1ZPVA

Act domain protein from streptococcus pneumoniae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
b'NAMKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACT domain protein
publication title X-ray crystal structure of ACT domain protein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 22
structure length 85
sequence length 85
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13740 ACT_6 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zpvA00
1ZPVA 3W7BA 3L7OA 3O1LA 3ENQA 2DTJA 3AB2B 5FIIA 1UJ6A 2PA3A 3DHXA 5IT4A 3IXQA 2F1FA 2JOQA 2QMWA 2PC6A 2RQMA 4IO1A 4GO7X 5JJBA 2MDAA 3DDNA 4X84A 1U8SA 2RE1A 3UW1A 3TUZC 2H9ZA 3LUYA 3N0VA 2P9GA 4GMKA 2QSWA 2QRRA 2LVWA 1LK7A 3P96A 1Y7PA 1UJ5A 1LK5A 2CDQA 3LOUA 3AB4B 1XTZA 3K5PA 3MAHA 1YGYA 1UJ4A 1PSDA 1SC6A 2ZHOA 2NYIA 2JHEA 3CEDA 3OFFA 3OFGA 1O8BA 3DC2A 3OFEA 4LUBA 1M0SA 2KO1A 3MWBA 2LQJA 1YBAA 2P9EA 3ENVA 4GO5X 3TUIC 3TUJC 4PWUA 3OFHA 3IBWA 2P9CA 2J0WA 3S1TA 3U7JA 5IT0A 2QMXA 1KS2A 1LKZA 3AAWB 3HHEA 4M8LA 2I9SA 3KWMA 3NRBA 5IS2A 1RWUA 2F8MA 2RQKA 3ENWA 3DHWC 3OBIA 3MTJA 2DT9A 2J0XA 4NMLA 2FGCA 5T41A
chains in the Genus database with same CATH superfamily
5D0RA 3WBZA 3PX0A 4DSEA 2BOPA 4PG6A 1KSPA 1NSAA 3KUGA 3QWUA 1ZAVA 2GW8A 1HMVB 4ZP7A 4ES3A 4M5DB 1BQXA 2I8EA 3H25A 2UVWA 4CO1A 1RTDB 4ZCIA 4OV1A 4LFAJ 1YKWA 3T5LA 2DO0A 3QMQA 3PRBA 1JLQB 3TR5A 1B70B 2CG8A 4BHQA 1IKXA 1WI8A 3CEDA 2XSJA 2RHSB 2DKOB 2YX4A 4RPFA 5KFGA 2FLPA 4ZHRA 5KT7A 1WNEA 1MSWD 1RYRA 2CQ3A 2Z2YB 2XEXA 1K1SA 1XNQF 4USUA 5C24A 1C4CA 4UOHA 2IAJB 5IM0B 4S0MA 2HFUA 3HJVA 2BJDA 3KLEA 1Q16B 3HKWA 4YOEA 4X4RA 2LCWA 3CCTA 1SQGA 2HIQA 4YB6A 4F4WA 2B7CB 4KC5A 4PYDA 3LF0A 4I0WA 1RHMB 3OR2B 2UUAF 3KJFB 1X4EA 4E98A 4J9PA 4FYDA 1WJ9A 1YQHA 4C11A 2LEAA 1WEYA 3FSYA 4WE1A 3CDWA 4RWXA 1REVA 4AE5A 3KDNA 5K8MA 4DL5A 5IWAF 2XS5A 3KYLA 4Q0BA 1UA0A 4ZVPB 1YGYA 2ASYA 4IDKB 4DR1J 2CA9A 1RJJA 2XGPA 1SC1B 4USTA 3ZNJ1 3AXMA 1T9YA 2NCKL 3PFEA 1WC1A 3MM9A 3KLFB 1N32J 2VPWB 2F4VF 4OI0A 1EP4B 3TVZA 4FNHA 1VC6A 2Y1LB 2NXCA 1A0OB 1R27B 1FKOB 2R8HA 2A6OA 2AV5A 1XMQJ 4EZ9A 4QWDA 4IQXA 4J9SA 2OPSB 4M5NA 2V4JB 4E0DA 4B3SF 3EGZA 3WDOA 2DY1A 2IDLA 3FRZA 4WKYA 2KXHA 1UJ6A 4MKAA 4CI0B 4EYIB 3TAPA 1REGX 3UD3P 2E9RX 5CYMA 4OJHA 1P27B 4Q8EA 3RRHA 2ZE2A 3DDNA 2E5LF 5DGBA 4X65F 1V5VA 2EW9A 2DH8A 3KLGA 1VYAA 3I96A 3H4DA 3CMES 4HACA 5J2MA 1RT4A 3KLIB 3G8TA 1S49A 4L75A 4B3TJ 2EKYA 2AT1B 1P8GA 1Q95G 4DV4F 4HEA9 2CJAA 3GU0A 2W2QP 3KNGA 3T9NA 4KY3A 3ICLA 3JTPA 2VV5A 3EDRB 1FFSB 4BCAA 2OPPB 2LQ9A 3IN5A 1N48A 3IR5B 2XTJP 3MM8B 2WTFA 3UE2A 2R7WA 3HF5A 3IBFB 2Z30B 3LH2S 1Q8IA 3CDAA 4Y65A 4RW7A 2ZBCA 3ZFVA 3CMQA 1F9HA 1KRPA 3M8PB 5I3UA 2BZ2A 1VBYA 4IOCQ 4L73A 2DR8A 2KFZA 3WIVA 4USVA 3RZAA 2XMMA 3RGIA 4ILMA 1YDLA 2VQEJ 1SKRA 2SXLA 1TK8A 2CZVC 4X4QA 2HQ3A 2RSQA 2Z58B 1PJ6A 5KOXA 2KTQA 5CD4H 4PUOA 1LK7A 3ZZUA 4PAAA 2IRUA 3L4BC 2CIMA 2PT0A 3GG1A 1LEOA 4JI6J 4R5PB 2EVZA 1M1KT 1RWVB 4WP8A 3R97A 4OZ5A 2QEXS 4N8OA 2DYAA 4CO2A 3DOKA 3CJSA 4ZLJA 2HHQA 4ICLB 1U49A 2F9DA 4AQYF 2BOAA 3AAWB 5C42A 1DRZA 4WFAQ 3CCQS 2NZCA 1WI6A 2D3UA 4QIGA 4LRAA 2HFOA 2J8SA 5DDPC 2WZ1A 3UD4P 1LWXA 5GAEU 3PZPA 4K59A 4JI3F 1RLCL 1O6XA 3WHIA 2NZ4A 4A8FA 1NH8A 3BGRB 3SCJE 1MWYA 3D1OA 4GRSA 5A8KB 3V81B 2UXBF 2RIJA 3UDLA 2KT3A 5J1EB 3A13A 4DZDA 2B56A 4ERDA 1VIXA 2IVFB 2ACYA 2UUBJ 3M8QA 2B7BB 2LA6A 2YKMA 4P7VA 5F8MA 3M8WA 2CZ9A 2CJQA 4DV0J 3T1YJ 1KLNA 1NKBA 2YKPA 1RT1A 3DLEA 2CVIA 4C8KA 2J0QD 1E6YA 3HSJA 2V2VA 1H2VZ 1RSCA 4M94A 5E3AA 3BO4A 4E8UA 3MCOA 5J2QA 3PCOB 1G7CB 2AYBA 3TJAA 2E5JA 3O1LA 3QJJA 5A0YA 5BR8F 3CUNA 3MD3A 2KFNA 1S1VB 1NLKL 5C5JA 1EJ7L 4FF1A 4DFMA 1S10A 1AW0A 2IPOB 2HAIA 1X9WA 1MN9A 4P71A 3RW6A 5EWFA 1U7LA 4DPOA 1TQLA 2CDQA 2AHOB 5KTQA 4J9OA 3VZHA 1FI4A 3VQTA 3POTA 4X66F 5IQ6A 1RWKB 1HNXF 5AXMA 2R2SA 4ZLLA 4YQWA 1FNOA 2HNYA 4ALZA 2LXUA 3A4TA 4AD6A 3FBFA 1M0SA 1YJ9S 4RU9A 1H2TZ 2DHHA 3NCRA 2BE7D 3W8GA 2ROGA 5LMNJ 2HNDA 2XS7A 1TFYA 1B3TA 1W7WA 4YHHF 2W2PP 1OY8A 3MUVP 4PG5A 3IGVA 3OVBA 4CRJA 2PO4A 1EETA 5HLFA 2M88A 3BGUA 3W2VB 3TAMA 2HZCA 2RF2A 5AE2A 1AB8A 3BH6B 4HH0A 1UEVA 4DR2J 3BJYA 2IM3A 5J2NB 2O1PA 5EHHA 3S6EA 3DKDA 2DBBA 3TNVA 3CCZA 2WB1D 4KFBB 3HPOA 2Y1JA 3CD7A 4XDCA 4PRFA 1NXIA 1F9EB 2HBZB 2R3VA 1W25A 2BJ3A 1U6ZA 4X62J 1IQTA 4IUFA 5IT9Y 1UAWA 3RRGA 2I0XA 3MFIA 3UNGC 4GC7A 5B0FA 3HHLA 2W01A 4XTTA 2OMOA 3TUPA 4NLQA 3DFEA 2C3YA 4JUZA 1YITS 2ILZA 3U1MA 4C6AA 3US5A 3D6HB 5D0GA 3RW7A 2B8PA 1X5SA 2B4UA 1TL1A 1S0MA 2R7SA 2RDDA 3JAMU 3EXCX 3L7OA 4B9LA 4K4YA 2VFSA 1HWLA 3EVWA 1DBDA 4Y2KA 4DV2F 4G1QA 2RVJA 2XZDB 4YY3F 1DTQA 3CJQA 3W5YA 3VVTA 4CYUB 1AYEA 1LWEB 1CJVB 1EZZB 1JLEA 2M52A 3IO1A 4QR1A 1VQNS 2QFJA 4NCGA 5D4PA 1FX2A 2PMWA 3AQOA 4RW4B 4P2FA 1NZ8A 1MG7A 1WF1A 2H5JB 3W5ZA 5A6PA 3BYPA 4EO6A 2RRAA 2VG6A 4NA2A 1QD1A 1WSRA 3WX8A 5U47A 1RHQB 2LQJA 5DS7A 4CLWA 3QZ8A 3UVJA 3KJVB 2IDEA 3MAAB 1MROA 5IV4A 4YR2A 3FCVA 5L1IA 2I1RA 4BWMA 4X4OA 1Y9OA 3R5BA 3V4MA 2DNPA 2XC9A 1Z1ZA 1HQUA 2KXNB 4NXMJ 3S01A 2AJ2A 2IRYA 1VQSA 1LW0B 2VDHA 1CC7A 1RWWB 2J8AA 1SJ1A 3T9ZA 2LKZA 5HMYA 2ABYA 5EWGA 5KFVA 1JLFB 