1ZP4A

Glu28gln mutant of e. coli methylenetetrahydrofolate reductase (oxidized) complex with methyltetrahydrofolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
282
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFQFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPGPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 282
sequence length 292
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zp4A00
3FSTA 3E2QA 1TJ0A 1ZPTA 3APYA 1V93A 1ZRQA 1TJ2A 1ZP3A 3FSUA 3IJDA 4O8AA 3APTA 3E2RA 2FMOA 1TJ1A 3E2SA 2FZNA 1ZP4A 3ITGA 4JNYA 4JNZA 2FZMA 1TIWA 1B5TA 2FMNA
chains in the Genus database with same CATH superfamily
4U3CA 2FHFA 1HJVA 2OO6A 3UZ5A 3FVMA 4AF0A 3RAOA 3KTXA 2DU2A 4RUBA 5LNWA 4AD5A 2RDTA 4NASA 1TG7A 3QVQA 1K70A 4FLQA 4IIGA 4EANA 1VJIA 3OPSA 3MA8A 3T1GA 4S23A 1FWHC 1G0CA 4XAGA 2F6KA 3QV7A 2PMQA 1E1EA 1Q8AA 4CNPA 3S1WA 3L68A 1UR2A 1TREA 4DB7A 3IK4A 2UZ9A 3AYSA 1ZP3A 1K4GA 3T0TA 3MVIA 1E4MM 1XLJA 1B2YA 4BR1A 3W1UA 1R7OA 2G95A 3BURA 1B3WA 1NDZA 3WH8A 3QMRA 5BOFA 1K1DA 3WH7A 4GI6A 3CUJA 4XIAA 1QR7A 2WSKA 3EZ4A 3PK7A 3PZMA 1CLXA 2IXUA 2WNWA 1NWUA 1UH4A 2QCHA 3WQ5A 2Y5JA 2VFGA 2TRSA 4RL3A 4XV0A 4O18A 4UTLA 5HXMA 2Y88A 1RH9A 1R5YA 2HVOA 4HMEA 2QCEA 3ERPA 1Z42A 1A0DA 5HNUA 4WEVX 5AHIA 1WA3A 2ISWA 2PDMA 3BMVA 4IP4A 3CZGA 4H2CA 4ZZ9A 2WAGA 5A6SA 3B97A 3V0SA 3AHZA 1JD9A 1DTNA 4GYPA 1M3UA 4DRSA 3B9OA 3IIVA 4PEKA 2E67A 3NZPA 3WEMA 1B0IA 1KR0A 2FVMA 3N34A 4H7CA 4UQ9A 5JQ9A 3LX9A 1EF3A 1KTBA 5LXEA 3SRKA 1JF6A 3EKZA 4QE1A 1J12A 2WKGA 2WNNA 3KLKA 4J2PA 3FN9A 4D6CA 4G5DA 3LERA 1SO6A 3CH9A 3LQLA 1K8YA 3MUY1 4G8TA 3TSBA 5FIPA 3TR2A 2VNCA 3VKCA 1GKPA 1P5BA 3LI1A 2HJPA 5E5CA 5IDIA 2FGBA 4QAWA 3VGFA 2G3FA 2C8NA 3L12A 2IMRA 1RVGA 5BRPA 5AY7A 1SZEA 2CLIA 2ZDRA 4B4FA 3UW6A 1S5WA 1L6FA 3A6OA 1WXYA 4GC3A 3AJXA 2BY3A 3FNDA 1EP2A 3HG2A 2FH6A 1LWJA 1SUXA 3R6IA 3PZVA 4QSFA 4QSHA 3EPNA 2ZXDA 1MMFA 2WCGA 2VJXA 4HT3A 5HMFA 4JQ4A 4GZJA 3ZMRA 4ZOCA 4DO7A 3EKLA 1BSLA 3DERA 1PV8A 2J8TA 3P0WA 4B9YA 1P7TB 4LUJA 2X42A 3I6EA 3MQTA 2EXOA 4DWSD 2XU2A 2Z1XA 3OVQA 4TIMA 4FNUA 3ALFA 3EMQA 1AH4A 2NXGA 3SRDA 4NI3A 1E0XA 3PZOA 3D6NA 4IPJA 3HMJG 2HPMA 1M03A 3VKDA 2WC3A 3UWYA 2VX7A 1PZ1A 4XX6A 2QF7A 2IPJA 2WJDA 5A8GA 1IWBA 4RZ5A 3C0SA 3H4GA 3T0AA 5FSDC 3PUOA 3EDEA 1Q6RA 4B90A 2WHLA 1W1ZA 1L6WA 1W8GA 4GLEA 2VENA 4LS2A 3QZ6A 1PE1A 2ZRYA 3AFBA 5LIKX 5D8WA 4Y96A 1W1A1 4PULA 3C3UA 1ZALA 3ZWTA 1JXJA 3M0KA 5A94A 1QI2A 1W2VA 2J7HA 4M0XA 1J10A 3C2YA 3UR5A 1ODUA 3TQPA 4XZWA 1DPMA 1MDRA 2BZNA 3ZXWA 1XICA 3GH7A 2BX7A 3SJNA 2V81A 1UBSA 2GZXA 3PBGA 4ML4A 3QHMA 3DFQA 5MKGA 3USZA 3G8EA 4CD8A 4YJ5A 2UV8G 3PR2A 3LU2A 5DANA 1NWTA 1K8CA 1AJ2A 3RCYA 3W7QA 2DW7A 5XINA 3W6YA 1Q6CA 5BOOA 1GYMA 4MMWA 4LAUA 1W31A 4M5PA 3QHOA 2ODOA 2HS6A 1QNPA 4GMEA 5FACA 1EBHA 3TYAA 1EUNA 3FYPA 2W9MA 1V0LA 4QIUA 3FHAA 4GCXA 5KZ6A 1PCWA 3TROA 2PF8A 1M04A 2PLCA 3LZ5A 2ATSA 3L4WA 4A29A 4A21A 1HIZA 1UA3A 4H7ZA 4O0QA 1X6UA 1G6CA 1OADA 3LHWA 2IKGA 5HANA 4OZOA 5DEZA 3U2EA 3HIJA 3OIXA 4JIQA 3LCGA 1AG1O 2YLLA 1OZQA 1BYDA 5DY2A 1WE5A 3EB3A 2J7BA 3SR7A 5IFPA 3ARVA 3NVTA 1Y5VA 1OG0A 3KXQA 1KGUA 1XIGA 1A3WA 1NFGA 3U8GA 1VENA 1OF8A 1S5MA 1AMKA 3W00A 4AZ6A 2IQ0A 2WO5A 4Q32A 4PL2A 5K3VA 2Z1KA 2J13A 5HOSA 3UERA 5HBFA 2CC0A 4UOQA 4GABA 7CGTA 4OOUA 3WNPA 3W2NA 4W85A 3M16A 2EPMX 4IFRA 4WDUA 1FWSA 2PD9A 1XD0A 3TFCA 5BRQA 1XH2A 3HB9A 1E6PA 3R25A 1OK4A 4W4QA 1YXDA 4I8DA 3EOLA 1DXEA 4C1KA 3PUDA 1N7KA 1GQJA 4HK7A 1QHOA 3AIWA 1ITUA 1TWZA 3E2SA 3TYEA 4WDTA 1UJPA 4IPPA 1QBBA 5DRIA 1H7RA 1DJXA 3PG8A 4JEQA 1TZ7A 4ZGYA 3KVLA 4NUWA 1BAGA 1EQPA 1B90A 1W9BM 3H4WA 4KF1A 3VGGA 3RLHA 2GQAA 5A95A 4K68A 1DJWA 5CSSA 5HUOA 1E40A 3DU0A 1IXPA 1V0MA 3GQYA 3LS9A 3FEQA 3EWXA 2E8ZA 4WY0A 1PTGA 5CZKA 4AFYA 2XTKA 3S1VA 1BG4A 1FCBA 1BWKA 4XZLX 2NV9A 2H9AB 1Q6QA 2P53A 3DC8A 4DHGA 1WNOA 4PSPA 3GU1A 3SUWA 3B0YA 3NZQA 4AD2A 2DT3A 4CGTA 4AWUA 1CB2A 8XIAA 3U2ZA 3BLIA 1OJXA 3AMLA 3NGJA 4QR6A 1TVNA 3ZT7A 1QNOA 2I9EA 4B16A 3WF3A 3BV4A 3BJFA 1ZP4A 1PDYA 4F0LA 3GHTA 2E5BA 1W1VA 4P8XA 1ITCA 3E12A 3RPDA 4DNMA 5H8PA 3KS6A 1WPCA 4B3ZA 4RNFA 4I8YA 1X8CA 4Y2WA 3CAKA 1Y0EA 2WPGA 3DECA 2DH2A 4GGHA 4GXMA 5D05A 3WD3A 4QNWA 3SFKA 1UC4A 1C8VA 3W7OA 4KESA 4ZB5A 2VEIA 5AZ1A 1LBLA 3N2BA 4H00A 4WOZA 4HHHA 2V3FA 1OB0A 2Z00A 1UR0A 2VZSA 6ALDA 3W7GA 3WD0A 4DJDD 1YX1A 1DJYA 3HQNA 2A4AA 4RV8A 4PRRA 3DHUA 3NZGA 1V3LA 1FHLA 2VEGA 4LVAA 1FH8A 4KFNA 1ZQ5A 4FXRA 4JTAA 1LQAA 1LT7A 1Q85A 3BAXA 1WXJA 4FXFA 4LU0A 3VK5A 4LW7A 4PODA 4RE2A 1TVLA 1NWRA 4FLRA 2ZX6A 5A1AA 1JCLA 4P2VA 4IX0A 3HV9A 4NZJA 3AHTA 5G2WA 4LS0A 9XIMA 5DLCA 1GQLA 1VFUA 5DO8A 1R85A 3JZEA 3QY7A 1I2NA 3IK2A 4FX7A 1THFD 4A22A 2GL5A 1Q6GA 1OF6A 3TCSA 5LIYX 5CH9A 5EMMA 5AHFA 1VGAA 1X6NA 1EBGA 5BRBA 1UOKA 3IACA 1VFLA 5I07A 2A3AA 1XSKA 4L6HA 2X1UA 3Q58A 1LG2A 5AN7A 4YXGA 4JHOA 4JTCA 3ZVHB 6TAAA 4F2UA 4Y9OA 1QJWA 4EPKA 4MB4A 4DUVA 1QOQA 2Y61A 1TIWA 2PSNA 2ONEA 1UD4A 2ZUTA 1UUQA 3CL6A 4B5XA 1GK8A 3UG8A 4J3WA 1FWIC 1ME7A 3BH4A 3JR2A 4Q8NA 3KL3A 1XLHA 3EXRA 3E3HA 3I4EA 4ZO7A 4Y90A 4HNTA 3R94A 2GVGA 1KBJA 4NVTA 2QUTA 1JNDA 