1ZQ3P

Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3'
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zq3P00
4ABZA 1WGXA 2G0EA 1IV6A 3K2AA 2XB0X 5F27A 2KDZA 1HDDC 2IEKA 1VFCA 2JMWA 2DA2A 3DCFA 1AHDP 2HDDA 1FIPA 4BY7J 3UKGA 1S7EA 1ETOA 2D5VA 4Y52J 2W48A 3Q0UA 2DA7A 2DA4A 3ZQHA 4AUXA 3JRDA 2ME0A 5J1UA 5F08A 5IPAA 3HOVJ 1X2NA 3JRAA 4DYCA 5M3MJ 2CU7A 1GV5A 4JP0A 9ANTA 4M3GA 3E7LA 2LR8A 2M2EA 5C3EJ 5C44J 2H1KA 5FLVA 3K7AJ 5K7FA 2LKXA 5E3MA 1ZKGA 2XPVA 2O8KA 3I4MJ 2XSDC 2E2HJ 1PUFA 1JJ8C 2XPUA 2K40A 3FIWA 3ZOBA 3IH3A 1JUMA 4A3MJ 1WH7A 3IV5A 1U78A 1IDZA 2EH3A 1ZTRA 1TC3C 1Q1VA 3BT9A 1TWHJ 2LK2A 1H8AC 1CQTA 3DEWA 3CMYA 4W1UA 3GTLJ 1RETA 1DU0A 2NS7A 1PUFB 5M3FJ 1LE8B 4CYCB 4M3DA 3D1NI 2Y9YA 5IYCJ 2GM4A 1T33A 3SDGA 1POGA 4IHXA 1EF4A 1MBJA 4M3EA 3HEFA 2IBDA 4RBOA 3JRBA 2PMZN 1P7IA 3HB9A 3RKQA 1QVTA 4M6VA 2JA7J 1JT6A 2Y30A 5EYRA 3TP0A 1I6HJ 4FTHA 4A3DJ 5FKMA 1ZGWA 2DJNA 1HOMA 3W6VA 2JN6A 2O9LA 2QCOA 1BW5A 3ZQLA 2E1OA 5BNGA 3HBLA 2DN0A 4AC0A 2VI6A 4IHYA 1LFBA 5IOZA 2LVSA 3B6CA 3F0CA 5E3OA 1WI3A 3WHCA 2COBA 1I50J 2NOGA 1AU7A 1JKQC 1GDTA 2ID3A 2XPWA 1JTYA 3TW6A 4DW6A 1ITYA 1ETWA 3MKLA 2MG4A 3RZOJ 2LFBA 1JJ6C 3OSGA 2LLKA 4A3KJ 2IAIA 2HXIA 3GTGJ 3LNQA 2XGCA 4BY1J 3BTLA 1GV2A 2ELKA 2DMPA 2ME6A 3L1PA 3BR2A 3O8GA 4MIMA 5EG0B 2XGDA 1JKOC 3BR1A 4NDLA 1B72A 2HOAA 2M0CA 5IOYA 3SFIA 2DA1A 4C2MJ 1GUUA 2EZIA 3JR9A 1MBHA 2R93J 2R7ZJ 4A3EJ 4DZPA 3LOCA 3Q0WA 3JRCA 4B1RA 1MBFA 4JYKA 4CYCA 1O4XA 3BR6A 4S0HB 4D5FA 2CJJA 4A3LJ 5C4JJ 1ZR2A 3S1MJ 2K9QA 5M5YJ 1RKTA 1OCPA 4A3FJ 1FJLA 2HYJA 2Y9ZA 2JA5J 3IH2A 2L7MP 3A01A 2CRGA 3A03A 1IJWC 1BJZA 4BBRJ 3VPRA 4IHWA 3S1NJ 2XB5A 3BG5A 3S16J 3BTCA 1T56A 5F0CA 2NS8A 5GPCA 3LSRA 2E2JJ 4UUSB 3BG3A 2FJ1A 3GTKJ 1JUPA 1RR7A 4XK4A 4A3BJ 1D5YA 2OF7A 1U9NA 2DMQA 1JTXA 4A3IJ 