1ZPVA

Act domain protein from streptococcus pneumoniae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
b'NAMKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACT domain protein
molecule tags Structural genomics, unknown function
source organism Streptococcus pneumoniae
publication title X-ray crystal structure of ACT domain protein from Streptococcus pneumoniae
rcsb
total genus 22
structure length 85
sequence length 85
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13740 ACT_6 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zpvA00
2NYIA 1KS2A 1RWUA 2PA3A 3ENQA 3LOUA 2QMXA 2QRRA 2CDQA 3OFHA 3MWBA 3ENVA 3CEDA 2RQKA 3KWMA 4GO5X 4GO7X 2RQMA 3TUZC 1M0SA 2QMWA 1UJ5A 3MAHA 2JOQA 3O1LA 4M8LA 3HHEA 3TUJC 1LK5A 2J0XA 3W7BA 2RE1A 1UJ6A 3AAWB 3TUIC 3U7JA 3L7OA 2QSWA 3DDNA 3DHWC 2ZHOA 3AB4B 2JHEA 4GMKA 2FGCA 1U8SA 2F1FA 1LK7A 2I9SA 3AB2B 5FIIA 3UW1A 4NMLA 1O8BA 3N0VA 1Y7PA 2P9EA 3K5PA 3OFGA 4X84A 3OFEA 1YBAA 3DHXA 1ZPVA 2P9GA 1YGYA 2DT9A 5T41A 4LUBA 3OBIA 2KO1A 3NRBA 1UJ4A 5JJBA 3MTJA 3OFFA 3ENWA 4IO1A 5IT0A 1SC6A 2PC6A 5IT4A 2DTJA 4PWUA 1XTZA 2H9ZA 2LVWA 2LQJA 3DC2A 2MDAA 3IBWA 2F8MA 1PSDA 3S1TA 5IS2A 3IXQA 3LUYA 1LKZA 2J0WA 2P9CA 3P96A
chains in the Genus database with same CATH superfamily
2AWZA 5KG7A 2CG4A 1QTNB 4UOHA 3RZAA 4QBUA 1MWYA 2HBQB 3NWRA 3EGWB 1SKWA 3OTBA 3M8ZA 5BJRA 1I1GA 1IBLF 4QQBA 5KG4A 3RJMB 2VPWB 2DR8A 2ZKUA 3THTA 5KFKA 5ETTA 3SFGA 1U1OA 1S6UA 1F9FA 3MD1A 1UW9A 1B4SA 2G0CA 4O4GA 5KFLA 2CNNB 3WQPA 2XBPA 3T1HJ 2E5LJ 3MEDA 1AUDA 2IDEA 2AYEA 3BQ1A 1PGZA 4ZCIA 5J2PB 3PVXA 2K7JA 2ALZA 1FCAA 4P6QA 3MAHA 4JB8B 3UDLA 1OYEA 2Y9HA 3R5BA 2NR0A 1SV5B 3C2PA 2IVYA 3CCVS 4LF9J 4W92B 2L9NA 2WTFA 2ZWOA 5KG0A 4LRCA 4TYBA 5K5MA 5D8HB 4YFUA 3BO3A 1N32F 1FJ7A 1YJWS 2XMTA 3NMRA 2VV5A 1S59A 2E1AA 2EKNA 3M2RA 1U1PA 1GTEA 1S9GA 2E9ZA 2MQLA 3AAWB 3PDNA 1U0HB 4PEOA 2IJNA 2Q6BA 3SV4A 1SBRA 4DUZJ 1T05B 1TKTA 2HLUA 4FKYA 3LQVA 1SI9A 1VRUA 4GC7A 1RWWB 1L3SA 5AE2A 4PG7A 1WEYA 4HH1A 2A6OA 2R7VA 3MM9B 5L1LA 2HZVA 3B54A 2GA7A 1RTDB 2J0SD 4QIWD 1HW9A 1N52B 1SQEA 4KB7A 4P72A 1RT4B 1HL6A 2W01A 1WTBA 1X31C 1U8SA 2IIHA 1V3SA 4JYAF 2YNFB 3POTA 4DR5F 2N3LA 2HIQA 4OYPA 4QWDA 4FXDA 1FRLA 2JL9A 3CC2S 2ADCA 3CW2C 3SDEA 1JLQA 4DR3F 1UTAA 1IKVA 4B3OA 4TNOA 3CDUA 3MZIA 1HI1A 4EWTA 2G2YA 2ZBCA 2J9DA 2DPJA 5A8KA 4R5PB 3J81U 4DV4F 4Q44A 1JLFA 3R2DJ 3LPYA 1LWEB 1FDNA 3SSRA 2F4VJ 3MECA 3CSKA 3WX8A 1T03B 3VWSA 3KKFA 4C98A 1JQGA 2D9PA 3MEGA 2MEWA 2XYHB 2ZZNA 2HW3A 1UJ4A 2KXFA 1MSWD 1NJXA 3MTJA 2V68A 4LT6A 2BJ7A 2DKOB 3R6GB 2KG1A 3P4UB 3TJAA 1IXKA 2Z2YB 3DYAA 2ABYA 3DMJA 1DHMA 1YX2A 4F4AA 3F44A 4IQMA 2ZITA 4AQYJ 1SC6A 2GVZA 1Q78A 3MCNA 2BQUA 4FYYB 4B9TA 1LWFB 3KHHA 2M88A 1XC9A 4CLYA 4NYZA 1J2VA 1IM6A 2LP4A 4DPYA 5FLXY 4QU7A 1HBNB 2BX6A 3MMJA 3LF0A 4X4QA 4R8UB 2IJRA 4FXWA 1OY9A 4CM2A 1WC1A 2ZDOA 3CCLS 4A8SA 2ADBA 2G0JA 3HZEA 2L41A 2JX2A 1WSRA 3WIVA 4RW9B 3A8KA 5CZXA 1T02A 8RUCA 3AQOA 1B0VA 2MZSA 5CHCB 3S1TA 1AT1B 5GADU 1F60B 4X4TA 3TJ9A 1S12A 2ZH7A 2CYYA 3CCSS 3MAAB 3BSCA 2CVIA 3EDRB 4ATNA 2EFPA 1RT5B 2P9CA 4JBCA 4HTJA 2BDPA 4M95A 2OPPA 2CVEA 5HL7Q 3TJ8A 4CNZA 4X62F 1P27B 2HZCA 4J9OA 1XQIA 4JI2J 4ZPAA 4BDPA 3CDAA 1TK5A 3NCPA 1B99A 2BANA 1D09B 2Q43A 2JEFA 1PIEA 4X64F 2ZH6A 2OSRA 4JI5J 1WI6A 2KZMA 2EKYA 1WOOA 4DS4A 2BUNA 4ZJLA 2D3O1 4B9SA 4PYAA 1HNXF 1N5QA 1F5BA 5LSRA 5JVHQ 1OS5A 1RSCA 4RUCA 4K50A 3M05A 4X66F 1DTQB 3BF4A 4O23A 4WK3A 3WZ0A 3VVTA 3CJTA 5J2QA 4QW8A 2OJ3A 1KLNA 4DCJB 1HYSA 5A76A 2BVZA 4UOFA 4ETXA 2K06A 2HQCA 4B08A 1VQKS 3H40A 1SL1A 2IFXA 4DV0F 1NNDA 3BSAA 5DO2A 1JLAA 5F8LA 2R2SA 4YB5A 5LOQA 1X9MA 3J7A1 4F50A 1ZH5A 3H98A 3L9ZA 2WW4A 4KH1B 4C0BA 3PRVA 4ECTA 5FD1A 2FVRA 1EB0A 3X1LB 2NXCA 2R7OA 3E3XA 3M8RA 2UV8A 3BPSP 5A0YA 2L9WA 1FVQA 2CDRB 2G2OA 4MMOA 4CO1A 1C1CB 2BKPA 2J0XA 3EJMA 4O0IA 2PMHA 3OT9A 3O6QA 2YQ0A 5I3UB 2CPZA 4ZOSA 3Q8QB 3BM7A 4I56A 1I94J 3G82A 1YQHA 4DCPB 1KHVA 1FJEB 1IN0A 2BJ3A 2DNGA 2CPJA 3I82A 4OJ1A 2VJUA 4KV8B 1IR0A 1HLWA 4M1KA 4DZDA 2D74B 3M30B 5HVFA 4N41A 1IWGA 1QSYA 3JTNA 4QR2A 1NK0A 2D9OA 3TP2A 4F25A 1MROB 1FFGB 4PXEA 2XCAA 2BZ2A 3M8WA 1REVB 4G1QB 1ZZNA 4RBTA 4H4OA 4DFPA 1M1GA 2BW2A 2V0NA 3GZ7A 3VHQA 3UCZP 2M8DB 2XYGB 2Y8WA 3PR5B 4P75A 3WC2A 4U7UD 3H5YA 1B0PA 2BACA 2VHGA 2MYFA 1VQNS 2HNDA 1C1BA 5LXRA 1X4EA 3F73A 1HI0P 2M2BA 3FZBA 1TK8A 5KG5A 2HFSA 1FA0A 3R27A 3J7YI 2CQHA 2WVBA 1S1XA 4LSZB 3JYTA 3K5MA 1UVNA 2FTRA 2W25A 5JUMA 4PQUA 3DRPA 1FDBA 4IG3B 2RNEA 4R0JA 3ENAA 4BWMA 4N56A 3OSPA 3GWCA 1DLOB 4K4SA 2HHSA 3OFFA 3HVRA 1H0HB 4Y2MA 1ITPA 3DU5A 3PFOA 5HN0A 2KG0A 2ERRA 3HD1A 1VBZA 2EFQA 3E51A 4B9LA 4PUOA 4HKQA 3UVJA 4CNYA 1IKVB 1X4FA 3CCZA 4HI1A 4MIAA 1VQMS 1N36J 1JJ4A 4B3OB 1ZTWA 3W2VA 2BMBA 5ADZA 3MPUB 1C4AA 1S6QA 4X4OA 4ZPVR 1N6QB 4ZPCA 4KGKA 3DXSX 1T9UA 3D0HE 4QR1A 2N7YA 4DXLA 4E8UA 2DY9A 5BR8J 1J27A 1RT2A 4M5JA 4UOGA 1CSJA 1U48A 1QVGR 2UXCF 1F5AA 2XSJB 2H48B 2GJFA 3Q23A 1UPMB 3H2UB 2N7CA 1QAYA 3BN4A 1Q81T 2HK3A 1AZSA 2GS8A 2ZH1A 2FJWA 2V8DA 3MR3A 5HLFB 1HQEB 4ZK7M 4CH0S 2B5JB 4QPXA 3W64A 2FJXA 2ZFHA 5H1SV 2CPEA 2BQ3A 3QRPA 3FC9A 1N8RT 