EHAA 3A21A 3MDWA 1XD0A 4N0RA 2OELA 2X1IA 5EPDA 1AW5A 5JH2A 1GTHA 2DZBA 3TV8A 3UWEA 1J0JA 1I6NA 4H01A 2DY3A 2PWEA 1H0IA 2QJJA 4QG8A 1EIBA 2J74A 4AZ5A 1R3SA 1JI1A 1ZL1A 3EOUA 4XUYA 4D6DA 3CHFA 1GNXA 3U2EA 1EQCA 1CXHA 4CNNA 1VFFA 4O1EA 3SSJA 1QI2A 2WC7A 5TF0A 4LAMA 1UWQA 5KZDA 3RDKA 3WELA 3QZEA 1IWPA 3EKZA 4UQDA 1VBUA 4GYJA 2B0MA 4R34A 1R3TA 3RLHA 3WD2A 1GQKA 4BF7A 2V2CA 4XSLA 3SUTA 3O3RA 4TX9A 1OFAA 3GZAA 1HW6A 4X9SA 3USBA 4HD5A 4C6EA 3TN6A 4AEOA 2WXDM 2G50A 4KWOA 3TNOA 1F5ZA 5TIMA 2YB1A 3BOFA 3GM8A 1MW2A 4PA8A 4J9JA 3IK4A 3PTQA 1YMYA 4CCZA 4JY9A 4ZQPA 4XVEA 1FHDA 1XBZA 5A6AA 2WCGA 1EBHA 4M6VA 3E96A 2Z6JA 3C0SA 4LH8A 5RUBA 1BKHA 2VFEA 2DIEA 3FFSA 1U1JA 4XZHA 2BV9A 1AQFA 2QIIA 4JQAA 3SCVA 5CLWA 4E2OA 2CLMA 2GJPA 3AYTA 3CZKA 3CT7A 2OGYA 2KX9A 4IG2B 2BVTA 5DY2A 3KBNA 5EGRA 2YJQA 5CJMA 1PTGA 4C60A 2VVNA 3UCDA 3A4WA 4GXMA 3L68A 2A85A 3A9BA 1TWDA 3MJMA 1TKKA 5BW6A 4TV6A 5C71A 1XW8A 3GS6A 4WSHA 1QBAA 1JNDA 3RLVA 1AQHA 1WP6A 1BSLA 2X1UA 1E9YB 1R86A 1PJ9A 1UR3M 2WHKA 2CZDA 1HKVA 3DCPA 4FXSA 1LWJA 4HK5A 1VBGA 3GDMA 4UQ9A 4GY7A 1UROA 5I24A 4IQDA 3FKRA 3R79A 4JIHA 3TNBA 2HBVA 5CSUA 4LNCA 3W25A 3DBNA 2X1SA 3BUVA 5T26A 4CVWA 3VC6A 2PU1A 3W7EA 4N9DA 4HK7A 4JHMA 4Y9AA 1TJ0A 1UQZA 5FOOA 1KM4A 1M7OA 3TJLA 3WQCA 1W9UA 4C6MA 4M1BA 3TWBA 3MV01 1S5VA 3B9EA 3E9AA 1OIMA 4WUIA 1E5NA 1UP3A 3IV3A 4GGHA 1X6LA 4IHCA 3SBFA 1FWFC 4PUDA 2FH6A 4CN6A 4E8CA 1XF0A 3HGRA 3ZOAA 1VPXA 1P1MA 1LWIA 5I00A 3AXIA 2AOSA 3GE7A 2REQB 4AFYA 3NYDA 5HAOA 4RZBA 4IMEA 1O66A 5I3GA 3SUVA 4A8RA 4QGCA 1PTDA 3O7UA 2V69A 4QAIA 3NGFA 4IIDA 3LPOA 4J3UA 4IP5A 4UNKA 4DJDA 3SIZA 1HXJA 3RUBL 1LUCB 1FWIC 5E5CA 3UF9A 1DEDA 3MPGA 3L4UA 1ITUA 3N19B 5CGQA 1GOOA 1CXLA 4PUWA 2VX7A 1XISA 2C1HA 2OEJA 4XAPA 4ICCX 3B9OA 1FWDC 2CHRA 3R8HA 3QN3A 3QVQA 5DBUA 1ECQA 3KWSA 2CCRA 2JGQA 3N04A 4TVUA 1LJYA 4U33A 3OU8A 3W3OA 3B04A 2I9EA 3SCRA 3V75A 2J8GA 4GCAA 1C9DA 2FFIA 3P61A 2D73A 4JQ4A 2IS7A 