1ZPLA

E. coli f17a-g lectin domain complex with glcnac(beta1-o)me
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
176
structure length
168
Chain Sequence
AVSFIGSTENDVGPSLGSYSRNLPFVYTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of natural variation in bacterial F17G adhesins on crystallization behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords F17a-G
total genus 42
structure length 168
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1zplA00
3F6JA 1ZPLA 1O9WA 1ZK5A 1O9VA 3F64A 4K0OA 3FFOA 1O9ZA 1OIOA 2BSBA 2BSCA 2BS71 2BS8A
chains in the Genus database with same CATH superfamily
3MA9H 1MQKH 3HTLX 4ALAC 3F3HA 4DVRL 3SJVA 3G6AB 4EN2A 1DBBL 1HXYB 2L3BA 5D1ZD 4FRWA 2CLZB 4R4BB 2XIBA 4G8IA 4PN6A 4WWID 1DJZA 2IWEA 3M88A 2R59A 3SE3C 3MJ9L 3NQKA 4L1HA 5G2NA 2ESVA 4LHUA 4MAUH 5FGBC 5J6GB 3CLEH 3C6LD 3QHFL 3HCVB 3FUDA 4BH7B 4MCYB 5CIPA 1U8NB 5FM8A 1FG2B 4QNPE 5KBKA 5JNYA 3GBMH 1IM9D 1EFQA 3LRMA 1C12A 4M93C 4OZHB 1U2CA 5MHSE 5EN2A 1TPXB 1JRHL 3BT0A 1M71A 3KL3A 3CFIC 4R7NB 5ABAA 1G87A 1EA9C 2IOMA 1HHIA 2KS0A 3K80A 4JCLA 4LVHC 4PS4H 5JPNB 5H4YA 4DQOH 1QSEB 3NJMA 2VSMB 1HYSD 4WNQA 3MFFA 4OF7A 4PGEA 1YYML 3MXVH 3QORC 4DP0X 5I1GL 1LWHA 2BSTA 5T3ZL 2HKAA 1NIDA 2Z31D 4X6DF 4E42B 3DMMB 5J5EA 1DBMH 1VACB 2DWTA 1E7VA 2F7RA 3HG1B 2YUWA 3TCTA 5I9QC 2FO1A 3G04A 2X40A 4J3BA 4RMSA 2H0FA 2PWDA 3M86A 4GFXA 2XWJA 5FECB 3AAZA 1F11A 1O0VA 2J2ZB 5KYYA 4M7ZC 4FQLH 3C8KB 2VXSL 4OZ4B 3THML 2IFFH 3ZTCC 1ROCA 1WZAA 3BUTA 4UZUA 1FSKC 1NM4A 35C8L 1PDKA 3EO1B 4N9GB 1B4JL 4V33A 3KPRB 4XC1H 2NW2A 1P7KA 5ELIA 5I0WA 2R0LL 2FECI 2GEEA 2K8QA 4W4OA 1YQ2A 3W9DB 1RPUA 2EKSA 3TCLB 2APXA 3N3EA 4PV9B 1YC8A 4Z3GA 1A4JB 1FNGA 2YD5A 3WLWC 3VW3L 2OYMA 1IC4L 4GI8A 3KWTA 1XCTB 1IM3B 1ZE3C 2JV6A 2OTPA 3ZUNC 4EMZA 2R51A 4F57L 1TZGH 4ELDA 3F5WA 4KXZH 4KWUA 3F6JA 2IGTA 1WYJA 4X8JA 2H47C 5ISZB 5IB1B 2OTWA 4A7QA 4M6NL 3QNZB 4O2EB 1OP3H 3EHBB 5PAZA 2VJ8A 3MYZA 5FOBA 1WWCA 4G3YL 1D5ZA 4OGXH 4P5MA 2OSLA 3LKPA 4PUBH 1S7SB 1GPOH 1HL4A 3Q2NA 4HWZB 4AUUA 3QUXA 5MEQB 2V5RA 3W37A 3NG5A 2YXFA 1G5AA 1MUJA 2QSQA 5E6YA 1U8HA 3EBGA 2YMOA 2H41A 4DT2A 2Y2WA 4NCC2 5HJ3B 5MEPB 4HCGA 1HWWA 1N6UA 3H9HB 4CA4A 3DUSA 2F1BA 4DPCX 1U3HC 3GB7B 1VIWA 4OJYA 1H3TA 5AAWC 3W5MA 3ULVL 3RDTC 1F3JB 3BAEH 1IBGH 2Y3NA 3GMQA 5T5NF 2UY6B 1AS6A 1QEWA 1H0DA 4ZZKA 2EDMA 2I24N 5TK2A 3V4LA 1LO2H 1GH7A 5EC1B 3DX9A 2R0KH 3T8XB 2YZ1A 3V6ZA 2XPGB 2EEDA 5E1AA 2J88L 3UYRL 4HUXA 1ITCA 4AVIA 4YE4H 2AV7A 2XYCA 3MCKA 4UIKL 1FAIH 2OZ4A 3QIUC 4MS6A 1JHTB 3QIUD 3TBWA 2AERT 4ONHA 4JY5H 3FO0H 2IDUA 4YDIH 3SE6A 1L7IL 2CJ3A 1EV2E 4LKCA 4DCQB 1YHPA 5JHLA 4BSVB 2ATKA 2CHXA 2FIKA 4XXWC 2A0LC 3F83A 4PJHF 4OGYL 3L54A 3COOA 4N1CA 1S7SA 1GGTA 3WGUB 2OQJB 1ADWA 1KV7A 4NNXB 4OFKA 1QHQA 2B8OT 3NDZE 7PCYA 4YHMH 4FXKC 2YO3A 3V4PB 4J3OC 4YDIL 2EYRA 4JY5L 5C0RH 5LBVA 3TYGL 5I74C 1F11B 3X13B 4LO9A 4MJ5B 2VABB 2KT6A 4QI3A 4IIQC 1SQ2N 2D3NA 4PLJC 5IBLD 3OC5A 2A9AA 3Q2CA 5HDBE 4LSVL 4YSAA 1BX2A 2XUWA 3DMMA 1GYCA 2DF3A 4PTUB 2D7NA 3D87B 1U92A 1FZJB 1RUMH 5KVFL 3EO0A 3RZWA 2ORBH 2ZD0A 4Q0XH 5E6ID 4FKHA 2UX7A 3CVBA 1R3KB 3IJEA 4R2GC 4FYRA 4MA8H 5H35B 1P4BL 2C9XA 4H0LC 1Y1DA 5GISH 3SDXA 4M6ML 4WTWA 3ZL1A 4P5TB 4RSVA 3PGDB 2BNRA 3AS1A 4C4BA 4PJ7B 1L9SA 2NTFA 2OYPA 4KV5F 4MA3A 3GJFK 1PLBA 5C9JA 3FUJA 1W72H 2BH0A 4JZJB 1RIHH 5LGHL 3MJ7B 1SYSA 4RIRB 4OKVA 3KJ6L 1JERA 4K0OA 2GI7A 3MJWA 3OJMB 4PSRA 4FQ1L 5C0CE 4Z6AT 4JL2A 3L3OC 3VXNB 5IB5B 4PVNA 5EORL 3G9VA 2FT8A 5CIPB 2YOAA 3O3EB 5HP5A 3PHSA 1ADQH 4NNPH 3GSUB 4YZFE 4MA1C 4FQIL 1TJGL 4JRWA 2BOLA 2DYPB 3ARFC 3TA3A 3KW7A 5IROA 1CIDA 3U7WH 2JJVA 1CGXA 4AM0B 3UTTA 4L5FH 4JQVA 1JGIA 3MSPA 4R7NA 1I1YA 2KI6A 5KOMC 3V0IA 1W9XA 3QDJE 3AITA 4JEGB 1S7VB 1MHPH 5KJRH 3DX3A 3HPJB 1EJOH 2WQAA 4HKXA 2OSLB 3LKPB 3WBDA 1WA0X 2HVJB 2K6WA 4YXKH 2WV3A 2Y1VA 3KPOB 4OJFL 3D85A 1U3HB 1J10A 1IFHL 2IAAC 3MCLL 5IB1A 3EJSA 2OX5B 4MCYA 5FYLD 1DDHA 3BE1L 4ONFH 2VRKA 3VB8A 4P3CH 2WUCL 3VXSE 4H0GA 3FOLB 1JCKA 3R4RA 3QIUB 1RLWA 3NCYS 5FUOL 1IGIL 5IHHA 2XKNA 5GRZA 3V6ZB 3O8XC 1F41A 4FQXD 5EOTA 2IFFL 2H6UA 1A4KA 3IGAB 2DLGA 2AZAA 3FU7A 1CDUA 2HVJA 4Q56A 4JN1L 5CCKH 4PJBE 2AJ3B 3SKNB 3DURA 1D3CA 1DYZA 1JGLL 1FZOB 1QSFA 3HFMH 1FYTD 2ZF8A 2UUDK 3P30H 4X2UA 5C0AB 3V5KA 2N0MA 2DEWX 4MFHA 1T6VN 5FV2A 3W0WE 3V4PH 5FV1L 4RA3A 1MFCL 5FUZH 4KXAA 3QZWB 2HH0L 4A6YH 1TQUA 1ILUA 4RQQB 1BM3L 2FTAA 3O81A 3PWLB 4Y19A 5D2NC 3FTYA 2DH2A 2OCCB 3O9WB 3AROA 1BD2D 4KGLA 3T0EC 3DBXB 1M1XB 2VDNL 1INQB 3SO3C 1QBMH 3MPCA 2XWJB 2YHGA 4BJLA 4JHVA 3ARFA 4F7KA 5JORB 3SJVE 3WSQH 3JTSB 5FHBH 1A6WH 4MXVF 4YHOL 1T1WA 2VXQL 2NTFB 1YC7A 3ZT6A 4GRLC 5JR1H 5KSAC 5HHOB 4YDJB 3MFGB 4I9XA 3E1ZA 2R2BB 3UAFA 2EXSA 4PJ7E 4S1DC 3V8CA 4E2OA 4UF7C 2NY6B 3D50A 1UURA 1SHMA 1U8CA 4DN3H 3GPSA 2LLGA 2GC4C 4J23A 4NQCE 4UQ9A 3DETC 4JZJC 4HOZA 2FLBT 1MAML 4ZTPH 5CIPH 3HCVA 1X7TA 1NMBL 1JD9A 1YY8A 3C5SB 3OV6A 5DTFB 5BW7C 5LUMA 3GSXB 3DRQA 3W9EA 2C9UA 5CD3A 3BP5B 4OZGF 4PJGE 4QHNB 4X5RA 3VFUA 3VGDA 3JQOB 3M07A 2J43A 4TNWK 2G3NA 4I7ZC 3OKEB 4XCYB 3L9RA 2XNAB 4U7MA 4Y9EA 3T08A 3I2CH 