3CCYA 4V2GA 1ETQA 2L7ZA 1B72B 2FD5A 1JKRC 2HI3A 3BR3A 1SANA 2CQQA 3O8HA 5FJ8J 1U8BA 3BR5A 3OSFA 3TW7A 2CUEA 2JK3A 4D7MA 2HOSA 2EQRA 2EZHA 4UUTA 1XC5A 2WV1A 4MFDA 3MN2A 5FKOA 1X2MA 4XIDA 1Y1VJ 1TWFJ 5F0FA 3HOYJ 3HOXJ 4HNVA 4D7NA 4D5CA 3GTJJ 5EGOB 1I3QJ 3PO3J 4BBSJ 3QPSA 5EF6A 1JT0A 2JWTA 1WPKA 1B8IB 4FISA 5F1JA 1BL0A 3G1LA 2X6OA 3FKIJ 4DZJA 5GPAA 1BA5A 3S1RJ 1GVDA 1ZQ3P 2VPRA 5J1YA 1ORKA 1FEXA 1UG2A 4L5EA 1JKPC 2DMNA 2Y2ZA 4MLOA 4UUSA 5M5WJ 1H88C 2GBYA 4X6AJ 2R92J 1OCTC 2Y0SN 4BKXA 2MW8A 3Q0VA 1IDYA 2VKEA 2YS9A 3FK7A 1A6IA 2E2IJ 2CQXA 1ZR4A 1IRZA 2L9RA 1MNMC 1FTZA 3JRFA 4V2FA 5FKLA 1Y1WJ 2OPTA 2B63J 3S17J 1ETYA 3HOZJ 4J19A 2JA8J 2FQ4A 5EDNA 3SJMA 1FTTA 1OJLA 1LE8A 1JUSA 3H3VK 3TP3A 5J3LA 1G2HA 4RDUA 3HOWJ 2HXOA 2DTZA 5E3LA 1HF0A 3TEDA 2NVXJ 3HM5A 2N8GA 2LTPA 4MO7A 2L7FP 4XRMA 2R5YB 4W97A 5DTDA 5M5XJ 1WH5A 3GTOJ 2Y31A 1Z0XA 2K9SA 1ENHA 3PM1A 1QRYA 3S15J 1YRNA 1NK2P 2R0QC 1VF9A 4FCYA 4LOCA 2QF7A 1HCRA 5J1RA 4A3CJ 5EG0A 4A93J 4IHVA 3JRHA 4B3AA 2NVTJ 3GTQJ 1FIAA 1MH4A 3G1OA 1SFOJ 4QTRA 1Z77A 4QIWN 2L0KA 1HLVA 5IP9J 1HDPA 2DMTA 4FE7A 2AO9A 1RESA 4I76A 2YUSA 2YU9J 1K61A 5FKKA 1RKWA 2M9HA 2CUFA 5HODA 3BTIA 2P81A 5EEAA 3M4OJ 5GP9A 1P7JA 1U9OA 4C3JJ 3HKZN 3BQZA 1YRNB 2MGQA 4BXXJ 4M3BA 2EZKA 4XRSA 4GFBA 5C4XJ 3HGGA 3QPLA 3OIOA 2AHQA 1AKHA 1F43A 2LP0A 4JX4A 2DA3A 2FX0A 3GTPJ 2TCTA 1RPWA 5F0HA 3A01B 1ETKA 2E19A 3JREA 3NAUA 1NTCA 2LY9A 1W0UA 4FE4A 4Y7NJ 4XICA 2M34A 4QSHA 4G12A 5FLMJ 2HOTA 3BQYA 4MFEA 2X48A 4JX5A 2O7OA 4AYBN 2ECCA 2JJ7A 2EZLA 1GT0C 1LFUP 1APLC 5K7ZA 4EEFG 1IUFA 1IG7A 4A69C 3LSGA 2XGEA 1TWCJ 5EZGA 1XS9A 1TWAJ 3ZQIA 3A02A 3BTJA 5IP7J 1NK3P 3I4NJ 5DS9A 3WHBA 2JA6J 2XRLA 3MVPA 2M8GX 1MBKA 2DA5A 3FISA 4B4CA 1UMQA 5FKNA 3HOUJ 1BW6A 2R5YA 1H89C 4XRSG 4A3JJ 1F36A 3OOUA 4C3IJ 3ZQCA 3M3YJ 2ECBA 