1ZQ3P

Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3'
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zq3P00
3JRGA 1ZKGA 2CUEA 1EF4A 3HOVJ 4JX4A 1OJLA 1Y1VJ 1BW6A 1VF9A 2DMQA 2WAQN 3BG5A 3GTMJ 3JR9A 5IOZA 4MFEA 3ZQGA 3FK7A 1IDZA 4AUXA 1WH7A 2DA5A 3NARA 2VKVA 3HB9A 5E3LA 3BTIA 2LD5A 4MIMA 5EG0B 4M6VA 1BA5A 1OCPA 4JP0A 3VPRA 3QQAA 3S14J 1JTXA 2M0CA 2I10A 1H8AC 4S0HB 2LVSA 3HM5A 4BBRJ 2CQXA 2CUFA 2HXIA 4DYQA 1Z77A 3CQZJ 1ZK8A 1TC3C 2NS7A 4D5FA 4IEJA 4MLOA 2L7MP 1H89C 4DZJA 1G2HA 1LE8A 3PO3J 1H88C 2L0KA 3W6VA 4LOCA 2COBA 5F04A 3G1LA 5F27A 1T56A 2X6OA 1RETA 5FKKA 5F08A 5IOYA 2GLOA 2QF7A 1JKQC 1ORKA 4M3FA 5FLMJ 3D1NI 2HQ5A 3BT9A 1FIAA 4UUSA 1JJ6C 1GV5A 1Z0XA 1HDDC 4XK4A 2NVXJ 4J19A 2NVYJ 5IYBJ 1ZR4A 4DYRA 2YS9A 1W0TA 3RKQA 2Y31A 5GPCA 2L9RA 3WHCA 1ETXA 2DMPA 2JA7J 1QRYA 1IRZA 2HXOA 2DMTA 2LTPA 3G1OA 4IHXA 2VUMJ 1PUFA 3HGGA 4XRMA 2HI3A 3BTJA 1NTCA 2JK3A 2DJNA 3Q0WA 2TCTA 3HOUJ 1T33A 1BW5A 2Y0SN 1O4XA 3IH4A 4B4CA 5C3EJ 4A69C 2CQQA 1JTYA 3S2DJ 1W0UA 2JMWA 3HOXJ 2ME0A 4I76A 2EZLA 1JKPC 2EQRA 3TEDA 2NOGA 2DA6A 2L7FP 1IUFA 2K9QA 2N8GA 2QCOA 4M3BA 1MBJA 1ETOA 4ABZA 1D5YA 1K61A 2HDDA 5IP7J 4QSHA 5M5WJ 3HGYA 3TP0A 2RAEA 4A3CJ 3S16J 5EYRA 3E7LA 1I6HJ 2GM4A 3HKZN 4JX6A 3OSGA 1APLC 2XB5A 4MFDA 2K9SA 2M8GX 4BY1J 1SFOJ 5M5YJ 1OFCX 1RKTA 5GP9A 5IPAA 4B1RA 2ECCA 1TWHJ 5M5XJ 4W97A 2XGEA 3IH2A 2LKXA 1HOMA 4M3EA 3BQZA 3JRDA 2R5YA 3BTLA 1S7EA 5EDNA 4UUTA 1XG1A 3GTQJ 1Y1WJ 3IV5A 2ID6A 3ZOBA 3S1QJ 4W1UA 3FISA 2PMZN 3K7AJ 5JLWA 2M9HA 3BTCA 1BJZA 9ANTA 2DA4A 4D7NA 2FQ4A 3DEWA 3SFIA 3GTOJ 4A93J 3FK6A 4A3EJ 2VI6A 3RZOJ 2NS8A 3HOWJ 3CCYA 1X2NA 1UMQA 5J1RA 2NVQJ 2VPRA 1SANA 1ETWA 3B6CA 2O7OA 1X2MA 4L5EA 5FKLA 4XRSA 5DTDA 2WB1N 4BXXJ 2XB0X 1IV6A 1JT6A 5F0CA 4MO7A 3BR5A 1NK3P 2W48A 3GTKJ 1FTZA 1WI3A 1HLVA 2R0QC 2HOSA 2MW8A 2Y30A 5EG0A 3S1NJ 1B72B 1P7IA 2K9NA 3GTPJ 2EZKA 4Y7NJ 2XRLA 2XPWA 1XC5A 1YRNB 3OIOA 2Y2ZA 3FKIJ 3GBGA 5EGOA 3G1MA 1WH5A 4BBSJ 1MBFA 4GFBA 4IHWA 4NDLA 1ZQ3P 3CDLA 2NVTJ 4JX5A 1MSFC 3M4OJ 2CRGA 3JRAA 1QVTA 4A3LJ 1GVDA 1FIPA 4FTHA 3S17J 4CYCB 3BR0A 3LNQA 2JA6J 2AO9A 3LSGA 5F0HA 1ITYA 3A01A 2H1KA 3O8HA 2LFBA 3GTLJ 4A3MJ 1AU7A 5M3MJ 1ZGWA 1RR7A 2LK2A 1XS9A 2R5YB 5DS9A 2L7ZA 5E3MA 1BL0A 2JA5J 2ELKA 5EZGA 1LFUP 3TW6A 1HCRA 2MSYA 1WGXA 1MH4A 4BY7J 1B8IB 3RQIA 1FEXA 3BR2A 2ME6A 3S1MJ 1MNMC 3ZQIA 3JREA 2R7ZJ 3F0CA 3OOUA 1GDTA 3Q0UA 2O9LA 1P7JA 3IH3A 3K2AA 3BG3A 2GBYA 4BKXA 4EEFG 1E3OC 2EZIA 1Q1VA 5M3FJ 2EH3A 2FJ1A 3HOZJ 2R5ZB 1JJ8C 1UG2A 4QIWN 1FTTA 1JUSA 5C4XJ 1WCMJ 1IJWC 5IP9J 3LSJA 3QPLA 5F0FA 2LP0A 4XRSG 4V2GA 2R5ZA 2YU9J 4X6AJ 4RDUA 2R92J 1GV2A 1R9TJ 1F43A 1U9OA 2P81A 4IHYA 3M3YJ 3BR6A 2DA7A 1JKRC 2D5VA 4DW6A 4FE4A 5FKNA 2KDZA 1LFBA 2E19A 4FCYA 2LR8A 2HOTA 5EF6A 3FIWA 3WHBA 2M34A 2DA3A 3TW7A 2LLKA 4Y52J 2E2IJ 5FKOA 5J1YA 1TWCJ 1U8BA 1IDYA 1F36A 1LE8B 4A3BJ 4M3GA 2K40A 1JUPA 1IGNA 1WPKA 1MH3A 1RPWA 5EEAA 3S1RJ 2B63J 4DZPA 1VNDA 1YRNA 2ID3A 4UUSB 2JWTA 2TRTA 3S2HJ 5C44J 2DA1A 3I4NJ 3Q3SA 3SDGA 5HODA 3HBLA 4AYBN 1MBHA 3ZQFA 3A03A 2CJJA 1POGA 4I6ZA 2KT0A 4M3DA 2E2HJ 3BR3A 3LSPA 2JJ7A 1RESA 2X48A 1AHDP 2VKEA 1QVUA 2JN6A 2YUSA 5JLXA 2OPTA 1FJLA 3JRHA 5K7HA 5IYDJ 4C3JJ 1AKHA 5K7ZA 2IEKA 3TP3A 1B72A 2HOAA 3LSRA 3CMYA 4JYKA 4AC0A 3ZQCA 2XPVA 3PM1A 2DA2A 4XICA 4A3JJ 2IBDA 5BNGA 2Y9ZA 4A3IJ 1TWAJ 4FISA 3L1PA 2Y9YA 3LOCA 2XGCA 1MBEA 1GUUA 1DU0A 1GT0C 1UHSA 2E1OA 2CU7A 3DCFA 2EZHA 5EGOB 1K83J 4CYCA 3JRIA 2JA8J 2OF7A 5J3LA 5K7FA 5FLVA 3MKLA 4G12A 2ZB9A 3BR1A 5E3OA 3Q0VA 1ETYA 3QPSA 2MG4A 1U78A 3H0GJ 1JUMA 3GTJJ 3UKGA 3OSFA 3A02A 4IHVA 3MN2A 5FJ8J 3A01B 3JRFA 1ZR2A 5J1UA 4C2MJ 2DMNA 2O8KA 5EZHA 1QPIA 4C3HJ 3H3VK 1PUFB 3MVPA 4D7MA 1A6IA 5C4JJ 1RKWA 4X1EA 1X58A 3HEFA 3B6AA 3JRBA 1IG7A 2DMUA 2HYJA 4RBOA 2DTZA 2AHQA 2FX0A 3BG9A 1MBKA 3ZQLA 5F1JA 1ETVA 2XGDA 2MGQA 3C2BA 2FD5A 1HDPA 3NAUA 1MBGA 1U9NA 1VI0A 2LY9A 2M2EA 1CQTA 2IAIA 3JRCA 1NK2P 3I4MJ 1OCTC 1ETQA 4D5CA 1DU6A 4A3FJ 2ECBA 1JT0A 3BQYA 2WV1A 4FE7A 5FKMA 1JKOC 1ETKA 2E2JJ 5IP6A 5IYCJ 4XIDA 4HNVA 4A3GJ 3HOYJ 2G0EA 1TWFJ 3SJMA 3ZQHA 2X9DA 1IC8A 2H8RA 4B3AA 2R93J 1AKHB 1I50J 2XSDC 2DN0A 5E3NA 3GTGJ 1B8IA 4A3KJ 3HDDA 1TWGJ 1ZTRA 2EBIA 5GPAA 4QTRA 3O8GA 3RZDJ 4A3DJ 1JGGA 3S15J 2XPUA 1ENHA 1HF0A 4V2FA 1I3QJ 4DYCA 1MSEC 3PO2J 1A5JA 4C3IJ 1VFCA
chains in the Genus database with same CATH superfamily
4RA2A 3JRGA 4B09A 3A1YA 5CVVA 3L9FA 1Z21A 5KK1A 1L0OC 1OJLA 3FF5A 1AOYA 3E5UA 4B47A 1BW6A 3G6EI 4N0BA 5HLIA 4LB6B 1HQCA 2DMQA 4D9JA 5GAGJ 1OISA 2BZTA 2ZXWH 2JVGA 5EEGA 1NG7A 3GYHX 1JHFA 3IKVA 2DA5A 4L9JA 3NARA 4E70A 2VKVA 1LDJA 3SZTA 3FBNB 1ZAOA 3BTIA 5E18F 3LAJA 1TT0A 5LEJA 2ZO4A 5FRMA 3S2WA 2OZ6A 2ZMEB 1JTXA 1A6QA 3H5AA 5H6QA 2JPCA 3QWLA 4BBRJ 4KDPA 1PP8F 1D8JA 5IT9K 3DKXA 1R1VA 1O7LA 5JVTA 1TC3C 4LK1F 2NS7A 3LQQA 5H20A 4P9UA 3CMAI 4NHJA 1G2HA 3H9QA 2VT3A 3WTUC 2L0KA 1STZA 2IS1A 2BGCA 4BDZA 3F9KA 4ZYEA 3G1LA 2X6YA 2QZ8A 1YTYA 4A12A 3NEUA 3RKWA 4AU7A 1J7KA 4RB1A 5FLMJ 3MD2A 4M9SA 3JTGA 3NRVA 1B9NA 1HKSA 1OLTA 2FNPA 3GLXA 1HDDC 1D0ZA 4O6JA 1S29A 4OWRB 2J5PA 3SZGA 4HSTA 1I39A 4ENMA 4XKCA 1WKMA 2PJRA 3RKQA 1OR7A 1HKQA 5GPCA 1UHWA 2P4WA 2L4MA 2EFWA 1TLHB 2JA7J 1E0EA 3I3LA 2DMTA 3PL8A 1V54H 3K4NA 3QPHA 4UY8I 1MMAA 2QQ9A 2GIZA 2Q0OA 5JR3A 1W36D 4Q4ZF 3ZCOA 1Y39A 2FOKA 4YIIA 3I71A 4IHSA 2JK3A 2DJNA 4L0YB 1T33A 3QP6A 4B43A 3IH4A 4AIKA 3CJRB 4LFUA 3S2DJ 4F3QA 2KZVA 1M1EB 2WV0A 4ON0A 4XN0A 3ERMA 1WQ2A 3BCBA 3RTRA 1TP4A 1KONA 1SVOA 4A5NA 4XLPF 4XQFA 2EQRA 4KIBA 1YO5C 2NOGA 2DA6A 3E6CC 1V5EA 1IUFA 1Z67A 2CQ7A 3MFKA 1U3EM 1QZZA 3IHUA 2QCOA 3BOQA 1LEBA 2AQEA 3FXOA 1MDMB 1D5YA 2A07F 2HDDA 5L3BA 2V9KA 2ZFUA 3DU6A 4QSHA 3RPQA 3VWBA 3DLAA 3OYIA 1R1TA 2DCEA 4BQQA 3ZMZA 3E7LA 4E6KG 2GM4A 1IV8A 4JX6A 5HDKA 2NYXA 2XB5A 4G7HF 2K9SA 2VT2A 4UXNA 1G3WA 1ZLKA 4DQ2A 1LQ1A 2H09A 1OFCX 4NC7A 3W6KB 5KAFC 2XGXA 2ZSIB 1RNLA 3ZMVA 2YU3A 2ECCA 3MKWB 5M5XJ 5TRDA 1YJNI 2GXAA 1XPXA 2LKXA 4M3EA 3DPUA 3JRDA 2R5YA 1XDUA 2KFDA 5EDNA 5JFRA 4XNFA 2E34A 2H1LA 4GXOA 5JLWA 2PMZN 3K4BA 3HUGB 1X3ZB 3BTCA 3DEWA 4A93J 3FK6A 4RB2C 5FLXK 4Y3OA 2ZNYA 2Z5UA 1ZRDA 1X2NA 4F91B 3TO9A 2QBYA 2VPRA 3OR1C 1XSXA 3KLNA 4DOZA 5D6EA 4UV9A 3VYSB 4CCKA 1J5YA 2UV1A 2KIFA 3HG9A 3L7WA 4EJWA 2XB0X 2FU4A 4ZC3A 1JT6A 1LVKA 2OQGA 4IOAF 2L7KA 3BZKA 1H9TA 2ICWG 1FOKA 1LDKB 1HBXG 1NK3P 2STTA 2FBKA 3GTKJ 4CHUA 3H5RA 1TTYA 4MQ9F 2R0QC 3OYKA 2HVRA 3H35A 1W5SA 1FBSA 1PVEA 2Y30A 1WJCA 1W1WE 1B1BA 3BP8A 3GLLA 3CUQC 3GTPJ 2F5CA 1EJ9A 2XPWA 1WFXA 2DK8A 4E4HA 1G3SA 2OUMA 3EQLF 3OIOA 1G8XA 2GXBA 5IT9Z 3V8KA 1IN6A 2HU9A 2ESHA 1VQLI 4HF1A 2NVTJ 4IPAA 3JRAA 1QVTA 4U7BA 2L01A 1UHMA 3WG9A 4CYCB 1JI8A 1BI0A 3BR0A 1U5TC 4I01A 2LF8A 2JA2A 1SD5A 2G7UA 1P92A 5D5WB 3ZN1A 5F0HA 1ITYA 1VZ0A 2BY2A 2WTEA 1KYZA 2LFBA 1G3YA 2V1UA 2KRHA 2Z1DA 4A3MJ 2MBFA 3GZ6A 3DWLE 4L9VA 3K69A 3DBRB 3K4MA 4II2A 2L02A 4CZZA 1OCCH 2OJED 1WI9A 3C7JA 5BPIA 1S6LA 4LG0A 2ZXJA 4GYGA 2RQQA 4A0XA 4ZDPA 1FNNA 2WAFA 3FXLA 1U8RA 1WGXA 1QU3A 3K4KA 3ROUA 1XB4A 1Q1HA 5GADJ 1QBJA 2XAUA 1WWXA 3F8BA 1FEXA 1T95A 2L4AA 4U7DA 1QZEA 3VODA 2HFHA 3F6VA 5DCMB 3ZQIA 5F6FA 3WU1B 3U1DA 4EM0B 2DFHA 2DT7B 2P6SA 3Q0UA 2QSFX 4J00A 1K78A 1F1ZA 2GBYA 2XKOA 2RVCA 3IP4B 3WTVC 1WJAA 3TO7A 4WWCA 1DUXC 1W5TA 2R5ZB 2R7VA 3T1BA 1FTTA 1IN4A 4WXCA 5D5VB 2CS3A 3QPLA 3ZMDA 5ICGA 2K3PA 2LP0A 1N25A 5ILVA 2OC6A 1MJAA 4V2GA 3K4JA 3W2VA 2VBWA 3HHHA 1SD4A 5TJJA 2CO5A 1VQOI 2VASA 3MKYB 2A3SA 2R7FA 4IHYA 1BR1A 2DA7A 1FLIA 2KLOA 1R23A 1OYIA 2UUZA 2LY2A 1FMVA 4FE4A 4NQWA 4Q5SF 3CCQI 4CICA 2ADUA 2LR8A 3C2GA 3JSOA 2CV2A 2RN7A 1MNEA 5L3GA 3A0BC 3DKYA 2Q2EB 2DA3A 3I0TA 4DBQA 3N97A 2R7UA 5CVIA 2UZKA 2E2IJ 5J1YA 2AQFA 2ZJRF 3HKZA 4F7ZA 4M3GA 3W2AA 2R7WA 3WE3A 4LMYA 1SFXA 1FOXA 1RPWA 3TDUC 1T0FC 5B66C 5EEAA 2F6CA 3U2RA 2D45A 2QLZA 2JSPA 2OBPA 5HODA 4LD5A 1O3RA 2MC3A 1ZGAA 1R36A 2XF5A 3ZQFA 3A03A 3K70C 1POGA 1P4XA 2OA4A 3K10A 3BR3A 1BI1A 2JJ7A 5B5EC 2VQLA 1VQ5I 1AHDP 2JN6A 4XN3A 4G6QA 3OY9A 1JGSA 3E6DA 3CJQB 3SEQA 1AKHA 1O3QA 2IEKA 3TP3A 3VOEA 1B72A 2EIKH 2HOAA 1FYKA 3GW2A 3PM1A 4MNUA 1A36A 4A3JJ 2IBDA 3CCVI 3CZ6A 1LVAA 3TMOA 4B8XA 2FEZA 2XGCA 3ECOA 1GT0C 1FYLA 3CMMA 3I59B 5LGNA 2GOXB 2K02A 3KE2A 3MAJA 2RV8A 3JRIA 4KMUX 1HW1A 2OF7A 4OIQF 5K7FA 3CCLI 2JA8J 3PQKA 2ZB9A 5HDGA 2XF7A 1XSDA 5E3OA 4BE2A 4PSXA 3CJNA 3HYIA 2LNBA 3GEZA 1HXDA 2MG4A 1CGPA 1U0JA 1T39A 1OCZH 5A2QZ 1JUMA 1YFHA 2GA2A 1WJDA 3OSFA 5E79C 3PUBA 1ACIA 2KIMA 3A01B 1ZR2A 1Z9CA 5EZHA 1QPIA 3HJEA 2HR3A 1W4MA 3QAHA 3VEPA 3MVPA 4PJMA 5CYVA 2K4JA 4S05A 3HSEA 4PUSA 1PJRA 1V4RA 3ESWB 4X1EA 4G7OF 3LSTA 5EEHA 5AIQA 1XN7A 3ZN0A 3BY6A 2AHQA 5ERIA 3ZQLA 2KRCA 3SXYA 3HZJA 3C2BA 2BBYA 2A5WA 2IS6A 1HDPA 3O6BB 