1QO2A 4ORIA 2BXVA 4Q8WA 2EG8A 2AGKA 1GONA 3CTLA 4H9VA 1B5TA 2EPKX 4GUIA 4Q4SA 4PEEA 1LYXA 4H1ZA 4Y96A 3VDBA 3GVGA 3VDHA 1KO0A 1OC7A 4MPQA 2O55A 1ZFJA 4KFPA 3SEPA 2R1KA 4UTIA 5A3HA 3BV4A 4B3KA 4TUFA 4Q4OA 3VFCA 1K7XA 3A47A 3AHXA 3N2TA 1E1CB 5JIWA 4DX3A 7REQB 2ZIDA 4NIRA 3ICJA 3TN4A 4YHEA 1LDCA 3QLLA 1HNYA 5AHIA 3AHTA 2VT0A 5CGMA 3U5UA 3BJTA 2J9YA 3UWVA 4Z08A 4OFCA 4BJHA 1W1IE 1VFOA 1XI3A 1CXFA 5I3JA 3ITYA 1MNZA 3TW9A 1DIOA 1IGSA 1SFSA 3UWWA 4BA0A 1V6VA 2NVDA 2XDFA 2XUCA 4DAIA 4EANA 3UVIA 4CN1A 4IIBA 1NOUA 4Q4PA 3SJ3A 1XJBA 3VOGA 2IQTA 4XAZA 5GJPA 1JD9A 2X0SA 5JVLA 1BLIA 5D38A 3AMLA 3QPEA 1NFBA 3XINA 4HSHA 2B7OA 4FIRA 3STFA 3H6OA 3BTNA 4GQ0A 1GW9A 1JZ2A 1CLKA 3V1PA 4KIEA 4IFKB 4NKCA 3BAYA 4A6GA 2QAPA 3QFWA 4WY0A 4F0SA 4PZVA 4IGNA 1NOFA 3KOFA 1EJVC 4S39A 2PWUA 4XBKA 1FCBA 3CIVA 5DXXA 1XDMA 1XYFA 2OLAA 3RMEA 1WKFA 1C3FA 3H2CA 1SU5A 1JXKA 4K8EA 3L5MA 3WJZA 3EDEA 4GUJA 4R85A 3OVPA 3WK3A 4EWJA 3O16A 1YYAA 4XX6A 4JR5A 1VH7A 3WQDA 4NI8A 4YIWA 2HMCA 3QHOA 3QKEA 3ARVA 3D5HA 5FJPA 2D2OA 4C6JA 2BGQA 3AZTA 2CLEA 2V5CA 3CIWA 3PFMA 3DFOA 4LAUA 2YBVA 3CHEA 2NLIA 6XIAA 3WYZA 4XKYA 2OMAA 4PMUA 3LTYA 1I1WA 2R14A 1NF0A 3ANVA 4O4VA 3AUJA 3CLWA 3ZVHB 5CPOA 4IF2A 2BTMA 1XIJA 1GVRA 3BE7A 4PC8A 2FZBA 3LPGA 1UWIA 1LCOA 1TTQA 1XLCA 3AS3A 1GQJA 1SR0A 4GC3A 1VS1A 4ORMA 1KQYA 1DQXA 1JDDA 1LOSA 1AG1O 1B9BA 2FGBA 3BLLA 3PAJA 3W9ZA 4O4WA 3RXZA 3HU7A 1YPIA 1RLDA 1E1CA 4LC8A 3TONA 2JFEX 3LENA 3KL0A 1OC6A 1XLLA 2QS8A 5EBAA 4PGLA 1CPUA 5D32A 2C8NA 4C5YA 2ZUMA 4NX5A 3ITOA 1ICSA 4US5A 1A5UA 4ZB5A 5C8BB 3DHUA 3PM6A 3VZZA 2ZE3A 3K8MA 1K9FA 1TZZA 3LV5A 1CTNA 2WZTA 4GISA 3A23A 1CGUA 1CXIA 2CITA 3TWAA 5IOBA 1JGIA 1NDWA 4JD4A 3DG3A 4NL1A 5C9ZA 4HCLA 2XYLA 4PTVA 4W8BA 3ZFHA 4P8VA 3ARXA 4XD5A 4JIPA 1H1ZA 3W74A 3GYEA 2J7DA 4LXFA 2XN1A 4W87A 1A0DA 3QF0A 2XU2A 3UXKA 1H1NA 1E56A 3DHPA 3FW6A 3NQAA 3B8TA 3FGCA 3HN3A 2ASHA 1OX5A 3GB6A 1SFLA 1FWGC 1DQWA 4LB3A 3ITXA 4MY8A 