1ZPVA

Act domain protein from streptococcus pneumoniae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
NAMKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of ACT domain protein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords ACT domain protein
total genus 22
structure length 85
sequence length 85
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13740 ACT_6 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zpvA00
3ENVA 5T41A 4GO5X 2RQMA 3OFGA 3MAHA 1UJ6A 1LK5A 2J0XA 3OFFA 4IO1A 2QSWA 1UJ5A 3K5PA 2DT9A 2ZHOA 2H9ZA 1M0SA 3AB2B 2LQJA 1YBAA 2J0WA 5IT4A 2MDAA 3OFEA 3TUJC 2PA3A 3CEDA 3LUYA 4LUBA 5IS2A 3AAWB 1Y7PA 1XTZA 4X84A 2DTJA 3ENQA 2P9CA 3LOUA 2NYIA 2PC6A 3MWBA 1UJ4A 3DHXA 2QRRA 1PSDA 2JHEA 2QMXA 3O1LA 1U8SA 2I9SA 3UW1A 3DC2A 2F1FA 1KS2A 3L7OA 4GO7X 2KO1A 3DHWC 3HHEA 1YGYA 3DDNA 2QMWA 3IXQA 4M8LA 3NRBA 1ZPVA 2FGCA 3P96A 3U7JA 3N0VA 4NMLA 3ENWA 3KWMA 3MTJA 3OBIA 2P9EA 2F8MA 3TUIC 2RQKA 2RE1A 1SC6A 5JJBA 2LVWA 5IT0A 2CDQA 3OFHA 1O8BA 3S1TA 3W7BA 3TUZC 2P9GA 4PWUA 3IBWA 4GMKA 1LKZA 1RWUA 3AB4B 5FIIA 1LK7A 2JOQA
chains in the Genus database with same CATH superfamily
2KZZA 4DUYJ 2FJVA 4WP9A 5L9NA 2AJ4A 1KN6A 2HNDA 3KUHA 3QGHA 3A3NB 4ZVTB 3G71S 1UZDA 2RS2A 1UJ6A 3IG1A 3B8HA 3R6GB 4EFAC 5A8KB 3BO4A 2BVZA 2OI2A 3BJYA 2I1RA 1OY9A 3MM7A 3ZZZA 3PW0A 2ASDA 5BR8F 1IBLJ 4O3QA 4LF7F 4NXMF 2ZOGA 2ZEJA 1VQOS 1Z2LA 2KFYA 3KHGA 2DPIA 4PPZA 4B3MF 4K4SA 2UXCJ 3BDPA 3QIPA 4JI8F 1RWMB 2R7SA 2QYCA 1H73A 2G9OA 3MMAB 5IC4B 4DL7A 2KT2A 3QRQA 1CBKA 4EMDA 5EWFA 1B3TA 3R5AA 2UUTA 3NBPA 4XPEA 1HHQA 2C3PA 2MMYA 2QYGA 3QT6A 1QAJA 2M8DB 3HHLA 2RH3A 1H38A 3PEHA 2LXUA 4ZCIA 3GIMA 4CRJA 2J0WA 4WBFA 4OHZA 1NSAA 3K8VA 4RR5A 3HD1A 3SV3A 4UOFA 3NS5A 5ITHA 2VICA 2HVDA 3MPYA 3JS9A 3CJ3A 1QUPA 4OJ3A 4QIGA 4O0NA 4USTA 3VV2B 3BKUA 1E6VB 1IWGA 2YWHA 2PT0A 4YMEA 3K59A 1BQXA 4YB7A 4DR1F 2F5GA 1G4CA 2RS8A 1RJJA 3VAFA 1VQNS 1RBOB 3KK3A 4K0KF 3MWBA 1RK8A 3ULHA 4DG1B 1FJCA 2NXNA 5HROB 1O51A 4RUAA 3EDQB 5L38A 5D4OA 2YKNA 2FY1A 5J2PA 3FKBA 1ZBTA 4DL2A 3G4SS 2FJDB 4U8VA 2XSFA 3AD9C 1U1QA 1PAEX 1NU4A 4CH7A 1VJWA 1MU2A 1YI2S 3BQ2A 4K4UA 2A6OA 2KYXA 2D74B 2HKEA 1FKPA 3E01B 4ED2A 4FBTA 4IRDA 2IJNA 1NHKL 4ZP9A 5K8OA 4HTJA 2CJKA 4IQXA 1BQNB 4J9SA 1LOUA 1QD1A 3QFWA 4MK8A 1YJRA 3MMJA 3PW4A 4QIVA 2NPIA 4M95A 1NPPA 1FXDA 1T3OA 2WW8A 3FMBA 2GZOA 2VASA 2BE7D 3M32B 4YR2A 4ID5A 4P6QA 3LA0A 2HHHF 4AT1B 4JI2F 2VC0A 3N0VA 4K4WA 1UETA 3N28A 4ES2A 3K5OA 1N8RT 2E5HA 3ZNUA 2QLJB 2CQ2A 3PIOQ 1NBEB 2P9EA 1XNQF 4ZVEA 3MEGA 4IRCA 2J5AA 4FVCA 4ZCMA 3VZHA 4P7VA 3BQ1A 4RW4A 4NA3A 5GMDA 1F9HA 1H3DA 1K44A 3EVMA 3KUGA 1U0SA 3LF0A 4H54A 1V3ZA 4N47A 1HL6A 4F0MA 4Q45A 1QM9A 2LMIA 1FDBA 3B54A 3GE9A 2FJXA 3OFHA 3CCWA 2E44A 2MLZA 3W1YC 4OYZA 1Q5VA 2CJXB 4LF5J 2RRNA 4KSEB 3AH6A 2E7WA 1HI1A 2QV6A 3OD2A 3H25A 3NNCA 2XYGB 2GVDB 1V5VA 1M5SA 1FKOA 4KT0C 4YN3B 4TU8A 3FEZA 5HAOA 3M9NB 4RUBA 3GV5B 2E7XA 5DO2A 1ZOTA 1R0CB 3GPAA 3RB4A 1S77D 3KMQA 3MPWA 2DR7A 2J6UA 5B0CA 3TQEA 4KHPJ 4NASA 3CD6S 5LMUJ 3ISND 4TVAB 3BM7A 3R7NB 3MEGB 1AT1B 4IRKA 1ZA2B 3NGSA 1LWEA 1RWXB 2HAFA 2QLBB 2IVYA 3LAKA 4DL4A 3OFGA 4TYBA 3QO9A 2MZJA 4B9TA 2QJ3A 2H4WB 3SMZA 1RISA 2B56A 3L95X 4QIFA 5GAHI 3BYRA 3V4IB 5L9XA 5DQIA 3DRYA 2N3LA 2W4DA 1B7YB 1RE1B 2KL8A 3TZWA 1U6FA 3J7YU 3SI8A 4OX7A 2OO4A 2H3EB 4R8UA 4EK2A 2KVIA 2WONA 1FT8A 1C1BA 1PJ5A 3RRGA 1X60A 2H5IB 4KV8B 3IS9B 4PRFA 1G2EA 1N5QA 3KFWX 1M0SA 2ROEA 1S7HA 3V6JA 4C98A 5AXLA 4DSEA 4C8MA 4HTIA 3BBBA 2HSEB 4WFXA 1N36F 1HWKA 1LFPA 1RU1A 1FDNA 2IRYA 3AB2B 3ZTRA 4AE5A 1SC3B 4KFBA 3ICLA 4LFBJ 1EP4B 1A7GE 3K5MA 4YS2A 3CEDA 4M5MA 1JWWA 3QBCA 3C46A 1XNRF 3MMBB 2GX8A 1HNZF 1XTZA 2A6MA 1N54B 2DTJA 2JJ4D 3R6LB 4I69A 4IKAA 4PXBA 4YFUA 3G6YA 1OSDA 4NE9C 4RUHA 3N01A 4DR4F 4FXVA 4NA2A 2WB4A 1IBMF 3NAHA 2J9DA 3OQ2A 2NYIA 2DBBA 1PO6A 2OIHA 1NH7A 2MQOA 2R8HA 5GAEI 2QGFB 4FYDA 3CDUA 3FCHA 1IKWB 4MKBA 2ZOMA 5D0GA 4Q5VA 3UD3P 1FJGF 3TVZA 4X4SA 3FK4A 2R7TA 1RT2A 3BGRA 1FJEB 3IO1A 2IYIA 1NDKA 3EICA 3B4DA 2KHDA 3WDOA 4YHHF 3BGUA 4M5NA 2W9AA 5FLXY 3HHLC 4B3TJ 1S6UA 3IWLA 4Y3CA 2BR0A 4LBHA 3CC4S 3KG4A 1FWPA 2IM1A 3HHKA 3QO9B 4HT7A 2MZSA 2QG9B 5KFTA 4X66J 3HFZB 3KK2A 1ZYQA 2R3VA 5DM7Q 1UVMA 3KLIB 4WIQA 3C6TA 3SDEB 5GMEA 3DDKA 2XMAA 2GGPA 4LIWA 1XR5A 1L3TA 2JEGA 2G2YA 4F25A 5L1LA 4DV6J 3AD8C 1HBOB 3MCMA 2F63A 2KXNB 1HNWJ 2XO6A 3SCIE 3HD2A 5KFSA 2FHJD 3D9BA 3KWMA 4Z7CA 2W9CA 1WORA 2QL5B 3BGFA 3GG1A 4ZA1A 1DJ0A 2V8DA 1TL3A 3OBIA 5L8RC 3UVJA 1CULB 4CTAA 2FPHX 1RB0A 4B17A 2CQGA 3PX4A 4DR1J 2CNLB 2IM3A 2RAQA 4KHMA 5IM0A 2OPPB 4CT8A 5KFJA 4F2RA 3M8ZA 2R7XA 1SV5B 4OZ1A 1IKWA 1NMEB 1HBMA 4I7FA 1V3RA 1D9DA 1EQMA 3N6NA 4LBIA 3KDNA 3WBZA 4WFAQ 1FNOA 2YH1A 3PJXA 4HKQA 2DVIA 1VRTA 4C11A 4CNZA 5CYJA 2E9RX 2HVZA 4LF9F 2HS4A 1S1TA 1VQ9S 3ZTOA 3Q22A 5I42A 4RJVA 1M90T 4BC9A 2XHCA 4X4OA 1S9GB 3AQPA 2UV8G 3U27A 1R8CA 1T95A 2DRDA 3KK2B 4AQYF 1UVIA 1K0TA 2LDIA 3TVYA 3AB4B 3CDBA 3N5BA 4ID8A 2FVPA 1X7VA 4XK8C 1FESA 5DG9A 1ZA1B 4XIUA 4FF1A 2CQCA 3LGMA 4B9SA 5DJBA 1RLDA 4WU2A 4EGLA 3CMAS 2RKIA 1J27A 1YSJA 3MAAB 1WELA 3OR1A 5H9FJ 