1ZQ3P

Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3'
publication title The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zq3P00
2M34A 1ETVA 1I50J 4IEJA 1OJLA 4DYQA 2L0KA 1JKQC 2OPTA 2JA7J 4JX5A 1JUMA 1BA5A 2DMUA 5FKLA 4A3DJ 2E1OA 1D5YA 2JJ7A 1FIPA 2PMZN 2H1KA 1ZGWA 3A01A 1JTYA 2KDZA 1UMQA 2HXOA 4BBSJ 2LTPA 1WGXA 3K7AJ 2R7ZJ 1NTCA 3JRFA 1I3QJ 4XRSA 1X58A 1DU6A 3BG3A 1JJ8C 2XSDC 5JLXA 1K83J 4D5CA 5F04A 5EG0A 2L7MP 3VPRA 1DU0A 2ECBA 1BW6A 2XGCA 4GFBA 2QCOA 3JRCA 4M3GA 5J1RA 5F0CA 2DA2A 3HBLA 1JKOC 3RZOJ 1U78A 2VKEA 2TCTA 1OFCX 2XB5A 3JRDA 3HDDA 3W6VA 4A93J 4QIWN 1WH7A 2ECCA 4DYCA 1HCRA 3G1LA 3M4OJ 3OSGA 1VF9A 1MBGA 2DA6A 3GTLJ 2XPWA 2QF7A 3PM1A 2JA6J 2P81A 2LD5A 5C44J 2NS8A 1BW5A 2YUSA 1W0UA 2G0EA 2DMQA 1B72A 2O9LA 3PO3J 4AYBN 2R5YB 1UHSA 1MBFA 2IEKA 3RQIA 1RETA 3FISA 4XICA 1LFUP 1ZQ3P 1T33A 3H3VK 1T56A 1JT6A 3IH4A 4V2FA 1GV5A 1ETKA 3M3YJ 4JP0A 3S16J 3GBGA 4A3LJ 4M3DA 1HF0A 3NAUA 3GTQJ 4RBOA 3Q0WA 2LP0A 3BR5A 1JJ6C 4UUSB 2LY9A 1TWHJ 2NVYJ 3BQZA 4A3BJ 2FD5A 2DMNA 2L9RA 4FE7A 1U9NA 3FKIJ 3JRAA 3JRHA 3K2AA 1WH5A 2YS9A 2JA5J 2GLOA 4I76A 2TRTA 4J19A 1FTTA 2LKXA 1WCMJ 3S1NJ 3ZQGA 4FCYA 1RKWA 5EZGA 1NK2P 1ZTRA 2CQXA 2E2IJ 3HOYJ 2MW8A 5GPCA 2XPUA 5K7ZA 2COBA 1LFBA 2YU9J 4DZPA 2Y9ZA 3ZQFA 2WAQN 2R0QC 4Y52J 5F0HA 1H89C 5EDNA 5FLMJ 1VI0A 3Q0VA 5M3FJ 5IOZA 2WV1A 1MBHA 4CYCB 1IUFA 2M0CA 1ZR4A 1MSFC 1TWFJ 2XB0X 3LNQA 2R5YA 1NK3P 3JREA 3D1NI 1B72B 4BY1J 3GTGJ 3A03A 2DTZA 4IHWA 2LLKA 3HEFA 5BNGA 2EQRA 5EEAA 4A3IJ 2ID3A 3BT9A 3OSFA 2RAEA 4M3EA 5IOYA 2CUFA 4UUSA 2JK3A 4B1RA 5E3NA 4A3CJ 1ETQA 3BR0A 5F0FA 1JUPA 5M5YJ 4NDLA 5C4XJ 4BKXA 3GTKJ 1ETXA 3ZQIA 1TWCJ 3S1RJ 2XPVA 5EGOB 2JWTA 4QTRA 5C3EJ 4C2MJ 3TEDA 4JX4A 3ZQLA 1E3OC 3RKQA 1H88C 1IDYA 2E2HJ 4XRSG 3Q3SA 2VPRA 1S7EA 3F0CA 4A69C 3BR2A 2MSYA 4MFDA 2CQQA 2FJ1A 3JRGA 4IHYA 3WHBA 3O8HA 2DJNA 3JR9A 2DMPA 1Z0XA 1AHDP 2K9NA 3DCFA 2E19A 1JKRC 4IHXA 1QVUA 1ZK8A 2HOSA 1U8BA 2EZKA 4X1EA 5M3MJ 1VNDA 2DA5A 5IP6A 5J3LA 3S2HJ 4CYCA 5F27A 2VI6A 1MBKA 1I6HJ 1AKHB 1IDZA 2DA4A 3WHCA 4C3HJ 5DS9A 5JLWA 5E3MA 4BY7J 2LR8A 1G2HA 4B3AA 1YRNA 3HOWJ 2DN0A 1IGNA 3LOCA 2K9SA 2L7ZA 3LSGA 4M3BA 1P7IA 1JTXA 4DZJA 3JRIA 2H8RA 3LSPA 1PUFB 3HOVJ 5F08A 1JUSA 3G1MA 2ME6A 3TP0A 3BG5A 4C3JJ 2HXIA 4UUTA 4D7NA 1GV2A 4JYKA 2XGEA 3TW6A 5F1JA 2AHQA 4XRMA 5GP9A 1RPWA 1TWAJ 1ZKGA 2XGDA 4W1UA 1HDDC 3MVPA 1F36A 4BXXJ 2CJJA 4MIMA 4IHVA 1LE8B 1MH4A 5EGOA 1P7JA 3BTLA 2X6OA 3CQZJ 2EZLA 2GM4A 2M8GX 5FJ8J 2EZHA 3A02A 4QSHA 2DA1A 2NS7A 3IV5A 1GDTA 3BG9A 5FKKA 1FIAA 4D5FA 5IYCJ 2L7FP 5EYRA 1K61A 4LOCA 3GTPJ 5GPAA 4FE4A 3TP3A 2VUMJ 2HQ5A 3BQYA 1ITYA 3S14J 2FQ4A 3SJMA 3FK6A 3S1QJ 4S0HB 2W48A 1Z77A 4XK4A 5K7FA 1POGA 2K40A 2EZIA 2NVXJ 2OF7A 3O8GA 4G12A 9ANTA 3L1PA 1QRYA 1AKHA 1EF4A 2HYJA 3IH3A 3LSRA 1B8IB 1WI3A 4AC0A 2DA7A 3GTOJ 1X2NA 5J1YA 2DMTA 1YRNB 2CRGA 1PUFA 4MO7A 1IRZA 2Y31A 4DYRA 4ABZA 2R5ZB 2HOAA 3S2DJ 5DTDA 2R93J 3S17J 2HOTA 1HOMA 2ZB9A 2LFBA 5FKMA 3C2BA 4MLOA 2GBYA 3QPLA 1QPIA 1JGGA 1ETOA 2X48A 1LE8A 3G1OA 1W0TA 1A5JA 4DW6A 4BBRJ 2JN6A 5E3OA 3SDGA 3SFIA 1O4XA 2M9HA 2HI3A 2FX0A 2LK2A 1GVDA 5FKOA 1ETWA 2ID6A 3HM5A 3S15J 2ELKA 1XG1A 2I10A 5HODA 4XIDA 1HLVA 3NARA 4C3IJ 4A3EJ 4A3KJ 3RZDJ 5C4JJ 3CMYA 1ZR2A 1ENHA 3H0GJ 2EBIA 1OCPA 4B4CA 1MBEA 3GTMJ 2NVQJ 3BTJA 2R92J 4L5EA 4M3FA 1F43A 1JKPC 1Y1VJ 4MFEA 4JX6A 2IBDA 2ME0A 3PO2J 3UKGA 3MN2A 1UG2A 4AUXA 4I6ZA 3GTJJ 3ZOBA 1TWGJ 4A3FJ 1JT0A 2NVTJ 3I4NJ 2XRLA 5IPAA 3ZQHA 3HOXJ 1B8IA 2D5VA 2Y2ZA 3TW7A 4FISA 4EEFG 1RR7A 3BR6A 2N8GA 4A3GJ 1FEXA 3HOZJ 1IC8A 3CDLA 5M5XJ 1H8AC 5EF6A 1A6IA 2O8KA 3ZQCA 2R5ZA 5IYDJ 1APLC 2NOGA 3FK7A 3BTCA 2IAIA 1GUUA 1XC5A 2AO9A 1IJWC 1ETYA 3FIWA 2CUEA 3Q0UA 4RDUA 5FKNA 1RESA 1Q1VA 3OIOA 4HNVA 1BJZA 1RKTA 4D7MA 4A3MJ 2Y0SN 1Y1WJ 1U9OA 3HB9A 1ORKA 3QQAA 1MSEC 4A3JJ 4X6AJ 1VFCA 3BTIA 3A01B 4M6VA 5IYBJ 4Y7NJ 1BL0A 1SFOJ 3QPSA 2X9DA 2Y9YA 5IP9J 2CU7A 3CCYA 3LSJA 4FTHA 1FTZA 1HDPA 1WPKA 1TC3C 5K7HA 1QVTA 1CQTA 2B63J 2E2JJ 3JRBA 1OCTC 5EG0B 2KT0A 2JMWA 2WB1N 2O7OA 1FJLA 2M2EA 1MBJA 1IG7A 3HKZN 2DA3A 2Y30A 2MG4A 5J1UA 2VKVA 4W97A 1AU7A 1IV6A 2LVSA 1X2MA 2MGQA 2EH3A 4V2GA 1MNMC 1R9TJ 1SANA 5EZHA 1GT0C 2JA8J 2K9QA 3HGYA 3HGGA 3E7LA 3B6CA 5IP7J 3HOUJ 3BR3A 1MH3A 5FLVA 3DEWA 5E3LA 2HDDA 3B6AA 3BR1A 1XS9A 3I4MJ 3IH2A 3MKLA 3S1MJ 3OOUA 5M5WJ
chains in the Genus database with same CATH superfamily
2AQFA 3F8NA 1I39A 1KYZA 2HZTA 1I50J 4IEJA 2QYOA 3MKZA 2L0KA 1BA5A 4AIKA 5J4YA 2DMUA 3TQNA 4IZZA 1XDUA 2FA5A 1GXQA 2XUBA 1D5YA 3DKYA 3CC4I 3CZ6A 1ZGWA 2X1DA 3G6EI 1ZAOA 4BQQA 2KDZA 3FHNA 3K4KA 5LRSA 4BBSJ 1WGXA 2KL4A 2EK5A 1I3QJ 4P96A 5E20A 3W6JB 4UNOA 4YIFA 5HLGA 3IKTA 1DU6A 4BQAA 3BG3A 3QPHA 4G6TB 2XSDC 1YQAA 4F93B 3J80K 5JLXA 1K83J 2GAUA 4D5CA 2L7MP 2IPQX 4HF2A 3QYFA 2D45A 3FM3A 2ETHA 2WV0A 3CTAA 2O0YA 2QCOA 4BL0B 1WFXA 4L9JA 4M3GA 3OYHA 4CCNA 2BEOA 3BG6A 2WTEA 1JKOC 3RZOJ 4LK0F 4GRIA 3H5AA 2XKOA 2X4HA 4AYBA 4RGSA 3WU0A 2BW3B 1FP2A 2XB5A 2CG4A 1ZN2A 2VONA 3V7CA 3VYSB 3KLNA 1WH7A 1K78A 3WU2C 4NB5A 3W2VA 1ULYA 1HCRA 4KMFA 3FHZA 1MBGA 2DDBA 2P7CB 1BOAA 4M6XA 4Y33A 1HW2A 3V7RA 2ZKZA 5J40A 4PJNA 2EFWA 2QQBA 2QSHX 3P9CA 4HNTA 1HC8A 1U5TC 4AM3A 1O7FA 4AYBN 3BJ6A 4UHTA 3H3VK 4GDFA 1FMWA 3GF2A 1Z6TA 1KZHA 3M3YJ 3CO6C 2K85A 3S16J 2HOEA 4M3DA 5DM6F 2OV7A 4ENKA 3L9FA 3Q0WA 1GHCA 2LP0A 2IA2A 4HSTA 1JJ6C 3HHHA 4UUSB 2LY9A 1T6SA 4PGHA 2HWVA 1B9MA 2NVYJ 3CP2A 4G8XA 1HSTA 1XB4A 4PCQA 1R00A 2BGCA 3KP7A 2ZC2A 2COMA 2X1EA 3HXLA 3FKIJ 3JRHA 2YS9A 3GO5A 4EATA 2L4AA 1EV7A 3GFMA 4I76A 3H3ZA 1VQOI 4HQEA 3D0SA 2EFQA 3F3XA 5J47A 6PAXA 1AA7A 3RQ4A 2HU9A 4HAMA 4DOZA 1YJNI 2QQ8A 4AVZA 3LAPA 4HRIA 1J0RA 2BW3A 2VASA 4EGYA 2IGNA 1S9HA 4BHPA 1ZTRA 2XHKA 3HOYJ 2OU2A 5BMZA 2MW8A 4XKWA 5GPCA 3HPGA 4PDKA 2HFHA 5K7ZA 4EVIA 2XAHA 2KJBA 1LVKA 4DZPA 3QYEA 2VBXA 2Y9ZA 4KISA 2ZBKA 2DK8A 2VODA 1X3ZB 4PJ0C 2JSCA 4Y52J 3OV8A 4PSXA 1Y0NA 3Q0VA 1WJEA 2W85A 5M3FJ 4E7LA 1WWXA 4IO9F 1V54H 2M0CA 1MSFC 1E17A 1SD6A 2FXAA 2MFZA 1RRJA 3RPUD 4BY1J 1QO0D 5FROA 1MMDA 1Z3XA 3WTTC 5EEAA 4I02A 2ID3A 5H20A 4ESFA 2DQLA 3K1MA 1MD0A 2E7XA 2OD5A 2M0MA 4M3EA 4ON0A 1MKMA 4EGZA 3MZ8A 4H4KC 2JRTA 3HJEA 2CUFA 4HQMA 4UUSA 5EJCA 3O2PE 2VOPA 3BR0A 1LQ1A 4BKXA 1ETXA 4RM3A 3EUAA 2P8TA 1U5TB 3COAC 1ACIA 1OCOH 1B6AA 2P6SA 2PMHA 5ERIA 2JUCA 2K4BA 1OR7C 2M8EA 5LBQA 2X0LA 2FBIA 1QGPA 2ZJRF 3ZQLA 1E3OC 3RKQA 2CMPA 3CCUI 1SVMA 3PNVA 2OC6A 2VPRA 1S7EA 3BPVA 3KYCB 3VSLA 3DPLC 4U0YA 2EFNA 2FJ1A 3GXOA 2DT6A 2FEZA 3SZPA 3ZCOA 2STWA 3E0JB 2DJNA 3OIPA 1JXSA 4N4OB 1QVUA 2K86A 1ZK8A 1O57A 5D5UB 3NQOA 2HOSA 1ZYRF 5M3MJ 1VNDA 1YFHA 3OMYA 2D2WA 3HHGA 5LGNA 5J3LA 4ITVA 3OYNA 1OQYA 1B1BA 1RI7A 2LKPA 3DP7A 5F27A 2VI6A 1X1PA 1MBKA 2ZNYA 1ZRDA 2K5CA 4WXDA 5CLSA 2HTJA 2CW0F 3GZ5A 5DS9A 3QODA 2HQNA 3P9KA 4LG0B 2P0WA 1G2HA 4B3AA 1YRNA 1W7PD 3LA2A 4RB2C 3F21A 2L7ZA 3FXQA 3HL2A 3CLQA 4A12A 3HOVJ 5F08A 3ZN0A 3DU5A 3G1MA 2RQPA 3TP0A 3L09A 4I98B 2UUZA 2HXIA 3DPTA 2L7KA 1GV2A 1OPCA 1W36C 4JYKA 2XGEA 1I5ZA 1VQLI 3GZNB 4XRMA 1YX3A 1RPWA 1U5TA 4W1UA 1F36A 2V9VA 2BXZA 4MIMA 4IHVA 1FC3A 3P7NA 4WK8F 4CSWA 1FYLA 2PBIA 1R1TA 1FBUA 1P7JA 2X6OA 3BTLA 3K70D 4KT6A 3HZJA 1GDTA 5J8FA 3RYPA 4D5FA 3I3LA 1HW1A 3O3KA 1G59A 2DAOA 2CQKA 3NEUA 5JHUA 3KP3A 1B9NA 5GPAA 1VQ5I 2O8XA 4Q48A 1J59A 2DW4A 2VQGA 4S0HB 4CCMA 2DK5A 1W5TA 2EZIA 2VL8A 5HS7A 2R3SA 1MJAA 9ANTA 2L9VA 1QHGA 5B1BH 3FXJA 2QQ9A 1WHUA 1EF4A 2RGVA 3IH3A 2X1CA 4F3QA 4LG0A 4OWRB 3EDPA 1B8IB 3A0HC 1WI3A 4AC0A 2EWNA 3ZR8X 3KZIC 2L9SA 5CKTA 2LNBA 2QM3A 1T08B 1DPRA 2L9NA 2Y31A 4E7KA 3J81K 3VEPA 4ABZA 5L3GA 1I1GA 3BJAA 1ZELA 4OAZA 2R93J 3V42A 4HF1A 4KMUX 2NNYA 3C2BA 2GBYA 4PJMA 2X48A 1SC7A 1E3HA 4DW6A 4G7HF 3LFUA 2H27A 4KN7X 2OUMA 3U9GA 2E7WA 3DTIA 3A0BC 1R1VA 5FKOA 4U7BA 2ICWG 2ID6A 2DQRA 2ELKA 1YW9A 1OCZH 2FE3A 1N25A 4B43A 3NARA 1S7OA 3I54A 5K5OA 3RZDJ 3GWZA 1KU9A 5C4JJ 4DBRA 4BH9A 1ZR2A 4LG3A 3H0GJ 2HYGD 3N4MA 3ECHA 4B4CA 1G3WA 3FXMA 3FZVA 5CQGA 1MW7A 3RKXA 4E7IA 4XM3A 3CLOA 4M3FA 4HLYA 3S32A 2QVOA 2ME0A 1OR7A 4IJAA 5AONA 4RMNA 5KNLA 1FBSA 2JT1A 2KIQA 5D4SA 1VQNI 1R5ID 3EQLF 2XRLA 2IW5A 1GVJA 3DTEA 3K9TA 4P1WA 1B8IA 2XIGA 2D5VA 2F5CA 4FX4A 4LJZF 5LHHA 2KZVA 1FY7A 1BC8C 1G8XA 1ZGAA 1FEXA 3W3CA 2LY2A 3CUQC 1NH3A 3CDLA 5M5XJ 1H8AC 4LLLA 2O8KA 4BAYA 2VQHA 2KISA 3KYDB 3WG9A 3FXOA 2DT5A 2IAIA 1FX7A 1GUUA 2DOAA 4KN4X 1XC5A 4G6QA 2W1OA 1R58A 1BI1A 1XN7A 1X1AA 2CUEA 2Q0OA 2CFOA 3S3NA 2L54A 3QPTA 1YW7A 3IHUA 5HS8A 3OIOA 4HNVA 5HLTA 3PUBA 1BJZA 1USSA 1IN7A 1U9OA 3QQAA 2KDOA 4H0EA 3LQQA 4DJAA 4ZYGA 5CQEA 4I99C 1VFCA 4N4NB 3D5RC 1LDDA 3P5JA 1SFOJ 2X9DA 3S2WA 1R23A 1BR4A 5IP9J 2DFHA 2V1DA 3OYKA 1FTZA 1WPKA 1YX5A 1OCRH 2KZGA 2PQ8A 1XMKA 4RAZA 