3HJFA 2KB2A 2GJIA 2QYGA 3C15A 5AT1B 1XMOF 3GP9A 3MF5A 4MIWA 3P8BB 3WX4A 3OSPA 2RKIA 3BM7A 1CS4A 3QT6A 4TVAB 2J5AA 1FERA 1VQ4S 3Q23A 4WKRA 3VAFA 4TLQA 2ALYB 3KXDA 2LXFA 1MMDA 2KO1A 4B02A 5HVHA 2KDOA 2O3DA 3SFGA 2HMIA 4DSJA 2NS1B 1RTHB 2ZJPQ 3QWPA 1JLAA 3IS9A 3H98A 2QIFA 5EX0A 1DLOA 1F9FA 3DOMB 3KK2B 4PR6A 7FDRA 4UY8T 3SCIE 3FJ2A 1UKUA 4RW8B 3TZWA 1UW9A 5DQIA 5AXLA 5F8NA 1XN9A 3FSIA 4IG3B 5KG5A 5LXYA 4OI3A 1TL4A 1WHXA 1S72S 4USMA 4LF9F 5D3GA 3EGNA 1JXLA 2MKYA 2IMOA 2HWTA 1HLWA 2GA7A 5I42B 4ZP8A 4GKKF 3OUYB 4OYBA 2CZ4A 3HCXA 2H1YA 3T19A 4URGA 4C8YA 3RTVA 5I3QA 3KNAA 1TFWA 2E1AA 3TZZA 2C3UA 5HP1A 4D3HA 1N32F 2FHOB 5KFFA 3NS6A 2G1HA 2MQPA 3GV5B 1KVKA 2DGOA 4DX8H 3AJDA 2F7VA 6AT1B 4NEYA 1ZAWA 3NGRA 3EUNA 1DQ8A 2YKOA 2YWFA 3BB5A 1N6QB 2B8QA 5THWA 3K57A 2HVHA 3KUEA 2GO9A 2YNIA 3PO5A 1MU2A 2DHAA 4H4OA 3O2IA 2MLYA 4ITSA 1JLCA 3W64A 5G4DA 2DPIA 4IFVA 1GNKA 3LANA 3ILOA 2FZCB 4ZKAA 2KL8A 1AFJA 4KO0B 1Q5VA 4OZ2A 3JXOA 1FNMA 5E3RA 1WOOA 3GR1A 1U1OA 2Y8YA 2K3KA 4F0KA 2BKPA 2ZM6J 2OAUA 4WBFA 4WXWA 2GCFA 4R25A 4L3NA 3ZO7A 2JHEA 3VVUA 5CH7B 3OD2A 4C0BA 2IBKA 3M8SA 3G6ES 1U2RA 1X8DA 1I94F 1IBKJ 4DPXA 5J2PA 3HSGA 1ACMB 3ZTQA 1MMLA 2MKJA 2BJEA 4KB7A 2XGQA 4PPDA 4OX8A 4OYXA 2XLJA 2ILYA 4NLWA 1VQ6S 3JTNA 4F25A 1RT3B 2VC0A 4F7VA 4XO0A 3MOJB 4TQRA 1S7IA 3UPFA 5FLXU 4ZJQA 3JYTB 2VJVA 4DN9A 4M5IA 3BZQA 1IR0A 1HYSB 5K8OA 1C2PA 2FB0A 2C22A 1J5EF 1BMQB 4W92B 3DHWC 2KYXA 5D0HA 5E3CA 4CT8A 3PKYA 3KLHA 4DF4A 4JI4J 1RGVA 1DQAA 3W66A 1JLBB 3RB0A 4K4WA 4DR5J 3R1LA 3I0SB 2ZH3A 3OVSA 1OPZA 4A48A 2MDAA 3GQCA 4DJBA 3J81U 4ED8A 1S6PA 4C0HA 1YIJS 4QWEA 3PHTA 1R6VA 3Q0AA 4PWDA 2MEWA 2G0IA 2K06A 2WVDA 1C0UA 4CDIA 2XO7A 4LQ3A 2OPRA 3PTWA 4DUZJ 2R2TA 1G1XA 1GXUA 1HBNA 3M32A 1B7FA 3MECA 4C3KA 2VPXB 3R2CJ 8AT1B 2RHQB 1HWJA 3KG1A 4ECVA 1NJZA 2DRAA 4KGKA 1U25A 3BREA 4KRWA 3DLKB 5D78A 2LDYA 2R7RA 3JS9A 4RZRA 1U26A 4NZ7A 5HO4A 2DNLA 3BGFA 1NDPA 4ZPDA 4TU8A 1WHWA 2JH3A 3G82B 2WVCA 3SYZA 2B51A 4DL6A 4QYZK 4X4NA 3FQLA 5A76A 2H51B 1JB0C 4O4GB 3JSRA 3NBPA 1ZOTA 3CJKB 4ID5B 1XNRJ 3R27A 3SXLA 1RT7A 3P3DA 3R5CA 4OZ0A 2IYIA 5KFSA 4AL7A 2QJ3A 3QAUA 1KOHA 3T1YF 3MEGA 2MSTA 2P9EA 4NLPA 3R7NB 3Q83A 2JEJA 2OSRA 2BXJA 3CD5A 4J9NA 1PBAA 5DDOC 5LSLA 1VQPS 3OL9A 5LL6d 3NGUA 2JEIA 4KQZA 2M8DB 1U0HB 4AYBD 4K4VA 1P9YA 3OBIA 4O44B 1HNWJ 1WACA 2VG5B 4Y2IA 1QY7A 1CJKA 5AE3A 5CCMA 5ETLA 1SI9A 3EZOA 4IG0A 1X4BA 3CJ0A 2KZZA 3H2UB 2GQQA 3J7ZT 4A8WA 2PSZA 2M9KA 3ZZRA 3QRQA 1W2BR 4F3QA 3IRXB 4JI2F 2DNKA 5KFMA 2ZHOA 3EMTA 1TL7A 3BGLA 2BDPA 4ELVA 4Y6IA 2Z2MA 4LIWA 1NUEA 3EDQB 1FKPB 3I4HX 2UXCF 4DV3F 1UCNA 3N6LA 1CG2A 2ZH4A 4B3MF 2FJVA 2YKNA 1IBMJ 4V19J 2DNZA 2UU9J 3FC9A 5LMNF 4G6VB 1TKZA 2HAFA 1FKAF 3HX9A 2MJNA 4CLFA 2IA0A 2LMIA 1R7IA 1QE1A 2LU2A 1P6TA 4P2XA 2FHMA 2QA2A 3K17A 4EEYA 4DR2F 4ED7A 2XS2A 1AZSA 2YNGB 2ZBQA 2U2FA 2XMKA 5F9NA 2G0CA 5B7WA 3OHBA 4BLGA 2RRNA 5DG9A 3I4PA 2W1BA 1U8SA 1Y5IB 3TX8A 2HURA 4K4UA 2XG8A 1ZTTA 3MR5A 1L5UA 1QUVA 3H90A 3TZYA 3A1YG 3FBCA 4X62F 2W9BA 4ANEA 5DETA 4RBVA 2UUCF 2ZZMA 2BRLA 3E01B 3BO3A 3UNYA 2I6WA 4QZVB 3MMBA 2X1AA 1WC4A 3R6LB 2CQPA 2DGXA 2RUGA 2D41A 4Y00A 1NRKA 1N4LA 1OPIA 3IGNA 1RTJA 3LO3A 4USKA 1YZ7A 2IM1A 4I7FB 5KT4A 3J80Y 1UVKA 1B0PA 1VGYA 3BSOA 2GFFA 2BYCA 3PJWA 3H42A 1RAFB 2PMHA 2I5JB 1JLGA 5K14A 1B0TA 1HD1A 3DRPB 5KFEA 4WU2A 3MTJA 4NMLA 3HVTB 1LWFA 1TL3A 1UVMA 3THVA 2OTJS 3FRYA 2V69A 1N34F 3AOAA 4AL6A 3PM9A 1CEZA 3DOLB 1S9EB 2A0FB 5HI7A 1HNVB 4LQ9A 2R7VA 2D3ZA 5DJBA 1CULB 4YR0A 1NZAA 2Z4PA 1KQGB 2VD3A 2I2YA 5F0WA 3GONA 2WB4A 1SH0A 4DV5F 2Q79A 4DQIA 4DSLA 1BHNA 1XTZA 1FCAA 4JV5F 4RBUA 2BABA 3GFZA 1D3WA 4DR7J 4U8YA 4J9UE 2AGQA 4NXNJ 3QLHB 3EZUA 4ZVTB 5IZHA 2MGZB 2RRBA 2AKWB 2A18A 3H8YA 3K89A 1U1KA 2XHCA 3MMJA 1P1LA 2CQHA 1VCTA 4F2RA 1WD6A 2MJUA 5HROA 3UD5A 4NI2B 2ZBPA 1IKWA 2N4DA 3ET6A 3NRBA 4NXMF 1XJWB 1KEKA 2DY9A 1VQLS 2B9EA 3ENWA 1RWNB 1VRUA 4PG7A 3NAIA 5KOWA 1R0CB 3AY0A 3LQVA 1C1BB 4K5RA 3BO2A 1K0VA 1G3OA 2H48B 2VF3A 3KJQB 3WC2A 3QRPA 1RWOB 3G6XA 3ADAC 2Q1LA 4GKJJ 4BDPA 2WK4A 2WONA 4G1PA 1A6LA 1T7PA 4L74A 2V63A 5D15A 5KFLA 3JQMA 2ZNZA 4OMFG 2ASJA 2NXJA 4RW9B 5J1NA 1EQ0A 3MEEA 3K2YA 1QAXA 1HBOA 1U09A 5KT6A 3H0PA 3U02A 4MFBA 2H54B 1Y10A 4LF4F 2N4CA 2GIQA 3RJMB 4TY8A 2FDNA 2W7PA 5C25A 2AJQA 5KFKA 1D9AA 3BV8A 3PYEA 3MM7B 4WFZA 4OQJA 5F3ZA 3SZ2A 4I2PA 4RUBA 2HZAA 4F4ZA 2FIUA 3PX6A 4K4XA 3LALA 2IYGA 3DXBA 3VGVA 5T7LA 2YXLA 2F8EX 4JI8J 4OX9J 1KKHA 3HHNB 1E6VA 3TZXA 1RT2B 2J6TA 4CM0A 3H59A 4PEOA 4Y2AA 4M5GA 5B08A 3K58A 3T6JA 3D67A 5K8NA 1IM4A 5IXUA 2P8IA 1VRTA 4KV8B 3QIPB 3HI9A 2NUHA 1XR5A 1JKHA 1VOMA 2HSEB 1VQYA 1XBWA 2V9WA 3DU6A 3IG1A 4DV1J 2HVZA 3DC2A 3A8JA 4IRKA 3MPYA 1SV5A 2CKWA 4FS1A 2CG4A 4LBHA 1T8EA 4PWWA 1FHTA 2MQQA 1DTTB 3HSZA 4ELUA 2C2EA 5B09A 2ACMA 2JLEA 2J76E 1WF2A 2X3GA 2V4QA 3G71S 3G8SA 2GMLA 3CJ3A 4EWTA 2JNJA 3VAMA 2AJ1A 4ILRA 3PXGa 1HNIB 2IC3A 2YNFA 2ZH5A 3TRGA 3QQCD 2DNRA 2UVRA 3KK3B 2ZH8A 4PCQA 3GR0A 2DNYA 1RAIB 1GXTA 4LSNA 1HBMA 4R0EA 1KFDA 4KHPJ 3UWTA 5F8IA 4XPEA 1U24A 3M2UA 3F73A 4ZPTR 4F26A 2OIHA 1IBKF 4NYZA 4RWWA 4ED6A 1FT8A 2B5JA 1HPZA 1TK5A 4EYHB 