4F4RA 2PDFA 3VYLA 2WYSA 1QPKA 2XJ7A 2QUTA 2P5NA 1WOAA 3WFZA 3LUTA 4QIUA 1SZNA 1LT8A 1KM5A 3TR2A 1P6WA 1UZ1A 1AQMA 4M0XA 1W1YA 2OEMA 4NJGA 1VFSA 3NQCA 3WJSA 3P14A 1JF5A 4JTLA 4GFSA 1NP0A 3YPIA 2NXHA 3M7SA 2QCDB 4JTCA 2H8XA 5C9WA 1X97A 1AODA 3EOSA 1GOIA 3P60A 3B0XA 4MWAC 3Q37A 1K9TA 3W0KA 1Z32X 3MUIA 3ID7A 4NF7A 2GFTA 4EWND 4R3UA 1KC7A 4TX6A 1ZHAA 3W26A 3Q58A 3LGEA 1QRQA 5AECA 3MCOA 2ZXDA 5G4EA 3PBUA 2X09A 3I7RA 3U4AA 3FAWA 4ZQMA 4NZ4A 5FACA 3MYOA 2WMJA 1JIBA 3TU9A 1H7RA 3QZAA 5HNTA 2FZ9A 1X7FA 1W2VA 2YL6A 4DLFA 4AYSA 3GKFA 3T0AA 1HGYA 4R27A 2ZRYA 5HMFA 4DYJA 5FAGA 1EJSC 3RK8A 2ZZ7A 4QDMA 5EFFA 4AX7A 4Z2GA 4DZAA 1REQA 1BEUA 4GABA 5D8ZA 4PUMA 1Q7MA 4W8LA 4U5IA 3GVWA 5ECUA 1YBQA 3ZT6A 3W85A 3E49A 4CQBA 3VIMA 2FTYA 4ZO6A 2A3BA 3IAPA 4I7WA 1XBVA 2V3GA 1UR4A 4JYEA 3VZXA 4ZZ9A 1XICA 4UTMA 4QEEA 2ZC8A 4Q8NA 2VUYA 2EPLX 2BP1A 3I4KA 1SJBA 1VFLA 1BPLB 3CQJA 1GVFA 3NL3A 4QE4A 5TNVA 1MXSA 2RGMA 5M03A 4UTUA 1J12A 2Q8XA 3WFLA 1K3UA 1CB7B 3AXXA 4J2PA 4HHPA 4UOQA 1X8CA 4LVGA 2ZWYA 3Q94A 4IIFA 4CD4A 1POJA 3KZSA 1R9YA 1ZCOA 4OWGA 3E5BA 3QJAA 3WLJA 4IQLA 4PUEA 1RHCA 9XIAA 1FCUA 3OBAA 2HQAA 1OG0A 2ISVA 3BG3A 1ESWA 1OFEA 3N13A 3AFBA 2CLLA 1H51A 1R3VA 4P5UA 3GDBA 1P5BA 4QLKA 3BSGA 4N4PA 6TIMA 4FF5A 3SCOA 3V3WA 4PRRA 4YLWA 3SN0A 4HBKA 2MANA 4OHQA 3P0WA 1PXGA 3T55A 3UWQA 3B4YA 3MSDA 4KMQA 3U7VA 1S3HA 1EJUC 2AAAA 5J5DA 3E0WA 1AJ0A 3LS9A 5FSDC 4HU4A 2HVMA 3GUGA 4MNMA 4JTHA 3O15A 3AHZA 2G8ZA 1C8YA 4KRZA 1FFQA 3R6IA 4HOZA 3MSGA 1I75A 4K39A 3MV11 1QWGA 3N9RA 1DL3A 3ZWTA 1UW9A 3C61A 3TEVA 3HMCA 3KX6A 4P8WA 2A1YA 5EMJA 2IW0A 3APTA 1K7FA 4QLJA 3I7QA 1EP2A 2FZDA 1NIUA 3E2SA 1D3HA 3STGA 2WQPA 5CAHA 3P0XA 1QNPA 2GVGA 4KEMA 1QOXA 1UYQA 2WK2A 5HQLA 1ME7A 4PCSA 1CLXA 1C7SA 2X0YA 4HZ7A 3WH8A 3DHDA 5HPCA 1A3XA 4AIUA 4KFOA 3BLEA 2G3MA 3TQ0A 7TIMA 3QV8A 3MSYA 4TQTA 5IRPA 3CPRA 2INEA 3WUGA 3QLDA 3ABOA 2A79A 3EMCA 1RPKA 1QAPA 3TMQA 1VBHA 3W02A 1P0KA 1TR9A 