1MBGA 2CUJA 1VI0A 3IRQA 3KIOA 1OR7C 4IJAA 2L54A 1J09A 3I4MJ 2VN2A 4Z2YA 4XSXF 2XAQA 1OCTC 3HUGA 2EILH 4D5CA 3S3MA 1KA8A 3EUHC 4A3FJ 4Y4RA 1JT0A 2XHKA 5BOXA 5D4RA 1JKOC 4M73A 2RQPA 3F23A 4E7JA 2D1HA 4HNVA 4RS8A 2W57A 3VSLA 3HOYJ 1L3LA 2J5OA 2QYOA 3BC8A 4IO9F 3SJMA 2CQKA 4UB6C 4XLHA 4ENNA 2DN0A 5E3NA 5HNFA 1D5VA 2P5VA 1YG2A 1SVLA 4G6DA 1TWGJ 2QVOA 3CCSI 4A6DA 3OYAA 4QTRA 3TOBA 3LQRA 3RZDJ 4D1QA 1JGGA 4XONA 1ENHA 3RIRA 1OCRH 4BGDA 1MSEC 2BW3B 2P0WA 1VFCA 4EGZA 1D8KA 2IGOA 1DDNA 2XVCA 5DEQA 1WHUA 1YS6A 3CCRI 5E20A 1Y1VJ 1OCOH 1VF9A 1P4AA 1X1PA 3DTKA 4OIPF 3GTMJ 1IN5A 2BVMA 3WG7H 4BU2A 1REPC 4MFEA 1H9GA 3ZQGA 1E17A 3HPHA 4AUXA 1Z05A 5E3LA 3GF2A 1BJAA 3MCZA 2AXTC 2CWEA 3BJAA 4YELA 1P2FA 3P9IA 3GFJA 3DV8A 4EM2A 3H9GA 1FY7A 3ABLH 3DEUA 4JP0A 3QQAA 4BNCA 2XC7A 2I10A 3U9GA 1O7FA 2KQRA 3ZMTA 4HSRA 2CQXA 2CUFA 2HXIA 5GAHJ 3CQZJ 1K7AA 4IX7A 4D5FA 4ZTFA 2EFOA 3F6OA 2R7XA 3K4CA 3ECHA 4DZJA 1HSTA 2NNYA 3PO3J 1UFMA 2H8WA 3RI4A 4BL0B 1T56A 2X6OA 5CLSA 1SAUA 3OYLA 3C3WA 2HQ5A 2Z99A 4UUSA 1JJ6C 1JXSA 3CP2A 2NVXJ 2LRDA 4BHBA 1D1AA 2NVYJ 2E1NA 4JQFA 4Y17A 5GTHC 2ZNZA 4BQNA 5FROA 4DYRA 4HOBA 3BZCA 4GCVA 4N4OB 1W0TA 2K7LA 3BZ6A 3M1CA 5LGTA 2NVUB 1ETXA 1FC3A 2R7OA 4FX4A 1QRYA 4XMYA 4LIUA 3JAMK 3LAPA 4AIJA 1SFUA 3BPVA 3J80Z 1A31A 2KIUA 2M7AA 1FP1D 2LKPA 2X6WA 1A35A 3ZXSA 3OWTA 1PUFA 3OYBA 2HI3A 4RLFA 1YS7A 4M6YA 3V42A 3AFHA 1NTCA 3K6GA 1VQ7I 2CW8A 2QSGX 3Q0WA 3HOUJ 2TCTA 1XMAA 2HTSA 2OZUA 1O4XA 1ZG3A 2CQQA 2VQGA 3CUQB 2JMWA 4XLAA 2EK5A 5IY5H 4DNCA 4ZYGA 1YX3A 5FD6A 3MZYA 2MD0A 1YE9A 2BY3A 3PUFA 3TEDA 2DDBA 2WY8Q 2L7FP 4XORA 5B1AH 2K9QA 4FHTA 3SQNA 2LBFA 3CLOA 4CDGA 4KT5C 4M3BA 4PFPA 1IN7A 3R60A 3VB2A 1R49A 1ETOA 4RGXA 1Z91A 4MTDA 2QKLB 2ESNA 3PNTA 2A6TA 1Y8QB 4G9YA 3TP0A 5EJCA 3QYFA 1GXQA 5TISC 4LJZF 2O03A 3HOSA 2V79A 4E7ZA 1I6HJ 1OQYA 4BXUA 2VOPA 4HPQA 1APLC 4MFDA 4NC6A 1K79A 1F5TA 2M8GX 2DT6A 1R4MB 1R6RA 1QHHD 1LJ9A 1SVMA 2EV6A 2RDPA 3BJ6A 4HV6A 2ZFWA 4L9NA 2L9NA 4M9XA 1TBXA 1TWHJ 2LREA 4W97A 3CUOA 2XGEA 1D0YA 3RPUD 5B3SH 1WSUA 4YFNF 2KP6A 2EWNA 1IXSB 2CSOA 3CLQA 4UUTA 4ESBA 2VBYA 3UNGC 4HF2A 5FRNA 3S1QJ 4W1UA 3K7AJ 4WXDA 3J7YJ 4DIQA 2DA4A 4D7NA 2DXIA 4M71A 1U5TA 1YLFA 2VI6A 4E7HA 1SD7A 2NS8A 3RDIA 5HLHA 3HOWJ 5ICFA 3K1MA 3ZRGA 1W5CC 2JZYA 2MH2A 3DTIA 1HC8A 2CG4A 4A0YA 3B6CA 2O7OA 3BJOA 2LSOA 2QKMB 3RCOA 4XRSA 5DTDA 3GWZA 5GTIC 4BXXJ 2VE8A 3AL0C 3IUOA 3H92A 2DBBA 2YX7A 1W7PA 3V4GA 4UNOA 2W48A 2A6EF 2K9LA 3HSFA 5CVRA 2V1DA 2W25A 2W7NA 3ABUA 3HTSB 1IRFA 5EG0A 1B72B 3BG6A 4I09A 1V3FA 3OL4A 4BEHA 5HOOA 1XC5A 1YRNB 2FA5A 3FKIJ 3L2VA 2PMUA 1RIOH 1IAWA 1R1UA 1S9HA 1XGOA 3KYLA 4NB5A 4ENKA 6PAXA 4II3A 3CDLA 3WTTC 4OU0A 1E3HA 1G4DA 2VL8A 3OYDA 1MSFC 4AWXB 4OIRF 1Z7LA 2QSHX 1GVDA 3L2QA 2IA1A 4HDVA 3G3ZA 2M0MA 3HRSA 1QHGA 3FXRA 3E1SA 1B9MA 2AO9A 3FHNA 3EYYA 3I55I 2ETHA 4N9HA 4NC8A 4CCNA 1HKTA 2BXYA 5M3MJ 1ZGWA 1OYYA 2FNAA 2E60A 1FSEA 4B44A 1IZ1A 1YOVB 4EJOA 2L7ZA 2Z9OA 2V1XA 3AKZA 3VFZA 2ELKA 5K5OA 1DP3A 5HS9A 4IRHA 3TW6A 1HCRA 3KYCB 3B02A 2HQRA 5J4YA 4HQEA 4UVCA 3O2PE 4EJTA 1UZCA 4KICA 4XOTA 4BY7J 1S5LC 5LHHA 1J9IA 3RQIA 2EFPA 3R0AA 4P1WA 2BVLA 3CMEI 2ZMEC 2H6CA 4CO8A 1XX5A 2CFXA 3S1MJ 1MNMC 3HRTA 1TL8A 2K27A 3H9JA 2HQAA 3OOUA 1LNWA 1T6SA 2PBIA 3FXQA 1S8NA 2VQCA 1K6OA 2QWWA 3SEZA 4BAYA 4IL6C 2CQNA 1UELB 4EEFG 1E3OC 2EZIA 2F5EA 4QWQA 2HKXA 3M8FA 2OTJI 2E5ZA 2FJ1A 3K4LA 3K9TA 4PJJA 3DPTA 1OMIA 3TKYA 1WCMJ 3LSJA 1BR4A 3A0HC 4IQ4A 3QRFF 2LYCA 4AIDA 3LSKA 1TQMA 2M7BA 1Y8RB 1IN8A 2AXLA 2CYYA 2R5ZA 2YU9J 2G9WA 4E7IA 5L3CA 1F43A 4XKBA 2HKOA 2P81A 3M3YJ 1D1CA 2FMYA 1GLNA 2IPQX 3LA7A 3OV8A 3P9CA 1VTNC 2BV6A 4GGGA 4DW6A 3FWEA 4RM2A 2W82A 1W7PD 2JRMA 3Q9VA 2HOTA 3K0LA 5JHUA 2E1MC 2OAZA 2QQ8A 3DBLB 2WWYA 4AIHA 4WX9A 2M34A 2CUZA 3SDBA 1WJEA 3TW7A 2VKHA 3FZVA 4HEA2 5DDGA 2HQNA 1FOWA 5CVUA 2W24A 3M8JA 4KIGA 4Y52J 1R7JA 5FKOA 1IDYA 1F36A 3U1KA 2K40A 1X4OA 5KCMA 3T8TA 1R5HA 4BEHB 2B9SA 2Y0SA 2DPDA 3S1RJ 2K85A 3DQVC 1YRNA 1VNDA 3PFYA 5K5QA 4I2OA 4UUSB 4KITB 1B4AA 1MZBA 2JWTA 3OOPA 2TRTA 5CQEA 2GXGA 3I4NJ 3Q3SA 3SDGA 1T98A 1TW3A 2HZDA 4H0EA 2M30A 1Z3XA 4IRGA 1HW2A 3FM5A 4ANJA 1DGRM 1IRXA 2OQRA 2BY0A 2CJJA 3GFLA 2KPMA 4I6ZA 2KT0A 4L0ZB 3LSPA 3CCUI 2GWRA 3E5XA 3BDDA 4MEXF 2VKEA 2JTVA 1FJLA 4HYEA 3JRHA 5K7HA 5IYDJ 4C3JJ 5K7ZA 4FASD 2F48A 3ZQ7A 1X1CA 4UV8A 4JYKA 3ZQCA 3FBIB 5KNLA 3EPZA 3I59A 5IT3A 5J6XA 2DODA 3M9AA 1X1BA 1TWAJ 4PK4A 2Y9YA 3LOCA 3RYPA 1MBEA 1ZHFA 1GUUA 1DU0A 2EV5A 3W2WA 1I27A 2CW7A 2E1OA 2LOOA 2IP2A 3JAMZ 3DEEA 1SMYF 1R5GA 2D2WA 4LITA 4CGZA 5FLVA 3KCCA 2K3FA 2F5DA 4L9TA 3QPSA 3HIFA 2H6BA 3GVAA 3V8LA 2HVSA 1QNTA 1FX7A 1B59A 5D8LB 3MN2A 3WTXC 3S3NA 2O8KA 1LDDA 4C2MJ 5LHGA 4UUVA 3ZGKA 3MWMA 1D0XA 4C3HJ 4B48A 1PUFB 2HYFA 3MMYB 1G3TA 4OOIA 4D7MA 1E3PA 5F1RA 2EIJH 2HEOA 1X58A 3HEFA 3JRBA 2IRFG 3QODA 4MHGA 1USTA 2DMUA 1VQ8I 2OCEA 2Z2SB 3LFKA 3H3ZA 1ETVA 2XGDA 2R7SA 3F72A 2VQHA 4AD9A 2IA2A 1TZLA 2LY9A 1CQTA 3JRCA 3HRUA 1XCVA 1OPCA 3PSFA 4C2UA 1ZRFA 3TOAA 1DU6A 2HWVA 4I0BA 3C18A 2XKPA 4X0GA 1SD6A 3F8CA 2FOWA 3CO6C 2WV1A 3VSKA 3H0DA 4FE7A 2DPUA 1ETKA 4RAFA 4CCOA 4Z6YA 1BI2A 4I0AA 5IYCJ 4XIDA 4H4KC 2IVMA 2F4MB 4A3GJ 1HW5A 2W84A 4UVAA 4LLLA 4IHTA 2IGKA 1MMSA 1RC9A 2X9DA 1F4KA 3HHGA 4B3AA 3CESA 5LRRA 2R93J 2MH9A 3GTGJ 3SFZA 1UAAA 1KU2A 2AS5F 2EBIA 5GPAA 2ELHA 3GFMA 4QPOA 4V2FA 2W85A 3P9KA 4F93B 3WGHA 2MD5A 2VONA 1A5JA 1KZHA 4C3IJ 1QZYA 2DAOA 1TW2A 1ZKGA 3LA3A 1EF4A 4OAYA 3E5QA 4GYIA 1RUOA 3EUKL 1MMDA 3EDPA 1DP7P 4BQAA 2BHYA 4CCLA 1J2XA 3BG5A 2CV0A 4HLXA 3JR9A 1IXRC 5IOZA 3BLYA 2QQAA 4KA4A 3FK7A 1W7PB 1GXPA 1WH7A 1I3AA 2LH9A 3R4KA 5ILSA 2QQBA 1RZ4A 3B73A 4XKWA 4YEJA 2I8DA 3LSHA 3HC7A 5EG0B 2ZXIA 4EV0A 1ZGJA 3D0SA 3DBHB 4M6VA 3COAC 2CV1A 3EUHA 3GFIA 2NNNA 2PMZA 1DGWY 2PN6A 3AG2H 2LC2A 2M0CA 1Z3YA 2A61A 1H8AC 2VOOA 4YIRX 4AYBA 4ZH4F 2DOEA 2Z33A 1ZK8A 5LHIA 1OYWA 2IS2A 1W36C 4IEJA 4MLOA 4E7LA 2GOMA 3TDZC 2L7MP 4XLFA 1H89C 2MLGA 1TQPA 3WGGA 3T5XA 1GVJA 2COBA 3ZR8X 2VODA 5FKKA 3VYRB 1SFEA 3T8RA 2GLOA 5F08A 2XAFA 3BPXA 5CJ9A 3RQ4A 1JKQC 1ORKA 4M3FA 4M72A 3BT9A 1ULYA 3GO5A 1Z0XA 4XK4A 3KP3A 4C2TA 1EV7A 4LGWA 3IRRA 3DXJF 4ESJA 3FXJA 1AA7A 2R7TA 1HSJA 2L9RA 2DMPA 4I7HA 1WJBA 2Z16A 3F8MA 4LB5A 1IRZA 1MNDA 2DU9A 1BM9A 2GA1A 2E5NA 4N4NB 5JI6A 2WBMA 1S7AA 1MW7A 3HGGA 3K2ZA 4BJ6C 4XRMA 4P9FA 3L2RA 4EVIA 1V5FA 3OIQA 2VC1A 3KYDB 1VQKI 1T2KA 4IKFA 2KISA 4B4CA 4A69C 1KU3A 2E7XA 3FDYA 5C3EJ 2VXZA 3JW4A 4KN4X 3KEYA 3G73A 4QPQA 1DPRA 3LA2A 1LB2A 2EZLA 5FFZA 2K4BA 2ZJQF 5ED4A 1JKPC 2VKDA 1VQ4I 4HLYA 4BUPA 2M8EA 3MEXA 4EQQA 5AIPA 2Z3YA 4U0YA 4ABZA 2FBIA 4LG0B 1Z1DA 3ABKH 2DQRA 3CUQA 3CTAA 4CUGA 1X3WB 1YW9A 2BOLA 2RAEA 2JPBA 4PGGA 5LFAA 3S16J 2DOFA 5EYRA 1KGSA 3HKZN 4KYWA 2QM3A 3OSGA 2CW0F 3KZZA 1D3YA 1EA3A 4OAZA 2IT0A 4GDFA 2DK5A 1ZELA 4XRFA 3A4CA 1SFOJ 1K4SA 5M5YJ 1RKTA 1RRJA 1IF1A 4MTEA 2KHMA 1VQ6I 1FSHA 3I5UA 2XROA 3BTLA 2XF6A 3I64A 4BH9A 4HV5A 3GTQJ 2OCCH 2V6CA 3PJRA 3GCMA 4YFXF 2RREA 2KKOA 9ANTA 2IA0A 2MFZA 2FQ4A 2DDAA 3SFIA 2O0YA 3KX2A 3RZOJ 1X1DA 2M87A 2PMHA 3AL0B 3Q9SA 5J1RA 2NVQJ 1XGNA 4HW0A 1CF7B 4AVZA 2ZJPF 3L2WA 3RSNA 3PQJA 3PNVA 2VPLA 1Y0NA 4HZFA 2A68F 2FSWA 2HDWA 5F0CA 3GX4X 1Z6RA 1ZRCA 2XAJA 4MO7A 1YIJI 1BOBA 1N75A 3H5NA 3R0JA 3F8FA 3W3CA 2JVHA 1WI3A 2RKHA 4ZZLA 1HLVA 2HOSA 4HNUA 1BIAA 2PFBA 5ILUA 2K9NA 4NNJA 3IC7A 3FM3A 4HBLA 4Y7NJ 2XRLA 2L9SA 2VC0A 4IXAA 1FWZA 3CDHA 3KFWX 3R61A 2WB1A 5D8KB 2R4GA 2YSRA 5DM6F 2Q1ZB 3K70D 1T0FA 1WH5A 3RYRA 4BBSJ 4GFBA 2B7EA 4IHWA 5GAEJ 2X6XA 1ZQ3P 3HRMA 4JX5A 1ZG1A 3M4OJ 4F55A 2CRGA 4XLEA 3NQOA 2VJJA 1FIPA 4FTHA 4BE0A 3WGIA 3LNQA 1QGPA 4F92B 1J75A 2H1KA 1BIBA 2EFNA 3VYUB 2Y75A 3GTLJ 3RPUA 3KLOA 3OL3A 3NWSA 5FFXA 4RAGA 3FKJA 2LK2A 1XS9A 2R5YB 1R00A 2V4JC 5BMZA 1BL0A 4PJ0C 5FB2A 3CF5F 5EZGA 2LMDA 2MSYA 3KZIC 4ZJZA 2FQ3A 4CXFA 4M9ZA 5K1YA 4PGHA 1B8IB 3GZNB 3KP5A 4KUMA 3F3XA 2B0LA 3BR2A 4Q48A 1WVRA 3KP6A 5LRSA 5FO5A 1DPUA 2R7ZJ 2R3SA 1T08B 2O9LA 2ZSHB 5BPDA 1P7JA 4BHPA 3IH3A 2DQLA 5KAIC 4BKXA 2ISYA 3ASNH 3MZ8A 5FLXZ 1Q1VA 1YJ9I 5M3FJ 2EH3A 2QUFA 1K4TA 1SC7A 3HOZJ 3GMEA 3U21A 1UG2A 3GZ5A 4QIWN 4QLCU 2MABA 2DYSH 3HXLA 1PUEE 3HSRA 5F0FA 4DGWB 2FRHA 2HZTA 4C9YA 4U88A 2F5FA 2UXNA 2XRNA 4BHCA 3DFGA 4X6AJ 3JTHA 4RDUA 2R92J 4L5IA 3REOA 1JHHA 1FMWA 3CP8A 5CKTA 1R9TJ 3BR6A 3CC4I 5E1XA 2NAZA 3E6MA 2DW4A 4GO1A 2D5VA 2VLAA 3D5SC 3OS2A 2OTLI 1WRJA 2F4IA 4HG2A 5J8FA 2WC2A 3QPTA 4XR6A 2NOJB 4XOPA 2ZC2A 1KQ8A 3MQ0A 2JUCA 4KN7X 4G6TB 3FIWA 3FHZA 3I58A 3N4MA 2F4OB 2VE9A 1MJBA 1X1AA 3IKTA 2ZJ2A 2HOEA 2E36A 5L3EA 2BXZA 1TWCJ 2XAHA 4G7ZF 1U8BA 4A3BJ 4UB8C 3M7GA 2OU2A 4BJTA 1JUPA 3QU6A 1VQMI 4RLQA 1EKEA 1MH3A 3ML6A 2P5KA 5FD5A 2B63J 4MEYF 4DZPA 