4X64F 1IN0A 1S10A 2V63A 3ILIA 2HFSA 5C7PA 4Q0BA 5E7OB 2CXEA 2W2OP 2YNHB 2ASLA 5CYQB 1G1XA 1U6BA 1TKZB 5A6PA 1RU2A 1XMBA 4LF1A 1X31C 2CPHA 4KB7A 4LSNB 4ECTA 3W9HA 2UVVA 3DRSB 3JQMA 4KGXB 3W8PA 1N34F 1DLOB 3WX4A 2BRLA 1CJTB 2LQ9A 4K50A 1QDUB 2Q79A 3TZYA 2QE5A 1LFWA 2M88A 4UQTA 5DDOC 2AJ2A 4ZDNA 1S0VA 5HMYA 1VC0A 4JI4F 5K9FA 4M5GA 4U9RA 1F0XA 3A13A 3H98A 2MXYA 5AJ3F 3DRXA 5I3PA 3I4PA 4I2PB 3C8YA 2GFFA 3DM2B 4FP9A 4M5LA 1DARA 1VQYA 2BJEA 3O44A 3ZTQA 3J7YI 3LALA 3EGVA 2W8KA 4LF5F 2Y0SD 4DN9A 4ZN1A 3ZC4A 3FBCA 2O5DA 2VFRA 2N4CA 1NB2A 1CJVB 1HQEA 2CJQA 5ETSA 3ZZUA 1RWKB 2XZDB 4OV1A 2NR0A 3CCRS 1F5BA 4RW6B 1U1RA 1KTQA 2JEJA 3C2PA 1S1UB 2EBGA 1S1XA 1FWLA 3HVRA 3IRXA 3FVYA 2JC1A 1H72C 4C0BA 4DF8A 2QMUB 2PC6A 3NG8A 5KFOA 4A8KA 2NXEA 2JX2A 3HP6A 3VQTA 1HARA 2V2KA 2YH0A 3ZZRA 4PG5A 2ZITA 2HK3A 4F3QA 3IRWP 4GC6A 2R9LA 4A8YA 3HT0A 3GJSB 4M5HA 4O3SA 1KP6A 4DQRA 4F02A 4QPTA 3UW1A 3MFHA 3D0HE 4BWJA 1IQTA 2ZWPA 3O2IA 3EZOA 4IG3A 2AJ1A 2HBRB 4NWBA 2IRUA 5A0YB 4DR3J 2J6SA 2ATLA 3EGWB 4K0KJ 4MJKA 5KFYA 1X5OA 1Y10A 1B0TA 2Y1RI 1N6QA 2DO4A 3IM9A 3NL0A 1S7IA 2HZCA 1N0VC 1RWOB 2E5GA 2HRUA 3EM1A 3SQGB 5IFMA 5L39A 4J9RA 2OH2A 4RX6A 1HPZA 1TKZA 2B4UA 2KXHA 1F60B 1ZAXA 2LA4A 4LSNA 4RW9A 2XLKA 2HHTA 2E29A 5D4LA 3IA0A 1FXLA 2RU9A 4EUVA 2K1RA 2JEIA 2ZNYA 2ZBCA 1U49A 2OEKA 1L3KA 4YDXA 4P7TA 1Q5YA 4RL1A 2Y0BB 2O3DA 2M5YA 1NKCA 4HDGA 1N33F 2KFZA 1VI7A 3D54A 3QRRA 4NX9A 5IZHA 3BR8A 1TZ0A 1VLOA 2P6TA 4ED6A 4IO9Q 2SXLA 1SKWA 5L1IA 1WC4A 1UVJA 1FRIA 4YR3A 5CD4A 1YRTA 1HQUB 3O3LA 1X5TA 3CUNA 2OSRA 1EX8A 4RWWA 4GC7A 4JI6J 4C8ZA 1EQ0A 1WJ9A 2GCFA 2WSCC 1KFDA 1T11A 4P2XA 3W65A 3I5CA 4ZVRB 5LSOA 2WVDA 3N6MA 2ROPA 2EFGA 4J7CA 4K4ZA 3BREA 3BQ0A 1ACMB 3OW2R 3JSMA 4RNNA 4C9DA 2U1AA 4CLTA 2F8HA 4O3PA 3V5RA 4PXCA 1BMQB 1TL7B 2WZ1A 4B9UA 3M2UB 2PE8A 5M2RA 2W4CA 2P2CB 3DRRB 4LSLA 1XIQA 2CKWA 1TV6B 2WB1D 2YNIA 1FRKA 3M6WA 2C2EA 4W98A 1SKSA 2L9DA 3W60A 2Y3YA 1S0MA 2HHPA 1YJ9S 3C6UA 1MSWD 1PJ6A 1H0HB 4O44A 1KFSA 3U02A 2ZDOA 1WHXA 2POKA 2E1CA 1D3WA 3H2LA 2HQDA 5CH7B 5BYQA 4ATNA 2DNMA 1LEOA 1W7WA 1F6TA 3NS7B 1RTJA 1LW2A 1UJ5A 1OIAA 4ED7A 1EKSA 1RWWB 2RB7A 3K5PA 3TAPA 2G2OA 1RAOA 4HI1A 2DCUB 2CWXA 1NSQA 5HROA 3FDSA 4B3SJ 2IJRA 4WWSA 1MN7A 2Z2LA 2BW7A 3RUBL 2HHVA 2CPYA 1SQFA 2H9ZA 4FF4A 5T14A 3PZPA 3VWSA 5C24A 2PMZD 2CUYA 4JV0A 5I4MA 2VQEJ 3R97A 2MKCA 4N41A 2FLLA 4G3IA 2K1RB 3KHHA 3KMSA 2YNIB 4Y00A 3EMTA 1KHWA 4WZMA 2XCAA 4CH1A 4ZS6A 1VIXA 3MM6A 3PM9A 2XS5A 3VZIA 2ZNZA 4JV1A 3OHBA 4KGMA 4WE1A 1WTBA 4MKVA 4X4VA 4HLBA 1DQ8A 2GA7A 3IBCB 4U7CA 2Q66A 3QIDA 1J5EF 4QWDA 3T3FA 3NOGA 2NXCA 1B0VA 4DL5A 1BD6A 4ZP8A 1IR2A 1KEKA 2KTQA 4IDKB 1HQUA 2D3OR 1RAFB 3M8RA 2CJ9A 1N5SA 3EVWA 1UJ4A 1K73T 2CZ9A 3KJQB 1HNIA 1GQEA 3GWCA 3WIVA 1S6PB 2ZH2A 4LFBF 3HDSA 3D5MA 2C1EB 1MW7A 1YX2A 4QZVB 5D0HA 5IV3A 4HACB 4NLTA 2L48A 2XI3A 4ZVQB 4RW4B 3ZXWA 2JSXA 4CLYA 5E41A 2R2UA 1C4CA 3GJTB 4AL6A 3L4BC 3Q24A 1JB0C 1V3SA 3T5KA 4DR4J 1B99A 5C2CA 1XK8A 1Q8KA 4WE1B 2RDIA 4NYZA 5CQGA 4DMZA 2GMHA 4UY85 2JC0A 1GTHA 1RT1B 1WI8A 2CJBA 2HNYB 1BXNA 4P9SA 4USKA 5FD1A 2VDHA 3SQOP 3KLGB 4DPXA 4TLRA 1RLCL 3DHWC 3TI0A 1R8HA 1HW8A 2CADA 1S79A 2HG4A 3NGTA 4RZRA 1FRLA 4J9MA 4QOTA 4NI2A 4UUXA 1RHUB 2PFFB 1S6PA 3MHYA 4QYZK 5HLFA 2WW4A 4NLPA 1RTDB 1TVRA 4PG6A 2DNKA 2VQFJ 3PY8A 3DI6B 3MCOA 2BRKA 2Z2MA 3H90A 2B7BB 4PAAA 1X4EA 4G1PA 4UF4A 2ZJQQ 5HATA 1VQ8S 3J7Z5 4BHQA 3AD7C 5DM6Q 2ZH7A 3CJ0A 3I0SA 1URNA 3OLBA 3MXHP 2RQ4A 2W2PP 2AF6A 2HVEA 3Q8UA 5DQGA 1IJEB 3NOCA 3W9JA 2D41A 4ZJOA 3OLAA 2LECA 2E1AA 2ADCA 1AFIA 4OHVA 1RHQB 3BDEA 4Z37A 4TYAA 3ONQA 4Y2MA 1PC5A 2KH9A 2GVDA 2PDAA 5A6WA 2W2QP 4F0HA 4F4YA 1QVGR 1YJVA 5I3QA 3QT7A 3ZZYA 3TRGA 2ZE2A 3CD0A 3CJKB 2CFXA 3TJ8A 4F4WA 1NJXA 1VRTB 4RPFA 3J7AN 2EKNA 4LF8J 3THVA 3POTB 5FIIA 3F0NA 4FNIA 1WDDA 3OSNA 2Z30B 2IFXA 1KTVA 4JBCA 2IHR1 3Q8QB 4LF9J 2G2ZA 1FF2A 2JFDA 3UCZP 3I56S 2DJWA 3ILJA 1NXIA 3ZZOA 4UZCA 1GMVA 1K9MT 2B9EA 2R42A 2F7VA 2KG1A 4AL7A 4WP8A 3PR5B 1F5CA 1MN9A 2IA6A 2YKMA 3DCAA 1DTQB 2ZD1A 3OTDA 9RUBA 5B0GA 4MH8A 2CNOB 4R5PA 1EARA 2KM8C 4A8MP 4DUZF 4OYIA 1LXNA 2OMOA 1I6JA 5SUHA 1QJHA 2KDOA 1U09A 3QATA 3RZAA 4X64J 2D3ZA 2CPDA 3N6LA 2MEWA 4EBDA 2IRXA 1VR6A 2ZHAA 4KO0B 2KG0A 2YNGA 1UEVA 2B7CB 3CIZA 5HLFB 1DHMA 4LF4J 1LWXA 5J1EA 3KLEA 1U1OA 2A2CA 3OFEA 1TKDA 5KOXA 1UW4A 3MCNA 3LP2B 2A10A 2IAJA 3MMBA 1C0UA 3LPEA 4O4GA 4Q8FA 1XMQF 4X65J 4NPOA 4MK7A 2MSSA 4N77A 4C0OC 4I6YA 4N8OA 3G6VA 2KU7A 1NK0A 5LMUF 3IFEA 2JWNA 1AROP 2BW2A 4UW2A 2BJ1A 4CIOA 1T8EA 3FRYA 3VQSA 2I2YA 2LLZA 3LWLA 2W9CB 4G1QB 3KNAA 1EAYC 1P9YA 1S4FA 3MEEB 5EWEA 1B4SA 2H48B 3RAMA 5KFXA 3ZZPA 2A1BA 3IRXB 3WC2A 5KG0A 1RT2B 3QJPA 3MM5A 3HHLB 4NCGB 4TQRA 2XLJA 2RUSA 1QSYA 4RW7A 4JUZA 1S48A 2KJVA 2XLIA 4ZP6A 2HW3A 2CG8A 2NZ4A 1NH8A 1RWPB 2KHCA 3MMAA 4L73A 1CPZA 5KAKA 1XNQJ 1KS2A 3D6HB 2VDIA 1IKXB 1IKVB 2VQEF 3QT5A 1PYOB 1SJFA 2DH9A 1R3NA 3EDRB 3NGKA 2DGQA 3DDNA 4OJ1A 3IXQA 3SDEA 3KLEB 2HHXA 3KK3B 2IA0A 1GH8A 4U7UK 3HMJG 1E6YB 1VK3A 2QSFA 1L3VA 3O8WA 1SVDA 2GHVC 3FZ2A 2VHGA 4TU9A 1VISA 1KC8T 2DKOB 1NHVA 4AFFA 4KO0A 3JQKA 1R8AA 5F8IA 3Q8PB 1ZM3A 