4GSDH 4PJHA 2HKFH 2C3GA 2ROXA 5E2WH 1Y6KR 2MNWA 4C59B 4FNLH 3SGKA 3ZE1E 5EU4A 1KOAA 5BVPL 2FX7H 2PABA 3CXHJ 3GSQA 3RX9A 3APFA 3DTXB 2WKOA 3LPPA 5E8OB 1Z0NA 3NDYE 3HE6D 2KH2B 5GS1B 5G4MA 4N2LA 1SLVA 3O2DA 3CDZA 5L6YH 4KY2A 4L4VB 2YJLA 3GEFA 1T7ZA 3FFDA 3CLFL 1OOWA 4OLEA 5DZPA 3N85H 2VC2H 1JBJA 3IDMA 4HUCA 4FYTA 2OMZA 3K3QA 3OB8A 5B3SB 3MRLA 3MJ6A 5F7KC 4WHTB 1SJMA 2I9LA 1UXLA 2J44A 1AGEA 3T6XA 4K9EH 4OKVB 1OY3B 4TKWA 5TF1L 2M83A 2GFBB 3OR7A 4PJ9A 4MAYD 4TNVK 1FI8C 4J3OH 5HVGB 5JIMA 1KENL 3IF1B 3M6DA 1LK2B 5EC1A 3TM6A 3U4BL 2VRAA 2DQTL 5C0AE 4KJQD 4KVCL 4DP9X 3BH4A 1UC6A 1CGYA 3I02B 4RMTA 4BUQA 4APQB 2I26N 2XY2A 4WTXA 4WEBL 1CD8A 2YPLE 4WV1C 2EXWC 1UA6L 4XBEL 3P2TA 3RVVC 7FABH 3AXIA 2BWQA 3F85A 3LVEA 2ZXAA 4FYSA 1BX2B 1DQMH 4IKJA 5D7JB 5LBSL 4ZTOL 1IT9L 3S48A 4QGTA 1XGUB 1GMEA 3CPLB 3QW9A 3Q2WA 3TONA 3ZE0E 1G84A 4FS0A 1F4XH 5JHDD 3ARXA 2EIBA 1SHWA 5L8JB 1KLGA 1WICA 4IRJA 1TKWB 2I25N 4O4YL 4HCRL 1HE7A 2YWYA 1A7BA 1T66C 5I66B 4YPGA 2GYSA 2VWEE 3Q1SH 1MVUA 2NW3B 2ZAGA 1A22B 2A1WH 1BF8A 4GSRA 3TBSA 2GIMA 5ICYA 1WLHA 5SX4I 3RA7L 1HH9A 2GSGB 2F2HA 1DJIA 2SEBB 3BUYB 2HT2D 3U0PB 5AW9B 4D9QE 4WO4B 43C9B 4LLWA 3L5WB 1T1YB 1MZZA 1JNHB 4NERA 5KAQG 3EF4A 2VM9A 1XR8A 1HT6A 2JIXB 1GCFA 1QLRA 4P23D 5IF0B 1FHGA 2X09A 4JHWH 4P46A 1P4LB 1DJGA 4CADA 3K6FA 4N2IA 3RX8A 5CZVH 3DX2A 3KYNA 1XZWA 2P5EE 4H1LH 2Q86B 1BQHG 4MMZA 5E2UL 1LO2L 2QKIC 3K6OA 5E4AA 4MNGA 3BAYA 1PZ3A 1TZIA 1XGTB 4H5SB 3FQUA 3MLVH 4MJ5A 5ETUB 3MACH 2ZONA 3C5ZC 4NOFA 5KVEE 4FQJL 2NUPB 1AQMA 4ZMLA 3IDUA 4DP1X 4OZFA 3D34A 4GKLA 4HCIA 4TSBL 4U31A 4HVBA 2BS9A 2ZZUT 3BPOB 4KKNA 1DE4A 1OKEA 2R1YA 2CNYA 1C5BH 4X80L 2DQTH 4KJYA 4HOMA 5AVUB 5KBLA 2O5XH 4P57A 2PWHA 4LESA 4FA6A 3BAJA 4F92B 3O2WH 1EHNA 2YARA 2GJRA 3ARDD 3NQIA 4M8RA 4QXGL 4N0UE 1CDHA 1XAKA 2E27L 4A66A 4ZRGA 3LRLA 4FG2A 3D07A 4BFOA 3KPPB 4IOFD 1CLVA 2D3LA 4QAWA 4GUPB 2F74A 3N9GL 3L95A 5DZOA 1C08A 1FLTX 4UU9A 1G1KA 1BLIA 2HVKB 2ZOKA 2J1KA 4OLYH 2WBJC 1MF2L 4HUXB 2DEXX 3JVGC 1J12A 3MLVL 2WIIA 1BECA 1DQLH 5F7WC 1AJ7L 4AK2A 1WBXB 2ZWKA 3ABMB 4A2LA 3OKOA 3CZUB 5AOJA 3QEHB 2CO4A 4AH2B 4DFHA 3D52A 5ESQA 2XCMC 5CGYC 5EULV 3JWDH 5I26A 1W72A 3V7AE 3KWXA 1F45A 1JPFB 3FSVA 1QSFE 4JMNA 5CGBA 2Z92B 3DSFL 3K2IA 2YN3A 5D96B 3IE4A 5LGJA 2QKIA 3P73B 4PWIA 4RX4A 1JG9A 1IE4A 3S4SA 1AG6A 4W9GC 3UOAB 2Q9OA 4KKBD 1PX3A 1UA6H 3F12A 3V4UL 4AV5A 4KKZA 1A9EA 1N4XL 1KG0A 1JPGB 1BD2E 5ERWA 3OKNA 5DHVH 3B2UD 4PRDA 3CZSA 5AB9A 1BVZA 1FLRH 1NUGA 2ETWA 5E24E 1OTUD 3MV9D 4M43L 1M9SA 2EC9T 2XWBB 4TUJB 5FYLH 3WDJA 3K8LA 3F7YA 5KEZA 1ZHBB 3C6LC 5C71A 2L7EA 1ZGLM 5T3XE 4M7JL 3PV6B 5I19L 3Q1SL 4Y16B 5KSVB 4NP4L 2VW4A 4K7PY 2D0GA 4H1LB 4I8DA 4YDMA 1EXGA 5DMGC 3C09B 2L0DA 4QO1A 1E6JH 2I60H 3ESVF 3GKZA 3UTPD 1AD0A 1IAIM 3FH8A 3IKCA 1JGVL 4HG4J 2HKHL 1Z9LA 5CZXD 4IRZL 2LW3A 4NN7B 4X9GA 3E9UA 5G55A 3AXLB 1ZS8B 3DPDA 1JPFA 2DMCA 2ARJQ 3FKUS 3FUKA 3RLSA 3NJXA 1IGFH 3WFEL 3S3JA 4GLRI 4L8SC 2AK4A 4PJAF 1E8ZA 2EYSA 1FVEA 4PJHE 2HT2C 1IEHA 1UXSA 2VISB 1U33A 4ECNA 1ZT7A 5EU3A 1NTDA 1F90L 1XX9C 1BBJB 3RDTB 4YLCA 2X2HA 4ILDA 4U4BA 3LOWA 1UZ8A 4LEXH 1MCLA 2WN2A 2HTKC 4OLWL 4XMTA 3WTYA 5B21A 5EUOA 4Z1PA 1GMIA 5IV2B 4I5BB 1HTYA 1A1NB 4HJGB 4OFDA 1UH2A 2B1AL 4OJFH 3NH7L 4LVNB 3U4EB 1GGIH 4KK8C 4N2DA 4CGUB 2VUYA 3QFJE 4ZPTB 5FDWA 4F5CE 2VC2L 4A7UA 4ZUUA 1RZFL 1ZSDA 4XH2B 1IQDB 2G5BA 2WWKO 3I50H 1CCZA 2AQRA 3QC6X 3WUWB 4ANKA 5TJWK 3TASA 4OIFA 4NJAH 1HCVA 3KGUA 5LXGH 2PYEE 3MRDA 2CE6A 3RFZC 3FQNA 1T83C 2JI2A 1WWAX 1NC4A 3RWJB 3S4SG 2CK0L 1BYPA 4L4TD 2OTUA 4OV5A 2IQ9L 3GHPA 3OG4B 1E2ZA 2B1AH 1U41A 2F6AA 5ALBH 4NNPL 2HKFL 2HLEB 4FNUA 3PWNB 5PCYA 4OCYL 4U1LB 4E9QA 4B0MM 1YY9C 4WY7L 1QR1B 2GSIA 4R97C 4AEHH 5EO1B 2CO6B 3BKCH 3M7FB 2EEFA 1WT5A 2JB5L 2VLRA 2DM4A 1YG9A 3NPSC 3U9UB 3WNLA 4P06A 1EHLL 3W39A 3EFDH 4GIOA 3T9WA 1E4KC 5F7UA 4NC1C 4EVNB 4FABL 3UPAA 1NGPH 5A2JH 4HIXL 3A67H 3X12B 1RVFH 4OUOA 4EZJA 3DECA 4N8VA 4P8QA 1G7HB 3VVWA 1RUML 2Z8RA 4TNGA 4WWKB 4BFIA 4XMXA 3ZE1B 5CSZB 3CFDB 5C2BH 1A6WL 3L4UA 1J0HA 4F1ZA 1MCFA 1UCBH 5BRZD 2BSSB 3ERXA 1LP9F 2OMWA 1QBML 2ZWNA 4EUPG 1YMME 4FN0A 1Z9PA 2Z4QA 3QQ3A 3EZ8A 4H40A 3WFZA 4BFIB 4QRSA 1JGUH 1XAUA 5SWSD 4I2XA 3QR0A 1HINL 4BQBA 3UERA 1FYHB 1UGKA 4HJIA 2FDBP 1I1AA 3WE6B 3PDOB 4ODWA 1BA9A 1UFGA 3NJKA 1UCTA 1QSFD 2FLMA 2PCXA 2EVGA 3D39A 5FGCE 3RPKA 4BCYA 2DLIA 4H8WL 2GVYA 3VFNA 5JXAL 3S5LG 3WDIA 4YUEL 3SDDC 4RISL 2C9SA 1IC1A 5AOIA 3VXTB 2CO3A 2RQ8A 4UOW0 5HD8D 3L3DB 4JO2H 3SKJH 2I07A 4UM8B 4YPJA 3L1EA 2G60H 5IMKA 3STLA 4NBYB 1RULL 1Y18B 4HQQL 4AZUA 1GC1H 2QL1A 4GXUM 2Q0ZX 5KBMA 4OZIB 3MCLH 4NJ9L 5BOPA 3QNYA 1TYRA 2X1WL 2Y07L 1XF3B 1DUYB 5IG7B 5I8CB 5KYWB 2C8NA 3T8MA 3W0WD 5HHXH 4GT7A 3ARZA 5I1CL 2EH8L 1ZTXE 1OGAB 4PRPE 3TA3B 2F53A 2VMJA 2R1WA 1X44A 3RNKA 5B38G 1OB1B 1Q9WA 4PGCA 3OSKA 3CVIH 5IGXL 1RZJL 5I1AB 5K9QI 2FCBA 4POYA 1M7DA 4MJIB 2CALA 2IPKB 2W5PA 3L4ZA 1HL5A 4X83A 4XMWA 2VDKB 3OZLA 4FQQA 3TXAA 2WLHA 3X11B 5KSUB 1ZGLA 1YNTA 5D2LE 5FYKE 4FLQA 3O6ML 4QTHB 4UTBA 4QLWA 4AQEA 1KXTA 2R9HC 1LP9E 4KJPC 4ZAKA 3VFMB 2BXZA 4QY8B 1DVYA 3FHQA 1LO3H 4JM4L 