3C6TA 5DZ6A 1YG0A 2CPEA 3LGMA 1RWPB 4P52A 5C7PA 1S6QA 2QLJB 4K5SA 3EE3A 3LAMA 3UN2A 1CJUB 1B7YB 1VJWA 2WSEC 2VOOA 4F67A 3JQKA 4ZA1A 2NLWA 3B4MA 4G1IA 5M2RA 2Y1IA 1Y00A 4DS5A 2WVFA 2QGFB 4DMZA 2PGCA 3AOCA 3AD8C 2GVZA 4JI4F 4FYVB 3W7BA 4YDDB 2VIHA 3VAHA 4WF9Q 4IRCA 4IO1A 2XMTA 2CQ0A 3GLJA 2XM3A 3PX4A 3V6HA 2EI5A 1ZAXA 5DM7Q 1KFSA 2F8HA 4I68A 1UFKA 2AEMA 3BQ2A 3SQGB 1Y7PA 4HHJA 4ZLNA 1FO1A 1D8ZA 3DM2B 4J5OA 1XNQJ 2WSFC 5AXNA 2E5IA 4ZIWA 4ZN3A 3KK1B 1FJGF 1S0VA 2CWXA 4LSZB 3RB4A 1RYSA 2OPQA 2DXFA 3W61A 2N82B 4CTAA 2EC0A 2DK2A 2BANA 1OYDA 2JEGA 4DPTA 2UUAJ 3HHEA 1WKJA 3SIPB 4Z7CA 3I0RB 4LSLA 3PG9A 4F8RA 3G87A 4EZ6A 1BGXT 3TQEA 1T3NA 1YRTA 1D09B 1VDHA 4OIXA 1N5VA 2RS2A 3CMAS 4LT6A 5IWAJ 5KFRA 1PKUA 1SUQB 2HG4A 4FPIA 3C46A 3W9IA 2QA1A 1Q82T 4PZVA 3PYFA 3UR3C 4DEZA 3NWRA 4Z37A 3T1AA 1UVLA 2AYGA 3OQ2A 5L9NA 1IKVB 2OI2A 3DDKA 2QA4S 2MKCA 1RKJA 5KG4A 2ZWOA 3Q8QB 3GJTB 2Y0SD 4MMOA 3Q2SC 1XR6A 1XNRF 1EKSA 5E5NA 2F4VJ 3QO9A 3TVKA 3GIIA 2E5GA 4P72A 5ETNA 4L72B 1BD6A 1WELA 2RNEA 3UCGA 2ATCB 2CQBA 4HKQA 3D6FB 3D0GE 3GIKA 3DN9A 1B0VA 1ZZNA 2ZUGA 3I5BA 4B3SJ 2QE5A 1N36F 3GG0A 3U7JA 2H3EB 4NEZA 1RT5A 2BEFA 5BJRA 3B4DA 2B4PA 3EXYA 5G0RA 2NSCA 3A3PB 1HNWF 4RW6B 4QU6A 3KFWX 5HN0A 1U45A 3S7RA 2G2OA 3CCMS 4X65J 3IRWP 2WAQD 2QLWA 1UWBB 1R0BG 1HMVA 4M5DA 1IXKA 4A8SA 3DLGB 1FA0A 1RTDA 4DV6F 2VDIA 3LWLA 1IR2A 4X4VA 4B3OB 4NLXA 1SL0A 1JLQA 3RAMA 2DEJA 3GCXP 4V1Ak 4TN2A 1AT1B 2V94A 4TLRA 1CPZA 3QJLA 4GC6A 3GJQB 1AUSL 1HL6A 1KC8T 2MZ1A 4EBEA 3T6BA 1UFLA 5AXKA 3I82A 3R5AA 2J9CA 1QM9A 2J9DA 4PG4A 2RU3A 1KVIA 4WFNQ 1Q8BA 2M3DA 1R8BA 3I31A 3LWMA 1KONA 4Q2MA 2IAJA 2UVUA 2BQUA 3EZ5A 2AP6A 1YHQS 5IM0A 3O8WA 3P45B 4DF8A 4U7UD 3BQ1A 4PQUB 1MNEA 4O3SA 4Y0FA 1BQNB 3CC7S 3OR2A 2VH7A 1BY9A 3MMCB 4ZP6A 2MKHA 2J0XA 2EBEA 1CLFA 1F0XA 3L09A 3RAXA 5KFDA 3D7SB 3MR2A 2AYMA 3EPGA 1UL3A 2VPZB 1SQEA 2DGUA 4ZJOA 4WZQA 2GV1A 4IDKA 3GYXB 3GIMA 2FGOA 1Q1KA 4OX7A 3WQPA 3M9MB 2FY1A 3MCSA 4ECZA 3I9ZA 3IWLA 2RH3A 2D69A 3AH6A 3KLFA 4OFZA 1JXVA 1F5BA 3AD9C 5I3PA 2ZBRA 2DPJA 2BW7A 3AFGA 4I6WA 4ANDA 2ZITA 3PRVA 2IFXA 4IOAQ 1EP4A 4FP9A 1X0PA 3HZEA 2VFUA 3MDFA 5LJ3Y 3W9JA 4NLDA 1S9FA 3TAQA 1FKOA 4C0OC 2XI2A 1BUXA 2OPSA 2OTLS 2V4JA 4TKTA 4NE9C 3F44A 3UFCX 1AXQA 3LP2B 2K7KA 5A8WB 3D1QA 3MPVA 4F4XA 1M5OC 2IA6A 4JI3J 1S9GB 4YDXA 1U1NA 1SC3B 1NHUA 4WWSA 4NYPA 4LR7A 2HFSA 1UZHA 2JVOA 4ECWA 4JI7F 3QPIA 3V2UC 3G6YA 2OFHX 1Q4RA 3N6NA 3KLIA 1G6BA 2KT2A 3N0VA 2W8LA 2FJAB 3D0IE 3IAM9 3QZ7A 1TL1B 2V8VA 1GEHA 4K4TA 2VICA 3HHLD 2KU7A 4IO9Q 2RQ4A 2G9OA 2EFQA 5KFZA 2GHVC 1K8AT 4F0HA 3DLJA 3R9LA 2YPYA 1TR0A 4OI2A 2BKNA 1GTEA 3MM8A 1S79A 3LP1B 2V2QA 1FJ7A 3GWCA 3P49B 3ILLA 4IQMA 2WW8A 5ETTA 3TWZA 5BR8J 4DQPA 4I6YA 2VQFF 1ZZFA 1S7HA 3M8PA 1RWXB 2E7VA 3K5NA 1NSQA 5T41A 5E3PA 3M8ZA 2IJRA 1IR1A 2AQ4A 4QR2A 4RL1A 3IXQA 4LF5J 4J9VA 3H5SA 2QV6A 1HBUB 1S4FA 5JJBA 4DFKA 2QTWA 4X66J 2HKEA 5SUHA 3PYGA 4F4KA 2Y0BB 2VZ9A 4O3NA 2CNLB 5F8LA 5EWEA 2K8GA 4CH0S 4WU3A 2OKQA 2HHTA 1OY6A 3LAKA 2GIFA 1KQKA 2AF6A 4RBTA 4R5PA 5CXTA 4DSIA 5HANA 2W2NP 2WSCC 4DUYF 3MUTP 5H9EJ 1OSCA 1K73T 1T9TA 1YSJA 2F3JA 4YHHJ 4LBPA 4RNMA 4ICLA 4C3LA 2Y1RI 3UCZP 2MTLA 1TVRB 2Q6CA 4ECYA 4RNNA 5IT0A 1T9XA 2V68A 3PW7A 3D0HE 1RAEB 1H6KX 3A8KA 2GMHA 1VI7A 4OX9F 2XY5A 2CXEA 3NMRA 1HHSA 4DX5A 5F0UA 1TUVA 2V8GA 3DYAB 1WG5A 4OZ3A 4PKDB 2IY5B 4DQQA 3KUHA 1KQSR 4YB1P 3BGRA 4DU7A 4OYPA 5A8KA 1SL2A 3MAQA 2VBZA 2QRRA 4QWAA 4DPWA 3GSIA 5KFCA 4ZPVR 5J1EA 4P10A 2JLFA 1HQEB 3HFKA 3VGUA 3H40A 4ZIVA 4YS2A 1HQ2A 2ADCA 3V5RA 3HO1A 3W3SA 2AYEA 4LIRA 3U1NA 2R7QA 4YFUA 4C8MA 4RJVA 1VMBA 2DJWA 3FKBA 3CDBA 4OLOA 2W7OA 5DQGA 3J7AN 4HTJA 2ZWPA 3VWSA 1ITPA 1EARA 2APOA 3MPUB 1S1TB 3HFZB 2XY7A 3SSQA 3NS5A 5IT9U 7FD1A 1VQ5S 1LWCB 1HIYA 2BACA 2H5EA 3D4JA 2XCPA 5A2QY 4DV2J 4YY3J 3CDUA 1EIYB 3CD6S 4FDFA 1S1VA 3MMAB 1H3DA 3AB2B 3DHXA 3VQSA 4M5LA 1YJUA 2BUNA 3DRSB 1WG1A 1J5OB 4JV2A 2AJFE 1D1UA 4CNYA 3BYRA 2N3OA 2RILA 2DVIA 1BXNA 2W25A 4IYQA 3QRRA 2MKSA 4IR9A 4MH8A 3AQPA 3Q24A 1ZM9A 1C4AA 2B6AA 1NDCA 2VASA 2K1RB 3CIMA 2N7YA 1HR0F 3RBDA 2XMAA 4F3OA 1X9SA 1TMJA 3PO4A 3I5CA 3EGVA 2Z56B 2W9CB 2E1CA 2YQ3A 4KJIA 3K8WA 1Q81T 1YBTA 1Y5NB 4E2FB 3J7YI 3TA1A 1T11A 1SJRA 2YNHB 3W2VA 4M95A 1V3RA 5IS2A 1V3ZA 4I1TA 2BKOA 2JL9A 3I9V9 5J2NA 1XMOJ 3AOBA 5FIIA 4FBTA 1XC9A 4KFBA 4BC7A 2HBQB 3B82A 1WTBA 4WCEQ 4C8LA 3PACA 4QOTA 1RE1B 3BR8A 1WKKA 2VKRA 1JJCB 4EUVA 1VFJA 3MM5B 2NXNA 2PD1A 3OL6A 4M63A 3CJ4A 4OHXA 2RB7A 2XI3A 2LECA 4N5SA 4RUCA 3EGWB 2F40A 3QFWA 5KFUA 1WC6A 1PYTA 5JUMA 2JZ5A 4A8KA 2AU0A 1UPPA 5HMZA 4I64A 1JNZB 2X3DA 1JJHA 3N01A 4C48A 2UXDJ 1RHKB 3PKMA 3A3NB 4ZMMA 1KHVA 3HM9A 1TKTB 4FS2A 1FD2A 3AODA 3GYGA 4HI2A 1UP1A 3Q2TC 4LFBF 5L39A 1NK7A 2YPZA 4B9UA 4DLGA 3M32B 3B78A 2HNZB 1S4EA 2OEMA 3S8SA 4LF9J 3M6VA 3MGJA 4JP8A 1VQMS 5AJ3J 2AIRB 1FVSA 2KYZA 2R8KA 2XO6A 4CLLA 3TEHB 4GKKJ 3M9NB 3ISZA 2HFVA 4CYUA 1LWEA 3H5YA 2XZWA 1DFDA 3TEGA 1CJVA 3O44A 1HWKA 2LQ8A 4RLEA 4RW4A 2POKA 2JLGA 3OTBA 2FLNA 3MCNA 2W4PA 2L9WA 3KJNB 4QW9A 2VA3A 2OMLA 2A6MA 3LTOA 5JVHQ 4ZPWR 4PXDA 4U9RA 3V6DB 3BEGB 2WVBA 4LFCJ 3L9ZA 3KJVA 2K3IA 2CFXA 3MAAA 3JQJA 2R42A 4QPTA 1T03B 2ZOMA 4OI4A 2YWWA 4PXEA 1RT7B 3ETOA 1C1CB 3NNHA 4JBCA 1LW0A 4X64J 5KFIA 2CAJA 1N0UA 2DT9A 4EK2A 1JLFA 3ILIA 5B0AA 1RLDA 2C2RA 1QJHA 2B0GA 4JI1F 2PC6A 1X9MA 3TI0A 3V6JA 1FE0A 5CA5A 2WOMB 4LRBA 1WEXA 2D9PA 4MT1A 3PRDA 1I94J 2KHDA 3B6BA 1FXRA 1ULRA 1Y4ZB 2FZGB 2LDIA 1LNQA 4H4MB 1S1XB 3OPKA 1Q78A 3IA0A 4XDDA 1MMNA 2XY6A 2X51A 1J27A 4B9NA 1TKDA 1WHYA 3QGPA 3FEYB 2C2KB 2PN6A 4W90B 1PAEX 1RTHA 1VQ9S 4QIWD 1HI0P 1U48A 4WFYA 5F9LA 2MKIA 1J5EJ 3LGNA 3DOMA 3KK2A 3EYZA 1IJFB 4RW8A 2CPYA 4OI6A 3R3TA 1Q86T 3W5XA 2D7SA 1TK0A 4IG3A 1H7XA 2ZFHA 2YKNB 4LR9A 2Q3PA 4ELTA 3GFHA 1NK8A 3D66A 5I42A 3WIUA 2XMJA 4AXJA 3OUYA 4ILLA 3CO9A 4MK8A 4HDGA 1QVFR 1RBLA 3MUMP 1OQ3A 1FRXA 3AHPA 1SC6A 1NK4A 2GJ2A 1UZDA 5IC4B 1Z2ZA 2XNRA 4RR5A 2XNQA 3LPYA 2A1BA 3M4XA 1HNZJ 3NOCA 2GGPB 2BE2B 3KTQA 3BPDA 1LXJA 1F60B 3UDEA 3BDEA 1N6QA 3FFIA 2DNHA 4KPCA 2BQ3A 3CE8A 4C2MA 2HQFA 2QA4G 3HHKA 5KAKA 3C6UB 3R5GA 4JI5J 2NSBA 4LF8F 3KKFA 1LOUA 1X4AA 3GMGA 3R6GB 1SVDA 1V9OA 4KO0A 1U6BA 3ZZOA 1T9VA 4ZITA 2QLBB 4IH7A 2MZRA 3MOZA 4DX6A 3J7YU 1PIEA 4Z2XA 1LXNA 2EWHA 1Y3JA 3Q8PB 4TQSA 2ZH6A 2C2MB 3NL0A 3LUYA 4GMKA 2DIUA 1OWXA 4KHMA 2RQCA 3BDPA 1JLGB 4ECXA 1J2VA 4FVMA 1LQ9A 2IBOA 1Q7YT 2W8KA 1F5AA 3I56S 3FGVA 4K2XA 5LJ5Y 2AX0A 3PJXA 5FDLB 2H4WB 1HA1A 3WZ0A 1RT3A 3VAJA 3M9OB 1YRXA 2HHHF 3BF4A 2M70A 4URSA 3JYTA 2JEFA 1SKUB 4LRDA 1HYSA 5CAAA 4ZN1A 4YN3B 1FRKA 3W2WA 3H4BA 3NLCA 5KFOA 1ZM2A 2P6SA 3C14B 2W4CA 3H2LA 3MXHP 1DQ9A 2HVIA 1JLBA 2HLUA 4A8YA 4LF5F 3I0SA 1FWLA 5IT4A 2UUTA 2E1MC 1KBRA 1SJ3P 4JI2J 2KVIA 3QSYB 3DGPB 1HI8A 1BQMB 3GFYA 3NGSA 3P96A 3C3LA 4YR3A 4FXVA 4ANCA 2UXCJ 4DV3J 4LBIA 2FY8A 1NMEB 3CDEA 4B3MJ 1RA7A 3HFVA 1NDKA 2AZ1A 3K7RA 2OGUA 4A8XA 3ZZ0A 1PGZA 3OFEA 1S6OA 1GFWB 3N28A 4C3MA 3DXSX 2AEJA 3ISND 4QU7A 5CYQB 4OYWA 3ENVA 4FYYB 1R89A 1H98A 4Q7AA 2M7SA 4DQSA 1ELOA 3DLKA 5ADZA 4FKXA 3ISNC 2YX7A 1QAYA 4EBDA 1IM6A 3D28A 1EKRA 5HVFA 5EGYA 1UTAA 4OYZA 4WJBA 2CJXB 1RAGB 3G82A 5FD1A 2A3JA 4LMZA 2B9XA 2MQOA 4CWBA 4I2PB 4NZ6A 3BR9A 1NDLA 4O4GA 4EMDA 2UUCJ 3CJKA 4ID5A 1M1HA 1FXDA 3FUYA 3Q86A 4QIVA 2F65A 2XMWA 1HW8A 1FWKA 3D6MB 1RTIB 4C7QA 2R7UA 5KFQA 1IBLF 5F8JA 5ETPA 1T3OA 1Q79A 5D4OA 1O8BA 3HHDA 3RG6A 4QWCA 2ZJRQ 4QBUA 5DGAA 3MWBA 4JV1A 3MURP 3OTCA 3ITHB 1EAYC 2CNOB 4PWUA 1FK9B 2HW3A 4OYOA 1RU1A 1RTZA 1U0HA 1N34J 4O44A 2ZDOA 2VG5A 2FVCA 4NMXA 1BWVA 4RKUC 1U1RA 1SV5B 2CQDA 1ZH5A 2ZHAA 4WP9A 1SH3A 2QZ8A 1U4BA 2LEBA 4DV5J 1YVFA 3JSYA 1UW4A 3CC2S 4O23A 4JV5J 1L3SA 3UDCA 1SJ4P 5ITHA 3J80U 2RDJA 3HVWA 3IRXA 4NRUA 1GMUA 1KLMA 3BSCA 5H9FJ 2ZHBA 3ZTRA 4LRCA 3VAGA 2XHWA 4A4JA 1L3UA 2HHVA 3ZTOA 3OTOF 4LF1A 4RNHA 1S1UB 2R2RA 3BQ0A 4Q5VA 4QR0A 4DCOB 4TYBA 3GV7B 4N77A 4DX7A 4FYWB 3PEHA 4I69A 4WTYA 4CO5A 3GJRB 4OZLA 1K9MT 3KG4A 2G13A 2OD4A 5F8GA 3R8YA 1VIOA 4HH1A 3M7VA 2V6AA 3SSRA 5IV3A 3G2XA 4XK8C 1B99A 5ETRA 4KGXB 4USHA 3JTOA 1N5YB 1ZA1B 5SZTA 2YNGA 1I6JA 2DEIA 1WC3A 5ETSA 3JSBA 4QIFA 1GX6A 1FE4A 1T05B 1WDTA 4ED0A 2WRMA 3FNNA 4HI1A 1FDDA 1ZYQA 4ED1A 1RBOB 5L38A 1RU2A 3N5FA 2R7XA 3TOQA 3IM9A 3MTKA 2XYHB 1JK9B 4BBYA 5H1SV 3OJUA 2E44A 2IVYA 4LF4J 3E01A 2ZVIA 4Y2MA 1L3VA 4DN0A 1TKXB 2NPIA 3I6PA 4I67A 4DG1B 4WYLA 1VISA 1PC5A 4KT0C 4LJMA 4LVNP 4YEAA 2UXDF 2X1FA 4I7FA 2BX6A 2UV8G 3C8YA 3VHQA 1RAJA 1T9UA 2Q66A 2I5JA 4FNIA 1YLXA 3DRPA 4PYAA 4CP5A 2WVEA 3HVTA 1WUUA 5AJ3F 4NRTA 5F8HA 4OV6A 1R6YA 1PBUA 2GVDB 5HMXA 4GVBB 2OO4A 3DOLA 1S9EA 1HNVA 3N9UC 1JX4A 1CULA 2A10A 1Y0HA 1W26A 2G0JA 2EKNA 1YK9A 1S99A 4HDHA 4OZNA 2DCLA 1NU4A 3MM6B 3T5KA 4H4KC 2CDRB 3V4IB 3RBXA 4CH1A 1Q7LB 3D1HA 2WBRA 3HD1A 3QLHA 1G4CA 1XIQA 3H5UA 3NS7B 5T14A 4O3PA 2YWEA 4UQTA 2A2CA 2MGZA 1R8PA 4DCPB 1U2CA 2HBYB 4ETXA 2V8HA 4KGZB 2HEKA 2KFYA 5K8PA 4LFCF 4DL2A 2YWHA 2W2MP 3MHYA 3M30B 2CQCA 1U0SA 4ZS6A 4WFXA 2PI4A 1GX5A 1PJ7A 3EICA 4NI2A 4K50A 3OV7A 4O0NA 4I6AA 1EHWA 3Q8YA 1TAUA 2FJBB 4X64F 1HW9A 4NASA 1C1BA 1RT6B 2W24A 4M1KA 1S57A 1RB0A 2GHPA 2DR6A 1ZPVA 1YX2A 4F4YA 2FC8A 1HARA 1NBEB 4DR4F 2I38A 3DMJB 3BN4A 2GX8A 4DFJA 1RT5B 1R8CA 3I87A 4DXLA 3DRYA 1M5SA 5DDQC 2PMZD 3CJRA 3M2VA 2XWYA 5ETOA 1UJ4A 1NH7A 1N56A 5CYJA 1SIWB 2FTRA 2FVPA 1X60A 4DZ6A 1H73A 3ENAA 2VPYB 1IWGA 4RNOA 3CJ5A 4LUBA 1R0AB 3WC0A 3MM7A 5DZ7A 1K1QA 5CZVA 1TV6B 2ZNYA 2HRTA 3VTIA 2DCUB 3ZTPA 2PIIA 2J0WA 3RU0A 4NCAA 2KI2A 5GMKa 1H2UX 1PYSB 1F5CA 2DNNA 3UN3A 2KZMA 3UR0A 1RT2A 5D4NA 2BJ7A 4U8VA 5E0OA 2VKZG 3DRRB 4CLUA 2MKKA 4N41A 2HGNA 2JRSA 1LW2A 3JSMB 2UV8A 3E2EA 4KV8A 3QIPA 3ZZTA 4P74A 2M0GB 4K0KF 1T9WA 3U27A 4ES2A 1BLUA 3T5HA 1FJGJ 3CSKA 3FEZA 4WZMA 2EG2A 4UT4A 2ZKTA 1ZS6A 3T1HF 2O66A 2HK2A 4N47A 1HNZF 2DD8S 5KFJA 3CT9A 5KG7A 2ASLA 3C16B 1NK0A 1TUWA 3BKTA 2O01C 3CVKA 2BJ8A 2AJ4A 1VR6A 2HHPA 3UCUP 1UWAA 1DTTA 3I5AA 3W65A 1R8AA 2W2OP 4FVCA 2Z0GA 1WKLA 2L08A 3BN7A 3C19A 3TUJC 5BYSA 4DL3A 2MHEA 2ZD1B 5HATA 3FZ2A 1ZM4A 2DRDA 4DLEA 2B43A 2GS8A 4DL4A 4JI5F 1SJFA 4NWBA 1HNIA 2CPFA 1IUJA 4DPUA 4P2SA 2MQLA 1DHMA 3E3XA 5BXIA 3KK3A 1HHQA 1GK8A 5LXRA 4MIBA 3TA2A 1PYOB 1CSJA 2VFVA 5I4MA 2BR0A 1CJTB 1DAXA 4WIQA 2P9GA 3EX7B 2IM2A 3BPSP 3LP0B 4PXCA 1TELA 3SDEB 