2P6TA 1PP7U 2PI0A 2JRTA 3S2HJ 2DA1A 2EA2A 1XDSA 2VBZA 2Y69H 3SHFA 3CC2I 2PJRB 3HBLA 1FBUA 4YIFA 4AYBN 1MBHA 3FXMA 4EGYA 1MIJA 2CMPA 4BXFA 1ONVA 1IXCA 2DFIA 2L2OA 3KP4A 2EIMH 3I53A 3OYEA 4NQWB 5JLXA 3RKXA 3OYHA 2Q8KA 4CCMA 2HPMA 1J59A 2XDVA 3DPLC 2XPVA 3F21A 2DA2A 4ZZDA 4XICA 2Y9ZA 1NH3A 4U87A 1UB9A 2L5QA 3I54A 4HA8A 2HGCA 4XLCA 5LLQA 1UHSA 2MA3A 2BW3A 2CU7A 2E7WA 2P8TA 4ZYDA 2EZHA 5EGOB 2OV7A 1K83J 1PDNC 3E6BA 2EPFA 4AVPA 2KJCA 3PIPF 5J3LA 3MKLA 2BY1A 4KT6A 2BEOA 3BR1A 5ICCA 1ZLJA 4IQJA 4BDYA 2E1MB 4IVNA 2M1BA 3Q0VA 1YHQI 1YQAA 1I5ZA 1U78A 1FOYA 2VBXA 3ELKA 1N77A 3GTJJ 3UKGA 3A02A 2WAEA 4PCQA 5FJ8J 3KETA 3JRFA 2W00A 4RAZA 5ICEA 3ZQQA 4V19K 2LKSA 1YX5A 2ZKZA 4R8HA 5HS7A 1BI3A 3R6SA 1D1BA 2COMA 3DU5A 1MMNA 1RKWA 2NXNB 2O3FA 3H36A 3H1CA 3KEOA 2ZCWA 2H94A 2HYJA 5DCFA 3HTUA 3W6JB 3BG9A 1MBKA 5F1JA 2GQQA 1E2XA 1P9QC 2FD5A 1ZG5A 1NHAA 1U9NA 1UCRA 2M2EA 2IJLA 3E3VA 5CVJA 2IAIA 2STWA 2LY1A 3PFIA 1G59A 4WK8F 1SMTA 3IAS2 4KNYA 1ETQA 5J47A 3S32A 4HX4A 5DD4A 4UHTA 4Y33A 5JHFA 2O8XA 1MDMA 2MYSA 2DYRH 2WADA 2WAQA 3QU3A 1XGMA 3V7CA 2GIVA 2BYVE 2HYGD 4KIFA 2JQ7A 5DYMA 3CDIA 2G0EA 2MC4A 1TWFJ 2HVQA 4JOMA 2RNJA 3CD6I 5HLTA 2HTJA 3LWFA 2IGMA 1XTAA 3ZQHA 1IC8A 2YX4A 2H8RA 2V26A 5KVRA 1AWCA 1AKHB 1I50J 4J01A 5E1ZB 4RGUA 4A3KJ 3HDDA 1USSA 2ELJA 2IGNA 2FE3A 3PNYA 1MKMA 4D0PA 1RI7A 4OMYA 2XPUA 3S15J 5HNHA 3ONQA 4I98B 1HF0A 1V55H 4TV7A 3QYEA 2DO7A 4CYDA 3J81K 2NS0A 1KYWA 4P5OA 5E17F 2CUEA 4IOCF 3HOVJ 4FETA 1I6XA 4L18B 3J7AY 4R79A 4JX4A 2K5CA 2NRAC 2V1NA 5HVQC 2WAQN 4KISA 3WODF 3TO6A 3CCJI 1IDZA 1U2WA 1LKXA 4HNTA 4ENJA 3HB9A 4PJNA 3AG4H 3MZHA 3MKZA 2LD5A 4MIMA 2KIQA 1YI2I 1ZREA 3OS1A 2GZWA 1BA5A 1OCPA 3OYJA 2KL4A 5DUKA 3VPRA 3S14J 2W4SA 4S0HB 2LVSA 3HM5A 3LSMA 3OMYA 4A0ZA 4BACA 4WF2A 4DYQA 4IRIA 1XD7A 1Z77A 2Y0MA 1SAXA 4ESFA 3M8EA 5E8GA 3V8JA 4HX7A 4KJZA 2RGVA 5J8CA 3ABTA 4ZTJA 4PZJA 1LE8A 1S72I 1H88C 2PLYA 2E35A 4LOCA 3W6VA 3D5LA 3GXOA 4Y15A 1FPQA 3ASOH 5F04A 1ODDA 3TQNA 5IOYA 5F27A 1QQIA 3IWFA 1RETA 4PJLA 3CCEI 1MMGA 4IZZA 1I1GA 2QF7A 3BROA 3J7ZI 4Q47A 2DT5A 3D1NI 2VJ4A 1FIAA 3K1PA 4AM3A 1RUNA 3S3OA 2KDOA 5J40A 1GV5A 4JK1X 2E71A 2C6YA 4J19A 4UVBA 2R7RA 5FGMA 5J4VA 3FMRA 2XUBA 4XM3A 2LBFB 5IYBJ 1ZR4A 2A05A 3M07A 2YS9A 2VIXA 3FXKA 1VQNI 1LUJB 2Y31A 5DM7F 2K9MA 2X0LA 3WHCA 3OYCA 2HPIA 3IWZA 1HA8A 2HXOA 1N78A 3JSPA 3DKWA 2JSCA 2LTPA 4U0WA 3TL4X 3G1OA 2H27A 1ON1A 4IHXA 5HLGA 4ASNA 2VUMJ 3KEQA 2X51A 3GUDA 3BTJA 4N9IA 1Z7UA 2IS4A 5LEKA 1LEAA 1BW5A 2Y0SN 2LF7A 1FYMA 1IUYA 2X1EA 1JTYA 1O3TA 2HDCA 1W0UA 1TNSA 3HOXJ 2ME0A 4I76A 4GRIA 1QA6A 4RGSA 3WU0A 2UXXA 4HDUA 4XBFA 2N8GA 3OR2C 3G71I 1MBJA 3WTSC 4CSWA 1K78B 1K61A 3OIPA 4BJ5C 1SEUA 5AONA 4ZDLA 5IP7J 5M5WJ 4RMNA 3HGYA 4HX8A 5BS6A 4A3CJ 1KQ0A 3OYMA 2IXSA 1XMXA 2M4KA 4BY1J 2ISZA 1J0RA 3OYFA 1ZYRF 3N05A 1MD0A 3CJTB 1P6RA 2M4GA 2O5RA 5GP9A 5IPAA 3A2KA 2I5UA 1UG0A 4B1RA 3V7SA 2XIGA 4OMZA 1X4PA 3IH2A 1HOMA 2ZXHA 1R58A 3BQZA 4BS9A 3HL2A 3G4SI 2V6EA 1EH6A 1S7EA 1CF7A 4WXHA 1XG1A 2A5YB 2V9VA 1Y1WJ 3IV5A 2ID6A 3ZOBA 1S3JA 2FF4A 1Y0UA 3FISA 4M74A 2M9HA 3E97A 3L09A 4MQVA 1BJZA 3GTOJ 2CH0A 3AG1H 4A3EJ 1UJ8A 4ZYHA 1I1SA 3CCYA 4O3MA 3RKYA 1UMQA 4FQGA 1SANA 1ETWA 1X2MA 2DLLA 4A6EA 4L5EA 5FKLA 3UR3C 3BCAA 3S8PA 4LLNA 2PEXA 4RB3C 3DP7A 3FMSA 2VJ5A 2WB1N 4IF4A 2L3DA 3ZPLA 1IV6A 5F64A 4ZDOA 2VXDA 3K1NA 4HRIA 1YJWI 1X19A 4MGRA 3LSIA 3EYIA 4E7SA 5HS8A 4P96A 2QEXI 1MGTA 2XSJC 2EFQA 3BR5A 2ZBKA 2D1VA 1FTZA 4EM1A 4EATA 3ZMSA 3ZMUA 2MW8A 3L00A 3C2HA 3S1NJ 1P7IA 2IW5A 2CGPA 2EZKA 2VJIA 3LL7A 4K2EA 1C0WA 5DD8A 2K86A 2XV4S 2EINH 4RB0A 3J7AO 2Y2ZA 2BE5F 2Y48A 3I9V2 2PJPA 4L5JA 1LPQA 2M3AA 2DFFA 1Y56A 3GBGA 1T38A 5EGOA 3G1MA 2FUG2 1MBFA 2TDXA 3EETA 4NDLA 1FT9A 4WCGA 3NWTA 3T0YA 3QOPA 3E0JB 2DI3A 3WE2A 4YFKF 2YPRA 3Q5FA 2BHZA 1FZPB 2QA4I 2G7HA 4OIOF 4A3LJ 1IRGA 2YR2A 3S17J 3I4PA 1WZ2A 3DF8A 2DOAA 3PSIA 5LD2C 2JA6J 3LSGA 1WJ5A 3A01A 3O8HA 2WA0A 5D6FA 4ETSA 4EJUA 1R71A 2UWMA 1AU7A 1R4NB 3KP7A 3CF2A 3CO7C 2E1CA 1RR7A 2HS5A 4O5VA 5D5XB 5DCMA 4NBQA 5DS9A 5E3MA 4ZYAA 3JCUC 2JA5J 1XSVA 4FT8A 2VB6A 5CQGA 3VDXA 4DJAA 2X4HA 1LFUP 5E1WA 2PX9A 3L2CA 3C1DA 1MH4A 1SFKA 3F8NA 4CH7A 4LIVA 1XCBA 3OYNA 4U0VA 2MLKA 1PYVA 2ME6A 3IL2A 1BN5A 4HQMA 3JREA 1O57A 3F0CA 2P7VB 1GDTA 2LDUA 3ISPA 4M6XA 1H0MA 3J81Z 3K2AA 3BG3A 4Y13A 2P7CB 3F22A 3KZYA 5A2QK 1YIOA 4RM3A 1XGSA 3FMQA 4RGRA 2KMUA 1YITI 1R5ID 2OD5A 1JJ8C 1FBQA 1JUSA 3LFUA 5C4XJ 1IJWC 2M45A 5IP9J 3OS0A 1Y6IA 4BQOA 4KFCA 1X3UA 4XRSG 3LMMA 3WU2C 4BE1A 1MJ9A 1K6YA 1GV2A 1U9OA 1S7OA 5L3FA 5H6RA 1JKRC 4KMFA 2V7FA 3HPGA 5FKNA 2KDZA 4LK0F 1LFBA 2M5WA 3OYGA 1YW7A 2E19A 2JT1A 2PQ8A 4FCYA 3DLLF 1IW7F 1WJFA 3CC7I 4R1HA 5EF6A 2A69F 2R7DA 4EMSA 2P5LC 1R22A 4A2UA 3AAFA 3EUAA 3WHBA 1A04A 2EA4A 1TNTA 3P7NA 2LLKA 2KRFA 1LE8B 1ON2A 2QGUA 2GAUA 1TT5B 1FP2A 1TQIA 1QPMA 5TGTA 1IGNA 1GHCA 1WPKA 4JBAA 2PG4A 2ID3A 3G2BA 2QBYB 2Q2EA 5C44J 1BC7C 1LFPA 3ERED 1KU7A 3L2UA 1NG6A 1OKRA 2XAGA 1QO0D 3QP5A 1KQ9A 2FBHA 2O61A 5HDNA 4HF0A 2EJRA 4CZCA 4M3DA 2E2HJ 4OINF 1YYVA 1RESA 2X48A 1QVUA 3SYTA 2YUSA 2W1OA 1BOAA 2OPTA 1RR8C 3WTZA 3P5JA 1YW8A 4A5MA 3QYBA 2CFOA 4G8XA 3LSRA 3IAM2 2HNHA 4AC0A 3CMYA 4C30A 4XL9A 2JUGA 5BNGA 4F52A 3I56I 5D5UB 3O3KA 2A6HF 1G6NA 4A3IJ 4FISA 1T8IA 3L1PA 3HOTA 5LGUA 1EH7A 2QENA 3DCFA 4DBRA 2X1CA 3RJPA 2F2EA 4LLGF 5D4SA 4B3XA 4CYCA 5L3DA 4XSZF 5JVGF 4RAYA 4G12A 3AG3H 2X1DA 1VQ9I 5KHDA 3CCMI 1VQPI 3BG7A 5B1BH 1ETYA 4S04A 4ITVA 5CPRB 1V5GA 2X85A 4G94A 3H0GJ 3VYTB 1ERDA 1Z6TA 4YG2F 5E8IA 3KP2A 3FXUA 4NUBA 4IHVA 4P55A 4PSWA 5J1UA 3WTWC 2DMNA 2O6GE 5DUIA 3ULQB 3H3VK 5LBQA 1O3SA 3TBIA 3V7RA 4HAMA 2R7QA 1DQUA 2ACJA 1A6IA 5C4JJ 1B6AA 4PFOA 1BC8C 3B6AA 3H3UA 1XMKA 1IG7A 2RC4A 1KU9A 2L9VA 4RBOA 3DTEA 4XKVA 2DTZA 3ABMH 2FX0A 4I99C 2MGQA 3WTYC 1EH8A 3NAUA 2DTRA 3SZPA 1NK2P 5BQTA 3TGNA 2KZGA 3M1EA 2DJIA 1IO2A 2XASA 3J80K 1U6GA 2ECBA 4LG3A 4BYYA 3BQYA 4CA0A 4CCJA 3QOEA 3X2QH 5FKMA 4XLNF 1ZARA 2DFEA 2FMLA 5IP6A 2E2JJ 4PDKA 1ZN2A 1F9NA 4FX0A 5DV5A 5H2FC 4YRVA 3PIOF 1P4WA 1BBYA 2F5VA 5K5RA 3ZP5A 4E7KA 3KPHA 2XSDC 2V9PA 1JE8A 2ZMEA 2FXAA 1B8IA 2LG4A 3BWGA 1BR2A 1ZTRA 2WY7Q 1ZH5A 4A3DJ 3O8GA 2EV0A 3FX3A 3D5RC 1U5TB 1I3QJ 4DYCA 2KJBA 2EB7A 2RNGA 3PO2J 4EJVA 4I02A 3S93A
chains in the Genus database with same CATH topology
3JRGA 1ZKGA 2CUEA 1EF4A 3HOVJ 4JX4A 1OJLA 1Y1VJ 1BW6A 1VF9A 2DMQA 2WAQN 3BG5A 3GTMJ 3JR9A 5IOZA 4MFEA 3ZQGA 3FK7A 1IDZA 4AUXA 1WH7A 2DA5A 3NARA 2VKVA 3HB9A 5E3LA 3BTIA 2LD5A 4MIMA 5EG0B 4M6VA 1BA5A 1OCPA 4JP0A 3VPRA 3QQAA 3S14J 1JTXA 2M0CA 2I10A 1H8AC 4S0HB 2LVSA 3HM5A 4BBRJ 2CQXA 2CUFA 2HXIA 4DYQA 1Z77A 3CQZJ 1ZK8A 1TC3C 2NS7A 4D5FA 4IEJA 4MLOA 2L7MP 1H89C 4DZJA 1G2HA 1LE8A 3PO3J 1H88C 2L0KA 3W6VA 4LOCA 2COBA 5F04A 3G1LA 5F27A 1T56A 2X6OA 1RETA 5FKKA 5F08A 5IOYA 2GLOA 2QF7A 1JKQC 1ORKA 4M3FA 5FLMJ 3D1NI 2HQ5A 3BT9A 1FIAA 4UUSA 1JJ6C 1GV5A 1Z0XA 1HDDC 4XK4A 2NVXJ 4J19A 2NVYJ 5IYBJ 1ZR4A 4DYRA 2YS9A 1W0TA 3RKQA 2Y31A 5GPCA 2L9RA 3WHCA 1ETXA 2DMPA 2JA7J 1QRYA 1IRZA 2HXOA 2DMTA 2LTPA 3G1OA 4IHXA 2VUMJ 1PUFA 3HGGA 4XRMA 2HI3A 3BTJA 1NTCA 2JK3A 2DJNA 3Q0WA 2TCTA 3HOUJ 1T33A 1BW5A 2Y0SN 1O4XA 3IH4A 4B4CA 5C3EJ 4A69C 2CQQA 1JTYA 3S2DJ 1W0UA 2JMWA 3HOXJ 2ME0A 4I76A 2EZLA 1JKPC 2EQRA 3TEDA 2NOGA 2DA6A 2L7FP 1IUFA 2K9QA 2N8GA 2QCOA 4M3BA 1MBJA 1ETOA 4ABZA 1D5YA 1K61A 2HDDA 5IP7J 4QSHA 5M5WJ 3HGYA 3TP0A 2RAEA 4A3CJ 3S16J 5EYRA 3E7LA 1I6HJ 2GM4A 3HKZN 4JX6A 3OSGA 1APLC 2XB5A 4MFDA 2K9SA 2M8GX 4BY1J 1SFOJ 5M5YJ 1OFCX 1RKTA 5GP9A 5IPAA 4B1RA 2ECCA 1TWHJ 5M5XJ 4W97A 2XGEA 3IH2A 2LKXA 1HOMA 4M3EA 3BQZA 3JRDA 2R5YA 3BTLA 1S7EA 5EDNA 4UUTA 1XG1A 3GTQJ 1Y1WJ 3IV5A 2ID6A 3ZOBA 3S1QJ 4W1UA 3FISA 2PMZN 3K7AJ 5JLWA 2M9HA 3BTCA 1BJZA 9ANTA 2DA4A 4D7NA 2FQ4A 3DEWA 3SFIA 3GTOJ 4A93J 3FK6A 4A3EJ 2VI6A 3RZOJ 2NS8A 3HOWJ 3CCYA 1X2NA 1UMQA 5J1RA 2NVQJ 2VPRA 1SANA 1ETWA 3B6CA 2O7OA 1X2MA 4L5EA 5FKLA 4XRSA 5DTDA 2WB1N 4BXXJ 2XB0X 1IV6A 1JT6A 5F0CA 4MO7A 3BR5A 1NK3P 2W48A 3GTKJ 1FTZA 1WI3A 1HLVA 2R0QC 2HOSA 2MW8A 2Y30A 5EG0A 3S1NJ 1B72B 1P7IA 2K9NA 3GTPJ 2EZKA 4Y7NJ 2XRLA 2XPWA 1XC5A 1YRNB 3OIOA 2Y2ZA 3FKIJ 3GBGA 5EGOA 3G1MA 1WH5A 4BBSJ 1MBFA 4GFBA 4IHWA 4NDLA 1ZQ3P 3CDLA 2NVTJ 4JX5A 1MSFC 3M4OJ 2CRGA 3JRAA 1QVTA 4A3LJ 1GVDA 1FIPA 4FTHA 3S17J 4CYCB 3BR0A 3LNQA 2JA6J 2AO9A 3LSGA 5F0HA 1ITYA 3A01A 2H1KA 3O8HA 2LFBA 3GTLJ 4A3MJ 1AU7A 5M3MJ 1ZGWA 1RR7A 2LK2A 1XS9A 2R5YB 5DS9A 2L7ZA 5E3MA 1BL0A 2JA5J 2ELKA 5EZGA 1LFUP 3TW6A 1HCRA 2MSYA 1WGXA 1MH4A 4BY7J 1B8IB 3RQIA 1FEXA 3BR2A 2ME6A 3S1MJ 1MNMC 3ZQIA 3JREA 2R7ZJ 3F0CA 3OOUA 1GDTA 3Q0UA 2O9LA 1P7JA 3IH3A 3K2AA 3BG3A 2GBYA 4BKXA 4EEFG 1E3OC 2EZIA 1Q1VA 5M3FJ 2EH3A 2FJ1A 3HOZJ 2R5ZB 