2QA4S 2KRBA 1R31A 1RA6A 2DIVA 3GCXP 3MPDA 1N5YA 4NEZA 3MEEA 1H7XA 2UUCF 2MSTA 1UA0A 4WKRA 1KR4A 2MTLA 3DOMA 4L75A 2L9WA 1CC7A 1RADB 2KT5A 4DV4F 3H59A 3CXCR 1GK8A 3A3PB 4YB5A 1GEHA 1NSKL 4MFBA 2DR5A 3W9IA 3TVKA 3BB5A 2ZZNA 5FLXU 4ECUA 2A0FB 4LSZB 2GC8A 4X4NA 3W64A 4LRDA 2J6TA 1WACA 1IKXA 2MZRA 3GYGA 1WTFA 2K2PA 3PFEA 4L76A 4CDIA 2OPRB 1JNZB 3IWNC 4LRBA 5ETVA 4OX9F 3GG0A 4USHA 4CZCA 1WD6A 2F9DA 1U1KA 1T03B 4KPYA 4GKKJ 1WF1A 1M5PC 1RCXB 3UR0A 2OPSB 4OYPA 1TL1B 2RVJA 2RUGA 1RBLA 4O0IA 3MFIA 1UW9A 2RQMA 4K4TA 2E5IA 2MY7A 2VBZA 2D3UA 2UU9J 4RNHA 1RWNB 4FYXB 2JLEA 2B3TB 2LEAA 4DV1F 2DH8A 1XBWA 2YQ1A 2DNHA 4OQJA 4NL5A 3RB6A 2YWEA 4C48A 2XY5A 1IKVA 1Q0NA 1VQSA 2JLFA 1T94A 2RHQB 2HHSA 4DBQA 2BQRA 4H4KA 3DOLA 1FJ7A 1FCAA 4NMXA 2D9OA 2NSCA 2V67A 2YQ3A 4LRAA 3NGDA 1VBYA 1HNZJ 3D6FB 1RBAA 5DDPC 2CQIA 5HL7Q 4S0MA 2HNZA 1HI8A 3QYYA 1IXKA 1S9EB 2ZOFA 4USMA 1JLEB 1RHJB 2DY9A 2L08A 1R6VA 4J5OA 4K59A 4CWBA 4ZIWA 3L7UA 2VOPA 1U0HB 2HHHJ 3MM8A 3KTQA 2AYEA 4LUBA 1RXOB 3SQGA 2HQIA 4ITSA 2OP5A 3KJNB 3Q8RB 3VGSA 3IR7B 4DR7F 2VG6B 2K7JA 2ZBRA 3MD1A 2FHOB 3M8YA 4M5KA 2D3O1 5EDWA 2GO9A 5KFMA 3BEGB 2GV1A 4HI2A 1F2HA 3D68A 3FSYA 3Q86A 1W26A 1WG1A 4MIWA 4YP3A 1A9NB 1UVLA 4KE5A 2C3YA 1HKAA 1SKRA 4AXJA 4FS2A 2XMJA 2ZBPA 5KG7A 4AXIA 1IR0A 1FX2A 2W4PA 4CLZA 3V4IA 3PFOA 4PWDA 4GVLA 4TY8A 1RTHB 2ACMA 2DNYA 4L6V3 1VC5A 1NK6A 4DPYA 2I9SA 2WTFA 4NLOA 3CULA 3DLHA 1JLEA 1G3OA 1KHVA 2LQ8A 3F41A 4H4OA 1FRJA 2FB0A 3WC0A 4DV0J 2XNRA 5KFZA 2YVSA 1NK9A 4A8QA 1KVJA 5ETRA 1GTEA 1TL1A 4CLKA 4Y0FA 2G0IA 2U2FA 3A3OB 5KFEA 2K8GA 2MQ8A 1R0BG 4ECRA 4UTGA 2BXJA 1SUQB 1HYSA 3HT3A 1WKJA 5LJ3Y 3P49B 4USIA 3T1HF 3BH7B 3UO0A 4CM0A 4TXSA 4LJMA 3OHAA 1PC4A 2OUGA 3M1VA 4HH1A 3FQKA 2E1PA 2IYGA 2ZFHA 2CA9A 3LP1A 1WC6A 1VFJA 4M5JA 5KFVA 1VYAA 1QAYA 2ZVIA 3KKFA 1T9TA 3DLBA 2ILYA 3GU0A 3G9CA 3TA0A 3MR5A 4CYUB 2CPEA 1S72S 4DR5F 2E5LJ 8RUCA 1KQSR 2GIRA 1UCNA 2HLTA 4LR8A 1NUEA 5KFIA 3TZZA 1L3SA 4V19X 3DNCA 3E3XA 2RJZA 5E3QA 2NYHA 2AW0A 4AQYJ 4RLEA 2VA2A 1OSCA 2EPIA 3HJVA 4KFBB 4KH1B 4C3KA 1TL4A 4OYWA 1UVNA 1P6TA 3J80Y 3BGRB 5IXUA 4MT1A 4QW8A 3W7BA 3J81j 4KHRA 1YQHA 2RILA 2AKWB 1OY8A 3KJFB 2VQFF 2Y1IA 1UWBB 3QZ8A 2ALZA 2VG6A 1JX4A 1UEKA 1JKHB 4WFNQ 5J2NA 2R2RA 4LRFA 4RWXA 4PG4A 4NLRA 2IBKA 4JI7F 2LP4A 4LF7J 4NZ6A 2MKJA 3HSZA 2FZCB 3CJ4A 4CLUA 4PPDA 5KFRA 4DXLA 1VLYA 1VRUB 4KGVB 4UOGA 4CO1A 4I67A 4C8NA 3T19A 1S99A 4EEYA 2YBVA 3DRRA 2I8EA 3DGVA 4LSLB 4X4TA 1NK7A 1RKJA 2V9KA 5B7WA 2G4BA 3JSBA 1FFSB 2B0GA 4ZHRA 2V0NA 2BA9A 1FERA 3F44A 2ALYB 3PIPQ 4TQSA 2CQBA 1Q16B 3MAHA 5JUMA 2AGPA 2W24A 3C14A 1TFWA 3MECA 5E3RA 3GFZA 4IO1A 4A8SA 1HR0J 2DNNA 4CYUA 3TAQA 1CLFA 4EBCA 2L41A 3KK1A 2HGLA 2EFVA 2Z56B 2ZH5A 1HNIB 3ILLA 2PEBA 2OPPA 3BV8A 1KLMA 4B3TF 2B4VA 3M2RA 4P10A 1N33J 2CPIA 2HWIA 2A3JA 1AZSA 4USWA 2MQPA 3CO0P 1FK9B 2F3JA 4J9LA 2F8EX 2E1RA 5ETMA 3ENAA 2B8PA 2CJAA 1C4AA 3ZNJ1 4DPUA 1RT6B 4X66F 1DTQA 2ZD1B 1RAHB 1Y4ZB 4DQPA 1IUJA 4DCPB 4YY3J 4DLGA 2K06A 5DETA 1JJ2R 4EO8A 2Y1LB 4YB1P 2VJVA 2MKYA 1GX5A 1N5TA 1RT1A 4KPCA 3E8OA 3SFUA 4BWMA 4QYRA 3EGNA 4RW8B 3GR0A 1N32F 3NWRA 2MKIA 1CS4B 2H4YB 2C42A 3ETOA 3DXBA 2WONB 3G8TA 2FLNA 2RMLA 1VRUA 2UVRA 4G1QA 2AHOB 2VOOA 3M8PB 4X84A 1RT5A 1U7LA 2DXDA 3GP9A 4LBPA 5B09A 2GHWA 4WCEQ 3FC9A 4DFKA 3DLGA 3E2EA 2NQPA 1IBCB 5HANA 1SJ1A 1OWXA 2I38A 3P8BB 2RIJA 1ZM4A 2Q6BA 2VG5B 5F8MA 2BJ7A 2RF2A 4OJHA 5KFKA 2W8LA 5J2MA 2IAJB 2EFOA 3QJLA 5K20B 6AT1B 1HD0A 3CNQP 4LF2A 4U67Q 1EZZB 1MMLA 5I42B 2M70A 3AA9A 2JL9A 2VG7B 4ED1A 1N4LA 1PG5B 3OXFA 4RNMA 3OVAA 1LWFA 1NRKA 2BV3A 4C97A 1DLOA 1ZTWA 1JLCA 4KQZA 4I64A 2DHHA 2P5VA 1IKYA 4HR2A 3UFCX 4NCAA 4OLPA 2QA2A 3JTOA 3TWZA 1RT6A 1Q8IA 2HNYA 4QW9A 2RKIB 4FBUA 3HZEA 1HWJA 3BGOP 1Y3JA 2XQCA 2XMVA 3AOAA 3HKZD 3IWXA 1S1XB 4I2PA 3QGPA 5HQ8A 1Y0HA 1YGYA 2HZAA 2XZWA 3DMJB 2ZH4A 3PRDA 5A8RA 3VAJA 2OMLA 3CT9A 2VG5A 1YDLA 1SIZA 2UUBJ 3B78A 5JVGQ 1CJVA 1NLKL 3U1MA 4PQAA 4RNFA 3CMQA 2BJ8A 2HQGA 4DR3F 2MQNA 3ENWA 1OQ6A 4FYYB 4B3MJ 4ALZA 4QR1A 1CQMA 4DU7A 4ED4A 5F0WA 3FEYB 3LGNA 1GNKA 1VDHA 1HHSA 2EKYA 4RUCA 2QT7A 3BF4A 3TUIC 4JI8J 4X62F 2B43A 2RE1A 2HBYB 1OPZA 3NAIA 2AIRB 3D3BJ 5DLGA 2VKRA 1LNQA 1QAIA 1H2TZ 3G86A 2DNGA 2A18A 5C5JA 5CZVA 5KG1A 1RYRA 3DLLQ 5GAEU 4W90B 2FHJA 3FFIA 4ZVOB 5CXTA 3ET6B 1HQEB 1F1BB 3M6XA 2E9TA 1REGX 1GFWB 2BYCA 2DITA 1UP1A 2XCPA 3NY0A 5C25B 1TFYA 4QWEA 1FRXA 4IG3B 2VODA 3Q8VA 3D6MB 2X7IA 3EUNA 1NZAA 4OZJA 1SJQA 2K3IA 2EXUA 2OD4A 4GVBA 5ETKA 2DNQA 4HEA9 4ETXA 1NHUA 2YPYA 5DGAA 2OPSA 1FE0A 3CB4A 2NCKL 4RKUC 3TR5A 2G1HA 4NXNJ 3EJMA 1M5VC 2QLXA 4WJBA 4F4ZA 3CCLS 2UP1A 1N6QB 2PMWA 3I4HX 1S12A 4DX8H 3DMJA 5LSLA 3VTIA 3M8QB 4ED0A 3UR3C 2HHUA 3AT1B 4JB8B 3Q0AA 2JOQA 4JI6F 5E2QA 4ED3A 3AJ1A 4PG7A 2RQCA 5THWA 1Q1KA 1QE1A 4GKJF 2AYGA 3T1HJ 1X5PA 1X4HA 3IG1B 3M8WA 2R7OA 4CO5A 4DEZA 2AD9A 3SYZA 2J0XA 3TNVA 4ZPBA 2GJ2A 4AYBD 2DPJA 3JAMU 4NLGA 2VBXA 2YWFA 3L7PA 3RRHA 4ERDA 2YKMB 3KYLA 3C15A 4ECWA 1U4BA 1F3FA 2IPOB 3R8YA 5FJ4A 5GAHU 2CQDA 2GAHC 3H5XA 1RZMA 5HMWA 2YKNB 2J9DE 3TA2A 2MKKA 3Q23A 4L3NA 2B6AA 4DF4A 2OHDA 3M4XA 2J7KA 2LFVA 2LKZA 3AOCA 