1XKYA 4ES4A 4AVFA 4GC4A 1F6PA 1IXNA 3BO9A 3AIEA 1A5BA 5BXRA 1S2AA 4W5UA 1FH7A 2WC3A 2DIJA 2CBVA 2OX1A 3BVJA 2W4XA 4TVCA 1W91A 2AMXA 4Q7NA 4MJZA 1AH4A 4M7TA 4D9PA 3CL7A 2OVLA 1LTDA 4RUBA 2Y5JA 4Y6GA 3N2MA 4G1KA 3D47A 3AMKA 4GLEA 3DKJA 5BOOA 2OU4A 4EPEC 3KBWA 1OFRA 1K77A 1Z6KA 4M81A 3O06A 5L9FA 1U30A 1R7OA 4O13A 3RX4A 2DT2A 2HISA 2J24A 1CT5A 4FLOA 1G94A 3THUA 2DV0A 2H6RA 4PTDA 3NVTA 2FVLA 3LGDA 3TSMA 3O6YX 2ICSA 2R1PA 7CGTA 3L2MA 4A3UA 3ZIZA 1IT8A 4DO6A 4JEJA 3GY1A 4LTSA 4NY2A 1R3RA 2VR2A 4GI9A 4JTKA 5E09A 3C5QA 3EDKA 3WZ0E 1QTWA 3A9IA 2R1MA 3VCRA 3MO7A 4NJHA 3LLFA 1LLOA 1Q13A 2E77A 2PWFA 1V4YA 5E70A 3LX9A 2YB4A 1Q6DA 4MY9A 3HIJA 3QV9A 4V27A 5KETA 1TCMA 1GVSA 2W62A 2PRLA 3WKZA 4FA3A 1E72M 4YTQA 3D6NA 2E5BA 1EB3A 1J0YA 1ECEA 1BRLB 2W92A 2NWSA 4YTTA 4NAFB 1G5AA 2NXGA 1XHGA 1K7EA 3G0SA 3ABQA 3WMSA 4GJJA 3OHMB 4HZMA 3SRHA 4YU1A 1TJPA 1XC6A 1NP2A 1Z44A 2ACSA 1W9PA 4HNVA 3NPXA 4GNVA 4YWSA 4OU1A 1NOWA 3CB8A 5CAKA 3PF3A 5JUVA 4C1NA 1PZ2A 4MKNA 1HF6A 3EX4A 4XTIA 3FAXA 1Q7ZA 3BDKA 3T2PA 1TPFA 2QCGA 2BLEA 2E68A 3BLPX 1O5RA 1QPNA 1DIEA 3AWOA 3ITLA 3LXAA 3QMSA 3UY7A 3EX6A 4KS0A 3GFXA 5IHSA 2I5IA 4A8IA 3WDJA 1XYLA 5D2XA 4S3CA 4ATDA 4HHLA 2A2IA 1X8FA 3VNIA 2G5WA 1DWAM 4XIMA 6PTDA 1GW1A 1VEMA 4QJ4B 3LHYA 4XKMA 2BFGA 1TMHA 2VGFA 3PHAA 3S4TA 2Y8UA 4HPXA 1D7KA 1AW1A 4MWAA 1QT1A 1I2QA 4GXWA 1DQUA 3IVUA 1OG6A 1WUEA 2WMKA 3BAJA 4AEEA 1VHNA 2Q09A 3E38A 2VC6A 3MWCA 1HL2A 4MIMA 1XFBA 4RV3A 4XAYA 3IGXA 3EX1A 4NZJA 2OWXA 4OQVA 4B91A 1OHLA 3SDOA 3W1QA 4AY7A 1PEZA 3OVGA 5J8LA 1QOPA 1M7JA 3N6JA 5CC3A 3BXWA 4AYGA 4C6CA 3UCQA 2Z1WA 1VBRA 1JPHA 2HBXA 4DXXA 4UR8A 2BDQA 4B5TA 4F9DA 4YS1A 3JVAA 4WDTA 4H9TA 4LUJA 3LSCA 2DSUA 2WWCA 1FQ0A 1DWJM 3PUOA 1B31A 1I45A 4LEQA 5G2IA 1K4HA 2QJHA 1IEVA 4UOZA 1A4MA 2X7VA 1X1ZA 2H3DA 1GJUA 2PTZA 2PGWA 1SW7A 2O7SA 3CNYA 1K8CA 1KLYA 3SCQA 2OYKA 4W84A 3RM4A 3U2OA 4KERA 5D30A 1JF6A 4FZIA 2PUZA 2PTWA 4JTUA 1J01A 4QHRA 