2TRTA 4C3HJ 1VNDA 1R9TJ 3BG9A 3PO2J 3GBGA 5IP6A 3B6AA 3HGYA 3NARA 5JLXA 1ETXA 5JLWA 1E3OC 1IC8A 3JRIA 4JX6A 1QVUA 1MSFC 2HQ5A 3LSPA 3S1QJ 5IYDJ 3S14J 4IEJA 3FK6A 1MBGA 3HDDA 3JRGA 1JGGA 1K83J 2DMUA 1MH3A 1UHSA 4DYQA 3GTMJ 4X1EA 2ZB9A 2LD5A 1IGNA 1W0TA 3RQIA 3ZQFA 5EZHA 3ZQGA 2MSYA 2X9DA 2DA6A 1OFCX 2H8RA 3QQAA 2I10A 3G1MA 1VI0A 2EBIA 1AKHB 2R5ZB 1ZK8A 2VKVA 4DYRA 2KT0A 2R5ZA 3S2DJ 1ETVA 2RAEA 4M3FA 2GLOA 2VUMJ 1TWGJ 3BR0A 3LSJA 1XG1A 2K9NA 3CDLA 2NVQJ 3S2HJ 1QPIA 3C2BA 3RZDJ 3IH4A 5K7HA 3CQZJ 1WCMJ 1MBEA 3Q3SA 5IYBJ 2NVYJ 2WB1N 1DU6A 3H0GJ 5F04A 2WAQN 1X58A 1B8IA 4A3GJ 1MSEC 1A5JA 2ID6A 5EGOA 4I6ZA 5E3NA
chains in the Genus database with same CATH superfamily
1ZRCA 4XKVA 1WGXA 2G0EA 3QYFA 4XR6A 3TOBA 4Y4RA 1BN5A 3K6GA 4LMYA 4LK1F 1KYZA 1ULYA 3K1PA 1I39A 4FX0A 2PJRA 2E1NA 5BQTA 5FRNA 1U5TA 3PIOF 4BQNA 1CF7A 1ETOA 2HYFA 3ZPLA 2W48A 3L7WA 1SFKA 2DA7A 3QPTA 3JRDA 4XLEA 5J1UA 5F08A 1HBXG 4Y17A 4BNCA 5CVUA 4HDUA 4IKFA 4BU2A 3P7NA 3S3OA 1XDSA 1YYVA 1Y8QB 5ILVA 3OYFA 1P9QC 2DLLA 1N78A 2PFBA 3E7LA 3EQLF 3ISPA 4E7ZA 5A2QK 5C44J 1WJBA 2LKXA 4OAZA 3N05A 1ZKGA 5E3MA 4EJOA 4M71A 2O8KA 1UJ8A 4P9FA 3F8CA 2CS3A 2E2HJ 5FD6A 5E79C 3FIWA 2P7VB 1IUYA 2HZTA 2XSJC 1WH7A 3MZYA 5L3EA 5K1YA 5DEQA 2GWRA 2EFQA 4E7JA 4I0BA 1IDZA 2ZFWA 2EH3A 4DBQA 2MLGA 1Q1VA 3BT9A 4OOIA 5HDNA 3F23A 3V4GA 1TC3C 1FOWA 1V3FA 1X3UA 3LSKA 1E0EA 2QUFA 2W1OA 1H8AC 3ECOA 1VQPI 2MABA 2OTJI 2XAJA 5J4VA 4KT5C 1WFXA 2MD0A 4XLAA 1OCCH 5M3FJ 4ZZDA 2I5UA 1MDMB 4CYCB 1ZRFA 2KIFA 4HLXA 3HUGB 3IAS2 3HPGA 5L3GA 1T33A 2KHMA 2HGCA 3ZN0A 1POGA 4ITVA 1MBJA 4M3EA 2V1XA 2IBDA 1YOVB 1R58A 2L4MA 3MFKA 1NHAA 5DD8A 4BQAA 1R5HA 4L18B 3FDYA 2IS4A 2W82A 5HDGA 3G71I 4QWQA 3O2PE 1BW5A 1I5ZA 3ZQLA 5BNGA 3GZNB 2QKLB 4XLFA 2HOEA 2VI6A 2F4OB 1WI3A 3VYRB 1TQPA 4J01A 