5EUHA 3W62A 3R3TA 2RU3A 3W2WA 3M8QA 1Q79A 1KD1T 3UN2A 5CABA 3DOLB 2V9WA 2IM0A 4UUWA 5G4DA 2AZ1A 5DDQC 3B82A 5J1EB 4F50A 1TTHB 3GIRA 3KG1A 3MD3A 4ZLJA 4PXDA 3TUJC 5M2PA 3IP0A 2C28A 3UD4P 4CP5A 4G6VB 1C0UB 1Y7PA 1KWMA 1GT8A 3JB9k 5F8JA 2BJDA 1EETA 1LW2B 2B9WA 1VIOA 2L9NA 5HJYA 1UKUA 2GJIA 2M9KA 2OPQA 3UQSA 4CLWA 2F4VJ 1WF2A 2DB1A 3C6UB 5DZ6A 5EHHA 3J80U 2CZ4A 4OI4A 1S59A 4DR6F 1WC5A 1ZM9A 1TUGB 3FCVA 1NPRA 1WG5A 1RAAB 1EB0A 3PYEA 4O44B 1U25A 5L46A 3R1LA 4DSLA 2HFZA 1BQNA 4J9VA 4WKYA 1HBNA 2BKPA 5CZXA 3KNGA 5GADU 3CJ2A 2AT1B 3I32A 4F4XA 2WBRA 1RQ0A 4FNHA 4W4MA 2F4FA 4MYTA 2BZ2A 3R7BB 2DNZA 4I2QA 1TL7A 1Z1ZA 3F56A 3HF5A 2W7OA 5LM7E 4FXDA 3I96A 2HQCA 2AZ3A 1C0TA 2X51A 2OEJA 5KT5A 1HNWF 3G87A 2BMBA 3OTOF 4TLQA 4JYAF 2RRBA 2ZBQA 1LWCA 1YJWS 4MAKA 4UOCA 1YLXA 2AQ4A 2MYFA 4TU7A 1ELOA 2KO1A 5LL6d 3DYAA 3I0RA 3R5BA 1VCTA 1WSVA 3W2VB 3HVWA 4M8LA 4Y2KA 5HSPA 1SC4B 1Q95G 1J5OA 2DR8A 2E1MC 3MM6B 4MIBA 2K7KA 4IQMA 4KC5A 5AXNA 1ULRA 2QIFA 4P2SA 4EBEA 4FF3A 4OHXA 3CMES 3VGUA 3MURP 3NNAA 2DK2A 2WBMA 3T5LA 2MB0B 4MMOA 2Q43A 3QPIA 5D77A 1BHNA 2BBEA 2H1YA 2XMTA 2MZQA 1R8BA 2HEKA 4OZ5A 3R2CJ 4XAKA 1VQ6S 4A8XA 3UD5A 4ENOA 3MZIA 1FA0A 5HQLA 3LP0B 1X4AA 3M9MB 1HBNB 3JAMY 1HMVA 3NBPB 1HFEL 3HM9A 4ANEA 4CNYA 3RBXA 3KLVA 4MFBB 3BH6B 2V8PA 2ZDPA 1DURA 4F0KA 1I94F 2OFHX 3UWTA 2G0CA 2EG2A 3RBEA 4PWUA 2AX1A 1T9YA 2HYIB 1HD1A 3MEDA 3EZ5A 4ETZA 2YX7A 1V6HA 1RTDA 3T6JA 2VUGA 1AFJA 3BBCA 4QIWD 3RAXA 1TKTB 1APSA 3W5ZA 1IBMJ 3CDWA 2JDJA 2FQQB 1RHRB 4IH7A 2WK4A 3CJQA 2B4OA 3HVTB 4L72B 5D6GA 4QU6A 2DR9A 4ILLA 1FD8A 4CI0B 4TY9A 2OLWA 4NZ0A 5AJ3J 1FJGJ 4PUOB 4M63A 4FYVB 2RDDA 4ZMMA 1Y11A 2DXEA 1K47A 4K4YA 3OSPA 2FVRA 3G96A 1TKXB 3K7RA 1RAEB 4H4MB 4EZ9A 4LF4F 2UXDJ 2KZMA 4X4RA 1WKKA 5F0UA 4IOAQ 2LXIA 3QGIA 3CGIA 3SXLA 5LOQA 3CC2S 2MHNA 3HULA 3I0RB 3MECB 3BSNA 4A8FA 4PWDB 3RGIA 5IT9Y 2IDEA 2EG1A 3MEKA 6FDRA 2R4FA 2Y8YA 4WTYA 3G6XA 2NSBA 2HFOA 1MWYA 2WRMA 3AJDA 3NCPA 3U1NA 1SH3A 3NCRA 2AGQA 2DRBA 2VFSA 4C8OA 1ZH5A 3RB3A 1KBRA 1BLUA 1UMJA 1WOOA 3DLEA 3N79A 6FD1A 1VQLS 2IY5B 2N4DA 2AJQA 1RDRA 2YTCA 4I4BA 5HBMA 5B0EA 5LMNF 1NJYA 4IYQA 4OYAA 2UXBF 3W5YA 4C3MA 5CA5A 3K58A 5B0AA 1WHWA 3MR3A 2DNPA 3BN7A 4QQBA 2ACYA 1VRQC 2AJ0A 4LF6J 2C2OB 3ENQA 4NLVA 2XSJB 3ELHA 3DOKA 3SCJE 3OL6A 4RBTA 4J9QA 4WK3A 4QR2A 2E9ZA 2Y8WA 4DCJB 2J0SD 3BR9A 3OXLA 1SJ4P 1XJWB 2BE2A 1M5KC 1NO8A 4GKJJ 5BJRA 2WCXA 2W1BA 4M1KA 3CCSS 3I9V9 2BOAA 3PV8A 1VQ5S 5K8MA 1A0OB 4KR0B 1T3NA 4JI5J 3KDOA 1S76D 4JI1F 5I3UB 3RAQA 2GGPB 4C4WA 1YRUA 3EGZA 4DL3A 4ZOSA 3KLFB 1FKOB 2IDLA 4PQUA 5KFNA 2FJWA 1HBUA 3V6DA 4J9KA 1AA1B 4LF8F 2Z4PA 1S97A 1VQMS 1X4DA 4M94A 2M4MA 1FXRA 1S1TB 5EGYA 3L7OA 4WYLA 4ZN3A 3SZ2A 1S1WA 2CQHA 3DXSX 1D9FA 4IFYB 1IKYB 5DS7A 4XO0A 1FRMA 2C22A 4O3RA 2FDNA 1VK8A 3QZ7A 1P1TA 2CQ0A 4Y2IA 3VAHA 1N48A 2IJFA 4WFYA 5KFFA 2HLUA 4USVA 3SEOA 3TEHB 4E8UA 1MROA 5ETQA 2Z0GA 5IWAJ 2GNKA 4FVMA 1KNZA 1SC1B 1CULA 3SCLE 1N34J 3MAAA 3OR1B 4FDFA 4OZ2A 5IOLA 2MPUA 5E3PA 4ZCLA 4W92B 1IM4A 2LCWA 3KLFA 3MGJA 1MNEA 1B7FA 3OL7A 2JEFA 2UUAF 2YXLA 4P71A 3RB0A 4I7FB 4TNOA 2VFUA 3AOBA 3IAS9 1RACB 4WFZA 1Q86T 1WUUA 4J9PA 1HA1A 3O5TB 2LU2A 4I0WA 2BACA 3AHPA 3QAUA 3TUZC 3DU6A 5KG3A 5DRKA 3NWGA 3CCTA 2W9BB 3CCES 1T0TV 2GQQA 5D3GB 1A6LA 1N88A 1M1HA 4PXEA 1FEEA 4I1TA 4UY8T 4DSFA 3FFIB 4LMZA 2V34A 2W2MP 1CJKB 3ET6A 4B02A 1NZ8A 3OT9A 4X65F 3I0SB 4F7VA 2R8IA 2V4JB 3UNYA 3ZTPA 3OTBA 3SFGA 3W63A 2N7CA 3EX7B 2V8HA 1U2CA 3H20A 3OPKA 4JI3J 4OYXA 4RW8A 2OEMA 2HFVA 3RJMB 3PKYA 2CAJA 4J9NA 4GVBB 4OZNA 1VQKS 2X3GA 3TANA 1P27B 3MCSA 1YK9A 1GXLA 3A8JA 2XULA 4XPCA 1EIYB 4OL8A 1JLQA 4NLXA 2Z8QA 1NSPA 2MLYA 3EXYA 3TYTA 2RDJA 2EVZA 4K2XA 1JNRB 1PIEA 4YOEA 3A1YG 4DSJA 1ZAWA 3SSRA 2WAQD 2UZAA 1UL3A 2XNQA 1AW0A 3QIPB 2HS3A 4DR2F 1KONA 4J9UE 2VG7A 1WEZA 3DDIA 2GO8A 1EHWA 2ZH9A 2LEBA 1REVB 1N5YB 1RWVB 1TQLA 3TP2A 4DR7J 2IIHA 1FEHA 4ES1A 2UU9F 5AXKA 3OTEA 1TUWA 1IQZA 3GYNA 1H7WA 3Q2SC 2W01A 4H4KC 4DL0C 5HN0A 2EI5A 3QWUA 4NA1A 1T02A 4ZPDA 4DV1J 1SL0A 3FGVA 1EETB 4KKOA 1YITS 4CLFA 3PRVA 3MUTP 2B8QA 3PEJA 1OO0B 3ZO7A 4KYZA 1UA1A 1U2FA 5HI7A 2VIHA 4KIAA 3I5BA 2KB2A 2IC3B 3TEGA 4A46A 2CPFA 4ECVA 5A8KA 3K17A 3N4WA 4ZPVR 2DYAA 2N82B 3DFEA 2GHPA 4N7TA 3LOUA 2AMCB 3D0GE 1BY9A 3D0IE 2M2BA 2QRRA 2XEXA 4FS1A 1XN9A 1JJ4A 1U2RA 4ZPTR 1RSCA 2MQLA 2OPQB 3M8SA 2UUWA 3HSJA 2D1CA 3ZZTA 2HK2A 3VALA 1U8SA 2RNEA 4ECYA 3GJQB 4NXMJ 1JIHA 3NGRA 1M1GA 2CQ1A 4FKYA 3T5HA 4KKOB 5BYSA 5KFAA 2ZKTA 1QSLA 4NRUA 1T03A 5D15A 3D66A 4KV8A 5GMKa 1DQ9A 3I55S 2UV8A 3NCQA 3TX0A 1JLFB 3D4JA 4K7QA 4D3GA 5CCMA 4OX9J 1FD2A 1S9EA 3T1YF 2HHQA 4FF2A 1HNVA 4NLWA 5KFCA 4UZBA 3D7SB 4QYZJ 3P3DA 1H6KX 2QMWA 1UEUA 2HIQA 1WC3A 3NMRA 4K5RA 4ZVUB 3QT8A 5K5MA 4BCAA 4C2MA 2BM1A 2FGCA 2M7SA 4QWBA 1K1SA 4NMLA 4ICLB 4J90A 2HFUA 3CJ5A 4I68A 5E33A 1QVFR 2P8IA 4R0JA 1NKEA 2B5JB 4DV4J 3S01A 4USUA 5DDRC 5CHCB 2V69A 1YZ7A 1SC6A 2BJ3A 3BSCA 3DGPB 1RHKB 1LV5A 2JVOA 3VHQA 2LVWA 3AFGA 4P74A 4F3MA 1X8DA 3BBFA 4M5IA 4F4KA 1CSJA 9ATCB 2HIYA 5ADZA 2VD3A 1SB6A 3M2UA 1JJHA 4U96A 2V8VA 2V6AA 1U0HA 1UZHA 2HBZB 2LQ5A 3FRZA 4P75A 2VBYA 