1RWUA 1QAIA 3C8YA 1U4BA 2XI2A 2E5JA 3T5LA 4ZCLA 1L3TA 1YHQS 4U67Q 4PZVA 2HBYB 3SV3A 3TANA 2JEJA 4ILMA 3HVAA 4LFCJ 4X4NA 2FZKB 4NZ6A 4F4KA 3HT3A 3QWUA 1VJQA 4J9RA 3K58A 1U45A 3VGSA 2XYPB 1Q7LB 2FC9A 4XK8C 3P8BB 2IJFA 2R7TA 2Y1RI 3GIMA 2R7QA 4JI3F 1JX4A 4L74A 4NLXA 1DARA 4USIA 3VAFA 1UL3A 3G8QA 4G65A 4EO6A 2NXNA 4ZVQB 2NREA 1QVFR 3RBZA 1U02A 3SZ2A 1YVFA 3PTWA 2DITA 3MUMP 2LFVA 3OTDA 2WRMA 3DGPA 3DNCA 4CWBA 2QFJA 1NK6A 4C6AA 4GC6A 2NS1B 1W26A 2COLA 4ZHRB 2IMWP 1RWNB 1IJFB 2BRKA 2HVEA 3AY0A 3FBCA 3W9JA 1S4EA 2X3DA 3I0RB 4EI2A 4AL7A 3U1NA 1SJ4P 1LWXA 1HA1A 1SXLA 5KT7A 2JC0A 2C2NA 1HWJA 2F9DA 2OEMA 4OYXA 2GAHC 4N47A 3TVKA 3VR1A 4ECVA 1VGYA 1CJKB 2A18A 3M7VA 1UJ6A 4L73A 1ULRA 3AT1B 3W1YC 2V2QA 1EETA 2DD8S 2C1EB 4KHMA 3EZUA 2BABA 2OIHA 3PW0A 4WK1A 4NLQA 3OL6A 2A2CA 4DV0J 1FRXA 2V2VA 3JS9A 2VD3A 3VALA 1SQGA 3CDWA 3V81B 3OPKA 4U9RA 1W7WA 4ZCKA 3D2WA 2C2EA 5KFCA 5ETPA 4DMZA 5KT6A 2V94A 4A8QA 5L38A 3KG1A 5A2QY 5LMUJ 2UVWA 1N34F 2J7UA 1UAWA 5T7LB 1W2IA 4DX8H 5DM7Q 2APOA 1JKHA 3VGTA 4PWDB 3MCSA 3CF5Q 2E7VA 4DS5A 3VVUA 4YQWA 2HHUA 2DGWA 2RT3A 1YJRA 2G0IA 3N0VA 5B7WA 5HMZA 3T1YJ 5GAHI 4NA3A 3D1OA 2CJKA 2CJ9A 5J1PA 2OH2A 1RHQB 1VQSA 3FZ2A 3R5CA 4I1TA 1SCJB 3PYFA 4DN9A 1R0AB 1UVIA 1WHWA 1T94A 3W5XA 4YHHJ 2HHVA 2HS0A 1F9EB 1U8WA 1YGYA 3AJ2A 5HROA 4BLGA 3RB4A 1RT6A 4GVLA 2KT5A 3OBIA 3G6YA 2LU2A 3C3LA 3K59A 1U25A 3GIRA 1Q0NA 2MGZB 3KJNB 3TA0A 3GYGA 4ZLNA 3GQCA 4HYKA 1XMQF 1N56A 4ILLA 2WSFC 4F4XA 4I0WA 1ZAWA 3PJ9A 3DLBA 4A8YA 1K1SA 3VZHA 5J1EA 2HYIB 2YX1A 1IKYB 3R5AA 4P2FA 2OKQA 3EYZA 4ECRA 2RJZA 2GV1A 2GVDA 2X7IA 2UUTA 2Y0BB 3DDIA 1GX5A 4GVBA 2DNLA 2PC6A 3ILIA 3HP6A 3EPGA 4OJHA 5HBMB 4H4MA 1TK0A 5D4OA 2VG7A 6FD1A 3I0SA 5G4DA 3CPWR 4N7TA 4F0KA 1H2UX 4K2XA 1NDPA 2EWHA 3TI0A 4DJBA 1RI7A 3BZQA 1UEUA 3BBBA 3C6TA 1WEXA 2OEKA 3CJ2A 2C3OA 3OR1A 3DOLB 4MKAA 5IS2A 4DX6A 4NLTA 3TEGA 2CXEA 4YS2A 3FFIA 2GQCA 2NXEA 2KTQA 2AMCB 2W2MP 4CT9A 3UNGC 4I4BA 1H6KX 1RP5A 4G6VB 2JVRA 1XJWB 4PQAA 3IA0A 3DI6B 2XC9A 1F6TA 4LQ9A 4I6AA 1T95A 1VQ5S 1XIQA 2L08A 3IAS9 5BYRA 3R5GA 4F0HA 1G6BA 3C15A 2W9CB 3DOKB 1CJUB 3DRSB 1KVJA 1YRTA 3UN2A 2XMMA 4NLPA 3BGUA 4RPFA 5KFQA 4DR3J 2RU3A 1IBMJ 1S9EB 3N5FA 2ZHAA 2RS2A 4JI1F 3IFEA 1Y5NB 3MWBA 2FVSA 1S9FA 4MK9A 3GTYX 1LW0B 2J7WA 3N6NA 3I5CA 2D3UA 1NSKL 1MMNA 1TELA 2I6WA 4GKKF 5E3AA 4DSKA 3KNAA 4LSLB 2ZOMA 3VAMA 1WF0A 4WFNQ 1SJQA 2ZOFA 2KL8A 1X5SA 6FDRA 1D9DA 3PHTA 2V9WA 4WP3A 2HK2A 5HJXA 2DYAA 5SUHA 2VA3A 1TL1A 2ASDA 1C0UB 3VAKA 1X0PA 2C3MA 5HQ8A 1RAEB 3Q8YA 3V6DB 2K8GA 2ROPA 2E1RA 4AYBD 1N48A 3ZTPA 2WVFA 1IBCB 3ZTQA 1YBUA 2VDHA 3ZO7A 2Z2LA 4QU6A 1AUSL 1MWZA 2W8KA 4Z7YA 1LK5A 5D3GA 1XWLA 4FKXA 3TWZA 3HK2A 4PPZA 4XTTA 4EZ9A 4IG0A 2BJ9A 4IR1A 4OYAA 2LA4A 1U6FA 2RDIA 3PFEA 4P9SA 4QYZJ 2CNKB 2W2OP 4RUAA 3IR6B 1ZA1B 3PXGa 1JXLA 4LRAA 4C11B 4RKUC 3IRWP 3LTOA 4A4JA 3BN7A 3UPFA 3WC0A 3HCXA 2XY5A 4OI0A 1RT1B 3TW0A 4O44B 3FGVA 4HHUA 4Z7CA 1K1QA 1JLCB 3LANA 2DO4A 2KH9A 3CMAS 2DISA 2E7XA 2VC1A 1CS4A 1QE1A 1GMWA 2HFUA 3O8WA 1VHIA 4K5SA 3Q0AA 1S0MA 4B3TJ 3MCMA 3TYTA 5F8GA 1M5PC 1XNQJ 4DF4A 2FLNA 3FUYA 4O3RA 2HVDA 4OHYA 5D0EA 3QFHA 2I9SA 2C22A 1CJKA 4ZIWA 4DQPA 3A13A 2ZKTA 3GR0A 3HHLA 3KK1B 1HBMB 4F4ZA 1Y7PA 4WKYA 3CCJS 2DGOA 2KJVA 1EARA 2QL7B 4FYWB 3KUEA 1RT3A 3G87A 2ZNYA 3NG8A 3OL7A 4DQQA 3FMWA 5LJ5Y 5ETLA 1T3NA 1Y5LB 2QJ3A 3SXLA 5DDQC 4UW2A 3LP2A 4FN5A 3JSMB 3AOBA 4TVAB 5K9FA 3U02A 3A8JA 3GFZA 4PCQA 1FKPB 3ZTSA 3H7HB 2YKNA 2YNGA 3PX6A 2J6UA 1WF2A 2K7KA 4PXDA 5AXKA 1RUSA 3QIDA 5B0EA 1QDUB 2VFUA 2HFOA 2YXLA 4JV5F 1ZBTA 4CTAB 1Q5VA 3KG0A 1TKDA 4U6PA 2B6AA 2W7PA 5IT4A 5MLCV 5H9EK 3KLIA 4NRUA 4RZRA 2EFVA 4KGVB 4NXMJ 4ZVTB 5HROB 1HFEL 1PILA 4C0HA 3VAIA 4DL2A 3UO0A 1HYSB 4ALZA 3FEXB 3JAMU 3IBWA 3DLKB 4DBQA 2IPOB 1HNWJ 1CULB 2GIRA 2OAUA 4LFBJ 1BC6A 2IVFB 1VMBA 2XS7A 1E6YA 1HBUB 2GJIA 4MIBA 1WNEA 1WHYA 2BE9B 2F4VF 3FCVA 4LFBF 3MM5A 4Q5VA 3DLGB 3HHDA 5B09A 4A8KA 2QA4G 3K7RA 2DRDA 4NLDA 4QW9A 2DGQA 4A48A 3EVWA 2KI2A 3P96A 2LDYA 2UUWA 1X4AA 1RT7B 1H3DA 2UV8G 3NXZA 4PWDA 2QT7A 2DNHA 3TNVA 3RTVA 2LCWA 2OD6A 3MM8B 3RUBL 4F2SA 3D1QA 4FVMA 2I38A 1B70B 4RWWA 2O5DA 5KFHA 4WKRA 2DPIA 1WDDA 2OTJS 1SKSA 1Q5YA 4WP8A 7FD1A 3KK3B 4NASA 4ECSA 4K5RA 1TL7B 1R6VA 2RQKA 4PPDA 3E2EA 4DL5A 2IM0A 3C6UA 4OI1A 4TU7A 3MDFA 4OI4A 3J7ZT 1YG0A 5KFZA 1R43A 2QN6B 2BRLA 2ZH3A 1RU2A 2KXHA 2KHCA 4IYQA 3TZWA 2QMWA 4DR2F 2DGVA 1J5EJ 1NMEB 2M52A 4PR6A 2R42A 2PSZA 1ZTTA 2UVVA 3MR6A 3A8EA 4MH8A 3JQKA 1K44A 5G0RA 2MKHA 3TOQA 2ZEJA 4OV6A 2NZCA 5EWGA 1N4LA 2Q66A 2IA6A 2M9KA 1WKKA 3W8GA 5IWAF 1FERA 4MK7A 4NL5A 5DDOC 2ZVIA 2BJDA 3M6UA 2RDDA 5F9NA 3OJUA 4DX7A 3Q8VA 4DI6A 1MN7A 3JXOA 2I2YA 3HJVA 2LXFA 2B9XA 2J7KA 3C14A 2IVMA 5HMWA 2YQ1A 3NMAA 1CG2A 3GFYA 3J80Y 4F4YA 2QSWA 2BE2B 4N8NA 1UFLA 1NH7A 2OTLS 4IOAQ 1MNEA 3UE2A 2QMUB 4KAIA 4IOCQ 3P3DA 2XNRA 3DRRA 4K0KJ 2JHEA 2MQ8A 1RCOB 4KC5A 5E3PA 3OD2A 3P5TL 4LIWA 4BBYA 2XEXA 1NCLA 2AJQA 3CXCR 4LBHA 2B0GA 1N5VA 1TMJA 1P9YA 4C48A 1IKXB 1UKUA 3QJJA 4I6WA 3W2VB 4KO0B 3ZZ0A 1X60A 4JI1J 1P8GA 2AT1B 3GMGA 4I7FA 4P74A 2QV6A 3IN5A 1NKBA 4NI2A 1XN9A 3NOGA 1IKWB 2AJ4A 4LRFA 5B08A 3VAHA 