1NWSA 1TV7A 1BQGA 3DENA 4HSHA 2VZOA 3G1DA 1W91A 4K1GA 5BNKA 1JCXA 4W8LA 3WLMA 3AS2A 3AISA 2ZBTA 3KBWA 1HUVA 3WELA 5ABEA 4HB7A 1JDAA 4PB5A 3UZWA 4GD0A 1A80A 1P43A 3U3HA 5CXPA 2JIEA 3PC0A 3PM6A 3H2MA 2R94A 3NL3A 4W7WA 3RX3A 2V5BA 2R82A 4MNMA 3W24A 4L4MA 3WK3A 4E3TA 1UWSA 3IJLA 3W7JA 4M6QA 2ZCGA 1WZLA 3E0FA 1YLVA 4TV5A 2PDCA 2P0IA 3GYCA 3TW7A 1ZHAA 2C91A 2WQDA 1AJZA 4Z1YA 3HPSA 1A3HA 5G4HC 3JRKA 2ASHA 1KFKA 1MRQA 4HHMA 4D6JA 2ZRVA 3VO0A 4EE9A 1WP6A 2BB0A 1DE6A 4KW2A 1BKHA 3FJNA 2GJNA 1J79A 1IGSA 4F0HA 1NSJA 2PGWA 4Q8WA 1VFOA 4QROA 1JDCA 1UP0A 2VO5A 1H62A 3LRKA 4L6DA 4U2ZA 3SRFA 3PTMA 4DXKA 1C9WA 3I7SA 4WKAA 1VD6A 2ZVIA 3RM8A 1GVOA 1GORA 1GVRA 3AU6A 4CQ9A 4LT9A 3QGVA 3MVTA 2JGYA 3S5NA 4AEFA 1LROA 4Y7EA 5F1VA 1DJGA 2FPYA 3ZZ1A 3U9IA 1I2PA 2ZUWA 1J0JA 2WHMA 4AX7A 2WMIB 1EXPA 3A64A 3PPGA 2OLHA 1KO0A 1J2WA 1B4KA 1R3QA 1E1CB 1LOLA 3CAQA 4AVFA 1CXLA 5CJNA 3CHVA 3U7VA 3ITXA 1OVDA 2E5DA 4JEJA 4O14A 4XUGA 1Y8BA 2CZDA 2VQUA 3SRHA 1S2UA 2Q8LA 3GKFA 3UFYA 4G1NA 3VMNA 4OJYA 3LRLA 3RRAA 1N55A 2E25A 4GJ1A 1F2JA 5C2GA 3GRIA 1UG6A 1XLIA 1BVZA 4AY7A 1P6CA 5JBEA 3O15A 3PBYA 4HN4A 3MV01 1UKTA 4LF2A 5A6TC 1MQPA 1B9ZA 1QRQA 3HGSA 5DT5A 2BTMA 1XX1A 3LK6A 4LCSA 1FKWA 4RDYA 3CC1A 2FB2A 1KXTA 3NL2A 1B31A 2QR6A 2YCJA 3DGBA 4AD3A 1PZ2A 1TUFA 2Z26A 3DFOA 3M6DA 1Z48A 3SCSA 4O13A 2ZVRA 4HSOA 3BQ6A 2VTFA 3UGVA 5KZMA 4LAMA 3C8NA 1A5OC 4H6RA 1FWRA 3VDBA 4YLWA 2EBNA 3OG2A 3VZZA 3GDBA 1F05A 4LEQA 3GHSA 3TP4A 1JPHA 4MIMA 3W1QA 3RR4A 2PDYA 3QC0A 3W1MA 3GM8A 4LYQA 4DF2A 4NNAA 2VEKA 3BLKA 5M5DA 3LPGA 4Z42C 2G0WA 1B3OA 4XZHA 2RFGA 1TPFA 2HDJA 4XSLA 3LD5A 5CSYA 1EFZA 4H8UA 4UBPC 4GVHA 3PSWA 3DG6A 2TPSA 1YNPA 2VRJA 4UQDA 3CJPA 1OEPA 1NQKA 1EC8A 3STCA 1EH9A 2ZUUA 3NTYA 3ARUA 2VCAA 1KRBC 1FWJC 1P0BA 4HPJA 2P5NA 1DJZA 3K13A 1EYWA 4PFMA 1FFRA 2J7EA 3LHYA 4ATWA 3EXSA 2E1WA 3L66A 3W27A 4J3ZA 3OVGA 4WDXA 4DZIA 1QI0A 1U2YA 3K5XA 4ZA0A 1ISZA 1H7PA 4HPHA 3EWDA 3LM7A 2G41A 2WKJA 4UCFA 1TTJA 3DN5A 4H19A 1JNEA 1EEPA 3L2IA 1OFBA 2EPLX 1TWDA 1NARA 4GI4A 2GVLA 3AWOA 2O55A 4E5TA 5H8UA 3EDFA 2OR2A 1J18A 1TV2A 2AGTA 1GTHA 2IKHA 4E4FA 4NQ1A 1P0EA 2Y8UA 3EWYA 4FIQA 1TTQA 3F2BA 5K4ZA 3AALA 1K77A 3VIIA 1BVNP 1YE4A 3NQFA 1R3SA 1GONA 4XTDA 3BTNA 2CBIA 4XKYA 5E70A 1AQFA 1V79A 3G1SA 4H4IA 3UWEA 1S5TA 3GK0A 3VIHA 4UUIA 3KWXA 4QBXA 4IXHA 3W1XA 5H6HA 3GC5A 4J27A 4NJGA 2DEPA 4N4QA 2WC7A 3OO2A 3B4UA 3VIGA 3L2LA 3BAWA 2EEXA 3F1QA 5HULA 3NQMA 4MY8A 3P2VA 3S5OA 3BGJA 3UT0A 2X7WA 3OBKA 1WDSA 2QCFA 1TJ2A 4JHZA 2WJEA 1JFXA 2BXZA 5KEZA 4B5SA 4GZ7A 2BLEA 4AX6A 1CGYA 4O8RA 1WUEA 3CUFA 1VJSA 1OFEA 1XRFA 2Q02A 3UP8A 4UNIA 5M2FX 4UCGA 1SMDA 4KMQA 2DJXA 4MWAD 2NUYA 4GXPA 4YYCA 3A4JA 4C6JA 5REQA 4QJ3B 4GZEA 1XBVA 4HU3A 4JQ3A 3TYBA 1RJQA 2FVKA 4LAZA 1KC7A 3UY7A 2DV0A 4PGLA 4QG8A 4ACZB 4E2OA 2DGAA 1US0A 4ATDA 3MI2A 2ISSA 3P62A 1CXEA 2PB1A 3H7UA 4PH6A 2IQTA 3M0HA 2V3EA 2GK1B 3EOEA 4H6QA 4TOQA 3H2CA 3S9ZA 4LV4A 4D2JA 4TTUA 3PG9A 1OD0A 2FQIA 2VC9A 1DP0A 1I75A 4XVEA 2FZ8A 4REQB 2XH4A 3I10A 3WLNA 1L0PA 1XIHA 2XM1A 1Q7MA 3DI1A 2GVEA 3DEQA 4KERA 4PMRA 2X05A 1W1TA 1DXIA 3AXIA 3GFYA 4L1GA 5DCBA 2TMDA 3BCFA 1UH3A 3FS2A 3RN6A 3T07A 2QCDB 3BANA 3FFSA 5BWAA 3WMSA 1TWIA 2ZOXA 4P61A 3JU2A 1OT2A 3N17A 3RIKA 1HT6A 4NJKA 4IL0A 5DFAA 3UEQA 3BW4A 4A3QA 4FOJA 4H1ZA 1PJ9A 1M7PA 2C0AA 1GWJA 2YDRA 4IIDA 1GQNA 1GOQA 1XGEA 3AMCA 2E6FA 4CEUC 2XIBA 5XIMA 1W17A 4B5VA 1SZNA 3CWNA 4LALA 4ERIA 2EJ1A 4KGLA 2NLIA 3IIZA 3L7RA 4PYSA 3GKAA 1ZCOA 2FVLA 7PTDA 2D2GA 3OU8A 3VTRA 3PZQA 3CO4A 3ITYA 3ISIX 3HO8A 3HQ1A 3ANYA 2YA0A 3LYEA 4XBJA 2OWXA 4EX4A 3C3NA 4MYXA 2R1KA 3WQOA 4C6DA 2DVTA 2Q6ZA 1RR2A 3NSMA 1N8WA 1UQZA 2VX4A 3KCOA 3RFAA 1IT8A 1EA9C 4F48A 3VIKA 1LUCB 3B8UA 3ARSA 4D6GA 1E0UA 2PDFA 1T8QA 3A5VA 1MFVA 1LQ0A 3WZ0E 2DPEA 1W9DM 2AQOA 3LHTA 2V82A 4LAKA 2P8BA 3TQ0A 1W5QA 4IGHA 5KZDA 1JZ7A 1E9ZB 2OKTA 2O9RA 3EMCA 1H09A 2VR2A 1QTWA 2OU4A 4F4RA 3SBFA 3G22A 4GINA 4LVGA 1SW3A 5U4NA 3WNMA 3SQMA 5A8OA 1EHNA 5BXSA 4Y9PA 1M6JA 4O52A 1E5NA 4JYFA 1WCGA 3W1TA 5LGZA 1X96A 1ZFJA 4AYSA 1RXOB 1TJ1A 3RCNA 4GVFA 3DHPA 2WW5A 4X63A 1FKXA 3URNA 2V0TA 3V5OA 4H8VA 1C8XA 5HNTA 3R12A 1YTKA 5BMXA 4EKJA 4RX0A 2V5DA 2VZUA 3QGKC 3OQEA 3FDKA 3DX5A 4EWJA 3OIHA 1RPXA 4L80A 1GUVA 1S39A 3AXHA 2BVWA 1UKQA 1NOWA 4B92A 4Z2LA 1W0MA 1HJWA 3W6LA 4D8AA 4I7VA 5I3DA 2BHYA 3OBEA 3VXGA 1FBAA 1EJUC 2JKPA 4GQQA 5AC5A 3M0JA 1YPFA 3NXLA 4H8NA 2HK1A 1UWRA 1KM6A 3MI3A 3T0CA 4KEUA 2Y70A 3NVDA 5LA2A 1DIEA 1T6MA 4QITA 4Z1CA 1WB0A 2QJHA 2YBTA 3UVAA 4US5D 3WN6A 3TWAA 4B2DD 3QZEA 3WNKA 4YTQA 5KETA 2VM8A 3IV3A 3IPWA 4FR1A 4GRSA 5M1TA 3KS5A 1RV8A 3IJ8A 1EQCA 1I6NA 1WV2A 3K4DA 1RBLA 2RKXA 1AL8A 4F9DA 1TRIA 3QPZA 5IRPA 4D6DA 1YMYA 3DHDA 2WQPA 3W7CA 5GVJA 3UA3A 2XGBA 3PN8A 2YYUA 3KOWA 4R7OA 5T9BG 1VC4A 4B5NA 4G2DA 3HPFA 1GOWA 3LOTA 4H9XA 4W7VA 3VDCA 4XD5A 2CKSA 2EHHA 2NQHA 2F38A 4PB3A 1PIGA 4C90A 3DG3A 3W74A 1TPDA 1E6SM 3N9KA 3OTRA 2FPVA 3S5ZA 5M03A 3OZMA 4XQ6A 1YDNA 2W67A 3KRUA 2DZSA 2HXUA 3I6RA 3OLEA 3W9ZA 5T9CE 3BK0A 3AIQA 3P82A 1AQ0A 2Y7GA 1ZU8A 1EOKA 4AW7A 1NDWA 1POKA 3KZPA 4DWSA 2FJKA 3XISA 4MFDA 