3W5XA 2LA6A 3KLHA 1VQ4S 5F3ZA 1NKBA 3E01A 4J37A 4PKDB 4LRCA 5F8LA 1JXLA 3QSYB 1NK8A 1TK0A 2AYBA 2IC3A 2Q6CA 1KQKA 1IBKJ 1QUVA 1S5ZA 3D2WA 5CAAA 3WZ0A 1FTCA 1U24A 2NZCA 3LP1B 1RTIB 4Y6IA 2A2DA 3IBWA 2QZ8A 1RTJB 2XI2A 4RW6A 4GMKA 3M32A 2BKNA 3A8IA 4ICLA 2ZUGA 2AYMA 1YKWA 1SCJB 4OI2A 4EYIB 2HAIA 3NP5A 1SUQA 2CPZA 1I5OB 2EFNA 3CJTA 1FNMA 3C66A 1RCOB 1Y5IB 2GVZA 3WX8A 1W25A 4U95A 1SJRA 3KLIA 4WXWA 4YB6A 2QEXS 2FJBB 3ISZA 1NK4A 4Q7AA 5K14B 1X0PA 2AP6A 2UUBF 2XM3A 3M1VB 3MI7X 3Q89A 2QA4G 2HHWA 4IOBA 2O01C 3IR5B 4K8RA 1YTYA 2QSWA 1ZPWX 2PMHA 4PZVA 4URQU 5KG6A 5IWAF 2DGTA 1Q8BA 2I5JA 1TL3B 3EPGA 3GYXB 4OI3A 5DZ7A 4ZVHA 4G65A 4UT4A 2Z2ZA 1G7CB 2AEMA 2WVEA 4G1IA 1SI9A 4KAIA 5J2NB 3D1HA 2FLPA 2ZHOA 4Q8EA 1QAXA 3QMQA 1NK5A 2KJWA 3FBBA 2LXFA 2OFGX 5KFUA 1XMQJ 4DV5J 3D28A 4ZLLA 2XTJP 4ECSA 1JJCB 3IC1A 3Q8SB 1FX4A 4LVOP 2FHKA 4C11B 2DCLA 2VKZG 1FDAA 7FD1A 2J7WA 1LWCB 2R2SA 3GSIA 5IT4A 1FHTA 2MDAA 5A76A 3T6BA 3HZGA 3K89A 4HVZA 4GRSA 1QTMA 2PO4A 3GQCA 4MYUA 1MWQA 1NDLA 1IWAA 2FVSA 4DPTA 1F2GA 4K5SA 2BE2B 3NMAA 5ETLA 4JI0J 2VPXB 4DR5J 4HT5A 5DG7A 4RU2A 5KTQA 2E5LF 1WDTA 4O3NA 4LFAF 1OJ4A 4NI2B 2XYHB 1DQAA 4IDKA 1DAXA 4YY3F 2IMWP 3L9ZA 3QLHB 3V6KA 3AXMA 2DISA 1YHQS 1R89A 2FZKB 2JVRA 1ICEB 5K14A 3TW0A 1FK9A 1I3OB 1VOMA 2JHEA 1JKHA 1SXLA 5HP1B 3HJFA 4L3KA 4F2SA 2O67A 2YNHA 4KRWA 3IS9A 3PJ9A 1RI7A 2R7VA 1KVIA 4WXOA 1JLBA 2X1AA 2R8JA 4KTQA 1RYSA 1NPKA 3JSMB 3M30A 2X3DA 4N8NA 1FNXH 1GAOA 3THTA 2CZVC 1SPBP 1YZ6A 3IBFB 4TKTA 2F65A 1RT5B 3B6BA 3K5NA 5J2QB 1D1UA 4X62J 4RBUA 1O6XA 4YEAA 3CJKA 1I1GA 1H74A 3MOZA 2UUCJ 4N76A 3QLHA 3EYZA 2UVUA 4DV2F 1CS4A 4R25A 3JTNA 1VQ7S 5KFDA 3P96A 5EN1A 1KLMB 2AX0A 2QL7B 2W25A 2BEFA 3GV7B 3HVTA 1F5AA 1M5OC 5E0OA 3T5JA 4CTAB 3TARA 4IFVB 1Z4UA 2B9YA 2CRLA 3UDVA 5U47A 2YWWA 1D8YA 1JLCB 4FN5A 2J0QD 1TP7A 1R0AB 1X4BA 3I5AA 2HWTA 1UTAA 3M30B 2FY8A 1URRA 2HQFA 5HJXA 4OI1A 2XYPB 1WOSA 3PR4A 1U1MA 1GXUA 1HMVB 2EK6A 5HMXA 3BSOA 1O8BA 3Q8YA 2FTRA 1HWIA 2ZM6J 4KBIA 2HMIB 2L3MA 4K4XA 4V19J 1Y3KA 4M5DA 1LQ9A 2APOA 2HNDB 1WEXA 2CPXA 5KFGA 3OJUA 3BSAA 1BQMA 4DCOB 1GMUA 2NUHA 3M2VA 2DHGA 2Q3PA 2YWKA 1FFGB 3DLGB 3WQPA 4A8OA 3TJ9A 4HYKA 2C3OA 4DLEA 3V6HA 3C3LA 2XBPA 4ZJQA 5SZTA 1MMNA 3IM8A 1NJZA 1UVKA 3DRPA 4TN2A 5IC6B 4LIRA 4ZLPA 1XEZA 2MKSA 5T7LA 4R5PB 1TKTA 2GJFA 4F4AA 2Y1JA 2PI4A 2ATCB 8AT1B 5KT2A 3VCDA 3WHIA 1HPZB 5T41A 1CJKA 5C42A 2QTWA 4GO5X 1YIJS 2AEFA 4RBVA 5F8HA 4V1Ak 5GVQA 3JXOA 2UVWA 4F8RA 4KGZB 2DEJA 1X4FA 4CO2A 2MQQA 3AY0A 3CCUS 3PJWA 4EWTA 2CVIA 2HVIA 5AT1B 3HHLD 4MKYA 2VZ9A 5F8NA 3L09A 2HFNA 5GAGU 5E5NA 5CYMB 2YKOA 3R5JB 3M2VB 3LP2A 4QR0A 3H7HB 3CF5Q 2BE9B 2ZJPQ 1WG4A 3CVKA 1R6YA 2H5JB 4HDHA 5KFHA 4ZJLA 1XMOJ 1U48A 2CNNB 1VBXA 5LXYA 3I87A 3QWPA 3K57A 3CCMS 2KXFA 3DM2A 4M5DB 3H5YA 4NCBA 4NZ7A 5KT4A 3TUPA 1AXQA 1D09B 3OUYB 5IT9U 2LQJA 4YQWA 2JLGA 1YBAA 3BN4A 5HBMB 1REVA 3PW5A 3GIJA 1I94J 3KUEA 1DRZA 1FVQA 1S57A 2PA3A 4D3HA 1RAJA 3R5DA 2HQ3A 4QPXA 4L74A 1DFDA 1NNDA 1TU0B 1NJWA 3GB0A 1SKUB 2GS8A 1QY7A 4F67A 3PO4A 4EYHB 4PYDA 3LTOA 2MLXA 5F9NA 2FVQA 4NLUA 2RRAA 1GX6A 3RBDA 5CYQA 1WEYA 2GW8A 2ZH8A 2DIUA 4DX5A 1FKPB 3G8SA 1MROB 4DUYF 3GV8B 2B9XA 2KT3A 1R43A 1S6QA 2B6AB 1DTTB 2V68A 3CCVS 4K2JA 5BYRA 3M9OB 2QLWA 2V50A 3J7A1 4NLSA 2DXFA 4O4RA 5KT6A 4OX8A 1OYDA 3C15B 2HGNA 4DDFA 3W2WB 4ECZA 1VQPS 4NLQA 1P1LA 3PNIA 3Q83A 4ZP7A 1HNXF 2BDPA 3N9UC 3UCGA 4NXNF 2YY3A 1TUVA 2ZVSA 3DC2A 3S6EA 3MR6A 3W3SA 4DR6J 3NS6A 1P9QC 2VPWB 2I6WA 1V9OA 5D3GA 3QRPA 3G82B 3PHEA 3PW2A 5JVHQ 2OTJS 3FUYA 1SBRA 4IFYA 1U8WA 4U6PA 2ROGA 1S6OA 1DBDA 1YBUA 4UOHA 5D4NA 2QFJA 3IGVA 2OPRA 5F8GA 1S6QB 3MUVP 5D0EA 3AQOA 2VBWA 5A2QY 3MR2A 4DSKA 4WZQA 4C7QA 4JYAJ 4YDDB 4PR6A 3MTJA 5H9EK 3MAQA 4JOUA 2XWXA 3ISNC 2MJNA 3CSKA 2FJAB 4Q2MA 4OLOA 1SQGA 3K2YA 4JI7J 4IR9A 3VR1A 1KDNA 1HI0P 2KVQE 4DWIA 2FHMA 2B4PA 5EX0A 2MZTA 3I31A 5KFWA 1S49A 2MHEA 1RT7A 2ZHBA 1HW9A 5D0RA 2YNGB 1TELA 4UQGA 4OV6A 4WIIA 1RTIA 3FSXA 3VAGA 3DGPA 4XDDA 2J8AA 3AJ2A 4FPIA 2R2TA 2W9BA 2J76E 2DNRA 3DN9A 2EC2A 4KGKA 4ELVA 2DD8S 4DV3J 1UPPA 2HPUA 2AU0A 2MGZA 1KLNA 1K0VA 2W7PA 3SBMA 4DOZA 3SIPB 1T7PA 3X1LB 3TJAA 2HNZB 2WHOA 2YKAA 5HVFA 3KLHB 1IBLF 3OL9A 3SV4A 3BZQA 1JXVA 2O66A 2D7SA 1FVSA 1SH0A 2WVCA 1CJUA 3C16B 5G0RB 3THPA 3H4DA 2ZWOA 4DPOA 4X4PA 4U8YA 3A4TA 4O3OA 3W61A 1N5VA 2ERRA 1U47A 4KY3A 5AE3A 3QJJA 3PO5A 3GIKA 2PSZA 2KI2A 2XS7A 4QU7A 3BO3A 2PIIA 1AB8A 5C25A 2KKHA 4I2QB 1NJIT 4DG1A 2EC0A 1LK5A 2OGUA 2PA8D 3P4UB 2FJEB 2QO3A 3UDEA 1E6VA 1HIYA 3E51A 3D1QA 3PW7A 2GVZB 3T1AA 3CTRA 4DUTA 3G6ES 2Z2YB 3R5GA 2DT9A 1M1KT 3MM8B 2FC9A 1RP5A 1Y5NB 3HX9A 4DL6A 4DV0F 3OTOJ 2JNJA 1ZS6A 3HK2A 3DKDA 3GSDA 2YNFA 4ZVFA 3AA8A 5J1PA 2DR6A 1AUDA 3SCKE 1QE1B 2CDRB 3HPOA 2WOMA 1YRXA 4H4OB 2DH7A 2XHWA 7FDRA 1HQ2A 3UPFA 4DX6A 1VGYA 4ZKAA 2PI5A 3CCJS 2HRYA 3NEKA 2D69A 3TO8A 3BO2A 4ED5A 2UXCF 3HSDA 2XY7A 2RSQA 1E6YA 1PBAA 4QIEA 4DS4A 3MEDB 1O5JA 1OPIA 1KOOA 3LUYA 4DV7F 5HQMA 5K8PA 1L5UA 3DLJA 2IVFB 1BWEA 2P6SA 3LP0A 2ZKUA 5H9EJ 4H4MA 4F36A 3CE8A 2G1DA 2E66A 2M0GB 4DQQA 3TQ1A 4JI3F 4DFPA 2OAUA 4LT6A 3VVUA 1L3UA 3PVXA 1HWLA 1PYSB 1VHFA 