3L00A 3JRBA 5E8GA 2ZJQF 2V26A 3T8TA 4AIJA 1X3WB 2EIKH 1XGSA 4Y4RA 5EEHA 1HSJA 5D5WB 4L0YB 2XAUA 4NQWB 1AOYA 2DA3A 4LMYA 4BUPA 2K3PA 5DCMB 2MG4A 2VKVA 1EA3A 4W97A 1AU7A 1MMGA 4QLCU 1IV6A 2HS5A 1QZYA 3MCZA 1MNMC 1PYVA 1GT0C 5HDNA 3JW4A 3HGYA 2HGCA 1ZARA 3HGGA 4FQGA 3A2KA 3QU6A 3K4JA 2X6YA 5FLVA 2HDDA 1QHHD 2J5OA 2VC0A 1XS9A 3I4MJ 3KP2A 2ADUA 2LG4A 2R7RA 5FD6A 2LRDA 4RGXA 2ACJA 2QUFA 3CCLI 4QPOA 2MABA 2MD5A 3JSPA 3E6BA 1D0ZA 4ZC3A 4ZYEA 2XSJC 2PJRB 3BZ6A 3H5NA 3G4SI 5H6QA 2F4MB 3Q9VA 4DYQA 3HG9A 2OPTA 2H09A 4JX5A 1JUMA 2A05A 4AD9A 4XONA 3RKWA 2AQEA 2L02A 3EPZA 2H1KA 1XCBA 2IGMA 3HTUA 1ON1A 5JFRA 1JTYA 1UMQA 2WY7Q 1IO2A 2HXOA 1AWCA 1E3PA 1NTCA 2GOXB 2LY1A 4II2A 1UAAA 3SFZA 3ZMVA 1JJ8C 4F92B 4O5VA 5DUKA 1X19A 5K1YA 1FZPB 2FNPA 5F04A 3IWFA 2GOMA 4FETA 5LGUA 3VPRA 4RB3C 1PP8F 3OS2A 3C3WA 4KIFA 4NQWA 5LHGA 2YPRA 1BW6A 2FBKA 2XGCA 2WWYA 5DCMA 4CYDA 1MMNA 5D8LB 5F0CA 4HBLA 5AIPA 2ZXIA 3HIFA 1ZRFA 4CHUA 2UV1A 4RA2A 2BY2A 3PUFA 3DWLE 1U78A 3BJOA 2QBYB 2K9LA 3WGHA 2MLGA 2XAGA 2R4GA 2VKEA 4XLFA 5D6FA 3GW2A 1OFCX 2P6TA 5BPIA 1A6QA 3R0AA 5E1XA 3JRDA 5D5VB 2DFFA 3MWMA 3HDDA 2F2EA 4AIHA 1BBYA 1Q1HA 4Z6YA 3G1LA 2FSWA 3CUOA 5KAIC 5JI6A 4HDVA 2DA6A 3GTLJ 2XPWA 2IA1A 2QF7A 5TJJA 5ICCA 4UUVA 2Q1ZB 1FOXA 2JA6J 2O03A 1R22A 2P81A 2BV6A 2DO7A 1CGPA 1BW5A 5FD5A 4U7DA 1W0UA 1QU3A 1KU3A 2G0EA 2MH9A 3KE2A 1YG2A 2DMQA 1B72A 3OYGA 2G7HA 2O5RA 1UHSA 1MBFA 3K10A 3PIOF 4XICA 1LFUP 1T33A 4IOCF 4FX0A 1GV5A 1ETKA 2P5KA 1HKQA 3S93A 1R4MB 3GBGA 1TBXA 1G3TA 2DDAA 1HF0A 2RDPA 3NAUA 2DPDA 2IS4A 1W5CC 3CJQB 2A69F 3E5QA 3BG7A 3RJPA 4B48A 4ENJA 1SD5A 2PEXA 4XMYA 4A6EA 4O6JA 4CA0A 1N78A 2QEXI 4A3BJ 4KICA 2DMNA 2L9RA 1BI2A 1TQIA 3QU3A 1P4AA 1FOWA 4HX8A 3JRAA 1WH5A 2JA5J 4OAYA 2X85A 2RN7A 2HVSA 4WXCA 3L7WA 4J19A 1CF7B 2FF4A 3IRQA 4IX7A 2R7XA 1EH8A 3WE3A 1V5FA 2QBYA 3BCAA 1WCMJ 3S1NJ 3BZKA 1RKWA 2WBMA 5EZGA 2E36A 3SHFA 3OYBA 2CQXA 5D5XB 1ZH5A 2EV5A 2PMUA 3AAFA 1ZG1A 4MTEA 3J7ZI 4JBAA 2COBA 1LFBA 3GMEA 4HLXA 3ZQFA 1QA6A 2RC4A 2O3FA 1H89C 3V8JA 3TOAA 3OYJA 2CV1A 2HPMA 2PLYA 1VI0A 3FXUA 4HV5A 4HX7A 2W82A 4UVBA 1K7AA 1O3RA 4BJTA 1HW5A 1L3LA 1IUFA 4F55A 1TWFJ 4UB6C 4L5JA 3F6OA 4L9VA 4CDGA 3C7JA 1Y56A 5L3CA 5BNGA 2E60A 2EQRA 5DD8A 3QYBA 1D0YA 1KQ0A 2HNHA 2XAFA 4CCLA 2OQGA 3ABKH 3I0TA 2NAZA 2JK3A 2WAEA 3CMMA 1ETQA 3ELKA 5F0FA 2GA1A 2OJED 3ZMZA 5C4XJ 1LDJA 3GTKJ 4IHTA 1X1CA 2A5WA 2OQRA 4PK4A 3ZQIA 4UV9A 1P9QC 3CCQI 5A2QZ 4X0GA 2GXGA 1Y6IA 2XAJA 2JWTA 4QTRA 2EA2A 3WGIA 3MFKA 1JE8A 1CF7A 2CV2A 4ZYHA 1YJ9I 3E1SA 4RLFA 4XRFA 2UWMA 4KFCA 2PG4A 2AS5F 1H88C 4M71A 2E2HJ 1B59A 2HTSA 3F0CA 3C18A 4Q4ZF 2Z9OA 3BR2A 2ZFUA 5CJ9A 2V79A 1FWZA 2MSYA 4MFDA 5CVVA 4KYWA 4G7OF 4IHYA 3IUOA 4RB0A 3O8HA 1SEUA 4IHSA 3JR9A 3PFYA 1Z9CA 1AHDP 2R7VA 2E5NA 2NNNA 1JKRC 1SD7A 2EIMH 2FRHA 4KIBA 2A61A 4YG2F 4IHXA 2EZKA 4X1EA 2ESHA 2V4JC 3E6DA 4KA4A 2VC1A 3S2HJ 5HNHA 1IUYA 1VZ0A 2KFDA 1FLIA 3F9KA 3ZMTA 1XD7A 4LITA 3WTZA 4ZZDA 2JZYA 4HDUA 1AKHB 1IDZA 3WHCA 3JAMZ 1ONVA 2LF8A 2XGXA 1VQMI 4BY7J 2XDVA 2LR8A 4HW0A 3R6SA 3JAMK 3HOWJ 3OYDA 4YELA 5DYMA 4UV8A 3UNGC 5JVTA 3LSTA 1P7IA 1JTXA 3JRIA 3LSMA 4MGRA 2ELHA 1VQ7I 2QWWA 2ZSHB 3KEYA 4PJLA 2FOWA 4CCKA 4OIRF 4C3JJ 2VBYA 1O3QA 4D7NA 2R7SA 2ESNA 4XN3A 4U0WA 3TW6A 5F1JA 2AHQA 5L3FA 5GP9A 2M87A 1Z6RA 4BXXJ 1LE8B 2IS6A 1MH4A 3FMSA 3SZTA 1C0WA 4U0VA 1D8JA 3T0YA 5FJ8J 3GZ6A 1TT0A 1L0OC 2EZHA 4RLQA 4QSHA 1V3FA 1TZLA 2OZUA 2YU3A 5FKKA 1FIAA 5IYCJ 1K61A 1FP1D 4HYEA 3GTPJ 3HPHA 5L3EA 4WF2A 3TP3A 2K02A 3L2VA 3S14J 2FQ4A 3F72A 3FK6A 4C30A 4HEA2 4D0PA 3K70C 4LLNA 2VQLA 3H5RA 3DTKA 1XX5A 5HNFA 5J8CA 3S3OA 3O8GA 5F64A 3L1PA 1UJ8A 1AKHA 2VJJA 2QLZA 2HYJA 3GFLA 3N05A 3SXYA 1KA8A 3VYRB 3GTOJ 2BYVE 2DOFA 2HZDA 1YRNB 2DMTA 3FX3A 1QZZA 3DBRB 1G4DA 1N77A 1R36A 3B73A 1RUNA 2OTJI 3W6KB 1DP3A 1YS7A 3EETA 2QQAA 1Z05A 5DTDA 2E34A 4HOBA 3S17J 1HOMA 2HKXA 3LL7A 4AWXB 1ETOA 5GAGJ 1LE8A 2EA4A 4BBRJ 4EJOA 2DCEA 2JN6A 1DGRM 4ZDOA 1O4XA 4AVPA 1FMVA 2M9HA 1QBJA 2RQQA 2QZ8A 1D8KA 2LK2A 4U87A 3TGNA 1T38A 2GA2A 3REOA 5B5EC 3HM5A 4XOTA 2F4OB 1BIBA 3AFHA 5BOXA 3OIQA 2I10A 3JTGA 5HODA 3I58A 3E6MA 2JPBA 4OIOF 2QKLB 2VBWA 1BM9A 2FUG2 3RPUA 1ENHA 2EBIA 1OCPA 2IT0A 1W7PB 4MEXF 2KPMA 3T1BA 1MBEA 4CO8A 1BIAA 1GLNA 4RGUA 4I0AA 1F43A 1FOYA 2VPLA 1UB9A 2IBDA 1ZG5A 1TTYA 2IS1A 4Y17A 4HNUA 3MN2A 1KGSA 1IRXA 3V8LA 5LEJA 3H3UA 1MGTA 4RS8A 1IXSB 2Y0SA 2NVTJ 5IPAA 3L2WA 3I4NJ 1ZLJA 2Y2ZA 3TW7A 1BOBA 4A3GJ 3HOZJ 4BACA 4IF4A 1MNEA 1FNNA 1LKXA 4PGGA 1A6IA 2XRNA 2ZSIB 2DJIA 1I6XA 2LF7A 3ZQCA 5JVGF 4XLHA 3BTCA 4IOAF 4MQVA 3PJRA 4PZJA 5ICGA 3Q0UA 4OIQF 3CCVI 2WB1A 3KEOA 3MKYB 5KK1A 4OOIA 1G3YA 5DD4A 4K2EA 1O3SA 1TW3A 2YX7A 1RKTA 4D7MA 4Q47A 2Y0SN 3BOQA 3HB9A 5ILSA 2IXSA 1MSEC 1R6RA 1W1WE 4OMZA 3A01B 4XKBA 4Y7NJ 5IYBJ 1K6OA 3ZQQA 2DBBA 2VE8A 3KZZA 4C9YA 1TLHB 3HRSA 1Y39A 3CDHA 2CU7A 3LSJA 3CJTB 3DBHB 3R61A 4CGZA 1TC3C 2C6YA 5K7HA 1REPC 5LHIA 1WJBA 2EINH 1W7PA 3H0DA 5EG0B 2KT0A 3CP8A 3R4KA 2JMWA 2WB1N 3OOPA 1WZ2A 1Z21A 1VTNC 2A07F 4R8HA 3TKYA 4DGWB 4LB5A 5J1UA 1E0EA 1UG0A 3IAM2 2WADA 1KU7A 2LVSA 3O6BB 2IGOA 1IRFA 2EH3A 1D1BA 2Y69H 1MNDA 1R9TJ 3DFGA 5EZHA 5FRNA 3HSFA 4V19K 4BXUA 4TV7A 3E7LA 3CO7C 3WU1B 4D1QA 3WODF 3D5LA 4BEHB 3HOUJ 4XOPA 3DPUA 3BR3A 1YIJI 2OTLI 1SD4A 3FBNB 2HQRA 2OBPA 3B6AA 3OY9A 3CC2I 3RTRA 3DQVC 3MKLA 1R49A 3OOUA 2ZO4A 3ZP5A 1JI8A 2M34A 1SAUA 4Y3OA 4BDZA 4C2UA 3MMYB 1HXDA 1OJLA 5CVUA 2JA7J 1R5GA 4BGDA 4IRGA 2R7TA 5FFZA 1IRGA 1LUJB 3FDYA 2DFIA 2GXAA 5FKLA 4M9XA 2E1OA 4UVAA 1FIPA 1O7LA 2IGKA 2ZFWA 3A01A 3CCMI 5DCFA 3ULQB 4RAYA 3K7AJ 3DLLF 2JSPA 2JVGA 1VQ9I 2QA4I 1YS6A 1X58A 3V4GA 4G7ZF 2ELJA 3LFKA 5EG0A 1T95A 5HVQC 3HYIA 2KRCA 2Y48A 4NC7A 3SQNA 5B66C 1DU0A 2ECBA 4FT8A 3I55I 3JRCA 3PQJA 2DTRA 2L2OA 2MA3A 2RNGA 3OL4A 1MJBA 3H9QA 3K0LA 2YX4A 4NUBA 4YIRX 2VE9A 1LEBA 1BR1A 2DOEA 2XV4S 2ZJPF 1D5VA 3DU6A 3W6VA 1QNTA 3HUGB 5EEGA 3ZN1A 4N9HA 3AG4H 4BEHA 2AXTC 2ECCA 2NVUB 1OCCH 4DYCA 4WWCA 2BY0A 2VOOA 1TNSA 3M4OJ 2HQAA 3OYFA 4ESJA 3QRFF 2R7OA 4N0BA 1IN8A 1VF9A 3TBIA 1FYKA 4KITB 3PM1A 2H94A 3T5XA 2I5UA 4ZYAA 1YI2I 2LD5A 5C44J 2QENA 4IPAA 3GFIA 4AU7A 3LSHA 4XSZF 4S04A 3EYYA 2BHZA 2W24A 2FU4A 3MEXA 5KAFC 3PO3J 4E7JA 5BPDA 1Z7UA 3FISA 1BR2A 2F6CA 1T56A 2K27A 3IH4A 3ZPLA 3OR2C 2L01A 3LA7A 1TP4A 2OAZA 4A3LJ 3FXKA 2CQ7A 3GTQJ 2V1UA 3KLOA 4RBOA 4BE2A 3PSFA 3IWZA 3LSIA 2Z2SB 5DUIA 3AG3H 3BQZA 2XF7A 1MMAA 2CQNA 1R7JA 1OISA 2WAQA 1SMTA 2VJIA 1G3SA 4B3XA 5H2FC 3GVAA 1T39A 3KX2A 1YJWI 1ON2A 4IRIA 2TRTA 2L3DA 4GYGA 3V8KA 3D5SC 5DDGA 2QGUA 2EILH 3QP6A 2MC3A 4UVCA 4CCOA 5KHDA 2LKXA 3ZQGA 1D1AA 4FCYA 4E4HA 2R7FA 2HDWA 3H92A 3HUGA 5JHFA 1NK2P 4E70A 2E2IJ 2XPUA 4II3A 1EKEA 4Y15A 1J75A 3BP8A 3MAJA 3PFIA 1WI9A 4ZTJA 2CSOA 2I8DA 2WAQN 2R0QC 5F0HA 1D3YA 3T8RA 2P7VB 5ICEA 4HPQA 4GXOA 4P55A 3IP4B 1U8RA 2IRFG 4BE0A 1KU2A 5IOZA 2WV1A 1MBHA 3TO6A 5GAHJ 3TO7A 1WVRA 3HSRA 2NRAC 1NK3P 4QWQA 1Z91A 3I64A 3JREA 3D1NI 1B72B 2HEOA 3GTGJ 2V9PA 1S29A 3A4CA 4BYYA 4ETSA 4L9TA 3BROA 2KLOA 1JHHA 3CCRI 1YW8A 3OSFA 2RAEA 2FBHA 5IOYA 2Z99A 4YFNF 4B1RA 5E3NA 3CCSI 2A5YB 5E1WA 4A3CJ 4EM2A 2H8WA 2M45A 3JTHA 3IAS2 5M5YJ 1YO5C 3VB2A 2ZMEB 3F8BA 2QSGX 1TWCJ 3S1RJ 1QQIA 2NS0A 3CJNA 3GCMA 4EJTA 2B0LA 2CH0A 5EGOB 3K6GA 1HQCA 4Z2YA 4C2MJ 4KJZA 1P6RA 4MTDA 4XLCA 3TEDA 2JQ7A 3PNTA 3J7AO 1IXRC 3EUHA 2D1HA 2PI0A 1IDYA 3ONQA 4XRSG 3Q3SA 1X4PA 2IVMA 4ENNA 3SEQA 3M8EA 4A69C 3G71I 4M9SA 3C1DA 3E5XA 1XMAA 1USTA 4HF0A 3JRGA 1T0FC 2KP6A 2IA0A 2ZNZA 3M7GA 2W4SA 3CJRB 2DMPA 1Z0XA 4DBQA 3DCFA 2E19A 3J7AY 3E3VA 4E7ZA 1J9IA 4M72A 1U8BA 2CUZA 4L0ZB 3K4NA 3ERMA 4BHCA 1PJRA 1VQKI 3TDUC 3DLAA 2JVHA 2BE5F 3TOBA 2DA4A 2M3AA 1K4SA 5E3MA 2O6GE 3PL8A 3IL2A 5GTIC 4LIVA 2O61A 4XKVA 1KONA 2VT2A 2BVLA 4P9FA 4R79A 2K9SA 1FYMA 2JTVA 2M7AA 3PQKA 5CVRA 4M3BA 4DZJA 2H8RA 3MD2A 4JOMA 2P5VA 2R7QA 1JUSA 4XBFA 2ME6A 4Y13A 2LOOA 2YSRA 2UXNA 1BN5A 3BG5A 1DQUA 3H1CA 3JCUC 4S05A 3FBIB 4UUTA 3RYRA 2H6CA 2ZMEA 4RB1A 1EJ9A 3K4MA 1TWAJ 1ZKGA 1HDDC 1LPQA 2CJJA 4PSWA 1TT5B 5EGOA 2Y75A 3CQZJ 1U2WA 3I5UA 4IVNA 3VYUB 2M8GX 2LC2A 4I7HA 1ZRCA 3AL0C 4DIQA 3VDXA 1J2XA 2IJLA 3IV5A 4A5NA 1R5HA 3BG9A 4JQFA 4CZCA 2HKOA 4G6DA 5D6EA 3KETA 1WJ5A 1IZ1A 3CMAI 1OYWA 1PVEA 2CS3A 3IC7A 2KHMA 2DU9A 3DKXA 2VUMJ 2HQ5A 3BQYA 2GQQA 3GLLA 4FHTA 1ITYA 2BOLA 1FT9A 1LDKB 5L3DA 5F6FA 3FWEA 3DXJF 3S1QJ 2XASA 1Z77A 2M30A 2ZXWH 1POGA 3RCOA 3WTUC 2OA4A 2PFBA 5AIQA 3G73A 2NVXJ 2FNAA 5LEKA 1QRYA 2IS2A 2H6BA 5D4RA 2P4WA 3BC8A 3LSRA 5IY5H 2KQRA 3HC7A 5J1YA 5HOOA 2JPCA 1XGNA 4IL6C 1YITI 5LRRA 3RDIA 2B9SA 4MO7A 1IRZA 4DYRA 2VIXA 1YTYA 1BI0A 4PFPA 2BY1A 4XORA 1HKTA 4OINF 3K4LA 2HOAA 3S2DJ 4DQ2A 2X51A 3L2QA 3HOTA 4L9NA 3F6VA 2ZB9A 3KP4A 2JRMA 