4JKKA 4ONVA 4D1JA 1ZCCA 1QAPA 1JAKA 2VZVA 6XIMA 2YCLB 4ICNA 4DYEA 2QJIA 5C5YA 2AL2B 3CM4A 5LIUX 4PUMA 1AH3A 4LUSB 4F9JA 2Y5SA 5LKYA 3EAUA 1VCFA 3P8JA 5BXTA 4S38A 3F5KA 2XVKA 1BSIA 5T8GA 1VLIA 2HPIA 3BL3A 4CNSA 4P7RA 3WQFA 1NY1A 1R3VA 4PCTA 2EG7A 4FOKA 2CLEA 4S39A 1UA7A 3H4XA 5EGRA 3PTDA 3IJQA 1AD1A 1RSCA 3BLEA 4HYWA 3TLQA 5LYRA 1EWDA 3IJ7A 1F73A 1H7OA 5CZJA 3H23A 4Q4RA 2G96A 4F0KA 3VKAA 3M44A 3LY0A 2D2OA 1MFUA 3PTQA 3R2GA 5DN1A 1UZ4A 3SCNA 1NFPA 3LCIA 3TJ4A 2I1OA 5A8PA 2Z25A 4FIRA 4JL1A 2QDEA 4R53A 3T42A 4H9VA 1OYAA 2CXEA 4UB9A 4HK5A 3WQEA 1JCJA 4LAOA 2BGSA 2E0PA 3LMZA 2QUVA 4LRSA 3W25A 2JE8A 3VOHA 2XWEA 1MQRA 4O1AA 3ZT5A 4LXFA 1VKFA 1UBPC 2IXVA 5BCAA 3ITVA 3S1GA 4LBUA 1PXGA 4MUPA 4C6LA 3B8VA 3C61A 3QTGA 2PE4A 3AS3A 3A9BA 1WZAA 2PDWA 2NV1A 2WMGA 3WJSA 1CGXA 4LC6A 3LGEA 1LWHA 4GYPC 2P50A 1POJA 3S5YA 4A4AA 4L1WA 2Y8KA 3BE7A 2PBGA 1E4LA 1Z32X 4GK8A 3U6WA 1JFHA 4Q8TA 3OLGA 4IFKB 1XS2A 1WQ5A 2XDFA 4MPQA 4GFSA 4OT7A 5I6SA 3NDZA 1Z6KA 4JQ2A 3REQB 3W7HA 3CZKA 2CLLA 3LM3A 4MM1A 3I68A 4EF8A 3QHNA 1TMQA 4JD4A 1E43A 2V68A 3VGHA 6TIMA 3W7RA 3QR1A 1A5BA 3TH6A 3LCLA 1DQUA 3M0MA 2W27A 1FWEC 3A5FA 4PUJA 2OTDA 1PL9A 3OP2A 1ZS2A 4LFYA 5JBFA 3H55A 4XO6A 3T08A 3OZYA 4WK9A 3W0KA 1RBOB 5IOBA 1ICPA 2GSJA 3M0IA 3VCCA 2QF8A 3LHVA 3AROA 3QY8A 3SQLA 4BF9A 2YXGA 2GQ9A 3KOXA 3LPFA 1SQ7A 3S3GA 1BF6A 1EJSC 4U5IA 2HZGA 3TU9A 3OYXA 4XAZA 1GQIA 1OX6A 1OC5A 3INPA 2VGGA 4R5EA 2AMGA 2ZWYA 1PPIA 3N11A 4QDWA 2QPSA 1C9DA 4JFUA 4N2YA 4EPEC 1O1HA 4KWOA 4NIRA 3V0UA 1E0TA 3GTXA 5ABFB 3GIPA 4E8DA 1CEOA 4NZCA 3G18A 3T81A 4PCNA 2GGHA 3UWZA 3KW3A 3RITA 3NYZA 4R33A 5C70A 3QRHA 3ITCA 4C6PA 1VPQA 1LG1A 4YTTA 4XTIA 4FLOA 2I9UA 3EOSA 3MKCA 3GTIA 2J7FA 2YL5A 3KWSA 3KOFA 5G1YA 4U5KA 2Z0IA 2V5KA 1H4PA 1QT1A 2E6AA 2Y5EA 3O0KA 3LXBA 3WDQA 2P88A 3T0BA 4UMBA 2ZC8A 5C9UA 1SZGA 2D0HA 1FXPA 3BJTA 3RPTA 4CD5A 4PBGA 1UC5A 4LBSA 3TTEA 1EGVA 1F9CA 3TW9A 3TK7A 5HJYA 5C9ZA 2DY3A 3LPPA 5F4SA 3W1AA 2J4GA 3GVVA 4FLSA 4Y8EA 4MJZA 4JCLA 5HNNA 3TX9A 3Q2DA 1TB3A 1XFBA 1F3WA 1Z3NA 3TJIA 3FGCA 4W7UA 1EP3A 1ODZA 4AD4A 3VA8A 1TYGA 3Q67A 4AG0A 2BOFX 4V1XA 3VNKA 2GVYA 1V77A 5E6ZA 4FALA 3M1ZA 2J88A 2J9YA 1SR0A 1YTDA 2ISFA 4Z1AA 3WG6A 3VOIA 4DF1A 3LCHA 3ZJ7A 1JGIA 1ADSA 1RQEA 2VEPA 4C1NA 1OC7A 2P0OA 2F61A 1ZJBA 2CZFA 1CTNA 1FOBA 3P6LA 4ENLA 5LNSA 1EEXA 4UMAA 3W7MA 2GGGA 1P0NA 3V4BA 2GJLA 4HU4A 3NGFA 3UR7A 5K2ZA 1VBJA 4DVOA 3WFLA 1MXDA 3OGRA 2ZUSA 4DJDA 1GZGA 1A5LC 1S5NA 4ZQPA 4HOXA 1WBHA 4JX4A 4QRNA 1LM1A 2QYGA 5F2MA 1MXGA 2JQXA 2XVNA 4ES4A 3NR0A 4GWEA 1PKNA 4IMAA 5D09A 3B9NA 1JZ8A 3W37A 4RJEA 3G6MA 4NYYA 1UD2A 2H8ZA 4MDOA 5I02A 3WLKX 1J5TA 3ZWSA 5JIWA 3NM3A 1CECA 3NJ3A 5FJOA 4O16A 5ABHA 5BW6A 2E8YA 2J6XA 5AHMA 1B1YA 3P84A 3MSGA 5I3GA 2IS7A 3CS2A 2I17A 5CPNA 3VKJA 1KW1A 3C0QA 2RJGA 3KL5A 4LYKA 3NQGA 3RNDA 3GTNA 1OCQA 4NG3A 4YVVA 1V3KA 4HMNA 4UTMA 1VYPX 1RY8A 3G3DA 1V02E 1XH1A 1FWWA 4A05A 4FO4A 4JDBA 4XZNX 1TJRA 1QHPA 5BMWA 2PAJA 3G5EA 3TYUA 4MHBA 5GJPA 3IGUA 1JDEA 4FHAA 4WGXA 4FA3A 1TE6A 1PTAA 2WCAA 4AEOA 2FKPA 1TPUA 4JIEA 4WUIA 4BQ2A 4FNRA 4PUKA 4Z17A 3N6HA 3NL5A 3WNLA 3B9DA 3RO6A 4XD3A 2X2GA 3ZR5A 3EB2A 1REQB 2ISVA 1UWIA 1DTUA 2FIQA 3C56A 3IGXA 3ARZA 2C13A 4GUGA 5EFDA 3GVGA 2X0YA 1WDQA 4ZQOA 3B04A 1VQTA 2ALRA 2VL4A 1ESWA 1UKPA 2D73A 3O07A 1GJPA 4QM1A 1XG4A 3AMDA 5KMYA 4WJ8A 3SUVA 1KA9F 3WYZA 1G01A 5A6KA 4OIFA 2D2JA 3WUFA 2VGIA 1AJ0A 3VE7A 3HQPA 3WBAA 3GHUA 5K7JA 4HNOA 1O12A 5EYWA 2WSRA 3DOPA 4HD5A 1J11A 4DXXA 1JYVA 1AVAA 1TKKA 3CXOA 2Y89A 3KBVA 1FWGC 1ZAIA 1WKDA 2X0HA 1OFPA 2KAUC 5DCEA 2D0FA 2DW6A 1RZMA 3B8DA 4Y9MA 3DKLA 1B9BA 1W1IE 2QUNA 3E1F1 2BS9A 3ITGA 3CMGA 4OU1A 1OFAA 1R9ZA 1Q7QA 5HWMA 5B7ZA 1OYCA 3CV2A 3NDOA 5TBOA 3M9YA 4HTYA 4RNJA 5M3WA 4QHRA 1SPQA 1XCXA 1YIXA 5GPRA 2OGYA 1VBGA 4PUUA 3GVQA 3N13A 2A85A 1B3VA 2D0GA 4UTFA 1KFEA 2GDVA 3QLDA 3NUKA 3MWCA 1XP3A 5FEXA 5D8ZA 1XYFA 2E68A 2ACRA 3UJ2A 3O63A 1WDDA 2BASA 5C55A 3CLMA 1NDVA 4XZBA 1W3IA 4XBSA 3IIXA 2CCRA 1PUDA 2ICSA 3KE0A 2WVVB 3A22A 4KETA 4NT0A 3TFXA 5HK4A 2OEJA 3WCZA 5HJLA 9RUBA 2Z2UA 3WX7A 2HRWA 5FCZA 1XRVA 2FTYA 4B5UA 1MUMA 1YQ2A 5LHEA 3TOYA 4O28A 3A47A 1CCWB 1I0DA 5EA9A 4A8NA 4PUNA 5CCZA 3W88A 3KRBA 4S2CA 2FPTA 2Z2AA 2A3EA 4MNLA 3G24A 2OX1A 1JRCA 2J66A 3C6CA 4INFA 5E0CA 2PP1A 3WH6A 1P0DA 3W71A 1LOQA 1S5VA 2JIWA 3WUGA 1CB7B 3W6MA 4XWUA 3DFPA 4DJEA 3WQ4A 2ACSA 1PO9A 3QLLA 1CZ1A 1U5JA 4L7ZA 5JU6A 1Z8AA 1W9XA 2CLHA 3TCEA 1XLDA 4H9ZA 1K8XA 4EAMA 4A35A 4BZYA 3GDLA 3O8AA 4F66A 5RUBA 3EWWA 1O60A 2W6RA 1QBAA 5D2TA 3CLWA 3G1YA 1UPPA 1A5SA 4RK8A 1TPH1 5IDZA 4WD0A 3KOYA 1R0MA 3R13A 3PF3A 1M7OA 1HVXA 2V3DA 4UFHA 5CGTA 4F40A 3CZEA 1JZ5A 3THCA 1CNVA 1UP3A 1YADA 2XYLA 5CPLA 3WLHA 4HNUA 1XPYA 1WXZA 3IUHA 3CASA 3CO8A 3HJZA 4NSBA 3WMBA 4NXSA 3KP0A 2D20A 2GJPA 3M46A 2J7GA 1FWCC 2EG8A 2VOTA 1XI3A 1XRSA 3SFWA 3SSJA 4CQDA 1HQTA 2PC4A 2H9AA 1V93A 1RPKA 4IISA 2CHOA 3W76A 4DF0A 4MKSA 3E2RA 3ZSTA 4NNCA 3KHDA 1FTXA 3TJXA 1SZFA 2OJPA 1J6PA 3D3AA 4O4VA 3LLXA 3R8RA 3S46A 4LNCA 2EJAA 3L9CA 3FX4A 5AECA 3CPRA 1E6XM 1O5KA 4LPCA 1R38A 1MO0A 1VR6A 4NL1A 3GNRA 4CQAA 