1A6TA 3CFMA 1Q1PA 4MMXC 3S9DB 4Q97A 3KWVA 4UIKH 2A4CA 4X99B 4L29B 4U2ZA 1CE6B 3G7TA 3IBEA 4OT1H 1D9KC 1DFXA 1M4KA 1SBSH 3QRLA 3RL1A 3GI8H 3U46A 5BRZB 3VFOB 4JHAL 4YH6A 2JK5B 2R4SH 1AO7E 2YBRA 3SBQA 3MV7B 5IUSA 4LAQH 4KRPC 3M1BA 4DZ8A 4LEOA 2ZIDA 1RJZB 2QHLA 5EPMB 2WVUA 3WMQA 1PY0A 3UAJC 5KYUB 2UYLB 2PYED 2WXFA 1HQRA 3BQUD 4YK4B 5AW3B 4IBSA 4I0PD 1KY7A 2O30A 1MVYA 3DDFA 3PUCA 1YAIA 1LK3H 4OQTA 1R3LB 1EDHA 1QTPA 1ZK5A 2P8PA 2ZUXA 4GIPD 3IKCB 2A38A 2IANE 3FB7B 5EO9B 1EZVY 3BYYA 4NLHA 1A9EB 1WWWX 5B7MA 3LNFA 1ORSB 3FQYA 4PWFA 1KIRB 4HIPA 3BOVA 4WNJA 4N3TA 2NZ9D 3CLWA 3O2VH 5HDBB 3TJHD 4TSCL 1Z9NA 2V7HA 3BCFA 2IAMA 2UVEA 2P5WA 3F7YB 5DD0H 3WY1A 5I30H 4DGVH 1BWWA 2X9XA 2P80D 1ED3A 3MREB 4YGVA 4XXCA 4PS3A 1NC4B 2ITCA 3POHA 3RWJA 1BQLH 3GEWB 1YEHL 4PLJD 5K59E 1R6VA 1BBDL 3SYOA 2VR7A 3KXFD 2NY4C 3BIBX 3TURA 1FF5A 1QABA 1KZQA 4OTXL 2OM5A 3FYEB 3L16A 2WLYA 3HG0A 4NBZB 1G7JB 4LE8A 3TOPA 3BKMH 4HGWB 3WIHA 5GJTL 1HZLA 1WCBB 1F97A 3V0DA 2LLNA 3N1MC 5IFAL 4BUGA 1J1PH 3VH8B 4L05A 4A6YA 2VAAA 4WFEE 3HPLA 5ID0B 4KRNA 5DUPL 2NYZA 5IY5B 3E8VA 1FZMB 2PW1A 3EGSB 3MODL 2D31B 4OD2A 4B50A 4C4UA 5EIVA 3SO5A 1NOLA 3KLSA 3RAJL 3BPCB 3DROB 4M62L 1DLFH 4NAMA 3TO2A 3HKZA 3GM8A 4CJ0A 3EH5B 5BNXD 1CDGA 4RETB 2H26B 2YAMA 1RJYB 4HZAA 1VA9A 5I1AA 2DQEL 5DD1H 3GSNL 3FC8A 3FCGA 4NCC1 1PZBA 1B4LA 5DJDA 2IWFA 3EOBB 3S5ZA 2GK0B 2YUVA 4X6CB 1UB5B 3TBTB 3LTVA 3A4EA 3UGEA 4M29A 5E00A 1I7UB 1A8ZA 2XVGA 3SDXB 2PW2B 1ANUA 1FN4A 3C5JA 4JDEA 1I8KB 1D5XA 1E9PA 4MJJA 3QQDA 1ZVHA 2VDLH 4BZ2H 4NRXA 1WPCA 4HIJB 3HG2A 2QMJA 2DI7A 1ZPUA 3GKWH 2AFNA 2YPLD 3NSJA 1H3XA 3L4TA 1ZEAH 2VZUA 4M7LH 4HD9A 5KSAA 4J8RB 2DI9A 4UT6L 4Z7NB 3EUDA 5DD3H 4DF9A 3JV6B 4WHDA 4AV4A 2BRRH 2EDWA 3ZKXB 5D5MF 1JOIA 2J57A 1WT5C 3LIZL 2IAMB 4NIKB 5I1IL 1YEFH 1AHWB 2MCPL 5BO1L 4XNQB 1I1AB 1RUPH 3ZL4H 1ZLWH 2VMEA 4JM2B 4N86A 2PTVA 4KBPA 1AGCB 4U1HB 3HW7A 1L3WA 4K3DL 4RGNC 3IFLL 1HKLH 1GVIA 4X8GA 1TVBA 2WXRA 1DO6A 4LSUH 3CFCL 3PAZA 4WU7B 3TBWB 3DV6B 2BIMA 2FQEA 2V9TA 4Z8FL 2DBLL 3ARTA 2BVTA 3CDGA 3N43F 4X5WB 5D1QD 3K91A 2RCSH 3N41F 4JGMA 3FQWB 2AXJA 4GRMB 1W80A 2Q6WA 2ZOWA 4DOHE 3C2AH 1NBVL 3HZKB 3IK2A 3VXMA 2XVKA 3P4NA 4AVHA 2BNUA 3L4WA 2QQNH 1H6EA 1OP3K 1BLNA 3ES6B 5EMYA 4LVHB 1G9NL 1JGLH 2DQHH 1HZHH 1XF3A 2W0FA 2UY6A 2YAPA 3IJSA 1CICB 3BVVA 5FGBA 2EDFA 3WS3B 1KIPB 1EAQA 2AEOA 3OBAA 1DQDH 4I48B 4ELMB 3B3BA 1QFWM 1QLFA 2QTEA 3V0FA 4JGUA 1SYVA 4NM4H 1ORQB 5I9QB 4H25B 1WAAE 5CEXB 3D39D 4FEIA 3RY4A 3M7OA 1BVLB 1IKFL 3WGVB 1CMOA 5F3HA 4FA8A 4ABQA 2M2DA 3GSWB 3KG5A 2BFVL 2XVLA 5TPWH 3GT6A 3ZMNA 1M9WA 5F1OB 4BSWA 1OF2A 3FS9A 3GIVB 3GLZA 5IROC 1J86A 4G8EA 1TZIB 3HMXL 1PSKH 5GS1C 2LR4A 4NP9A 4U6XB 3VGGA 4OIIH 4BQ9A 1E65A 4L5FL 1PQZA 1VB9A 4RA0C 4F3FB 1NL0H 3T3PF 2BXYA 4BE5A 3EYSL 3B2MA 3LQAC 3SDXE 3FRUB 2FJUB 4TVPE 4U1JB 1KCKA 1RJCA 4Q6IA 4XO5A 3OKEA 4QRPD 4HIIA 5DK2B 1HDMB 3B2DC 5L8KB 5D71H 4K73A 1UB6A 2WLJA 3IRCA 4ADIA 2R1WB 3UTPE 1ZT4A 4XP9L 3D9AH 4Y0GA 5D4IA 4AV0A 3AACA 3EKCA 2XQBL 3J27A 2WO4A 3LQMA 3QJSB 2YQBA 3MBXL 1RIHL 2YIHA 5LNGA 2WBJD 4F37K 3QWRA 5A16A 5J9PA 3KPRD 4N68A 4PCKA 3BRGC 3TO4B 1P6WA 4O9HH 3UCQA 1E4WL 1UQSB 2DQUH 1EEYB 4QGYA 1EZLA 2X3AA 5IB2B 2XN0A 1E5YA 3CZNA 3JUYA 5T1JA 4HZ1A 3CNKA 1VZIA 5A16B 1U2YA 1E2WA 4X4YB 5D7LD 5E1GA 5F1IB 4M7ZB 5E8NA 4DEUA 2YEZA 3NFSH 1UADC 2E3VA 2QQNL 3BCDA 1JZDC 2OZ4H 1M1XA 3QZNA 3J7HA 1MFDL 2BHFA 3ET9F 3RRQA 3IT8D 3PWNA 2KDYA 5M95B 2A0LD 3UGUA 5EU5A 4PJFB 3QK0A 4U1JA 3BLPX 3ARGD 4AOFA 1T1WB 1SMOA 4NUJA 4NQED 1KTJA 3IDXH 1MOEA 3ROOB 1NDMB 2ZXBA 3O6KL 1IKNC 3LKRA 3SKMB 3LN5B 4H8WC 4F8TA 4ZX3A 1F6LL 1JI2A 4QXUH 1KTDB 3OMZA 2HX8A 2DS4A 1L7TH 5HYSG 3L5HA 4NNYA 3B7YA 2UY7B 1PMYA 2UZIH 1BP3B 2XWTA 4FI6A 5EF0A 3N06B 2J72A 4NUJB 4JK0D 1FAKT 3CHXA 3OHMB 4GQZA 3BEWA 4W70A 2P5EB 1AFVH 1SY6A 4MYPA 3HAEH 4ZMOA 3OL2A 5ISZE 4N8UA 4DVBA 1DQKA 4M7LL 3A22A 5JDJA 4CU8A 4OM0L 5EU3B 4GMTL 3EBAA 1A6ZA 4NS0A 1MREH 2FX9L 1RV6X 1G7MA 3F62A 4FXKB 4XNUH 4M5SA 2WGNB 1LMIA 2JWYA 4FXGB 4Y2OB 4BZ2L 2DWSA 4ETQA 3LPGA 4PRIB 5E8OA 1OAXL 2B7DT 5KSBB 4X6DB 3KMDA 1WAPA 4IIQB 4DPAX 3WS6C 4GRMA 1GY1A 1AOHA 2DQIH 1KTKE 3WKQA 4CU6A 1EDYA 4LCCA 5AOZA 1GS6X 1QWHA 3KGRA 3L5XL 4Y16D 3MTXA 1QBLL 4AC4A 5DVPA 4XHJC 3L1OL 1W0VA 5IIEB 3WUWG 4KK6D 1FUNA 3IAQA 5DTFA 1SYSB 4QPEA 4WI0A 4D0DB 4UQ3B 2PPCA 1CT8B 4Z77A 2NUTA 3HMWL 4TSCH 5AW7B 2X89A 1I4FB 3QUYB 1MAKA 5IB3A 1O7DE 4DWHA 3PP4H 3ULVF 4IU2A 3A6BL 1FP5A 5K39A 2R9HD 3GRGA 2UWEF 1FVCA 3SPHA 1ROWA 2EDNA 4M00A 2E0PA 1GGBH 3FQUB 4RMWA 3Q01A 3N40F 2BS8A 3O3AA 4PRHB 2AGJL 1LEKA 1OXYA 1JZGA 2VGLM 4QOKD 3JWNC 4LGSB 3WI9A 3JWOC 2DQGH 1UKQA 3BGFB 2J55A 4R83A 5A43C 2P47B 2VLME 1OK8A 2AEPH 2A9NH 5GS0H 4FERA 5D8JL 4AH2A 1NFKA 1Q4NX 3QIWC 4WDIB 1H3GA 1SXCA 4PHXA 2OV0A 2XZAH 4TULH 4CW1B 3NK3A 1J0YA 2WOBA 3KZ8A 5HTSA 2Q7AA 4HDIA 1BXAA 2HJLB 3HA0A 4N2MA 5IOPB 2GSGA 2Z1KA 3MNMA 1E67A 3ISRA 5DJ8A 3DYOA 4AZ8A 1X9LA 2PYFB 4GRLA 4PVLA 4YEFA 1JZ7A 1BMZA 2X6CA 5DJXA 4DTGL 1H19A 4KJWD 1VFMA 5IMMA 3V4VH 2J1XA 2AV7B 1CZ8H 3MCKB 4EDWL 5T5FA 5I15H 2VSCA 3TYFB 5DJ2B 1Y1UA 1AXIB 3BDXA 3P77B 1H8SA 