2K3FA 4YFXF 5DV5A 5FKMA 4EQQA 4MLOA 1DDNA 1QPIA 4U88A 3RIRA 2LMDA 4R1HA 1P4XA 1U0JA 4JK1X 5E3OA 3SDGA 5CPRB 4ZYDA 3E5UA 2FX0A 3GEZA 5A2QK 3B02A 1GVDA 1TW2A 3QWLA 4YFKF 1ETWA 3S15J 5BS6A 4EJUA 1PP7U 1X3UA 3C2HA 2KRHA 3K2ZA 1YIOA 1SVLA 2Z3YA 3J80Z 4ZH4F 1HLVA 4CUGA 5H6RA 2HDCA 4C3IJ 4EM0B 5E18F 4A3EJ 5E17F 3NRVA 2NXNB 5IT9Z 2A3SA 3KPHA 3ASOH 2WC2A 5IT9K 1XSVA 2ZCWA 3CCEI 1S72I 3GTMJ 1DGWY 4L5IA 3DEUA 1SVOA 2A6TA 1JKPC 5E1ZB 2LH9A 2Y0MA 1STZA 2LREA 3H36A 4BS9A 4BE1A 3PO2J 3AL0B 5L3BA 1R4NB 1RZ4A 2RREA 4B09A 2BZTA 3OWTA 3VOEA 3TDZC 4B8XA 2DPUA 2M4KA 3GTJJ 4IXAA 2RV8A 1TWGJ 4A3FJ 1JT0A 1MZBA 3N97A 1OLTA 2DODA 1D1CA 4PFOA 3UR3C 3IRRA 1Z1DA 1G6NA 4XLAA 3WTSC 4ASNA 5FRMA 4EEFG 1RR7A 2WA0A 2K4JA 3KEQA 3BR6A 2EIJH 1T0FA 2N8GA 5CVJA 1TL8A 1BI3A 2DFEA 1XSDA 5EF6A 3HRMA 4RAGA 4XLNF 1APLC 5J6XA 2GIVA 2IP2A 2NYXA 2RNJA 3FK7A 1DUXC 4B44A 2VJ5A 1XMXA 1IJWC 1ETYA 4XN0A 3CC7I 3LA3A 4RDUA 3PSIA 5FKNA 2MD0A 1WQ2A 1RESA 1MDMB 3ML6A 1Y1WJ 1T98A 4A3JJ 3OYLA 1H0MA 1J5YA 1OYIA 1ODDA 4M6VA 2ZXHA 2E1NA 3RI4A 4ZTFA 1EH6A 4I01A 3AG1H 2Y9YA 5E79C 3WE2A 3CCYA 4IQ4A 4UB8C 1HDPA 3H35A 4BDYA 2K9MA 5HDGA 2HYFA 5FO5A 2B63J 3ZMUA 1IF1A 3CF5F 3J7YJ 4OIPF 1YE9A 2VT3A 1VQPI 1OCTC 3TO9A 2O7OA 3HRUA 3MZHA 3KIOA 1FJLA 2M2EA 2W00A 1IG7A 3ABUA 1PDNC 4KNYA 3VFZA 4P5OA 4M6YA 3CESA 2ZXJA 5J4VA 2HR3A 1X2MA 4LFUA 2E5ZA 2EPFA 1SANA 2VKHA 1R71A 3EYIA 2V1XA 3LQRA 2EFOA 2PMZA 1FOKA 4XLPF 2K9QA 2MLKA 1I27A 2CWEA 2F4IA 2W25A 1FPQA 4BHBA 2XAQA 4BXFA 2CGPA 1Y8QB 3ERED 3M8FA 5JR3A 4ENMA 1K79A 5HS9A 5E3LA 4BQNA 1XGOA 3BR1A 1UHMA 1A36A 4EJWA 1YOVB 4LD5A 4LB6B 4F91B 1ETVA 1Y8RB 2VB6A 2M7BA 4GCVA 1MDMA 1JKQC 1S5LC 4QPQA 2F5VA 4A3DJ 2VXDA 2JJ7A 2PMZN 2Z5UA 5DM7F 3M9AA 5GAEJ 2L4MA 3I4PA 4ZZLA 2GXBA 1IN6A 2LTPA 1ZG3A 2R7ZJ 5LLQA 3JRFA 4CXFA 4M74A 4XRSA 3BPXA 3MQ0A 1E2XA 4A5MA 3WG7H 2R7DA 1SFEA 3DF8A 3M8JA 4RM2A 2EJRA 2HVRA 3PIPF 3E6CC 2E1CA 3LWFA 1GXPA 5FFXA 3L2RA 1ZREA 4M73A 4GFBA 5J1RA 3WTXC 2XVCA 5KVRA 2DA2A 4XLEA 4XL9A 3HBLA 3ABLH 2CYYA 1F1ZA 1I3AA 1NHAA 1FSHA 3GX4X 3CCJI 1XPXA 2FMYA 3HSEA 2TCTA 2D1VA 2EV6A 2LBFB 3VSKA 1IAWA 2CO5A 4A93J 4AIDA 4QIWN 4KIGA 4B47A 1MMSA 3QOEA 3OYIA 1V55H 2Z16A 3H9GA 1RR8C 3OSGA 1PUEE 4NNJA 1S3JA 1BJAA 1ERDA 5HLIA 1U6GA 3GUDA 2W57A 2BHYA 4YEJA 2NS8A 1XSXA 3ZRGA 3GFJA 2YUSA 1LFPA 3K69A 2VQCA 4LGWA 4RGRA 3RKYA 2CV0A 4L18B 1Z3YA 2O9LA 2R5YB 1Z67A 4CZZA 3U2RA 2IEKA 3RQIA 1OKRA 1RETA 3CD6I 2P5LC 1ZQ3P 4ZDLA 3GYHX 1JT6A 2MYSA 3ABTA 2FQ3A 2OZ6A 2XF6A 4V2FA 4F7ZA 2LYCA 4JP0A 1RIOH 3WTYC 4XKCA 2DT7B 2EB7A 5IT3A 1ZHFA 1U3EM 4A0ZA 3K1PA 3DV8A 3BR5A 3CF2A 1UELB 3BCBA 1TWHJ 4GO1A 3VODA 4WXHA 4C2TA 2GIZA 4GYIA 3HTSB 3OYAA 4LK1F 3BWGA 2MH2A 3OS0A 2FD5A 4Q5SF 2KIFA 1WJDA 3GLXA 1UCRA 4FE7A 4D9JA 1U9NA 3OYCA 2Q2EB 3K2AA 4NC6A 3CDIA 1A31A 3KP5A 2EFPA 2GLOA 3BY6A 1ZLKA 3R0JA 2M5WA 4G9YA 1FTTA 4PJJA 3NWTA 5GTHC 3QOPA 2LBFA 2CW8A 4GGGA 4G94A 1UZCA 1D0XA 1OYYA 3C2GA 3IKVA 1WSUA 4CH7A 1UHWA 2YU9J 1HA8A 5CYVA 4XQFA 1XCVA 2YR2A 5EDNA 4HSRA 5FLMJ 4YIIA 2BVMA 2FOKA 2NOJB 2KJCA 1P4WA 4A0YA 4F52A 1FBQA 1JGSA 3PNYA 4CYCB 1ZR4A 2XB0X 1N75A 3LNQA 2R5YA 1JHFA 4BU2A 4A6DA 3A03A 1A04A 2DTZA 4IHWA 2DI3A 2LLKA 2V7FA 3HEFA 1A35A 2DYRH 1IXCA 3J81Z 3BT9A 4A3IJ 3RSNA 5KCMA 2X6WA 2KRFA 4DNCA 1LNWA 3F8CA 2V6CA 4I09A 4WX9A 2GWRA 3EUHC 4I2OA 2W7NA 1JUPA 3F8FA 4NDLA 2JA2A 2LDUA 2KIUA 3LAJA 4N9IA 3VYTB 2Q2EA 5BQTA 2VLAA 3AG2H 1OMIA 2XPVA 3ISPA 1T2KA 4EM1A 2VN2A 5C3EJ 3CMEI 2L5QA 2XKPA 2CFXA 4JX4A 4WCGA 1H9GA 3S8PA 1K6YA 4HA8A 4KT5C 1LB2A 4HZFA 3ROUA 5LD2C 5FLXZ 3U1KA 2CQQA 4ZDPA 3WHBA 4EJVA 1LEAA 4LLGF 4XR6A 5FLXK 2XF5A 4NBQA 3NWSA 2H1LA 1MIJA 2K9NA 3S3MA 2B7EA 2A6HF 3WGGA 2RVCA 3DKWA 3EUKL 3ZQ7A 1ZGJA 2DA5A 5TGTA 3QP5A 3TL4X 5IP6A 4CICA 4J00A 4CYCA 1SFUA 2ZMEC 2E35A 1B4AA 4IKFA 1I6HJ 3BLYA 4CCJA 4BNCA 3WTWC 1W36D 4RAFA 4C3HJ 2MBFA 5JLWA 1LJ9A 3Q5FA 3FF5A 2OCEA 2DN0A 1IGNA 5B1AH 4E7HA 3LOCA 2DYSH 1WJFA 3LSGA 1M1EB 2RKHA 1V5EA 3LSPA 1PUFB 3K4CA 4MNUA 2Z33A 1SFXA 3I59B 2A6EF 4BQOA 1TNTA 1RC9A 2XC7A 4FASD 3W2WA 5E8IA 2CW7A 2XGDA 2A68F 3MVPA 4NC8A 3KFWX 2UXXA 2VKDA 3I71A 2EZLA 2GM4A 3U1DA 1HBXG 4XNFA 1XDSA 1S8NA 3A02A 2M4GA 3AKZA 2UZKA 5TISC 1WJAA 1VQ6I 2DA1A 2NS7A 4MEYF 1XGMA 1X1DA 3G3ZA 3E97A 1O3TA 2M1BA 1V4RA 3L2CA 1P92A 3FKJA 4E7SA 2L7FP 4ANJA 3F23A 5FGMA 5DEQA 5EYRA 4ZJZA 4NHJA 2GZWA 2VBZA 3VWBA 5LGTA 4LOCA 1VQ8I 2HPIA 1KYWA 1Z7LA 2W84A 2WAFA 4FE4A 1YLFA 2ZJ2A 3RPQA 4HV6A 5K5QA 3ZMDA 4J01A 3SJMA 5K5RA 4PUSA 1YHQI 1FSEA 2W48A 2KKOA 4IRHA 4XK4A 2Q8KA 5K7FA 3H9JA 3KYLA 2PX9A 3X2QH 2K40A 2X6XA 1X4OA 2OF7A 1NG7A 3FXRA 4G12A 2QKMB 1P2FA 4IQJA 2KIMA 2BXYA 1J09A 5HLHA 1HKSA 3K4BA 4P9UA 3G2BA 4I0BA 2V6EA 2DA7A 1I1SA 1X2NA 2DXIA 2CRGA 2LKSA 1PUFA 2F5FA 3KP6A 1LVAA 1BC7C 3ZMSA 3WTVC 3KCCA 3I59A 3HOSA 3TMOA 1IN5A 2E1MC 4BJ6C 2R5ZB 5LFAA 4LIUA 1K4TA 2HOTA 3OR1C 2LFBA 5ICFA 2WY8Q 3BZCA 3QPLA 1JGGA 2PN6A 3G1OA 1W0TA 1A5JA 2R7UA 3SFIA 2HI3A 4OMYA 3R60A 3CUQB 3SDBA 5F1RA 1XG1A 2CUJA 1V5GA 2KMUA 2Z1DA 1KQ9A 5B3SH 4YRVA 4UXNA 4KUMA 4XIDA 1EH7A 3U21A 2PJPA 4E6KG 4A3KJ 3I53A 3CMYA 1MJ9A 3L2UA 3BDDA 2QSFX 3ZGKA 4OU0A 2NVQJ 3BTJA 2R92J 4L5EA 2XROA 2J5PA 2OCCH 1Y1VJ 4MFEA 4JX6A 3F22A 3ABMH 3UKGA 1UFMA 3LMMA 5D8KB 2VXZA 3FM5A 1SAXA 5ILUA 2STTA 1W5SA 1F5TA 1UG2A 2MC4A 3QAHA 5CVIA 4AUXA 3ZOBA 3ECOA 2BBYA 5GADJ 4I6ZA 1H9TA 1IV8A 1S7AA 3ZQHA 3HOXJ 2V9KA 3ESWB 1RNLA 1X1BA 4M9ZA 4ESBA 4FISA 4HG2A 2FMLA 3OYEA 1KQ8A 1QPMA 3M07A 1IC8A 4BJ5C 3F8MA 3OS1A 2F48A 1WKMA 1QZEA 2AXLA 2EV0A 3SZGA 2R5ZA 5IYDJ 2NOGA 3V7SA 4XSXF 5ED4A 2PJRA 3FXLA 3DBLB 2AO9A 3OL3A 1YYVA 2VJ4A 3FIWA 1R1UA 4EV0A 1WJCA 1XTAA 1SMYF 1Q1VA 3HKZA 3W2AA 3P9IA 1S6LA 4A3MJ 3FMQA 1ORKA 5TRDA 2ISYA 2BY3A 4X6AJ 1F9NA 3CUQA 1BL0A 3BTIA 3K1NA 1W4MA 1T8IA 3QPSA 5HDKA 2TDXA 1J7KA 1TQPA 2K7LA 4FTHA 2DLLA 2E71A 3SYTA 2E1MB 3I9V2 3DEEA 1QVTA 1TQMA 2LSOA 3LSKA 4A0XA 1CQTA 3A1YA 3KZYA 2E2JJ 3HRTA 2HVQA 2G7UA 3JSOA 1RUOA 4A2UA 1MBJA 3HKZN 3I56I 2Y30A 3M1EA 1SFKA 4KDPA 4MQ9F 3MKWB 2JUGA 4UY8I 2V1NA 2R7WA 1WRJA 2MGQA 3SEZA 1IN4A 4V2GA 2ISZA 1IW7F 3ZXSA 1DPUA 3MZYA 1F4KA 2JA8J 5ILVA 1DP7P 4O3MA 3B6CA 5IP7J 2F5EA 4MHGA 3M1CA 1K78B 1MH3A 1Y0UA 3DEWA 4EMSA 3OYMA 3ASNH 2G9WA 1NG6A 3FMRA 4HX4A 3IH2A 2F5DA 5FB2A 1VQ4I 3S1MJ 5M5WJ 3Q9SA
chains in the Genus database with same CATH topology
2M34A 1ETVA 1I50J 4IEJA 1OJLA 4DYQA 2L0KA 1JKQC 2OPTA 2JA7J 4JX5A 1JUMA 1BA5A 2DMUA 5FKLA 4A3DJ 2E1OA 1D5YA 2JJ7A 1FIPA 2PMZN 2H1KA 1ZGWA 3A01A 1JTYA 2KDZA 1UMQA 2HXOA 4BBSJ 2LTPA 1WGXA 3K7AJ 2R7ZJ 1NTCA 3JRFA 1I3QJ 4XRSA 1X58A 1DU6A 3BG3A 1JJ8C 2XSDC 5JLXA 1K83J 4D5CA 5F04A 5EG0A 2L7MP 3VPRA 1DU0A 2ECBA 1BW6A 2XGCA 4GFBA 2QCOA 3JRCA 4M3GA 5J1RA 5F0CA 2DA2A 3HBLA 1JKOC 3RZOJ 1U78A 2VKEA 2TCTA 1OFCX 2XB5A 3JRDA 3HDDA 3W6VA 4A93J 4QIWN 1WH7A 2ECCA 4DYCA 1HCRA 3G1LA 3M4OJ 3OSGA 1VF9A 1MBGA 2DA6A 3GTLJ 2XPWA 2QF7A 3PM1A 2JA6J 2P81A 2LD5A 5C44J 2NS8A 1BW5A 2YUSA 1W0UA 2G0EA 2DMQA 1B72A 2O9LA 3PO3J 4AYBN 2R5YB 1UHSA 1MBFA 2IEKA 3RQIA 1RETA 3FISA 4XICA 1LFUP 1ZQ3P 1T33A 3H3VK 1T56A 1JT6A 3IH4A 4V2FA 1GV5A 1ETKA 3M3YJ 4JP0A 3S16J 3GBGA 4A3LJ 4M3DA 1HF0A 3NAUA 3GTQJ 4RBOA 3Q0WA 2LP0A 3BR5A 1JJ6C 4UUSB 2LY9A 1TWHJ 2NVYJ 3BQZA 4A3BJ 2FD5A 2DMNA 2L9RA 4FE7A 1U9NA 3FKIJ 3JRAA 3JRHA 3K2AA 1WH5A 2YS9A 2JA5J 2GLOA 4I76A 2TRTA 4J19A 1FTTA 2LKXA 1WCMJ 3S1NJ 3ZQGA 4FCYA 1RKWA 5EZGA 1NK2P 1ZTRA 2CQXA 2E2IJ 3HOYJ 2MW8A 5GPCA 2XPUA 5K7ZA 2COBA 1LFBA 2YU9J 4DZPA 2Y9ZA 3ZQFA 2WAQN 2R0QC 4Y52J 5F0HA 1H89C 5EDNA 5FLMJ 1VI0A 3Q0VA 5M3FJ 5IOZA 2WV1A 1MBHA 4CYCB 1IUFA 2M0CA 1ZR4A 1MSFC 1TWFJ 2XB0X 3LNQA 2R5YA 1NK3P 3JREA 3D1NI 1B72B 4BY1J 3GTGJ 3A03A 2DTZA 4IHWA 2LLKA 3HEFA 5BNGA 2EQRA 5EEAA 4A3IJ 2ID3A 3BT9A 3OSFA 2RAEA 4M3EA 5IOYA 2CUFA 4UUSA 2JK3A 4B1RA 5E3NA 4A3CJ 1ETQA 3BR0A 5F0FA 1JUPA 5M5YJ 4NDLA 5C4XJ 4BKXA 3GTKJ 1ETXA 3ZQIA 1TWCJ 3S1RJ 2XPVA 5EGOB 2JWTA 4QTRA 5C3EJ 4C2MJ 3TEDA 4JX4A 3ZQLA 1E3OC 3RKQA 1H88C 1IDYA 2E2HJ 4XRSG 3Q3SA 2VPRA 1S7EA 3F0CA 4A69C 3BR2A 2MSYA 4MFDA 2CQQA 2FJ1A 3JRGA 4IHYA 3WHBA 3O8HA 2DJNA 3JR9A 2DMPA 1Z0XA 1AHDP 2K9NA 3DCFA 2E19A 1JKRC 4IHXA 1QVUA 1ZK8A 2HOSA 1U8BA 2EZKA 4X1EA 5M3MJ 1VNDA 2DA5A 5IP6A 5J3LA 3S2HJ 4CYCA 5F27A 2VI6A 1MBKA 1I6HJ 1AKHB 1IDZA 2DA4A 3WHCA 4C3HJ 5DS9A 5JLWA 5E3MA 4BY7J 2LR8A 1G2HA 4B3AA 1YRNA 3HOWJ 2DN0A 1IGNA 3LOCA 2K9SA 2L7ZA 3LSGA 4M3BA 1P7IA 1JTXA 4DZJA 3JRIA 2H8RA 3LSPA 1PUFB 3HOVJ 5F08A 1JUSA 3G1MA 2ME6A 3TP0A 3BG5A 4C3JJ 2HXIA 4UUTA 4D7NA 1GV2A 4JYKA 2XGEA 3TW6A 5F1JA 2AHQA 4XRMA 5GP9A 1RPWA 1TWAJ 1ZKGA 2XGDA 4W1UA 1HDDC 3MVPA 1F36A 4BXXJ 2CJJA 4MIMA 4IHVA 1LE8B 1MH4A 5EGOA 1P7JA 3BTLA 2X6OA 3CQZJ 2EZLA 2GM4A 2M8GX 5FJ8J 2EZHA 3A02A 4QSHA 2DA1A 