3NQ8A 3WEZA 3LBMA 1XUUA 1Z9AA 4TR9A 2J75A 3CHFA 1GKQA 3H2AA 4J5NA 5D04C 1QPOA 4ZTYA 1DWGM 1D3GA 4GI8A 1QPNA 1CGWA 3GR7A 4GOAA 3LCWA 3GE7A 4RLIA 1JG9A 1BYAA 3MY9A 4DM1A 4MZYA 4J40A 3S83A 4ATLA 4E2DA 1G7VA 3H70A 2Q3RA 1IR1A 3WLPA 3BAJA 4H83A 3PFRA 1JZ3A 5I5RA 1ZZMA 1PZ0A 3CUHA 2GQ8A 2Z1BA 4D8LA 3NQ2A 3CUZA 3BG5A 2R1MA 4GH3A 4ZB0A 2O4MA 2C79A 2R9RA 3MB9A 3LCXA 5I78A 2VT0A 4GGBA 2DZWA 1W3HA 3NQVA 2D1ZA 2DZBA 4P8UA 4EIVA 5PTDA 1JUBA 4ZFCA 4CQ8A 4HN8A 1RP9A 5IFTA 1KRCC 4D6EA 4DYKA 3DYOA 2VMFA 1MRAA 2E1DA 3GUGA 2INFA 2DJLA 2HMCA 2A0NA 2QV4A 1UP2A 1HTIA 1JI2A 1Q2SA 3AC0A 4M19A 4IH3A 1DWHM 4FEZA 5BZAA 3ANVA 4MJMA 1F8MA 2YFOA 4RCXA 1TUXA 1SJCA 4FNQA 4AZIA 4ALDA 2OOFA 1W5NA 3LDVA 5CG7A 2E6YA 3O9NA 3RCMA 1CXFA 4MPKA 5I3JA 4MWAA 3BLOA 2P3ZA 2QQ6A 2BV9A 4GY0A 3I7RA 2C1GA 4M82A 3OYZA 4Q4SA 1UD6A 2R91A 2EKGA 2FGLA 1XW8A 3T9PA 2PLMA 3IVSA 2QW5A 4QS6A 3NO1A 1FHVA 1EO7A 5CPSA 3OHMB 1D8CA 3HGJA 1PWMA 2VX5A 4NILA 4PTVA 4AC1X 3EWBX 2QUUA 5EMYA 3W1NA 4MF4A 5C6MA 4I3GA 1ZTVA 5E9XA 5D9PA 1KFJA 2ABAA 3A12A 2V69A 4L6OA 1TX0A 3C0LA 3V5CA 5J5DA 3UESA 4W88A 4QE5A 3VC6A 2RGLA 1KNWA 3A13A 5F2LA 1T99A 1MQQA 4DPPA 3AQUA 3CK5A 1XLGA 1GVSA 1LP6A 4LB4A 3J7HA 1O5RA 2BWGA 3SGUA 2QDGA 1QHZA 1BF2A 1OGGA 1GEQA 4K8GA 5HINA 5FL1A 5CAHA 4R3UA 2A21A 5HMEA 4PTXA 1SO5A 3CWOX 4Q4OA 3FJ6A 5CC6A 4YWSA 4O12A 2PTWA 3H24A 1N8FA 3EA1A 3LGGA 4TX6A 4DO5A 2FZBA 4GBDA 1QNQA 2VFEA 2AQVA 4ZE5A 5GJMA 4LS1A 3TWBA 4CCCA 3QW3A 3OW1A 1VH7A 2LLEA 2QVHA 1J5SA 3RJYA 4X3ZA 5I0DA 1E56A 3CQIA 4UOJA 4IICA 3FKRA 3RILA 3T8QA 3OZOA 1FWNA 1PYFA 2A3BA 3MUAA 1GOXA 3CEPA 3RGTA 5EPDA 4JFVA 4MG4A 5LA1A 1KRAC 1QK2A 2CXGA 3MJYA 3WENA 1NVMA 2WMIA 3CZLA 5EL1A 4IMFA 3OLIA 2QT3A 1BYBA 1V6TA 1QOPA 3EB4A 5FEPA 1U1UA 3NCOA 1MYRA 4F3HA 4PUWA 1J0HA 3CV1A 1A5NC 3MYPA 4YVXA 4E4PA 3M5VA 1SR9A 4M3PA 4UQBA 4A6GA 3I3EA 2Y1HA 3U2OA 3ZS4A 1E55A 1OD8A 1BTMA 1Q4WA 3ARRA 1J0KA 3I6TA 4GUIA 2YKKA 1WKFA 5BU9A 3KVMA 5TAOA 3UZZA 1DHPA 3QV6A 2WJFA 3LBCA 3QMSA 3RMEA 4V33A 4K3ZA 3N15A 3U7BA 3DCPA 2XJ7A 5FF0A 1ICSA 2OYLA 4Q4QA 4LUYA 3BCJA 4E6MA 2DVXA 4AWSA 5CQ1A 2QZRA 3UNDA 1I1XA 2V63A 3KLLA 3WLTA 4PUDA 4WXZA 2DZAA 5AYZA 1DWJM 3U57A 3UG4A 1I2OA 2GSHA 3QM3A 2Y6ZA 1XSJA 4NZ4A 1V6XA 1RVKA 4YHEA 1L2QA 4WY0B 4R34A 1PKLA 1UR4A 7ENLA 3WH5A 1WAWA 1CYGA 4RKAA 4CCDA 1KQZA 3R0KA 3AI0A 5ECUA 3WQPA 3HURA 4GIRA 4GKLA 4OE7A 4MAZA 3NQDA 4QJ5B 3EEZA 2WM0A 1US2A 4JKLA 1RA5A 3P67A 1FX6A 4P8VA 5CC3A 3MSYA 3FY1A 2XHYA 1Y5XA 2Q01A 4HKPA 1ZBKA 2RDUA 4OTKA 2XH0A 1LF1A 3R89A 3WUEA 4US5A 4B2DA 4S3BA 3BWWA 3CZJA 3NO5A 4X0VA 4Q22A 1TPEA 2VEFA 4M51A 2GGIA 3GDTA 4AYGA 4AD0A 5AZ0A 1VJZA 3RO8A 3CPUA 1L2UA 5G4EA 2ZRZA 1KRMA 1X6LA 3VOFA 3CHCA 1HJSA 2XIJA 2ZUMA 3KRSA 2CLPA 5FJJA 3QR3A 3PZGA 4IP5A 4IMGA 5C9RA 4M1RA 3IUDA 1EA0A 3UJFA 3M7SA 1DIKA 3UVIA 1PDZA 3C4UA 3BGGA 4AEEA 1CGUA 4LY8A 3SCOA 3BAYA 3VABA 2VR4A 2WK2A 2PZ0A 2YDAA 3HPZA 4O1DA 1TTIA 4WSHA 1KM2A 4FX6M 3R0UA 3PB2A 1TSIA 4TMCA 4QS5A 2BNJA 4HCLA 1S38A 2OMAA 4MLJA 1JULA 1XWYA 3VD3A 1LL7A 3RR1A 3CQHA 4BJHA 1NTHA 1C90A 3ES7A 1NM9A 4GE8A 1I2RA 3KP1A 4DPQA 4DY1A 5LA0A 1Q2RA 2DSUA 4HZ8A 3S2CA 1W9UA 1UJQA 3GDKA 3WD1A 2TYSA 2A3HA 1VYSX 3QFEA 3VFLA 4IUOA 1VPXA 4KCTA 3TIMA 3NQAA 3MZNA 3WDRA 2VC6A 3AXXA 1EO5A 5J8LA 1VFSA 5DBUA 3IAQA 3ONBA 1XIIA 3QKEA 4Z2JA 4HJFA 4DLFA 2O0TA 4TVUA 1UW9A 2Y2WA 3HM7A 1H5YA 1C3FA 1JF5A 4S3EA 5I3FA 3CNYA 4AVNA 4OV9A 3W72A 4QJ1A 4O54A 5HWJA 3WF4A 5BWFA 1WKEA 4IJBA 3OGVA 2DIEA 1XCFA 2YR1A 2Q71A 4KT2A 4W8BA 3PWGA 2OOGA 3U5YA 5D02A 4NAEA 1AW2A 3P5ZA 1EUAA 2EF9A 4ROPA 1QATA 3K4AA 3FAXA 1ISVA 1PTDA 3FYOA 3HG4A 1XLFA 3MKKA 4LANA 2OYKA 4XZ9A 2V6AA 5IHSA 4XD6A 3SADA 2YL6A 1JL8A 1R3WA 5GJNA 1GW9A 2HS8A 1GYNA 1MNZA 8TIMA 1RCOB 1R46A 3LENA 3V36A 3BLPX 1KCLA 2PI6A 1XSIA 4NXKA 3W7NA 1J8VA 1VPYA 3KFTA 2Z6IA 1IXNA 3UCQA 3L5AA 1M1BA 1Z7AA 2GK1A 4JIHA 1TZ9A 3IJDA 3COTA 3P5YA 3VYLA 1JUEA 3P7YA 2F6XA 1UR3M 3CB3A 3PJWA 3PZUA 3VDAA 4BFAA 4HYVA 5MF5A 2FDMA 3AXKA 3RLUA 3NSXA 1Z69A 7REQA 4O1EA 4Y9AA 2WZEA 2NZLA 3MC5A 3VIPA 2NX9A 1E9LA 5D4YA 1PX3A 4GNKB 4UQCA 2QCDA 3G0UA 4ERAA 1NQ6A 4DAIA 4FNPA 4L4PA 1YNQA 3PSVA 4JTSA 1A0CA 4AZCA 3ABSA 5T26A 4CNUA 1KCKA 3R43A 1XQLA 2P3EA 1GGOA 4JTIA 1SZRA 2WNQA 4ZXLA 4FNSA 1TPC1 1VEOA 2CFFA 4O17A 2OZ8A 4RPQA 4HNNA 1H63A 3WQGA 4I9AA 2Y62A 2JF7A 3W2UA 2ANUA 4PTWA 1CBGA 4LGXA 3W81A 3AUOA 5DF0A 2E40A 2GJXB 1W1PA 2Z1WA 1IXQA 4D6FA 2CEQA 3W29A 1UKOA 3L5LA 1XLAA 5A6BA 4YYFA 5I3KA 1W9PA 4QCFA 4ML9A 3E9AA 4AC7C 2Z27A 2ZICA 5CPQA 1K7XA 2G5WA 4TXEA 3M0ZA 1XQKA 2YA1A 2P10A 4GNJA 3RRXA 4PMZA 2E6DA 3SN1A 4J7RA 3LI0A 3JVAA 1NIUA 4DWSC 4C60A 3CEUA 5CPTA 3UXDA 4JNMA 3MUZ1 1M5WA 2AAMA 1LT8A 4J3SA 2Z29A 2ZX7A 5HNRA 4ERGA 1VEMA 2C19A 4DUOA 3M41A 3ABQA 1LUCA 2YOCA 1BFNA 1Z44A 1V08A 3SGGA 1Q65A 5DBTA 4ZL1A 1FDYA 5DQPA 2VP8A 1F4AA 3O6DA 1ZENA 4N6FA 4MJ4A 1V6VA 2CERA 2NX1A 2X1RA 3NSNA 5HR6A 5JH1A 1LRNA 1CGTA 1C91A 5XIAA 1FCUA 1YXYA 3QFWA 1PIIA 1WZKA 2DVUA 2JF6A 1XLBA 2OXNA 3AU2A 1UCWA 2FTWA 2BVYA 3DBNA 3GC2A 3T0DA 2QJJA 2W5FA 4E8GA 2XFFA 3RU6A 2WV8A 3NA8A 3LPOA 3SZ8A 3BLLA 4OUEA 1WDRA 3W7EA 3WK1A 