2OFGX 4OZ1A 5HBMB 4ECTA 2VBXA 2ROPA 3U1LA 4C8OA 3C66A 1DY3A 2EFNA 1F3FA 2RMLA 1N36J 2M5YA 3DI6B 1OO0B 3OLBA 2PEHA 3H20A 1CJUA 4JYAF 4RUAA 1URNA 4ZVFA 5LOQA 1M5VC 5KFHA 1X5PA 3IC1A 1RP5A 5IQQA 2V50A 2F4FA 1RK8A 2I9SA 4U96A 3M1VA 1VK8A 1Z4UA 1MN7A 4ZOSA 1OJ4A 1KHWA 2IRXA 2C3MA 1S1WB 2GHWA 9RUBA 4DV6J 3HP6A 3N4WA 2XWXA 2VOPA 3D54A 4NA3A 2HVEA 4DR6F 3SQGA 2VG7B 1HFEL 2GQ2A 2CUYA 1QUPA 3MR6A 2AX1A 3DM2A 5MLCV 2FVRA 3QATA 5B0EA 1U1LA 2M2BA 4MJKA 4NLSA 1FDNA 4DSFA 2Y8WA 3KK1A 4FF4A 2HQCA 4I2QB 3NGDA 2JDJA 1KTVA 1VHIA 3MCMA 4EFAC 3OR1B 2DGWA 2RJZA 2MHNA 3RR8A 3MR3A 1YBAA 1S76D 2W9AA 1GMWD 4KKOB 2VBYA 2LQ5A 4DUTA 2EEYA 2ALZA 3I0RA 1VLYA 4R0JA 4ZVEA 1XQIA 1N33F 1BC6A 3DDIA 5LM7E 2FJWA 3KWMA 1F2HA 2VC1A 2ERRA 2MLZA 4MAKA 3AA9A 1SUQA 4X4UA 5K9FA 3D9BA 4R8UB 3N5BA 2PA3A 2OH2A 4WTOB 4MIAA 2ZUAA 2BVZA 1H0HB 5A8RB 5GVQA 2CWKA 2QMWA 3K59A 1FDAA 3A8EA 1IKVA 4IFYB 4GO7X 4MYTA 1SPBP 2N7CA 1KTQA 3HD2A 3M2RB 3AXKA 2F5GA 2E66A 2E7XA 4WK3A 1PSDA 2ZDPA 5B0DA 1OS5A 2J9DE 3SEOA 3GSDA 3HK2A 4ID8A 4DQRA 5GADU 2G2YA 2ZKUA 4EBCA 7AT1B 4NLTA 1SKWA 3PEJA 4GO5X 3DLHA 4X4TA 1RCOB 2XMUA 5KFBA 2NUUG 2V67A 2YX1A 1VLOA 1NSKL 2IJNA 2FD2A 1YJTA 2IHR1 4RW6A 4Q8FA 1CC8A 2QG9B 3X3UA 3PR4A 5C2GA 4JI7J 1RQ0A 3CJ2A 1UWBA 1PCAA 4HHHA 3SV4A 5DRKA 3EVOA 2OJ3A 3DLGA 4O3RA 3ENQA 2DTJA 1WG4A 3M6WA 3MEDB 2CADA 4B3OA 2HK3A 2ZOGA 3M8RA 1VJQA 1T02A 2E29A 4GVLA 2FVQA 1FNXH 1IJEB 3BH7B 2NR0A 3VGTA 3N79A 4NLGA 3VCDA 1FRLA 4CT9A 2G1DA 3HVRA 4ZPCA 2M8HA 1C0TB 4L76A 4USWA 3DLLQ 4IOBA 1IQZA 4PQUA 2VQFJ 2MLXA 4IRDA 2GIRA 4JI0J 2CPXA 1BQNA 4CLSA 3PFOA 2B6AB 3MMCA 1RHRB 1IKYB 1YJ7A 4C98A 5GAHI 2D9OA 3IMQJ 4CLPA 3IWXA 2E1PA 4ECRA 2KG1A 3KG0A 1HWUA 4P75A 4RO0A 5GMDA 3BSNA 3MZIA 1FWPA 3CJTA 4IKAA 3VF0B 3B8HA 4B3RJ 2J0SD 4DUYJ 4J9KA 3DNCA 4AXIA 9ATCB 1YJNS 2KHCA 1QDUB 2MQMA 5ETVA 3TQ1A 4HT5A 2E9ZA 2KVQE 3ZXWA 2HQIA 2EPIA 1IKXB 5D8HB 3IWNC 2OSQA 4ZVSB 2HWHA 2XSJB 4WFBQ 2RUSA 1KOOA 2LYVA 4ZHRB 1V6HA 2DGTA 2HFNA 3SSSA 4ER8A 4B9SA 4WPAA 2ZJQQ 3LP2A 4CM2A 5HSPA 2KM8C 5A8WA 4MK7A 5KG1A 2DB1A 3I32A 5C24B 1QSSA 3LGHA 1S9GA 2XZTB 1S59A 2Y9HA 1U47A 4USIA 3PNIA 4EU0A 3KLEB 5M2UA 2LQBA 2N3LA 5AE1A 2COLA 2QMUB 1RHJB 4X4PA 5HAOA 2PA8D 2V2ZA 3QBCA 3GZ7A 3FCWA 4LF2A 4C11B 4ED4A 4PXBA 2MQ8A 4WE1B 2ZH1A 5CD4A 3QSIA 1LFWA 1REVB 2J7WA 8RUCA 3QFHA 4KBIA 4PG8A 5IOLA 3CJ8A 4NLRA 3NWGA 3TANA 2JVRA 2OD6A 1KD1T 4Q0BB 1M5HA 3CCRS 4NZ0A 2ZH7A 3TX0A 1UA1A 2KXFA 1A9NB 3LP1A 1NPRA 2RU9A 4OHVA 3MM9B 5D6GA 3OTEA 5HJXA 1TTHB 4F4AA 1VBXA 1TL5A 1ZM3A 4NA1A 4LF7F 3TUIC 3IAS9 1SXLA 2KJVA 4A8MP 2KG0A 2AJ0A 3G96A 1U2FA 2OUGA 4K2JA 5JVGQ 1Y3KA 2RS8A 4DOZA 1RISA 4DPYA 3QGGA 4QQBA 2HIYA 1H7WA 3M6UA 3VR1A 1FD8A 1TUGB 2CPDA 3IR6B 3ULHA 5GMEA 1F3VA 1HBUA 4YP3A 4LF6F 3HT3A 2RQMA 4MK9A 2HQDA 5C2CA 1NM2A 1RCXB 2OELA 2BRKA 2QO3A 3VAIA 5CYMB 4DR3J 2E1RA 2QSWA 1QAJA 2ZE2B 1L3KA 1HR0J 4CH7A 4OHZA 1RAHB 3KLGB 5A2QU 1B64A 4HACB 4CO3A 5J2MB 1RT4B 4RNFA 1DZ5A 5EN1A 2DIVA 5L8RC 2JWNA 4LFAF 2HPUA 5CCLA 1ZA2B 1JWWA 2FPHX 3THTA 2L9DA 3KMSA 3K5LA 2GAGC 2YWKA 3F41A 1TVRA 3IR7B 4ED3A 3UQSA 2R8IA 1RWMB 3AA8A 3PIOQ 1RHUB 5D4LA 3DU5A 4L6V3 4YB5A 2E9TA 4M5KA 2YQ0A 1XWLA 1CQMA 2C3OA 3DYAA 4AL5A 3I55S 2QT7A 4OYAA 3SCLE 4RW7B 4H4KA 1OYEA 4YMEA 4X4SA 2QLFB 5I3UB 2CJ9A 3PYDA 2MB0B 1NPKA 3CB4A 3TJ8A 3NOGA 2QL7B 5B0GA 3CNQP 2U1AA 3ZNUA 1HQEA 4F04B 5CABA 1UFWA 1NJYA 3W63A 3RAQA 1WHVA 4RX6A 4PUOB 3R5JB 1R31A 1I5OB 2DHGA 1NNDA 1Q8LA 2BJ9A 4F36A 3H2VE 4H54A 3M6XA 3OFFA 2YWGA 2NXEA 2PEBA 4OLPA 4DR1F 3FVYA 4LFBJ 3RYLA 3FCHA 3FMWA 3TARA 1S1TA 4ZVGA 1I51B 4ED5A 2MZSA 1FVQA 3GJSB 3DOKB 4OHYA 1LWCA 4KGMA 4M8LA 3SI8A 1VRQC 1Y5LB 5E2QA 3MMAA 3H5XA 5C42B 3D3BJ 2AGOA 2IJFA 4URQU 1K44A 3OVAA 3RBEA 3TO8A 2DH9A 3DRSA 4A46A 1J5OA 4ED2A 1XMQF 4OJ3A 3QAEA 3FFIB 5HQ8A 3NGKA 4OJ1A 2CVEA 2ZEJA 2HGMA 5H9EK 2V2KA 4NCBA 2EK6A 5GAHU 3X1LB 2K1RA 3GPAA 1KVJA 5BYRA 4V19X 4UZBA 2PI5A 2KKHA 1XEZA 3GCWP 5KFXA 3TJ9A 3RBZA 2GNKA 2R2UA 1I1GA 4Y3CA 3K0JA 2VU5A 3GYNA 2W9CA 2R7TA 2DNMA 2ATLA 3CCSS 3M8QB 4B3TF 2YKMB 5KG0A 4UTGA 2DGQA 2YNHA 2YTCA 1WWHA 4C8ZA 4F0MA 1N5TA 1TP7A 5HQLA 4HL9A 1X0FA 2JFDA 3R2DJ 1KP6A 4I4BA 2FJEB 3VV2B 2NREA 4JI1J 2IM0A 1RT1B 3DLEB 2IIHA 4USJC 2D3O1 2EFVA 1E6YB 1N5QA 2F9JA 5KFAA 4DS4A 4Q45A 1GH8A 4KIAA 5J2QB 3KOAA 1UVJA 2EG1A 2CYYA 1Q53A 1T94A 4OI1A 5LSRA 1IVZA 4CLYA 2GQCA 4D3GA 5A0YB 2KN4A 3W2WB 3MM5A 1FEEA 1R8HA 5MAOA 3UO0A 2E5HA 1UVNA 3V6KA 3AB4B 5M2PA 1UMJA 3D5MA 2VQEF 3PW5A 1IWAA 3ZZZA 4RUHA 2IVMA 1VC5A 3POTB 3HZGA 3EM1A 1FF2A 1KN6A 4ZVUB 1K47A 3PW2A 2DO4A 1NJXA 5HQMA 2HNYB 3A8IA 5KG3A 1TKTA 2QL5B 1QSYA 4JI6F 3Q8SB 4KSEB 5JXSA 1QTNB 3HLUA 3T5JA 3R7SB 3S1TA 1RDRA 2HNZA 1VK3A 2GAHC 3HVAA 5E41A 4XPCA 4PQAA 2HNDB 3EPIA 5LT5A 2VFTA 3FDSA 1FXLA 2CJYB 3CO0P 4J9LA 2HYIB 5HLFB 1EETB 1KR4A 3TAMB 2G2ZA 2RF2B 5LSOA 1QVGR 3DCAA 2VFRA 2ADBA 2MXYA 2DHSA 4O3QA 2FZKB 2RAQA 1GAOA 3RRKA 2JJ4D 1ZTWA 1YJWS 4B9TA 1JXEA 5KFYA 2MY7A 4ECUA 3RB3A 1R3NA 1UJ5A 1OY9A 1LK5A 3FZBA 4HVZA 5IC6B 1H38A 5LMUJ 2ASDA 2ZH9A 2WW4A 2CJKA 2JFKA 3ZC4A 1DURA 3L7UA 3MEKA 1KDNA 3CGIA 1AUDA 2MY8A 5A6WA 3V6DA 3CXCR 3CPWR 