2NS7A 3IV5A 1GDTA 3BG9A 5FKKA 1FIAA 4D5FA 5IYCJ 2L7FP 5EYRA 1K61A 4LOCA 3GTPJ 5GPAA 4FE4A 3TP3A 2VUMJ 2HQ5A 3BQYA 1ITYA 3S14J 2FQ4A 3SJMA 3FK6A 3S1QJ 4S0HB 2W48A 1Z77A 4XK4A 5K7FA 1POGA 2K40A 2EZIA 2NVXJ 2OF7A 3O8GA 4G12A 9ANTA 3L1PA 1QRYA 1AKHA 1EF4A 2HYJA 3IH3A 3LSRA 1B8IB 1WI3A 4AC0A 2DA7A 3GTOJ 1X2NA 5J1YA 2DMTA 1YRNB 2CRGA 1PUFA 4MO7A 1IRZA 2Y31A 4DYRA 4ABZA 2R5ZB 2HOAA 3S2DJ 5DTDA 2R93J 3S17J 2HOTA 1HOMA 2ZB9A 2LFBA 5FKMA 3C2BA 4MLOA 2GBYA 3QPLA 1QPIA 1JGGA 1ETOA 2X48A 1LE8A 3G1OA 1W0TA 1A5JA 4DW6A 4BBRJ 2JN6A 5E3OA 3SDGA 3SFIA 1O4XA 2M9HA 2HI3A 2FX0A 2LK2A 1GVDA 5FKOA 1ETWA 2ID6A 3HM5A 3S15J 2ELKA 1XG1A 2I10A 5HODA 4XIDA 1HLVA 3NARA 4C3IJ 4A3EJ 4A3KJ 3RZDJ 5C4JJ 3CMYA 1ZR2A 1ENHA 3H0GJ 2EBIA 1OCPA 4B4CA 1MBEA 3GTMJ 2NVQJ 3BTJA 2R92J 4L5EA 4M3FA 1F43A 1JKPC 1Y1VJ 4MFEA 4JX6A 2IBDA 2ME0A 3PO2J 3UKGA 3MN2A 1UG2A 4AUXA 4I6ZA 3GTJJ 3ZOBA 1TWGJ 4A3FJ 1JT0A 2NVTJ 3I4NJ 2XRLA 5IPAA 3ZQHA 3HOXJ 1B8IA 2D5VA 2Y2ZA 3TW7A 4FISA 4EEFG 1RR7A 3BR6A 2N8GA 4A3GJ 1FEXA 3HOZJ 1IC8A 3CDLA 5M5XJ 1H8AC 5EF6A 1A6IA 2O8KA 3ZQCA 2R5ZA 5IYDJ 1APLC 2NOGA 3FK7A 3BTCA 2IAIA 1GUUA 1XC5A 2AO9A 1IJWC 1ETYA 3FIWA 2CUEA 3Q0UA 4RDUA 5FKNA 1RESA 1Q1VA 3OIOA 4HNVA 1BJZA 1RKTA 4D7MA 4A3MJ 2Y0SN 1Y1WJ 1U9OA 3HB9A 1ORKA 3QQAA 1MSEC 4A3JJ 4X6AJ 1VFCA 3BTIA 3A01B 4M6VA 5IYBJ 4Y7NJ 1BL0A 1SFOJ 3QPSA 2X9DA 2Y9YA 5IP9J 2CU7A 3CCYA 3LSJA 4FTHA 1FTZA 1HDPA 1WPKA 1TC3C 5K7HA 1QVTA 1CQTA 2B63J 2E2JJ 3JRBA 1OCTC 5EG0B 2KT0A 2JMWA 2WB1N 2O7OA 1FJLA 2M2EA 1MBJA 1IG7A 3HKZN 2DA3A 2Y30A 2MG4A 5J1UA 2VKVA 4W97A 1AU7A 1IV6A 2LVSA 1X2MA 2MGQA 2EH3A 4V2GA 1MNMC 1R9TJ 1SANA 5EZHA 1GT0C 2JA8J 2K9QA 3HGYA 3HGGA 3E7LA 3B6CA 5IP7J 3HOUJ 3BR3A 1MH3A 5FLVA 3DEWA 5E3LA 2HDDA 3B6AA 3BR1A 1XS9A 3I4MJ 3IH2A 3MKLA 3S1MJ 3OOUA 5M5WJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M34 A;  1ETV A;  1I50 J;  4IEJ A;  1OJL A;  4DYQ A;  2L0K A;  1JKQ C;  2OPT A;  2JA7 J;  4JX5 A;  1JUM A;  1BA5 A;  2DMU A;  5FKL A;  4A3D J;  2E1O A;  1D5Y A;  2JJ7 A;  1FIP A;  2PMZ N;  2H1K A;  1ZGW A;  3A01 A;  1JTY A;  2KDZ A;  1UMQ A;  2HXO A;  4BBS J;  2LTP A;  1WGX A;  3K7A J;  2R7Z J;  1NTC A;  3JRF A;  1I3Q J;  4XRS A;  1X58 A;  1DU6 A;  3BG3 A;  1JJ8 C;  2XSD C;  5JLX A;  1K83 J;  4D5C A;  5F04 A;  5EG0 A;  2L7M P;  3VPR A;  1DU0 A;  2ECB A;  1BW6 A;  2XGC A;  4GFB A;  2QCO A;  3JRC A;  4M3G A;  5J1R A;  5F0C A;  2DA2 A;  3HBL A;  1JKO C;  3RZO J;  1U78 A;  2VKE A;  2TCT A;  1OFC X;  2XB5 A;  3JRD A;  3HDD A;  3W6V A;  4A93 J;  4QIW N;  1WH7 A;  2ECC A;  4DYC A;  1HCR A;  3G1L A;  3M4O J;  3OSG A;  1VF9 A;  1MBG A;  2DA6 A;  3GTL J;  2XPW A;  2QF7 A;  3PM1 A;  2JA6 J;  2P81 A;  2LD5 A;  5C44 J;  2NS8 A;  1BW5 A;  2YUS A;  1W0U A;  2G0E A;  2DMQ A;  1B72 A;  2O9L A;  3PO3 J;  4AYB N;  2R5Y B;  1UHS A;  1MBF A;  2IEK A;  3RQI A;  1RET A;  3FIS A;  4XIC A;  1LFU P;  1ZQ3 P;  1T33 A;  3H3V K;  1T56 A;  1JT6 A;  3IH4 A;  4V2F A;  1GV5 A;  1ETK A;  3M3Y J;  4JP0 A;  3S16 J;  3GBG A;  4A3L J;  4M3D A;  1HF0 A;  3NAU A;  3GTQ J;  4RBO A;  3Q0W A;  2LP0 A;  3BR5 A;  1JJ6 C;  4UUS B;  2LY9 A;  1TWH J;  2NVY J;  3BQZ A;  4A3B J;  2FD5 A;  2DMN A;  2L9R A;  4FE7 A;  1U9N A;  3FKI J;  3JRA A;  3JRH A;  3K2A A;  1WH5 A;  2YS9 A;  2JA5 J;  2GLO A;  4I76 A;  2TRT A;  4J19 A;  1FTT A;  2LKX A;  1WCM J;  3S1N J;  3ZQG A;  4FCY A;  1RKW A;  5EZG A;  1NK2 P;  1ZTR A;  2CQX A;  2E2I J;  3HOY J;  2MW8 A;  5GPC A;  2XPU A;  5K7Z A;  2COB A;  1LFB A;  2YU9 J;  4DZP A;  2Y9Z A;  3ZQF A;  2WAQ N;  2R0Q C;  4Y52 J;  5F0H A;  1H89 C;  5EDN A;  5FLM J;  1VI0 A;  3Q0V A;  5M3F J;  5IOZ A;  2WV1 A;  1MBH A;  4CYC B;  1IUF A;  2M0C A;  1ZR4 A;  1MSF C;  1TWF J;  2XB0 X;  3LNQ A;  2R5Y A;  1NK3 P;  3JRE A;  3D1N I;  1B72 B;  4BY1 J;  3GTG J;  3A03 A;  2DTZ A;  4IHW A;  2LLK A;  3HEF A;  5BNG A;  2EQR A;  5EEA A;  4A3I J;  2ID3 A;  3BT9 A;  3OSF A;  2RAE A;  4M3E A;  5IOY A;  2CUF A;  4UUS A;  2JK3 A;  4B1R A;  5E3N A;  4A3C J;  1ETQ A;  3BR0 A;  5F0F A;  1JUP A;  5M5Y J;  4NDL A;  5C4X J;  4BKX A;  3GTK J;  1ETX A;  3ZQI A;  1TWC J;  3S1R J;  2XPV A;  5EGO B;  2JWT A;  4QTR A;  5C3E J;  4C2M J;  3TED A;  4JX4 A;  3ZQL A;  1E3O C;  3RKQ A;  1H88 C;  1IDY A;  2E2H J;  4XRS G;  3Q3S A;  2VPR A;  1S7E A;  3F0C A;  4A69 C;  3BR2 A;  2MSY A;  4MFD A;  2CQQ A;  2FJ1 A;  3JRG A;  4IHY A;  3WHB A;  3O8H A;  2DJN A;  3JR9 A;  2DMP A;  1Z0X A;  1AHD P;  2K9N A;  3DCF A;  2E19 A;  1JKR C;  4IHX A;  1QVU A;  1ZK8 A;  2HOS A;  1U8B A;  2EZK A;  4X1E A;  5M3M J;  1VND A;  2DA5 A;  5IP6 A;  5J3L A;  3S2H J;  4CYC A;  5F27 A;  2VI6 A;  1MBK A;  1I6H J;  1AKH B;  1IDZ A;  2DA4 A;  3WHC A;  4C3H J;  5DS9 A;  5JLW A;  5E3M A;  4BY7 J;  2LR8 A;  1G2H A;  4B3A A;  1YRN A;  3HOW J;  2DN0 A;  1IGN A;  3LOC A;  2K9S A;  2L7Z A;  3LSG A;  4M3B A;  1P7I A;  1JTX A;  4DZJ A;  3JRI A;  2H8R A;  3LSP A;  1PUF B;  3HOV J;  5F08 A;  1JUS A;  3G1M A;  2ME6 A;  3TP0 A;  3BG5 A;  4C3J J;  2HXI A;  4UUT A;  4D7N A;  1GV2 A;  4JYK A;  2XGE A;  3TW6 A;  5F1J A;  2AHQ A;  4XRM A;  5GP9 A;  1RPW A;  1TWA J;  1ZKG A;  2XGD A;  4W1U A;  1HDD C;  3MVP A;  1F36 A;  4BXX J;  2CJJ A;  4MIM A;  4IHV A;  1LE8 B;  1MH4 A;  5EGO A;  1P7J A;  3BTL A;  2X6O A;  3CQZ J;  2EZL A;  2GM4 A;  2M8G X;  5FJ8 J;  2EZH A;  3A02 A;  4QSH A;  2DA1 A;  2NS7 A;  3IV5 A;  1GDT A;  3BG9 A;  5FKK A;  1FIA A;  4D5F A;  5IYC J;  2L7F P;  5EYR A;  1K61 A;  4LOC A;  3GTP J;  5GPA A;  4FE4 A;  3TP3 A;  2VUM J;  2HQ5 A;  3BQY A;  1ITY A;  3S14 J;  2FQ4 A;  3SJM A;  3FK6 A;  3S1Q J;  4S0H B;  2W48 A;  1Z77 A;  4XK4 A;  5K7F A;  1POG A;  2K40 A;  2EZI A;  2NVX J;  2OF7 A;  3O8G A;  4G12 A;  9ANT A;  3L1P A;  1QRY A;  1AKH A;  1EF4 A;  2HYJ A;  3IH3 A;  3LSR A;  1B8I B;  1WI3 A;  4AC0 A;  2DA7 A;  3GTO J;  1X2N A;  5J1Y A;  2DMT A;  1YRN B;  2CRG A;  1PUF A;  4MO7 A;  1IRZ A;  2Y31 A;  4DYR A;  4ABZ A;  2R5Z B;  2HOA A;  3S2D J;  5DTD A;  2R93 J;  3S17 J;  2HOT A;  1HOM A;  2ZB9 A;  2LFB A;  5FKM A;  3C2B A;  4MLO A;  2GBY A;  3QPL A;  1QPI A;  1JGG A;  1ETO A;  2X48 A;  1LE8 A;  3G1O A;  1W0T A;  1A5J A;  4DW6 A;  4BBR J;  2JN6 A;  5E3O A;  3SDG A;  3SFI A;  1O4X A;  2M9H A;  2HI3 A;  2FX0 A;  2LK2 A;  1GVD A;  5FKO A;  1ETW A;  2ID6 A;  3HM5 A;  3S15 J;  2ELK A;  1XG1 A;  2I10 A;  5HOD A;  4XID A;  1HLV A;  3NAR A;  4C3I J;  4A3E J;  4A3K J;  3RZD J;  5C4J J;  3CMY A;  1ZR2 A;  1ENH A;  3H0G J;  2EBI A;  1OCP A;  4B4C A;  1MBE A;  3GTM J;  2NVQ J;  3BTJ A;  2R92 J;  4L5E A;  4M3F A;  1F43 A;  1JKP C;  1Y1V J;  4MFE A;  4JX6 A;  2IBD A;  2ME0 A;  3PO2 J;  3UKG A;  3MN2 A;  1UG2 A;  4AUX A;  4I6Z A;  3GTJ J;  3ZOB A;  1TWG J;  4A3F J;  1JT0 A;  2NVT J;  3I4N J;  2XRL A;  5IPA A;  3ZQH A;  3HOX J;  1B8I A;  2D5V A;  2Y2Z A;  3TW7 A;  4FIS A;  4EEF G;  1RR7 A;  3BR6 A;  2N8G A;  4A3G J;  1FEX A;  3HOZ J;  1IC8 A;  3CDL A;  5M5X J;  1H8A C;  5EF6 A;  1A6I A;  2O8K A;  3ZQC A;  2R5Z A;  5IYD J;  1APL C;  2NOG A;  3FK7 A;  3BTC A;  2IAI A;  1GUU A;  1XC5 A;  2AO9 A;  1IJW C;  1ETY A;  3FIW A;  2CUE A;  3Q0U A;  4RDU A;  5FKN A;  1RES A;  1Q1V A;  3OIO A;  4HNV A;  1BJZ A;  1RKT A;  4D7M A;  4A3M J;  2Y0S N;  1Y1W J;  1U9O A;  3HB9 A;  1ORK A;  3QQA A;  1MSE C;  4A3J J;  4X6A J;  1VFC A;  3BTI A;  3A01 B;  4M6V A;  5IYB J;  4Y7N J;  1BL0 A;  1SFO J;  3QPS A;  2X9D A;  2Y9Y A;  5IP9 J;  2CU7 A;  3CCY A;  3LSJ A;  4FTH A;  1FTZ A;  1HDP A;  1WPK A;  1TC3 C;  5K7H A;  1QVT A;  1CQT A;  2B63 J;  2E2J J;  3JRB A;  1OCT C;  5EG0 B;  2KT0 A;  2JMW A;  2WB1 N;  2O7O A;  1FJL A;  2M2E A;  1MBJ A;  1IG7 A;  3HKZ N;  2DA3 A;  2Y30 A;  2MG4 A;  5J1U A;  2VKV A;  4W97 A;  1AU7 A;  1IV6 A;  2LVS A;  1X2M A;  2MGQ A;  2EH3 A;  4V2G A;  1MNM C;  1R9T J;  1SAN A;  5EZH A;  1GT0 C;  2JA8 J;  2K9Q A;  3HGY A;  3HGG A;  3E7L A;  3B6C A;  5IP7 J;  3HOU J;  3BR3 A;  1MH3 A;  5FLV A;  3DEW A;  5E3L A;  2HDD A;  3B6A A;  3BR1 A;  1XS9 A;  3I4M J;  3IH2 A;  3MKL A;  3S1M J;  3OOU A;  5M5W J; 
#chains in the Genus database with same CATH topology