4AMAA 4ZQMA 1AUSL 1P6WA 4GQRA 5D9NA 2ACQA 2E09A 4HGXA 1BLIA 3L67A 1QDSA 2XGZA 3CQKA 1GCYA 4ASTA 4JIIX 1A4LA 1IV8A 1FH9A 4O50A 4N02A 2WZHA 4R88A 2WZMA 1SJBA 4G9PA 2QJGA 2NUXA 4IJCA 2PZNA 1L6YA 1FXQA 3SCRA 4HZ7A 3L4TA 3ARWA 2OZ0A 5F4XA 2XIIA 2JFEX 2HE8A 1SFJA 4U2YA 1BD0A 4AY1A 1C92A 3F5JA 1JPIA 2G50A 4W86A 3FXYA 1YPXA 5CBBA 3GXTA 5HQMA 4HMCA 1EPXA 3PJTA 3TONA 3CBWA 3E49A 5HPOA 4K37A 3R8HA 5C2CA 4H3DA 1D2KA 4YTUA 4NRRA 2E7FA 1KM5A 1UMYA 4AISA 3EPOA 3H12A 1CLKA 3W7IA 2FFCA 1MZRA 4EOUA 3MV11 4IZGA 2X1TA 1UWQA 1FWBC 2YCKX 1WBJA 1T0OA 2HBVA 2PDJA 5JVLA 2GWNA 4KWVA 5J04A 3GW3A 1RP8A 3PJUA 2OO0A 4Q6JA 2WYSA 1BXCA 4AZBA 5E0KA 3W28A 1GJWA 1CW2A 4B5WA 2YYTA 4GACA 3DUGA 4S3GA 2IW0A 4JX6A 2EAWA 3W38A 2Y0FA 3T7VA 4XZIA 4CD7A 4IQJA 1L6SA 4YHGA 3U4FA 4HPXA 3MSDA 5CSRA 3GYEA 2BFGA 1WOAA 4EK7A 5FJTA 3D0CA 4GYJA 2A5HA 3L0NA 4NAFA 5CBJA 1MVYA 1GPWA 2CHNA 1IZKA 5GQBA 3VE9A 3T2PA 3IGSA 4LNYA 5JMUA 3IJ6A 3GZAA 4D9PA 2PU0A 3UGRA 4ZSTA 1CXHA 4E38A 3IIOA 4ZOAA 1TV3A 2CWXA 2V9DA 1GVIA 3F4CA 2AL2A 1ZL1A 3GY1A 4HBKA 4P7QA 4J35A 3VX0A 4HQVA 3VZXA 3G1VA 4LUSA 1H51A 1MZHA 4L9YA 3USBA 4LH8A 1T7LA 3W53A 2PDUA 6A3HA 2CETA 1A5KC 3TDFA 1OQFA 2QUMA 3EXTA 5EB8A 1E70M 3HTWA 1AA1B 2BMBA 2DZTA 2I5IA 4OHQA 1EWEA 4DM2A 3BDKA 1W1B1 3O6AA 3O0FA 3Q37A 1XG3A 4HJWA 3ATZA 1L8NA 3ARQA 4OBSA 4H8HA 3RX4A 4DIAA 1XYLA 4OECA 3WQ6A 4NX5A 4BKNA 1VRXA 5D9OA 3W7KA 4EWND 3S8HA 1JDDA 1TWSA 2CNCA 1KBIA 4LX4A 2OKOA 1YDYA 4PB4A 3TNBA 5BXRA 4G7EB 1R3TA 4HA3A 1WKYA 3KCLA 3W85A 1Q8JA 3GUWA 4UQAA 2PDKA 1OSEA 2Z7GA 3NNTA 3LSCA 1TX2A 4IGSA 4HNLA 3UU0A 2MANA 1JPDX 4TUFA 3GU2A 2XINA 4F0SA 2CPUA 4V27A 3QOKA 2WBGA 1J0ZA 4BF7A 4MADA 2DSWA 3PUGA 1B5TA 4KEVA 3TXZA 4M6PA 2AQWA 2X0SA 1G67A 2NQ5A 1OX4B 1X38A 1OGBA 1EC7A 3N2CA 4EPDC 4KRUA 4PMVA 3CMJA 3AYTA 4JFTA 4JTLA 3UQNA 2YZ5A 5HPCA 3DAQA 4GQGA 3WL0A 3SIMA 3W4RA 1BXBA 1E3XA 4J28A 2I56A 2J78A 4JR5A 1R47A 3F4NA 4KRTA 2GFTA 1W3JA 4OUIA 1M65A 1TMHA 5G5IA 4IFKA 3AMGA 3E38A 4JY9A 4GIEA 1EGZA 3IS4A 3NPWA 5D33A 4ZE4A 1CXKA 3NO3A 3MKVA 1Q5MA 3MO4A 2C0HA 4DJDC 3OA3A 1JRBA 3REQA 2VQTA 1M7JA 4L4LA 1M7XA 1A4MA 1GVFA 2AKZA 1TE1A 1XINA 3SCQA 4XVDA 2DSZA 1L6GA 2YGYA 2Q3OA 3AIRA 3TTOA 1VFMA 5EU9A 2ZWZA 4JN7A 3V35A 3A4AA 1DJHA 1NDYA 1OBAA 4CVWA 2ZRUA 4UTIA 4JYEA 5A6LA 3CV7A 3D5HA 5AKQA 4GJIA 4UFKA 1S1PA 4JQAA 1XKYA 2XSBA 3NZ1A 4JY8A 4MGGA 1YDOA 3LRMA 4MZ1A 1ISXA 3R79A 3Q65A 1V4YA 4WY0F 1X1OA 4K39A 2R14A 2XSXA 2ZZ6A 2X16A 2F7FA 1ZGDA 3GH5A 5C9XA 2FZDA 3WQWA 3KUMA 1O6IA 1EJVC 3VIOA 1YE6A 4RNHA 4YPJA 3CHDA 1UWAA 1I0BA 4UIOA 5ABFA 2ZADA 3N1AA 2WSQA 4WXYA 2PA6A 5CBIA 5ECVA 2QHAA 2Z2BA 1R3YA 2WPBA 1OIFA 3SY8A 5DMYA 1PYMA 4UFMA 1EX1A 1YKWA 1H1ZA 1OY0A 3H21A 3VM5A 3HFYA 3OHIA 1QI5A 3NPVA 1GOIA 2CZ5A 3DC0A 2PWUA 1VB9A 4DUWA 4WJXA 1Q7ZA 4GIAA 1MEWA 1HNYA 3K2GA 5AVNA 2PF0A 2RHGA 1K3UA 5A2CA 1BKSA 2VC5A 3C8FA 4BWLA 3M7WA 4M24A 2PWVA 1ONXA 4N42A 5C71A 5KINA 3U48A 3NOYA 1I45A 4XIMA 2OX4A 1UR9A 3ZO9A 3R5EA 3RPMA 5LNUA 2GJRA 3SDOA 3E2QA 3DZ1A 3HJEA 4JTTA 2YDSA 4DJFD 4GY7A 4MAVA 1DOSA 3MUIA 3W01A 4IMDA 3UWQA 5FEWA 3GVWA 4MZ8A 1CIUA 5TQLA 4IXXA 3AWNA 1QWGA 2CLMA 2Y24A 2FLIA 1LTDA 2DORA 1EL3A 3A3WA 5FJIA 3HZ3A 4PMDA 1EKOA 1JGMA 4C5ZA 3L5MA 3G6LA 1AMYA 1CT5A 5U7SA 1AH0A 1BRLB 3TUUA 5CPOA 1W54A 1F6PA 2P8CA 3CWHA 2V5JA 1JCMP 4J3TA 3W7PA 4S1FA 9CGTA 1K7FA 5AOUA 5DRCA 3U4AA 1RY0A 2AOSA 2FZMA 3H8AA 3HG5A 2DZVA 2WXDM 4F2TA 4ZQRA 5I77A 5EFFA 4DBUA 3BLDA 2REQB 4XAFA 1OINA 2J9ZA 4ZB2A 5AYYA 3WLQA 1X8FA 4HMDA 3BG3A 2WCSA 2WSYA 3E96A 4YNGA 4HOWA 1MW3A 5A6JA 1TV4A 3VILA 3KX6A 1O68A 2E9LA 1A53A 2BHZA 4K8HA 5D37A 5E6YA 1VLWA 3MI6A 5HDRA 3WJXA 3ARTA 1B54A 1RCXB 2QAPA 1IEWA 4QFUA 1QPRA 5DXYA 1P48A 4MY1A 5D32A 1U5VA 2BOGX 4ACYA 4DWSB 3KHJA 2HISA 4UTTC 3KAOA 1RJRA 4JN8A 4TX8A 3ICJA 3CIVA 1V6WA 4E3VA 2WANA 2ISDA 1GG1A 4DJEC 3IRSA 4DJED 1B57A 3L21A 4LB3A 3BAIA 2OGJA 2VRKA 1TELA 5H1WA 2CITA 3ZOAA 4M81A 4P7OA 1C8YA 1E9YB 1EJ7L 5AC4A 4L9XA 3W2KA 4IPLA 4FI4A 3EDJA 5DMNA 2XIMA 2OELA 3UPMA 5I79A 3P81A 2UBPC 3R58A 1X7IA 4LY4A 1XBYA 3ARXA 3TC3A 4RPPA 2ZDSA 3HV8A 3C2FA 3F4VA 4Q7NA 2Y85A 4I9TA 4M1BA 4UFJA 2O92A 4FAMA 3I7QA 3WNOA 5FOOA 1J0IA 3IJIA 1D3HA 4W84A 1J93A 1V0NA 2ZX9A 3L4ZA 3OGSA 3PBWA 3LCFA 1W32A 2BBFA 3S5SA 4KRZA 2UWFA 3RLVA 3FV9A 1FFQA 3TYCA 1HFBA 4C6EA 1IEIA 4QJ4B 2ZXAA 2IPGA 3MO7A 3RHGA 4B3KA 3P14A 1HZYA 5E0FA 4W8AA 2ZRWA 4DO4A 3PWIA 1NU5A 3H2FA 1H1NA 4RW5A 3FA4A 2AKMA 4X61A 3W2JA 3ITTA 2WHKA 1GHSA 2VC7A 1PHWA 2G3NA 3ZJKA 3R4IA 4AZGA 3NG3A 2HK0A 3QQ0A 2C7FA 4ZXOA 3M5YA 1PAMA 4DZHA 4DN1A 2PDBA 3MP3A 2VRQA 1RK5A 3AZSA 1Y7VA 3KVJA 1ML1A 1XLMA 3LXAA 2QCCA 3LNMA 1GG0A 4WRHA 4GYFA 1D8WA 4LRTA 1CGVA 4WGHA 3PHAA 7ODCA 1GYLA 3FSTA 3QC3A 2HTMA 3UWVA 2NT0A 3DFHA 4PMYA 8RUCA 1U30A 2W0UA 3GZ3A 5HWNA 2IKIA 2G37A 1HGWA 3QQWA 5DMMA 2WVTA 3DGRA 3GTHA 1V51A 2HV5A 2I16A 3QPYA 2CBJA 3AAMA 2CKRA 3T6CA 3N25A 2WJZA 2JKAA 4JTDA 2V38A 2HQAA 4WKFA 3SIZA 3ARYA 3O2LA 2XWDA 3GG7A 3KM8A 1GOMA 2NUWA 4O53A 3FAWA 2WVVA 5I06A 2NT1A 3MSRA 5C54A 1SYTA 2AGKA 5EMLA 1OG6A 1TV8A 3GWQA 4R7JA 4JIRA 4Q8OA 3Q45A 3OZPA 1IXOA 4TQTA 3VPLA 