1DBDA 3M6VA 2DEJA 4DR4F 3D9BA 3UDEA 3BGOP 4JI7J 4DV2J 2RAQA 2AYMA 1FF2A 3VQSA 4O44A 5CCLA 4O3PA 4P52A 3GPAA 1FDAA 4KFBA 2EK6A 2V67A 2F40A 3TVZA 5L39A 5D78A 3CD7A 1FKAF 4HR2A 3UDCA 4W4MA 4Q8FA 3C19A 4QCLA 1NSQA 3V4IA 4IKAA 2H51B 1BMQB 3TVYA 3CCUS 4G1PA 2H54B 2VG6A 4IO1A 1KFSA 2FY8A 1NPPA 2E7WA 2EI5A 2OELA 3IRXB 4IFYB 2V9KA 4URSA 4YY3F 4CLTA 1JLBB 4C9DA 1WORA 2C3UA 4USJC 5BXIA 1SC1B 2Z56B 3FCWA 5E3CA 4OX6A 4AE5A 1NKCA 3TAQA 2HQIA 2HPUA 2H1YA 3GJTB 3MXHP 1Q4RA 3VZIA 4DWIA 1X5PA 2W24A 3CTRA 1UPPA 3MM7B 3D1HA 4KQZA 2HS4A 2MQPA 2ZM6F 2F8MA 4B3MF 4X4RA 4KY3A 1AYEA 2QSFA 2J6TA 4ZLPA 2OPQA 2DHGA 3AOAA 1X4BA 2DNZA 3GONA 3I87A 2ILYA 1RTJA 3N4WA 4B02A 2YWKA 2MLYA 5A0YB 2LXUA 1S7IA 3PW4A 5L1KA 4DR1J 3TUPA 1D8ZA 3CDEA 4O3OA 4DPOA 2KJWA 1RAFB 3SQOP 4DX5A 2DNOA 2AX1A 3GV7B 1JB0C 3GIKA 1YI2S 1WC4A 4ZS6A 4DV3F 1D1UA 3GJQB 4NXMF 2OPSA 2MKJA 2KM8B 3JYTB 3CJSA 3CMQA 1NDKA 1BHNA 2Y1LB 3BQ2A 2W7AA 2N4CA 4LVNP 1T3OA 2AEMA 3TQ1A 1SB6A 2EVZA 2EG1A 3BREA 2H5IB 3CEDA 3W62A 2R8KA 3KLFA 4J9QA 3M9OB 1KN6A 2FDNA 2WVCA 4ZP6A 5F41A 3OLBA 3TAPA 2XGQA 2BQRA 1IBKJ 3J81Y 3C16A 4ZVOB 4LF5J 2CWKA 3AOCA 5HANA 1P1LA 1UETA 3QO9A 1C0TA 3IM9A 5EWFA 1RT7A 5KFMA 2JEGA 2XLIA 5KFBA 4FF4A 2PFFB 2BBEA 3L95X 1TKZA 3MM8A 4OLOA 1K0TA 2VODA 3KYLA 4TU8A 3B6BA 5ETMA 4QZVB 3T5HA 1GXUA 1PYSB 2BM0A 4QR0A 2KXNB 1VJWA 4UOCA 1OMSA 2FGOA 1UA0A 1VQ7S 3RGIA 1R0AA 1TL7A 5LMNJ 1VC0A 4QOTA 2QA1A 3H90A 4QIVA 1RBOB 1NEEA 3H59A 5U47A 4FS2A 2H5JB 4ER8A 4OFZA 1IBKF 3CB4A 3QRQA 4B9MA 1LXNA 1R8BA 3IS9A 3GV8B 3CO0P 1VRQC 3MEEA 1OPIA 1YJ9S 4A8WA 3IBCB 1S1WB 3JB9k 5A8WB 4N76A 1LOUA 5F8HA 2XS5A 2MTLA 2G13A 1RXOB 3EDQB 3EWGA 3QGPA 4O3NA 1HMVB 1J5OA 1WG5A 1K47A 3L4BC 2AJFE 4WFZA 4QYZK 1RQ0A 3MF5A 3MECB 1XK8A 4PYDA 1FRKA 4AD6A 2N3OA 5KT2A 2HWTA 1RBAA 1I6JA 4USTA 1FRMA 2BA9A 2CPXA 2FHOB 4F7VA 4LJMA 2V8VA 4NYPA 3FK4A 4O3SA 3I0SB 3NGDA 2JH3A 1JMTA 1RWOB 1S49A 4DL7A 3BDPA 5F3ZA 3KLHB 3ISNC 4B3MJ 4HL9A 2F8EX 4X84A 4YHHF 3ADAC 2EFOA 2WVEA 1IR1A 1N5TA 2POKA 1P6TA 3EM1A 1TV6A 4DU7A 2R8IA 1HR0J 5DG8A 5B0FA 3HFKA 3D6FB 2V34A 4K8RA 2YNIB 2GW8A 5KTQA 2W9BB 1VQPS 3QRRA 2RHQB 3ZZRA 4XDDA 1FEHA 3RW7A 3DOMB 3F0NA 2PEHA 4K0KF 2YPYA 3G4SS 2EFGA 4OI3A 4PAAA 5E3QA 4A8FA 3SDEB 2FJVA 3TX8A 1R0BG 1CBKA 3ZFVA 1FK9A 2CQCA 2IRYA 2UUCJ 4BS2A 4V19X 4NXNF 4DHVA 5LMUF 1UWBB 3MUVP 3K8VA 2W8LA 1DQ9A 5C24A 4M5HA 3BS9A 1WC0A 5A8KB 1F0XA 4R5PA 3OUYB 3MR5A 1N88A 1EQMA 3DN9A 5E0OA 5AXLA 2XO6A 5IV3A 3RB3A 2D3OR 2AQ4A 3HSJA 4Q43A 4P2MA 5K14B 5DM6Q 5CAAA 5I42A 3K89A 1E6VB 1V5VA 3R5DA 4HACB 5HAOA 2DY1A 2YNHB 2YX4A 3SCKE 5B0BA 4NCBA 4EUVA 5LSOA 2YY3A 3BPDA 1F3VA 3WX4A 2XMJA 3NBPA 3W2WB 2MQOA 2HHHJ 1LW2A 4AUKA 1UVMA 2R7UA 2Q79A 3PM9A 4ZHRA 1S99A 4O0NA 4URGA 2ASJA 3RYLA 2R8HA 1N54B 3BO2A 3BBFA 1RADB 4OYOA 3KJQB 3F41A 1DTQA 3J7AN 4M5MA 4AL6A 3QIPA 1HBOA 3FEZA 9RUBA 1VBXA 1XNQF 1AB8A 3VF0B 3ENQA 3LOUA 1TL4A 3ISZA 4IG0B 3HT0A 3PW7A 3CJ5A 2CADA 4B3SF 4P73A 4ANEA 5A8RB 2QLFB 4RW8A 3HLUA 3HM9A 4RUHA 1R0CB 3FDSA 2R2TA 4K4YA 1VHFA 1Y9OA 4E98A 4C11A 3JSRA 4CCHA 4Y28C 1RTZA 3J7YU 4EU0A 1UZHA 4KSEB 3R1LA 1S48A 2CQ3A 3DLEB 1FXRA 3PCOB 4I2PA 4B3RF 1R8AA 1QM9A 2V69A 1C1CA 3OTOF 3ICLA 5D4PA 2EBEA 1GH8A 1A9NB 2DNKA 1XMQJ 1CC8A 1SC3B 2CQ1A 3R3TA 4JV0A 2BANB 5CCMA 5IM0A 5F8NA 4ZVEA 2HAFA 2XMVA 1B7FA 2GQQA 2DR6A 2OFGX 4BC9A 2QFIA 3Q89A 3FMBA 4WP9A 3KK1A 1UZDA 2CQDA 3CMES 1HD1A 4EYIB 4WE1A 1HNIB 4XPCA 3DXBA 3M8PA 3SQGA 3FJ2A 1XMOJ 5J2MA 2W2NP 2MGZA 2KZZA 3MM6B 4OHXA 4B3RJ 3L7OA 1JLEB 3QYYA 4KIAA 5KFJA 4WXWA 3T6JA 1WWHA 2RKIA 1SJ1A 4URQU 3QO9B 1SL2A 2VASA 2FD2A 3Q86A 4UUXA 1URRA 3O44A 4TY8A 3X3UA 1GEHA 2DR9A 1TKZB 3SSSA 5RUBA 3HD2A 2QYGA 1UFKA 2CPYA 2FPHX 2RUSA 5AE3A 1T0TV 3P45B 4J90A 2BM1A 3NS6A 4KKOA 4D3GA 3N79A 1V5IB 2OUGA 5F9LA 1S6PB 4LF9F 3QMQA 4H4MB 1MWQA 1AXQA 3N6MA 4WFYA 4CTAA 4RNFA 4YP3A 3NNAA 4YB7A 4K7QA 4UQTA 1KQSR 2V4JB 3KXDA 4M5IA 5KFFA 5KOWA 1WTFA 2ZD1A 3ITHB 3OXFA 3T6BA 4KV8A 1VQ9S 1IR2A 1U2CA 4X4SA 4DSEA 1D9AA 3IS9B 3PRDA 5B0AA 4HI2A 2OFHX 3RRHA 2OEJA 5KT4A 1Q16B 2XM3A 2UUAF 1SQFA 4ED7A 1VK3A 2VOOA 3ZTOA 1DAXA 2CQIA 2DHHA 4PXCA 4P7TA 4OX9F 2DRAA 3M2RB 3QLHA 2Y8YA 1EHWA 2N82B 4PG8A 2IC3A 1TUVA 3NRBA 2QL5B 1C4CA 3WDOA 4Q0BB 1Y0HA 3PKYA 1Y5IB 2NYHA 4DV6F 3S6EA 3HSDA 5JJBA 2YWFA 3NAHA 2MLZA 2CPFA 4WFXA 2QIFA 3SMZA 3KLEA 1NK8A 1WC3A 5IFMA 5I3QA 4RNMA 2WB1D 2RSQA 2LQ5A 3JQJA 3QGHA 1NDCA 2BKNA 1YDLA 1BUXA 4DV3J 4ELUA 3SCIE 1FNXH 5IT9U 3CCES 2C2KB 1NBEB 3WIUA 2F8HA 4F3MA 2H9ZA 1LEOA 1U2FA 2E5HA 4LF8J 2EPIA 3LW5C 2G2ZA 2DGXA 1RJJA 1HW8A 2D7SA 5IC4B 2DHAA 1FFSB 1VISA 3NGUA 3V6HA 1WC6A 2DIUA 2C42A 5HK4A 4CLPA 3H2LA 4WFAQ 4F26A 1CJVA 3EZ5A 3OTOJ 3GR1A 3W60A 3R1HA 5JMNA 4A8OA 2IRXA 2IYIA 2OO4A 3BKTA 2MKYA 3E01A 2OD4A 4WXOA 3NOCA 2RMLA 5CYQB 1BWEA 2HURA 2ILZA 1GNKA 2EK1A 3TRGA 5KT5A 5AE1A 1GMUA 4ZPTR 5DRKA 2FZCB 4U95A 2B43A 4B3SJ 1IVZA 2G1DA 3GB0A 1DFDA 3WBZA 1Y4ZB 1BQNA 3HX9A 4DUTA 4CZCA 1V6HA 3AODA 3TEHB 2GZOA 3D28A 4X66J 2B4VA 3K5OA 4Y2IA 1PG5B 1TUWA 1M1HA 3FQLA 5DETA 2XMAA 4CIOA 1M0SA 9ATCB 1U1QA 1U1NA 2CQGA 2UVRA 1Q79A 2RILA 2ZWPA 3UI3A 4DSIA 1SUQA 4I2QB 2L48A 4AL5A 4R8UA 3M32A 