4D6HA 4IGHA 3M5XA 1DJYA 5GQBA 4IPIA 3SN1A 7XIMA 2REQA 3QV6A 3PG8A 1UB3A 2ZOXA 2ZC1A 1GZGA 1NM9A 1XLFA 5KZMA 4MDPA 2VX4A 3WDHA 3DFQA 3UU0A 2PDWA 5CC6A 4FR6A 4LEFA 2G4FA 5FJRA 4C5ZA 1V79A 3BCJA 5A69A 2PTDA 3VGBA 3LRLA 4MSSA 4BQ5A 1H3GA 1XLGA 4MJ4A 4ICNA 3BW4A 1TCDA 1IWBA 1W1B1 2C79A 1GOMA 1OCNA 2Y8VA 3UVAA 1SMAA 1TWZA 3PZVA 1EGVA 1E71M 1TTPA 3GHTA 4J7RA 3THCA 2BS9A 2D2GA 1G1YA 1VD6A 3O8AA 3NO3A 4TU1A 1VKFA 4LRSA 3SGGA 4D8ZA 1FWTA 1H09A 2TSYA 2VGBA 3IGHX 3LU2A 1N8IA 1WXZA 3CK5A 3TOYA 3CZEA 1EJRC 3GH5A 2CLOA 1FA2A 1Q7QA 1G6CA 4GFIA 1FCQA 4DLMA 2D2JA 4K8HA 3W37A 4QS5A 5AC6A 2BOEX 3FJLA 4WY0F 3VUSA 4AC7C 1JQVA 4BWLA 2AL1A 1TWWA 3EYPA 1VFMA 3WNPA 1W3NA 3WEOA 2ZRUA 1W9VA 3O1NA 1FDZA 3RO6A 3A3WA 3B03A 2V5DA 2PC4A 3FJNA 1JFHA 2TMDA 3S5ZA 3FA3A 4UMCA 1KV8A 1M7PA 2DW6A 2TPSA 2XSAA 3RU6A 3K5XA 4HN8A 4WY0B 2W91A 3CS2A 2ZA1A 3N11A 3GXPA 5HA7A 1DIDA 4IPLA 1P7TA 1O68A 6REQB 4M29A 3IUIA 3HV8A 4U3CA 3R11A 1ZENA 5FF2A 2OB3A 2X1RA 4U10A 2ISWA 2I1OA 3KUMA 2XIOA 2FIQA 4F0LA 1H61A 2QHAA 4FI4A 1JCYA 4D8AA 4L6HA 2BZNA 2PCEA 4CCEA 1A80A 4QJ3B 4E2VA 2GJXA 2D24A 3GC2A 3PK7A 4YNGA 5A8NA 2F6XA 3UZYA 4I9MA 1GTEA 2NUYA 4IGSA 3CHVA 2NQJA 4UCFA 1GZJA 4XD3A 1ZGDA 3P7YA 2E9MA 3MS8A 4JFVA 4R53A 1SO6A 3B0YA 2TRSA 2FKPA 1WDWA 4GVIA 1W3HA 4CQ9A 4OVXA 1WDPA 3ZJ8A 2PDXA 3FXGA 2Y5SA 5F1VA 3EPNA 1RP9A 3AAMA 4QROA 3LCFA 3KLLA 3H7UA 1N82A 1LG2A 4ZR8A 1B3XA 1BRLA 4MF4A 4D6GA 1DP0A 1E0TA 4NJKA 4GZ7A 4PBFA 2QCMA 5DCDA 1Q66A 4OKDA 1OK4A 3WLKX 3K4DA 3NG3A 2C0AA 4I9JA 1BAGA 1TJ2A 2YGYA 2Y7FA 2OTDA 3CMFA 4WDWA 2DFAA 5LZLA 2ZUTA 5FF7A 1UWRA 3NQFA 3STPA 4ZQNA 2H9AB 5I2UA 2J79A 3WLQA 4W5ZA 3G24A 4Q8OA 1PCWA 4JN8A 2QMJA 3M6DA 4NXKA 4LOCA 4W93A 3QSTA 4LAZA 1V3KA 2L5HA 5I6SA 4J27A 5CSSA 3W7QA 4C65A 1O94A 6A3HA 1FP9A 4L7ZA 4Q8TA 4PFMA 2YCLA 4F66A 3EBVA 4JX4A 4C7GA 2OKTA 9RUBA 1MRAA 3ZR6A 3GHUA 1DV7A 2ZRWA 4J4KA 1JEZA 1YNPA 4LNYA 3HQ1A 3KLKA 1ZS2A 4W7UA 2Z1XA 3W2NA 4C6PA 