4B9MA 4EI2A 1S77D 6FDRA 3PJ9A 4IH6A 1T95A 2M4MA 1N0VC 5E7OB 4ZCKA 1X31C 1T03A 3UI3A 3QJPA 2UUBF 3HHLB 5ETKA 3BBCA 4LF8J 5J1PA 3TVYA 4A8QA 1C1CA 2QMXA 2CRLA 1VQKS 1PAUB 4ZCMA 1PJ5A 1WSVA 1UEUA 4DV0F 4HLBA 1MWQA 3PV8A 2FJDB 3MD1A 2KT5A 3HKZD 3W9HA 2G4BA 1IBCB 2WOMA 2AZ3A 2XQCA 2J7KA 4J9MA 3P6YC 2H4YB 4NLUA 2ROEA 5IFMA 2MZTA 3HULA 4G1QB 1RAAB 4AFFA 4H4MA 4DL0C 3MPWA 1NK5A 1DTQB 3L3CA 2B4OA 3OXGA 1S1XA 2OPPA 2JSXA 2DHXA 2F63A 3NEKA 1SKSA 4F02A 1JLEB 2XSFA 3K5MA 2HHHJ 2YQ1A 3G4SS 4HHUA 4NCGB 3Q8UA 2VBWA 1NB2A 3FEXB 1FEHA 2XCAA 5L9XA 4QWBA 3SQOP 1GMWA 4KPYA 1NCLA 4JI0F 1KLMB 2VG6B 1YI2S 2DXEA 1QTMA 2BV3A 3UVJB 3T41A 1SB6A 2AMCB 4FF2A 2VA2A 1MROB 4MKVA 1URRA 1FESA 4EGLA 2MPUA 1YBUA 2OHDA 1PG5B 4DSKA 2EBGA 1FRMA 4NL5A 4F3MA 1HQUB 1X5OA 2PFDA 4QW8A 2HHWA 2F1FA 2DR5A 5CQGA 4B3RF 4U95A 5K20B 2P2CB 3VALA 2YH1A 3RB6A 2V0NA 4L3KA 5KFWA 3C15B 3CCES 2LP4A 2QLXA 2GGPA 2BE2A 2RKIB 1CS4B 2C2OB 3R1HA 1A7GE 3M05A 3O5TB 2BMBA 4MKYA 1LFPA 1NEEA 3JAMY 1U1QA 3NCPA 2Y3YA 2HQGA 4C9DA 3THPA 2YY3A 4W98A 3J7A1 2QL9B 1U02A 6FD1A 2HMIB 1FRHA 2J9EA 1VBKA 3C6UA 1OQ6A 1JLAB 3IS9B 4DL7A 1FJEB 1DLOB 2EFGA 3V81A 3D3CJ 4OYIA 2FHJD 5DO2A 3KMQA 2V5HG 3OLAA 2XMVA 3R5DA 1OSDA 4I56A 3GB0A 4FYXB 4DV7J 4TXSA 3P5TL 3G9CA 3QYYA 4HYKA 2X1GA 3K5OA 1IBLJ 3OTDA 1YJRA 4P73A 2LVWA 5D3GB 5L1KA 1N8RT 3DRXA 1NJWA 5FDLA 2H65B 4FZVA 4UUXA 5DLGA 5RUBA 1VHFA 1KWMA 1F6TA 1P1TA 4J91A 4KTQA 2W7AA 3FK4A 3EJMA 5HP1B 2L48A 1ICEB 5KFPA 5KFTA 5L1JA 4B17A 3G8QA 4CIOA 1NPPA 2OEJA 2EXUA 2EC2A 2HWIA 4UW2A 4CLKA 2Q6BA 3ZTSA 4KHRA 3C14A 2FYXA 3HT0A 1L3TA 2C3PA 1S97A 1NB7A 1ROFA 1Y11A 2YNIB 4C4WA 1MU2B 2HRYA 3FQKA 4YUDA 3GV8B 2OLWA 4F50A 4H4OB 3CCLS 3DGPA 1JLCB 1Z2LA 4IFVB 1BQMA 4DR3F 2LFVA 2QFIA 1GXLA 4A47A 2ZC3A 3OHAA 1O0PA 2CQGA 4J7CA 1OMSA 2YKAA 3LW5C 2AWZA 1YWXA 3OTOJ 4WP3A 3TYTA 5DQHA 3A3OB 2KRBA 1XMBA 2C28A 2GC8A 4LRFA 2FVSA 1WC0A 2E7WA 4CNZA 2BM1A 2LXIA 3OFGA 4QYZJ 1FTRA 4DBQA 5CYQA 2NXUA 4P7TA 5J2PB 5ETQA 4IH5A 3M2VB 4NLYA 3AD7C 4WIIA 2CPJA 4U7UK 2UP1A 5D77A 4MYUA 4KAIA 3QNWB 3IM8A 1RACB 3NCQA 5HJYA 1D9DA 5DG7A 2B4VA 2ZZNA 2VONA 3GIRA 2DH7A 1FRIA 4DHVA 1RAOA 3PR5B 5L46A 3J81j 2K7JA 3G86A 2XLIA 4PPZA 4FF3A 2VB6A 2DITA 3KLHB 1YRUA 1V3SA 1D0EA 2R9LA 1N54B 3OW2R 1FX4A 1D9FA 1RTIA 4LREA 3GIJA 2BM0A 1S6PB 5B0BA 3MAHA 1MLAA 4PWDB 3FMBA 1LW2B 3BS9A 3GILA 1U1MA 1C0UB 1PC4A 3D6TB 1X4GA 1S48A 3C2PA 4Q2LA 3AJ2A 2OPRB 3MPDA 1Q0NA 4CO0A 3ITHA 1HBNB 1F2GA 4UF4A 1FK9A 3MECB 3HMJG 4ETZA 1NK6A 2DGSA 3F0NA 4NX9A 4M5HA 2XLKA 4QJVA 1MWZA 2GZOA 4N7TA 4UUWA 1S5ZA 5EDWA 2X7IA 4DWIA 2ZC4A 2FUG9 1VQOS 5B0CA 1NKEA 2F8MA 4A8OA 3R7BB 4Y28C 3E8OA 2FGCA 5FJ4A 1X5TA 5KFNA 1SBRA 2DGVA 4UOFA 2VHGA 4QCLA 3PY8A 1ZBTA 3MR7A 1S6UA 4K8RA 4WK1A 1K0TA 3KLVA 3L7PA 4AUKA 4Q43A 1SL1A 3Q8RB 2CPIA 2R8JA 1RXOB 4U7CA 5FLXY 4ZP9A 4P2MA 2PDAA 3NBPB 3G6VA 1S1UA 1JMTA 8ATCB 3SFUA 2ZM6F 4G65A 1Q5YA 1JJ4A 4DDFA 1WF0A 3NNCA 3VGSA 3MEGB 4K4SA 4ZVRB 3J81Y 4KR0B 1N5YA 3W1YC 2AW0A 3UDVA 4DCJB 2D1CA 4CQ1A 4DR4J 2R4FA 1YJVA 3Q8VA 1S0OA 5HL7Q 1T05A 2J6SA 1M90T 2QC3A 2OP5A 1CVJA 3ILJA 4KYZA 1CJKB 4M5JA 1W2IA 2Z2ZA 4X84A 4IG0B 3M1VB 3PDNA 4HR2A 4ECQA 1SIZA 3Q22A 4O0IA 2FHKA 1VS3A 2MYFA 3BGOP 3QT7A 4DR5F 2CNNB 4N76A 2V34A 1TKXA 4ZCLA 3CULA 4DG1A 3W62A 3DLBA 2NYIA 5F3TA 4J9QA 1TL7B 2MMYA 1X4FA 1S0NA 3BBFA 3SCKE 2V8DA 5KT3A 5EUHA 4CZCA 3SV3A 3OL8A 3EVMA 4DUZF 4NPOA 2NPFA 1NHKL 1LKZA 2HS0A 1FFWB 1H74A 5KT2A 1TKZB 2LA4A 2GVDA 1X4CA 3H7HB 2W4DA 2BJ1A 4GVBA 2RQKA 3TA0A 2VJUA 1F1BB 1TAQA 1QE1B 4K0KJ 1YTYA 1SH2A 5KT5A 2AGPA 2IMWP 3OXFA 3CTRA 2OEKA 3KHRA 2GMJA 5H9FK 1VQ8S 4FXWA 5HVGA 2YH0A 2RD5C 1AZSB 4CCHA 3TW0A 3T1HJ 3MM6A 3CIZA 1WORA 3V4IA 1VQ7S 3EWGA 3CC4S 3PHEA 5LMUF 2YKQA 4HT7A 2UZAA 4UOGA 5CZXA 4ZPAA 2KH9A 2JC0A 3HXMA 4HTIA 4JOUA 4FBUA 3OL7A 1UVIA 4ZDNA 2XULA 4DI6A 2DR7A 2CQIA 3O3LA 1PO6A 4OYMA 1O5JA 2W9BB 2B3TB 1N52B 3M30A 1M5PC 1BE4A 1TZ0A 2XB2D 2BE9B 1YZ6A 3MMBB 3ZZYA 3LA0A 3NY0A 4Y34A 3IBWA 1X7VA 2D3OR 1OIAA 1RTJB 1RT6A 3NGTA 1Q8KA 4M5MA 2DISA 2FC9A 4FN5A 5L1LA 2CQ1A 4KH0B 4TNOA 5K14B 5E33A 1NHVA 3DMJA 4XAKA 3RR7A 1SQFA 1LWFB 1TL3B 1X4DA 3OT9A 2V4RA 2JC1A 5KG6A 3W8PA 2NYHA 1TMMA 2RDIA 1FRJA 1S12A 3CCVS 4NOHA 2E5LJ 1JQGA 1GMVA 2QN6B 3ELHA 2R7OA 2D74B 2J7UA 2H5IB 4JYAJ 5CHCB 4FKYA 1X4HA 3QT5A 4K4ZA 2L9NA 4KH1B 2JX2A 1R0AA 4DV4J 1M5KC 3NAHA 1TV6A 2B9WA 2ZVSA 1KQFB 3NXZA 4YB7A 1WTFA 2HZVA 1VC0A 4BWJA 2XBPA 2DRBA 4IR1A 5E3QA 2WCXA 3OFHA 2UUWA 2BBEA 4OL8A 2DXDA 1IBMF 5EX3A 3DRRA 2VL1A 4ZVQB 1MW7A 4NLOA 2C2ZB 4ECSA 5HROB 2UU9F 5GAGI 1IKWB 4DR6J 3ET6B 1NAQA 3ZZPA 3JSMA 3VAKA 1EX8A 2HS3A 1RI7A 3M8YA 1B4SA 3FBEA 4QPXA 1VRUB 1CBKA 3JB9k 4EO8A 1FTCA 4BC9A 4FXDA 3QGHA 1N88A 2YBVA 4F2SA 3GE9A 2RE1A 4LR8A 1HHTP 1RZMA 3TP2A 4UY85 1H72C 1XR7A 4X2BA 2WONB 1AA1B 4TU9A 1V5IB 3K5PA 3CW2C 5HMWA 2KM8B 1KNZA 3C16A 1NO8A 3MEEB 1AROP 4AT1B 4ATNA 4KGVB 1HBOB 3KHLA 4MFBB 2HGLA 2V8PA 1N33J 4LVOP 2VUGA 4TY8B 5C25B 5BYQA 1EQMA 2ZD1A 3SBMA 2ZZTA 2C2NA 2LU1A 3E51A 1O51A 4ZVOB 3D68A 4AQYJ 1WOPA 2CQ4A 3L95X 1T0TV 2Z8QA 4P9SA 3KHGA 2HHSA 1U1PA 4N8NA 1ZPWX 1SCJB 5T7LB 2HHUA 4DV7F 1CJTA 1E6VB 