1TU2B 1K6QH 2ATPA 3KPOA 3MX0B 3OQ3B 4ELKA 5JOPD 2EEAA 4IRJB 5DQ9A 4ANUA 3QI9D 1IE5A 2HJFA 2AP2A 5FFOA 4M7KH 4P3DB 5D7IE 1TNNA 2YAHA 4M1GL 3NCEB 3BSHA 3JWNH 5I8OH 3S37X 5JYLA 4L3CA 4TTDC 3OHXB 3D33A 1QSED 5CEXA 1FDLH 1IILE 2VDOH 4PP1C 2W07B 3OJVC 3P77A 4MAUL 4MB1A 2O5ZH 4N4YB 3CSTA 1NMAH 2Y06L 4QCIB 3ZRFC 2ISDA 4MVBC 3EJQA 3ZIYA 4ANXA 3IXAB 1M6OB 2GQHA 2BVQB 2JJTC 1ZDSA 2X38A 2FO4A 3CHPA 3MV9E 3NYKA 4GW5B 4O02B 4HUNB 4X50A 3VFVB 5GGVY 3RTQA 3O4LE 3PLYA 2CR3A 3VSVA 4P46B 1T80A 4L2LA 4UQ2A 5IVXF 4HXAL 3ZE0B 1FORL 1YN7A 3MUZ1 1QSVA 4F9PA 5DUBB 4NQTA 3HZMB 3QXTA 4RSYA 5BVJB 2X1PA 3DUSB 4Y1AE 3DI3B 3SGDI 4WWPA 4L37B 1KWKA 2CQVA 1MCBA 4BBWA 5DJ8B 3VXRB 1BM7A 1HH9B 2LOEA 3AU1A 3OAWA 2VL4A 2HB0A 3EDDA 4XVUC 5D71L 2WUBL 5GRVL 3FL7A 5E6IB 3U2SB 1WJ3A 1ZTMA 4NQCA 4XAWL 2HJFB 1SXZA 2VLKA 3D25B 5F9AC 4AT6A 1JZEA 3KR3L 4ZOEA 3RX7A 5D2LA 4Z95H 2PKDA 4NN7C 5ISZA 4OQTH 3GTVA 2A6JB 1Q72L 1WZ1H 1G9ML 3MROB 4TXVB 2EE0A 3GS4A 5I82A 4ZOCA 3W2DL 4DK6A 4G5AA 3WIIL 3K1KC 2CRYA 3RL1B 4L3EB 1NCDL 2PP8A 4CVZA 4G6MH 4WUKL 1KLGB 1YUKB 4AYDC 3ATDA 3CFTA 2A6KB 3VTMA 2AC0A 1JVKA 2NY3B 1CXLA 3S35X 1MCHA 1XBDA 1X5FA 4OF5A 4QT5B 3S36X 2WLIA 1X9UA 4JO2L 1J0IA 4NKQB 5J06A 1AO7A 1OHZA 4UQAA 4QY8A 1SY6L 1YEIL 3NSDA 3QNFA 4HF5H 4WI3A 5K39B 2K4AA 2MH4A 1UVQB 4Q14A 2GB2A 2DMBA 2P9RA 1D7DA 4J5VA 4M56A 5JXAH 4ESKA 1I3VA 8FABB 4AG4L 3A21A 3NCJH 4JFDE 4PLKC 4Z76B 4EI0A 3Q13A 5HVWA 5DR5L 1O7VA 2VXVL 2IAMD 4PG9B 5F72S 2APFA 3FQ2A 1J8HE 5ICZA 4FL4B 4OZIF 4K8RH 3CFBB 4X7DC 3RE0A 4RWHA 3VXQA 1R0AL 4GXVH 5LKNA 1S9XA 4NUGH 1HNGA 3WLBA 3C8DA 1QP1A 2RALA 3EGDA 5ALBL 5FB8B 6FABL 2VMCA 4NZTH 5J6GA 5EEWA 2RAMA 2DIAA 4BIKA 1EEZB 1T7YA 2IAMC 3DDGA 2W95A 4LCWE 4W9IC 3KCPB 3E9TA 3QZWA 1B4TA 3O2DH 4K8RC 1Z3GH 5TTRA 1EK3A 1QLFB 3O6FD 4UI2A 1R5IB 1IM9A 4L8CA 5EO9A 2BNQB 3LIZH 3Q06A 4PGBA 2JCCE 5DQ9B 4Y19E 5TPWL 1KACB 1XSIA 3HE7B 4ABVA 4AWJC 3ESUF 3A67L 3HN3A 3REVB 3P4NB 4YOKA 1QLEL 3PL6B 4XB3A 4GG6E 3CH8A 5LVEA 4NM4L 3MRCA 2Z6FA 2NY7H 3ALWA 4OLWH 1A5FL 2VC2B 2BZ7A 1E8YA 1U8QB 2QGEA 3MV7A 5JIPA 2XZCL 3KBFA 4BGLA 2YN5A 4F33B 4F24A 4XCNA 1NLDL 5FA4A 3WXWH 3AWFA 1RSFA 2WQSA 3N04A 1T21B 4OLUL 3D39B 3FYIB 1UA3A 1IM3D 4LCWA 3L3IB 4LPXA 4L8BB 3DHPA 3QDGD 1A1OB 1CDCA 2EVJA 1A6TB 4NM8L 2Y36H 2HRGA 1S7RB 3QUMA 5FCUH 2VNCA 2WBWB 1WH0A 2WIMA 4M5TA 2GUOA 5DQJB 1BOGA 2AK4D 2Y22A 1KT2B 4Z7WE 4HZLA 3POCA 1EEZA 5BV7B 3Q6FB 3RKDC 1J48A 2L7UA 3DK2A 4BDVA 2Y23A 5IVZB 3B43A 1RK1B 2JKXA 1R75A 3AABA 1MIEL 1GOFA 5LO7A 4W6WB 3UTZB 4YHKL 1SNRA 3H9YA 5I15L 4KDWA 2YMTA 1BIIA 3DTXA 5I74B 2G2NA 2FAUA 2J1YA 3AT0A 3U1PA 4ADJA 4PJ5A 5AZ2H 4LEOB 2UWEB 5KUMA 4TNEA 2IIJA 3DJTA 5C09E 1GZQA 3DGCR 2I32A 1KBWA 2YD9A 4DN4L 1MCPH 4EI5A 6CGTA 1U4EA 1RVFL 5D7EA 5GGTA 3KYOA 2Z8VC 1JZ6A 4XMKH 1K4CB 2KL6A 4JJ5B 3IS0X 5FM4A 3GSXA 1AO7B 1S8DB 3MRRA 1OALA 3TBTA 5I73C 2HRPL 1CN4A 2GK0A 3KYKH 4QNPF 4X6CA 3RX5A 2ZPKH 3GKWL 3QXAB 3T77B 1HFUA 2A73B 3FUIA 1OCZB 3WNMA 2BM3A 3CMGA 2QFPA 3MLRL 4MAYC 1IEBA 4BSJA 4R5VA 3ZT5A 4ZS7H 1OK0A 5DZNA 4A2FA 1JGVH 1HI6A 2A2QT 1UZGA 4YQXH 2ESVB 1YECH 2WXOA 3APDA 3DROA 3B56A 4I18C 4LHUB 4XOEA 4ZT1A 5C08B 1TTRA 2F1AA 3RIAF 1AZZC 1H3PH 4IU3A 3OZ9H 5DRXA 4HUKB 5DF0A 2W38A 4OZFH 2D7TL 2APTA 2A3TA 4HKXB 4IRSC 4Q8BA 3HUJA 1PD1A 3QNXB 4AGOA 3FO2B 3NZHL 3GSOA 4LL1A 3RFRA 3T3PE 1MFAL 1NBYB 1ECZA 1R5IA 3MKKA 2HZHA 1IGTA 5DD6A 2EO9A 4FAAB 3I9GH 5GSRB 3IVKB 4IKLA 2E74C 5KVDL 1SEBA 2X42A 5CCJA 1ZMYA 1Z7JA 5JHDA 1DHKA 2VZ1A 4UT6A 5D7IB 4UYPA 4WKZB 1IGJA 1OV8A 4KQ0A 2JLPA 5KS9A 4WU7A 2XIIA 1QBLH 4LAQL 3L5XH 1J9CT 4XMLH 4KTYA 4TQPA 4C54A 5I1JL 1NFDA 5F7EL 3D4GA 2EH7L 4KAQH 3T1FB 1NCCH 3CG8A 1A6AA 4WIQA 3FQWA 3IU4L 4LOEA 4RBPK 5FYJE 3Q8BA 1A9VA 2K6YA 1KGCE 1UJ3C 3MNVA 3FO9B 4OTXH 2BY2A 4ZAKC 2GCYA 3BIKB 1P1ZB 3E3QC 2X9YA 1CLYL 2G75A 2HMID 4PB9H 3MV9B 4E9RA 1N59B 5AALA 4G70B 4GP8B 3BAXA 4Z7WB 4OLXL 1KIPA 3EYQD 3UO8B 2NY1B 3BUQA 1HILB 4OZGE 4PJGF 4ZMPA 5CZVL 4KV5E 4MHHI 5I17B 1KCUH 3QQ9D 2GTWB 5D5MA 4KNQA 3HOGA 4XNZC 3L4XA 3OAUH 4H1LA 4NZRL 3X14A 2OULB 1MW3A 2XG4B 3WNPA 1D6VH 3QJFA 3TBVA 2OZNA 4IDJL 1J87A 3VWKC 4OUUB 1BREA 3ILQC 1MJ8L 3ISYA 1XR9A 3ECQA 3RUGA 2PR4L 1OLLA 2W8CA 1USQA 4XCEA 1JF1B 4M43H 2E46A 3BH9A 4B7IA 4OCRH 2EC9U 5F7DA 5LG6A 1FLRL 4MD0B 3ROLB 2HA1A 4LP5A 5JQHC 3WKNA 1BCIA 3CXFA 3U1QA 1VERA 4E5XA 1U3HD 5F7BA 1AGCA 3US0A 4LQFH 2SODB 3Q2LA 3UTSB 3QZBA 3ARPA 3UFIA 1CFVL 3MCG1 1RJYA 1NQBA 4GBXD 1I7UA 3NCJL 2E8ZA 2OK0L 5KVGE 4K71B 1RZJC 1TQBC 3OXRA 4B97A 4FQQB 1XEDA 1ZIAA 2W65A 1P7QD 4JFOB 3LZLA 4N0CD 4MMZC 1FFNA 4F8NA 1WAAF 4I1RA 4JG5A 3NTCH 2EDQA 2M1KA 1R3HB 4LQFL 2X4PB 4EI6B 4PY7B 5HPMA 5FAAA 4H8WH 5H94B 4RMQA 4LASH 4A7VA 2MPVA 1I8KA 1S9KC 4C56D 3C60B 5KYXA 2KBGA 3X17A 1DP0A 4H20L 1D2PA 2QSTA 2BSCA 2ZUWA 2PYEB 4X4XA 3MLUL 3RWDB 2HN7B 3ABLB 3IDNA 4XNYH 3GNML 2KUTA 4RGNB 1S5HB 5B7FA 2KLTA 3RVVD 4QXGH 1D9KD 2GK2A 2A1WL 4OQTL 3WS3A 1VGKB 4N8CL 1R3JB 5T1LD 5D7LA 5IEKB 3TN0B 1X5LA 2Z8WC 5FYKD 1TEFA 2B15A 5I0XA 1FYTA 4QD2E 1QI3A 4K3JH 3CK0H 1QO3A 4WGKA 2PTTA 1DTUA 4ES8A 4DEPC 4KZDH 5JOEA 1LE9B 2ZX8A 1XGZA 3GTTA 4FI7A 