 2AQF A;  3F8N A;  1I39 A;  1KYZ A;  2HZT A;  1I50 J;  4IEJ A;  2QYO A;  3MKZ A;  2L0K A;  1BA5 A;  4AIK A;  5J4Y A;  2DMU A;  3TQN A;  4IZZ A;  1XDU A;  2FA5 A;  1GXQ A;  2XUB A;  1D5Y A;  3DKY A;  3CC4 I;  3CZ6 A;  1ZGW A;  2X1D A;  3G6E I;  1ZAO A;  4BQQ A;  2KDZ A;  3FHN A;  3K4K A;  5LRS A;  4BBS J;  1WGX A;  2KL4 A;  2EK5 A;  1I3Q J;  4P96 A;  5E20 A;  3W6J B;  4UNO A;  4YIF A;  5HLG A;  3IKT A;  1DU6 A;  4BQA A;  3BG3 A;  3QPH A;  4G6T B;  2XSD C;  1YQA A;  4F93 B;  3J80 K;  5JLX A;  1K83 J;  2GAU A;  4D5C A;  2L7M P;  2IPQ X;  4HF2 A;  3QYF A;  2D45 A;  3FM3 A;  2ETH A;  2WV0 A;  3CTA A;  2O0Y A;  2QCO A;  4BL0 B;  1WFX A;  4L9J A;  4M3G A;  3OYH A;  4CCN A;  2BEO A;  3BG6 A;  2WTE A;  1JKO C;  3RZO J;  4LK0 F;  4GRI A;  3H5A A;  2XKO A;  2X4H A;  4AYB A;  4RGS A;  3WU0 A;  2BW3 B;  1FP2 A;  2XB5 A;  2CG4 A;  1ZN2 A;  2VON A;  3V7C A;  3VYS B;  3KLN A;  1WH7 A;  1K78 A;  3WU2 C;  4NB5 A;  3W2V A;  1ULY A;  1HCR A;  4KMF A;  3FHZ A;  1MBG A;  2DDB A;  2P7C B;  1BOA A;  4M6X A;  4Y33 A;  1HW2 A;  3V7R A;  2ZKZ A;  5J40 A;  4PJN A;  2EFW A;  2QQB A;  2QSH X;  3P9C A;  4HNT A;  1HC8 A;  1U5T C;  4AM3 A;  1O7F A;  4AYB N;  3BJ6 A;  4UHT A;  3H3V K;  4GDF A;  1FMW A;  3GF2 A;  1Z6T A;  1KZH A;  3M3Y J;  3CO6 C;  2K85 A;  3S16 J;  2HOE A;  4M3D A;  5DM6 F;  2OV7 A;  4ENK A;  3L9F A;  3Q0W A;  1GHC A;  2LP0 A;  2IA2 A;  4HST A;  1JJ6 C;  3HHH A;  4UUS B;  2LY9 A;  1T6S A;  4PGH A;  2HWV A;  1B9M A;  2NVY J;  3CP2 A;  4G8X A;  1HST A;  1XB4 A;  4PCQ A;  1R00 A;  2BGC A;  3KP7 A;  2ZC2 A;  2COM A;  2X1E A;  3HXL A;  3FKI J;  3JRH A;  2YS9 A;  3GO5 A;  4EAT A;  2L4A A;  1EV7 A;  3GFM A;  4I76 A;  3H3Z A;  1VQO I;  4HQE A;  3D0S A;  2EFQ A;  3F3X A;  5J47 A;  6PAX A;  1AA7 A;  3RQ4 A;  2HU9 A;  4HAM A;  4DOZ A;  1YJN I;  2QQ8 A;  4AVZ A;  3LAP A;  4HRI A;  1J0R A;  2BW3 A;  2VAS A;  4EGY A;  2IGN A;  1S9H A;  4BHP A;  1ZTR A;  2XHK A;  3HOY J;  2OU2 A;  5BMZ A;  2MW8 A;  4XKW A;  5GPC A;  3HPG A;  4PDK A;  2HFH A;  5K7Z A;  4EVI A;  2XAH A;  2KJB A;  1LVK A;  4DZP A;  3QYE A;  2VBX A;  2Y9Z A;  4KIS A;  2ZBK A;  2DK8 A;  2VOD A;  1X3Z B;  4PJ0 C;  2JSC A;  4Y52 J;  3OV8 A;  4PSX A;  1Y0N A;  3Q0V A;  1WJE A;  2W85 A;  5M3F J;  4E7L A;  1WWX A;  4IO9 F;  1V54 H;  2M0C A;  1MSF C;  1E17 A;  1SD6 A;  2FXA A;  2MFZ A;  1RRJ A;  3RPU D;  4BY1 J;  1QO0 D;  5FRO A;  1MMD A;  1Z3X A;  3WTT C;  5EEA A;  4I02 A;  2ID3 A;  5H20 A;  4ESF A;  2DQL A;  3K1M A;  1MD0 A;  2E7X A;  2OD5 A;  2M0M A;  4M3E A;  4ON0 A;  1MKM A;  4EGZ A;  3MZ8 A;  4H4K C;  2JRT A;  3HJE A;  2CUF A;  4HQM A;  4UUS A;  5EJC A;  3O2P E;  2VOP A;  3BR0 A;  1LQ1 A;  4BKX A;  1ETX A;  4RM3 A;  3EUA A;  2P8T A;  1U5T B;  3COA C;  1ACI A;  1OCO H;  1B6A A;  2P6S A;  2PMH A;  5ERI A;  2JUC A;  2K4B A;  1OR7 C;  2M8E A;  5LBQ A;  2X0L A;  2FBI A;  1QGP A;  2ZJR F;  3ZQL A;  1E3O C;  3RKQ A;  2CMP A;  3CCU I;  1SVM A;  3PNV A;  2OC6 A;  2VPR A;  1S7E A;  3BPV A;  3KYC B;  3VSL A;  3DPL C;  4U0Y A;  2EFN A;  2FJ1 A;  3GXO A;  2DT6 A;  2FEZ A;  3SZP A;  3ZCO A;  2STW A;  3E0J B;  2DJN A;  3OIP A;  1JXS A;  4N4O B;  1QVU A;  2K86 A;  1ZK8 A;  1O57 A;  5D5U B;  3NQO A;  2HOS A;  1ZYR F;  5M3M J;  1VND A;  1YFH A;  3OMY A;  2D2W A;  3HHG A;  5LGN A;  5J3L A;  4ITV A;  3OYN A;  1OQY A;  1B1B A;  1RI7 A;  2LKP A;  3DP7 A;  5F27 A;  2VI6 A;  1X1P A;  1MBK A;  2ZNY A;  1ZRD A;  2K5C A;  4WXD A;  5CLS A;  2HTJ A;  2CW0 F;  3GZ5 A;  5DS9 A;  3QOD A;  2HQN A;  3P9K A;  4LG0 B;  2P0W A;  1G2H A;  4B3A A;  1YRN A;  1W7P D;  3LA2 A;  4RB2 C;  3F21 A;  2L7Z A;  3FXQ A;  3HL2 A;  3CLQ A;  4A12 A;  3HOV J;  5F08 A;  3ZN0 A;  3DU5 A;  3G1M A;  2RQP A;  3TP0 A;  3L09 A;  4I98 B;  2UUZ A;  2HXI A;  3DPT A;  2L7K A;  1GV2 A;  1OPC A;  1W36 C;  4JYK A;  2XGE A;  1I5Z A;  1VQL I;  3GZN B;  4XRM A;  1YX3 A;  1RPW A;  1U5T A;  4W1U A;  1F36 A;  2V9V A;  2BXZ A;  4MIM A;  4IHV A;  1FC3 A;  3P7N A;  4WK8 F;  4CSW A;  1FYL A;  2PBI A;  1R1T A;  1FBU A;  1P7J A;  2X6O A;  3BTL A;  3K70 D;  4KT6 A;  3HZJ A;  1GDT A;  5J8F A;  3RYP A;  4D5F A;  3I3L A;  1HW1 A;  3O3K A;  1G59 A;  2DAO A;  2CQK A;  3NEU A;  5JHU A;  3KP3 A;  1B9N A;  5GPA A;  1VQ5 I;  2O8X A;  4Q48 A;  1J59 A;  2DW4 A;  2VQG A;  4S0H B;  4CCM A;  2DK5 A;  1W5T A;  2EZI A;  2VL8 A;  5HS7 A;  2R3S A;  1MJA A;  9ANT A;  2L9V A;  1QHG A;  5B1B H;  3FXJ A;  2QQ9 A;  1WHU A;  1EF4 A;  2RGV A;  3IH3 A;  2X1C A;  4F3Q A;  4LG0 A;  4OWR B;  3EDP A;  1B8I B;  3A0H C;  1WI3 A;  4AC0 A;  2EWN A;  3ZR8 X;  3KZI C;  2L9S A;  5CKT A;  2LNB A;  2QM3 A;  1T08 B;  1DPR A;  2L9N A;  2Y31 A;  4E7K A;  3J81 K;  3VEP A;  4ABZ A;  5L3G A;  1I1G A;  3BJA A;  1ZEL A;  4OAZ A;  2R93 J;  3V42 A;  4HF1 A;  4KMU X;  2NNY A;  3C2B A;  2GBY A;  4PJM A;  2X48 A;  1SC7 A;  1E3H A;  4DW6 A;  4G7H F;  3LFU A;  2H27 A;  4KN7 X;  2OUM A;  3U9G A;  2E7W A;  3DTI A;  3A0B C;  1R1V A;  5FKO A;  4U7B A;  2ICW G;  2ID6 A;  2DQR A;  2ELK A;  1YW9 A;  1OCZ H;  2FE3 A;  1N25 A;  4B43 A;  3NAR A;  1S7O A;  3I54 A;  5K5O A;  3RZD J;  3GWZ A;  1KU9 A;  5C4J J;  4DBR A;  4BH9 A;  1ZR2 A;  4LG3 A;  3H0G J;  2HYG D;  3N4M A;  3ECH A;  4B4C A;  1G3W A;  3FXM A;  3FZV A;  5CQG A;  1MW7 A;  3RKX A;  4E7I A;  4XM3 A;  3CLO A;  4M3F A;  4HLY A;  3S32 A;  2QVO A;  2ME0 A;  1OR7 A;  4IJA A;  5AON A;  4RMN A;  5KNL A;  1FBS A;  2JT1 A;  2KIQ A;  5D4S A;  1VQN I;  1R5I D;  3EQL F;  2XRL A;  2IW5 A;  1GVJ A;  3DTE A;  3K9T A;  4P1W A;  1B8I A;  2XIG A;  2D5V A;  2F5C A;  4FX4 A;  4LJZ F;  5LHH A;  2KZV A;  1FY7 A;  1BC8 C;  1G8X A;  1ZGA A;  1FEX A;  3W3C A;  2LY2 A;  3CUQ C;  1NH3 A;  3CDL A;  5M5X J;  1H8A C;  4LLL A;  2O8K A;  4BAY A;  2VQH A;  2KIS A;  3KYD B;  3WG9 A;  3FXO A;  2DT5 A;  2IAI A;  1FX7 A;  1GUU A;  2DOA A;  4KN4 X;  1XC5 A;  4G6Q A;  2W1O A;  1R58 A;  1BI1 A;  1XN7 A;  1X1A A;  2CUE A;  2Q0O A;  2CFO A;  3S3N A;  2L54 A;  3QPT A;  1YW7 A;  3IHU A;  5HS8 A;  3OIO A;  4HNV A;  5HLT A;  3PUB A;  1BJZ A;  1USS A;  1IN7 A;  1U9O A;  3QQA A;  2KDO A;  4H0E A;  3LQQ A;  4DJA A;  4ZYG A;  5CQE A;  4I99 C;  1VFC A;  4N4N B;  3D5R C;  1LDD A;  3P5J A;  1SFO J;  2X9D A;  3S2W A;  1R23 A;  1BR4 A;  5IP9 J;  2DFH A;  2V1D A;  3OYK A;  1FTZ A;  1WPK A;  1YX5 A;  1OCR H;  2KZG A;  2PQ8 A;  1XMK A;  4RAZ A;  3L00 A;  3JRB A;  5E8G A;  2ZJQ F;  2V26 A;  3T8T A;  4AIJ A;  1X3W B;  2EIK H;  1XGS A;  4Y4R A;  5EEH A;  1HSJ A;  5D5W B;  4L0Y B;  2XAU A;  4NQW B;  1AOY A;  2DA3 A;  4LMY A;  4BUP A;  2K3P A;  5DCM B;  2MG4 A;  2VKV A;  1EA3 A;  4W97 A;  1AU7 A;  1MMG A;  4QLC U;  1IV6 A;  2HS5 A;  1QZY A;  3MCZ A;  1MNM C;  1PYV A;  1GT0 C;  5HDN A;  3JW4 A;  3HGY A;  2HGC A;  1ZAR A;  3HGG A;  4FQG A;  3A2K A;  3QU6 A;  3K4J A;  2X6Y A;  5FLV A;  2HDD A;  1QHH D;  2J5O A;  2VC0 A;  1XS9 A;  3I4M J;  3KP2 A;  2ADU A;  2LG4 A;  2R7R A;  5FD6 A;  2LRD A;  4RGX A;  2ACJ A;  2QUF A;  3CCL I;  4QPO A;  2MAB A;  2MD5 A;  3JSP A;  3E6B A;  1D0Z A;  4ZC3 A;  4ZYE A;  2XSJ C;  2PJR B;  3BZ6 A;  3H5N A;  3G4S I;  5H6Q A;  2F4M B;  3Q9V A;  4DYQ A;  3HG9 A;  2OPT A;  2H09 A;  4JX5 A;  1JUM A;  2A05 A;  4AD9 A;  4XON A;  3RKW A;  2AQE A;  2L02 A;  3EPZ A;  2H1K A;  1XCB A;  2IGM A;  3HTU A;  1ON1 A;  5JFR A;  1JTY A;  1UMQ A;  2WY7 Q;  1IO2 A;  2HXO A;  1AWC A;  1E3P A;  1NTC A;  2GOX B;  2LY1 A;  4II2 A;  1UAA A;  3SFZ A;  3ZMV A;  1JJ8 C;  4F92 B;  4O5V A;  5DUK A;  1X19 A;  5K1Y A;  1FZP B;  2FNP A;  5F04 A;  3IWF A;  2GOM A;  4FET A;  5LGU A;  3VPR A;  4RB3 C;  1PP8 F;  3OS2 A;  3C3W A;  4KIF A;  4NQW A;  5LHG A;  2YPR A;  1BW6 A;  2FBK A;  2XGC A;  2WWY A;  5DCM A;  4CYD A;  1MMN A;  5D8L B;  5F0C A;  4HBL A;  5AIP A;  2ZXI A;  3HIF A;  1ZRF A;  4CHU A;  2UV1 A;  4RA2 A;  2BY2 A;  3PUF A;  3DWL E;  1U78 A;  3BJO A;  2QBY B;  2K9L A;  3WGH A;  2MLG A;  2XAG A;  2R4G A;  2VKE A;  4XLF A;  5D6F A;  3GW2 A;  1OFC X;  2P6T A;  5BPI A;  1A6Q A;  3R0A A;  5E1X A;  3JRD A;  5D5V B;  2DFF A;  3MWM A;  3HDD A;  2F2E A;  4AIH A;  1BBY A;  1Q1H A;  4Z6Y A;  3G1L A;  2FSW A;  3CUO A;  5KAI C;  5JI6 A;  4HDV A;  2DA6 A;  3GTL J;  2XPW A;  2IA1 A;  2QF7 A;  5TJJ A;  5ICC A;  4UUV A;  2Q1Z B;  1FOX A;  2JA6 J;  2O03 A;  1R22 A;  2P81 A;  2BV6 A;  2DO7 A;  1CGP A;  1BW5 A;  5FD5 A;  4U7D A;  1W0U A;  1QU3 A;  1KU3 A;  2G0E A;  2MH9 A;  3KE2 A;  1YG2 A;  2DMQ A;  1B72 A;  3OYG A;  2G7H A;  2O5R A;  1UHS A;  1MBF A;  3K10 A;  3PIO F;  4XIC A;  1LFU P;  1T33 A;  4IOC F;  4FX0 A;  1GV5 A;  1ETK A;  2P5K A;  1HKQ A;  3S93 A;  1R4M B;  3GBG A;  1TBX A;  1G3T A;  2DDA A;  1HF0 A;  2RDP A;  3NAU A;  2DPD A;  2IS4 A;  1W5C C;  3CJQ B;  2A69 F;  3E5Q A;  3BG7 A;  3RJP A;  4B48 A;  4ENJ A;  1SD5 A;  2PEX A;  4XMY A;  4A6E A;  4O6J A;  4CA0 A;  1N78 A;  2QEX I;  4A3B J;  4KIC A;  2DMN A;  2L9R A;  1BI2 A;  1TQI A;  3QU3 A;  1P4A A;  1FOW A;  4HX8 A;  3JRA A;  1WH5 A;  2JA5 J;  4OAY A;  2X85 A;  2RN7 A;  2HVS A;  4WXC A;  3L7W A;  4J19 A;  1CF7 B;  2FF4 A;  3IRQ A;  4IX7 