5CQGA 4AT1B 4I68A 2AJ1A 2GHPA 3OTEA 2ZH5A 2BR0A 3MFIA 4LMZA 4OZ3A 2RQCA 3NNCA 3IG1B 3H4DA 2AF6A 1YK9A 4OIXA 3O1LA 3ZZYA 2VICA 4RW8B 4NEZA 6AT1B 1NJWA 4X64J 2MHEA 2KHDA 1O0PA 1ZM4A 2X51A 2W2QP 2J9DE 2C3YA 5T7LA 4FYXB 4NCGB 1HHTP 1H2VZ 2W9AA 1W2BR 3BGRA 4EBDA 1SC4B 4CYUA 2VC0A 2VPZB 2CJAA 2KT3A 2YNGB 5J2PA 3BDEA 3KOAA 2XLKA 3W9HA 2WVDA 3QSYB 5CD4H 3KNGA 1GAOA 2AGPA 1U2RA 3RR7A 1G1XA 2BV3A 2CJQA 1I5OB 2DR5A 1RHRB 3NP5A 4OJGA 1FRIA 1SJ3P 4PABA 4YR3A 1RB0A 4OQJA 2W1BA 4MKVA 4LF6J 1TFWA 2XS2A 3MMBB 3TAMA 1NSPA 3M8SA 4U8VA 1N5YA 2CQBA 2EBGA 1ZS6A 4WE1B 3IO1A 4MAKA 4ZVFA 3K0JA 3PKMA 5FIIA 1X4CA 4NLVA 1O8BA 5IWAJ 1FRJA 3ZZPA 1T05A 2P9EA 2E66A 4MIWA 3SBMA 4S0MA 3TX0A 1HNVB 1HBUA 2H4YB 2K1RA 4NE9C 4O4RA 5GAGU 4YDDB 2RHSB 4AQYF 2C28A 2Y1IA 2AV5A 3IWLA 4JI0J 1EP4B 3GLJA 4WZMA 1X4HA 1PC4A 2MZTA 2XTJP 2FHJD 4Y3CA 2PMZD 1FWKA 4ECZA 4LF5F 1QLNA 3JSBA 1O51A 1GX6A 2HFZA 1RT4A 3DRXA 3I96A 2PDAA 2KU7A 4KKOB 5IT9Y 1RWVB 3MM9A 2YPZA 3B4MA 4DPUA 2L3MA 4PXBA 1R89A 2AEFA 2NSBA 2VB6A 1EKSA 3IP0A 3AD8C 2CNLB 1RLDA 3M30A 4LFAJ 2IYGA 5C25A 4JI4J 4FYVB 2YNFA 5M2PA 1Q1KA 2I8EA 4CRJA 5L9XA 2IRUA 1KLMB 4F04B 3W5YA 3SCJE 3BSOA 3KLGA 2Q3PA 2HNYA 5IOLA 2OHDA 4CT8A 4FBUA 2AYGA 1Q53A 4FPRA 1U1RA 1T7PA 4V19J 4ZP9A 2CWXA 2FJAB 4FNIA 5D0GA 4DSLA 1BXNA 3R6LB 3GFXA 4JP8A 4C2MA 3QT5A 4LF4F 5M2RA 1IKYA 3AA8A 3FQKA 2WCXA 3NGSA 5MAOA 2UP1A 1F3FA 2VBWA 2KFZA 2YX7A 2ROEA 1RAIB 4A46A 4MTPA 4MYUA 3PHEA 1OIAA 4FVCA 5J1NA 2KM8C 4KBIA 1TKXA 1FKOA 1DY3A 3N28A 1JK9B 4MK8A 1NKEA 2ZVSA 5HBMA 4UT4A 1F5CA 2DNNA 3FEYB 4NX9A 1S1VA 3EGNA 2M5YA 4KTQA 5ETRA 1QD1A 4PKDB 2YKOA 1LFPA 5LJ3Y 1DURA 3IM8A 3C6TB 2J8SA 2GVZB 2QE5A 3OR1B 5IZHA 3THVA 2E5LF 2OLWA 5FDLB 3QBCA 1LQ9A 1VS3A 1F1BB 2B56A 2GGPB 3FFIB 2ACYA 5KFXA 1FT8A 1RACB 1FX2A 3MR2A 5JVGQ 4DV2F 4DR7J 4ES3A 4TU9A 1M5SA 3TUZC 3THPA 4TY9A 4CH1A 1TVRA 2M0GB 3PJWA 4IDKB 1NHVA 2VZ9A 5GAHU 2A0FB 2B4PA 2W4DA 2HBZB 1SIZA 3K2YA 4I7FB 4LRDA 2KYXA 4RW9A 2XLJA 1RT2B 2GCFA 5CYQA 4OYIA 4P71A 5C42B 1LNQA 5K8PA 3GFHA 5LSLA 4Y2KA 1RT1A 3H5SA 5LT5A 2ZJQQ 1UFWA 4EYHB 4C8YA 2OPPB 2CIMA 3QGIA 2F3JA 1F9HA 5LXYA 5DLFA 2EC0A 4UTGA 4K4UA 1S77D 1HQEA 3H25A 4OYMA 2CPHA 4AXIA 1OJ4A 2GMHA 3NL0A 4ZLJA 2XHCA 1YSJA 2BJ8A 4JI4F 4J37A 1HQUA 2Z58B 3M2VB 2CA9A 2BXJA 1QSSA 1S10A 4B9NA 3MMCA 2YNIA 1VQOS 3TA2A 4GKJJ 5KG3A 4Y00A 1U47A 2UUCF 1JIHA 1SUQB 2VFTA 3OVSA 1S4FA 2MPUA 4RW4A 3UD3P 1HNXJ 2CQPA 1JNRB 2HMIA 3CJ8A 4ANDA 1NK4A 1Z2LA 3G86A 1RAGB 3I9V9 3CCTA 1QJHA 3VCDA 3EICA 4JI2F 3AJ1A 1OQ6A 2MSSA 1JJCB 4I6YA 4OX7A 3RU0A 4FF3A 2UZAA 1UEKA 2IA0A 3GYNA 4UUWA 3PIOQ 1NHKL 1JLAB 1X5OA 3Q83A 1FX4A 3JSMA 4ZP8A 1KVKA 4J9KA 2LQBA 3DGPB 1WHVA 4ECQA 1EQ0A 2DXEA 4YR2A 1HWUA 2JLGA 4CLUA 5B0CA 3EVOA 3S8SA 2HVZA 3UR0A 4NCAA 1JLCA 4USMA 3DHXA 2IDLA 2ZH2A 4WTOB 3FCHA 1R8CA 3FRYA 1R27B 2A3JA 2HVIA 4LUBA 3MHYA 1SVDA 3FSIA 1HPZB 2IM1A 2GMJA 3KLIB 3I5AA 3RW6A 1XNRF 1NK7A 2L9DA 4MFBB 1KTQA 3R7BB 2M8HA 4H4KA 2B4OA 2Z4PA 5F0WA 5LL6d 1M5KC 1YJVA 2PGCA 3J81j 4J9MA 2CJYB 3HHNB 1AFIA 2P2CB 5HQMA 2D69A 3DFEA 2WW8A 4ZPDA 4ZVGA 2ZH4A 1IBLJ 5IT0A 1T9TA 3MPDA 3DU6A 3VTIA 3DM2B 3H4BA 3RR8A 4G3IA 2PT0A 1CQNA 3KUGA 3LWLA 2F4FA 1RA6A 1ZM3A 5GVQA 1EP4A 1VK8A 3LP2B 2HRYA 4OMFG 4ZJOA 1NJZA 5DDRC 2MB0B 5B0DA 2E9RX 1S1UA 3T5KA 2CAJA 2MDAA 2YKNB 2ZNZA 3ET6A 1K8AT 4J9LA 3P49B 3PACA 1IM4A 4ZCMA 1M5OC 2VFVA 1FD8A 2HQDA 3MEDB 2ATCB 1T9WA 1WUUA 2P6SA 3M6XA 5KFNA 2B9YA 2UU9J 1PBUA 3H2VE 4LFAF 4K4XA 2Y1JA 1N33J 2CNOB 3O2IA 3R2CJ 3ILOA 1HHQA 3L7PA 1RYRA 2B6AB 2R7WA 3GIIA 2MY8A 2VDIA 3LA0A 4J91A 5CD4A 4MT1A 4L75A 1H72C 1OY8A 2E5GA 2HLTA 1KOHA 2PEBA 3CJQA 3OL8A 1KRPA 3NCRA 5C7PA 2CDQA 2VFSA 4WFBQ 2HNYB 2LMIA 3OFHA 4O3QA 3ZZTA 4CI0B 4ZITA 3MEEB 5DQHA 3OHAA 1U09A 3GV5B 3MD3A 1ZZFA 5J1EB 3CT9A 3C66A 5A8WA 2XSJA 5FJ4A 3DLGA 1XERA 3DKDA 4J9SA 2GVDB 2HIYA 2QLXA 5C24B 1U0HA 2HZAA 3EE3A 1RABB 4Z2XA 2R8JA 2CJBA 4GVBB 4CLFA 3NLCA 1QUVA 2HS3A 3OXLA 5ETKA 2ZJPQ 1FKOB 1TKXB 1T9XA 4DQRA 3AJDA 2AEJA 2W4CA 3PG9A 2JFDA 3GIJA 2MZRA 1WELA 2V8PA 4L72B 2JDJA 1S1VB 3M8YA 4P2SA 4WU3A 3G6VA 3NKYA 1YBTA 1DRZA 1CC7A 1A0OB 3DOLA 3K5LA 4CO3A 3ITHA 4M8LA 3HHEA 4R25A 1RYSA 5HI7A 4X65F 2RQ4A 3BYRA 1T9YA 4Q8EA 4K4ZA 3HHLC 1PYOB 5FDLA 1Z2ZA 3OR2A 2W9BA 2DJWA 1BLUA 1NLKL 4DL6A 4IR9A 2LECA 2RUGA 4NLYA 3CIZA 3QGGA 3KHRA 2G4BA 1MW7A 3JAMY 4K2JA 2ALYB 3HMJG 4NPOA 5D4NA 3LAMA 5EN1A 2JJ4D 3I55S 3HHKA 1EX8A 4F4WA 5L1JA 1OQ3A 3CJKB 2DGTA 3I4HX 1B7YB 5EWEA 3OUYA 4HT5A 5EX0A 1GFWB 4WTYA 3KLEB 4QWAA 3G9CA 1PJ5A 4N5SA 4IOBA 4ELTA 2FGCA 3DMJB 1I51B 2U2FA 3P6YC 3HFZB 4RBUA 1TP7A 3D6MB 4DG1A 1LWFA 1EIYB 5HQLA 4HHJA 1V3ZA 3D3BJ 4ETZA 2GX8A 2IAJB 2OGUA 3HKZD 1HBNA 4NMLA 4RW7A 3QATA 3V4IB 1EETB 2DNMA 3R97A 4DV7J 4WYWA 3C46A 4MKYA 1SPBP 2J5AA 2QLJB 2R7XA 2MXYA 3EX7B 4DR6J 4RW4B 1YJNS 4CO2A 2KFNA 2MKIA 3V81A 2H4WB 4OI2A 3SIPB 3K5NA 4HDGA 4LF2A 5T41A 4DPXA 1BE4A 3NCQA 1DQ8A 2AKWB 2XGPA 4ECWA 5H9EJ 1FWLA 1UW4A 3AD9C 2AYBA 2FLOA 2VUGA 1PJ7A 4DDFA 4UY85 2X3GA 2Q6CA 4Z37A 4ES1A 2LQ9A 3GSIA 1IKWA 1KNZA 3CGIA 4ILRA 2K3KA 4LREA 2HVHA 3OSNA 2DXFA 2HQFA 2YKAA 3QPIA 2IHR1 4ID5A 2GO9A 2AJ0A 3R9LA 3RB0A 