3P6LA 3IJQA 4WGHA 3AROA 2NLYA 4JKMA 2H8ZA 1MW0A 5FF0A 5GNZA 5CG0A 4BI7A 2RUSA 5G2WA 1XGEA 1DTNA 1H62A 5C70A 4GI8A 3DN5A 1E6XM 1XKJA 1W3IA 4LBUA 1C29A 4JKKA 1Q6QA 3MTWA 3CUFA 4WX2A 3B06A 3V0TA 4Q6XA 4GCXA 4ZBCA 4L61A 4IJRA 2R6OA 2D2HA 1SO4A 3EZ4A 3AU6A 3BWWA 3UWZA 2ZQ0A 3UG4A 3WK1A 3G1VA 5TBOA 4HCDA 3HGJA 1KA9F 3SB0A 3WF3A 3O6DA 4EE9A 4GUFA 3AIVA 3QKZA 2WZIA 2HROA 1MNSA 2ZRVA 4WKFA 2ACQA 3RITA 3WBWA 3PFRA 1RR2A 4JFWA 4PB3A 1QW9A 2VDGA 2XVGA 2O92A 3G2GA 3IJLA 1MEHA 4GE8A 3NZ1A 3HPZA 4JTEA 2B81A 3SRKA 3MMUA 3NUKA 3V0UA 3ATZA 2R1NA 4DWSC 4RL3A 3UY8A 5SWUA 5M17A 2Y7EA 3MB9A 3U9IA 3LI1A 3W7GA 3EA2A 3TC3A 4RE4A 2NQZA 5KSWA 5LHEA 3M0JA 2E40A 2ZTKA 3E0VA 2QEZA 1W5QA 2PD5A 3AYRA 5CPQA 5D9MA 3GWQA 2FHBA 1MSSA 3B8SA 2AL2B 2Z6IA 3C6CA 2VEIA 3SGUA 3I6EA 3I10A 4FX6M 3RRXA 2HJPA 4B5XA 4JTGA 4WDXA 4IPJA 3M5ZA 5C7HA 3VIFA 4XAFA 2WSYA 1RVKA 2AGTA 1VZWA 1KM3A 4IXHA 1TA3A 2YZ5A 1L6SA 3SQSA 4ZE4A 5AN7A 2ZX9A 3VD7A 1H49A 1RV8A 1YLVA 2Z00A 5D8WA 1F3EA 1ZJHA 1GOQA 4FO4A 1D3GA 1FWWA 2Z1BA 1EO5A 1V03A 2ZVIA 1KV5A 3NNTA 4JYFA 4DY1A 1K4GA 4EXQA 4HZ8A 1H7PA 2FVMA 4NYYA 2E0PA 2NV9A 1W8SA 3GDRA 1IR2A 2VP8A 4DJFA 1UA3A 2Z1SA 4WZHA 3HGOA 3ANUA 3T1GA 2DP3A 1E6PA 3S47A 5H2ZA 1PKNA 2ZZ3A 4XB3A 1TZ9A 4RZ5A 3PZMA 4LSBA 2W6RA 2V3EA 3QYQA 2ATMA 4HA4A 2O9RA 2BHYA 2DZPA 3UYIA 4UZUA 4JN6A 2GGIA 2GL5A 1KM2A 3PULA 4H8NA 5LNWA 3MMDA 2HPIA 2WBGA 2OKOA 4GIYA 4PL1A 5DY3A 3CYJA 1W1PA 1ZQ5A 5C5YA 1Z9AA 3TX9A 3BLDA 3R8RA 1AH0A 4GQGA 5K2ZA 1RBAA 2FYMA 1F6YA 3SO7A 3BOXA 3LLDA 3EOLA 5A6BD 4HA0A 2VQTA 3VDCA 3SRDA 3VOIA 1U5VA 3U8GA 4K1WA 3RO8A 3WQ5A 1BTCA 3A4XA 1SUXA 4DZHA 3W1MA 3ZMRA 1XUZA 2C18A 3P5ZA 4H7ZA 4FSAA 4V33A 3EWBX 3VOCA 1XSIA 3PTDA 2V6AA 1RUSA 3FIGA 4PMZA 1KKRA 3IARA 4DM2A 1UJQA 1VYPX 4BFAA 2J8FA 2OT1A 2FHFA 2Z25A 2CPUA 2HK0A 4C6QA 2NUXA 1UZHA 2OX4A 1E0UA 1FWJC 1P0NA 1B1YA 3B0UX 1PUDA 1R3QA 1S39A 3OODA 3CHCA 4M5PA 3GYCA 3M6YA 4NG3A 1JCMP 5HULA 3GC4A 4Q8QA 