1JJ8C 1UG2A 4QIWN 1FTTA 1JUSA 5C4XJ 1WCMJ 1IJWC 5IP9J 3LSJA 3QPLA 5F0FA 2LP0A 4XRSG 4V2GA 2R5ZA 2YU9J 4X6AJ 4RDUA 2R92J 1GV2A 1R9TJ 1F43A 1U9OA 2P81A 4IHYA 3M3YJ 3BR6A 2DA7A 1JKRC 2D5VA 4DW6A 4FE4A 5FKNA 2KDZA 1LFBA 2E19A 4FCYA 2LR8A 2HOTA 5EF6A 3FIWA 3WHBA 2M34A 2DA3A 3TW7A 2LLKA 4Y52J 2E2IJ 5FKOA 5J1YA 1TWCJ 1U8BA 1IDYA 1F36A 1LE8B 4A3BJ 4M3GA 2K40A 1JUPA 1IGNA 1WPKA 1MH3A 1RPWA 5EEAA 3S1RJ 2B63J 4DZPA 1VNDA 1YRNA 2ID3A 4UUSB 2JWTA 2TRTA 3S2HJ 5C44J 2DA1A 3I4NJ 3Q3SA 3SDGA 5HODA 3HBLA 4AYBN 1MBHA 3ZQFA 3A03A 2CJJA 1POGA 4I6ZA 2KT0A 4M3DA 2E2HJ 3BR3A 3LSPA 2JJ7A 1RESA 2X48A 1AHDP 2VKEA 1QVUA 2JN6A 2YUSA 5JLXA 2OPTA 1FJLA 3JRHA 5K7HA 5IYDJ 4C3JJ 1AKHA 5K7ZA 2IEKA 3TP3A 1B72A 2HOAA 3LSRA 3CMYA 4JYKA 4AC0A 3ZQCA 2XPVA 3PM1A 2DA2A 4XICA 4A3JJ 2IBDA 5BNGA 2Y9ZA 4A3IJ 1TWAJ 4FISA 3L1PA 2Y9YA 3LOCA 2XGCA 1MBEA 1GUUA 1DU0A 1GT0C 1UHSA 2E1OA 2CU7A 3DCFA 2EZHA 5EGOB 1K83J 4CYCA 3JRIA 2JA8J 2OF7A 5J3LA 5K7FA 5FLVA 3MKLA 4G12A 2ZB9A 3BR1A 5E3OA 3Q0VA 1ETYA 3QPSA 2MG4A 1U78A 3H0GJ 1JUMA 3GTJJ 3UKGA 3OSFA 3A02A 4IHVA 3MN2A 5FJ8J 3A01B 3JRFA 1ZR2A 5J1UA 4C2MJ 2DMNA 2O8KA 5EZHA 1QPIA 4C3HJ 3H3VK 1PUFB 3MVPA 4D7MA 1A6IA 5C4JJ 1RKWA 4X1EA 1X58A 3HEFA 3B6AA 3JRBA 1IG7A 2DMUA 2HYJA 4RBOA 2DTZA 2AHQA 2FX0A 3BG9A 1MBKA 3ZQLA 5F1JA 1ETVA 2XGDA 2MGQA 3C2BA 2FD5A 1HDPA 3NAUA 1MBGA 1U9NA 1VI0A 2LY9A 2M2EA 1CQTA 2IAIA 3JRCA 1NK2P 3I4MJ 1OCTC 1ETQA 4D5CA 1DU6A 4A3FJ 2ECBA 1JT0A 3BQYA 2WV1A 4FE7A 5FKMA 1JKOC 1ETKA 2E2JJ 5IP6A 5IYCJ 4XIDA 4HNVA 4A3GJ 3HOYJ 2G0EA 1TWFJ 3SJMA 3ZQHA 2X9DA 1IC8A 2H8RA 4B3AA 2R93J 1AKHB 1I50J 2XSDC 2DN0A 5E3NA 3GTGJ 1B8IA 4A3KJ 3HDDA 1TWGJ 1ZTRA 2EBIA 5GPAA 4QTRA 3O8GA 3RZDJ 4A3DJ 1JGGA 3S15J 2XPUA 1ENHA 1HF0A 4V2FA 1I3QJ 4DYCA 1MSEC 3PO2J 1A5JA 4C3IJ 1VFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRG A;  1ZKG A;  2CUE A;  1EF4 A;  3HOV J;  4JX4 A;  1OJL A;  1Y1V J;  1BW6 A;  1VF9 A;  2DMQ A;  2WAQ N;  3BG5 A;  3GTM J;  3JR9 A;  5IOZ A;  4MFE A;  3ZQG A;  3FK7 A;  1IDZ A;  4AUX A;  1WH7 A;  2DA5 A;  3NAR A;  2VKV A;  3HB9 A;  5E3L A;  3BTI A;  2LD5 A;  4MIM A;  5EG0 B;  4M6V A;  1BA5 A;  1OCP A;  4JP0 A;  3VPR A;  3QQA A;  3S14 J;  1JTX A;  2M0C A;  2I10 A;  1H8A C;  4S0H B;  2LVS A;  3HM5 A;  4BBR J;  2CQX A;  2CUF A;  2HXI A;  4DYQ A;  1Z77 A;  3CQZ J;  1ZK8 A;  1TC3 C;  2NS7 A;  4D5F A;  4IEJ A;  4MLO A;  2L7M P;  1H89 C;  4DZJ A;  1G2H A;  1LE8 A;  3PO3 J;  1H88 C;  2L0K A;  3W6V A;  4LOC A;  2COB A;  5F04 A;  3G1L A;  5F27 A;  1T56 A;  2X6O A;  1RET A;  5FKK A;  5F08 A;  5IOY A;  2GLO A;  2QF7 A;  1JKQ C;  1ORK A;  4M3F A;  5FLM J;  3D1N I;  2HQ5 A;  3BT9 A;  1FIA A;  4UUS A;  1JJ6 C;  1GV5 A;  1Z0X A;  1HDD C;  4XK4 A;  2NVX J;  4J19 A;  2NVY J;  5IYB J;  1ZR4 A;  4DYR A;  2YS9 A;  1W0T A;  3RKQ A;  2Y31 A;  5GPC A;  2L9R A;  3WHC A;  1ETX A;  2DMP A;  2JA7 J;  1QRY A;  1IRZ A;  2HXO A;  2DMT A;  2LTP A;  3G1O A;  4IHX A;  2VUM J;  1PUF A;  3HGG A;  4XRM A;  2HI3 A;  3BTJ A;  1NTC A;  2JK3 A;  2DJN A;  3Q0W A;  2TCT A;  3HOU J;  1T33 A;  1BW5 A;  2Y0S N;  1O4X A;  3IH4 A;  4B4C A;  5C3E J;  4A69 C;  2CQQ A;  1JTY A;  3S2D J;  1W0U A;  2JMW A;  3HOX J;  2ME0 A;  4I76 A;  2EZL A;  1JKP C;  2EQR A;  3TED A;  2NOG A;  2DA6 A;  2L7F P;  1IUF A;  2K9Q A;  2N8G A;  2QCO A;  4M3B A;  1MBJ A;  1ETO A;  4ABZ A;  1D5Y A;  1K61 A;  2HDD A;  5IP7 J;  4QSH A;  5M5W J;  3HGY A;  3TP0 A;  2RAE A;  4A3C J;  3S16 J;  5EYR A;  3E7L A;  1I6H J;  2GM4 A;  3HKZ N;  4JX6 A;  3OSG A;  1APL C;  2XB5 A;  4MFD A;  2K9S A;  2M8G X;  4BY1 J;  1SFO J;  5M5Y J;  1OFC X;  1RKT A;  5GP9 A;  5IPA A;  4B1R A;  2ECC A;  1TWH J;  5M5X J;  4W97 A;  2XGE A;  3IH2 A;  2LKX A;  1HOM A;  4M3E A;  3BQZ A;  3JRD A;  2R5Y A;  3BTL A;  1S7E A;  5EDN A;  4UUT A;  1XG1 A;  3GTQ J;  1Y1W J;  3IV5 A;  2ID6 A;  3ZOB A;  3S1Q J;  4W1U A;  3FIS A;  2PMZ N;  3K7A J;  5JLW A;  2M9H A;  3BTC A;  1BJZ A;  9ANT A;  2DA4 A;  4D7N A;  2FQ4 A;  3DEW A;  3SFI A;  3GTO J;  4A93 J;  3FK6 A;  4A3E J;  2VI6 A;  3RZO J;  2NS8 A;  3HOW J;  3CCY A;  1X2N A;  1UMQ A;  5J1R A;  2NVQ J;  2VPR A;  1SAN A;  1ETW A;  3B6C A;  2O7O A;  1X2M A;  4L5E A;  5FKL A;  4XRS A;  5DTD A;  2WB1 N;  4BXX J;  2XB0 X;  1IV6 A;  1JT6 A;  5F0C A;  4MO7 A;  3BR5 A;  1NK3 P;  2W48 A;  3GTK J;  1FTZ A;  1WI3 A;  1HLV A;  2R0Q C;  2HOS A;  2MW8 A;  2Y30 A;  5EG0 A;  3S1N J;  1B72 B;  1P7I A;  2K9N A;  3GTP J;  2EZK A;  4Y7N J;  2XRL A;  2XPW A;  1XC5 A;  1YRN B;  3OIO A;  2Y2Z A;  3FKI J;  3GBG A;  5EGO A;  3G1M A;  1WH5 A;  4BBS J;  1MBF A;  4GFB A;  4IHW A;  4NDL A;  1ZQ3 P;  3CDL A;  2NVT J;  4JX5 A;  1MSF C;  3M4O J;  2CRG A;  3JRA A;  1QVT A;  4A3L J;  1GVD A;  1FIP A;  4FTH A;  3S17 J;  4CYC B;  3BR0 A;  3LNQ A;  2JA6 J;  2AO9 A;  3LSG A;  5F0H A;  1ITY A;  3A01 A;  2H1K A;  3O8H A;  2LFB A;  3GTL J;  4A3M J;  1AU7 A;  5M3M J;  1ZGW A;  1RR7 A;  2LK2 A;  1XS9 A;  2R5Y B;  5DS9 A;  2L7Z A;  5E3M A;  1BL0 A;  2JA5 J;  2ELK A;  5EZG A;  1LFU P;  3TW6 A;  1HCR A;  2MSY A;  1WGX A;  1MH4 A;  4BY7 J;  1B8I B;  3RQI A;  1FEX A;  3BR2 A;  2ME6 A;  3S1M J;  1MNM C;  3ZQI A;  3JRE A;  2R7Z J;  3F0C A;  3OOU A;  1GDT A;  3Q0U A;  2O9L A;  1P7J A;  3IH3 A;  3K2A A;  3BG3 A;  2GBY A;  4BKX A;  4EEF G;  1E3O C;  2EZI A;  1Q1V A;  5M3F J;  2EH3 A;  2FJ1 A;  3HOZ J;  2R5Z B;  1JJ8 C;  1UG2 A;  4QIW N;  1FTT A;  1JUS A;  5C4X J;  1WCM J;  1IJW C;  5IP9 J;  3LSJ A;  3QPL A;  5F0F A;  2LP0 A;  4XRS G;  4V2G A;  2R5Z A;  2YU9 J;  4X6A J;  4RDU A;  2R92 J;  1GV2 A;  1R9T J;  1F43 A;  1U9O A;  2P81 A;  4IHY A;  3M3Y J;  3BR6 A;  2DA7 A;  1JKR C;  2D5V A;  4DW6 A;  4FE4 A;  5FKN A;  2KDZ A;  1LFB A;  2E19 A;  4FCY A;  2LR8 A;  2HOT A;  5EF6 A;  3FIW A;  3WHB A;  2M34 A;  2DA3 A;  3TW7 A;  2LLK A;  4Y52 J;  2E2I J;  5FKO A;  5J1Y A;  1TWC J;  1U8B A;  1IDY A;  1F36 A;  1LE8 B;  4A3B J;  4M3G A;  2K40 A;  1JUP A;  1IGN A;  1WPK A;  1MH3 A;  1RPW A;  5EEA A;  3S1R J;  2B63 J;  4DZP A;  1VND A;  1YRN A;  2ID3 A;  4UUS B;  2JWT A;  2TRT A;  3S2H J;  5C44 J;  2DA1 A;  3I4N J;  3Q3S A;  3SDG A;  5HOD A;  3HBL A;  4AYB N;  1MBH A;  3ZQF A;  3A03 A;  2CJJ A;  1POG A;  4I6Z A;  2KT0 A;  4M3D A;  2E2H J;  3BR3 A;  3LSP A;  2JJ7 A;  1RES A;  2X48 A;  1AHD P;  2VKE A;  1QVU A;  2JN6 A;  2YUS A;  5JLX A;  2OPT A;  1FJL A;  3JRH A;  5K7H A;  5IYD J;  4C3J J;  1AKH A;  5K7Z A;  2IEK A;  3TP3 A;  1B72 A;  2HOA A;  3LSR A;  3CMY A;  4JYK A;  4AC0 A;  3ZQC A;  2XPV A;  3PM1 A;  2DA2 A;  4XIC A;  4A3J J;  2IBD A;  5BNG A;  2Y9Z A;  4A3I J;  1TWA J;  4FIS A;  3L1P A;  2Y9Y A;  3LOC A;  2XGC A;  1MBE A;  1GUU A;  1DU0 A;  1GT0 C;  1UHS A;  2E1O A;  2CU7 A;  3DCF A;  2EZH A;  5EGO B;  1K83 J;  4CYC A;  3JRI A;  2JA8 J;  2OF7 A;  5J3L A;  5K7F A;  5FLV A;  3MKL A;  4G12 A;  2ZB9 A;  3BR1 A;  5E3O A;  3Q0V A;  1ETY A;  3QPS A;  2MG4 A;  1U78 A;  3H0G J;  1JUM A;  3GTJ J;  3UKG A;  3OSF A;  3A02 A;  4IHV A;  3MN2 A;  5FJ8 J;  3A01 B;  3JRF A;  1ZR2 A;  5J1U A;  4C2M J;  2DMN A;  2O8K A;  5EZH A;  1QPI A;  4C3H J;  3H3V K;  1PUF B;  3MVP A;  4D7M A;  1A6I A;  5C4J J;  1RKW A;  4X1E A;  1X58 A;  3HEF A;  3B6A A;  3JRB A;  1IG7 A;  2DMU A;  2HYJ A;  4RBO A;  2DTZ A;  2AHQ A;  2FX0 A;  3BG9 A;  1MBK A;  3ZQL A;  5F1J A;  1ETV A;  2XGD A;  2MGQ A;  3C2B A;  2FD5 A;  1HDP A;  3NAU A;  1MBG A;  1U9N A;  1VI0 A;  2LY9 A;  2M2E A;  1CQT A;  2IAI A;  3JRC A;  1NK2 P;  3I4M J;  1OCT C;  1ETQ A;  4D5C A;  1DU6 A;  4A3F J;  2ECB A;  1JT0 A;  3BQY A;  2WV1 A;  4FE7 A;  5FKM A;  1JKO C;  1ETK A;  2E2J J;  5IP6 A;  5IYC J;  4XID A;  4HNV A;  4A3G J;  3HOY J;  2G0E A;  1TWF J;  3SJM A;  3ZQH A;  2X9D A;  1IC8 A;  2H8R A;  4B3A A;  2R93 J;  1AKH B;  1I50 J;  2XSD C;  2DN0 A;  5E3N A;  3GTG J;  1B8I A;  4A3K J;  3HDD A;  1TWG J;  1ZTR A;  2EBI A;  5GPA A;  4QTR A;  3O8G A;  3RZD J;  4A3D J;  1JGG A;  3S15 J;  2XPU A;  1ENH A;  1HF0 A;  4V2F A;  1I3Q J;  4DYC A;  1MSE C;  3PO2 J;  1A5J A;  4C3I J;  1VFC A; 
#chains in the Genus database with same CATH topology