3MMAB 1X0FA 1GXTA 5D6GA 2LEPA 5KG1A 4KFBB 2KT2A 2GO8A 1RK8A 2LVWA 3U1MA 2CUYA 1RAOA 2HAIA 5IM0B 4C8KA 3PEJA 1RAHB 1HPZA 1Q8LA 1HWIA 4OZNA 4RLEA 1XR7A 2C2DA 2MZJA 2WSEC 2FY1A 1T11A 2JSXA 2VG6B 1NK5A 3TR5A 5J2QB 4X4VA 2BKOA 3RAMA 3VGUA 4BC7A 1NK9A 4P10A 8ATCB 3QFWA 1HIYA 3LPEA 4LF4J 4ED5A 4DR5J 1ZOTA 4ZA1A 1H7XA 1RU1A 2RF2B 3OQ2A 4CLZA 2XZDB 2GIQA 2OMOA 1QUPA 2XY7A 1Q95G 4K59A 1X4GA 2RIJA 2HHPA 1TKTB 1WKLA 2QMXA 1OSCA 4YB1P 3MM7A 3GILA 2MLXA 2J8AA 4PWWA 3BGRB 4KR0B 2XQCA 3OTCA 2VH7A 3QWPA 4ZP7A 4DL0C 3ET6B 4E0DA 3V5RA 4EMDA 3D6HB 5HMXA 4R0EA 1RTJB 4XO0A 2WONB 3AHPA 4DL4A 3CD6S 1S97A 5KFDA 4IO9Q 4C4WA 2FC8A 1VR6A 4M5LA 4P7VA 3PRBA 4G1QA 5KFWA 3OL9A 2DEIA 4IFVB 3IWNC 4ZN1A 2DH7A 1FTRA 4NXNJ 5ETOA 4E2FB 2FVCA 4WBFA 3ZZOA 1RAAB 4RR5A 3D54A 3AXMA 4KGMA 3MM5B 5HP1B 1HWKA 2DCUB 3TUJC 3AFGA 2XNQA 3LP1B 2VQFF 2LEBA 1LW0A 4BWJA 5KFGA 3DGVA 3D0GE 1KR4A 1BWVA 1RHUB 2B3TB 4UF4A 1ZETA 1M90T 1EJ7L 4LSLA 1S9EA 4DEZA 1C0TB 1IQTA 3U7JA 4HH0A 2JLEA 3MEGB 2QA4S 2JEIA 1LWCA 2E44A 2A1BA 4F36A 3TARA 1UWAA 3MOZA 2RRBA 4QYRA 4CLKA 5GAEI 5E41A 1RTHA 1WKJA 4USHA 2A2DA 1X5TA 3CJ3A 3AB4B 4JI6F 3KLHA 1YJ7A 1TL1B 2ZC3A 4LQ3A 3GJSB 4IH6A 4LR7A 3ZZUA 3B4DA 4OHWA 4JI6J 2AD9A 4WWSA 1VOMA 3Q22A 4IH5A 2PI4A 2HHQA 3UVJB 4ZPBA 3RAQA 2EC2A 1ZYQA 1HD0A 1GTHA 1TMMA 2F1FA 2RU9A 3CJ4A 2YWWA 5D0HA 4ED0A 3M9MB 4J9PA 1HI8A 2MSTA 2PD1A 4ED1A 3FKBA 1ROFA 2XG8A 3HF5A 2PI5A 3DLLQ 3ETOA 4OHZA 3KLGB 1B3TA 4I67A 4YOEA 1F2GA 2F63A 1TUGB 3K5PA 2ATLA 2VJVA 2YWGA 3W9IA 1D9FA 4ICLA 4J9UE 2P6TA 3CVKA 1CJTB 1S1TB 4DR6F 1YBAA 1JXVA 2AZ1A 3LH2S 3UR3C 4TKTA 3R7NB 1SKRA 2RVJA 1HMVA 3VGVA 8AT1B 1J5OB 1NO8A 1WHXA 3K8WA 3TO8A 4NLSA 3PW5A 2HHTA 3DCAA 2FLLA 5LM7E 3D66A 3HO1A 4OI6A 2XMUA 5KFPA 1P1TA 2E5IA 2V4RA 2NUHA 1L5UA 4B9VA 3EGZA 3ZC4A 2DVIA 2B8QA 4USWA 1SJRA 1TL3B 2FB0A 1RGVA 2CKWA 2IAJA 2O01C 2PE8A 4RW7B 2B5JA 4N8OA 5F8JA 4XPEA 4EGLA 2QG9B 3FNNA 3HVWA 4MYTA 3OXGA 2AU0A 1OYDA 3QZ8A 2DO0A 2FHKA 1A6LA 3TQEA 1HBOB 5C2GA 2V63A 3H20A 5KFUA 3ONQA 2YKMB 4A8XA 4DUZF 4DFJA 3FVYA 2BW7A 3M32B 1K0VA 2MZ1A 1RT3B 2CPIA 4WF9Q 4KPCA 4ZN3A 1S6OA 2QLBB 5KFAA 2AZ3A 1NPRA 3T19A 1X8DA 3U1LA 3RRGA 4W90B 1MU2A 1BD6A 2QA2A 4O4GB 1KP6A 1WD6A 4RX6A 4U7UK 1N36F 5E5NA 2CJXB 4EK2A 5HSPA 3OLAA 5K14A 1O5JA 3DRYA 5DG7A 2CFXA 4NCGA 4Y65A 2YKQA 2LXIA 4NMXA 2DNRA 3RRKA 3B82A 2FJBB 3SSQA 5KFEA 1PC5A 4DV7F 2XY6A 4FF2A 2DH9A 2BE7D 3G82B 1X4DA 1HQUB 1XR6A 3M2VA 1JLGB 3NS7B 3D7SB 3GJRB 2XO7A 4C3LA 3I0RA 2MJUA 3RBEA 3HXMA 4I69A 1Y00A 3D4JA 2UXDJ 1XMBA 4IRDA 4C3MA 1S0OA 1EAYC 4UQGA 2M3DA 1B64A 1R8HA 2RQMA 2CZ4A 3NGKA 2E9TA 2YQ3A 3SQGB 2E1CA 1L3KA 1S9GB 4Y2CA 3MR7A 4ED6A 3DLKA 5D0RA 3OW2R 5DGAA 1QAJA 2HNZA 2ZBQA 1UJ5A 4QWBA 3UCUP 5BYQA 2IMOA 2CZ9A 3QT6A 1OO0B 2D41A 2E1MC 3VV2B 3ZNUA 3J80U 1YIJS 1DZ5A 4FP9A 2HHHF 3BB5A 2YH0A 3DLJA 3E8OA 2HNDB 2IM2A 1VBKA 2GQ2A 2K1RB 3GCWP 1WDTA 1KTVA 3PYGA 5K8NA 2Z57B 3HSGA 2AIRB 4PG6A 2R7SA 3MGJA 3QNWB 5LMNF 3BBCA 4IRKA 3DLEA 4F67A 2GHVC 1RWKB 3BKFA 3V4MA 2XCPA 2RDJA 1AFJA 3O3LA 4KGXB 5KFSA 1BY9A 1VRTB 4DCOB 4Q2MA 5DDPC 1KQFB 3D5MA 4TXSA 3DRPB 2JC1A 1BQMA 1KONA 2F65A 3M1VA 4JI7F 4CP5A 4FNHA 4GKJF 2B4UA 2OPSB 1NUEA 4D3HA 3HPOA 4DSFA 2MQNA 3ZNJ1 4EO8A 1DLOA 2EEYA 5ETNA 1R31A 2ZHOA 1H73A 4TN2A 3NGRA 4RO0A 2DNQA 3CJRA 5CYMB 4ZVHA 4JI8J 4J7CA 1VQLS 1GQEA 2OP5A 3PJXA 2QC3A 2O1PA 1MG7A 4GMKA 1UA1A 1S79A 2VONA 3Q8SB 2CZVC 3W8PA 2OPRA 1W25A 2ACMA 2U1AA 3EGVA 1WI8A 4X62J 4WCEQ 5HP1A 1VQ4S 3W63A 1T03A 1AROP 1R3NA 4C8NA 2OI2A 4V1Ak 3PR4A 1TTHB 5GMKa 2RKIB 3T1YF 3ULHA 2YTCA 1G7CB 2YVSA 3C14B 1FRHA 4LBIA 4ELVA 1FTCA 3KJVA 3GU0A 3MPVA 2UXBF 2DK2A 2BE2A 4QIFA 5IXUA 1REGX 3OHBA 2ZHBA 5AJ3J 2LKZA 1U1KA 5KFTA 2DGSA 3IGVA 4DR7F 2UXBJ 2OSQA 2AHOB 2NCKL 2VG7B 3ZZZA 1J5EF 1A7GE 3OVBA 1P9QC 1TL5A 2R3VA 2VBYA 4FZVA 4KYZA 3CWJA 5C2CA 2ZH8A 3CC7S 3UCGA 4IRCA 3RAXA 2MKSA 1XNRJ 4C7QA 4TQRA 2V8GA 2IY5B 2JZ5A 5I4MA 4FYDA 2G9OA 2ZH9A 5DS7A 1JLQB 1RWXB 3SI8A 3BEGB 3TZZA 1PCAA 5K20B 2HFVA 4ECYA 2QX0A 2X1AA 4BHQA 2UVUA 3H5UA 3M8QA 1XBWA 4HTIA 1WOPA 2ZJRQ 3DI6A 5L1IA 4EBCA 4FPIA 1IKXA 3M6WA 4C8ZA 5KAKA 1LWEA 1ZAVA 2BOAA 3DOKA 3KTQA 3BR8A 1ICEB 2CQ2A 1VQYA 1DTTA 2R4FA 3KFWX 5GMEA 2QYCA 4RUBA 7FDRA 2NQPA 3PO4A 2GAGC 5EHHA 3DC2A 1UVJA 1RWMB 4ED2A 1IQZA 1ZAXA 3AA9A 2WHOA 2I0XA 1VIXA 2HEKA 4IH7A 1PSDA 2MQMA 2V2KA 3OJSA 4DUYJ 1VC5A 1H38A 2ZC4A 3BH7B 1HNWF 5H9FK 4XDCA 1TU0B 4DR2J 1TQLA 3J7Z5 1FO1A 4LR9A 4ZLLA 4LSNA 1WF1A 4AXJA 1HNZF 4C3KA 1G2EA 4KH0B 4MJKA 5DGBA 1KKHA 1KS2A 2QGFB 1F2HA 1C0UA 4DU8A 2KRBA 2KVIA 4C97A 5D3GB 1VQ6S 2FHJA 2XMKA 3OR2B 2W2PP 3CE8A 4FDFA 2VBXA 4HT7A 1SKUB 5AT1B 5EGYA 2LDIA 4RWXA 4L6V3 1FK9B 4QPTA 5A6WA 3ZXWA 5HVGA 4C8MA 2M7SA 3PEHA 3RB6A 2Z8QA 2MY7A 3PX4A 1RTIB 4WJBA 5J2NB 4RU2A 4OLPA 2WB4A 2WOMB 4GO7X 1VBYA 5AXMA 3BYPA 2QZ8A 4M5DB 3A3NB 4LF7F 1RLCL 1VDHA 2RH3A 4EFAC 3BQ0A 3T5JA 1Q82T 5E3RA 4CO5A 4Q7AA 2ZE2B 3MPYA 3O5TB 4OJ3A 1L3UA 1SH3A 1Z1ZA 2MKCA 2ZM6J 1HNZJ 4DG1B 2Q1LA 2OPQB 3M9NB 4OL8A 2KRRA 4DFKA 1M1KT 2JRSA 4NYOA 1N33F 1H98A 2DHXA 4A47A 4M94A 3JTOA 2JNJA 1HR0F 1ZM2A 4F3OA 5D15A 1Q86T 2HSEB 2XI3A 2ZOGA 3G96A 3MCOA 2ZUGA 1RT6B 3A3OB 3BGLA 1REVA 3W66A 4C8OA 1U24A 2RE1A 2Z2ZA 2NXUA 3M4XA 2VQEF 5DZ6A 2CRLA 2D1CA 4JV2A 2LYVA 2KYZA 1FESA 2RS8A 3I6PA 4I2QA 4MFBA 4DR4J 1VLYA 3UD5A 3TZXA 1Y10A 1JJHA 1RKIA 2DIVA 2HNZB 3CIMA 1G3OA 2BEFA 3HVTA 4HHHA 5T14A 1HNVA 3CCQS 3H0PA 3CD5A 3K17A 4XIUA 2HRUA 2DR7A 4OYZA 5L9NA 1CPZA 1WEZA 4DUYF 1NJIT 3SYZA 4PG5A 3ILLA 1M5HA 3DDKA 5IC6B 4QIGA 5IV4A 3KK2A 4B3TF 1S1XB 5K8MA 2DGUA 3N5BA 3MMAA 2Z2MA 1R8PA 3A3PB 5KG6A 3VQTA 1WJ9A 4TLQA 4JOUA 2FVQA 3BSNA 3R8YA 1BQMB 1KOOA 2B8PA 4X4PA 1ELOA 3QAEA 1S72S 1HHSA 2WK4A 4EZ6A 2HWIA 1QY7A 2FUG9 2PFDA 1RHKB 1CULA 2CG8A 1B0TA 4LRBA 1ZPVA 2VFRA 3MFHA 1MROA 3KHGA 2H5EA 1IJEB 2DT9A 4F3QA 2LQ8A 1PYTA 2R2UA 1NB7A 5K8OA 1WG4A 3M8PB 1YZ7A 1N5YB 2E29A 2QO3A 4H4OB 4H54A 2KO1A 3KUHA 4J9NA 1KVIA 1SH2A 2OPRB 5THWA 5I3PA 1QTMA 1JLEA 2VIHA 1URNA 4CO4A 3Q2TC 1S1WA 4JV1A 4WZQA 1C1BB 2DH8A 4DR1F 1FVSA 3SCLE 3PV8A 1PAEX 4EBEA 3G2XA 2ZDPA 2KFYA 1RE1B 2HQ3A 2OMLA 3IBFB 4JV5J 2C2RA 3IR5B 1V3RA 3EXCX 5DLGA 1NPKA 1WC5A 1NRKA 2AJ2A 2O3DA 4CM0A 5DQGA 5AXNA 2DTJA 3UWTA 4P2XA 3POTB 4PWUA 2X1GA 1MLAA 4Y6IA 3T1HF 4IG3A 4J5OA 4LR8A 1UCNA 2NUUG 2KN4A 2LQJA 5H9FJ 5KFOA 3GCXP 1N0UA 2NPFA 2FYXA 2HGNA 1KDNA 2I5JB 1AW0A 3C6UB 2ZUAA 1VFJA 3V6DA 4KHPJ 3AH6A 3LGMA 4CLLA 4ZJQA 5C25B 2GGPA 2V5HG 2ZBIA 1S57A 3QAUA 4ZVPB 4LF7J 2Y0SD 1N34J 1HQ2A 2KB2A 5F8IA 2V6AA 1S0VA 1ZPWX 1N6QA 1WSVA 2PA3A 4Y2AA 2VG5A 4Q2LA 3Q8RB 2GC8A 2EXUA 3BJYA 2VPXB 2AW0A 1KHWA 2KVQE 3LGHA 1UWBA 3Q8PB 4OZ1A 5KFYA 1DTTB 4B9UA 1OPZA 3CO9A 4OZ2A 2QRRA 1U6ZA 4DSJA 3NEKA 4WYLA 4PRFA 2ROGA 2YNHA 4F2RA 1ACMB 1NAQA 1U1LA 1S76D 2HGMA 2GHWA 4FBTA 1VLOA 1Y11A 3DYAB 3OVAA 4DN0A 4KPYA 4DV4J 5HLFA 4NZ0A 4WPAA 4JI0F 3KMQA 5I42B 2V2ZA 5F3TA 2RRNA 1NJYA 4HACA 2SXLA 1KEKA 4B17A 2VQEJ 1OWXA 4KHRA 3MUTP 2BOPA 2LEAA 3NBPB 1IUJA 3W2WA 3QT8A 4LSNB 4FF1A 2VKRA 2FJDB 2JOQA 1VQ8S 3NNHA 1TAUA 1KQGB 5B0GA 3S01A 3LP0A 3KJFB 1TZ0A 2HG4A 1WG1A 1H7WA 4CLSA 4OYWA 1GMVA 3N9UC 3QSIA 4I64A 4LVOP 3MAAA 2VQFJ 5KFRA 3FBEA 4RU9A 3LALA 1RTIA 2B51A 3G6XA 3W7BA 2HKEA 1PBAA 4L76A 2J0QD 1JKHB 1APSA 1HARA 2QEXS 3CC4S 2JLFA 2AX0A 2PIIA 3EMTA 3FSYA 2F5GA 1FKPA 4L3NA 3GYXB 3TUIC 4DZ6A 5HVHA 3Q24A 4J9VA 3T9ZA 2YKPA 1ZA2B 2AP6A 4ED4A 3DDNA 3DHWC 2ZBPA 3CCWA 1Y3KA 4I2PB 4NOHA 3T1AA 1LFWA 3BGFA 3I4PA 2W4PA 1TL3A 1VI7A 3QQCD 5CA5A 1HKAA 1YWXA 1JWWA 4TQSA 2A6MA 2DNYA 4USVA 1JNZB 1PAUB 1D3WA 1G4CA 4RNNA 3MI7X 1KD1T 1FWPA 1SV5A 4TYAA 4FS1A 4IQXA 3QT7A 4N77A 4QWEA 2GNKA 2MKKA 2GFFA 5DG9A 1KSPA 2V4QA 1N5SA 2JVOA 5L46A 3BR9A 1NU4A 2N4DA 3IRXA 4U96A 3RG6A 1JLBA 3EPIA 3HVTB 4GKKJ 4JI3J 5J2MB 5GADI 3MM6A 1MU2B 1RKJA 2O67A 3T9NA 4DOZA 2HGLA 1Z4UA 3KHLA 3KK2B 2J76E 1FE4A 3HULA 3N6LA 1L3VA 2M4MA 3QJLA 1KFDA 1S6PA 4UY8T 3I31A 2HMIB 4TY8B 1RTDA 2PN6A 4ZVRB 5DZ7A 3KK3A 2VU5A 2V4JA 1OSDA 2B9WA 4RW6B 4IUFA 5A2QU 3AQPA 2UXDF 3V6JA 2C2ZB 2A10A 2VF3A 4DV1J 3EXYA 1BGXT 3GG0A 3GG1A 4M5GA 2CPDA 3GP9A 1YJTA 5HATA 4CO0A 4ZMMA 3KLVA 3KLFB 1U49A 5D4LA 4DL3A 2BJEA 5E33A 3KMSA 2YWEA 3MOJB 2RD5C 2ZD1B 3HI9A 4OX8A 2QL9B 1AA1B 1KWMA 3GE9A 1C2PA 2HQGA 2LU1A 4HLBA 4NLOA 3PIPQ 2WAQD 3D3CJ 2NPIA 2PMWA 3I9ZA 1RAJA 1JLFB 3QZ7A 4ERDA 4L3KA 4G1IA 2R7RA 4DF8A 1Q8KA 2R9LA 4KJIA 3LP1A 3PY8A 3UNYA 4K4TA 1R7IA 1K9MT 2DHSA 4M5NA 2ZBRA 2IBKA 2KKHA 7AT1B 4CDIA 5ITHA 4PQUB 5CXTA 1VCTA 4LF6F 4LF8F 2F7VA 2UUBJ 2D3ZA 1LWCB 4OZ0A 3PO5A 1FNOA 1NZAA 1IBMF 3M1VB 4HDHA 4NWBA 4OHVA 1RDRA 1FXDA 2IBOA 3ENVA 2PO4A 3MURP 2Z30B 4DFMA 3BKUA 2I5JA 4QIEA 3KWMA 4USKA 3PYEA 2VA2A 1SL0A 1NSAA 4ZIVA 4M63A 3Q8UA 2DBBA 3IC1A 1FE0A 1Q8IA 2WBMA 4MKBA 1CJVB 3IWXA 1S6QB 4DV5J 4DLEA 4C8LA 4NRTA 3L3CA 4NLGA 3C15B 2W9CA 3VAGA 2XZTB 2B9EA 4BCAA 4UZBA 1TAQA 1Q8BA 2Y3YA 3HDSA 3EVMA 5KOXA 3LGNA 1NDLA 3P5BP 3FBBA 3A4TA 3L7UA 3R7SB 3VAJA 3NGTA 3NY0A 4DLGA 3G8SA 4A8MP 2C2OB 2VKZG 4QJVA 1CJTA 1S1TA 1NB2A 4U7CA 3WHIA 1FEEA 1UVKA 1WACA 3KDNA 3PYDA 2NSCA 5CABA 1RBLA 3NS5A 5FLXU 3KJVB 4F8RA 1YJUA 2F9JA 1CS4B 1QE1B 2E1PA 2K3IA 4JUZA 3TZYA 3LO3A 3PX0A 4K4VA 3IR7B 3A1YG 3Q2SC 1PO6A 3ELHA 4H4KC 3PW2A 1TV6B 4USUA 1NH8A 3I5BA 4OZJA 3LAKA 3M2UB 1V9OA 5F0UA 5F8MA 5GAEU 3HHLB 4JI5F 3UD4P 4NLWA 4ZPWR 2NZ4A 4XAKA 2CQ0A 5L8RC 1U6BA 1X9WA 3FBFA 5CH7B 4RNOA 1RHJB 1PKUA 1U7LA 4IFYA 2B7BB 4LF1A 4NLUA 4RBVA 5C5JA 1UVLA 2X1FA 1UMJA 1EZZB 2G1HA 3IG1A 3DOMA 5EUHA 1Q7YT 1DQAA 3M8QB 2DRBA 1TFYA 2I1RA 2LLZA 3D6TB 1UEVA 2X1BA 4OZLA 2HBRB 3LWMA 3FRZA 2HWHA 2YWHA 4IDKA 4YB6A 3CUNA 1RWPB 2EFNA 3AB2B 4LBPA 3TA1A 3UW1A 4ENOA 3A8IA 3D67A 4DPTA 2MQQA 3JSYA 1E6VA 2VOPA 3BV8A 5IQ6A 4AFFA 3KDOA 4HEA9 3D68A 5HO4A 4HVZA 3CJKA 1D0EA 2UUAJ 3MEKA 3UDVA 2IM3A 1CEZA 3HFVA 5E2QA 3PZPA 2XWXA 4KT0C 2HFNA 4ED3A 2AGOA 5ETSA 5I3UA 2HHXA 4ES2A 3BO4A 1FNMA 3SFUA 3HJFA 4CYUB 4DV6J 1FHTA 2NXJA 3IMQJ 3MTKA 4FXVA 1LW2B 4JI8F 4DPWA 4NA1A 4K4WA 2UUBF 3UN5A 1S7HA 1JLGA 3EUNA 3ENWA 3CD0A 3ILJA 1XEZA 3U27A 2GJ2A 4NA2A 3HKWA 3N01A 1VC6A 3MMBA 3TAMB 1MMLA 3B78A 1RISA 1WOSA 4YN3B 3ZTRA 2PA8D 2WSCC 1U26A 1VIOA 2RF2A 1TR0A 3C16B 2XSFA 3W65A 3MAQA 5J2NA 1GXLA 3BH6B 3DLHA 1XTZA 5A8RA 4M5DA 2R8GA 4W98A 4YEAA 1YKWA 3V2UC 5BR8F 5AJ3F 3H5XA 5HJYA 5SZTA 1QAXA 2J9EA 2UU9F 2ZE2A 3KG4A 