1FI4A 2YQ0A 3U1LA 3OVSA 5LMNJ 4URGA 2R8GA 1ZZNA 3G2XA 3R9LA 2MGZB 3DOMB 4XTTA 4ECQA 1GMWA 2CNKB 4HACA 4QWCA 2QN6B 4Y34A 2NLWA 3C6TB 2M52A 4NLYA 3BYPA 1HLWA 3T41A 3MM9A 1IVZA 3GTYX 3K0JA 3TZXA 4P2MA 4JV2A 4LFAJ 3RR8A 4YR0A 3W8GA 4JI2J 1HWUA 1MMDA 4DR2J 2HZVA 1CG2A 4EU0A 3O6QA 3NNHA 2ABYA 1T9UA 2Q1LA 1UPMB 4BS2A 4A4JA 5KFLA 3X3UA 5ETPA 4Y65A 2V4RA 4LQ3A 4K4VA 4DQIA 1HNVB 3HHEA 2ZZMA 4JI5F 4HHJA 3TX8A 1LWEB 2QL9B 3GJRB 1Q53A 1RTZA 1TKXA 2D9PA 2GMLA 3NRBA 4DN0A 1ZZFA 4CM2A 3KHRA 2Y9HA 1NB7A 1ZPVA 2QX0A 4Q43A 1NCLA 2VFVA 5BR8J 1R0AA 4AD6A 1HR0F 4WPAA 4B9NA 2GIFA 3JYTB 4RU9A 1UWBA 5HVHA 3MM9B 1EP4A 2WOMB 4N5SA 1KKHA 5MAOA 1T9WA 3OV7A 1CEZA 1X9MA 1OMSA 3DLKB 5M2UA 2VU5A 3DLEB 3M6UA 1MLAA 2OKQA 3CJSA 4NOHA 3KK1B 2KRRA 4NYOA 5IV4A 4X2BA 5LJ5Y 3V2UC 5H1SV 1ZAVA 2DO0A 5I3UA 1S1WB 1WOPA 3OL8A 2DNOA 1XWLA 2COLA 1N32J 5FDLA 4PWWA 3TAMB 2DHSA 1YBTA 1B0PA 3C14B 3I82A 4OHWA 3J7ZT 1ZETA 2ZE2B 2HBQB 1HBUB 2HMIA 2GAGC 2ILZA 3HHNB 1RWUA 1U1NA 2HGMA 5CD4H 4LF6F 4U7UD 5IQQA 2HRTA 3DRSA 2C2RA 4Y2AA 3US5A 2B51A 2ZH3A 1WHYA 3T1YJ 3MPVA 2KFNA 3ENVA 1BC6A 2OELA 3CDEA 3NXZA 2ZBIA 3CDAA 4OHYA 3AODA 1UWAA 3D3CJ 1TK8A 3DLKA 1MWZA 5A2QU 3KJVA 2ZH6A 4LFCJ 4F3OA 3EE3A 2NXUA 8ATCB 3PACA 4ZPWR 2V8GA 5GAGI 4JI1J 3IMQJ 1WKLA 4I56A 3M6VA 2W7AA 2YPZA 1N36J 2FD2A 2PGCA 2CWKA 5ETOA 3EVOA 1VBKA 3GZ7A 5GADI 1RHMB 3PX0A 3H5UA 4LQ9A 3VVTA 4ECXA 1PGZA 2XO7A 1LXJA 4X4QA 2OSQA 1BGXT 4JP8A 4CO0A 3FEXB 4IG0A 3V4MA 1U1PA 1C1CA 4Z7YA 2YKPA 2V2QA 2G13A 1S4EA 1JLBB 1X0FA 4FPRA 5E3AA 3LAMA 1FDDA 3T9NA 2VFTA 2FVCA 1F9FA 2RF2B 1GXTA 5C2GA 3HSGA 2DGVA 1T05A 1WWHA 5B08A 4B3SF 3RU0A 4FKXA 3R5CA 4DI6A 3GFHA 1YJ7A 4PEOA 3HCXA 4CLLA 5IQ6A 4ZCKA 1D9AA 2J7UA 1SH2A 2V4JA 2WVBA 3WIUA 1WC0A 4B9MA 4JV5F 1SQEA 1EKRA 4DS5A 4DU8A 1JLAB 4ANDA 3OUYA 1JLGB 3FBFA 4Z2XA 4IR1A 3GMGA 3VAIA 5K8NA 5A0YA 5B0DA 2UUAJ 4AL5A 5KFPA 2EW9A 2XS2A 2VC1A 3KJVB 1DZ5A 3CJRA 3DHXA 2MKHA 2QC3A 2IMOA 4IG0B 1KQGB 4O23A 5FDLB 3TAMA 1RAGB 1C1CB 3B4MA 3UN3A 5J2PB 1R27B 4Y2CA 2C2MB 4Q44A 3FJ2A 3RG6A 2FLOA 3PYGA 4QJVA 2AGOA 4B3RF 3R7SB 3G82A 4OIXA 4WYWA 1T05B 1HNXJ 1MU2B 1DTTA 1O0PA 2M3DA 3MPUB 4BC7A 1S9GA 2R7RA 1SV5A 3QNWB 1U26A 1S0NA 1VC6A 4KHPF 1MG7A 3SSSA 1Q78A 1XR6A 2XMKA 4A8WA 1QLNA 5L1KA 1CC8A 4GO7X 4JI4J 1SL2A 2VONA 1JLGA 2GQ2A 3RW6A 4N56A 4CO4A 3CD5A 5KG4A 4OZ3A 3M7VA 1KSPA 5A8RB 3RTVA 4WF9Q 2AV5A 4J91A 3M05A 4NCGA 3FBEA 1BE4A 1FWKA 1Q4RA 2GIQA 2OTLS 2MJUA 4Q0BB 3BS9A 5T7LB 1D0EA 5D78A 4CT9A 1RA7A 1Y5LB 2DHAA 2ZZTA 1JQGA 3V6DB 4ANCA 5JMNA 2BQ3A 3OTCA 2CQPA 3J81U 3PXGa 5B0BA 3H5SA 4E98A 3AXKA 1Y9OA 1NDCA 2RQKA 3JQJA 5HVGA 5CCLA 2ZJRQ 3ETMA 4ILMA 1CJTA 2LEPA 3QQCD 3GFXA 3P5BP 4CLSA 3L3CA 3UNGC 5D8HB 2YX1A 4RW7B 2R7WA 4DV6F 2YKQA 1B70B 5AXMA 1TL5A 2VL1A 1JLFA 4ES3A 2O1PA 3PG9A 1VHIA 2IVMA 5B0FA 3VGTA 3BPDA 1SJ3P 1CJUB 4WK1A 3Q2TC 2XWYA 2ASJA 2JH3A 1FE4A 1JLAA 1PBUA 1PCAA 1FO1A 1WSRA 2DHXA 2K3KA 2P9GA 5JXSA 4F26A 4WFBQ 1RT7B 1W2IA 2VH7A 1Q81T 2J9CA 4KH0B 1PAUB 3D1OA 3GLJA 3LGHA 3M8PA 1ZTTA 4USJC 1GMWD 1TR0A 4C8KA 4OJGA 5A8WA 3MOJB 1WI6A 3CCQS 2OJ3A 3RYLA 4NEYA 4HHHA 1S1UA 5KG2A 4ER8A 4PABA 1Q7YT 1Z2ZA 1YVFA 3J81Y 2DRAA 4ZIVA 1OYEA 1FFWB 2IM2A 3QFHA 1IM6A 3HO1A 2ASYA 4DV3F 2JRSA 2RT3A 4DX7A 3MUMP 5H9FK 3TA1A 3H8YA 2NS1B 4MTPA 3PCOB 1VJQA 3DU5A 3CWJA 5HO4A 2C2KB 1YWXA 3OFFA 2V2ZA 3OJSA 4LR9A 1JMTA 1U02A 2BANB 3PYFA 1PYTA 2FUG9 2PFDA 3I9ZA 3C19A 5HMZA 3A8KA 4E0DA 2DGSA 4IH6A 2ADBA 3A12A 2MQMA 4R8UB 4AUKA 2I0XA 2KYZA 4OI6A 3H2UB 5HK4A 1CVJA 1TAQA 3ILOA 3RRKA 3HFKA 2R8KA 1N56A 4OMFG 2X1GA 2H5EA 3HHDA 1YJUA 3JSRA 2ZM6F 1C0TB 4URSA 4BLGA 4E2FB 1JXEA 4RO0A 3H2VE 4EO6A 5KFBA 2YNFB 4DHVA 3RR7A 2CQ3A 2EFPA 2W2NP 1X9WA 3BKFA 4WP3A 5ETTA 1JK9B 2FZGB 1RABB 4F04B 1U45A 1RUSA 4RW9B 4B3RJ 4B08A 2EK1A 3AAWB 2JFKA 2FGOA 2AJFE 1UAWA 1NAQA 2VB6A 1AUSL 3FNNA 4OX6A 3EPIA 1T9VA 4NYPA 4QBUA 2UXBJ 3CC7S 1H98A 1T9XA 3GONA 4LR7A 5AE2A 2BKOA 4NRTA 5RUBA 2NREA 4OYMA 1VS3A 2XMWA 3ZTSA 2F4VF 3PKMA 4GKKF 4ZPCA 4ZHRB 3HLUA 4HHUA 5DLFA 1N0UA 3CCZA 4WU3A 4Y28C 4EI2A 1TAUA 1U1LA 4MIAA 3QAEA 3HI9A 3O1LA 5KG5A 4LFCF 1C1BB 4DJBA 3PDNA 2V4QA 2XB2D 2DEIA 1R7IA 1TMMA 2YWGA 3W2VA 2RD5C 2WVFA 3OR2A 3S7RA 1IBKF 2I5JB 5A8WB 3P6YC 3NKYA 3SSQA 1ROFA 1UFWA 4ZPAA 3IN5A 3HXMA 4B9VA 2F1FA 1D8ZA 2PEHA 4IH5A 1K1QA 2E7VA 2V94A 3H4BA 3GR1A 2R7QA 3GILA 3OVBA 4KJIA 4PCQA 2X1BA 1YG0A 3PTWA 1RGVA 1WHVA 2R7UA 4J9OA 3R27A 1RTHA 4CQ1A 4WTOB 2BANA 1J5OB 5C24B 3R2DJ 3IGNA 4FXWA 3C16A 2XMMA 1YJNS 4EZ6A 5MLCV 2NUUG 3UDLA 2NXJA 1XC9A 3EZUA 2Z58B 3FCWA 2ZH1A 4FYWB 2IBOA 3LWMA 2EBEA 3UCUP 5L1JA 2UXDF 1DY3A 4C8LA 3UI3A 2EWHA 1FRHA 3CD7A 2CJYB 1TMJA 2F8MA 3PX6A 1TV6A 2E5JA 3PHTA 4ID5B 2GMJA 5JJBA 2F40A 4TY8B 2N3OA 7AT1B 4DFJA 4CCHA 4DZ6A 3S8SA 2BJ9A 4XDCA 5IT0A 1VBZA 1HYSB 4B3OB 3BGLA 5HP1A 1LW0A 3FQLA 1HBMB 1I51B 2BX6A 2DGOA 2Z57B 4DV5F 4OFZA 2CVEA 1KVKA 2C2ZB 4PUOA 2CYYA 2ZC3A 3RW7A 4ZLNA 3OR2B 1PKUA 5AE1A 1RT4A 2M8HA 3ITHB 3LW5C 2H54B 1LWFB 2CPJA 3QSIA 3LH2S 1C2PA 2C2NA 4MKAA 4CLPA 4DPWA 3R1HA 2B5JA 4CH0S 4BDPA 1Y00A 2XG8A 2LDYA 2PN6A 5EWGA 4X4UA 3KOAA 2C3MA 3D6TB 3VGVA 4ZVSB 3HKWA 4JI0F 