4OLVL 4WFGE 3HZVA 3M8OL 4HS8H 1DO5A 3MACL 4HUWA 3OR6A 3RJOA 2ED6A 4LCWD 1UXSB 4EIGB 3B1TA 1XGYL 1OHQA 3V2AR 5M7QA 3GBNL 3DI2B 1GIGH 3L7FB 2R0ZH 5AAWA 4R4BA 2PXYA 3HPLB 5ID0A 1TG8A 2LV4A 2ITFA 4XTRD 4CILA 4KUCD 5LB1A 2CDEA 5K59F 3KS0H 1VEPA 3BC9A 1KN4H 1O5DT 1S7UA 3T0AA 4WY7H 1CF1A 3VFGL 4K9JA 4N2FA 3AWEA 4EUPB 1I8AA 4Y5VB 3LHPH 2J73A 4BKLA 2ICWI 1QRNB 4KDVA 1UUNA 4Z78A 2XKSA 1FDLL 2F7QA 2QQKH 5GGRA 2Y1AA 5GGTL 5I8OL 4P2QA 2H0EA 1CR9L 2LTQB 4G6JH 4W9JC 3U79A 2ICES 3ABZA 4NAJA 3BD3A 1U36A 1UZ6E 1FH5H 4OJCA 4D0BB 2HLFD 4YC2C 6PCYA 1MG3C 1X7SA 1GKOA 5KS9E 3ARBB 1ZY9A 1MLBB 3RIFK 2Q2LA 5D1ZC 3SB3A 3ZZLA 2FBJL 5GRXG 2WAQA 5T5FH 1FNHA 1JI1A 3L9EA 1MFEL 1KGCD 3O3DA 4GINA 3V4VA 1U3NA 4DTGH 2AJUL 4ABWA 1JPSL 5AD0A 1CFBA 1E3XA 4XPAH 1M71B 1ITBB 2UWEE 4IRJC 4J27A 4AENA 2FT6A 3VI3E 4R4ND 1JWMB 1BZOA 3L2LA 1CD0A 5JQIB 4KK9D 5KWYC 4ZXBB 4XP4H 1OE3A 3CCHA 2JH2A 3QUML 5HVHB 1ULVA 3QP3A 1AH1A 3UYPA 2P24A 1WBXA 2MTPA 2XQYG 3KWWA 4H1LG 3B9KB 1F4AA 2PPDA 4XOBA 3DHUA 3QUXD 4U1KA 1P69B 1PNDA 4UB0L 3T4AA 4BXVA 5DGRA 4EQ3A 5H37H 2OI9B 4MJIA 4P3CL 2QPEB 4ZOAA 2DN7A 3FTVA 4BHUI 2K0RA 5DD6B 1A6ZB 4H0IA 1OSZA 1RHHA 1IBZA 3O8XB 5AVVB 1CGWA 1NSNH 3CBKB 3G9AB 4HXBH 4PJ5E 5T5FL 1E6JL 4XBGB 3WU1A 4I4WA 4JDTH 1I8UA 3MNZB 2BZCA 5IFJB 3HC0A 4CAGA 4K4KA 3A4AA 4MB3A 1ASPA 5CWSB 2D7MA 4FX5A 1YO4A 4IEFB 4RVBA 2VUKA 3QIWD 1V3JA 4M7JH 3H3BC 3MGAA 1AAJA 5CU9A 2EIJB 1T1ZA 2HH0H 5C08A 4PJEF 3QJOA 3OGCB 4ODXA 2QQKL 2ROYA 1M7IA 3IMUA 3DWTA 3L4VA 5HDOA 4D8OA 1TTCA 2V7NB 3BWAB 3DIDA 3MRMA 1JDAA 3QYMA 4NPYA 4PP1D 1JWMA 4PJ8A 2OXGA 1F90H 2F53D 2APWA 2ALAA 5E7FA 1B90A 1XMWA 4UM9B 1QQDB 3FQRB 3O45B 3ECBA 4AGMA 2IF7A 1EXHA 5EIIB 5KYWA 2CBTA 3QEQD 3IFOB 4F9LA 2F7IA 3D30A 3I6GB 3GBEA 4YIQA 3QWQB 1B9KA 3CJJA 4H2AA 2ZXQA 3ZL2A 4G1EA 1IFHH 1PIGA 2VR4A 1ZK9A 3N1QC 2OMXB 3ES6A 3BZFA 1AGBB 2P3YA 2J6WA 4OGZA 2I07B 4S0TD 1JZFA 2IWKA 1FG9C 3T1FA 1MF2H 3QZPA 3GLDA 1T20A 3H3PL 4P59L 1NGWA 1DBKL 2VDML 3MHZA 5FW8A 1WF5A 1DR9A 3CFKA 2ADGA 4Y16C 3B5HA 4EVNA 1PCSA 3QQNA 4ZS6C 4Y5VA 5BRZE 3TYGH 2GIXA 2OW7A 4J4PC 4YDLC 1DVXA 3CIAA 4UBDC 1S7TB 2GUYA 5D2LF 5CWSA 3LZOA 1KT2A 3QRBA 2J5LB 1LJMA 1TTAA 3APNA 4N5ED 2QQLH 4KTGA 1CLOH 3DLQR 2GSMB 2ADIB 2CUHA 2ZKWA 1JYXA 1PKQE 3FFDB 4E9SA 4ZMYA 3V0HA 5IW6B 1A66A 4HJJL 1NANH 1HNFA 2ZUYA 3VGBA 4G42B 1DZBA 4DPBX 4F91B 3SE8L 1YEGL 3E8UH 3L2NA 1BQKA 4P2OD 3TPKA 3REWB 4ZZFA 4BK4A 3QRFM 2BSSA 3CZGA 3OPZH 1CGUA 2YWZA 3G3LA 2ZNWA 2X4OA 3GYRA 4HX1B 1F2QA 4LCYA 3SOTA 4XT1C 3TJHC 2C3WA 4IBVA 4ZUSB 1KELL 2XHNA 3MRCB 4RRPA 3VD7A 5KVFH 3Q3GA 4B95C 3GXPA 2F74B 3BUBA 5FDWB 3BP7A 3KH4A 3VWJD 5K1VA 4BYHA 3FU0A 3RNKB 2BNRE 5C0ND 5EFIB 1SVZA 1KCVH 2A73A 1FZKB 1H3WM 2WMPB 4DP6X 5A6MA 4HETA 5AD0B 3OKLB 5E00B 1XH3B 4FMKA 4JFDD 4ZAKD 3FTGB 5I71C 1J0JA 1T22A 3CVDA 5L2KD 4Z7VA 2BIQA 4M93B 1U4FA 4QRPE 1S7QA 4FEMA 5IM7A 1AZVA 3RYMA 3D1MC 1YNKH 3KVPA 1A2YB 1G1CA 4RFOH 2AXGA 4XAWH 3DGGA 5FYJL 4BD4A 1I3GH 1IFRA 2H26A 4LCUB 4PLKD 1HYRC 1Q1JL 2FX8H 2OMYA 2WUBH 2CJTA 4NOBA 3JYBA 3MRFA 3VTAA 3FULA 1ZLUK 1B2WL 2JSFA 3WKMH 4JQVC 3FSOA 4XODA 1OE1A 1U8IB 2FJFB 4P5KA 4O2CA 3KJ6H 3IU3A 2ZSVB 4XVOA 5J57B 4AKOA 4G7VH 1MELA 2F7OA 2Z91B 2RMNA 2AABH 5ADOL 4X9IA 1OARH 1ZLDA 1PSKL 3OAZK 3O41A 3STZA 1WBZB 4PJXA 3W11D 2IGLA 1U30A 4Y16A 3OB0K 3VDCA 4X4KA 2JKWA 3O4LB 2HPTA 1XF2A 4KRLB 5HHMB 4P9MH 4F9PC 1W0WA 4ZNEE 4V1DB 5C0AA 2ZWSA 4XZ4A 4WK2B 4W9EC 4XBEH 1SQMA 4Y4KB 5E1IA 4DAGL 1HC1A 4OI7A 3EDKA 3V6OE 1BZ7A 1M2OA 3K4DA 4P2QD 5KTEH 3UPRA 3DGDA 4N1HB 3U2IA 4TQHA 4UZGA 4KVCH 1XFPA 3R06A 1DBJL 2WKLA 3CC5B 4KUCF 2A83B 1HL9A 1TJHL 4WAFA 1S78C 4KNUA 5FEBA 2CGZA 1RIUL 3LH8A 3PWJB 1ZHBA 3MGTA 3ARQA 3QPQD 3QHZH 5EBWB 1NCTA 2VLLB 4UOQA 4BRVA 3QB7C 2AXWA 1XSOA 2DM3A 1XTLA 5JO5A 4YGAB 5JZ7C 3HHSB 1XH1A 4B9ZA 1XB3A 1X9QA 3N1PC 3K74B 3MNDA 3SBWC 2NY1C 5KW9H 3V4VL 3PWPB 3RFZA 5EBMB 5ICUA 2A99A 3S5LA 4BWUA 3V0EA 1DJYA 2G75B 2KC0A 1UG9A 4WK4B 1MEXL 3IMVA 4XR8C 3ZR5A 5E9DE 1CO1A 2H9GB 1QHPA 4Z7UB 2VDRB 1KCLA 1HKLL 1BXVA 4ISVA 5IQ9A 4AI7A 4D9RD 4GUPA 4C58B 4X42A 1CD1B 3H53A 3L3GA 1R3HA 3MJGX 3RTQB 3KDMA 4CDHA 4IOSA 2H3NB 1W6WA 4JO3H 3ULUD 5ICZB 5A7EA 5J12B 4H2CA 3HNVL 3FPXA 5DC9B 3UPRB 3HNSH 4B9JA 3K72B 4ZNCD 4X6EB 3ULUH 2C3XA 2BFGA 5DHYA 4GH7B 3VGAB 4KJYB 1ZEAL 3FHEA 3TC9A 4W68A 4PRPB 4LSSH 2Z92A 1YEEL 1UT9A 4XMKL 1OT2A 1KCRL 2WLIB 2A7BA 4EI5C 3VI3B 1E9QA 4N8VG 2W0KA 5D93B 5D1XD 4AEHL 1VGEH 3FCBA 4WEEA 2DMKA 2XC8A 5F0LB 4U6VH 1P4IL 3MA7A 1ZDQA 2ZOLA 2DYPD 5EUKB 2A6IA 3KWWB 1H9VA 1XF4A 3NIGB 4PS4L 3BP4A 4JY6B 4OIAA 4RGND 5AKSA 1HJBC 4JVPA 5MENE 3BQUB 2D7OA 4XCYA 5T8IA 4MCNA 1VPOL 3X1EA 1WIUA 5JIHA 3KPPA 4KO6A 2FEDC 1XCTA 2HJLA 2V9RA 1PG7X 4P99A 1C5DA 1N70A 6PAZA 3U9PL 5HSFA 5GSVB 3I50L 3O6FC 3ME0B 1T22B 4ABUA 2EEBA 2ZYSA 1MFCH 5DRZA 4GKOA 4NKOB 5LBSA 4JANA 2ATKB 3HN5A 5C92A 5IOKA 2KPNA 3WY4A 3HE7C 3TBYA 2BNRD 4LLVB 2ZICA 3Q2VA 1LGVA 3VXUD 4GKZB 4KMTH 4JG1L 3U6RB 5HYFA 5L7XL 1DBBH 1SXBA 1HQRB 3JV4B 2HVBA 5E1AB 2Y72A 3L5WA 1N0XH 3AAZB 3PXJA 5C08D 3TVMB 1NBQA 5EC2A 4HSQA 4XX1G 3WFEH 1ZHLB 3X13A 3BXNB 2A77L 1F8TL 4K71C 3MV8B 2XA3A 