A;  2R7X A;  1EH8 A;  3WE3 A;  1V5F A;  2QBY A;  3BCA A;  1WCM J;  3S1N J;  3BZK A;  1RKW A;  2WBM A;  5EZG A;  2E36 A;  3SHF A;  3OYB A;  2CQX A;  5D5X B;  1ZH5 A;  2EV5 A;  2PMU A;  3AAF A;  1ZG1 A;  4MTE A;  3J7Z I;  4JBA A;  2COB A;  1LFB A;  3GME A;  4HLX A;  3ZQF A;  1QA6 A;  2RC4 A;  2O3F A;  1H89 C;  3V8J A;  3TOA A;  3OYJ A;  2CV1 A;  2HPM A;  2PLY A;  1VI0 A;  3FXU A;  4HV5 A;  4HX7 A;  2W82 A;  4UVB A;  1K7A A;  1O3R A;  4BJT A;  1HW5 A;  1L3L A;  1IUF A;  4F55 A;  1TWF J;  4UB6 C;  4L5J A;  3F6O A;  4L9V A;  4CDG A;  3C7J A;  1Y56 A;  5L3C A;  5BNG A;  2E60 A;  2EQR A;  5DD8 A;  3QYB A;  1D0Y A;  1KQ0 A;  2HNH A;  2XAF A;  4CCL A;  2OQG A;  3ABK H;  3I0T A;  2NAZ A;  2JK3 A;  2WAE A;  3CMM A;  1ETQ A;  3ELK A;  5F0F A;  2GA1 A;  2OJE D;  3ZMZ A;  5C4X J;  1LDJ A;  3GTK J;  4IHT A;  1X1C A;  2A5W A;  2OQR A;  4PK4 A;  3ZQI A;  4UV9 A;  1P9Q C;  3CCQ I;  5A2Q Z;  4X0G A;  2GXG A;  1Y6I A;  2XAJ A;  2JWT A;  4QTR A;  2EA2 A;  3WGI A;  3MFK A;  1JE8 A;  1CF7 A;  2CV2 A;  4ZYH A;  1YJ9 I;  3E1S A;  4RLF A;  4XRF A;  2UWM A;  4KFC A;  2PG4 A;  2AS5 F;  1H88 C;  4M71 A;  2E2H J;  1B59 A;  2HTS A;  3F0C A;  3C18 A;  4Q4Z F;  2Z9O A;  3BR2 A;  2ZFU A;  5CJ9 A;  2V79 A;  1FWZ A;  2MSY A;  4MFD A;  5CVV A;  4KYW A;  4G7O F;  4IHY A;  3IUO A;  4RB0 A;  3O8H A;  1SEU A;  4IHS A;  3JR9 A;  3PFY A;  1Z9C A;  1AHD P;  2R7V A;  2E5N A;  2NNN A;  1JKR C;  1SD7 A;  2EIM H;  2FRH A;  4KIB A;  2A61 A;  4YG2 F;  4IHX A;  2EZK A;  4X1E A;  2ESH A;  2V4J C;  3E6D A;  4KA4 A;  2VC1 A;  3S2H J;  5HNH A;  1IUY A;  1VZ0 A;  2KFD A;  1FLI A;  3F9K A;  3ZMT A;  1XD7 A;  4LIT A;  3WTZ A;  4ZZD A;  2JZY A;  4HDU A;  1AKH B;  1IDZ A;  3WHC A;  3JAM Z;  1ONV A;  2LF8 A;  2XGX A;  1VQM I;  4BY7 J;  2XDV A;  2LR8 A;  4HW0 A;  3R6S A;  3JAM K;  3HOW J;  3OYD A;  4YEL A;  5DYM A;  4UV8 A;  3UNG C;  5JVT A;  3LST A;  1P7I A;  1JTX A;  3JRI A;  3LSM A;  4MGR A;  2ELH A;  1VQ7 I;  2QWW A;  2ZSH B;  3KEY A;  4PJL A;  2FOW A;  4CCK A;  4OIR F;  4C3J J;  2VBY A;  1O3Q A;  4D7N A;  2R7S A;  2ESN A;  4XN3 A;  4U0W A;  3TW6 A;  5F1J A;  2AHQ A;  5L3F A;  5GP9 A;  2M87 A;  1Z6R A;  4BXX J;  1LE8 B;  2IS6 A;  1MH4 A;  3FMS A;  3SZT A;  1C0W A;  4U0V A;  1D8J A;  3T0Y A;  5FJ8 J;  3GZ6 A;  1TT0 A;  1L0O C;  2EZH A;  4RLQ A;  4QSH A;  1V3F A;  1TZL A;  2OZU A;  2YU3 A;  5FKK A;  1FIA A;  5IYC J;  1K61 A;  1FP1 D;  4HYE A;  3GTP J;  3HPH A;  5L3E A;  4WF2 A;  3TP3 A;  2K02 A;  3L2V A;  3S14 J;  2FQ4 A;  3F72 A;  3FK6 A;  4C30 A;  4HEA 2;  4D0P A;  3K70 C;  4LLN A;  2VQL A;  3H5R A;  3DTK A;  1XX5 A;  5HNF A;  5J8C A;  3S3O A;  3O8G A;  5F64 A;  3L1P A;  1UJ8 A;  1AKH A;  2VJJ A;  2QLZ A;  2HYJ A;  3GFL A;  3N05 A;  3SXY A;  1KA8 A;  3VYR B;  3GTO J;  2BYV E;  2DOF A;  2HZD A;  1YRN B;  2DMT A;  3FX3 A;  1QZZ A;  3DBR B;  1G4D A;  1N77 A;  1R36 A;  3B73 A;  1RUN A;  2OTJ I;  3W6K B;  1DP3 A;  1YS7 A;  3EET A;  2QQA A;  1Z05 A;  5DTD A;  2E34 A;  4HOB A;  3S17 J;  1HOM A;  2HKX A;  3LL7 A;  4AWX B;  1ETO A;  5GAG J;  1LE8 A;  2EA4 A;  4BBR J;  4EJO A;  2DCE A;  2JN6 A;  1DGR M;  4ZDO A;  1O4X A;  4AVP A;  1FMV A;  2M9H A;  1QBJ A;  2RQQ A;  2QZ8 A;  1D8K A;  2LK2 A;  4U87 A;  3TGN A;  1T38 A;  2GA2 A;  3REO A;  5B5E C;  3HM5 A;  4XOT A;  2F4O B;  1BIB A;  3AFH A;  5BOX A;  3OIQ A;  2I10 A;  3JTG A;  5HOD A;  3I58 A;  3E6M A;  2JPB A;  4OIO F;  2QKL B;  2VBW A;  1BM9 A;  2FUG 2;  3RPU A;  1ENH A;  2EBI A;  1OCP A;  2IT0 A;  1W7P B;  4MEX F;  2KPM A;  3T1B A;  1MBE A;  4CO8 A;  1BIA A;  1GLN A;  4RGU A;  4I0A A;  1F43 A;  1FOY A;  2VPL A;  1UB9 A;  2IBD A;  1ZG5 A;  1TTY A;  2IS1 A;  4Y17 A;  4HNU A;  3MN2 A;  1KGS A;  1IRX A;  3V8L A;  5LEJ A;  3H3U A;  1MGT A;  4RS8 A;  1IXS B;  2Y0S A;  2NVT J;  5IPA A;  3L2W A;  3I4N J;  1ZLJ A;  2Y2Z A;  3TW7 A;  1BOB A;  4A3G J;  3HOZ J;  4BAC A;  4IF4 A;  1MNE A;  1FNN A;  1LKX A;  4PGG A;  1A6I A;  2XRN A;  2ZSI B;  2DJI A;  1I6X A;  2LF7 A;  3ZQC A;  5JVG F;  4XLH A;  3BTC A;  4IOA F;  4MQV A;  3PJR A;  4PZJ A;  5ICG A;  3Q0U A;  4OIQ F;  3CCV I;  2WB1 A;  3KEO A;  3MKY B;  5KK1 A;  4OOI A;  1G3Y A;  5DD4 A;  4K2E A;  1O3S A;  1TW3 A;  2YX7 A;  1RKT A;  4D7M A;  4Q47 A;  2Y0S N;  3BOQ A;  3HB9 A;  5ILS A;  2IXS A;  1MSE C;  1R6R A;  1W1W E;  4OMZ A;  3A01 B;  4XKB A;  4Y7N J;  5IYB J;  1K6O A;  3ZQQ A;  2DBB A;  2VE8 A;  3KZZ A;  4C9Y A;  1TLH B;  3HRS A;  1Y39 A;  3CDH A;  2CU7 A;  3LSJ A;  3CJT B;  3DBH B;  3R61 A;  4CGZ A;  1TC3 C;  2C6Y A;  5K7H A;  1REP C;  5LHI A;  1WJB A;  2EIN H;  1W7P A;  3H0D A;  5EG0 B;  2KT0 A;  3CP8 A;  3R4K A;  2JMW A;  2WB1 N;  3OOP A;  1WZ2 A;  1Z21 A;  1VTN C;  2A07 F;  4R8H A;  3TKY A;  4DGW B;  4LB5 A;  5J1U A;  1E0E A;  1UG0 A;  3IAM 2;  2WAD A;  1KU7 A;  2LVS A;  3O6B B;  2IGO A;  1IRF A;  2EH3 A;  1D1B A;  2Y69 H;  1MND A;  1R9T J;  3DFG A;  5EZH A;  5FRN A;  3HSF A;  4V19 K;  4BXU A;  4TV7 A;  3E7L A;  3CO7 C;  3WU1 B;  4D1Q A;  3WOD F;  3D5L A;  4BEH B;  3HOU J;  4XOP A;  3DPU A;  3BR3 A;  1YIJ I;  2OTL I;  1SD4 A;  3FBN B;  2HQR A;  2OBP A;  3B6A A;  3OY9 A;  3CC2 I;  3RTR A;  3DQV C;  3MKL A;  1R49 A;  3OOU A;  2ZO4 A;  3ZP5 A;  1JI8 A;  2M34 A;  1SAU A;  4Y3O A;  4BDZ A;  4C2U A;  3MMY B;  1HXD A;  1OJL A;  5CVU A;  2JA7 J;  1R5G A;  4BGD A;  4IRG A;  2R7T A;  5FFZ A;  1IRG A;  1LUJ B;  3FDY A;  2DFI A;  2GXA A;  5FKL A;  4M9X A;  2E1O A;  4UVA A;  1FIP A;  1O7L A;  2IGK A;  2ZFW A;  3A01 A;  3CCM I;  5DCF A;  3ULQ B;  4RAY A;  3K7A J;  3DLL F;  2JSP A;  2JVG A;  1VQ9 I;  2QA4 I;  1YS6 A;  1X58 A;  3V4G A;  4G7Z F;  2ELJ A;  3LFK A;  5EG0 A;  1T95 A;  5HVQ C;  3HYI A;  2KRC A;  2Y48 A;  4NC7 A;  3SQN A;  5B66 C;  1DU0 A;  2ECB A;  4FT8 A;  3I55 I;  3JRC A;  3PQJ A;  2DTR A;  2L2O A;  2MA3 A;  2RNG A;  3OL4 A;  1MJB A;  3H9Q A;  3K0L A;  2YX4 A;  4NUB A;  4YIR X;  2VE9 A;  1LEB A;  1BR1 A;  2DOE A;  2XV4 S;  2ZJP F;  1D5V A;  3DU6 A;  3W6V A;  1QNT A;  3HUG B;  5EEG A;  3ZN1 A;  4N9H A;  3AG4 H;  4BEH A;  2AXT C;  2ECC A;  2NVU B;  1OCC H;  4DYC A;  4WWC A;  2BY0 A;  2VOO A;  1TNS A;  3M4O J;  2HQA A;  3OYF A;  4ESJ A;  3QRF F;  2R7O A;  4N0B A;  1IN8 A;  1VF9 A;  3TBI A;  1FYK A;  4KIT B;  3PM1 A;  2H94 A;  3T5X A;  2I5U A;  4ZYA A;  1YI2 I;  2LD5 A;  5C44 J;  2QEN A;  4IPA A;  3GFI A;  4AU7 A;  3LSH A;  4XSZ F;  4S04 A;  3EYY A;  2BHZ A;  2W24 A;  2FU4 A;  3MEX A;  5KAF C;  3PO3 J;  4E7J A;  5BPD A;  1Z7U A;  3FIS A;  1BR2 A;  2F6C A;  1T56 A;  2K27 A;  3IH4 A;  3ZPL A;  3OR2 C;  2L01 A;  3LA7 A;  1TP4 A;  2OAZ A;  4A3L J;  3FXK A;  2CQ7 A;  3GTQ J;  2V1U A;  3KLO A;  4RBO A;  4BE2 A;  3PSF A;  3IWZ A;  3LSI A;  2Z2S B;  5DUI A;  3AG3 H;  3BQZ A;  2XF7 A;  1MMA A;  2CQN A;  1R7J A;  1OIS A;  2WAQ A;  1SMT A;  2VJI A;  1G3S A;  4B3X A;  5H2F C;  3GVA A;  1T39 A;  3KX2 A;  1YJW I;  1ON2 A;  4IRI A;  2TRT A;  2L3D A;  4GYG A;  3V8K A;  3D5S C;  5DDG A;  2QGU A;  2EIL H;  3QP6 A;  2MC3 A;  4UVC A;  4CCO A;  5KHD A;  2LKX A;  3ZQG A;  1D1A A;  4FCY A;  4E4H A;  2R7F A;  2HDW A;  3H92 A;  3HUG A;  5JHF A;  1NK2 P;  4E70 A;  2E2I J;  2XPU A;  4II3 A;  1EKE A;  4Y15 A;  1J75 A;  3BP8 A;  3MAJ A;  3PFI A;  1WI9 A;  4ZTJ A;  2CSO A;  2I8D A;  2WAQ N;  2R0Q C;  5F0H A;  1D3Y A;  3T8R A;  2P7V B;  5ICE A;  4HPQ A;  4GXO A;  4P55 A;  3IP4 B;  1U8R A;  2IRF G;  4BE0 A;  1KU2 A;  5IOZ A;  2WV1 A;  1MBH A;  3TO6 A;  5GAH J;  3TO7 A;  1WVR A;  3HSR A;  2NRA C;  1NK3 P;  4QWQ A;  1Z91 A;  3I64 A;  3JRE A;  3D1N I;  1B72 B;  2HEO A;  3GTG J;  2V9P A;  1S29 A;  3A4C A;  4BYY A;  4ETS A;  4L9T A;  3BRO A;  2KLO A;  1JHH A;  3CCR I;  1YW8 A;  3OSF A;  2RAE A;  2FBH A;  5IOY A;  2Z99 A;  4YFN F;  4B1R A;  5E3N A;  3CCS I;  2A5Y B;  5E1W A;  4A3C J;  4EM2 A;  2H8W A;  2M45 A;  3JTH A;  3IAS 2;  5M5Y J;  1YO5 C;  3VB2 A;  2ZME B;  3F8B A;  2QSG X;  1TWC J;  3S1R J;  1QQI A;  2NS0 A;  3CJN A;  3GCM A;  4EJT A;  2B0L A;  2CH0 A;  5EGO B;  3K6G A;  1HQC A;  4Z2Y A;  4C2M J;  4KJZ A;  1P6R A;  4MTD A;  4XLC A;  3TED A;  2JQ7 A;  3PNT A;  3J7A O;  1IXR C;  3EUH A;  2D1H A;  2PI0 A;  1IDY A;  3ONQ A;  4XRS G;  3Q3S A;  1X4P A;  2IVM A;  4ENN A;  3SEQ A;  3M8E A;  4A69 C;  3G71 I;  4M9S A;  3C1D A;  3E5X A;  1XMA A;  1UST A;  4HF0 A;  3JRG A;  1T0F C;  2KP6 A;  2IA0 A;  2ZNZ A;  3M7G A;  2W4S A;  3CJR B;  2DMP A;  1Z0X A;  4DBQ A;  3DCF A;  2E19 A;  3J7A Y;  3E3V A;  4E7Z A;  1J9I A;  4M72 A;  1U8B A;  2CUZ A;  4L0Z B;  3K4N A;  3ERM A;  4BHC A;  1PJR A;  1VQK I;  3TDU C;  3DLA A;  