2R8GA 3HSDA 3AT1B 2RT3A 3LP0A 3IP0A 4QYRA 3SDEA 3TUZC 5HBMA 5F41A 2PE8A 1QAIA 2YVSA 4MKBA 3DGVA 1NJIT 1VRTB 2P5VA 2EFPA 4N56A 2A2DA 1ZETA 4NYOA 1JIHA 2UXBJ 1JKHB 2XYPB 4W4MA 4OZJA 3DI6A 1UPMB 3PW4A 3Q89A 2KJWA 2FLLA 2PFFB 1HWIA 4Q44A 2O5DA 2CNKB 3IG1B 3ONQA 3NP5A 1D8YA 4DR7F 2MQNA 1GQEA 3IFEA 2MZQA 4NXNF 2K2PA 2P6TA 3MI7X 3CCUS 3QIDA 3KHHA 4RU2A 4ZK7M 2C1EB 4Z7YA 4Y2CA 4UZCA 3QGIA 5DG8A 1HD0A 1S1WA 3HHLC 1GTHA 3VZIA 4G3IA 1QLNA 2L3MA 3CF5Q 3BSAA 2ZOFA 4XIUA 4BS2A 3P4UB 4UOCA 3PW0A 2AEFA 1PILA 2VG7A 4UQGA 2IC3B 3GFXA 1WC5A 1CQNA 2YNFB 1FKPA 3BBBA 4ZJLA 4CO4A 3D2WA 2CQ2A 2Z2LA 2L41A 2CJBA 3UW1A 1I3OB 2H9ZA 4U67Q 3OJSA 5K5MA 1SC4B 3NKYA 2DNGA 4LSNB 4GKJF 1HBMB 1RA6A 4ZVHA 4TY9A 1FDBA 2MZJA 4I2QA 2FJXA 3CD0A 2HHXA 2FQQB 3M2UB 2GO8A 3OR1A 1HNXJ 1UETA 2HVDA 2B5JB 4KKOA 5D0EA 1HPZB 4OX6A 2ZH2A 3B54A 3C6TB 3SMZA 4MTPA 4WYWA 1XK8A 3MFHA 3GTYX 1EB0A 3K8VA 5ETMA 1S6QB 5DLFA 2P9CA 1FJCA 4TU7A 4ES1A 1RKIA 4KE5A 2LLZA 3LPEA 4B08A 4QIEA 5DDRC 2DR9A 2HLTA 2NQPA 2FHJA 1BWEA 4R8UA 3A12A 1FFGB 2HRUA 1LV5A 1U6FA 3T3FA 4JB8B 5A8RA 3NNAA 1IN0A 3F56A 1JNRB 1RADB 2V9KA 4CLZA 4IFYA 2Q43A 2CPZA 3CCWA 2GVZB 2VODA 4C97A 4K7QA 3FBBA 4JI8F 2X1BA 2XYGB 3M2RA 3CCJS 1WEZA 5DM6Q 1HI1A 4ENOA 5KG2A 3LOUA 2DNQA 1GT8A 2DNOA 1G2EA 4O3OA 2QYCA 2BA9A 3NG8A 1QSLA 2KRRA 3N6MA 3PVXA 3KDOA 1DJ0A 2B9YA 2WHOA 3UN5A 2HS4A 4DV1F 4CLTA 3NMAA 2OPQB 1WOSA 2O67A 4TYAA 4OJGA 1NSPA 4CTAB 2MSSA 3OXLA 4J90A 1WDDA 4P6QA 1KS2A 4B9VA 2BANB 2AD9A 4U6PA 1UEKA 3O6QA 1N5SA 1JJ2R 2ZBIA 2QSFA 3MEDA 2GJFA 4LSLB 1XERA 2EFOA 1R43A 1APSA 2JOQA 2BQRA 3W60A 5HK4A 4WXOA 3IBCB 2Z57B 4O4RA 4ZPBA 3P5BP 4FPRA 2C42A 5JMNA 1RBAA 1RUSA 2EK1A 4DFPA 1M1GA 5GAGU 2UVVA 3AJ1A 4OHWA 3QT8A 2LEPA 4JV0A 1NK9A 1NKCA 2HFZA 1HKAA 3ETMA 1C0TA 4KHPF 2FLOA 4PABA 4J37A 3OSNA 2QX0A 3QO9B 4LF7J 4C8NA 3CWJA 3J7Z5 2CPHA 3HDSA 2J6UA 4J9RA 4DU8A 3BKFA 5GAEI 4NLVA 1AFIA 1RABB 1SJQA 2WBMA 1DARA 1IKYA 3FSXA 3RUBL 1TU0B 4LF6J 3BKUA 2C2DA 1VBZA 4RW9A 5GADI 1RWUA 4ZLPA 1U8WA 3PIPQ 2HBRB 2BW2A 1P9QC 5G0RB
chains in the Genus database with same CATH topology
1JLBA 2HLUA 4DS4A 3AY0A 3LQVA 1C1BB 4K5RA 3BO2A 4Q45A 4A8YA 4LF5F 1GH8A 3WBZA 3I0SA 4KIAA 5J2QB 3PX0A 3KOAA 4DSEA 1K0VA 1G3OA 2EG1A 2CYYA 1UVJA 5IT4A 2BOPA 2UUTA 4PG6A 1KSPA 1Q53A 3WC2A 2E1MC 1T94A 3G6XA 4OI1A 5LSRA 3QWUA 2Q1LA 1ZAVA 4BDPA 2GW8A 1SJ3P 1HMVB 4ZP7A 4ES3A 2GQCA 2KVIA 2WK4A 4M5DB 4D3GA 2KN4A 5A0YB 3W2WB 2WONA 4G1PA 1A6LA 1BQXA 2I8EA 3H25A 1T7PA 5KFLA 1HI8A 3MM5A 1FEEA 2ZNZA 1BQMB 1R8HA 5MAOA 3GFYA 2UVWA 4OMFG 2ASJA 4CO1A 3P96A 4RW9B 5J1NA 4YR3A 1RTDB 3C3LA 4ZCIA 4FXVA 2E5HA 1UVNA 4OV1A 3MEEA 3V6KA 3AB4B 3T5LA 2DO0A 5M2PA 1UMJA 3K2YA 1QAXA 3D5MA 3PRBA 3QMQA 1HBOA 1JLQB 1U09A 2VQEF 3TR5A 5KT6A 3CDEA 3U02A 4BHQA 3PW5A 1IKXA 1RA7A 3ZZZA 1WI8A 4MFBA 4RUHA 3CEDA 2IVMA 1VC5A 2XSJA 3K7RA 3POTB 2YX4A 4A8XA 4LF4F 3HZGA 5KFGA 2FLPA 3ZZ0A 2N4CA 4ZHRA 5KT7A 2GIQA 1FF2A 1WNEA 1MSWD 1KN6A 1PGZA 1RYRA 4TY8A 3OFEA 1S6OA 2FDNA 2CQ3A 3PW2A 2DO4A 2W7PA 1NJXA 5C25A 3N28A 4C3MA 2AJQA 2HNYB 2XEXA 3DXSX 5KFKA 3ISND 5KG3A 1TKTA 1K1SA 1QSYA 1XNQF 4QU7A 5CYQB 1D9AA 3ENVA 4JI6F 5C24A 3Q8SB 4KSEB 5JXSA 1C4CA 3MM7B 1R89A 1H98A 4WFZA 4Q7AA 4OQJA 2IAJB 2M7SA 3HLUA 5F3ZA 4DQSA 3T5JA 1ELOA 3DLKA 4I2PA 5ADZA 3S1TA 3SZ2A 3ISNC 5IM0B 1RDRA 2HNZA 1VK3A 3HVAA 2BJDA 5E41A 4F4ZA 4XPCA 2FIUA 2YX7A 4PQAA 3PX6A 2HNDB 4K4XA 3KLEA 1Q16B 3HKWA 3EPIA 5LT5A 3LALA 4YOEA 4X4RA 2IYGA 1QAYA 2LCWA 3CCTA 4EBDA 2VFTA 3FDSA 2HIQA 4F4WA 4YB6A 1FXLA 3DXBA 3D28A 2B7CB 5T7LA 2F8EX 4KC5A 4J9LA 2HYIB 3LF0A 4I0WA 5EGYA 1EETB 5HLFB 1KR4A 3OR2B 3HHNB 1E6VA 4WJBA 2UUAF 1RT2B 2J6TA 1X4EA 3H59A 4Y2AA 3TAMB 4E98A 4J9PA 5FD1A 2A3JA 4FYDA 1YQHA 2RF2B 5LSOA 4LMZA 2B9XA 5B08A 1QVGR 3K58A 4C11A 3T6JA 3DCAA 2VFRA 2ADBA 2LEAA 1WEYA 2MQOA 3FSYA 4WE1A 2DHSA 3CDWA 2MXYA 4RWXA 4O3QA 1GAOA 4I2PB 5K8NA 1REVA 3RRKA 4AE5A 4NZ6A 3BR9A 1IM4A 5IXUA 2JJ4D 1ZTWA 5K8MA 1YJWS 1VRTA 4O4GA 4B9TA 1JXEA 4DL5A 5KFYA 4KV8B 5IWAF 2MY7A 4ECUA 3QIPB 3RB3A 3HI9A 3CJKA 1R3NA 4ID5A 1UJ5A 2NUHA 1FXDA 1LK5A 1XR5A 3FZBA 4HVZA 1JKHA 4QIVA 1VOMA 2XMWA 1H38A 1HW8A 3KYLA 2XS5A 1VQYA 4Q0BA 1UA0A 2ASDA 2ZH9A 1YGYA 2ASYA 4IDKB 1RTIB 1RJJA 4C7QA 2R7UA 1XBWA 5KFQA 1IBLF 2XGPA 2CJKA 2V9WA 2JFKA 3ZC4A 1DURA 3MEKA 5F8JA 1T3OA 3DU6A 3CGIA 1AUDA 1Q79A 3PFEA 2MY8A 3IG1A 5A6WA 5D4OA 1O8BA 3V6DA 3HHDA 2HVZA 3DC2A 3CXCR 3MM9A 3KLFB 3CPWR 4B9MA 4QWCA 2ZJRQ 4IRKA 4QBUA 5DGAA 1S77D 3MPYA 1SV5A 6FDRA 2CKWA 3T1YF 2VPWB 3MWBA 4FS1A 2F4VF 2CG4A 4IH6A 1T8EA 1T95A 2M4MA 1N0VC 4JV1A 3MURP 5E7OB 1FHTA 2MQQA 4ZCKA 4OI0A 1DTTB 3OTCA 1T03A 3UI3A 3QJPA 3ITHB 2UUBF 1EP4B 3HHLB 4ELUA 2C2EA 4PWUA 1FK9B 5B09A 2HW3A 3TVZA 5J1PA 3TVYA 4FNHA 4A8QA 1VC6A 2JLEA 1C1CA 2J76E 2QMXA 2CRLA 1WF2A 1VQKS 2X3GA 2V4QA 3G71S 1R27B 1FKOB 3G8SA 2GMLA 2R8HA 3CJ3A 4O44A 4EWTA 4ZCMA 2AV5A 2VG5A 2ZDOA 4EZ9A 2FVCA 4QWDA 4IQXA 1UEUA 2OPSB 4J9SA 3VAMA 2V4JB 4DV0F 4RKUC 4E0DA 2AJ1A 4B3SF 4ILRA 4HLBA 3EGZA 3WDOA 3PXGa 3PV8A 2FJDB 1U1RA 1SV5B 2CQDA 3FRZA 3MD1A 4WKYA 1HNIB 2IC3A 2KT5A 3HKZD 1ZH5A 2KXHA 1UJ6A 2YNFA 2ZH5A 4MKAA 4CI0B 4EYIB 