1KRPA 3P45B 2YX4A 5J2QA 5G0RA 2C3UA 4ELTA 1RKIA 4ZITA 4PG8A 1LK7A 3LANA 3VAKA 2JZ5A 1Q82T 3MDFA 2MY8A 1FTRA 3I6PA 2LQBA 3A8EA 1R8PA 2V2VA 2RHSB 5EX3A 2G0JA 1HHTP 3MF5A 1XMOF 1TK5A 3NLCA 5F41A 3EXCX 2HURA 1NM2A 4OYBA 5IM0B 1WNEA 2AEJA 1H2VZ 5KT7A 4LREA 3DOKB 4ZVGA 5BXIA 5DQHA 1XQIA 1X9SA 1QTNB 2X1FA 4IFVA 3FMWA 3UE2A 1IJFB 1RT4B 3ITHA 1N52B 1Q7LB 2AWZA 1NEEA 3OXGA 4B3OA 2BOPA 1W2BR 2F9JA 5J1NA 1LW0B 1ITPA 2FYXA 1AZSB 1XNRJ 3K5LA 1KQFB 3UN5A 3DI6A 4PYAA 3ZFVA 2LYVA 1XR7A 3T9ZA 2ZUAA 2VPZB 3DYAB 3KHLA 2J9EA 2WSFC 2BABA 4QWAA 4DZDA 3V81B 1NDPA 4Q2LA 4HH0A 3BKTA 1BQMB 3JTPA 4I6AA 5F3TA 3W66A 4DV2J 4DQSA 1F9EB 5KOWA 1VMBA 1X4GA 2XGQA 1KOHA 1RT3B 2DGWA 3HVAA 3IAM9 3M2RB 5IS2A 3F73A 2ZC4A 1WF0A 3ADAC 4DSIA 3KLGA 3FSIA 1SIWB 1TVRB 4MK9A 1BUXA 1X4CA 1V5IB 4C0HA 2WSEC 3PRBA 2XSJA 1S9FA 1OQ3A 4IUFA 1RAIB 2P9CA 4NLDA 4YHHJ 2BUNA 5C42B 2HVHA 4B9LA 2HS0A 3QGGA 3GFYA 3IR6B 1PSDA 4OYOA 2VA3A 1F3VA 2FC8A 2QA1A 1K8AT 2QMXA 2PD1A 1EJ7L 1S1VB 1ZM2A 2J8SA 4ILRA 4RNOA 3VAMA 1J5EJ 1M5HA 2GQCA 4OI0A 5ETNA 4JV5J 4IOCQ 2VV5A 2XGPA 2V5HG 1B64A 1H2UX 3DRPB 5CYMA 5LXRA 2VJUA 1S0OA 3CO9A 4I6WA 4PQUB 1OY6A 2H51B 3MM7B 3PYDA 4OZLA 3K8WA 1X5SA 2XMUA 4DUZJ 2NPFA 3CPWR 5DGBA 5E3CA 3MTKA 3N5FA 4C8YA 1BWVA 2OD6A 2CIMA 3BPSP 3MMCA 3POTA 3HFVA 1HBOA 3D67A 4P72A 4R0EA 3LO3A 3TOQA 4HL9A 4ZVPB 2CG4A 4P52A 3GIIA 5DG8A 3H40A 3V81A 3ZZ0A 4ZK7M 1AYEA 1YJTA 1P8GA 2DY1A 2HWHA 2QLFB 3CIMA 4A47A 3JSYA 2H65B 3U7JA 1WC1A 5LSRA 2BQUA 4QCLA 2DNLA 1XERA 2QFIA 5J2MB 4DV7J 1SL1A 3JYTA 1QSSA 2N7YA 3NGUA 3EWGA 3MR7A 3VF0B 1Q8LA 2VF3A 1U6ZA 1PJ7A 3H0PA 1OS5A 4BBYA 5KT3A 2CQ4A 3GCWP 4O4GB 1UFLA 4C6AA 4CO3A 2EEYA 5KFQA 1CQNA 2DGXA 2CDQA 2DGUA 3KG0A 4P73A 1S1VA 3UVJB 3CW2C 1UFKA 3MMCB 4LVNP 3S1TA 1RT3A 5LT5A 2XC9A 4DFMA 4YUDA 4ELUA 3KXDA 4FZVA 1IR1A 5D4PA 3UDCA 1JLQB 3P5TL 1PILA 2KM8B 1FKAF 2EFQA 4A48A 2VPYB 3FZBA 4P2FA 2BM0A 3H42A 3MM5B 4C3LA 1LKZA 2MZ1A 2FIUA 3G8QA 3RBZA 2C2DA 3LPYA 5F9LA 2KN4A 2XY6A 3CJ8A 1J2VA 2LU1A 2XZTB 3LQVA 4OZ0A 1G6BA 4ED8A
chains in the Genus database with same CATH topology
2KZZA 2FJVA 5L9NA 2AJ4A 1KN6A 2HNDA 3G71S 3QGHA 2RS2A 4DQPA 1UJ6A 3IG1A 3B8HA 4EFAC 5A8KB 3BO4A 1VQLS 2BVZA 3BJYA 3PW0A 2I1RA 3MM7A 3ZZZA 2ASDA 4LF7F 5BR8F 4O3QA 4NXMF 2ZOGA 2DPIA 1VQOS 1Z2LA 2KFYA 3KHGA 4B3MF 4PPZA 4K4SA 3BDPA 3QIPA 4JI8F 2R7SA 2QYCA 2G9OA 3MMAB 4DL7A 2KT2A 5EWFA 3R5AA 2UUTA 3NBPA 4XPEA 2C3PA 2MMYA 1QAJA 2M8DB 3HHLA 2RH3A 1H38A 3PEHA 2LXUA 4ZCIA 3GIMA 2J0WA 4OHZA 3K8VA 3SV3A 3NS5A 5ITHA 3MPYA 4OJ3A 3CJ3A 1QUPA 4QIGA 1E6VB 2YWHA 2PT0A 4YMEA 3K59A 1BQXA 4YB7A 4DR1F 2RS8A 1RJJA 1VQNS 3KK3A 4K0KF 3MWBA 1RK8A 3ULHA 4DG1B 1FJCA 5HROB 1O51A 4RUAA 5L38A 5D4OA 2YKNA 2FY1A 5J2PA 1ZBTA 4DL2A 3G4SS 2FJDB 2XSFA 1U1QA 1NU4A 4CH7A 1VJWA 1MU2A 1YI2S 3BQ2A 4K4UA 2KYXA 2D74B 1FKPA 3E01B 4ED2A 4FBTA 4IRDA 2IJNA 5K8OA 4ZP9A 4HTJA 2CJKA 4IQXA 1BQNB 4J9SA 1LOUA 4MK8A 3PW4A 1YJRA 3MMJA 4M95A 4QIVA 2NPIA 1FXDA 1T3OA 2WW8A 3FMBA 2VASA 3M32B 4YR2A 4ID5A 4P6QA 2HHHF 4JI2F 2VC0A 3N0VA 4K4WA 1UETA 3N28A 4ES2A 3K5OA 1N8RT 2E5HA 2CQ2A 3PIOQ 2P9EA 1XNQF 4ZVEA 3MEGA 4IRCA 2J5AA 4FVCA 4ZCMA 3VZHA 4P7VA 3BQ1A 4RW4A 4NA3A 3LF0A 1H3DA 2Y1IA 2F4VF 4H54A 4Q45A 1V3ZA 4N47A 1HL6A 1QM9A 2LMIA 1FDBA 3GE9A 2FJXA 3OFHA 3CCWA 2E44A 2RRNA 4KSEB 3AH6A 2E7WA 1HI1A 2QV6A 3H25A 3NNCA 1M5SA 1FKOA 4KT0C 4TU8A 3M9NB 3FEZA 3HXMA 1HNXF 4PUOB 3GV5B 2E7XA 5DO2A 1ZOTA 3RB4A 3KMQA 1S77D 3MPWA 2DR7A 2J6UA 5B0CA 3CD6S 3ISND 3BM7A 3MEGB 1LWEA 2IVYA 3LAKA 4DL4A 3OFGA 4TYBA 3QO9A 2MZJA 4B9TA 3SMZA 1RISA 2B56A 3L95X 4QIFA 5GAHI 3V4IB 5L9XA 5DQIA 3DRYA 2N3LA 2W4DA 3J7YU 1U6FA 3SI8A 4OX7A 2OO4A 4R8UA 2KVIA 2WONA 1FT8A 1C1BA 3RRGA 4KV8B 4PRFA 3IS9B 1G2EA 1N5QA 3KFWX 1M0SA 2ROEA 1S7HA 3V6JA 4C98A 5AXLA 4DSEA 4C8MA 4HTIA 4WFXA 1N36F 1HWKA 1LFPA 1FDNA 2IRYA 3AB2B 4AE5A 4KFBA 3ICLA 1EP4B 1A7GE 3K5MA 3CEDA 1JWWA 1XNRF 3C46A 3MMBB 2GX8A 1HNZF 1XTZA 2JJ4D 1N54B 2DTJA 4I69A 4IKAA 4PXBA 4YFUA 3G6YA 1OSDA 4RUHA 3N01A 4DR4F 4FXVA 4NA2A 2WB4A 1IBMF 3NAHA 2J9DA 3OQ2A 2NYIA 2DBBA 1PO6A 2OIHA 1NH7A 2MQOA 2R8HA 5GAEI 4FYDA 3CDUA 3FCHA 1IKWB 4MKBA 2ZOMA 4Q5VA 3UD3P 1FJGF 3TVZA 4X4SA 2R7TA 1RT2A 3BGRA 1FJEB 3IO1A 2IYIA 3B4DA 2KHDA 3WDOA 4YHHF 3BGUA 2W9AA 5FLXY 3HHLC 1S6UA 3IWLA 4Y3CA 2BR0A 3CC4S 3KG4A 2IM1A 3HHKA 3QO9B 4HT7A 2MZSA 3KK2A 5KFTA 1ZYQA 5DM7Q 1UVMA 3KLIB 3C6TA 3SDEB 3DDKA 2GGPA 4LIWA 1XR5A 1L3TA 2JEGA 4F25A 5L1LA 1HBOB 2KXNB 3SCIE 4B3RF 5KFSA 2FHJD 3KWMA 2W9CA 3GG1A 3BGFA 4ZA1A 3H40A 3SYZA 1DJ0A 2V8DA 1TL3A 3OBIA 5L8RC 4CTAA 2FPHX 4B17A 2CQGA 3PX4A 5IM0A 2IM3A 4KHMA 4F2RA 2OPPB 4CT8A 5KFJA 1SV5B 4OZ1A 1IKWA 1HBMA 4I7FA 1V3RA 1D9DA 3N6NA 4HKQA 3WBZA 4WFAQ 1FNOA 2YH1A 3PJXA 2DVIA 1VRTA 4C11A 4CNZA 5CYJA 2E9RX 2HVZA 4LF9F 2HS4A 1S1TA 1VQ9S 3Q22A 5I42A 1M90T 4BC9A 4X4OA 1S9GB 3AQPA 2UV8G 3U27A 1R8CA 1T95A 4AQYF 3KK2B 1UVIA 1K0TA 2LDIA 3TVYA 3AB4B 3CDBA 3N5BA 4ID8A 2FVPA 1X7VA 4XK8C 1FESA 5DG9A 4XIUA 4FF1A 2CQCA 3LGMA 4B9SA 5DJBA 4WU2A 3CMAS 4EGLA 2RKIA 3OR1A 1YSJA 5H9FJ 1WELA 4X64F 4DSKA 1S10A 1IN0A 4Q0BA 5E7OB 2ASLA 2YNHB 5CYQB 1G1XA 1U6BA 1TKZB 