2VUNA 4BI7A 2QMJA 1GZ1A 4N4PA 4AZ5A 5ABGA 1BTCA 2YB1A 4XBKA 1H11A 1FWDC 1BGAA 2ZYFA 5A3HA 4O1BA 3BJSA 3SSZA 4N6EA 3NOEA 3QN3A 5TF0A 4A8IA 3NZRA 2GYIA 1RBAA 4CEXC 2QGHA 1BG9A 1VYRA 4Y6GA 3P61A 1ENUA 1V6YA 3AICA 3W22A 1LWIA 1LLWA 3FSUA 2XGIA 1EOMA 4U33A 1YDVA 1GVQA 1NOUA 2AMXA 2GUBA 2YL9A 1S3HA 4PE8A 1OCBA 4CN6A 3GXIA 1EJXC 4MWAC 2PCEA 4BQ3A 4JTUA 8CGTA 3KTCA 4ZENA 1QWKA 3H7VA 3SUUA 1QASA 1FH7A 3WF2A 5D2YA 1AW5A 3P8IA 1UQYA 3DFSA 3O1NA 2XFYA 4WX2A 3M5XA 1XBZA 1KGXA 2B4GA 4JIPA 3UYCA 3FEMA 1GT8A 1PWLA 2HNHA 3HFTA 1XYBA 2R1LA 4C91A 2ZZ5A 3DYPA 2DIJA 1WOBA 3HGOA 3APGA 3MJMA 4CNTA 3N18A 4I9MA 4H01A 4C6BA 2DIKA 1I4NA 3AZRA 2Y7DA 3D3FA 4OWGA 1E6QM 1C7TA 3N2XA 1WO2A 3ZSSA 3FGCB 1S46A 2HVNA 4H6KA 2WHJA 3UR2A 2VCBA 3A3XA 4CNNA 4F0MA 1GVYA 4F8XA 1BYCA 3QY6A 1UKSA 2J7DA 2V67A 3SECA 2XZ7A 5I00A 4W89A 5IHRA 1A0EA 2POTA 5I3HA 3H2NA 3DESA 4IP7A 1SW7A 4ZO6A 4C1NB 2QULA 4NNBA 1KLZA 1HL8A 4RZBA 5C0QA 2ZUVA 4MYAA 2ZZ4A 3M0LA 1ONRA 3TQKA 4EP8C 2O9TA 1K9FA 3O06A 3WJZA 5CZTA 4S2BA 5LGXA 3B0PA 3TZNA 1F4HA 4HPNA 1QPKA 1V3JA 3RK8A 4EACA 3TJLA 3LN3A 4OVXA 1XV8A 2VX6A 1DIOA 1V8EA 2CHRA 3NEHA 1QI3A 4I5UA 3VAVA 3BICA 1XYCA 3C86A 3OVPA 2OSXA 3PBVA 4O10A 4TVCA 4M56A 3F7JA 3KVKA 3PPHA 1BHGA 4R9XA 2PRMA 3KOZA 4YTRA 1XUZA 5JBDA 2CBVA 3BG9A 3N3MA 1H50A 1ECQA 4UC5A 3TW6A 2J25A 3ELFA 1LOSA 3NEVA 2A6LA 5GNXA 3NPUA 2PS2A 4S3DA 3EWCA 4JL2A 2A2IA 4YL2A 1OT1A 2WVSA 4ADSA 1QFEA 1RUSA 2F84A 1ONWA 5C8BB 1KM4A 4QDMA 4ZOBA 3SUTA 1VF8A 2JEQA 4KEZA 3STGA 3WL1A 4W5UA 1ZUAX 2AAAA 4AHQA 1E4NA 4GZIA 1XM3A 5MHBA 1F8IA 3R11A 4O1FA 5HAOA 1F6KA 1QVBA 2ZA1A 3KDOA 5D30A 4K8EA 4C6KA 3VM7A 3P0XA 1J9YA 5LIXX 4GQBA 1KD0A 3N29A 3CQ0A 4PUEA 2C16A 1YTEA 3B0VC 1E0WA 2BDQA 4OV4A 4NZ1A 4TMBA 3UXLA 1JI1A 3MWAA 3JUGA 1HKMA 1Y65A 3ZT6A 2VVSA 1JD7A 2W62A 3TZFA 4UTJA 1I60A 1SSGA 3MHUA 4GO9A 1UD5A 2QKFA 3N4EA 3RM4A 3VGEA 4H41A 2XVPA 3GG0A 4Q4KA 3M0XA 3IUIA 3PZ9A 5JXQA 3EWZA 1VBUA 2X30A 3QXBA 5A5WA 1O4UA 1KXVA 1TA3A 5KTLA 1DV7A 5BXPA 3RX2A 1G69A 3IVTA 3W23A 2EKCA 1UROA 2OODA 1G1YA 4MY9A 3SCPA 1K7EA 3HN3A 3EX4A 3VCRA 1XLKA 3BOXA 3VNDA 1DORA 3AIBA 3CB8A 2J79A 4N9DA 1ZB5A 3M64A 4O4WA 4FK9A 1UUOA 1TJ0A 6REQB 3TQVA 2PGEA 1HJQA 1PS9A 3BXWA 1CWYA 3POHA 1Q6FA 4WSKA 4HIBA 1RHCA 2I5QA 1A47A 2ZX5A 5EMJA 5E1QA 4UTUA 2BY0A 1XXXA 4QLJA 2QJNA 4Q8VA 1KKOA 3BCDA 5EBUA 4AXKA 1F3EA 3F5LA 4AXNA 3FOKA 3LBOA 4PCPA 1GPFA 1PVNA 4HA4A 3WQ8A 4GYKA 5I23A 3B8IA 3EA3A 3SY1A 3MMWA 2PDNA 4E2VA 2WMKA 3B8SA 1AQHA 4C6QA 5TNVA 3K8MA 5AB3A 2EPHA 1E3ZA 1S3TC 1AFSA 4JQ1A 5DMLA 1J6OA 3VCNA 1K9TA 1XLEA 4AWEA 2VGBA 4DBDA 4WSJA 5FA5A 4BS0A 2GOKA 5K9CA 3W1RA 4Z2IA 2WLZA 4KFPA 4D72A 3MBFA 1N2VA 3V1HA 3R8GA 1GOKA 4YWIA 3CYJA 4RW3A 3UG3A 1XCWA 1QOXA 4K1WA 3BARA 2CZEA 4WR3A 4C6MA 1T41A 1LLOA 1MSSA 1QK0A 1I1WA 3RDKA 2QAFA 4HA0A 2ZFAA 4QTGA 3MCNA 3AS0A 2XN2A 5AVHA 3ZR6A 1W56A 2RGMA 3H26A 3VNYA 3H54A 1JCYA 2VD8A 3MYOA 1PZ3A 3BAKA 3UA4A 1EDQA 2RH9A 4PTDA 4JTRA 3B03A 2V2DA 3BVJA 3UWUA 3WO8A 2PCQA 3W7LA 5TIMA 5C7HA 3ZQ9A 4N9EA 4BEQA 3LXCA 4IFOA 4I7WA 4LSBA 3MP4A 4CQCA 1XLLA 3QYSA 1HP4A 2VD9A 1EX5A 2FZ9A 4DAFA 3TEVA 2EPOA 3PTKA 2OZ3A 1LL6A 3NQCA 2SFPA 4YMZA 4AQLA 1O1ZA 1DEDA 3LMYA 1OFQA 1NFBA 4I7UA 1JAEA 1W9VA 2PTYA 1JCNA 4LUTA 2G3JA 1D3CA 2NWRA 3WY1A 2BXVA 1LLZA 3WF1A 4XISA 4JICA 2ZE0A 2WLYA 1XF0A 3W1PA 1PHQA 1TR1A 4ECLA 3WD4A 4MDPA 1EP1A 2VDHA 3ENLA 3CT2A 4GX9A 4L1XA 4GQ0A 4JTKA 1F76A 1XHGA 3EX1A 1HKKA 2YIHA 4F0RA 3VX1A 4LJ3A 1OABA 4UOZA 1ZBVA 2WSPA 2ZX8A 4PR4A 1VFTA 3WH9A 1V02A 5CLWA 3S6OA 3VIFA 3SN0A 4CCEA 2OQLA 1FRBA 2OYMA 3U5UA 4O11A 3ABOA 3ME3A 3ANUA 1HKVA 2RUSA 3SURA 3ZR4A 4R9OA 3CH0A 2UY4A 3NYDA 3IANA 1SMAA 3VDHA 1M41A 4D6IA 4IMCA 3ZVIA 1ONEA 1UZDA 3BOFA 1ZSXA 4LCRA 1YNYA 2GPTA 1X1ZA 2OEMA 2VOMA 3APTA 5B80A 1ZY9A 5G1MA 2PUZA 2Z28A 4MSSA 1K9EA 1F3TA 3B0XA 4Z2KA 2BGNE 5G4WA 4RR4A 1VHNA 3N04A 4HOZA 3SO7A 3LUTA 3UR8A 3MT1A 4AIOA 4DQWA 4A3RA 1XIMA 1RD5A 1BGGA 2VFHA 3G0XA 4U28A 1BXNA 3G1AA 4IWWA 3F03K 3MDWA 2DP3A 1SO4A 7TAAA 4BA0A 3UF9A 5A6BD 3YPIA 2J77A 3TN6A 3G0SA 3THDA 2WMHA 3I65A 1ZJIA 3AYRA 3TN4A 2GGJA 3ONCA 2VCCA 1OM0A 2X09A 1OK6A 2NXHA 2FB3A 3WBXA 1B30A 3L65A 3TOPA 2E77A 1PSCA 1YRRA 2ZZ3A 4JTFA 1G4SA 3AS1A 2B31A 1XC4A 1HJXA 1R86A 4FNTA 3UJSA 3WNNA 2H8XA 2VURA 3PUEA 3RF9A 4IMEA 4O15A 1CXIA 3MW7A 1JR1A 5CG0A 1OFOA 4QAIA 1TVPA 4I6KA 1TR9A 4KWWA 4LEFA 3FW6A 4HK6A 4LBRA 2XPKA 5K9XA 4N7QA 3B8WA 2ZZ1A 2BODX 1PX8A 1KM0A 5A8NA 4UTWA 4XKMA 4EXAA 1UOZA 3N2MA 1MEHA 3VC5A 3ORWA 4BCEA 4D8ZA 3G77A 1RK6A 2OQYA 4IM4A 3V16A 2GDUA 4GXWA 3UD6A 4JTJA 4RV3A 4XK2A 1H0GA 4S3JA 2FYMA 2YXXA 4GA8A 1PKMA 3MUCA 3DFYA 4MWAB 2EG6A 1OX5A 1T40A 3GSMA 1UMLA 2QEZA 3T2QA 4M29A 2OFJA 2ZKMX 1ZBCA 2VELA 5D2XA 2XZ9A 3N9SA 4UZSA 1UH2A 4RDVA 4C65A 3TKFA 3S4TA 1VBRA 4AIEA 4JKMA 4DI9A 4OOZA 1R30A 4FF7A 2XN1A 1EC9A 1AZ2A 2QNEA 4ZO9A 1CPUA 3WIJA 5A8QA 1YW1A 3G2GA 3WDHA 3TN3A 1WUFA 1A5CA 1H7NA 3HF3A 1SW0A 3WLRA 4PMOA 1XRTA 2YA2A 1GJUA 3GTFA 3TAOA 4PFHA 2TSYA 2VWTA 2GDQA 4L61A 1PB0A 3QJAA 1P1MA 1UHVA 3M4HA 4AAJA 1B4EA 2FGZA 3CT7A 2NWSA 3EBVA 1XLCA 3V7PA 1KM1A 4MFEA 4U4MA 4O0KA 