4XN4A 5K1NA 1LLAA 2JXMA 1E6OL 1AHKA 2WP3O 3HI6H 2AJUH 5ESAA 3D09A 4DGVL 3O2DL 3T0VA 1JXJA 2I60L 4ZFZA 4MZ3A 2P48B 4XPFH 1PZAA 3GSNB 4K7FA 5T1DL 1OO2A 3ZKSD 2J8HA 3PIQB 2EICA 2G30A 1HVXA 1C12B 3MMEB 3NCBB 4Q6KA 5HGDB 4XNBA 3L4YA 5F0MB 2XA8L 2EDEA 3FUEA 4WKZA 2ODHA 3MRNB 2V2TB 3MOAH 1UASA 4FNPA 1CR9H 4G6JL 4A6YL 1CVSC 5HXMA 4QRRD 1U9KA 5F7FA 2R2HB 5I66A 1D5BB 1L9OA 4YSDA 5GZND 4XVUD 1N18A 2HUHA 3RVUD 1NMCB 4F8PA 5MHSD 4G1EB 3CN2A 3EGXB 5GISL 5L2KA 1BVOA 1AR1B 1XH0A 1KMGA 5EBGA 2LFGA 1I1YB 3SDYL 1NOAA 3VYOA 1IGIH 3QJRB 4HPYL 5IG7A 3H85A 4FFWD 1FCCA 3IDYB 4XZUB 4ONFL 5AAMC 3LQZB 1IGTB 3E1F1 4G8GA 2WNKA 5KTEL 4OT1L 3T0DA 5KJ7E 4NO0D 1GZQB 1JIBA 1ES0B 2AAAA 1CUOA 4P4KD 4I1NB 4WEUD 2R0ZL 1GIGL 3QS3A 1QI5A 3HAEB 4U7SA 5DO8A 3A5VA 4LMQI 2YQGA 3D7PA 4LVOC 1FFNB 3QPQC 4OLVH 3PGCA 4MCZA 3VM7A 4TQEL 1LO0L 4FXTA 1DVFD 4KKBC 4ZO8A 4HUUB 4E0RA 4JO4H 3QIBD 1TZHA 1P7QA 4HJJH 1C7SA 2BNRB 3MLXL 5MERB 1TEYA 3HC0B 3KYOB 1A7NL 4LPYA 3V0WL 2PP9A 3QXDB 4JE4B 4FI8A 4NC0B 2DQCL 1BG1A 2XXGA 4JO8A 1J8KA 2GG1A 4NN6C 1E28B 4XN8A 2D2OA 4EN3B 4PJDF 3UTSA 3GNMH 1BFSA 4Z7VF 2NR6C 1AI1L 4MD4B 2JIXD 1A4CA 4GW4B 4U3SB 4E41E 3UADA 4PJAB 1I1FB 1UOVA 5A40E 4X4YA 3P3YA 4TSBH 2DTSA 3IMRA 5DJ6B 1ASQA 3KPRE 4WSJA 1U8OB 5GS0D 4WFFD 5JW4M 4J6RL 2BCKB 3NUKA 4R96A 1VESA 2Y07H 3LMJH 3LIZA 4PREB 3HRPA 2UZPA 5HYJB 1NDGB 2Z0UA 3DMMC 1H6FA 4AGNA 1SN5A 4UTBL 5SWQB 1OSYA 2C9AA 4PJ8C 2IDQA 1RULH 3OPUA 3FQ1A 3I6LE 3IGKA 3GBDA 4LKXA 2C1PA 3JWOH 5CBAA 1G7MB 4FXKA 4LGRB 1I8MB 2V17L 4MXVE 1OP5H 3R7RA 1F02I 2ILLA 4WCYH 5FLVA 1DEDA 1O75A 4PJ5D 2RFXB 4K5NA 3SPVA 1FH2A 1B2WH 2FUTA 4L9LC 4YNYA 3CFCH 3MRJB 4U0RB 4K5LA 5DZ9A 1Q1JH 2FX8L 3VFWB 1J8RA 5KVDH 3ZQWA 2QPUA 2VQ4A 4NENA 4P5TD 3NIFE 3JTSA 3INUL 4L8BA 4NNYB 4NQXB 4LCWB 1XT5A 4LU5L 1YA5A 3BFWA 1ZVSB 4P9HL 2CCVA 4OCSL 1OGPA 3WJJC 1G9EA 2HUEA 4JB9L 1D7BA 4F57H 2WNGA 4KH9A 3GSNA 4K7FB 3W1ZA 4AIZB 3FONA 4KKLD 5DEGA 5ECJE 4NENB 4Z0BH 1M6OA 1ES0A 2AVGA 4O4YH 4QAMB 3ZYIA 3O9WA 4Q6IC 4KMQA 5ESAB 1BIHA 2FR4B 4M1CC 4U1MB 4YE4L 4FMVA 4WTZG 1EDQA 5DS1A 1XF5A 4OF8A 1E90A 1R5VB 2CDEB 3NRQA 2WD0A 1U8MA 3CV5A 5D8JH 2FWSA 4J39A 3WNKA 1V8HA 1ONQA 3CU7A 5DU7A 5I1DB 3WFDH 3OKOB 1UACH 2HTLC 4XMZA 3AUVA 5T33L 3IMBA 4L1LA 4BUHA 2MFNA 3QDJD 3TT1L 3TH2T 3DYMA 2GJ6E 1YJDH 3OKYA 1UD2A 1SFHA 2PN5A 4FLOA 5JHLH 2AXFA 4DKFL 1CXEA 4KKAD 4G43B 2G0LA 2VDOB 5D7KE 4M5YL 3LPWA 4AJVA 2H1PH 4F5CA 5T3ZH 3P9WB 2XV0A 2BY1A 5DEFB 4QTIL 1KSRA 1BXXA 2B0SH 1O9VA 2ZCHL 1WG3A 4LBEB 2FNBA 2H32H 3RTLA 4NQCB 4LLDB 4CW1A 2AJXH 3PWPE 1CVRA 4FQ2H 1B0GA 4O02H 3UAEA 1WZLA 4F8OA 2HPOA 5AWNL 1U91A 2VO8A 4V2BA 2F08A 3IDNB 2IOIA 3PUUA 1AHWA 3RQ3A 4ZFZB 3QJHB 4QRPB 4XMPH 3MROA 4G9FB 3UG5A 1EJFA 1H5BA 4TUOB 3AS0A 1LEKB 4OVVA 4YHPA 1TITA 4RAVA 3IDIA 4TM9A 3GDCA 3SCMC 3DX7A 3HI1A 3I2CL 3T3PB 4NQDE 1EFXB 3I75B 4LEXL 3K46A 4KROD 1ZS2A 2L4OA 3LH2L 4LFHG 2ID5A 4IBUA 4JRXE 2I85A 2RJMA 1PD0A 2VQUA 1QYGH 2APVA 1KN4L 4JPSA 2QADB 5DUML 5GHWH 3VCLB 4HG4K 4LLVA 4LLYA 4HJSA 4I0CC 5I0DA 2NNAB 3NFPB 1S7XB 1QLRB 1AP2B 3VE0A 5ENWB 3LKNA 1QLEH 4UBDD 2CIKA 3EFOB 4OGQC 1BEYH 3BPOC 3WLWD 1DQTA 2BVPB 4P2RE 3S96A 1CDBA 1RZKH 5CU5A 2PXYB 4UQEA 3VD4A 5IR1B 4TQ8A 5D1ZA 3TEXA 3CXDL 3OSVA 1OAUH 2R2HA 3TF7C 5GSVA 3WSQL 2YXVA 4ZFGL 5BVJA 3HZMA 2EADA 4AMXA 1IZJA 3QUYC 2DQDL 2ZXCA 2WXJA 3NA4A 2QZ5A 2W07A 3F7KA 1AIZA 1CL7L 1LK3L 3AM8C 3IM1A 4FTVB 5D1ZB 1OP5K 3K2KA 5EDSA 4L18A 1OM3H 3ZBMA 1E4XH 4L3CB 1FH5L 2NY2B 5I8EB 4FXGA 4Y2OA 3EYUH 3B2VH 2B4CL 4I3RL 2BNQA 2WB7A 3TFKD 1X7QA 2X4TA 4MBRA 5EUOF 4BRJA 1HSBB 5C97A 4Y2NA 1CFQA 1XF5B 5FFGA 1MH5B 2WTRA 3HRZA 2OR8A 3SE3A 1DSFH 2ICCA 4P4RA 1CDIA 1EHXA 4BHUA 3BFOA 2NSMA 1KEML 4C56A 1SBSL 1UTDA 4GQ9H 1Z5LB 1JV5A 1JNJA 1S9YA 4G2AA 2C1OB 3BZ4B 1XCQA 5DZVA 5DK0B 4QKTA 3RHWF 3WEXA 1NCOA 3GZKA 3I02A 5KANI 4P3DA 3HS0B 4I87A 1J5OH 2E9WA 4QRRA 3Q44A 1ET7A 3HFFA 5EIIG 1W16A 2J20A 4HP5A 5F1SA 3NSXA 4RAUA 1NJ9B 1PEZA 4JCMA 4JFEB 5I2IB 4BKSC 4YFLF 1ACZA 1XQ4A 4WDIA 3FN0H 1XGYH 1EJOL 2IALA 2IBGA 4N2EA 4YSEA 4XWOC 1V54B 4UT7H 1G7QA 1NKRA 1U8HB 1UM5H 2LQRA 2ENQA 4WU5B 4JLRB 1BJ8A 1ZTXH 1JTTA 3UYOD 1CC3A 3TZVD 1G1YA 2H2SC 4GO8A 1BJ1H 5AW4B 4DW2H 3RVWD 3VQLA 4JKMA 1ZLSH 4MDJB 3FMGH 1K85A 1KTRL 2OTWB 3GXMA 3E6FA 5E6UB 3BZEA 3DGGB 3GWJA 3QJQB 1SHXA 3VSTA 4FHJA 3WTTA 1XV8A 4UT7L 1D5IH 3KNBB 4J4PA 4JFQA 3IFNH 2ZOLB 3TZVC 3GSRB 1W72L 4IRJD 5TFSH 5KVMC 1IBDA 1FORH 3CN4A 3CC5A 3ZGHA 4Q9RL 1JVOA 1AQDB 2XBTA 5IWLC 4PD4K 1MCQA 2Y5TB 1FZKA 3DX1A 4GAGL 4EN3D 2Z7YA 5KVEL 4DCQA 3NIGF 3CMOH 4PBWD 5DD5H 5AVXB 3Q8CA 4JPWH 5JNYB 1GCYA 4HU2A 2W60A 3UROR 1NCCL 4NN5B 3ZQXA 4YLBA 2O61A 3J2PA 2YSSA 1CU4H 4S1RL 2FJGB 3M1OA 4QRUA 3ARUA 3ZZ1A 1OAZH 5HGBA 2EVIA 1WFOA 4M9PA 5BS0B 1FPTL 1JGDA 2Z64C 1BIIB 1CE1H 3G5YA 2ZWYA 3QJXA 1KTDA 2OMYB 4M1GH 3GIVA 3A0OA 4J1UA 2LGNA 4P46D 4F7PB 1KJMA 1YEDA 4B5ZA 2EDKA 4ISVB 1AE6H 1UT2A 4WSKA 3OMAB 3FQTB 1UGNA 1IM9B 1J1XL 4AUYA 5FA3A 4KHXH 4KX9A 3DBSA 2VZSA 4PJIA 4R90L 3ZJAA 3SPVB 4V1DD 2H0PA 5E2VH 3IFPB 1SJEB 3UC0L 3D12B 3HHSA 2NZIA 2NY5L 4JQXA 3NSFA 2VLMD 2ADGB 2BO0A 5AB1A 1G9NC 2FYYB 3K8MA 4NZRH 