3G8TA 1FI4A 5A6PA 1MN9A 1YTYA 1CQMA 5JXSA 4F02A 1OY6A 3IXQA 1FJGF 4ID5B 1LKZA 1YZ6A 2Z0GA 1R6YA 1I3OB 3CDBA 4KGZB 4DV1F 4X4UA 2MMYA 4RW6A 4WIQA 4WU2A 4LIRA 1RA7A 2B7CB 3D0IE 1QSLA 1VRTA 2P8IA 2NYIA 1ZM9A 3T41A 1HNIA 2AGQA 1IWAA 3G6ES 5DJBA 2M70A 4C0OC 4QWCA 2BYCA 4IFVA 1KC8T 3NWGA 4PUOB 4LFCF 2GMLA 2MZQA 2ASYA 3UQSA 5G0RB 3ISND 1T8EA 2JFKA 1Y3JA 3FSXA 2XZWA 5CYMA 1E6YB 4DQSA 5KFVA 2ZZMA 1KLMA 3AD7C 3F56A 1BQXA 4GO5X 3DM2A 1UP1A 4M5KA 5IQQA 2FLPA 4DQIA 4YMEA 2P5VA 2VL1A 1XMOF 1S0NA 2WZ1A 2MHNA 3HHLD 1VRUB 3NAIA 4UZCA 2H3EB 1FJGJ 3H8YA 2W7OA 1D8YA 1S5ZA 3W3SA 1KQKA 1S1UB 5E7OB 3R5JB 4YR0A 2R2RA 3B8HA 2FJEB 2C2MB 1AZSB 1GK8A 1M5VC 3UFCX 3W61A 1LXJA 1RTHB 3A12A 3UN3A 2XWYA 3CCMS 2YBVA 5GMDA 1YITS 3CULA 2J9CA 3JTPA 4NZ7A 1GT8A 5DQIA 2V8HA 2FIUA 2WONA 4X2BA 2BJ1A 3MPWA 2LA6A 4YUDA 5ETQA 4ECXA 3RBDA 4Y34A 2YH1A 5HMYA 4ANCA 2JWNA 2NLWA 2VPYB 3PNIA 4F0MA 2RRAA 1CJUA 3DRSA 1K73T 3IAM9 1EKRA 1FD2A 2K2PA 1RZMA 1TVRB 3QLHB 4OYBA 2ASLA 1U1MA 2IC3B 4JYAJ 4Q0BA 5CZVA 5KT3A 1H2TZ 1NHUA 3US5A 1X7VA 1FFWB 5C42A 1N32J 1SH0A 2V50A 1FJCA 4OZ5A 4RJVA 1YRXA 3GSDA 4YDXA 3S7RA 1RHMB 3W5ZA 1CVJA 2CQ4A 4ZVUB 3ETMA 1LK7A 2FVPA 1FDDA 3QJPA 1FXLA 1PJ6A 3M2UA 3OFGA 2HHWA 2KDOA 1NZ8A 3DRRB 3CJ0A 4ID8A 1I94F 2O66A 3OFEA 2FQQB 4WIIA 2DCLA 1MMDA 2P9GA 2XULA 1X9SA 1NXIA 2QTWA 3MMCB 3QIPB 4KE5A 4OV1A 4U8YA 2ZZTA 3T3FA 2H65B 5EDWA 2WBRA 3G71S 1SIWB 3K57A 4KO0A 2DNPA 2YKMA 1H74A 1KBRA 3E01B 4RNHA 5CYJA 2GIFA 4ECUA 4ZDNA 1N0VC 1U0SA 1T9VA 2VG5B 5BYSA 2J6SA 4NI2B 4CQ1A 2FZGB 4RL1A 3RBXA 4ICLB 1RT5A 1HWLA 1RCXB 2RB7A 2XMWA 1VYAA 1DJ0A 5EX3A 2WOMA 2XHWA 4YY3J 2C3PA 2HRTA 1SJFA 1O6XA 2EW9A 3I32A 4EEYA 1XR5A 1YLXA 2MJNA 3HSZA 3CNQP 4NLRA 5D77A 5ETVA 4NEYA 1LV5A 4ED8A 4GRSA 4X65J 4OX9J 3IGNA 4ZKAA 2DXDA 2DB1A 2UXCJ 1JXEA 1BQNB 1GMWD 4TLRA 1NM2A 4PG4A 5KG2A 4Q45A 3V6KA 4CLWA 5KFIA 3HZGA 1HBMA 1CLFA 2XB2D 3AXKA 4Y0FA 4KHPF 3I56S 4ITSA 4KRWA 3EZOA 3OV7A 1JJ2R 3SEOA 4CH7A 1YRUA 3LP0B 4ZVSB 4DV5F 2VBZA 3LUYA 3L09A 3CCRS 2J0WA 5M2UA 2FHMA 5GAGI 3H42A 3JQMA 2QLWA 2EG2A
chains in the Genus database with same CATH topology
2AWZA 5KG7A 2CG4A 3RZAA 4QBUA 1MWYA 3EGWB 1SKWA 3OTBA 5BJRA 1I1GA 1IBLF 4QQBA 5KG4A 2VPWB 2DR8A 2ZKUA 3THTA 5KFKA 3SFGA 1U1OA 1S6UA 1F9FA 3MD1A 2G0CA 4O4GA 5KFLA 2XBPA 3MEDA 2AYEA 3BQ1A 1PGZA 4ZCIA 5J2PB 3PVXA 2K7JA 2ALZA 1FCAA 4P6QA 3MAHA 3UDLA 3R5BA 2NR0A 1SV5B 3C2PA 2IVYA 3CCVS 4W92B 2L9NA 2WTFA 5KG0A 4TYBA 5K5MA 5D8HB 4YFUA 3BO3A 1N32F 1FJ7A 1YJWS 2XMTA 3NMRA 2VV5A 3M2RA 2E1AA 1U1PA 1GTEA 1S9GA 2E9ZA 2MQLA 3AAWB 3PDNA 2IMWP 3SV4A 2IJNA 2Q6BA 1T05B 1SBRA 1TKTA 2HLUA 3LQVA 1SI9A 1VRUA 4GC7A 1L3SA 5AE2A 4PG7A 1WEYA 4HH1A 2R7VA 3MM9B 5L1LA 2GA7A 1RTDB 2J0SD 4QIWD 1HW9A 1N52B 1SQEA 4KB7A 1RT4B 1HL6A 1WTBA 1U8SA 4JYAF 1V3SA 2YNFB 3POTA 4DR5F 2N3LA 2HIQA 4QWDA 4FXDA 1FRLA 2JL9A 3CC2S 3SDEA 1JLQA 4DR3F 1IKVA 4B3OA 4TNOA 3CDUA 3MZIA 1HI1A 4EWTA 2ZBCA 2J9DA 2DPJA 5A8KA 4R5PB 4DV4F 4Q44A 1JLFA 3LPYA 1LWEB 1FDNA 3SSRA 3MECA 3CSKA 1T03B 3VWSA 3KKFA 4C98A 2D9PA 3MEGA 2HW3A 1MSWD 2ZZNA 1UJ4A 2KXFA 1NJXA 3MTJA 4LT6A 2KG1A 1IXKA 3DYAA 2ABYA 3DMJA 1DHMA 3F44A 4IQMA 2ZITA 2BQUA 1SC6A 1Q78A 4B9TA 1LWFB 3KHHA 2M88A 1XC9A 4NYZA 1J2VA 5FLXY 4QU7A 1HBNB 3MMJA 3LF0A 4X4QA 4R8UB 4FXWA 3CCLS 4A8SA 2ZDOA 2ADBA 3HZEA 2L41A 2JX2A 4RW9B 5CZXA 5GADU 1T02A 3AQOA 1B0VA 2MZSA 5CHCB 3S1TA 1F60B 4X4TA 2ZH7A 2CYYA 3CCSS 3BSCA 2CVIA 4ATNA 2EFPA 1RT5B 2P9CA 4JBCA 4HTJA 2BDPA 4M95A 2OPPA 2CVEA 5HL7Q 4CNZA 4X62F 1P27B 2HZCA 4J9OA 4ZPAA 4BDPA 3CDAA 1TK5A 3NCPA 2BANA 2Q43A 2JEFA 4X64F 2ZH6A 2OSRA 2KZMA 1WI6A 2EKYA 4DS4A 2BUNA 4B9SA 1HNXF 1N5QA 1F5BA 5JVHQ 1OS5A 4RUCA 4K50A 3M05A 4X66F 1DTQB 3BF4A 4O23A 4WK3A 3WZ0A 5J2QA 2OJ3A 4QW8A 1KLNA 1HYSA 2BVZA 4ETXA 4B08A 1VQKS 3H40A 1SL1A 2IFXA 4DV0F 1NNDA 3BSAA 5DO2A 1JLAA 5F8LA 2R2SA 4YB5A 1X9MA 3J7A1 4F50A 1ZH5A 3H98A 4C0BA 4ECTA 2FVRA 5FD1A 3X1LB 2R7OA 3M8RA 3E3XA 2UV8A 5A0YA 2L9WA 1FVQA 4MMOA 4CO1A 1C1CB 2J0XA 4O0IA 2PMHA 3O6QA 5I3UB 2CPZA 4ZOSA 3Q8QB 3BM7A 4I56A 1YQHA 1FJEB 1KHVA 1IN0A 2DNGA 2CPJA 3I82A 4OJ1A 4KV8B 1IR0A 4M1KA 2D74B 3M30B 4N41A 1QSYA 3JTNA 4QR2A 1NK0A 2D9OA 3TP2A 4F25A 1MROB 2XCAA 4PXEA 1ZZNA 2BZ2A 4G1QB 1REVB 4RBTA 4H4OA 4DFPA 3GZ7A 2BW2A 2V0NA 2M8DB 3UCZP 3PR5B 3WC2A 3H5YA 1B0PA 2BACA 2MYFA 1VQNS 2HNDA 1C1BA 5LXRA 1X4EA 3F73A 1HI0P 2M2BA 3FZBA 1TK8A 5KG5A 3R27A 1FA0A 3J7YI 1VC0A 2CQHA 3JYTA 1S1XA 3K5MA 1UVNA 2FTRA 2W25A 5JUMA 4PQUA 3DRPA 1FDBA 4IG3B 2RNEA 4R0JA 4BWMA 4N56A 3OSPA 3GWCA 1DLOB 4K4SA 2HHSA 3OFFA 3HVRA 1H0HB 4Y2MA 3DU5A 3PFOA 5HN0A 2KG0A 2ERRA 1VBZA 4B9LA 2EFQA 3E51A 4PUOA 4HKQA 4CNYA 1IKVB 1X4FA 3CCZA 4HI1A 4MIAA 1VQMS 1JJ4A 4B3OB 1ZTWA 3W2VA 5ADZA 1C4AA 1S6QA 4X4OA 4ZPVR 1N6QB 4ZPCA 4KGKA 3DXSX 3D0HE 4QR1A 2N7YA 4E8UA 1RT2A 1CSJA 1U48A 1QVGR 2UXCF 1F5AA 2XSJB 3Q23A 3H2UB 2N7CA 1QAYA 3BN4A 1Q81T 2FJWA 2ZH1A 2V8DA 3MR3A 5HLFB 1HQEB 4ZK7M 4CH0S 2B5JB 4QPXA 2FJXA 2ZFHA 5H1SV 2CPEA 2BQ3A 1N8RT 1RWUA 1QAIA 3C8YA 1U4BA 2XI2A 2E5JA 3T5LA 4ZCLA 1L3TA 1YHQS 4U67Q 3SV3A 3TANA 2JEJA 4ILMA 3HVAA 4X4NA 4NZ6A 4F4KA 3HT3A 3QWUA 4J9RA 3K58A 4XK8C 