2V2HA 3S42A 1K6AA 3NL6A 3KDNA 3CPGA 5CLTA 5CZSA 1VHCA 3S47A 3IAPA 3MP5A 3VNMA 3UYIA 3RJXA 5ABTA 3S9IA 4LUIA 1UWUA 3O3RA 1S2WA 2F6UA 3PAJA 1E6NA 5AC6A 5D2VA 3I3DA 2D2HA 1KFBA 3LSBA 4RDWA 3VOCA 2CBUA 4JFWA 3VI2A 3VOJA 3WJWA 1M68A 5C9WA 2QPUA 4E4UA 3PBUA 2VGFA 1Q66A 3W2MA 1DVJA 4PCSA 3F2CA 1C93A 5H2ZA 4TTGA 1F07A 2WMJA 1S2TA 2C14A 1UUMA 3KRZA 3FHQA 4HA1A 3KCJA 1O5XA 4IG2B 2QIIA 4PA8A 1T96A 4JHMA 3W3OA 3PS7A 1ZBWA 1UASA 4ZSUA 1ELSA 1U83A 2GJXA 4PMJA 3LLDA 2PRHA 5E09A 2D22A 4MTVA 1F3XA 1S2CA 4QEEA 1LRTA 3FVDA 4Q3MA 5BYWA 4RE4A 4BEUA 2PC8A 1O94A 3IVUA 4S3KA 3M47A 3ZJ6A 5A8MA 1GKRA 2W63A 2J24A 5FL0A 2PDIA 1P7TA 3GG8A 2VFIA 4BI5A 1SSDA 4R27A 2J7CA 4G6CA 1R7AA 4HTBA 2V30A 2DDXA 1FHDA 3FJ4A 4NI8A 4AU0A 1ZPTA 2VWSA 3B0UX 2JK2A 3BV7A 3G1XA 1UZHA 1V3HA 3EEGA 3MS8A 3EWUA 4FMVA 3RU8X 1H41A 3WQDA 3C2OA 3C52A 1W5MA 5IBXA 1E15A 4HP5A 4D1IA 2FZNA 3N19B 1LORA 3O05A 3POCA 1DWIM 3GXDA 4HNVA 3E5PA 3TAKA 3EDDA 3FA5A 2VYOA 3BLFA 1JJKA 1KV8A 1XC6A 1K03A 1US3A 3W84A 1GVEA 2VVNA 3AXMA 3G8RA 1PCKA 5AYXA 1MWOA 1G4EA 2PLKA 1ITXA 5FJUA 2QGYA 2XUCA 1YBQB 4IUGA 3DFNA 4LQ1A 4DWDA 1FQ0A 3MU7A 4JYDA 3URQA 3E0IA 2AL1A 4IIBA 1KV5A 3I4KA 1HVQA 4J3UA 1R2TA 4QX4A 4O19A 3ABXA 5HUPA 4AIBA 4QLKA 1UD3A 1E6RA 3GHRA 1SFSA 1V0KA 1OC6A 2Z1VA 3L4VA 1ME8A 2VDIA 3U2CA 2XM2A 3ZIZA 4ZO8A 3MHGA 3SJ3A 4DJFA 2POZA 2HSAA 3GU9A 3WFZA 3R0DA 3CIWA 4XZMX 3LNPA 3JZUA 3MTWA 3A3HA 3W87A 1N82A 3GXMA 1EZWA 3UCDA 3W75A 4BQ5A 3CUIA 2OEKA 3RLGA 4ZBCA 1KB3A 4UZUA 1LL4A 4Q8MA 1KFWA 2YBVA 3MMTA 4WZHA 4WHBA 3NQEA 3L4UA 3T2OA 3EDKA 4E8CA 4MLRA 3SM0A 4BHYA 2A1YA 2BSLA 3GR4A 2Q8ZA 4EF9A 1BVWA 5F2GA 1TPVA 1B3YA 1IEQA 1QW7A 3OBAA 4JTHA 2JGQA 3PANA 1A3XA 3CAWA 1V7YA 2F9RA 2P76A 1FDZA 2VXNA 3G1FA 1TQJA 3MBDA 1IT0A 5AHEA 4AUBA 2ALDA 4D6HA 3GFZA 3HOJA 4M80A 1KM3A 3LB0A 1R2SA 4UR8A 4OBTA 4UNLA 3RUBL 4WF7A 5CSUA 4DUXA 2RDXA 4AF0B 1N8IA 4KQNA 4M8UA 1Q63A 1K8ZA 2B7PA 4K38A 2FHBA 3OOQA 2BVTA 2IPWA 2E28A 2GQ3A 4UTTA 4QISA 4LYPA 3VD5A 5CC5A 1ADDA 3CIXA 4ZFMA 1UR1A 4LVFA 3ZM8A 4YU1A 1GHRA 2UY5A 2INZA 3B05A 3UXIA 1S1RA 1Q6EA 2WMFA 3N6QA 1O95A 4FZIA 4IOTA 1NELA 4AZ7A 2Q8XA 3PPFA 1DQWA 4Y9NA 1U5HA 2BHUA 2OT0A 1C8QA 2I57A 2G4FA 3UG5A 2XSAA 4KEMA 1V5XA 1W5PA 4WCJA 3GNDA 1YPIA 1AODA 1ZLPA 2CYGA 4JDYA 4ORMA 3URAA 2H3DA 4DELA 3AO0A 2PP0A 4NAEB 5LHFA 3WLSA 3LGDA 4Q4MA 2BOEX 1V03A 3WLJA 2C1IA 2PDPA 1G4PA 4DLMA 2GSEA 1UD8A 3GX9A 5FESA 1RD6A 1H2JA 1HL9A 2PRLA 4BWLC 1NP0A 2XN0A 4NKCA 4G7EA 3DBPA 3W07A 5C7VA 3BW2A 1KLYA 4FP1A 4H6EA 2GUUA 1KFLA 1XH0A 1JQVA 2C6QA 4FXJA 2YCEA 2E3ZA 3QOMA 3FLUA 4ZOEA 1IEVA 1VCGA 2DH3A 2ESCA 3WLIA 4UNKA 4P7NA 1W37A 1W8SA 1F74A 3UETA 3SCTA 4GIYA 1E71M 4NU7A 1WAUA 3SI9A 2DSKA 3QPEA 3FA3A 3N14A 1DBTA 3LZ3A 2G3MA 3E74A 2PLJA 4IIFA 4NJIA 2V2CA 3R1ZA 4QG6A 3H22A 2J8GA 1AL7A 3UJEA 3NQ6A 3L4XA 1XDJA 7REQB 3C2RA 5I24A 1OX4A 3VDGA 1MUWA 4K7YA 2D24A 5HR7A 3MHFA 4V28A 5LZLA 1E1FA 2CU0A 4PMXA 3B40A 4DZAA 2V8ZA 3UXAA 2O7QA 2YW3A 4R7WA 2MNRA 3FJLA 1UB3A 4JGDA 2OB3A 2X8RA 4OKDA 4AZCB 4A3YA 1KBBA 1IF2A 4XG1A 3QEZA 4URIA 5D2WA 4JX5A 1R9YA 1TTPA 3E02A 1IZJA 3GB6A 3GDRA 3WDJA 4QNEA 3BZJA 5T91A 4CN4A 1TFVA 1LRQA 3H2OA 1VIZA 3A9IA 4XB3A 2V3GA 2JBMA 3PULA 1EDTA 2YFNA 1O66A 1VFFA 1DXFA 5GNYA 2WB5A 2DFAA 4KCWA 2R8WA 3PJXA 5CKSA 2VI0A 4LC8A 1EDGA 2PDQA 4EPBC 4JNZA 2PDGA 3WUBA 4PSRA 3M5ZA 4GVGA 1FWFC 3C2EA 1KFCA 1V3MA 4YCOA 3G1RA 3KBSA 4PZVA 1ZJHA 1BWVA 2DUXA 5I2UA 3TVAA 4B5TA 4TX9A 3V1PA 1JVNA 3AHYA 2Q09A 3UXKA 2DT1A 4H04A 3HBLA 4AMCA 1ZAJA 3LG3A 2DZXA 3ZVHA 3S2LA 3ZLHA 3A23A 4GH1A 3QQ1A 4KIRA 4WKHA 1XGZA 1QCWA 2R1NA 1CI1A 2QMKA 4ICMA 5D03A 5E9AA 4KBXA 1XYAA 4X22A 3TTQA 3IRDA 2PGRA 2RJHA 4C6FA 1QXLA 4PN2A 5A6MA 3PWAA 1QO2A 1G94A 3N2TA 1RLDA 1GQKA 3VUSA 4PL1A 4J1OA 3BSGA 4V1YA 5EMKA 1BQCA 1DJIA 3WJYA 4ZEPA 2Z7KA 3T4WA 3K8LA 3CZ8A 1XDMA 3EKGA 3BQ5A 2HNEA 4GFIA 1K02A 4XD4A 2FJUB 3UWWA 4POCA 2C18A 4JOMA 3A24A 2O4QA 4G7FA 5MKGB 1WZMA 2PWDA 1SO3A 1H60A 3WQCA 3W7DA 3B3DA 3VNLA 2DQXA 2NVCA 5L6UA 1VAHA 1W3TA 2YLAA 1RQBA 5DT7A 1NF7A 1MEIA 3ARPA 1EHAA 2R1PA 2JKEA 2TODA 3SUSA 3VNIA 3UZXA 4JCMA 5F2IA 4A2SA 2A7NA 1VCVA 4Q7BA 4MB5A 4PBFA 1ITQA 4IT1A 1MNSA 4A3UA 3N4FA 3GXFA 1JZ2A 3S6TA 2NXIA 1JEZA 1DIDA 4DYJA 2F2HA 1TJPA 3T05A 5FKYA 2Y7EA 3RMJA 1QNSA 5EMUA 1I8JA 4L56A 2EPNA 5DXXA 1W6TA 2RAGA 1VP5A 5FF4A 3XIMA 3SQSA 1A49A 3VD7A 1KTCA 2WWDA 3GIYA 2H3BA 4GISA 3UPWA 4X9SA 2H6RA 1CLVA 2XH7A 1BRLA 3KBMA 4HSNA 1LBMA 1DE5A 2NQLA 2XFRA 1OCNA 3UJRA 4NJHA 1V3IA 1R2RA 4BQ4A 3OVRA 4ADUA 1HP5A 1WX0A 4W87A 1RCQA 1X39A 1XGDA 4DBEA 5SWUA 1JDFA 3W83A 4ZODA 1Q45A 2REQA 3S2NA 2CZVA 4C5YA 4JTGA 4NY2A 1W3KA 2YZRA 4KPLA 4F2BA 2GUYA 1DHKA 4J4KA 1H7XA 1EB3A 4CVUA 3S0CA 1VBHA 1Q6OA 4GUFA 1HO4A 3GLCA 2X2YA 5CJMA 3ES8A 1QW9A 1UZ1A 1JZ6A 1FVPA 3VD4A 2YSWA 4AD1A 4JBRA 3IIPA 3LTPA 1W3LA 4NAFB 2ON3A 5A69A 4MUZA 4XSMA 3VKKA 2G8ZA 3ABZA 1E1CA 5D9MA 2W79A 1Q4NX 2FTPA 2ZQ0A 1ZNNA 1TV5A 1UIOA 4J9JA 3OJGA 3S6DA 4UR9A 1EIBA 2O56A 2RDWA 4G56A 3QF0A 5CAKA 4QDPA 5KZEA 3MDUA 1WDWA 2WOQA 4LOCA 3W02A 1J01A 2DSVA 4S3AA 1XPGA 2NV2A 3L2MA 2PU1A 3NWRA 4IQLA 3CGTA 1DJNA 3S1XA 