 4RA2 A;  3JRG A;  4B09 A;  3A1Y A;  5CVV A;  3L9F A;  1Z21 A;  5KK1 A;  1L0O C;  1OJL A;  3FF5 A;  1AOY A;  3E5U A;  4B47 A;  1BW6 A;  3G6E I;  4N0B A;  5HLI A;  4LB6 B;  1HQC A;  2DMQ A;  4D9J A;  5GAG J;  1OIS A;  2BZT A;  2ZXW H;  2JVG A;  5EEG A;  1NG7 A;  3GYH X;  1JHF A;  3IKV A;  2DA5 A;  4L9J A;  3NAR A;  4E70 A;  2VKV A;  1LDJ A;  3SZT A;  3FBN B;  1ZAO A;  3BTI A;  5E18 F;  3LAJ A;  1TT0 A;  5LEJ A;  2ZO4 A;  5FRM A;  3S2W A;  2OZ6 A;  2ZME B;  1JTX A;  1A6Q A;  3H5A A;  5H6Q A;  2JPC A;  3QWL A;  4BBR J;  4KDP A;  1PP8 F;  1D8J A;  5IT9 K;  3DKX A;  1R1V A;  1O7L A;  5JVT A;  1TC3 C;  4LK1 F;  2NS7 A;  3LQQ A;  5H20 A;  4P9U A;  3CMA I;  4NHJ A;  1G2H A;  3H9Q A;  2VT3 A;  3WTU C;  2L0K A;  1STZ A;  2IS1 A;  2BGC A;  4BDZ A;  3F9K A;  4ZYE A;  3G1L A;  2X6Y A;  2QZ8 A;  1YTY A;  4A12 A;  3NEU A;  3RKW A;  4AU7 A;  1J7K A;  4RB1 A;  5FLM J;  3MD2 A;  4M9S A;  3JTG A;  3NRV A;  1B9N A;  1HKS A;  1OLT A;  2FNP A;  3GLX A;  1HDD C;  1D0Z A;  4O6J A;  1S29 A;  4OWR B;  2J5P A;  3SZG A;  4HST A;  1I39 A;  4ENM A;  4XKC A;  1WKM A;  2PJR A;  3RKQ A;  1OR7 A;  1HKQ A;  5GPC A;  1UHW A;  2P4W A;  2L4M A;  2EFW A;  1TLH B;  2JA7 J;  1E0E A;  3I3L A;  2DMT A;  3PL8 A;  1V54 H;  3K4N A;  3QPH A;  4UY8 I;  1MMA A;  2QQ9 A;  2GIZ A;  2Q0O A;  5JR3 A;  1W36 D;  4Q4Z F;  3ZCO A;  1Y39 A;  2FOK A;  4YII A;  3I71 A;  4IHS A;  2JK3 A;  2DJN A;  4L0Y B;  1T33 A;  3QP6 A;  4B43 A;  3IH4 A;  4AIK A;  3CJR B;  4LFU A;  3S2D J;  4F3Q A;  2KZV A;  1M1E B;  2WV0 A;  4ON0 A;  4XN0 A;  3ERM A;  1WQ2 A;  3BCB A;  3RTR A;  1TP4 A;  1KON A;  1SVO A;  4A5N A;  4XLP F;  4XQF A;  2EQR A;  4KIB A;  1YO5 C;  2NOG A;  2DA6 A;  3E6C C;  1V5E A;  1IUF A;  1Z67 A;  2CQ7 A;  3MFK A;  1U3E M;  1QZZ A;  3IHU A;  2QCO A;  3BOQ A;  1LEB A;  2AQE A;  3FXO A;  1MDM B;  1D5Y A;  2A07 F;  2HDD A;  5L3B A;  2V9K A;  2ZFU A;  3DU6 A;  4QSH A;  3RPQ A;  3VWB A;  3DLA A;  3OYI A;  1R1T A;  2DCE A;  4BQQ A;  3ZMZ A;  3E7L A;  4E6K G;  2GM4 A;  1IV8 A;  4JX6 A;  5HDK A;  2NYX A;  2XB5 A;  4G7H F;  2K9S A;  2VT2 A;  4UXN A;  1G3W A;  1ZLK A;  4DQ2 A;  1LQ1 A;  2H09 A;  1OFC X;  4NC7 A;  3W6K B;  5KAF C;  2XGX A;  2ZSI B;  1RNL A;  3ZMV A;  2YU3 A;  2ECC A;  3MKW B;  5M5X J;  5TRD A;  1YJN I;  2GXA A;  1XPX A;  2LKX A;  4M3E A;  3DPU A;  3JRD A;  2R5Y A;  1XDU A;  2KFD A;  5EDN A;  5JFR A;  4XNF A;  2E34 A;  2H1L A;  4GXO A;  5JLW A;  2PMZ N;  3K4B A;  3HUG B;  1X3Z B;  3BTC A;  3DEW A;  4A93 J;  3FK6 A;  4RB2 C;  5FLX K;  4Y3O A;  2ZNY A;  2Z5U A;  1ZRD A;  1X2N A;  4F91 B;  3TO9 A;  2QBY A;  2VPR A;  3OR1 C;  1XSX A;  3KLN A;  4DOZ A;  5D6E A;  4UV9 A;  3VYS B;  4CCK A;  1J5Y A;  2UV1 A;  2KIF A;  3HG9 A;  3L7W A;  4EJW A;  2XB0 X;  2FU4 A;  4ZC3 A;  1JT6 A;  1LVK A;  2OQG A;  4IOA F;  2L7K A;  3BZK A;  1H9T A;  2ICW G;  1FOK A;  1LDK B;  1HBX G;  1NK3 P;  2STT A;  2FBK A;  3GTK J;  4CHU A;  3H5R A;  1TTY A;  4MQ9 F;  2R0Q C;  3OYK A;  2HVR A;  3H35 A;  1W5S A;  1FBS A;  1PVE A;  2Y30 A;  1WJC A;  1W1W E;  1B1B A;  3BP8 A;  3GLL A;  3CUQ C;  3GTP J;  2F5C A;  1EJ9 A;  2XPW A;  1WFX A;  2DK8 A;  4E4H A;  1G3S A;  2OUM A;  3EQL F;  3OIO A;  1G8X A;  2GXB A;  5IT9 Z;  3V8K A;  1IN6 A;  2HU9 A;  2ESH A;  1VQL I;  4HF1 A;  2NVT J;  4IPA A;  3JRA A;  1QVT A;  4U7B A;  2L01 A;  1UHM A;  3WG9 A;  4CYC B;  1JI8 A;  1BI0 A;  3BR0 A;  1U5T C;  4I01 A;  2LF8 A;  2JA2 A;  1SD5 A;  2G7U A;  1P92 A;  5D5W B;  3ZN1 A;  5F0H A;  1ITY A;  1VZ0 A;  2BY2 A;  2WTE A;  1KYZ A;  2LFB A;  1G3Y A;  2V1U A;  2KRH A;  2Z1D A;  4A3M J;  2MBF A;  3GZ6 A;  3DWL E;  4L9V A;  3K69 A;  3DBR B;  3K4M A;  4II2 A;  2L02 A;  4CZZ A;  1OCC H;  2OJE D;  1WI9 A;  3C7J A;  5BPI A;  1S6L A;  4LG0 A;  2ZXJ A;  4GYG A;  2RQQ A;  4A0X A;  4ZDP A;  1FNN A;  2WAF A;  3FXL A;  1U8R A;  1WGX A;  1QU3 A;  3K4K A;  3ROU A;  1XB4 A;  1Q1H A;  5GAD J;  1QBJ A;  2XAU A;  1WWX A;  3F8B A;  1FEX A;  1T95 A;  2L4A A;  4U7D A;  1QZE A;  3VOD A;  2HFH A;  3F6V A;  5DCM B;  3ZQI A;  5F6F A;  3WU1 B;  3U1D A;  4EM0 B;  2DFH A;  2DT7 B;  2P6S A;  3Q0U A;  2QSF X;  4J00 A;  1K78 A;  1F1Z A;  2GBY A;  2XKO A;  2RVC A;  3IP4 B;  3WTV C;  1WJA A;  3TO7 A;  4WWC A;  1DUX C;  1W5T A;  2R5Z B;  2R7V A;  3T1B A;  1FTT A;  1IN4 A;  4WXC A;  5D5V B;  2CS3 A;  3QPL A;  3ZMD A;  5ICG A;  2K3P A;  2LP0 A;  1N25 A;  5ILV A;  2OC6 A;  1MJA A;  4V2G A;  3K4J A;  3W2V A;  2VBW A;  3HHH A;  1SD4 A;  5TJJ A;  2CO5 A;  1VQO I;  2VAS A;  3MKY B;  2A3S A;  2R7F A;  4IHY A;  1BR1 A;  2DA7 A;  1FLI A;  2KLO A;  1R23 A;  1OYI A;  2UUZ A;  2LY2 A;  1FMV A;  4FE4 A;  4NQW A;  4Q5S F;  3CCQ I;  4CIC A;  2ADU A;  2LR8 A;  3C2G A;  3JSO A;  2CV2 A;  2RN7 A;  1MNE A;  5L3G A;  3A0B C;  3DKY A;  2Q2E B;  2DA3 A;  3I0T A;  4DBQ A;  3N97 A;  2R7U A;  5CVI A;  2UZK A;  2E2I J;  5J1Y A;  2AQF A;  2ZJR F;  3HKZ A;  4F7Z A;  4M3G A;  3W2A A;  2R7W A;  3WE3 A;  4LMY A;  1SFX A;  1FOX A;  1RPW A;  3TDU C;  1T0F C;  5B66 C;  5EEA A;  2F6C A;  3U2R A;  2D45 A;  2QLZ A;  2JSP A;  2OBP A;  5HOD A;  4LD5 A;  1O3R A;  2MC3 A;  1ZGA A;  1R36 A;  2XF5 A;  3ZQF A;  3A03 A;  3K70 C;  1POG A;  1P4X A;  2OA4 A;  3K10 A;  3BR3 A;  1BI1 A;  2JJ7 A;  5B5E C;  2VQL A;  1VQ5 I;  1AHD P;  2JN6 A;  4XN3 A;  4G6Q A;  3OY9 A;  1JGS A;  3E6D A;  3CJQ B;  3SEQ A;  1AKH A;  1O3Q A;  2IEK A;  3TP3 A;  3VOE A;  1B72 A;  2EIK H;  2HOA A;  1FYK A;  3GW2 A;  3PM1 A;  4MNU A;  1A36 A;  4A3J J;  2IBD A;  3CCV I;  3CZ6 A;  1LVA A;  3TMO A;  4B8X A;  2FEZ A;  2XGC A;  3ECO A;  1GT0 C;  1FYL A;  3CMM A;  3I59 B;  5LGN A;  2GOX B;  2K02 A;  3KE2 A;  3MAJ A;  2RV8 A;  3JRI A;  4KMU X;  1HW1 A;  2OF7 A;  4OIQ F;  5K7F A;  3CCL I;  2JA8 J;  3PQK A;  2ZB9 A;  5HDG A;  2XF7 A;  1XSD A;  5E3O A;  4BE2 A;  4PSX A;  3CJN A;  3HYI A;  2LNB A;  3GEZ A;  1HXD A;  2MG4 A;  1CGP A;  1U0J A;  1T39 A;  1OCZ H;  5A2Q Z;  1JUM A;  1YFH A;  2GA2 A;  1WJD A;  3OSF A;  5E79 C;  3PUB A;  1ACI A;  2KIM A;  3A01 B;  1ZR2 A;  1Z9C A;  5EZH A;  1QPI A;  3HJE A;  2HR3 A;  1W4M A;  3QAH A;  3VEP A;  3MVP A;  4PJM A;  5CYV A;  2K4J A;  4S05 A;  3HSE A;  4PUS A;  1PJR A;  1V4R A;  3ESW B;  4X1E A;  4G7O F;  3LST A;  5EEH A;  5AIQ A;  1XN7 A;  3ZN0 A;  3BY6 A;  2AHQ A;  5ERI A;  3ZQL A;  2KRC A;  3SXY A;  3HZJ A;  3C2B A;  2BBY A;  2A5W A;  2IS6 A;  1HDP A;  3O6B B;  1MBG A;  2CUJ A;  1VI0 A;  3IRQ A;  3KIO A;  1OR7 C;  4IJA A;  2L54 A;  1J09 A;  3I4M J;  2VN2 A;  4Z2Y A;  4XSX F;  2XAQ A;  1OCT C;  3HUG A;  2EIL H;  4D5C A;  3S3M A;  1KA8 A;  3EUH C;  4A3F J;  4Y4R A;  1JT0 A;  2XHK A;  5BOX A;  5D4R A;  1JKO C;  4M73 A;  2RQP A;  3F23 A;  4E7J A;  2D1H A;  4HNV A;  4RS8 A;  2W57 A;  3VSL A;  3HOY J;  1L3L A;  2J5O A;  2QYO A;  3BC8 A;  4IO9 F;  3SJM A;  2CQK A;  4UB6 C;  4XLH A;  4ENN A;  2DN0 A;  5E3N A;  5HNF A;  1D5V A;  2P5V A;  1YG2 A;  1SVL A;  4G6D A;  1TWG J;  2QVO A;  3CCS I;  4A6D A;  3OYA A;  4QTR A;  3TOB A;  3LQR A;  3RZD J;  4D1Q A;  1JGG A;  4XON A;  1ENH A;  3RIR A;  1OCR H;  4BGD A;  1MSE C;  2BW3 B;  2P0W A;  1VFC A;  4EGZ A;  1D8K A;  2IGO A;  1DDN A;  2XVC A;  5DEQ A;  1WHU A;  1YS6 A;  3CCR I;  5E20 A;  1Y1V J;  1OCO H;  1VF9 A;  1P4A A;  1X1P A;  3DTK A;  4OIP F;  3GTM J;  1IN5 A;  2BVM A;  3WG7 H;  4BU2 A;  1REP C;  4MFE A;  1H9G A;  3ZQG A;  1E17 A;  3HPH A;  4AUX A;  1Z05 A;  5E3L A;  3GF2 A;  1BJA A;  3MCZ A;  2AXT C;  2CWE A;  3BJA A;  4YEL A;  1P2F A;  3P9I A;  3GFJ A;  3DV8 A;  4EM2 A;  3H9G A;  1FY7 A;  3ABL H;  3DEU A;  4JP0 A;  3QQA A;  4BNC A;  2XC7 A;  2I10 A;  3U9G A;  1O7F A;  2KQR A;  3ZMT A;  4HSR A;  2CQX A;  2CUF A;  2HXI A;  5GAH J;  3CQZ J;  1K7A A;  4IX7 A;  4D5F A;  4ZTF A;  2EFO A;  3F6O A;  2R7X A;  3K4C A;  3ECH A;  4DZJ A;  1HST A;  2NNY A;  3PO3 J;  1UFM A;  2H8W A;  3RI4 A;  4BL0 B;  1T56 A;  2X6O A;  5CLS A;  1SAU A;  3OYL A;  3C3W A;  2HQ5 A;  2Z99 A;  4UUS A;  1JJ6 C;  1JXS A;  3CP2 A;  2NVX J;  2LRD A;  4BHB A;  1D1A A;  2NVY J;  2E1N A;  4JQF A;  4Y17 A;  5GTH C;  2ZNZ A;  4BQN A;  5FRO A;  4DYR A;  4HOB A;  3BZC A;  4GCV A;  4N4O B;  1W0T A;  2K7L A;  3BZ6 A;  3M1C A;  5LGT A;  2NVU B;  1ETX A;  1FC3 A;  2R7O A;  4FX4 A;  1QRY A;  4XMY A;  4LIU A;  3JAM K;  3LAP A;  4AIJ A;  1SFU A;  3BPV A;  3J80 Z;  1A31 A;  2KIU A;  2M7A A;  1FP1 D;  2LKP A;  2X6W A;  1A35 A;  3ZXS A;  3OWT A;  1PUF A;  3OYB A;  2HI3 A;  4RLF A;  1YS7 A;  4M6Y A;  3V42 A;  3AFH A;  1NTC A;  3K6G A;  1VQ7 I;  2CW8 A;  2QSG X;  3Q0W A;  3HOU J;  2TCT A;  1XMA A;  2HTS A;  2OZU A;  1O4X A;  1ZG3 A;  2CQQ A;  2VQG A;  3CUQ B;  2JMW A;  4XLA A;  2EK5 A;  5IY5 H;  4DNC A;  4ZYG A;  1YX3 A;  5FD6 A;  3MZY A;  2MD0 A;  1YE9 A;  2BY3 A;  3PUF A;  3TED A;  2DDB A;  2WY8 Q;  2L7F P;  4XOR A;  5B1A H;  2K9Q A;  4FHT A;  3SQN A;  2LBF A;  3CLO A;  4CDG A;  4KT5 C;  4M3B A;  4PFP A;  1IN7 A;  3R60 A;  3VB2 A;  1R49 A;  1ETO A;  4RGX A;  1Z91 A;  4MTD A;  2QKL B;  2ESN A;  3PNT A;  2A6T A;  1Y8Q B;  4G9Y A;  3TP0 A;  5EJC A;  3QYF A;  1GXQ A;  5TIS C;  4LJZ F;  2O03 A;  3HOS A;  2V79 A;  4E7Z A;  1I6H J;  1OQY A;  4BXU A;  2VOP A;  4HPQ A;  1APL C;  4MFD A;  4NC6 A;  1K79 A;  1F5T A;  2M8G X;  2DT6 A;  1R4M B;  1R6R A;  1QHH D;  1LJ9 A;  1SVM A;  2EV6 A;  2RDP A;  3BJ6 A;  4HV6 A;  2ZFW A;  4L9N A;  2L9N A;  4M9X A;  1TBX A;  1TWH J;  2LRE A;  4W97 A;  3CUO A;  2XGE A;  1D0Y A;  3RPU D;  5B3S H;  1WSU A;  4YFN F;  2KP6 A;  2EWN A;  1IXS B;  2CSO A;  3CLQ A;  4UUT A;  4ESB A;  2VBY A;  3UNG C;  4HF2 A;  5FRN A;  3S1Q J;  4W1U A;  3K7A J;  4WXD A;  3J7Y J;  4DIQ A;  2DA4 A;  4D7N A;  2DXI A;  4M71 A;  1U5T A;  1YLF A;  2VI6 A;  4E7H A;  1SD7 A;  2NS8 A;  3RDI A;  5HLH A;  3HOW J;  5ICF A;  3K1M A;  3ZRG A;  1W5C C;  2JZY A;  2MH2 A;  3DTI A;  1HC8 A;  2CG4 A;  4A0Y A;  3B6C A;  2O7O A;  3BJO A;  2LSO A;  2QKM B;  3RCO A;  4XRS A;  5DTD A;  3GWZ A;  5GTI C;  4BXX J;  2VE8 A;  3AL0 C;  3IUO A;  3H92 A;  2DBB A;  2YX7 A;  1W7P A;  3V4G A;  4UNO A;  2W48 A;  2A6E F;  2K9L A;  3HSF A;  5CVR A;  2V1D A;  2W25 A;  2W7N A;  3ABU A;  3HTS B;  1IRF A;  5EG0 A;  1B72 B;  3BG6 A;  4I09 A;  1V3F A;  3OL4 A;  4BEH A;  5HOO A;  1XC5 A;  1YRN B;  2FA5 A;  3FKI J;  3L2V A;  2PMU A;  1RIO H;  1IAW A;  1R1U A;  1S9H A;  1XGO A;  3KYL A;  4NB5 A;  4ENK A;  6PAX A;  4II3 A;  3CDL A;  3WTT C;  4OU0 A;  1E3H A;  1G4D A;  2VL8 A;  3OYD A;  1MSF C;  4AWX B;  4OIR F;  1Z7L A;  2QSH X;  1GVD A;  3L2Q A;  2IA1 A;  4HDV A;  3G3Z A;  2M0M A;  3HRS A;  1QHG A;  3FXR A;  3E1S A;  1B9M A;  2AO9 A;  3FHN A;  3EYY A;  3I55 I;  2ETH A;  4N9H A;  4NC8 A;  4CCN A;  1HKT A;  2BXY A;  5M3M J;  1ZGW A;  1OYY A;  2FNA A;  2E60 A;  1FSE A;  4B44 A;  1IZ1 A;  1YOV B;  4EJO A;  2L7Z A;  2Z9O A;  2V1X A;  3AKZ A;  3VFZ A;  2ELK A;  5K5O A;  1DP3 A;  5HS9 A;  4IRH A;  3TW6 A;  1HCR A;  3KYC B;  3B02 A;  2HQR A;  5J4Y A;  4HQE A;  4UVC A;  3O2P E;  4EJT A;  1UZC A;  4KIC A;  4XOT A;  4BY7 J;  1S5L C;  5LHH A;  1J9I A;  3RQI A;  2EFP A;  3R0A A;  4P1W A;  2BVL A;  3CME I;  2ZME C;  2H6C A;  4CO8 A;  1XX5 A;  2CFX A;  3S1M J;  1MNM C;  3HRT A;  1TL8 A;  2K27 A;  3H9J A;  2HQA A;  3OOU A;  1LNW A;  1T6S A;  2PBI A;  3FXQ A;  1S8N A;  2VQC A;  1K6O A;  2QWW A;  3SEZ A;  4BAY A;  4IL6 C;  2CQN A;  1UEL B;  4EEF G;  1E3O C;  2EZI A;  2F5E A;  4QWQ A;  2HKX A;  3M8F A;  2OTJ I;  2E5Z A;  2FJ1 A;  3K4L A;  3K9T A;  4PJJ A;  3DPT A;  1OMI A;  3TKY A;  1WCM J;  3LSJ A;  1BR4 A;  3A0H C;  4IQ4 A;  3QRF F;  2LYC A;  4AID A;  3LSK A;  1TQM A;  2M7B A;  1Y8R B;  1IN8 A;  2AXL A;  2CYY A;  2R5Z A;  2YU9 J;  2G9W A;  4E7I A;  5L3C A;  1F43 A;  4XKB A;  2HKO A;  2P81 A;  3M3Y J;  1D1C A;  2FMY A;  1GLN A;  2IPQ X;  3LA7 A;  3OV8 A;  3P9C A;  1VTN C;  2BV6 A;  4GGG A;  4DW6 A;  3FWE A;  4RM2 A;  2W82 A;  1W7P D;  2JRM A;  3Q9V A;  2HOT A;  3K0L A;  5JHU A;  2E1M C;  2OAZ A;  2QQ8 A;  3DBL B;  2WWY A;  4AIH A;  4WX9 A;  2M34 A;  2CUZ A;  3SDB A;  1WJE A;  3TW7 A;  2VKH A;  3FZV A;  4HEA 2;  5DDG A;  2HQN A;  1FOW A;  5CVU A;  2W24 A;  3M8J A;  4KIG A;  4Y52 J;  1R7J A;  5FKO A;  1IDY A;  1F36 A;  3U1K A;  2K40 A;  1X4O A;  5KCM A;  3T8T A;  1R5H A;  4BEH B;  2B9S A;  2Y0S A;  2DPD A;  3S1R J;  2K85 A;  3DQV C;  1YRN A;  1VND A;  3PFY A;  5K5Q A;  4I2O A;  4UUS B;  4KIT B;  1B4A A;  1MZB A;  2JWT A;  3OOP A;  2TRT A;  5CQE A;  2GXG A;  3I4N J;  3Q3S A;  3SDG A;  1T98 A;  1TW3 A;  2HZD A;  4H0E A;  2M30 A;  1Z3X A;  4IRG A;  1HW2 A;  3FM5 A;  4ANJ A;  1DGR M;  1IRX A;  2OQR A;  2BY0 A;  2CJJ A;  3GFL A;  2KPM A;  4I6Z A;  2KT0 A;  4L0Z B;  3LSP A;  3CCU I;  2GWR A;  3E5X A;  3BDD A;  4MEX F;  2VKE A;  2JTV A;  1FJL A;  4HYE A;  3JRH A;  5K7H A;  5IYD J;  4C3J J;  5K7Z A;  4FAS D;  2F48 A;  3ZQ7 A;  1X1C A;  4UV8 A;  4JYK A;  3ZQC A;  3FBI B;  5KNL A;  3EPZ A;  3I59 A;  5IT3 A;  5J6X A;  2DOD A;  3M9A A;  1X1B A;  1TWA J;  4PK4 A;  2Y9Y A;  3LOC A;  3RYP A;  1MBE A;  1ZHF A;  1GUU A;  1DU0 A;  2EV5 A;  3W2W A;  1I27 A;  2CW7 A;  2E1O A;  2LOO A;  2IP2 A;  3JAM Z;  3DEE A;  1SMY F;  1R5G A;  2D2W A;  4LIT A;  4CGZ A;  5FLV A;  3KCC A;  2K3F A;  2F5D A;  4L9T A;  3QPS A;  3HIF A;  2H6B A;  3GVA A;  3V8L A;  2HVS A;  1QNT A;  1FX7 A;  1B59 A;  5D8L B;  3MN2 A;  3WTX C;  3S3N A;  2O8K A;  1LDD A;  4C2M J;  5LHG A;  4UUV A;  3ZGK A;  3MWM A;  1D0X A;  4C3H J;  4B48 A;  1PUF B;  2HYF A;  3MMY B;  1G3T A;  4OOI A;  4D7M A;  1E3P A;  5F1R A;  2EIJ H;  2HEO A;  1X58 A;  3HEF A;  3JRB A;  2IRF G;  3QOD A;  4MHG A;  1UST A;  2DMU A;  1VQ8 I;  2OCE A;  2Z2S B;  3LFK A;  3H3Z A;  1ETV A;  2XGD A;  2R7S A;  3F72 A;  2VQH A;  4AD9 A;  2IA2 A;  1TZL A;  2LY9 A;  1CQT A;  3JRC A;  3HRU A;  1XCV A;  1OPC A;  3PSF A;  4C2U A;  1ZRF A;  3TOA A;  1DU6 A;  2HWV A;  4I0B A;  3C18 A;  2XKP A;  4X0G A;  1SD6 A;  3F8C A;  2FOW A;  3CO6 C;  2WV1 A;  3VSK A;  3H0D A;  4FE7 A;  2DPU A;  1ETK A;  4RAF A;  4CCO A;  4Z6Y A;  1BI2 A;  4I0A A;  5IYC J;  4XID A;  4H4K C;  2IVM A;  2F4M B;  4A3G J;  1HW5 A;  2W84 A;  4UVA A;  4LLL A;  4IHT A;  2IGK A;  1MMS A;  1RC9 A;  2X9D A;  1F4K A;  3HHG A;  4B3A A;  3CES A;  5LRR A;  2R93 J;  2MH9 A;  3GTG J;  3SFZ A;  1UAA A;  1KU2 A;  2AS5 F;  2EBI A;  5GPA A;  2ELH A;  3GFM A;  4QPO A;  4V2F A;  2W85 A;  3P9K A;  4F93 B;  3WGH A;  2MD5 A;  2VON A;  1A5J A;  1KZH A;  4C3I J;  1QZY A;  2DAO A;  1TW2 A;  1ZKG A;  3LA3 A;  1EF4 A;  4OAY A;  3E5Q A;  4GYI A;  1RUO A;  3EUK L;  1MMD A;  3EDP A;  1DP7 P;  4BQA A;  2BHY A;  4CCL A;  1J2X A;  3BG5 A;  2CV0 A;  4HLX A;  3JR9 A;  1IXR C;  5IOZ A;  3BLY A;  2QQA A;  4KA4 A;  3FK7 A;  1W7P B;  1GXP A;  1WH7 A;  1I3A A;  2LH9 A;  3R4K A;  5ILS A;  2QQB A;  1RZ4 A;  3B73 A;  4XKW A;  4YEJ A;  2I8D A;  3LSH A;  3HC7 A;  5EG0 B;  2ZXI A;  4EV0 A;  1ZGJ A;  3D0S A;  3DBH B;  4M6V A;  3COA C;  2CV1 A;  3EUH A;  3GFI A;  2NNN A;  2PMZ A;  1DGW Y;  2PN6 A;  3AG2 H;  2LC2 A;  2M0C A;  1Z3Y A;  2A61 A;  1H8A C;  2VOO A;  4YIR X;  4AYB A;  4ZH4 F;  2DOE A;  2Z33 A;  1ZK8 A;  5LHI A;  1OYW A;  2IS2 A;  1W36 C;  4IEJ A;  4MLO A;  4E7L A;  2GOM A;  3TDZ C;  2L7M P;  4XLF A;  1H89 C;  2MLG A;  1TQP A;  3WGG A;  3T5X A;  1GVJ A;  2COB A;  3ZR8 X;  2VOD A;  5FKK A;  3VYR B;  1SFE A;  3T8R A;  2GLO A;  5F08 A;  2XAF A;  3BPX A;  5CJ9 A;  3RQ4 A;  1JKQ C;  1ORK A;  4M3F A;  4M72 A;  3BT9 A;  1ULY A;  3GO5 A;  1Z0X A;  4XK4 A;  3KP3 A;  4C2T A;  1EV7 A;  4LGW A;  3IRR A;  3DXJ F;  4ESJ A;  3FXJ A;  1AA7 A;  2R7T A;  1HSJ A;  2L9R A;  2DMP A;  4I7H A;  1WJB A;  2Z16 A;  3F8M A;  4LB5 A;  1IRZ A;  1MND A;  2DU9 A;  1BM9 A;  2GA1 A;  2E5N A;  4N4N B;  5JI6 A;  2WBM A;  1S7A A;  1MW7 A;  3HGG A;  3K2Z A;  4BJ6 C;  4XRM A;  4P9F A;  3L2R A;  4EVI A;  1V5F A;  3OIQ A;  2VC1 A;  3KYD B;  1VQK I;  1T2K A;  4IKF A;  2KIS A;  4B4C A;  4A69 C;  1KU3 A;  2E7X A;  3FDY A;  5C3E J;  2VXZ A;  3JW4 A;  4KN4 X;  3KEY A;  3G73 A;  4QPQ A;  1DPR A;  3LA2 A;  1LB2 A;  2EZL A;  5FFZ A;  2K4B A;  2ZJQ F;  5ED4 A;  1JKP C;  2VKD A;  1VQ4 I;  4HLY A;  4BUP A;  2M8E A;  3MEX A;  4EQQ A;  5AIP A;  2Z3Y A;  4U0Y A;  4ABZ A;  2FBI A;  4LG0 B;  1Z1D A;  3ABK H;  2DQR A;  3CUQ A;  3CTA A;  4CUG A;  1X3W B;  1YW9 A;  2BOL A;  2RAE A;  2JPB A;  4PGG A;  5LFA A;  3S16 J;  2DOF A;  5EYR A;  1KGS A;  3HKZ N;  4KYW A;  2QM3 A;  3OSG A;  2CW0 F;  3KZZ A;  1D3Y A;  1EA3 A;  4OAZ A;  2IT0 A;  4GDF A;  2DK5 A;  1ZEL A;  4XRF A;  3A4C A;  1SFO J;  1K4S A;  5M5Y J;  1RKT A;  1RRJ A;  1IF1 A;  4MTE A;  2KHM A;  1VQ6 I;  1FSH A;  3I5U A;  2XRO A;  3BTL A;  2XF6 A;  3I64 A;  4BH9 A;  4HV5 A;  3GTQ J;  2OCC H;  2V6C A;  3PJR A;  3GCM A;  4YFX F;  2RRE A;  2KKO A;  9ANT A;  2IA0 A;  2MFZ A;  2FQ4 A;  2DDA A;  3SFI A;  2O0Y A;  3KX2 A;  3RZO J;  1X1D A;  2M87 A;  2PMH A;  3AL0 B;  3Q9S A;  5J1R A;  2NVQ J;  1XGN A;  4HW0 A;  1CF7 B;  4AVZ A;  2ZJP F;  3L2W A;  3RSN A;  3PQJ A;  3PNV A;  2VPL A;  1Y0N A;  4HZF A;  2A68 F;  2FSW A;  2HDW A;  5F0C A;  3GX4 X;  1Z6R A;  1ZRC A;  2XAJ A;  4MO7 A;  1YIJ I;  1BOB A;  1N75 A;  3H5N A;  3R0J A;  3F8F A;  3W3C A;  2JVH A;  1WI3 A;  2RKH A;  4ZZL A;  1HLV A;  2HOS A;  4HNU A;  1BIA A;  2PFB A;  5ILU A;  2K9N A;  4NNJ A;  3IC7 A;  3FM3 A;  4HBL A;  4Y7N J;  2XRL A;  2L9S A;  2VC0 A;  4IXA A;  1FWZ A;  3CDH A;  3KFW X;  3R61 A;  2WB1 A;  5D8K B;  2R4G A;  2YSR A;  5DM6 F;  2Q1Z B;  3K70 D;  1T0F A;  1WH5 A;  3RYR A;  4BBS J;  4GFB A;  2B7E A;  4IHW A;  5GAE J;  2X6X A;  1ZQ3 P;  3HRM A;  4JX5 A;  1ZG1 A;  3M4O J;  4F55 A;  2CRG A;  4XLE A;  3NQO A;  2VJJ A;  1FIP A;  4FTH A;  4BE0 A;  3WGI A;  3LNQ A;  1QGP A;  4F92 B;  1J75 A;  2H1K A;  1BIB A;  2EFN A;  3VYU B;  2Y75 A;  3GTL J;  3RPU A;  3KLO A;  3OL3 A;  3NWS A;  5FFX A;  4RAG A;  3FKJ A;  2LK2 A;  1XS9 A;  2R5Y B;  1R00 A;  2V4J C;  5BMZ A;  1BL0 A;  4PJ0 C;  5FB2 A;  3CF5 F;  5EZG A;  2LMD A;  2MSY A;  3KZI C;  4ZJZ A;  2FQ3 A;  4CXF A;  4M9Z A;  5K1Y A;  4PGH A;  1B8I B;  3GZN B;  3KP5 A;  4KUM A;  3F3X A;  2B0L A;  3BR2 A;  4Q48 A;  1WVR A;  3KP6 A;  5LRS A;  5FO5 A;  1DPU A;  2R7Z J;  2R3S A;  1T08 B;  2O9L A;  2ZSH B;  5BPD A;  1P7J A;  4BHP A;  3IH3 A;  2DQL A;  5KAI C;  4BKX A;  2ISY A;  3ASN H;  3MZ8 A;  5FLX Z;  1Q1V A;  1YJ9 I;  5M3F J;  2EH3 A;  2QUF A;  1K4T A;  1SC7 A;  3HOZ J;  3GME A;  3U21 A;  1UG2 A;  3GZ5 A;  4QIW N;  4QLC U;  2MAB A;  2DYS H;  3HXL A;  1PUE E;  3HSR A;  5F0F A;  4DGW B;  2FRH A;  2HZT A;  4C9Y A;  4U88 A;  2F5F A;  2UXN A;  2XRN A;  4BHC A;  3DFG A;  4X6A J;  3JTH A;  4RDU A;  2R92 J;  4L5I A;  3REO A;  1JHH A;  1FMW A;  3CP8 A;  5CKT A;  1R9T J;  3BR6 A;  3CC4 I;  5E1X A;  2NAZ A;  3E6M A;  2DW4 A;  4GO1 A;  2D5V A;  2VLA A;  3D5S C;  3OS2 A;  2OTL I;  1WRJ A;  2F4I A;  4HG2 A;  5J8F A;  2WC2 A;  3QPT A;  4XR6 A;  2NOJ B;  4XOP A;  2ZC2 A;  1KQ8 A;  3MQ0 A;  2JUC A;  4KN7 X;  4G6T B;  3FIW A;  3FHZ A;  3I58 A;  3N4M A;  2F4O B;  2VE9 A;  1MJB A;  1X1A A;  3IKT A;  2ZJ2 A;  2HOE A;  2E36 A;  5L3E A;  2BXZ A;  1TWC J;  2XAH A;  4G7Z F;  1U8B A;  4A3B J;  4UB8 C;  3M7G A;  2OU2 A;  4BJT A;  1JUP A;  3QU6 A;  1VQM I;  4RLQ A;  1EKE A;  1MH3 A;  3ML6 A;  2P5K A;  5FD5 A;  2B63 J;  4MEY F;  4DZP A;  2P6T A;  1PP7 U;  2PI0 A;  2JRT A;  3S2H J;  2DA1 A;  2EA2 A;  1XDS A;  2VBZ A;  2Y69 H;  3SHF A;  3CC2 I;  2PJR B;  3HBL A;  1FBU A;  4YIF A;  4AYB N;  1MBH A;  3FXM A;  4EGY A;  1MIJ A;  2CMP A;  4BXF A;  1ONV A;  1IXC A;  2DFI A;  2L2O A;  3KP4 A;  2EIM H;  3I53 A;  3OYE A;  4NQW B;  5JLX A;  3RKX A;  3OYH A;  2Q8K A;  4CCM A;  2HPM A;  1J59 A;  2XDV A;  3DPL C;  2XPV A;  3F21 A;  2DA2 A;  4ZZD A;  4XIC A;  2Y9Z A;  1NH3 A;  4U87 A;  1UB9 A;  2L5Q A;  3I54 A;  4HA8 A;  2HGC A;  4XLC A;  5LLQ A;  1UHS A;  2MA3 A;  2BW3 A;  2CU7 A;  2E7W A;  2P8T A;  4ZYD A;  2EZH A;  5EGO B;  2OV7 A;  1K83 J;  1PDN C;  3E6B A;  2EPF A;  4AVP A;  2KJC A;  3PIP F;  5J3L A;  3MKL A;  2BY1 A;  4KT6 A;  2BEO A;  3BR1 A;  5ICC A;  1ZLJ A;  4IQJ A;  4BDY A;  2E1M B;  4IVN A;  2M1B A;  3Q0V A;  1YHQ I;  1YQA A;  1I5Z A;  1U78 A;  1FOY A;  2VBX A;  3ELK A;  1N77 A;  3GTJ J;  3UKG A;  3A02 A;  2WAE A;  4PCQ A;  5FJ8 J;  3KET A;  3JRF A;  2W00 A;  4RAZ A;  5ICE A;  3ZQQ A;  4V19 K;  2LKS A;  1YX5 A;  2ZKZ A;  4R8H A;  5HS7 A;  1BI3 A;  3R6S A;  1D1B A;  2COM A;  3DU5 A;  1MMN A;  1RKW A;  2NXN B;  2O3F A;  3H36 A;  3H1C A;  3KEO A;  2ZCW A;  2H94 A;  2HYJ A;  5DCF A;  3HTU A;  3W6J B;  3BG9 A;  1MBK A;  5F1J A;  2GQQ A;  1E2X A;  1P9Q C;  2FD5 A;  1ZG5 A;  1NHA A;  1U9N A;  1UCR A;  2M2E A;  2IJL A;  3E3V A;  5CVJ A;  2IAI A;  2STW A;  2LY1 A;  3PFI A;  1G59 A;  4WK8 F;  1SMT A;  3IAS 2;  4KNY A;  1ETQ A;  5J47 A;  3S32 A;  4HX4 A;  5DD4 A;  4UHT A;  4Y33 A;  5JHF A;  2O8X A;  1MDM A;  2MYS A;  2DYR H;  2WAD A;  2WAQ A;  3QU3 A;  1XGM A;  3V7C A;  2GIV A;  2BYV E;  2HYG D;  4KIF A;  2JQ7 A;  5DYM A;  3CDI A;  2G0E A;  2MC4 A;  1TWF J;  2HVQ A;  4JOM A;  2RNJ A;  3CD6 I;  5HLT A;  2HTJ A;  3LWF A;  2IGM A;  1XTA A;  3ZQH A;  1IC8 A;  2YX4 A;  2H8R A;  2V26 A;  5KVR A;  1AWC A;  1AKH B;  1I50 J;  4J01 A;  5E1Z B;  4RGU A;  4A3K J;  3HDD A;  1USS A;  2ELJ A;  2IGN A;  2FE3 A;  3PNY A;  1MKM A;  4D0P A;  1RI7 A;  4OMY A;  2XPU A;  3S15 J;  5HNH A;  3ONQ A;  4I98 B;  1HF0 A;  1V55 H;  4TV7 A;  3QYE A;  2DO7 A;  4CYD A;  3J81 K;  2NS0 A;  1KYW A;  4P5O A;  5E17 F;  2CUE A;  4IOC F;  3HOV J;  4FET A;  1I6X A;  4L18 B;  3J7A Y;  4R79 A;  4JX4 A;  2K5C A;  2NRA C;  2V1N A;  5HVQ C;  2WAQ N;  4KIS A;  3WOD F;  3TO6 A;  3CCJ I;  1IDZ A;  1U2W A;  1LKX A;  4HNT A;  4ENJ A;  3HB9 A;  4PJN A;  3AG4 H;  3MZH A;  3MKZ A;  2LD5 A;  4MIM A;  2KIQ A;  1YI2 I;  1ZRE A;  3OS1 A;  2GZW A;  1BA5 A;  1OCP A;  3OYJ A;  2KL4 A;  5DUK A;  3VPR A;  3S14 J;  2W4S A;  4S0H B;  2LVS A;  3HM5 A;  3LSM A;  3OMY A;  4A0Z A;  4BAC A;  4WF2 A;  4DYQ A;  4IRI A;  1XD7 A;  1Z77 A;  2Y0M A;  1SAX A;  4ESF A;  3M8E A;  5E8G A;  3V8J A;  4HX7 A;  4KJZ A;  2RGV A;  5J8C A;  3ABT A;  4ZTJ A;  4PZJ A;  1LE8 A;  1S72 I;  1H88 C;  2PLY A;  2E35 A;  4LOC A;  3W6V A;  3D5L A;  3GXO A;  4Y15 A;  1FPQ A;  3ASO H;  5F04 A;  1ODD A;  3TQN A;  5IOY A;  5F27 A;  1QQI A;  3IWF A;  1RET A;  4PJL A;  3CCE I;  1MMG A;  4IZZ A;  1I1G A;  2QF7 A;  3BRO A;  3J7Z I;  4Q47 A;  2DT5 A;  3D1N I;  2VJ4 A;  1FIA A;  3K1P A;  4AM3 A;  1RUN A;  3S3O A;  2KDO A;  5J40 A;  1GV5 A;  4JK1 X;  2E71 A;  2C6Y A;  4J19 A;  4UVB A;  2R7R A;  5FGM A;  5J4V A;  3FMR A;  2XUB A;  4XM3 A;  2LBF B;  5IYB J;  1ZR4 A;  2A05 A;  3M07 A;  2YS9 A;  2VIX A;  3FXK A;  1VQN I;  1LUJ B;  2Y31 A;  5DM7 F;  2K9M A;  2X0L A;  3WHC A;  3OYC A;  2HPI A;  3IWZ A;  1HA8 A;  2HXO A;  1N78 A;  3JSP A;  3DKW A;  2JSC A;  2LTP A;  4U0W A;  3TL4 X;  3G1O A;  2H27 A;  1ON1 A;  4IHX A;  5HLG A;  4ASN A;  2VUM J;  3KEQ A;  2X51 A;  3GUD A;  3BTJ A;  4N9I A;  1Z7U A;  2IS4 A;  5LEK A;  1LEA A;  1BW5 A;  2Y0S N;  2LF7 A;  1FYM A;  1IUY A;  2X1E A;  1JTY A;  1O3T A;  2HDC A;  1W0U A;  1TNS A;  3HOX J;  2ME0 A;  4I76 A;  4GRI A;  1QA6 A;  4RGS A;  3WU0 A;  2UXX A;  4HDU A;  4XBF A;  2N8G A;  3OR2 C;  3G71 I;  1MBJ A;  3WTS C;  4CSW A;  1K78 B;  1K61 A;  3OIP A;  4BJ5 C;  1SEU A;  5AON A;  4ZDL A;  5IP7 J;  5M5W J;  4RMN A;  3HGY A;  4HX8 A;  5BS6 A;  4A3C J;  1KQ0 A;  3OYM A;  2IXS A;  1XMX A;  2M4K A;  4BY1 J;  2ISZ A;  1J0R A;  3OYF A;  1ZYR F;  3N05 A;  1MD0 A;  3CJT B;  1P6R A;  2M4G A;  2O5R A;  5GP9 A;  5IPA A;  3A2K A;  2I5U A;  1UG0 A;  4B1R A;  3V7S A;  2XIG A;  4OMZ A;  1X4P A;  3IH2 A;  1HOM A;  2ZXH A;  1R58 A;  3BQZ A;  4BS9 A;  3HL2 A;  3G4S I;  2V6E A;  1EH6 A;  1S7E A;  1CF7 A;  4WXH A;  1XG1 A;  2A5Y B;  2V9V A;  1Y1W J;  3IV5 A;  2ID6 A;  3ZOB A;  1S3J A;  2FF4 A;  1Y0U A;  3FIS A;  4M74 A;  2M9H A;  3E97 A;  3L09 A;  4MQV A;  1BJZ A;  3GTO J;  2CH0 A;  3AG1 H;  4A3E J;  1UJ8 A;  4ZYH A;  1I1S A;  3CCY A;  4O3M A;  3RKY A;  1UMQ A;  4FQG A;  1SAN A;  1ETW A;  1X2M A;  2DLL A;  4A6E A;  4L5E A;  5FKL A;  3UR3 C;  3BCA A;  3S8P A;  4LLN A;  2PEX A;  4RB3 C;  3DP7 A;  3FMS A;  2VJ5 A;  2WB1 N;  4IF4 A;  2L3D A;  3ZPL A;  1IV6 A;  5F64 A;  4ZDO A;  2VXD A;  3K1N A;  4HRI A;  1YJW I;  1X19 A;  4MGR A;  3LSI A;  3EYI A;  4E7S A;  5HS8 A;  4P96 A;  2QEX I;  1MGT A;  2XSJ C;  2EFQ A;  3BR5 A;  2ZBK A;  2D1V A;  1FTZ A;  4EM1 A;  4EAT A;  3ZMS A;  3ZMU A;  2MW8 A;  3L00 A;  3C2H A;  3S1N J;  1P7I A;  2IW5 A;  2CGP A;  2EZK A;  2VJI A;  3LL7 A;  4K2E A;  1C0W A;  5DD8 A;  2K86 A;  2XV4 S;  2EIN H;  4RB0 A;  3J7A O;  2Y2Z A;  2BE5 F;  2Y48 A;  3I9V 2;  2PJP A;  4L5J A;  1LPQ A;  2M3A A;  2DFF A;  1Y56 A;  3GBG A;  1T38 A;  5EGO A;  3G1M A;  2FUG 2;  1MBF A;  2TDX A;  3EET A;  4NDL A;  1FT9 A;  4WCG A;  3NWT A;  3T0Y A;  3QOP A;  3E0J B;  2DI3 A;  3WE2 A;  4YFK F;  2YPR A;  3Q5F A;  2BHZ A;  1FZP B;  2QA4 I;  2G7H A;  4OIO F;  4A3L J;  1IRG A;  2YR2 A;  3S17 J;  3I4P A;  1WZ2 A;  3DF8 A;  2DOA A;  3PSI A;  5LD2 C;  2JA6 J;  3LSG A;  1WJ5 A;  3A01 A;  3O8H A;  2WA0 A;  5D6F A;  4ETS A;  4EJU A;  1R71 A;  2UWM A;  1AU7 A;  1R4N B;  3KP7 A;  3CF2 A;  3CO7 C;  2E1C A;  1RR7 A;  2HS5 A;  4O5V A;  5D5X B;  5DCM A;  4NBQ A;  5DS9 A;  5E3M A;  4ZYA A;  3JCU C;  2JA5 J;  1XSV A;  4FT8 A;  2VB6 A;  5CQG A;  3VDX A;  4DJA A;  2X4H A;  1LFU P;  5E1W A;  2PX9 A;  3L2C A;  3C1D A;  1MH4 A;  1SFK A;  3F8N A;  4CH7 A;  4LIV A;  1XCB A;  3OYN A;  4U0V A;  2MLK A;  1PYV A;  2ME6 A;  3IL2 A;  1BN5 A;  4HQM A;  3JRE A;  1O57 A;  3F0C A;  2P7V B;  1GDT A;  2LDU A;  3ISP A;  4M6X A;  1H0M A;  3J81 Z;  3K2A A;  3BG3 A;  4Y13 A;  2P7C B;  3F22 A;  3KZY A;  5A2Q K;  1YIO A;  4RM3 A;  1XGS A;  3FMQ A;  4RGR A;  2KMU A;  1YIT I;  1R5I D;  2OD5 A;  1JJ8 C;  1FBQ A;  1JUS A;  3LFU A;  5C4X J;  1IJW C;  2M45 A;  5IP9 J;  3OS0 A;  1Y6I A;  4BQO A;  4KFC A;  1X3U A;  4XRS G;  3LMM A;  3WU2 C;  4BE1 A;  1MJ9 A;  1K6Y A;  1GV2 A;  1U9O A;  1S7O A;  5L3F A;  5H6R A;  1JKR C;  4KMF A;  2V7F A;  3HPG A;  5FKN A;  2KDZ A;  4LK0 F;  1LFB A;  2M5W A;  3OYG A;  1YW7 A;  2E19 A;  2JT1 A;  2PQ8 A;  4FCY A;  3DLL F;  1IW7 F;  1WJF A;  3CC7 I;  4R1H A;  5EF6 A;  2A69 F;  2R7D