1Q7LB 2FC9A 2IJFA 2R7TA 2Y1RI 3GIMA 2R7QA 4JI3F 1JX4A 4NLXA 1DARA 4USIA 3VAFA 1UL3A 3G8QA 4EO6A 2NREA 1QVFR 3SZ2A 1YVFA 3MUMP 2DITA 3OTDA 2WRMA 3DGPA 3DNCA 2QFJA 1NK6A 4GC6A 2NS1B 2COLA 4ZHRB 1IJFB 2BRKA 3AY0A 3I0RB 4AL7A 3U1NA 1SJ4P 1HA1A 1SXLA 5KT7A 2JC0A 3VR1A 1HWJA 2F9DA 3RRHA 4N47A 3TVKA 4ECVA 1VGYA 2A18A 1UJ6A 1ULRA 1EETA 2DD8S 4KHMA 3EZUA 2BABA 2OIHA 3PW0A 4WK1A 4NLQA 3OL6A 2A2CA 1FRXA 2VD3A 3VALA 3CDWA 3V81B 3OPKA 4U9RA 4ZCKA 3D2WA 2C2EA 5KFCA 4DMZA 5KT6A 2V94A 4A8QA 5L38A 3KG1A 5A2QY 2UVWA 1N34F 2J7UA 1UAWA 5T7LB 1W2IA 4DX8H 5DM7Q 2APOA 1JKHA 4PWDB 3MCSA 3CF5Q 4DS5A 4YQWA 2HHUA 2DGWA 2RT3A 1YJRA 3N0VA 5B7WA 5HMZA 2CJKA 4WF9Q 5GAHI 4NA3A 3D1OA 2CJ9A 5J1PA 2OH2A 1VQSA 3FZ2A 3R5CA 4I1TA 1UVIA 4DN9A 1R0AB 1WHWA 1T94A 2HHVA 2HS0A 1YGYA 3AJ2A 5HROA 3RB4A 1RT6A 2KT5A 3OBIA 3G6YA 2LU2A 3C3LA 3K59A 1U25A 3GQCA 2MGZB 1XMQF 3TA0A 4HYKA 1N56A 4ILLA 2WSFC 4F4XA 4I0WA 1ZAWA 3DLBA 4A8YA 1K1SA 3VZHA 5J1EA 2HYIB 2YX1A 1IKYB 3R5AA 2OKQA 3EYZA 4ECRA 2RJZA 2GV1A 2UUTA 1GX5A 2DNLA 2PC6A 3HP6A 3EPGA 4OJHA 5HBMB 4H4MA 1TK0A 5D4OA 2VG7A 6FD1A 3I0SA 5G4DA 3CPWR 1H2UX 4K2XA 2EWHA 3TI0A 4DJBA 1RI7A 3BZQA 1UEUA 3C6TA 1WEXA 3CJ2A 2C3OA 3OR1A 3DOLB 4MKAA 5IS2A 4NLTA 3FFIA 2GQCA 2KTQA 4CT9A 3UNGC 4I4BA 1H6KX 1RP5A 4G6VB 2JVRA 4PQAA 2XC9A 3IA0A 3DI6B 1VQ5S 4LQ9A 4I6AA 1T95A 2L08A 3IAS9 5BYRA 1G6BA 2W9CB 1KVJA 3DOKB 3DRSB 1YRTA 5KFQA 2XMMA 4NLPA 3BGUA 2RU3A 1S9EB 3N5FA 2ZHAA 2RS2A 4JI1F 3IFEA 1Y5NB 3MWBA 2FVSA 1S9FA 4MK9A 3N6NA 1LW0B 2J7WA 3I5CA 2D3UA 1MMNA 4GKKF 5E3AA 4DSKA 3KNAA 4LSLB 2ZOMA 3VAMA 1WF0A 4WFNQ 1SJQA 2ZOFA 1X5SA 6FDRA 1D9DA 2V9WA 5SUHA 2VA3A 1TL1A 2ASDA 1C0UB 3VAKA 1X0PA 2C3MA 5HQ8A 3V6DB 2K8GA 2ROPA 2E1RA 4AYBD 1N48A 4QU6A 2Z2LA 1MWZA 2W8KA 5D3GA 1LK5A 1XWLA 3HK2A 4PPZA 4EZ9A 4IG0A 4IR1A 2LA4A 1U6FA 2RDIA 3PFEA 4QYZJ 4RUAA 3IR6B 3PXGa 1JXLA 4C11B 4RKUC 3IRWP 4A4JA 3BN7A 3UPFA 3WC0A 2XY5A 4OI0A 1RT1B 3TW0A 4O44B 3FGVA 1K1QA 1JLCB 3LANA 2DO4A 2KH9A 3CMAS 2DISA 2E7XA 2VC1A 1QE1A 1TFYA 2XNRA 3O8WA 4K5SA 3Q0AA 1S0MA 1M5PC 3TYTA 5F8GA 4DF4A 2FLNA 4O3RA 4OHYA 2I9SA 4DQPA 3HHLA 2ZKTA 3GR0A 3KK1B 1HBMB 4F4ZA 1Y7PA 4WKYA 3CCJS 2DGOA 2KJVA 1RT3A 3NG8A 2ZNYA 3OL7A 4DQQA 3FMWA 5LJ5Y 1T3NA 1Y5LB 3SXLA 5DDQC 4UW2A 3LP2A 4FN5A 3JSMB 3U02A 5K9FA 3GFZA 4PCQA 1FKPB 2YKNA 2YNGA 3PX6A 2J6UA 1WF2A 2K7KA 4PXDA 5AXKA 3QIDA 5B0EA 2VFUA 2HFOA 4JV5F 1ZBTA 4CTAB 3KG0A 1TKDA 4U6PA 2B6AA 2W7PA 5IT4A 5MLCV 3KLIA 4NRUA 4RZRA 2EFVA 5HROB 1HFEL 1PILA 4C0HA 3VAIA 4DL2A 1HYSB 4ALZA 3FEXB 3IBWA 3DLKB 4DBQA 1BC6A 2GIRA 2OAUA 2IVFB 1VMBA 2XS7A 1E6YA 1HBUB 2GJIA 4MIBA 1WNEA 1WHYA 2F4VF 4LFBF 3MM5A 4Q5VA 3DLGB 3HHDA 5B09A 4A8KA 2QA4G 3K7RA 4NLDA 4QW9A 2DGQA 4A48A 2KI2A 3P96A 2LDYA 2UUWA 1X4AA 1RT7B 1H3DA 2UV8G 2QT7A 2DNHA 3TNVA 3RTVA 2LCWA 2OD6A 3MM8B 4F2SA 3D1QA 4FVMA 2I38A 5KFHA 4RWWA 2O5DA 4WKRA 2DPIA 2OTJS 1SKSA 3KK3B 7FD1A 4ECSA 4K5RA 2RQKA 4PPDA 3E2EA 4DL5A 2IM0A 3C6UA 4OI1A 4TU7A 3MDFA 4OI4A 3J7ZT 1YG0A 5KFZA 1R43A 2BRLA 2ZH3A 2KXHA 2KHCA 4IYQA 2QMWA 4DR2F 2DGVA 2M52A 4PR6A 1ZTTA 2UVVA 2PSZA 3MR6A 3A8EA 4MH8A 5G0RA 2MKHA 3TOQA 5EWGA 2Q66A 2IA6A 2M9KA 5IWAF 1FERA 4MK7A 4NL5A 5DDOC 2BJDA 3M6UA 5F9NA 3OJUA 2I2YA 2LXFA 2B9XA 2J7KA 2IVMA 5HMWA 3NMAA 1CG2A 3GFYA 3J80Y 4F4YA 2QSWA 2BE2B 4N8NA 1UFLA 1NH7A 2OTLS 4IOAQ 1MNEA 3UE2A 4KAIA 4IOCQ 3P3DA 3DRRA 2JHEA 4KC5A 5E3PA 3P5TL 4LIWA 4BBYA 2XEXA 2AJQA 2B0GA 1N5VA 1IKXB 1UKUA 3QJJA 4I6WA 3W2VB 4KO0B 3ZZ0A 1P8GA 4I7FA 3GMGA 2QV6A 3IN5A 1NKBA 1XN9A 1IKWB 2AJ4A 5B08A 3VAHA 1DBDA 3M6VA 4DR4F 2AYMA 1FF2A 3VQSA 4O44A 5CCLA 4O3PA 1FDAA 4KFBA 2EK6A 3TVZA 2F40A 5L39A 5D78A 3CD7A 1FKAF 3UDCA 4Q8FA 4QCLA 3V4IA 4IKAA 3TVYA 3CCUS 4G1PA 2VG6A 4IO1A 1KFSA 3IRXB 2E7WA 2EI5A 4IFYB 4URSA 3HM9A 4YY3F 2V9KA 4C9DA 1JLBB 2C3UA 4USJC 5E3CA 4OX6A 4AE5A 1NKCA 3TAQA 2HQIA 2HPUA 3MXHP 1Q4RA 3VZIA 4DWIA 1X5PA 2W24A 3CTRA 3MM7B 2MQPA 3D1HA 4KQZA 2HS4A 2ZM6F 4B3MF 2F8MA 4X4RA 2J6TA 2QSFA 4ZLPA 2OPQA 2DHGA 4B02A 1X4BA 2DNZA 3I87A 2ILYA 1RTJA 3N4WA 2YWKA 5A0YB 2LXUA 3PW4A 5L1KA 1D8ZA 3CDEA 4O3OA 4DPOA 2KJWA 2DNOA 2AX1A 3GV7B 1JB0C 3GIKA 1YI2S 4ZS6A 4DV3F 1D1UA 4NXMF 2OPSA 2MKJA 2KM8B 3BQ2A 2W7AA 2N4CA 4LVNP 1T3OA 3TQ1A 1SB6A 2EVZA 2EG1A 3BREA 3CEDA 2R8KA 3KLFA 4J9QA 3M9OB 1KN6A 2FDNA 3TAPA 4ZP6A 5F41A 3OLBA 2XGQA 2BQRA 3J81Y 1P1LA 1UETA 3QO9A 1C0TA 5EWFA 1RT7A 5KFMA 2JEGA 2XLIA 5KFBA 4FF4A 2PFFB 2BBEA 3L95X 1TKZA 3MM8A 4OLOA 1K0TA 2VODA 3KYLA 4TU8A 4QZVB 1GXUA 2BM0A 4QR0A 2KXNB 1VJWA 4UOCA 2FGOA 1UA0A 1VQ7S 1R0AA 4QOTA 2QA1A 4QIVA 1NEEA 3H59A 5U47A 4FS2A 1IBKF 4OFZA 3CB4A 4B9MA 1LXNA 1R8BA 3IS9A 3GV8B 3MEEA 1OPIA 1YJ9S 4A8WA 1S1WB 3JB9k 5A8WB 4N76A 1LOUA 5F8HA 2XS5A 2G13A 3QGPA 4O3NA 1HMVB 1J5OA 1WG5A 4WFZA 2AJFE 1RQ0A 3MF5A 3MECB 1XK8A 2N3OA 1FRKA 5KT2A 2HWTA 1I6JA 1FRMA 2BA9A 2CPXA 2FHOB 4LJMA 2V8VA 4NYPA 4O3SA 3I0SB 3NGDA 2JH3A 1JMTA 4DL7A 1S49A 3BDPA 5F3ZA 3KLHB 3ISNC 4HL9A 2F8EX 4X84A 4YHHF 2EFOA 1N5TA 2POKA 1P6TA 2R8IA 1TV6A 5DG8A 5B0FA 3HFKA 5KTQA 2YNIB 2GW8A 2W9BB 1VQPS 3ZZRA 4XDDA 1FEHA 3RW7A 2PEHA 4K0KF 3G4SS 2EFGA 4OI3A 4A8FA 5E3QA 4F2RA 3SDEB 2FJVA 3TX8A 3ZFVA 4