3TRGA 2ZHAA 3TAPA 2G4BA 1SH3A 2QZ8A 1U4BA 3UD3P 2WOMA 2E9RX 2LEBA 2DNRA 5CYMA 4OJHA 1YVFA 3JSYA 1UW4A 1P27B 2J7KA 3CC2S 2UVRA 4O23A 3KK3B 2ZH8A 4Q8EA 4J9MA 3RRHA 4PCQA 3P6YC 3GR0A 1L3SA 2ZE2A 3UDCA 1SJ4P 3DDNA 2DNYA 4NLUA 5ITHA 5DGBA 2ROEA 4X65F 2E5LF 5IFMA 2MZTA 2RDJA 2EW9A 1GXTA 4LSNA 1HBMA 2DH8A 4G1QB 3HVWA 3IRXA 3KLGA 4AFFA 4H4MA 3I96A 1KFDA 4R0EA 4NRUA 4DL0C 3UWTA 3H4DA 3MPWA 5J2MA 1NK5A 1DTQB 3L3CA 3CMES 1KLMA 1RT4A 2B4OA 3BSCA 3KLIB 3OXGA 1S1XA 5H9FJ 2OPPA 5F8IA 2JSXA 4XPEA 2ZHBA 2DHXA 3G8TA 1S49A 1SKSA 1U24A 3M2UA 3VAGA 3F73A 4F02A 4ZPTR 1JLEB 2XHWA 2XSFA 4F26A 3K5MA 2OIHA 4A4JA 2EKYA 3G4SS 1IBKF 1L3UA 4NYZA 1P8GA 4DV4F 2HHVA 4NCGB 4HEA9 4RWWA 4ED6A 1FT8A 2CJAA 3OTOF 2B5JA 2VBWA 3FEXB 1FEHA 1HPZA 1TK5A 4EYHB 3KNGA 4RNHA 3C6TA 3T9NA 2XCAA 5L9XA 1S1UB 1YG0A 2R2RA 4QWBA 3BQ0A 3ICLA 4Q5VA 4QR0A 3JTPA 4TYBA 2CPEA 2VV5A 3LGMA 3GV7B 4KPYA 4N77A 1S6QA 4JI0F 1KLMB 2VG6B 1YI2S 4K5SA 3PEHA 4BCAA 3LAMA 1QTMA 2OPPB 4I69A 4WTYA 4CO5A 2LQ9A 1VJWA 2WSEC 4OZLA 3IN5A 1N48A 1K9MT 2VOOA 4F67A 3IR5B 3KG4A 2G13A 2BV3A 3MM8B 2WTFA 2OD4A 3UE2A 3HF5A 5F8GA 2R7WA 4ZA1A 1SB6A 2NLWA 1VIOA 4HH1A 3LH2S 1Q8IA 4FF2A 3SSRA 3CDAA 3B4MA 4G1IA 5M2RA 2VA2A 1MROB 4Y65A 2Y1IA 1URRA 1FESA 4EGLA 2MPUA 1Y00A 4RW7A 4XK8C 4DS5A 2ZBCA 3ZFVA 4DSKA 4DMZA 4USHA 3JTOA 2PGCA 2EBGA 1FRMA 4NL5A 5SZTA 2YNGA 1N5YB 1KRPA 4F3MA 1I6JA 3M8PB 5I3UA 4JI4F 1HQUB 3W7BA 1X5OA 2BZ2A 4YDDB 1VBYA 3JSBA 4QW8A 4QIFA 1GX6A 4IOCQ 1FE4A 2HHWA 2F1FA 2DR8A 2KFZA 1T05B 2DR5A 3RZAA 3VAHA 4WF9Q 2XMMA 4IRCA 4ED0A 4ILMA 2WRMA 3FNNA 4HI1A 4IO1A 5CQGA 2XMTA 2CQ0A 4B3RF 3PX4A 3V6HA 2EI5A 1FDDA 1ZAXA 1ZYQA 1SKRA 4ED1A 2SXLA 1TK8A 5L38A 2CZVC 5DM7Q 4X4QA 1KFSA 2F8HA 2HQ3A 2RSQA 3N5FA 4I68A 3VALA 2R7XA 2YH1A 3TOQA 5KOXA 3RB6A 2KTQA 3BQ2A 3MTKA 5CD4H 2V0NA 4PUOA 1LK7A 3SQGB 1JK9B 1Y7PA 4BBYA 4HHJA 5KFWA 5H1SV 3OJUA 2E44A 2IVYA 3ZZUA 3CCES 3E01A 1FO1A 1D8ZA 2IRUA 4Y2MA 1L3VA 2QLXA 3DM2B 2GGPA 2CIMA 4DN0A 2BE2A 2RKIB 5KFAA 2PT0A 4J5OA 3R1HA 1TKXB 3GG1A 2NPIA 1A7GE 2WSFC 3I6PA 3M05A 5AXNA 2E5IA 3KK1B 4I67A 3O5TB 4R5PB 4DG1B 1FJGF 4MKYA 2EVZA 4WYLA 1LFPA 1S0VA 1M1KT 1NEEA 1PC5A 3RB4A 3JAMY 1RYSA 4KT0C 2OPQA 1U1QA 4LJMA 4LVNP 4YEAA 4OZ5A 2N82B 3NCPA 2UXDF 2X1FA 4I7FA 4CTAA 2QEXS 2UV8G 3C8YA 4N8OA 2EC0A 2DK2A 4CO2A 3DOKA 4C9DA 1RAJA 3THPA 2Q66A 2HHQA 2BANA 2YY3A 4ICLB 3J7A1 1U49A 2F9DA 2JEGA 2I5JA 4AQYF 6FD1A 2HMIB 1FRHA 2J9EA 4FNIA 5C42A 3AAWB 3HHEA 3C6UA 1DRZA 1OQ6A 3DRPA 4WFAQ 1JLAB 3I0RB 3IS9B 4DL7A 4LSLA 1FJEB 4F8RA 3HVTA 5AJ3F 4EZ6A 1DLOB 4NRTA 1BGXT 3CCQS 1WI6A 2D3UA 4QIGA 2EFGA 5F8HA 3V81A 1T3NA 1R6YA 1YRTA 2HFOA 2FHJD 5HMXA 5DO2A 5DDPC 3KMQA 2V5HG 4OIXA 1N5VA 2OO4A 2RS2A 3CMAS 4LT6A 3OLAA 3DOLA 3UD4P 1S9EA 5KFRA 2XMVA 1HNVA 3N9UC 1SUQB 5GAEU 3R5DA 2HG4A 1JX4A 1OSDA 3C46A 4I56A 2QA1A 2A10A 3GB0A 1Q82T 3PZPA 1Y0HA 4K59A 4TXSA 4JI3F 3P5TL 3G9CA 3QYYA 3UR3C 4DEZA 2NZ4A 4HYKA 2X1GA 1S99A 4Z37A 3K5OA 3T1AA 4HDHA 4OZNA 4A8FA 1UVLA 2AYGA 3OQ2A 3OTDA 1NH8A 2DCLA 5L9NA 1IKVB 1YJRA 1NU4A 2LVWA 3MM6B 3DDKA 2QA4S 2MKCA 1RKJA 3T5KA 4H4KC 3BGRB 5KG4A 5D3GB 3SCJE 3V4IB 3Q8QB 4CH1A 1MWYA 1Q7LB 3D1OA 5A8KB 2Y0SD 3V81B 4MMOA 2UXBF 5L1KA 3D1HA 2WBRA 3Q2SC 1N8RT 2RIJA 1XR6A 3DRXA 3QLHA 1XNRF 3UDLA 1NJWA 2KT3A 3H5UA 5FDLA 5T14A 5E5NA 4FZVA 4UUXA 5DLGA 1VHFA 4O3PA 2YWEA 4UQTA 5J1EB 2A2CA 3QO9A 2MGZA 3TVKA 3GIIA 2B56A 1P1TA 2E5GA 4ERDA 1R8PA 4KTQA 4ETXA 1VIXA 2W7AA 2V8HA 4L72B 1BD6A 1WELA 2ACYA 2IVFB 3M8QA 2KFYA 2B7BB 2LA6A 2RNEA 5K8PA 2YKMA 4P7VA 3UCGA 5HP1B 4LFCF 4DL2A 2YWHA 2L48A 5F8MA 2CQBA 4HKQA 3MHYA 3D0GE 3M30B 5KFPA 2CQCA 5KFTA 4ZS6A 5L1JA 4B17A 4WFXA 3G8QA 4CIOA 3GIKA 2PI4A 2CJQA 3DN9A 1B0VA 1ZZNA 1GX5A 2ZUGA 3I5BA 2HWIA 2QE5A 4UW2A 1N36F 1KLNA 1NKBA 4K50A 2Q6BA 2YKPA 3GG0A 3U7JA 3OV7A 1RT1A 4KHRA 3DLEA 2CVIA 4I6AA 4C8KA 1RT5A 2J0QD 5BJRA 1E6YA 1TAUA 2FJBB 3B4DA 2B4PA 3EXYA 4X64F 5G0RA 1H2VZ 2NSCA 1L3TA 1HW9A 1HNWF 2C3PA 4RW6B 4QU6A 1C1BA 5E3AA 3BO4A 3KFWX 4E8UA 5HN0A 4M94A 1U45A 3S7RA 1RT6B 5J2QA 2W24A 4M1KA 1S97A 1NB7A 1ROFA 2YNIB 4C4WA 2GHPA 1MU2B 2HRYA 1G7CB 2AYBA 3CCMS 1ZPVA 4F4YA 3FQKA 2E5JA 3O1LA 2WAQD 4YUDA 2QLWA 1UWBB 2FC8A 3IRWP 3GV8B 2OLWA 3QJJA 4F50A 1HARA 1HMVA 4M5DA 5A0YA 5BR8F 3CUNA 3MD3A 1IXKA 4H4OB 3CCLS 2KFNA 4A8SA 1S1VB 3DGPA 1JLCB 1Z2LA 3DLGB 5C5JA 4IFVB 1BQMA 4FF1A 4DR4F 1FA0A 2I38A 4DR3F 1RTDA 3DMJB 3BN4A 2GX8A 4DV6F 4DFJA 4DFMA 1RT5B 3LWLA 1GXLA 1R8CA 4A47A 4X4VA 3I87A 1S10A 2ZC3A 3OHAA 1AW0A 4B3OB 3DRYA 4NLXA 1M5SA 1O0PA 2HAIA 2CQGA 5DDQC 1X9WA 2PMZD 3RW6A 2YKAA 5EWFA 1U7LA 3LW5C 1JLQA 2AWZA 1YWXA 1SL0A 4DPOA 3RAMA 1TQLA 3M2VA 3TYTA 2XWYA 2CDQA 4TN2A 5DQHA 5KTQA 4J9OA 2KRBA 1XMBA 2V94A 1UJ4A 2C28A 4TLRA 1CPZA 3QJLA 2GC8A 1NH7A 3VZHA 4GC6A 2FVSA 3VQTA 1HL6A 3POTA 1KC8T 2MZ1A 4EBEA 3T6BA 1UFLA 4X66F 5CYJA 5AXKA 1N56A 1SIWB 3I82A 2FTRA 3R5AA 2J9CA 2FVPA 1QM9A 2E7WA 2J9DA 4PG4A 5IQ6A 5AXMA 2RU3A 2R2SA 4CNZA 2BM1A 2LXIA 3OFGA 4QYZJ 4YQWA 1FNOA 2HNYA 1FTRA 4WFNQ 1Q8BA 2LXUA 4ALZA 2VPYB 4DBQA 2M3DA 5CYQA 1R8BA 4RNOA 2NXUA 3CJ5A 3I31A 4LUBA 4P7TA 1M0SA 5J2PB 3LWMA 1R0AB 1YJ9S 4RU9A 1KONA 3WC0A 3MM7A 1