4G7YH 3W38A 2A9MH 1U8KA 3A6CL 2IFGA 4N9OB 2Q2EB 3VXTA 3JYCA 5DJYA 3MV01 3KGTA 2FH6A 2FSEB 2G0KA 4W6XB 5E03A 4XPBH 2DQGL 4R7DB 3ULAB 1JYVA 2CR0A 3VD5A 4R2GB 2Z65C 1C8QA 5AYUH 5C09A 1YLBB 2Y7LA 5SWSE 4GFTB 2GBTA 4K15A 3NABH 1USZA 4R3SB 4BZ2A 4PJ9C 3BH8B 3LZRA 4APQC 5K9JL 4Z7OE 3UTTB 5FGRA 5GRUL 1UB6B 5HYSB 3SQOH 2DLTA 1AQHA 3BRFA 4QTHA 5CN2A 2J25A 5IW1A 4XNZB 5SV3A 4HCRA 1KEGH 3BGMB 4HJTA 2JKTM 3WHE0 5D1ZI 4HUUA 1TEGA 5F93C 5I8KH 1ZVYA 4PJ5B 3E6FB 3QISA 3SPCA 5IB5A 4GP5B 4ZQTA 4U6XA 4TLKA 4PJ7F 1KN2H 1MCRA 2NX5E 5IHBA 2FSDA 4TMPA 3RAJH 4ZX4A 2D03H 4NQDD 1BYOA 3HAEA 5AVRB 4P4KA 4FGMA 3MN8A 5AOKA 3UDWC 3BGMA 2BRQA 3DVIA 3QQDB 4JFYB 2BS71 3RPIB 2OMXA 1NLBL 4JRXD 1TZAA 4LL4A 1EZVX 5DA0B 2GEQA 1P7BA 5BJTB 2AKRB 2F54D 2HRLA 3IU4H 4OCWH 4NKOA 4DEPB 1IGCH 4WTQA 5DRZB 4MMXB 2EDJA 1WAAA 3QIBA 4E68A 1PG7H 3DHMA 2DL9A 4L9DA 1AY1H 4PJCB 4F7EA 1ILSA 3NBNA 3ESNA 5GGSY 3TEWA 4ZMXA 1JWSA 5F96H 1FA4A 2E9GA 3K6DA 4FJZA 3NFNB 2G4EA 1SVCP 2QR0B 3AY2A 3H9SA 3MRHB 3Q8AA 5MI0B 5M94B 2JB6B 3SYQA 3UAJD 5TDPA 3GK8H 2AI0H 3FFCB 3BSGA 4FFYH 1NCHA 4DN4H 2ED8A 1I9IL 2O6CA 4I0KA 4JVUA 2AJYL 3AMLA 5FYKH 1AZUA 3U36A 5AKRA 1M42A 1N12A 3G08B 3PWVB 2MSPA 1UD3A 3MBWA 2E7DA 2QBWA 3PDOA 4ODWB 3SBWA 25C8L 4HHGA 4PH8A 3A24A 1MNNA 1TJIH 1Z9SA 4JPQA 5DVOA 1NCAL 3QUXC 4FHBD 5C3TA 2CDGA 3KPSB 4D0BA 1P53A 3O11A 3TTYA 4N20A 4MKTA 4WFGD 2W81C 4KU1A 3UAJA 2KPWA 3NCMA 2HLAB 2WO2B 1N4XH 1CK0H 1X5GA 1BD2A 2VISA 2VSDA 1KPRA 2XLLA 4P49A 1T0NA 3UGXA 2DEYX 3QCVL 4HH8A 4YJZL 2H8PA 4OB5L 2AV1B 3EADA 3HR6A 3RUGE 1ZVNA 3GZOA 3CX5K 2EDTA 3HMXA 1RJLA 3W81A 4AG4H 5FGCB 3I6SA 4FTVE 4HGMA 2R29H 3H2QA 5T3XD 3HRZC 4WNSA 2ZOTA 2CIKB 3EFOA 4RDQG 3VGAC 4KZ0A 1MRCH 4X5WA 2ZNXA 5D4HA 1HEZB 2ED9A 2PPEA 4MXQD 2KZKA 1JUFB 1QPPA 3F2LA 4AL8C 3RWHA 1DBAH 4JFFB 1NLBH 4O2FA 4ZBJA 3TBYB 3ZKQD 5T1KB 3L3JB 5FWRA 3B2XA 3BW9B 4M3KB 2PWEA 4JPIB 3SSGA 3ZZQA 2BSDA 1EQWA 1GZPA 1NCDH 2X87A 5CCGE 4XO4A 4DSYA 1D5ZB 4P5MB 1ZANL 4MQ7B 1F56A 2QEJA 4JY4A 1WFJA 4PRIE 5ICXA 1KLFB 3L8QA 4JFSA 5KG9A 1UWXK 4D7BA 2CUAA 1B6UA 1RFDL 2PXYD 2WQ8A 4A68A 1AXTL 2AQQA 4NFCA 1QRKA 2A6JA 1A7NH 3C5JB 4JDEB 2WN3A 3R0MA 4POZC 3IAGC 1YUHB 3KPMA 3VAEA 1S9VB 3KHQA 1U91B 1G43A 4EUPH 1ZLUH 3S8WA 2E9BA 2VJXA 3IMTA 3HE6A 4Z77B 2BW4A 5JA8B 2X6AA 5D7SL 2XETA 2IPTL 3QQ4B 4FFVD 3EXLA 5F6HI 5ANHA 5FM5O 3RBSA 2X5PA 3X3FH 1JYNA 5IVNA 2C26A 4HJEA 3KHOA 4XOCA 1N64H 1QKZH 3V0GA 2DLEA 2NY2D 1W8EA 2O6DA 3LXAA 4ONHB 4NUMA 1QFWH 2X4PA 4WW2F 3C75A 4ZMAT 3QFJA 4ICXA 1LM8V 1NEZA 3LB6C 3X11A 5IMLA 3IU3B 2CA3A 1QX1A 4GLRH 4K8RD 5SWSA 1NCBL 2P49B 1SLWA 4G7YL 1MHHB 1WFNA 3DPBB 4HPYH 2X6VA 1MCCA 1Z5YD 1E8XA 2A6DA 1GHFL 4KKCD 1OF0A 4UV4H 2ITCB 4L4TE 5CGTA 4ZQKA 4FJ6A 4L1TA 4AQ8C 4K07A 4O02A 3VFVA 3QFJB 1AKPA 1G9NH 2AXGB 4NC1E 3WEOA 5J1AA 3CZFB 3QIWB 4U3XA 3CFJB 4NDMB 1K5NA 4BGDA 2WZAA 3PY9A 4PJBB 3F01A 4JFED 3ZSSA 4X0NA 3SEPA 1E27B 4YBQC 1XEUA 2EDLA 3NJIA 3LNGA 1E4XL 4GS7C 1TMCB 4JVWA 3IJSB 1RXLA 4AXWB 4S2SB 2IG2H 3EJPA 2LU5A 1RH8A 5T1DH 1S6NA 2O5YH 5H94A 3W5NA 4RFEA 5C6TL 4UM9D 5J6SA 2IGFL 1CZ8L 4LHJB 4W4OC 2EVFA 1YY9D 2XTLA 4XAKD 4HIHB 4GQQA 4MJID 3PFUA 1MCDA 2BVOB 1R47A 4K5OA 3QO1B 4MDRA 1MG2C 1RZKL 1RUQL 5DD5L 1ZXQA 3EHBC 5EBMA 3BDYL 1YPZF 2CLZA 2ZUVA 4QOKE 1UXMA 3BMVA 4NFDA 4OD3L 1J05A 3SGJA 4UAOC 4CVXA 2JJSA 2R2EA 2WLZA 3I84A 2GJJA 4AEEA 4G6ML 1PLCA 2AQ3A 3DIFB 5IBLC 1E3FA 5DDHA 5DUJA 2AQTA 3KL5A 4MAYA 4ZNEA 1S7XA 2XXCB 2O93L 4TS6A 3FT4B 2X4RB 4BELD 1M57B 1O7DC 2JCCB 3WIHL 1AMYA 5CEZD 4P04A 4ODHL 2IPTH 3EYUL 3ILQD 5F7DB 3N40P 3BH9B 5CEZH 3CFKB 1GGBL 1GY2A 4FG0A 5LAPA 1EJ6A 3CX5J 2FT7A 4H88L 5ILTL 2H45A 2XYBA 5E9DD 1H8LA 5A2IH 3G6JE 5TF0A 4P0DA 3VRLE 3QG7L 1AXTH 2P52A 1H5BB 1XF2B 3P4OA 3NRPA 4IHOA 4P2OB 2VXQA 3QEQB 4OGXL 1P5UC 2F8IA 3CHRA 1HAWA 4HS6A 4R26L 3VFPA 1B9ZA 2ZOOA 3UCRA 1OB1A 4AXWA 3PABB 1YRKA 1J88A 3ZU8A 1A25A 5KBPA 1EO5A 1J9SA 3FAXA 1R3JA 3MBWB 4B9PA 1HSAA 3WS6A 1EUUA 1P4IH 2C3VB 2ALWA 2P5ED 1R17A 2EKJA 4LCCC 4DERA 4NHCL 1HYSC 3CPUA 3TCXA 3P9MB 4NO3B 1AGFA 4FQCL 4CBPA 5DD3L 4JS7A 2Y4SA 4YVNA 3BWAA 4QRQA 5JW5B 2ZG2A 2JCCF 4OV5B 2EDOA 5IBTH 5D6DA 2XZZA 3ARSA 5D4JA 2VITA 4B41A 4PY8J 5E08H 1V05A 3LRKA 2NY1D 4MJ2A 2BJMH 3Q05A 3VD2A 1BFOA 4L3EE 4HMEA 1BQ5A 5HYQB 5IMLB 4G8IB 2CGRL 3RVTC 4PRIA 3VSUA 2AKRA 4Z7OB 1JN6B 2DMHA 2XZQH 4HH9B 5DJ0A 5BZZA 4HU8A 5I1EH 4QF1A 2WXIA 2VE6B 4WSGA 5JW4R 1F4YL 4J4PD 1XD1A 2VDQB 3AS3A 3JVFC 3QEQA 5DS8B 1NCAH 1U93B 4ZFGH 1PKOA 3ESPA 3AQXA 4NBXB 2ZCHH 5GS1A 3KVDD 4OQ1A 5FF6B 4NQVB 4PS8A 2HX7A 3C6LA 4L2YA 2YPLB 3WKYA 3G5ZB 2K45A 4QF1B 2RA1A 2B3RA 1QI4A 3KPQB 4Z7NE 5CBEA 1VHPA 3U36B 1INDH 1WFUA 1F4YH 2YBGA 2WXHA 3ZDZB 5G4NA 1RKRA 3HFML 3OAYH 4PGDA 5MEOB 4S1QL 5FO7A 4ZMQA 4G9DA 1K4DB 5ACZB 3DX8A 4HC1L 4LBAA 2CGRH 3V4UH 4LPUA 2ZJSH 3IYLW 3H9SE 2DJMA 2VXUH 4MS8D 4YXLH 3FUFA 4JPIA 4QXVA 1J1PL 1FV1A 3J07A 4Z3JA 3PDGA 3JWOL 4JHAH 4JPVL 2XJKA 2CBQA 2GITA 1DVFA 4Q7DA 5FA4B 1A3ZA 1VFBA 4LOUD 4KKRA 1D9KA 5CP3H 5FLUA 5KZCD 1BLNB 1CYXA 4UMGA 3GHEH 3TTSA 2ZWLT 2OXHB 4Y2DB 3WIFA 4Y8AA 4F1SA 4JFFE 2OJZH 1RJLB 4JKPH 1IZKA 4Z7WF 3ECVA 1O9ZA 