2JVH A;  2BE5 F;  3TOB A;  2DA4 A;  2M3A A;  1K4S A;  5E3M A;  2O6G E;  3PL8 A;  3IL2 A;  5GTI C;  4LIV A;  2O61 A;  4XKV A;  1KON A;  2VT2 A;  2BVL A;  4P9F A;  4R79 A;  2K9S A;  1FYM A;  2JTV A;  2M7A A;  3PQK A;  5CVR A;  4M3B A;  4DZJ A;  2H8R A;  3MD2 A;  4JOM A;  2P5V A;  2R7Q A;  1JUS A;  4XBF A;  2ME6 A;  4Y13 A;  2LOO A;  2YSR A;  2UXN A;  1BN5 A;  3BG5 A;  1DQU A;  3H1C A;  3JCU C;  4S05 A;  3FBI B;  4UUT A;  3RYR A;  2H6C A;  2ZME A;  4RB1 A;  1EJ9 A;  3K4M A;  1TWA J;  1ZKG A;  1HDD C;  1LPQ A;  2CJJ A;  4PSW A;  1TT5 B;  5EGO A;  2Y75 A;  3CQZ J;  1U2W A;  3I5U A;  4IVN A;  3VYU B;  2M8G X;  2LC2 A;  4I7H A;  1ZRC A;  3AL0 C;  4DIQ A;  3VDX A;  1J2X A;  2IJL A;  3IV5 A;  4A5N A;  1R5H A;  3BG9 A;  4JQF A;  4CZC A;  2HKO A;  4G6D A;  5D6E A;  3KET A;  1WJ5 A;  1IZ1 A;  3CMA I;  1OYW A;  1PVE A;  2CS3 A;  3IC7 A;  2KHM A;  2DU9 A;  3DKX A;  2VUM J;  2HQ5 A;  3BQY A;  2GQQ A;  3GLL A;  4FHT A;  1ITY A;  2BOL A;  1FT9 A;  1LDK B;  5L3D A;  5F6F A;  3FWE A;  3DXJ F;  3S1Q J;  2XAS A;  1Z77 A;  2M30 A;  2ZXW H;  1POG A;  3RCO A;  3WTU C;  2OA4 A;  2PFB A;  5AIQ A;  3G73 A;  2NVX J;  2FNA A;  5LEK A;  1QRY A;  2IS2 A;  2H6B A;  5D4R A;  2P4W A;  3BC8 A;  3LSR A;  5IY5 H;  2KQR A;  3HC7 A;  5J1Y A;  5HOO A;  2JPC A;  1XGN A;  4IL6 C;  1YIT I;  5LRR A;  3RDI A;  2B9S A;  4MO7 A;  1IRZ A;  4DYR A;  2VIX A;  1YTY A;  1BI0 A;  4PFP A;  2BY1 A;  4XOR A;  1HKT A;  4OIN F;  3K4L A;  2HOA A;  3S2D J;  4DQ2 A;  2X51 A;  3L2Q A;  3HOT A;  4L9N A;  3F6V A;  2ZB9 A;  3KP4 A;  2JRM A;  2K3F A;  4YFX F;  5DV5 A;  5FKM A;  4EQQ A;  4MLO A;  1DDN A;  1QPI A;  4U88 A;  3RIR A;  2LMD A;  4R1H A;  1P4X A;  1U0J A;  4JK1 X;  5E3O A;  3SDG A;  5CPR B;  4ZYD A;  3E5U A;  2FX0 A;  3GEZ A;  5A2Q K;  3B02 A;  1GVD A;  1TW2 A;  3QWL A;  4YFK F;  1ETW A;  3S15 J;  5BS6 A;  4EJU A;  1PP7 U;  1X3U A;  3C2H A;  2KRH A;  3K2Z A;  1YIO A;  1SVL A;  2Z3Y A;  3J80 Z;  4ZH4 F;  1HLV A;  4CUG A;  5H6R A;  2HDC A;  4C3I J;  4EM0 B;  5E18 F;  4A3E J;  5E17 F;  3NRV A;  2NXN B;  5IT9 Z;  2A3S A;  3KPH A;  3ASO H;  2WC2 A;  5IT9 K;  1XSV A;  2ZCW A;  3CCE I;  1S72 I;  3GTM J;  1DGW Y;  4L5I A;  3DEU A;  1SVO A;  2A6T A;  1JKP C;  5E1Z B;  2LH9 A;  2Y0M A;  1STZ A;  2LRE A;  3H36 A;  4BS9 A;  4BE1 A;  3PO2 J;  3AL0 B;  5L3B A;  1R4N B;  1RZ4 A;  2RRE A;  4B09 A;  2BZT A;  3OWT A;  3VOE A;  3TDZ C;  4B8X A;  2DPU A;  2M4K A;  3GTJ J;  4IXA A;  2RV8 A;  1TWG J;  4A3F J;  1JT0 A;  1MZB A;  3N97 A;  1OLT A;  2DOD A;  1D1C A;  4PFO A;  3UR3 C;  3IRR A;  1Z1D A;  1G6N A;  4XLA A;  3WTS C;  4ASN A;  5FRM A;  4EEF G;  1RR7 A;  2WA0 A;  2K4J A;  3KEQ A;  3BR6 A;  2EIJ H;  1T0F A;  2N8G A;  5CVJ A;  1TL8 A;  1BI3 A;  2DFE A;  1XSD A;  5EF6 A;  3HRM A;  4RAG A;  4XLN F;  1APL C;  5J6X A;  2GIV A;  2IP2 A;  2NYX A;  2RNJ A;  3FK7 A;  1DUX C;  4B44 A;  2VJ5 A;  1XMX A;  1IJW C;  1ETY A;  4XN0 A;  3CC7 I;  3LA3 A;  4RDU A;  3PSI A;  5FKN A;  2MD0 A;  1WQ2 A;  1RES A;  1MDM B;  3ML6 A;  1Y1W J;  1T98 A;  4A3J J;  3OYL A;  1H0M A;  1J5Y A;  1OYI A;  1ODD A;  4M6V A;  2ZXH A;  2E1N A;  3RI4 A;  4ZTF A;  1EH6 A;  4I01 A;  3AG1 H;  2Y9Y A;  5E79 C;  3WE2 A;  3CCY A;  4IQ4 A;  4UB8 C;  1HDP A;  3H35 A;  4BDY A;  2K9M A;  5HDG A;  2HYF A;  5FO5 A;  2B63 J;  3ZMU A;  1IF1 A;  3CF5 F;  3J7Y J;  4OIP F;  1YE9 A;  2VT3 A;  1VQP I;  1OCT C;  3TO9 A;  2O7O A;  3HRU A;  3MZH A;  3KIO A;  1FJL A;  2M2E A;  2W00 A;  1IG7 A;  3ABU A;  1PDN C;  4KNY A;  3VFZ A;  4P5O A;  4M6Y A;  3CES A;  2ZXJ A;  5J4V A;  2HR3 A;  1X2M A;  4LFU A;  2E5Z A;  2EPF A;  1SAN A;  2VKH A;  1R71 A;  3EYI A;  2V1X A;  3LQR A;  2EFO A;  2PMZ A;  1FOK A;  4XLP F;  2K9Q A;  2MLK A;  1I27 A;  2CWE A;  2F4I A;  2W25 A;  1FPQ A;  4BHB A;  2XAQ A;  4BXF A;  2CGP A;  1Y8Q B;  3ERE D;  3M8F A;  5JR3 A;  4ENM A;  1K79 A;  5HS9 A;  5E3L A;  4BQN A;  1XGO A;  3BR1 A;  1UHM A;  1A36 A;  4EJW A;  1YOV B;  4LD5 A;  4LB6 B;  4F91 B;  1ETV A;  1Y8R B;  2VB6 A;  2M7B A;  4GCV A;  1MDM A;  1JKQ C;  1S5L C;  4QPQ A;  2F5V A;  4A3D J;  2VXD A;  2JJ7 A;  2PMZ N;  2Z5U A;  5DM7 F;  3M9A A;  5GAE J;  2L4M A;  3I4P A;  4ZZL A;  2GXB A;  1IN6 A;  2LTP A;  1ZG3 A;  2R7Z J;  5LLQ A;  3JRF A;  4CXF A;  4M74 A;  4XRS A;  3BPX A;  3MQ0 A;  1E2X A;  4A5M A;  3WG7 H;  2R7D A;  1SFE A;  3DF8 A;  3M8J A;  4RM2 A;  2EJR A;  2HVR A;  3PIP F;  3E6C C;  2E1C A;  3LWF A;  1GXP A;  5FFX A;  3L2R A;  1ZRE A;  4M73 A;  4GFB A;  5J1R A;  3WTX C;  2XVC A;  5KVR A;  2DA2 A;  4XLE A;  4XL9 A;  3HBL A;  3ABL H;  2CYY A;  1F1Z A;  1I3A A;  1NHA A;  1FSH A;  3GX4 X;  3CCJ I;  1XPX A;  2FMY A;  3HSE A;  2TCT A;  2D1V A;  2EV6 A;  2LBF B;  3VSK A;  1IAW A;  2CO5 A;  4A93 J;  4AID A;  4QIW N;  4KIG A;  4B47 A;  1MMS A;  3QOE A;  3OYI A;  1V55 H;  2Z16 A;  3H9G A;  1RR8 C;  3OSG A;  1PUE E;  4NNJ A;  1S3J A;  1BJA A;  1ERD A;  5HLI A;  1U6G A;  3GUD A;  2W57 A;  2BHY A;  4YEJ A;  2NS8 A;  1XSX A;  3ZRG A;  3GFJ A;  2YUS A;  1LFP A;  3K69 A;  2VQC A;  4LGW A;  4RGR A;  3RKY A;  2CV0 A;  4L18 B;  1Z3Y A;  2O9L A;  2R5Y B;  1Z67 A;  4CZZ A;  3U2R A;  2IEK A;  3RQI A;  1OKR A;  1RET A;  3CD6 I;  2P5L C;  1ZQ3 P;  4ZDL A;  3GYH X;  1JT6 A;  2MYS A;  3ABT A;  2FQ3 A;  2OZ6 A;  2XF6 A;  4V2F A;  4F7Z A;  2LYC A;  4JP0 A;  1RIO H;  3WTY C;  4XKC A;  2DT7 B;  2EB7 A;  5IT3 A;  1ZHF A;  1U3E M;  4A0Z A;  3K1P A;  3DV8 A;  3BR5 A;  3CF2 A;  1UEL B;  3BCB A;  1TWH J;  4GO1 A;  3VOD A;  4WXH A;  4C2T A;  2GIZ A;  4GYI A;  3HTS B;  3OYA A;  4LK1 F;  3BWG A;  2MH2 A;  3OS0 A;  2FD5 A;  4Q5S F;  2KIF A;  1WJD A;  3GLX A;  1UCR A;  4FE7 A;  4D9J A;  1U9N A;  3OYC A;  2Q2E B;  3K2A A;  4NC6 A;  3CDI A;  1A31 A;  3KP5 A;  2EFP A;  2GLO A;  3BY6 A;  1ZLK A;  3R0J A;  2M5W A;  4G9Y A;  1FTT A;  4PJJ A;  3NWT A;  5GTH C;  3QOP A;  2LBF A;  2CW8 A;  4GGG A;  4G94 A;  1UZC A;  1D0X A;  1OYY A;  3C2G A;  3IKV A;  1WSU A;  4CH7 A;  1UHW A;  2YU9 J;  1HA8 A;  5CYV A;  4XQF A;  1XCV A;  2YR2 A;  5EDN A;  4HSR A;  5FLM J;  4YII A;  2BVM A;  2FOK A;  2NOJ B;  2KJC A;  1P4W A;  4A0Y A;  4F52 A;  1FBQ A;  1JGS A;  3PNY A;  4CYC B;  1ZR4 A;  2XB0 X;  1N75 A;  3LNQ A;  2R5Y A;  1JHF A;  4BU2 A;  4A6D A;  3A03 A;  1A04 A;  2DTZ A;  4IHW A;  2DI3 A;  2LLK A;  2V7F A;  3HEF A;  1A35 A;  2DYR H;  1IXC A;  3J81 Z;  3BT9 A;  4A3I J;  3RSN A;  5KCM A;  2X6W A;  2KRF A;  4DNC A;  1LNW A;  3F8C A;  2V6C A;  4I09 A;  4WX9 A;  2GWR A;  3EUH C;  4I2O A;  2W7N A;  1JUP A;  3F8F A;  4NDL A;  2JA2 A;  2LDU A;  2KIU A;  3LAJ A;  4N9I A;  3VYT B;  2Q2E A;  5BQT A;  2VLA A;  3AG2 H;  1OMI A;  2XPV A;  3ISP A;  1T2K A;  4EM1 A;  2VN2 A;  5C3E J;  3CME I;  2L5Q A;  2XKP A;  2CFX A;  4JX4 A;  4WCG A;  1H9G A;  3S8P A;  1K6Y A;  4HA8 A;  4KT5 C;  1LB2 A;  4HZF A;  3ROU A;  5LD2 C;  5FLX Z;  3U1K A;  2CQQ A;  4ZDP A;  3WHB A;  4EJV A;  1LEA A;  4LLG F;  4XR6 A;  5FLX K;  2XF5 A;  4NBQ A;  3NWS A;  2H1L A;  1MIJ A;  2K9N A;  3S3M A;  2B7E A;  2A6H F;  3WGG A;  2RVC A;  3DKW A;  3EUK L;  3ZQ7 A;  1ZGJ A;  2DA5 A;  5TGT A;  3QP5 A;  3TL4 X;  5IP6 A;  4CIC A;  4J00 A;  4CYC A;  1SFU A;  2ZME C;  2E35 A;  1B4A A;  4IKF A;  1I6H J;  3BLY A;  4CCJ A;  4BNC A;  3WTW C;  1W36 D;  4RAF A;  4C3H J;  2MBF A;  5JLW A;  1LJ9 A;  3Q5F A;  3FF5 A;  2OCE A;  2DN0 A;  1IGN A;  5B1A H;  4E7H A;  3LOC A;  2DYS H;  1WJF A;  3LSG A;  1M1E B;  2RKH A;  1V5E A;  3LSP A;  1PUF B;  3K4C A;  4MNU A;  2Z33 A;  1SFX A;  3I59 B;  2A6E F;  4BQO A;  1TNT A;  1RC9 A;  2XC7 A;  4FAS D;  3W2W A;  5E8I A;  2CW7 A;  2XGD A;  2A68 F;  3MVP A;  4NC8 A;  3KFW X;  2UXX A;  2VKD A;  3I71 A;  2EZL A;  2GM4 A;  3U1D A;  1HBX G;  4XNF A;  1XDS A;  1S8N A;  3A02 A;  2M4G A;  3AKZ A;  2UZK A;  5TIS C;  1WJA A;  1VQ6 I;  2DA1 A;  2NS7 A;  4MEY F;  1XGM A;  1X1D A;  3G3Z A;  3E97 A;  1O3T A;  2M1B A;  1V4R A;  3L2C A;  1P92 A;  3FKJ A;  4E7S A;  2L7F P;  4ANJ A;  3F23 A;  5FGM A;  5DEQ A;  5EYR A;  4ZJZ A;  4NHJ A;  2GZW A;  2VBZ A;  3VWB A;  5LGT A;  4LOC A;  1VQ8 I;  2HPI A;  1KYW A;  1Z7L A;  2W84 A;  2WAF A;  4FE4 A;  1YLF A;  2ZJ2 A;  3RPQ A;  4HV6 A;  5K5Q A;  3ZMD A;  4J01 A;  3SJM A;  5K5R A;  4PUS A;  1YHQ I;  1FSE A;  2W48 A;  2KKO A;  4IRH A;  4XK4 A;  2Q8K A;  5K7F A;  3H9J A;  3KYL A;  2PX9 A;  3X2Q H;  2K40 A;  2X6X A;  1X4O A;  2OF7 A;  1NG7 A;  3FXR A;  4G12 A;  2QKM B;  1P2F A;  4IQJ A;  2KIM A;  2BXY A;  1J09 A;  5HLH A;  1HKS A;  3K4B A;  4P9U A;  3G2B A;  4I0B A;  2V6E A;  2DA7 A;  1I1S A;  1X2N A;  2DXI A;  2CRG A;  2LKS