A;  4EMS A;  2P5L C;  1R22 A;  4A2U A;  3AAF A;  3EUA A;  3WHB A;  1A04 A;  2EA4 A;  1TNT A;  3P7N A;  2LLK A;  2KRF A;  1LE8 B;  1ON2 A;  2QGU A;  2GAU A;  1TT5 B;  1FP2 A;  1TQI A;  1QPM A;  5TGT A;  1IGN A;  1GHC A;  1WPK A;  4JBA A;  2PG4 A;  2ID3 A;  3G2B A;  2QBY B;  2Q2E A;  5C44 J;  1BC7 C;  1LFP A;  3ERE D;  1KU7 A;  3L2U A;  1NG6 A;  1OKR A;  2XAG A;  1QO0 D;  3QP5 A;  1KQ9 A;  2FBH A;  2O61 A;  5HDN A;  4HF0 A;  2EJR A;  4CZC A;  4M3D A;  2E2H J;  4OIN F;  1YYV A;  1RES A;  2X48 A;  1QVU A;  3SYT A;  2YUS A;  2W1O A;  1BOA A;  2OPT A;  1RR8 C;  3WTZ A;  3P5J A;  1YW8 A;  4A5M A;  3QYB A;  2CFO A;  4G8X A;  3LSR A;  3IAM 2;  2HNH A;  4AC0 A;  3CMY A;  4C30 A;  4XL9 A;  2JUG A;  5BNG A;  4F52 A;  3I56 I;  5D5U B;  3O3K A;  2A6H F;  1G6N A;  4A3I J;  4FIS A;  1T8I A;  3L1P A;  3HOT A;  5LGU A;  1EH7 A;  2QEN A;  3DCF A;  4DBR A;  2X1C A;  3RJP A;  2F2E A;  4LLG F;  5D4S A;  4B3X A;  4CYC A;  5L3D A;  4XSZ F;  5JVG F;  4RAY A;  4G12 A;  3AG3 H;  2X1D A;  1VQ9 I;  5KHD A;  3CCM I;  1VQP I;  3BG7 A;  5B1B H;  1ETY A;  4S04 A;  4ITV A;  5CPR B;  1V5G A;  2X85 A;  4G94 A;  3H0G J;  3VYT B;  1ERD A;  1Z6T A;  4YG2 F;  5E8I A;  3KP2 A;  3FXU A;  4NUB A;  4IHV A;  4P55 A;  4PSW A;  5J1U A;  3WTW C;  2DMN A;  2O6G E;  5DUI A;  3ULQ B;  3H3V K;  5LBQ A;  1O3S A;  3TBI A;  3V7R A;  4HAM A;  2R7Q A;  1DQU A;  2ACJ A;  1A6I A;  5C4J J;  1B6A A;  4PFO A;  1BC8 C;  3B6A A;  3H3U A;  1XMK A;  1IG7 A;  2RC4 A;  1KU9 A;  2L9V A;  4RBO A;  3DTE A;  4XKV A;  2DTZ A;  3ABM H;  2FX0 A;  4I99 C;  2MGQ A;  3WTY C;  1EH8 A;  3NAU A;  2DTR A;  3SZP A;  1NK2 P;  5BQT A;  3TGN A;  2KZG A;  3M1E A;  2DJI A;  1IO2 A;  2XAS A;  3J80 K;  1U6G A;  2ECB A;  4LG3 A;  4BYY A;  3BQY A;  4CA0 A;  4CCJ A;  3QOE A;  3X2Q H;  5FKM A;  4XLN F;  1ZAR A;  2DFE A;  2FML A;  5IP6 A;  2E2J J;  4PDK A;  1ZN2 A;  1F9N A;  4FX0 A;  5DV5 A;  5H2F C;  4YRV A;  3PIO F;  1P4W A;  1BBY A;  2F5V A;  5K5R A;  3ZP5 A;  4E7K A;  3KPH A;  2XSD C;  2V9P A;  1JE8 A;  2ZME A;  2FXA A;  1B8I A;  2LG4 A;  3BWG A;  1BR2 A;  1ZTR A;  2WY7 Q;  1ZH5 A;  4A3D J;  3O8G A;  2EV0 A;  3FX3 A;  3D5R C;  1U5T B;  1I3Q J;  4DYC A;  2KJB A;  2EB7 A;  2RNG A;  3PO2 J;  4EJV A;  4I02 A;  3S93 A; 
#chains in the Genus database with same CATH homology
 3JRG A;  1ZKG A;  2CUE A;  1EF4 A;  3HOV J;  4JX4 A;  1OJL A;  1Y1V J;  1BW6 A;  1VF9 A;  2DMQ A;  2WAQ N;  3BG5 A;  3GTM J;  3JR9 A;  5IOZ A;  4MFE A;  3ZQG A;  3FK7 A;  1IDZ A;  4AUX A;  1WH7 A;  2DA5 A;  3NAR A;  2VKV A;  3HB9 A;  5E3L A;  3BTI A;  2LD5 A;  4MIM A;  5EG0 B;  4M6V A;  1BA5 A;  1OCP A;  4JP0 A;  3VPR A;  3QQA A;  3S14 J;  1JTX A;  2M0C A;  2I10 A;  1H8A C;  4S0H B;  2LVS A;  3HM5 A;  4BBR J;  2CQX A;  2CUF A;  2HXI A;  4DYQ A;  1Z77 A;  3CQZ J;  1ZK8 A;  1TC3 C;  2NS7 A;  4D5F A;  4IEJ A;  4MLO A;  2L7M P;  1H89 C;  4DZJ A;  1G2H A;  1LE8 A;  3PO3 J;  1H88 C;  2L0K A;  3W6V A;  4LOC A;  2COB A;  5F04 A;  3G1L A;  5F27 A;  1T56 A;  2X6O A;  1RET A;  5FKK A;  5F08 A;  5IOY A;  2GLO A;  2QF7 A;  1JKQ C;  1ORK A;  4M3F A;  5FLM J;  3D1N I;  2HQ5 A;  3BT9 A;  1FIA A;  4UUS A;  1JJ6 C;  1GV5 A;  1Z0X A;  1HDD C;  4XK4 A;  2NVX J;  4J19 A;  2NVY J;  5IYB J;  1ZR4 A;  4DYR A;  2YS9 A;  1W0T A;  3RKQ A;  2Y31 A;  5GPC A;  2L9R A;  3WHC A;  1ETX A;  2DMP A;  2JA7 J;  1QRY A;  1IRZ A;  2HXO A;  2DMT A;  2LTP A;  3G1O A;  4IHX A;  2VUM J;  1PUF A;  3HGG A;  4XRM A;  2HI3 A;  3BTJ A;  1NTC A;  2JK3 A;  2DJN A;  3Q0W A;  2TCT A;  3HOU J;  1T33 A;  1BW5 A;  2Y0S N;  1O4X A;  3IH4 A;  4B4C A;  5C3E J;  4A69 C;  2CQQ A;  1JTY A;  3S2D J;  1W0U A;  2JMW A;  3HOX J;  2ME0 A;  4I76 A;  2EZL A;  1JKP C;  2EQR A;  3TED A;  2NOG A;  2DA6 A;  2L7F P;  1IUF A;  2K9Q A;  2N8G A;  2QCO A;  4M3B A;  1MBJ A;  1ETO A;  4ABZ A;  1D5Y A;  1K61 A;  2HDD A;  5IP7 J;  4QSH A;  5M5W J;  3HGY A;  3TP0 A;  2RAE A;  4A3C J;  3S16 J;  5EYR A;  3E7L A;  1I6H J;  2GM4 A;  3HKZ N;  4JX6 A;  3OSG A;  1APL C;  2XB5 A;  4MFD A;  2K9S A;  2M8G X;  4BY1 J;  1SFO J;  5M5Y J;  1OFC X;  1RKT A;  5GP9 A;  5IPA A;  4B1R A;  2ECC A;  1TWH J;  5M5X J;  4W97 A;  2XGE A;  3IH2 A;  2LKX A;  1HOM A;  4M3E A;  3BQZ A;  3JRD A;  2R5Y A;  3BTL A;  1S7E A;  5EDN A;  4UUT A;  1XG1 A;  3GTQ J;  1Y1W J;  3IV5 A;  2ID6 A;  3ZOB A;  3S1Q J;  4W1U A;  3FIS A;  2PMZ N;  3K7A J;  5JLW A;  2M9H A;  3BTC A;  1BJZ A;  9ANT A;  2DA4 A;  4D7N A;  2FQ4 A;  3DEW A;  3SFI A;  3GTO J;  4A93 J;  3FK6 A;  4A3E J;  2VI6 A;  3RZO J;  2NS8 A;  3HOW J;  3CCY A;  1X2N A;  1UMQ A;  5J1R A;  2NVQ J;  2VPR A;  1SAN A;  1ETW A;  3B6C A;  2O7O A;  1X2M A;  4L5E A;  5FKL A;  4XRS A;  5DTD A;  2WB1 N;  4BXX J;  2XB0 X;  1IV6 A;  1JT6 A;  5F0C A;  4MO7 A;  3BR5 A;  1NK3 P;  2W48 A;  3GTK J;  1FTZ A;  1WI3 A;  1HLV A;  2R0Q C;  2HOS A;  2MW8 A;  2Y30 A;  5EG0 A;  3S1N J;  1B72 B;  1P7I A;  2K9N A;  3GTP J;  2EZK A;  4Y7N J;  2XRL A;  2XPW A;  1XC5 A;  1YRN B;  3OIO A;  2Y2Z A;  3FKI J;  3GBG A;  5EGO A;  3G1M A;  1WH5 A;  4BBS J;  1MBF A;  4GFB A;  4IHW A;  4NDL A;  1ZQ3 P;  3CDL A;  2NVT J;  4JX5 A;  1MSF C;  3M4O J;  2CRG A;  3JRA A;  1QVT A;  4A3L J;  1GVD A;  1FIP A;  4FTH A;  3S17 J;  4CYC B;  3BR0 A;  3LNQ A;  2JA6 J;  2AO9 A;  3LSG A;  5F0H A;  1ITY A;  3A01 A;  2H1K A;  3O8H A;  2LFB A;  3GTL J;  4A3M J;  1AU7 A;  5M3M J;  1ZGW A;  1RR7 A;  2LK2 A;  1XS9 A;  2R5Y B;  5DS9 A;  2L7Z A;  5E3M A;  1BL0 A;  2JA5 J;  2ELK A;  5EZG A;  1LFU P;  3TW6 A;  1HCR A;  2MSY A;  1WGX A;  1MH4 A;  4BY7 J;  1B8I B;  3RQI A;  1FEX A;  3BR2 A;  2ME6 A;  3S1M J;  1MNM C;  3ZQI A;  3JRE A;  2R7Z J;  3F0C A;  3OOU A;  1GDT A;  3Q0U A;  2O9L A;  1P7J A;  3IH3 A;  3K2A A;  3BG3 A;  2GBY A;  4BKX A;  4EEF G;  1E3O C;  2EZI A;  1Q1V A;  5M3F J;  2EH3 A;  2FJ1 A;  3HOZ J;  2R5Z B;  1JJ8 C;  1UG2 A;  4QIW N;  1FTT A;  1JUS A;  5C4X J;  1WCM J;  1IJW C;  5IP9 J;  3LSJ A;  3QPL A;  5F0F A;  2LP0 A;  4XRS G;  4V2G A;  2R5Z A;  2YU9 J;  4X6A J;  4RDU A;  2R92 J;  1GV2 A;  1R9T J;  1F43 A;  1U9O A;  2P81 A;  4IHY A;  3M3Y J;  3BR6 A;  2DA7 A;  1JKR C;  2D5V A;  4DW6 A;  4FE4 A;  5FKN A;  2KDZ A;  1LFB A;  2E19 A;  4FCY A;  2LR8 A;  2HOT A;  5EF6 A;  3FIW A;  3WHB A;  2M34 A;  2DA3 A;  3TW7 A;  2LLK A;  4Y52 J;  2E2I J;  5FKO A;  5J1Y A;  1TWC J;  1U8B A;  1IDY A;  1F36 A;  1LE8 B;  4A3B J;  4M3G A;  2K40 A;  1JUP A;  1IGN A;  1WPK A;  1MH3 A;  1RPW A;  5EEA A;  3S1R J;  2B63 J;  4DZP A;  1VND A;  1YRN A;  2ID3 A;  4UUS B;  2JWT A;  2TRT A;  3S2H J;  5C44 J;  2DA1 A;  3I4N J;  3Q3S A;  3SDG A;  5HOD A;  3HBL A;  4AYB N;  1MBH A;  3ZQF A;  3A03 A;  2CJJ A;  1POG A;  4I6Z A;  2KT0 A;  4M3D A;  2E2H J;  3BR3 A;  3LSP A;  2JJ7 A;  1RES A;  2X48 A;  1AHD P;  2VKE A;  1QVU A;  2JN6 A;  2YUS A;  5JLX A;  2OPT A;  1FJL A;  3JRH A;  5K7H A;  5IYD J;  4C3J J;  1AKH A;  5K7Z A;  2IEK A;  3TP3 A;  1B72 A;  2HOA A;  3LSR A;  3CMY A;  4JYK A;  4AC0 A;  3ZQC A;  2XPV A;  3PM1 A;  2DA2 A;  4XIC A;  4A3J J;  2IBD A;  5BNG A;  2Y9Z A;  4A3I J;  1TWA J;  4FIS A;  3L1P A;  2Y9Y A;  3LOC A;  2XGC A;  1MBE A;  1GUU A;  1DU0 A;  1GT0 C;  1UHS A;  2E1O A;  2CU7 A;  3DCF A;  2EZH A;  5EGO B;  1K83 J;  4CYC A;  3JRI A;  2JA8 J;  2OF7 A;  5J3L A;  5K7F A;  5FLV A;  3MKL A;  4G12 A;  2ZB9 A;  3BR1 A;  5E3O A;  3Q0V A;  1ETY A;  3QPS A;  2MG4 A;  1U78 A;  3H0G J;  1JUM A;  3GTJ J;  3UKG A;  3OSF A;  3A02 A;  4IHV A;  3MN2 A;  5FJ8 J;  3A01 B;  3JRF A;  1ZR2 A;  5J1U A;  4C2M J;  2DMN A;  2O8K A;  5EZH A;  1QPI A;  4C3H J;  3H3V K;  1PUF B;  3MVP A;  4D7M A;  1A6I A;  5C4J J;  1RKW A;  4X1E A;  1X58 A;  3HEF A;  3B6A A;  3JRB A;  1IG7 A;  2DMU A;  2HYJ A;  4RBO A;  2DTZ A;  2AHQ A;  2FX0 A;  3BG9 A;  1MBK A;  3ZQL A;  5F1J A;  1ETV A;  2XGD A;  2MGQ A;  3C2B A;  2FD5 A;  1HDP A;  3NAU A;  1MBG A;  1U9N A;  1VI0 A;  2LY9 A;  2M2E A;  1CQT A;  2IAI A;  3JRC A;  1NK2 P;  3I4M J;  1OCT C;  1ETQ A;  4D5C A;  1DU6 A;  4A3F J;  2ECB A;  1JT0 A;  3BQY A;  2WV1 A;  4FE7 A;  5FKM A;  1JKO C;  1ETK A;  2E2J J;  5IP6 A;  5IYC J;  4XID A;  4HNV A;  4A3G J;  3HOY J;  2G0E A;  1TWF J;  3SJM A;  3ZQH A;  2X9D A;  1IC8 A;  2H8R A;  4B3A A;  2R93 J;  1AKH B;  1I50 J;  2XSD C;  2DN0 A;  5E3N A;  3GTG J;  1B8I A;  4A3K J;  3HDD A;  1TWG J;  1ZTR A;  2EBI A;  5GPA A;  4QTR A;  3O8G A;  3RZD J;  4A3D J;  1JGG A;  3S15 J;  2XPU A;  1ENH A;  1HF0 A;  4V2F A;  1I3Q J;  4DYC A;  1MSE C;  3PO2 J;  1A5J A;  4C3I J;  1VFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...