4IRSD 5IHLB 2D03L 3A6BH 2FYYA 4N3UA 3O6MH 4QHMB 2JK5A 2QGDA 3I3EA 3GLAA 3N9GH 1D9KB 4XHJD 4XNAA 5K5YA 3WCYA 1UWGL 3GMRB 1A0QL 1EERB 4L1SA 2WLNA 4YIQB 5DJCB 3HB3C 5BZXA 3ZMEA 3K2UL 3LEYH 2X2IA 1JDCA 3E80A 3BIAX 3QUGA 4YE0A 2LAAA 4RMUA 4U3SA 3VXSD 4YSCA 43CAB 3UBXA 2QSCH 3U9UA 2CO6A 1EAJA 1SN0A 3CDFA 3FRPG 3FT4A 5BV7C 4PTTA 4A04A 3RIKA 1UJTA 4KPHL 2N4IA 2XN2A 1IB5A 4L1BA 2V17H 3T6WA 3CDZB 1RZJH 1S9XB 3BT2H 1ET8A 2C9VA 1CS6A 1A4KB 2F68X 2V4LA 2A6DB 5AL8A 4AJYV 5EUKA 3BGFC 1UACL 3DIVA 1TQCB 3EYFA 4N0FB 2JB6A 1IJ9A 3PJNA 4WI7A 2ICEB 2OZ4L 4XBPA 1IKFH 1KTCA 4PPTA 4D8PA 4GMTH 2CHDA 4OM0H 4XBGA 2A4EA 3HE7A 4Y7OC 1AGFB 4NHUA 1N3NB 2VDRH 3VNZA 4F7EB 2ATAA 4HH9A 5DJ0B 1MN4A 1CDYA 1PZ5A 4ZX6A 4L4TB 4MQTB 3T4YA 3KPNA 4RISH 2EXWD 4CVZB 1ND0B 3LNHA 5C0FB 4R84A 3RKDD 4GW1A 1SUJA 4AQAA 4QXUL 5JTWA 4N2KA 4NWTL 5J4MA 3QYNA 1DE4B 5C6TH 1NC2B 1ZJAA 4LU5H 3CFEB 4PB0H 3TP4A 1ZPLA 4XC3L 3TWYA 3UJIH 1EO8L 3GS0A 1CIUA 3UZVA 3VTTA 2DM2A 5A2LH 2AEIT 4G82A 4O58L 1K9TA 5E0QA 2LABA 4XP9H 1KTLA 1LEIB 5GGUB 1RPKA 2V2WB 5EZJB 3VWKA 4TVSa 2E6QA 1HK6A 3CFJA 4NDMA 3US9A 4RMVA 1IRAY 1FO0H 4M4RA 1CE1L 4O51A 4ZFOL 2J71A 1XXFC 4WCYL 4ZW5A 2E76C 3JT2A 3SQBB 1QUPA 2GT9B 1RK1A 1E4JA 3JZYA 2X0WA 5IGXH 2ZG3A 3PWLA 2J88H 3UYRH 3VXUE 1RUPL 3GXUB 2XTJC 3VH8G 4D9LL 3FTXA 2IALB 4YX2H 5B22A 2ZE0A 2YZ8A 5KSVA 2VCOA 5E51A 2GHWB 3VI4F 2O26U 1I8IB 1OIOA 4LPTA 4UV4L 5CJOL 3IJYB 2FRGP 3TNMA 4OCXH 1W2KT 2LU7A 5DT1L 3TS8A 2W9LA 3ULVH 1JXKA 1NGPL 1KJVA 5E9DA 1GC1L 4PY8I 4HQQH 1XF1A 3QDMB 1PTZA 2K78A 5F8RC 1QRNA 2GJZB 3IMWA 2BVQA 2J1WA 4RAHA 4BXSV 1GTFA 1EANA 3ULSA 1LHZA 3ZHNA 5I6KA 4I3SL 1C1EH 3RUGB 4EI5D 4UDTB 1TT6A 1S9VA 1AIFA 4XPGH 1JWUB 4XCFH 1TQBB 2X6MA 4P4RB 3VWJB 3T0XA 2DQHL 4JJOA 4MAZA 2C7UA 1DN2A 1L0XA 4KI5F 1CURA 4UTAH 3JWNE 2CLVA 5LG1A 4S2SA 3LVTA 3H6JA 3HPJA 4R5XA 2OP4H 4AQEB 1GL4B 1FO0A 1UD6A 3ATFA 4IRZA 1IMHC 2CO2A 3WTWA 4QRTB 1KJ2B 2EC8A 4Z8FH 4KQ4H 1S5HA 3V52L 1P2CB 5EEXA 4OZFG 4OGAC 4U7KA 4P57B 3RWHB 4N0UA 3UIZA 2DKUA 4Z5RA 3WL9A 2C4FU 2BVOA 4LCIH 3S8FB 4U1LA 1FIEA 4QHPA 2WSDA 3MZTA 4N24A 2YD1A 3VW3H 4K3DH 2ZXEB 1QRNE 1L9MA 1TTBA 2XWXA 5T3XH 2HSIA 4HWEL 1GOHA 1U3YA 3M17A 3T65B 4J1UB 2XU9A 4G9FD 4XBMA 4TNWF 3CX2A 1UXWA 4JHUA 3KH3A 1ZAGA 1H0DB 3S36L 1Z6JT 4PJDE 3O3BA 5I24A 3TA3D 2A9CA 2F7PA 4MSWA 4FADA 4H8QA 5DS2A 4QRFA 2NQDA 1ICTA 5JHDB 4Y1AD 1I7TA 2ZUQB 3K7UA 5IQNA 2FHFA 4FQLL 3T65A 3QI9C 3HAEG 4GAAA 4WJKB 3X1GA 5A2FA 2D4FA 3MJ9A 3OHXA 1XH2A 2B20A 4XWOD 3UG3A 4DH2A 4PJ6A 4ALAH 3ZDYF 1DBML 5HPMB 3T3MF 2VN6A 2EZ0D 4TSAL 4CDGC 3DX7B 4IJ3B 2Y25A 2B4CC 3U9PH 4UV7L 4G6FD 1P5VA 4M8VA 2DD8L 3RGHA 3TA3C 4A38A 3VO0A 1A6VL 5JHMA 1XL4A 3LSOA 3T2QA 4X8JB 1IC5L 1T4KA 2EAEA 4YGVB 5B3NA 2QR0A 4XPFL 4LRNH 2CA4A 3LH9A 2FGWH 5F88B 3BDBA 1A47A 2COQA 1HIML 2Q76B 3FFCA 3HEIB 2UX6A 3FB6B 1ZS8A 1A6VH 3QJFB 4BFRA 1XGTA 4FXLA 2P44B 4NNXA 4AE0A 5BO1H 1YMMB 3I6KB 3Q5TA 4UIMA 1I9IH 5FYKL 1KBPA 3V6FA 3UBXB 4WO4A 43C9A 5ITBL 5E2TH 3RTQC 1R34A 5C1MB 2A77H 4PRAB 3VRLF 3FT3B 3O6LL 5FC9A 3BFQG 3CSBA 1RZKC 4XCEB 1MFMA 4IYKA 5CCKL 1CFSB 1DVTA 5ICYB 4LHQB 3QRGH 2GCYB 3Q5OA 2EVHA 4TLTA 3PAYA 5D4QA 4XX5A 1N0XL 4OBSA 5DVNA 3ULUL 2NNAA 2WBXA 3HIZA 3TESA 5L7XH 4H13C 3R8BB 3WFBH 3U0PA 1T7VA 2DLFH 3MA9L 3IPEA 5ALCL 5EOCJ 1KJ2H 2BVUA 3MYJB 4PLOB 2Y1ZA 4LSDA 2H8PB 1QBBA 3QVAA 3SBRA 3BKML 3VXSA 4E41B 1N6QL 2IH8A 4LP8A 2XN9D 3B6SA 3VFSA 3EXJA 2Z34A 4HGKC 3CIQA 4UILH 1JV5B 3MUUA 4QOKB 4XPHL 1Y0LA 1TSRA 3QO0A 1UOWA 1JZJA 4IRZH 1MEXH 2I9LB 3BVWA 4ZG1A 3ELQA 2BMKB 3BH8A 3AB0B 2O72A 3F58L 1JAEA 4PIBA 1HKFA 2Y7NA 3NPZB 4AGQA 5HGAA 1DLFL 1CTMA 4AQAB 1YYLL 1J9QA 1ZGLB 5I8KL 3NVQA 4NYLA 2D2CC 4CVUA 3JTTB 2OR7A 3T3ME 4KH2A 5D2NA 5JLZB 3QHZL 1XCWA 2BWDA 2XTJD 1DCLA 4LVEA 4D0DA 4PMFA 4XPGL 2VT0A 1RIUH 3ROOA 2O5XL 3EOAB 4F7TB 2HVKA 4U1NB 2C34A 3EW3B 1CICC 1H6UA 3FH5A 2PCPB 4KC3B 5GSRA 3IVKA 1H15A 1IEBB 2V8MA 5C6PB 1P5UB 2EP6A 2MEJB 3LKQA 3M46A 3LXUX 3V6OA 3UO1L 4HDIB 1UA7A 1AXSB 3HI5L 4TNFA 1JMZA 3C09C 4C83A 2OAAA 2QZQA 5BPPA 2DLHA 5HHXL 4CBZA 5EUOB 3KPTA 5CJOH 4NI6A 1HE8A 4OJDH 2WM0A 4TOYL 4ZS6D 4L8CB 1XH3A 5DRXB 3U30C 3DV4A 4HAKA 4LSQL 4I18B 5EO1A 3TPUB 3N2JA 4X5QA 4C83B 2ADYA 2WZPD 4EE2A 2XQYK 1NCGA 1AKJB 1X5IA 3HZYB 3KD4A 4F8QA 3IE9A 5FKAB 3RGVD 3L5IA 2H1LM 5C0RL 4IGBA 4QEGA 2P5EA 43CAA 1J18A 2G9KA 2IDSA 3MV7E 3BQUC 5C0CB 5LDSA 1AHWC 3MV7D 2Y7OA 4UT9A 5HHNA 3LB6D 3T04D 4B9YA 4OCSH 4PW4A 1X4XA 2M26A 1V7NL 5HI3D 2HMIC 5GXBB 1BMWA 4IRSB 4WQOA 3IN0A 3EJUA 3B8YA 4GY4A 2FR4A 4M6AA 1BFVL 3ZN6A 3ZDWA 3EJZC 4QRUB 2YKLH 1A7OL 4PV8B 4PU2A 4DESA 3VFWA 1JGUL 5F9JA 3ZHKA 5IKCA 1CT8A 1IEAA 4NT6A 4P9HC 2DIEA 4PJFA 1L9RA 3GIZL 4F2MA 1AQDA 2IO5A 1UYWH 4RAUB 3F7LA 1VRSA 1WFIA 3GHBL 3OKKA 3G6DH 3QO0B 2J5LC 2SEBA 4CMMA 4Z7UE 2ADFH 4KJWC 3DHJA 3U7AA 2P8LA 1J0ZA 4LKXB 2BSBA 1Z0MA 2HRHA 3NT0A 1LDPH 2EYRB 2WQVA 1T20B 1OAYH 3TPUA 1DDHB 3MO1A 1NC4D 2ZXDA 5ANMA 2X4QA 3ELAT 5GQBA 1X5YA 3SOBL 4JQIA 5E70A 3SCMA 3BZFB 3RKPA 5CBEB 2VLKB 4HYTB 4LSPL 1YMHB 5FS5A 2EDDA 4L3AA 3G6DL 4UTCA 5MEND 5DJ6A 3U4BH 4RRPG 1E50A 3CSPA 2AJ3A 3SKNA 3QUZC 4GG6F 4Q9QH 2BNQE