1DJIA 4ZQCA 3ZLHA 3QZ6A 1S2CA 2I17A 3M0MA 1RK5A 4OV9A 4JTFA 4PMJA 3DKLA 3E2QA 2A3LA 2VVSA 5BXSA 2VMFA 2J6XA 3IEBA 2V5BA 4AQLA 3E0IA 3HF3A 3TSBA 5BWFA 3WBYA 3SFWA 4X22A 1A0CA 2ZZ4A 2OG9A 2CLKA 4O14A 2E3ZA 1JDFA 3W86A 5G2HA 1V6TA 2QUMA 4L9ZA 4L6OA 3SCNA 3RG6A 3GG0A 2WNWA 3CO4A 1U33A 2Y61A 1TELA 4KRUA 3WBXA 1D8WA 3WNLA 3UR5A 4PBGA 4UQAA 2WNQA 1MWOA 5A5WA 5C54A 3RJYA 3MDUA 3PR2A 3CQIA 4AY1A 2KAUC 2PDLA 3RPDA 2H9AA 1XPGA 2YA1A 3AJ7A 3H26A 3ERPA 4NQ1A 2C71A 1W5OA 2XGBA 1QHPA 2QXWA 3ZT7A 3F4CA 2WMIB 3M64A 3BW2A 4CQDA 3TN3A 2ZXAA 5A8QA 3QBUA 2OEKA 4Z42C 4G9PA 5CPMA 4DJDD 3OLDA 3GG8A 4EX4A 1JCJA 3QHNA 3EKLA 3AS1A 1G01A 2E5DA 2EEXA 5EU9A 3GTXA 1E9IA 3MHGA 5I78A 5M2FX 4AIEA 2EG7A 2WLYA 4EPKA 2FB2A 3IJDA 3TW7A 3UW6A 1BXCA 3CPGA 3ONCA 3C2EA 2YW4A 1MFUA 3TH6A 2Q02A 3TYZA 1QI4A 3EPOA 2VGIA 2I16A 3L0KA 1GPFA 1W1VA 1F76A 3VI2A 5M5DA 4MB5A 3UG3A 1L8NA 2BASA 3CMJA 3G1RA 1RA5A 3BZJA 2OXNA 4JX5A 2O4MA 1YNQA 1AJZA 2PZ0A 1RCXB 1U83A 2B7NA 1R87A 4JDYA 1CECA 1E4IA 1H11A 5FCZA 5I7GA 3LTSA 3ME3A 1MI3A 4P7QA 3WDQA 4IOTA 1CGWA 3A6OA 1JPMA 3NM3A 4DWSB 2VEPA 5IHRA 3JR2A 1TRDA 2VD8A 3WDIA 4IQJA 3M7WA 3RLGA 2NQ9A 1WO2A 4Q8MA 5HJLA 4Q4RA 4YHGA 1Z8AA 1E51A 3H4GA 2G0WA 4C6KA 1JDAA 4NNCA 2NVAA 3TC7A 1OFPA 3CV1A 5EMUA 5E9XA 5CPLA 4A29A 3H7RA 1NFGA 3AXMA 3PNUA 2WSKA 4P7RA 1H4PA 2RH9A 1IXOA 3KP1A 3WDRA 3THAA 4ZGYA 3FDKA 4B2DD 1GQNA 3C4UA 3KS6A 2CKSA 1O1ZA 4U4MA 1MUCA 3A3HA 1UJPA 3KL3A 4ROQA 1JPIA 1X38A 4MKSA 4HJWA 3UPBA 3FJ6A 2P10A 2OSYA 5G5IA 2DSZA 3CWNA 1WZKA 3SQLA 1XRTA 1IF2A 5CZTA 3WJYA 1I2NA 1I60A 3W1UA 4JFUA 1FWHC 2DZTA 3HZ3A 5HDRA 3GK0A 4MAVA 1AL8A 4CNTA 1YDYA 1JQXA 1RVGA 3NSXA 4PRWA 4WJEA 1EF2A 1XBXA 2D3LA 4MWAD 2JKEA 3FOKA 4B15A 5GJMA 3L21A 1RZMA 1BQGA 3I4EA 1QK2A 4ADSA 4I7UA 1ADSA 3DFNA 2ZRZA 1C90A 5K4ZA 4KCWA 1NH6A 3NL2A 1T0OA 2FH8A 2WV8A 3KBJA 3IIZA 1UP2A 1ZUAX 4LW7A 2NX1A 1DJZA 3GU1A 2HS8A 3R94A 1JPDX 3CU2A 4K68A 4U28A 4P7NA 5GPRA 1KCKA 3A22A 