5A6PA 1XMBA 4ECTA 4KB7A 2CPHA 4LSNB 2UVVA 3DRSB 1N34F 1DLOB 3WX4A 2BRLA 4K50A 2LQ9A 2Q79A 5DDOC 2QE5A 1LFWA 2M88A 4UQTA 1S0VA 4ZDNA 5HMYA 1VC0A 4JI4F 5K9FA 2MXYA 4U9RA 1F0XA 3H98A 5AJ3F 3DRXA 5I3PA 3I4PA 4I2PB 3C8YA 2GFFA 3DM2B 4FP9A 3J7YI 1DARA 1VQYA 2BJEA 3O44A 3LALA 2W8KA 4LF5F 2Y0SD 4DN9A 3ZC4A 2O5DA 2VFRA 2N4CA 1HQEA 2CJQA 3ZZUA 4OV1A 2NR0A 3CCRS 1F5BA 4RW6B 1U1RA 1KTQA 2JEJA 3C2PA 1S1UB 2EBGA 1S1XA 3HVRA 3IRXA 3FVYA 2JC1A 4C0BA 2PC6A 3NG8A 5KFOA 4A8KA 2JX2A 3HP6A 3VQTA 1HARA 2V2KA 2YH0A 3ZZRA 4PG5A 2ZITA 4F3QA 3IRWP 4GC6A 2R9LA 4A8YA 4O3SA 4DQRA 4F02A 4QPTA 3UW1A 3MFHA 3D0HE 4BWJA 1IQTA 3O2IA 4IG3A 2AJ1A 4NWBA 2J6SA 2IRUA 5A0YB 2ATLA 3EGWB 4MJKA 5KFYA 1X5OA 1B0TA 2Y1RI 1N6QA 2DO4A 3NL0A 2HZCA 1N0VC 2E5GA 5IFMA 2HRUA 4J9RA 3SQGB 5L39A 2OH2A 4RX6A 1HPZA 1TKZA 2B4UA 2KXHA 1F60B 1ZAXA 2LA4A 4LSNA 4RW9A 2XLKA 2HHTA 2E29A 5D4LA 3IA0A 1FXLA 2RU9A 4EUVA 2K1RA 2JEIA 2ZNYA 2ZBCA 1U49A 1L3KA 4P7TA 2O3DA 2M5YA 1NKCA 4HDGA 1N33F 2KFZA 1VI7A 3D54A 4NX9A 5IZHA 3BR8A 1TZ0A 2P6TA 4ED6A 4IO9Q 2SXLA 1SKWA 5L1IA 1UVJA 1FRIA 4YR3A 1YRTA 1HQUB 3O3LA 1X5TA 3CUNA 2OSRA 4RWWA 4GC7A 4C8ZA 2GCFA 2WSCC 1KFDA 5LSOA 3I5CA 3N6MA 2ROPA 2EFGA 3BREA 3BQ0A 3OW2R 3JSMA 4RNNA 4C9DA 2U1AA 2F8HA 4O3PA 3V5RA 4PXCA 4B9UA 3M2UB 2PE8A 5M2RA 2W4CA 3DRRB 4LSLA 5KT6A 2C2EA 2CKWA 1TV6B 2WB1D 2YNIA 1FRKA 3M6WA 1SKSA 2L9DA 1S0MA 2HHPA 1YJ9S 3C6UA 1MSWD 1H0HB 4O44A 1KFSA 3U02A 2ZDOA 1WHXA 2POKA 2E1CA 1D3WA 3H2LA 5CH7B 4ATNA 5BYQA 2DNMA 4ED7A 1RTJA 1LW2A 1UJ5A 1OIAA 3K5PA 2RB7A 3TAPA 2HHXA 5HROA 4HI1A 2DCUB 3FDSA 2Z2LA 2HHVA 2CPYA 2H9ZA 4FF4A 5T14A 3PZPA 3VWSA 5C24A 2PMZD 4JV0A 5I4MA 2MKCA 4N41A 2FLLA 4G3IA 2K1RB 3KHHA 3KMSA 2YNIB 4Y00A 1KHWA 4WZMA 2XCAA 4CH1A 4ZS6A 1VIXA 3MM6A 3PM9A 2XS5A 3VZIA 2ZNZA 4JV1A 3OHBA 4KGMA 4WE1A 1WTBA 4HLBA 1DQ8A 2GA7A 4U7CA 2Q66A 3QIDA 1J5EF 4QWDA 3T3FA 1B0VA 4DL5A 1BD6A 4ZP8A 1KEKA 2KTQA 4IDKB 1HQUA 2D3OR 3M8RA 1N5SA 2CJ9A 1UJ4A 1K73T 1HNIA 1GQEA 3GWCA 1S6PB 2ZH2A 4LFBF 3HDSA 3D5MA 4QZVB 1MW7A 3TQ1A 4NLTA 2L48A 2XI3A 2R2UA 4RW4B 5E41A 2JSXA 3VAFA 3RBEA 1C4CA 4AL6A 3Q24A 1JB0C 1V3SA 3T5KA 1XK8A 4WE1B 2RDIA 4NYZA 5CQGA 4DMZA 2GMHA 4UY85 1GTHA 1RT1B 1WI8A 2JC0A 2CJBA 2HNYB 3J7ZT 3D2WA 5FD1A 3KLGB 4TLRA 3DHWC 3TI0A 1R8HA 1HW8A 1S79A 2HG4A 4RZRA 1FRLA 4J9MA 4QOTA 4UUXA 2PFFB 1S6PA 3MHYA 5HLFA 1RTDB 4NLPA 1TVRA 4PG6A 2DNKA 3PY8A 3DI6B 2BRKA 2Z2MA 2B7BB 1X4EA 4G1PA 2ZJQQ 1VQ8S 3J7Z5 4BHQA 5DM6Q 2ZH7A 3MXHP 3CJ0A 3I0SA 1URNA 3OLBA 2RQ4A 2AF6A 5DQGA 1IJEB 2D41A 3OLAA 2LECA 2E1AA 2ADCA 1AFIA 4OHVA 3BDEA 4Z37A 4TYAA 3ONQA 4Y2MA 1PC5A 2KH9A 2PDAA 5A6WA 4F4YA 1QVGR 1YJVA 5I3QA 3ZZYA 3TRGA 2ZE2A 3CD0A 3CJKB 2CFXA 4F4WA 1NJXA 1VRTB 3THVA 3POTB 5FIIA 4FNIA 3OSNA 2IFXA 1KTVA 4JBCA 2IHR1 3Q8QB 1FF2A 2JFDA 3UCZP 3I56S 2DJWA 3ZZOA 1K9MT 2F7VA 2KG1A 4AL7A 3PR5B 1F5CA 2IA6A 2YKMA 3DCAA 1DTQB 2ZD1A 3OTDA 2KM8C 5B0GA 4MH8A 4R5PA 4A8MP 4DUZF 1LXNA 2OMOA 1I6JA 5SUHA 1QJHA 2KDOA 1U09A 3RZAA 2D3ZA 2CPDA 3N6LA 4EBDA 2IRXA 2ZHAA 4KO0B 2KG0A 2YNGA 1UEVA 2B7CB 3CIZA 5HLFB 1DHMA 5J1EA 3KLEA 1U1OA 2A2CA 3OFEA 1TKDA 5KOXA 1UW4A 3LP2B 2A10A 2IAJA 3MMBA 1C0UA 4O4GA 4Q8FA 1XMQF 4NPOA 4MK7A 2MSSA 4N77A 4C0OC 4I6YA 4N8OA 3G6VA 2KU7A 1NK0A 5LMUF 3IFEA 2JWNA 1AROP 2BW2A 4UW2A 1T8EA 4CIOA 3FRYA 3VQSA 2I2YA 2LLZA 3LWLA 2W9CB 4G1QB 3KNAA 5EWEA 1S4FA 3MEEB 3RAMA 5KFXA 3ZZPA 2A1BA 3IRXB 3WC2A 5KG0A 1RT2B 3QJPA 3MM5A 3HHLB 4NCGB 4TQRA 2XLJA 1QSYA 4RW7A 4JUZA 1S48A 2KJVA 2XLIA 4ZP6A 2NZ4A 1NH8A 2KHCA 3MMAA 1CPZA 5KAKA 1KS2A 1IKXB 1IKVB 2VQEF 1SJFA 2DH9A 1R3NA 3NGKA 2DGQA 3DDNA 4OJ1A 3IXQA 3SDEA 3KLEB 3KK3B 2IA0A 1GH8A 4U7UK 3HMJG 1E6YB 1VK3A 2QSFA 1L3VA 3O8WA 2GHVC 3FZ2A 4TU9A 1KC8T 1NHVA 4AFFA 4KO0A 1R8AA 3Q8PB 1ZM3A 2QA4S 2KRBA 1R31A 1RA6A 2DIVA 1N5YA 2UUCF 2HW3A 3MEEA 1H7XA 2MSTA 1UA0A 4WKRA 1KR4A 3DOMA 2L9WA 1CC7A 2KT5A 3H59A 3CXCR 4YB5A 4MFBA 2DR5A 3TVKA 3BB5A 2ZZNA 4ECUA 2GC8A 4X4NA 2J6TA 1WACA 1IKXA 2MZRA 3PFEA 1WTFA 2K2PA 2OPRB 1JNZB 3IWNC 4OX9F 4CZCA 3GG0A 4USHA 1U1KA 1WD6A 2F9DA 1T03B 4KPYA 1WF1A 1M5PC 3UR0A 2OPSB 1TL1B 2RVJA 2RUGA 4O0IA 3MFIA 4K4TA 2RQMA 2E5IA 2MY7A 2VBZA 2D3UA 4RNHA 2JLEA 2B3TB 2LEAA 4DV1F 2DH8A 1XBWA 4OQJA 2DNHA 3RB6A 4NL5A 2YWEA 2HHSA 2XY5A 1IKVA 1VQSA 2JLFA 1T94A 4DBQA 2BQRA 4H4KA 3DOLA 1FJ7A 1FCAA 2D9OA 2NSCA 1VBYA 2YQ3A 3NGDA 5DDPC 2CQIA 5HL7Q 2HNZA 1HI8A 3QYYA 1IXKA 1S9EB 2ZOFA 1JLEB 2L08A 4K59A 4J5OA 2VOPA 3MM8A 3KTQA 2AYEA 4LUBA 3SQGA 2HQIA 4ITSA 2OP5A 3Q8RB 3IR7B 4DR7F 2VG6B 2K7JA 3MD1A 2FHOB 5EDWA 2GO9A 5KFMA 3BEGB 2GV1A 4HI2A 4YP3A 3FSYA 1WG1A 4MIWA 1A9NB 1UVLA 4KE5A 2C3YA 1SKRA 4AXJA 4FS2A 2XMJA 5KG7A 4AXIA 1IR0A 2W4PA 3V4IA 4PWDA 3PFOA 4TY8A 1RTHB 2DNYA 4L6V3 1VC5A 1NK6A 2I9SA 2WTFA 4NLOA 3CULA 3DLHA 1JLEA 1G3OA 1KHVA 3F41A 4H4OA 1FRJA 2FB0A 3WC0A 2XNRA 5KFZA 2YVSA 1NK9A 4A8QA 1KVJA 1GTEA 1TL1A 4Y0FA 2U2FA 5KFEA 2K8GA 4ECRA 2BXJA 1SUQB 1HYSA 3HT3A 3P49B 5LJ3Y 4USIA 3T1HF 1KRPA 4TXSA 4LJMA 3OHAA 1PC4A 4HH1A 3M1VA 3K0JA 3FQKA 3LP1A 2IYGA 2ZFHA 1VFJA 5KFVA 3KKFA 1QAYA 3DLBA 2ILYA 3G9CA 3TA0A 3MR5A 2CPEA 1S72S 4DR5F 1KQSR 2GIRA 2HLTA 1L3SA 5KFIA 4V19X