A;  1PUF A;  2F5F A;  3KP6 A;  1LVA A;  1BC7 C;  3ZMS A;  3WTV C;  3KCC A;  3I59 A;  3HOS A;  3TMO A;  1IN5 A;  2E1M C;  4BJ6 C;  2R5Z B;  5LFA A;  4LIU A;  1K4T A;  2HOT A;  3OR1 C;  2LFB A;  5ICF A;  2WY8 Q;  3BZC A;  3QPL A;  1JGG A;  2PN6 A;  3G1O A;  1W0T A;  1A5J A;  2R7U A;  3SFI A;  2HI3 A;  4OMY A;  3R60 A;  3CUQ B;  3SDB A;  5F1R A;  1XG1 A;  2CUJ A;  1V5G A;  2KMU A;  2Z1D A;  1KQ9 A;  5B3S H;  4YRV A;  4UXN A;  4KUM A;  4XID A;  1EH7 A;  3U21 A;  2PJP A;  4E6K G;  4A3K J;  3I53 A;  3CMY A;  1MJ9 A;  3L2U A;  3BDD A;  2QSF X;  3ZGK A;  4OU0 A;  2NVQ J;  3BTJ A;  2R92 J;  4L5E A;  2XRO A;  2J5P A;  2OCC H;  1Y1V J;  4MFE A;  4JX6 A;  3F22 A;  3ABM H;  3UKG A;  1UFM A;  3LMM A;  5D8K B;  2VXZ A;  3FM5 A;  1SAX A;  5ILU A;  2STT A;  1W5S A;  1F5T A;  1UG2 A;  2MC4 A;  3QAH A;  5CVI A;  4AUX A;  3ZOB A;  3ECO A;  2BBY A;  5GAD J;  4I6Z A;  1H9T A;  1IV8 A;  1S7A A;  3ZQH A;  3HOX J;  2V9K A;  3ESW B;  1RNL A;  1X1B A;  4M9Z A;  4ESB A;  4FIS A;  4HG2 A;  2FML A;  3OYE A;  1KQ8 A;  1QPM A;  3M07 A;  1IC8 A;  4BJ5 C;  3F8M A;  3OS1 A;  2F48 A;  1WKM A;  1QZE A;  2AXL A;  2EV0 A;  3SZG A;  2R5Z A;  5IYD J;  2NOG A;  3V7S A;  4XSX F;  5ED4 A;  2PJR A;  3FXL A;  3DBL B;  2AO9 A;  3OL3 A;  1YYV A;  2VJ4 A;  3FIW A;  1R1U A;  4EV0 A;  1WJC A;  1XTA A;  1SMY F;  1Q1V A;  3HKZ A;  3W2A A;  3P9I A;  1S6L A;  4A3M J;  3FMQ A;  1ORK A;  5TRD A;  2ISY A;  2BY3 A;  4X6A J;  1F9N A;  3CUQ A;  1BL0 A;  3BTI A;  3K1N A;  1W4M A;  1T8I A;  3QPS A;  5HDK A;  2TDX A;  1J7K A;  1TQP A;  2K7L A;  4FTH A;  2DLL A;  2E71 A;  3SYT A;  2E1M B;  3I9V 2;  3DEE A;  1QVT A;  1TQM A;  2LSO A;  3LSK A;  4A0X A;  1CQT A;  3A1Y A;  3KZY A;  2E2J J;  3HRT A;  2HVQ A;  2G7U A;  3JSO A;  1RUO A;  4A2U A;  1MBJ A;  3HKZ N;  3I56 I;  2Y30 A;  3M1E A;  1SFK A;  4KDP A;  4MQ9 F;  3MKW B;  2JUG A;  4UY8 I;  2V1N A;  2R7W A;  1WRJ A;  2MGQ A;  3SEZ A;  1IN4 A;  4V2G A;  2ISZ A;  1IW7 F;  3ZXS A;  1DPU A;  3MZY A;  1F4K A;  2JA8 J;  5ILV A;  1DP7 P;  4O3M A;  3B6C A;  5IP7 J;  2F5E A;  4MHG A;  3M1C A;  1K78 B;  1MH3 A;  1Y0U A;  3DEW A;  4EMS A;  3OYM A;  3ASN H;  2G9W A;  1NG6 A;  3FMR A;  4HX4 A;  3IH2 A;  2F5D A;  5FB2 A;  1VQ4 I;  3S1M J;  5M5W J;  3Q9S A; 
#chains in the Genus database with same CATH homology
 2M34 A;  1ETV A;  1I50 J;  4IEJ A;  1OJL A;  4DYQ A;  2L0K A;  1JKQ C;  2OPT A;  2JA7 J;  4JX5 A;  1JUM A;  1BA5 A;  2DMU A;  5FKL A;  4A3D J;  2E1O A;  1D5Y A;  2JJ7 A;  1FIP A;  2PMZ N;  2H1K A;  1ZGW A;  3A01 A;  1JTY A;  2KDZ A;  1UMQ A;  2HXO A;  4BBS J;  2LTP A;  1WGX A;  3K7A J;  2R7Z J;  1NTC A;  3JRF A;  1I3Q J;  4XRS A;  1X58 A;  1DU6 A;  3BG3 A;  1JJ8 C;  2XSD C;  5JLX A;  1K83 J;  4D5C A;  5F04 A;  5EG0 A;  2L7M P;  3VPR A;  1DU0 A;  2ECB A;  1BW6 A;  2XGC A;  4GFB A;  2QCO A;  3JRC A;  4M3G A;  5J1R A;  5F0C A;  2DA2 A;  3HBL A;  1JKO C;  3RZO J;  1U78 A;  2VKE A;  2TCT A;  1OFC X;  2XB5 A;  3JRD A;  3HDD A;  3W6V A;  4A93 J;  4QIW N;  1WH7 A;  2ECC A;  4DYC A;  1HCR A;  3G1L A;  3M4O J;  3OSG A;  1VF9 A;  1MBG A;  2DA6 A;  3GTL J;  2XPW A;  2QF7 A;  3PM1 A;  2JA6 J;  2P81 A;  2LD5 A;  5C44 J;  2NS8 A;  1BW5 A;  2YUS A;  1W0U A;  2G0E A;  2DMQ A;  1B72 A;  2O9L A;  3PO3 J;  4AYB N;  2R5Y B;  1UHS A;  1MBF A;  2IEK A;  3RQI A;  1RET A;  3FIS A;  4XIC A;  1LFU P;  1ZQ3 P;  1T33 A;  3H3V K;  1T56 A;  1JT6 A;  3IH4 A;  4V2F A;  1GV5 A;  1ETK A;  3M3Y J;  4JP0 A;  3S16 J;  3GBG A;  4A3L J;  4M3D A;  1HF0 A;  3NAU A;  3GTQ J;  4RBO A;  3Q0W A;  2LP0 A;  3BR5 A;  1JJ6 C;  4UUS B;  2LY9 A;  1TWH J;  2NVY J;  3BQZ A;  4A3B J;  2FD5 A;  2DMN A;  2L9R A;  4FE7 A;  1U9N A;  3FKI J;  3JRA A;  3JRH A;  3K2A A;  1WH5 A;  2YS9 A;  2JA5 J;  2GLO A;  4I76 A;  2TRT A;  4J19 A;  1FTT A;  2LKX A;  1WCM J;  3S1N J;  3ZQG A;  4FCY A;  1RKW A;  5EZG A;  1NK2 P;  1ZTR A;  2CQX A;  2E2I J;  3HOY J;  2MW8 A;  5GPC A;  2XPU A;  5K7Z A;  2COB A;  1LFB A;  2YU9 J;  4DZP A;  2Y9Z A;  3ZQF A;  2WAQ N;  2R0Q C;  4Y52 J;  5F0H A;  1H89 C;  5EDN A;  5FLM J;  1VI0 A;  3Q0V A;  5M3F J;  5IOZ A;  2WV1 A;  1MBH A;  4CYC B;  1IUF A;  2M0C A;  1ZR4 A;  1MSF C;  1TWF J;  2XB0 X;  3LNQ A;  2R5Y A;  1NK3 P;  3JRE A;  3D1N I;  1B72 B;  4BY1 J;  3GTG J;  3A03 A;  2DTZ A;  4IHW A;  2LLK A;  3HEF A;  5BNG A;  2EQR A;  5EEA A;  4A3I J;  2ID3 A;  3BT9 A;  3OSF A;  2RAE A;  4M3E A;  5IOY A;  2CUF A;  4UUS A;  2JK3 A;  4B1R A;  5E3N A;  4A3C J;  1ETQ A;  3BR0 A;  5F0F A;  1JUP A;  5M5Y J;  4NDL A;  5C4X J;  4BKX A;  3GTK J;  1ETX A;  3ZQI A;  1TWC J;  3S1R J;  2XPV A;  5EGO B;  2JWT A;  4QTR A;  5C3E J;  4C2M J;  3TED A;  4JX4 A;  3ZQL A;  1E3O C;  3RKQ A;  1H88 C;  1IDY A;  2E2H J;  4XRS G;  3Q3S A;  2VPR A;  1S7E A;  3F0C A;  4A69 C;  3BR2 A;  2MSY A;  4MFD A;  2CQQ A;  2FJ1 A;  3JRG A;  4IHY A;  3WHB A;  3O8H A;  2DJN A;  3JR9 A;  2DMP A;  1Z0X A;  1AHD P;  2K9N A;  3DCF A;  2E19 A;  1JKR C;  4IHX A;  1QVU A;  1ZK8 A;  2HOS A;  1U8B A;  2EZK A;  4X1E A;  5M3M J;  1VND A;  2DA5 A;  5IP6 A;  5J3L A;  3S2H J;  4CYC A;  5F27 A;  2VI6 A;  1MBK A;  1I6H J;  1AKH B;  1IDZ A;  2DA4 A;  3WHC A;  4C3H J;  5DS9 A;  5JLW A;  5E3M A;  4BY7 J;  2LR8 A;  1G2H A;  4B3A A;  1YRN A;  3HOW J;  2DN0 A;  1IGN A;  3LOC A;  2K9S A;  2L7Z A;  3LSG A;  4M3B A;  1P7I A;  1JTX A;  4DZJ A;  3JRI A;  2H8R A;  3LSP A;  1PUF B;  3HOV J;  5F08 A;  1JUS A;  3G1M A;  2ME6 A;  3TP0 A;  3BG5 A;  4C3J J;  2HXI A;  4UUT A;  4D7N A;  1GV2 A;  4JYK A;  2XGE A;  3TW6 A;  5F1J A;  2AHQ A;  4XRM A;  5GP9 A;  1RPW A;  1TWA J;  1ZKG A;  2XGD A;  4W1U A;  1HDD C;  3MVP A;  1F36 A;  4BXX J;  2CJJ A;  4MIM A;  4IHV A;  1LE8 B;  1MH4 A;  5EGO A;  1P7J A;  3BTL A;  2X6O A;  3CQZ J;  2EZL A;  2GM4 A;  2M8G X;  5FJ8 J;  2EZH A;  3A02 A;  4QSH A;  2DA1 A;  2NS7 A;  3IV5 A;  1GDT A;  3BG9 A;  5FKK A;  1FIA A;  4D5F A;  5IYC J;  2L7F P;  5EYR A;  1K61 A;  4LOC A;  3GTP J;  5GPA A;  4FE4 A;  3TP3 A;  2VUM J;  2HQ5 A;  3BQY A;  1ITY A;  3S14 J;  2FQ4 A;  3SJM A;  3FK6 A;  3S1Q J;  4S0H B;  2W48 A;  1Z77 A;  4XK4 A;  5K7F A;  1POG A;  2K40 A;  2EZI A;  2NVX J;  2OF7 A;  3O8G A;  4G12 A;  9ANT A;  3L1P A;  1QRY A;  1AKH A;  1EF4 A;  2HYJ A;  3IH3 A;  3LSR A;  1B8I B;  1WI3 A;  4AC0 A;  2DA7 A;  3GTO J;  1X2N A;  5J1Y A;  2DMT A;  1YRN B;  2CRG A;  1PUF A;  4MO7 A;  1IRZ A;  2Y31 A;  4DYR A;  4ABZ A;  2R5Z B;  2HOA A;  3S2D J;  5DTD A;  2R93 J;  3S17 J;  2HOT A;  1HOM A;  2ZB9 A;  2LFB A;  5FKM A;  3C2B A;  4MLO A;  2GBY A;  3QPL A;  1QPI A;  1JGG A;  1ETO A;  2X48 A;  1LE8 A;  3G1O A;  1W0T A;  1A5J A;  4DW6 A;  4BBR J;  2JN6 A;  5E3O A;  3SDG A;  3SFI A;  1O4X A;  2M9H A;  2HI3 A;  2FX0 A;  2LK2 A;  1GVD A;  5FKO A;  1ETW A;  2ID6 A;  3HM5 A;  3S15 J;  2ELK A;  1XG1 A;  2I10 A;  5HOD A;  4XID A;  1HLV A;  3NAR A;  4C3I J;  4A3E J;  4A3K J;  3RZD J;  5C4J J;  3CMY A;  1ZR2 A;  1ENH A;  3H0G J;  2EBI A;  1OCP A;  4B4C A;  1MBE A;  3GTM J;  2NVQ J;  3BTJ A;  2R92 J;  4L5E A;  4M3F A;  1F43 A;  1JKP C;  1Y1V J;  4MFE A;  4JX6 A;  2IBD A;  2ME0 A;  3PO2 J;  3UKG A;  3MN2 A;  1UG2 A;  4AUX A;  4I6Z A;  3GTJ J;  3ZOB A;  1TWG J;  4A3F J;  1JT0 A;  2NVT J;  3I4N J;  2XRL A;  5IPA A;  3ZQH A;  3HOX J;  1B8I A;  2D5V A;  2Y2Z A;  3TW7 A;  4FIS A;  4EEF G;  1RR7 A;  3BR6 A;  2N8G A;  4A3G J;  1FEX A;  3HOZ J;  1IC8 A;  3CDL A;  5M5X J;  1H8A C;  5EF6 A;  1A6I A;  2O8K A;  3ZQC A;  2R5Z A;  5IYD J;  1APL C;  2NOG A;  3FK7 A;  3BTC A;  2IAI A;  1GUU A;  1XC5 A;  2AO9 A;  1IJW C;  1ETY A;  3FIW A;  2CUE A;  3Q0U A;  4RDU A;  5FKN A;  1RES A;  1Q1V A;  3OIO A;  4HNV A;  1BJZ A;  1RKT A;  4D7M A;  4A3M J;  2Y0S N;  1Y1W J;  1U9O A;  3HB9 A;  1ORK A;  3QQA A;  1MSE C;  4A3J J;  4X6A J;  1VFC A;  3BTI A;  3A01 B;  4M6V A;  5IYB J;  4Y7N J;  1BL0 A;  1SFO J;  3QPS A;  2X9D A;  2Y9Y A;  5IP9 J;  2CU7 A;  3CCY A;  3LSJ A;  4FTH A;  1FTZ A;  1HDP A;  1WPK A;  1TC3 C;  5K7H A;  1QVT A;  1CQT A;  2B63 J;  2E2J J;  3JRB A;  1OCT C;  5EG0 B;  2KT0 A;  2JMW A;  2WB1 N;  2O7O A;  1FJL A;  2M2E A;  1MBJ A;  1IG7 A;  3HKZ N;  2DA3 A;  2Y30 A;  2MG4 A;  5J1U A;  2VKV A;  4W97 A;  1AU7 A;  1IV6 A;  2LVS A;  1X2M A;  2MGQ A;  2EH3 A;  4V2G A;  1MNM C;  1R9T J;  1SAN A;  5EZH A;  1GT0 C;  2JA8 J;  2K9Q A;  3HGY A;  3HGG A;  3E7L A;  3B6C A;  5IP7 J;  3HOU J;  3BR3 A;  1MH3 A;  5FLV A;  3DEW A;  5E3L A;  2HDD A;  3B6A A;  3BR1 A;  1XS9 A;  3I4M J;  3IH2 A;  3MKL A;  3S1M J;  3OOU A;  5M5W J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...