4CLMA 1JDEA 1HVXA 1X98A 2PBGA 4HPGA 2NXIA 2PP0A 4CNOA 2ZX5A 5DFAA 1GQIA 1Y0EA 3VKAA 2OSXA 4QXIA 3PUGA 1FDJA 2F6KA 2VRKA 5KITA 2DVUA 1W37A 1CGTA 4OOUA 2GZXA 1K9EA 3WNOA 1N55A 2XZ7A 3KTSA 1GOXA 4US6A 1AD4A 1H1YA 3CASA 4K3ZA 5EFDA 1QNRA 4H8UA 3WK2A 2MUCA 5GNYA 3WD1A 4F40A 3MCMA 1S2VA 1A5SA 3T0CA 1US0A 3UZWA 3UYCA 1XG3A 4US5D 1W1ZA 2ZZ5A 4M24A 4AHQA 1J11A 3N1AA 1F73A 3WH6A 4Z1BA 5FI8A 3VCNA 1ZPTA 4XQ6A 1JCLA 1TWIA 4QFUA 4XG1A 5E6YA 3CBWA 3E02A 3T0TA 4CNSA 3KW3A 3T0DA 3CXOA 5D05A 4GH3A 3TYAA 4KGLA 4D6IA 3MJYA 3T05A 2VENA 4W4QA 1GORA 5LKYA 3QFEA 1JNEA 3UCCA 1CB2A 3UD6A 4GXPA 1KTCA 2IMRA 1BWVA 5LNVA 1TR1A 3S2JA 2F7FA 4Z2JA 4WKAA 1HP4A 2P8CA 1M68A 2GSEA 1NELA 3H2OA 5IBXC 2J7HA 2PGFA 4D6FA 3RN6A 2X40A 4XO7A 1XYCA 3NZPA 4H7CA 4DEFA 3BH4A 4XZBA 3QHMA 1VFHA 3M44A 2YXOA 1J8VA 5A6JA 4UTWC 4MDOA 1PKMA 3JS3A 3V7PA 4IICA 4DUWA 4ADUA 3IVTA 3IVSA 5IFPA 4MLRA 3R58A 1IEXA 2PDYA 3M4HA 3E5PA 4GA8A 7A3HA 3R8GA 2R9RA 4KWVA 4X2RA 4LB4A 3U2ZA 3VGEA 2FVKA 3POHA 3TAOA 4CD5A 4GNJA 1KRAC 2CEQA 4IP4A 4S3GA 2WZEA 1XYMA 4RZ4A 1JFXA 3CEPA 1EZWA 2OR2A 1UH4A 4PEKA 2WKGA 2PAJA 1JZ6A 3JZUA 4DF1A 2E9BA 3GU2A 5DANA 1W32A 2NSOA 3HBLA 3T7VA 3WJWA 1TTIA 4GBDA 4UBPC 1OCBA 2HPMA 1XLAA 5H6HA 2Y2WA 1HKKA 3CTTA 3T4CA 4KEUA 1GEHA 1BQCA 3VD5A 4JZ5A 4ADTA 4MWAB 3TFXA 5I77A 3DBPA 2ZZ6A 5CQ1A 3NQVA 4S3KA 3KM8A 4B5NA 3VIJA 1IXPA 4DXVA 4I9TA 3MSRA 1WCGA 3LY0A 2DQWA 3W07A 3S9ZA 1R85A 4C7DA 4ZXOA 2V8ZA 4GO9A 2BODX 5A2CA 2FJKA 3UXAA 3AOFA 4PTWA 2W67A 3GFYA 2YYUA 4JICA 2C1IA 2D0GA 3EXSA 1SW3A 3GC5A 5ABGA 4NASA 1XXXA 3OGSA 3ZJKA 3CYVA 2BVYA 4UTKA 4JIQA 2EPNA 2YFOA 4UIOA 1DBTA 3E2RA 3N18A 1WAWA 5CPNA 4LYPA 5EBUA 2VFHA 2INFA 4S3AA 3OVRA 1KW1A 5I03A 4GWEA 1KFJA 3NQDA 3KCJA 2V68A 2QCEA 3RILA 4WGXA 5D02A 3M5YA 3LI0A 2UBPC 3NFUA 3ABZA 4LY4A 4IIGA 3MI3A 2PWHA 1PBGA 1NSJA 3AC0A 2HV5A 1OM0A 4N4QA 1VFTA 1OC5A 3OG2A 5EYWA 4HMCA 2TODA 2XINA 3TTOA 3PZOA 1P6CA 4F9JA 3LRKA 3NJ3A 1UD4A