3DI0A 3ITLA 3G1HA 3GBEA 4TO8A 3BSHA 5AYBA 4LTSA 2W4XA 4WIWA 4BY3A 3VKBA 5BU6A 5DCDA 1FY6A 3HU7A 1IHIA 3BPWA 2OQHA 3ZJ8A 5A2AA 5FF3A 3FDGA 2GVJA 1SVDA 1OHLA 4LV9A 2X40A 1T8XA 2JALA 1H3GA 2PWGA 1YEYA 4ZTXA 3Q94A 4YCPA 5HA7A 5CPMA 1KXHA 1S2AA 4ICCX 1EF2A 2PTZA 1FWTA 4IPNB 1HKWA 5CGQA 1VS1A 2E5CA 2A7RA 1XJBA 2Y4SA 3UBPC 4C7GA 1FP9A 4ILSA 4MNKA 3T8LA 4EXQA 1YXCA 3UPBA 3CMFA 3V0TA 4C6CA 2KX9A 3FKKA 1KBKA 1GEHA 3E0WA 2CLKA 3WBWA 2B7QA 3TC7A 2Z24A 4HNCA 5C2XA 3P74A 1BEUA 1I9CB 2WBKA 1O7AA 2PD5A 2EGZA 3AHVA 5ENLA 1R8LA 3QW4B 4L5ZA 1SJDA 4L9ZA 4A8RA 3F4DA 3PB0A 3JS3A 1JXKA 4ZR8A 3C5QA 3O6CA 3EMZA 3HGRA 3II1A 1GZJA 2OZTA 5HMSA 3R10A 4XUYA 3WLLA 4GPNA 3AIEA 1AQMA 4C6IA 6ENLA 4PMNA 3LA4A 1RAKA 2ZTKA 4GCAA 2D23A 1E0VA 3GW0A 1HW6A 4GUJA 1ISWA 1T5AA 2Y63A 3XINA 4C7FA 3BC9A 4UMCA 5BOEA 4XAYA 2ZUNA 3TMQA 3LQGA 1EXBA 1CX9A 3TSMA 4I5RA 4ZVJA 3JW7A 4CCZA 1OFDA 1IZCA 1OCJA 2QCLA 3N73A 4AHOA 2VZTA 4UXDA 3V75A 3TYDA 1DYSA 1ICQA 4NZFA 4V2XA 5HJXA 2V5LA 4FX8A 3OB8A 2R24A 4HHLA 1KWKA 1B3ZA 3QGAC 1FDJA 3BSMA 9XIAA 1F5ZA 1W1YA 1KCXA 4IL2A 4MJ2A 4PBEA 1RJPA 1IEXA 3THQA 4KWSA 4GUHA 3TTYA 2UY2A 4HVXA 4A2RA 2DUAA 3PNUA 3SCVA 1ZJAA 5CGMA 2INEA 1J4EA 3W70A 4HU0A 3STEA 4RNIA 4WLCA 2OLSA 1OWQA 3HG3A 1VEPA 2X1IA 4GKTA 4OGZA 3NM1A 4OQVA 4AB4A 3OEXA 1K6WA 2DT2A 4XAPA 3GDMA 4JS3A 1NEYA 4S3FA 3GAKA 2WC4A 4LWWA 4C6NA 1JIBA 3GFXA 3E2VA 4H9UA 5I03A 2A7PA 1JPMA 4DBSA 2YXOA 5G2IA 2PDXA 3KEHA 4CNOA 3LTSA 1NOFA 4EAYA 1IGWA 5AC8A 2FH8A 1TPB1 2Z1SA 5LNVA 2G4JA 4F79A 1A5AA 3VU2A 3IWPA 4Q8QA 3URBA 3MCOA 1TPWA 2JEPA 2OCZA 3FCPA 2YW4A 3A21A 3LHUA 2BP1A 2CLFA 1QI4A 4HCDA 4JZ5A 3VZYA 2UY3A 1BWLA 2XISA 4IGNA 3UZYA 4YVPA 6XIAA 3BW3A 2EQDA 1XFCA 4O57A 3RG6A 4QE4A 1SGJA 1Z41A 4ZMGA 1E5JA 2PODA 3RXZA 4IX2A 5H91A 4ACZA 2YX0A 1C7SA 1UPMB 4QXIA 8A3HA 2Z6JA 2WVUA 6CGTA 3A4WA 4JFSA 4N0RA 8XIMA 4O0ZA 3F4WA 5FJPA 4LYRA 1KWGA 1MW1A 4REQA 1ECEA 3PZIA 2IPFA 2G3IA 5KSWA 3IARA 4FR6A 2NW0A 3CU2A 5E93A 4ORIA 1JQXA 2QCGA 2PBOA 1WYIA 2HBXA 1XL9A 4P5UA 1HF6A 1A5MC 3VGBA 1XKJA 2YPIA 1U1HA 1XIJA 3M0VA 1HGYA 1HO1A 1Q13A 3SEPA 1YYAA 4TVDA 4WVXA 1ZRQA 2CLOA 3TXVA 1TO3A 1MXSA 2H90A 1ALDA 3L0GA 4RXFA 4NHVA 2QV5A 5DELA 2OVLA 3MMUA 4NX0A 2BXYA 1KGWA 3NURA 4ADTA 4Z0SA 4Z2HA 1H1YA 4A8LA 3T44A 3RM9A 3OG3A 4Q33A 1E6ZA 4I9JA 1JZ4A 4RE3A 4DXVA 2B81A 4M6UA 4HPGA 4NZ5A 1QPQA 3IGHX 3L23A 3T40A 1DWAM 1M01A 4PRWA 3TYZA 3T4CA 1NAL1 1H49A 4BK9A 1EZ2A 1QW8A 3WDPP 1TQXA 4DZ5A 2PFHA 3VUPA 1Q6LA 3LTYA 4HCHA 3B9EA 3P3BA 1TCMA 1FA2A 2YCIX 4CKQA 5D38A 1XYZA 2GGEA 4UR7A 4CD6A 2HROA 3TE9A 3TC6A 1LYXA 3SB0A 2QLYA 3H53A 2VR5A 3DDMA 4B4HA 3DG7A 3IV8A 1EPVA 1NP2A 3T09A 1IE7C 5F1UA 5FF7A 2YBUA 1NJJA 3ITOA 4CU8A 3ECQA 1RLCL 3EGJA 1Q3NA 3CL7A 1R87A 2QCNA 3D47A 3TTSA 2TAAA 4PMUA 1HKIA 4HZ6A 3K8KA 4KH2A 4PC8A 3T55A 3CHEA 3NFUA 1NF0A 2W66A 3O16A 2D3LA 1PIFA 4K36A 2FMNA 3ZLFA 3DYMA 3OA5A 2OLAA 4N9BA 3VNZA 3IEBA 4ZQNA 1E51A 3LV5A 4XO7A 3KTSA 3E5BA 3V5FA 2FFIA 1FP8A 3ZLGA 2XVLA 1IWPA 1A5UA 3CV6A 1MW2A 3PVFA 3STPA 3K4WA 1KTNA 2ADAA 4H9YA 2VEMA 4MB1A 4JAWA 3GNNA 1QUMA 7TIMA 1M53A 4IGMA 4L65A 2HWGA 2BY1A 4AVOA 2ZC1A 4P7LA 4QLLA 3LLFA 2QJMA 1RA0A 4IHCA 1FWAC 1SFLA 1GW1A 4K7VA 1U22A 3KBNA 1K4HA 1HN1A 4KCVA 3AYVA 3QR0A 4GG9A 3LHZA 1SM9A 3WK0A 1Z89A 3RYSA 1QO5A 2ZZ2A 3K1GA 3ZYZA 3PZNA 3BUVA 3GBDA 6REQA 4QG9A 4KS0A 3QBUA 1P6BA 4MNJA 4UTKA 4J2MA 2FDSA 2I7GA 2QCMA 3EX2A 3H6OA 1VRDA 1X98A 3QH2A 3NDYA 1DL3A 4JTQA 4CN1A 5LNRA 1R9XA 3M43A 4FB7A 1E73M 4OFCA 4QQUA 3CAVA 1KR1A 2YDQA 1X7FA 5HATA 5HQLA 1MUCA 1P1XA 2J47A 5FAGA 3APYA 5H8MA 3U0HA 4IIHA 3ABRA 1K9DA 3SGZA 4EXBA 3W86A 4J3XA 2NLYA 4I5XA 3W1LA 4DO6A 2YL8A 3OLDA 3VMOA 3R7MA 2QDHA 1DKWA 2WZIA 3TN5A 2WM1A 4Q7IA 1AZ1A 1OGSA 3I3BA 4XKYB 1W2PA 4FOUA 2XFWA 3PFMA 1AK5A 4W5ZA 3W73A 1KBLA 1O5QA 2EPKX 3DIPA 3VNJA 2F8QA 7XIMA 3PY2A 1XR2A 2ACUA 5F4WA 5BROA 2YCLA 3WFAA 5AYIA 3OODA 4DEFA 1OFRA 1JCTA 1MDLA 4O8AA 1G7UA 3ATYA 2IKJA 4H2HA 2PURA 1PKYA 2ABBA 1IIGA 2J8FA 3O6YX 3UNTA 3P93A 1VZWA 3NQ7A 1JUKA 1XIDA 4M7TA 2R6OA 4UTWC 2GWGA 2PP3A 4IPIA 4GJJA 2QXWA 4H9MA 4U3AA 3LV6A 3KL0A 4UTHA 3DFTA 5J5RA 1ME9A 3E0LA 3HMCA 2ZTJA 3LEPA 4QP0A 4WOQA 2KZHA 5DY3A 2J6VA 2A3LA 1J0YA 1LDCA 4Z0JA 3PNZA 4DNHA 5A6AA 4X9YA 5REQB 1SJAA 2C3ZA 3E0VA 5EBAA 2J74A 1JYNA 2HE5A 2VDGA 1TRDA 3VMPA 1F7BA 1H5VA 2X1SA 4FXSA 4RZ6A 4E0CA 3VOGA 4NYUA 4BF5A 2NSOA 1AD4A 1H61A 1GNXA 1MW0A 4NP7A 4ZQCA 3SW6A 2ZA2A 1CENA 2PDLA 4FF5A 3W26A 3SCWA 1DQXA 1F6YA 3DHFA 2NQJA 3A4XA 1XIEA 2J27A 5LXXA 1KQYA 4H9TA 2ATMA 4HHPA 4X60A 4UFIA 4H7VA 5F7UA 4IQDA 1Q6DA 3CQJA 4GY1A 3ID7A 2C71A 3SCUA 4C1LA 1HXJA 4LVBA 2BG5A 1XDLA 4HYRA 3MZ2A 3WQVA 1I2QA 2XIOA 2FMOA 4X2PA 5EKYA 1MI3A 3O7UA 4L64A 3G3MA 4KCUA 3BMXA 3CTTA 3GO2A 1TCDA 2PWFA 3L0KA 2CESA 2DQWA 4AHPA 3AOFA 5FF2A 4NJJA 1V7AA 2CW6A 1XIBA 4PRTA 3N9RA 1BPLB 1PEZA 5FSEC 2J9XA 2BVDA 3N6JA 3QV8A 5TD4A 5M17A 3EOOA 1SFTA 4R85A 1NH6A 2ZXQA 4FSAA 1QU4A 3TNOA 4Z2GA 4PMQA 1WDPA 5CZ0A 1RALA 4AH7A 5LSMA 4GVIA 5JIPA 3SAZA 4LVDA 2I14A 3EPMA 3TA6A 1FUYA 3EOUA 2PWHA 4X0NA 4DX3A 2NVAA 6PTDA 2NSXA 4GBUA 4P8WA 3GR8A 3AIVA 3BGAA 3KBJA