5DD4A 4U7BA 1EV7A 5JHUA 1ITYA 2XPWA 4IOCF 3HRSA 1ETWA 3WTZA 3MKLA 1LB2A 4PSXA 2AQFA 1B9MA 2HKOA 2W85A 4G6TB 2HVRA 3LNQA 4Q47A 2XGCA 3I71A 4OIPF 3TL4X 2CQ7A 3HRUA 1SC7A 1XSVA 2O8XA 4I09A 3F6OA 5D4SA 3O8GA 3OL3A 5CVIA 2RREA 2XGDA 3MZHA 4NDLA 1B72A 4AU7A 4B8XA 3QP6A 5B1BH 1GUUA 1USTA 2KMUA 2EZIA 1HQCA 3FMRA 2R7ZJ 3QRFF 3LOCA 3LMMA 4ZDOA 2H09A 1FSEA 3BCAA 3QPHA 4B1RA 1K4SA 4JYKA 4ETSA 2CMPA 2FBKA 4S0HB 4D5FA 1GXPA 2QVOA 2CJJA 1NG7A 1T6SA 3I0TA 3P9IA 2K9QA 3HKZA 2HYJA 3M1CA 3IKTA 1Z67A 1XB4A 5H6QA 1RUNA 4ENJA 1OMIA 3ZR8X 3A01A 3A03A 4HX4A 3SEZA 3A2KA 4J00A 3F8NA 1YW9A 3GF2A 1YS6A 4XSZF 2XB5A 5CVVA 3CC7I 4HEA2 3OS1A 2EINH 2FMLA 3K4CA 1KA8A 2BGCA 3GTKJ 1AA7A 4A3BJ 1VZ0A 3V8LA 3I4PA 3JAMK 2EIKH 1XMKA 5ICFA 4I02A 2NAZA 2KL4A 1U9NA 5D5UB 3S3MA 3R4KA 3QYBA 4A3IJ 2HR3A 1X3ZB 1REPC 3I56I 2GIZA 3E0JB 4V2GA 2LRDA 3FM5A 5K5RA 5J8CA 1ETQA 1MMSA 1OR7A 2FD5A 2ZCWA 4PJLA 4E7IA 2CGPA 4LB5A 1AOYA 1WJDA 2CUEA 4OU0A 2B9SA 2HOSA 1A6QA 4CA0A 4M6YA 1WHUA 3ZRGA 1J5YA 2CFOA 4KIGA 4IXAA 2FF4A 3MN2A 5FKOA 3FMQA 3HJEA 3QU3A 1FY7A 1DPRA 3ZMDA 4D7NA 1FSHA 3NEUA 1DDNA 2YX4A 1FP2A 3CTAA 4HRIA 4Q4ZF 1JT0A 3KEQA 1W5CC 3SHFA 1BL0A 1GVJA 2HVQA 4G7ZF 2HTSA 1S7AA 4F91B 4H4KC 3PNYA 1WJEA 3L2UA 2R7VA 1SVOA 3G3ZA 4E7HA 1I1GA 4LLLA 1GVDA 2DI3A 1ZQ3P 4L0ZB 5J1YA 3I58A 1A35A 1SD7A 4RS8A 2X1CA 3SFZA 5JR3A 4L5EA 1VQ7I 3IL2A 3P9CA 2DMNA 2L9VA 4YFXF 3CJRB 2PI0A 2A3SA 5LRRA 1DUXC 2DOEA 5M5WJ 5IT3A 3CF2A 5FLXK 4XKBA 1PYVA 1D0ZA 2R92J 4AIHA 4IJAA 1QHHD 5AIPA 1O3RA 4C30A 4PJNA 1IDYA 2MBFA 2VKEA 1WJFA 3RPUA 1Z7LA 1IRZA 1LDDA 3TGNA 4OWRB 3I53A 4KIFA 1H0MA 2A5WA 2F5DA 3JRFA 3G73A 1FTZA 5FKLA 3WU0A 3LA3A 1VQ9I 4N9IA 2CH0A 1UFMA 5D5VB 2OPTA 4LLGF 3S17J 2RN7A 3QP5A 3J81Z 4J19A 1P4XA 5J8FA 5EDNA 3SJMA 3TDZC 3MCZA 4CGZA 1RIOH 4UV9A 1JUSA 3L00A 1BIAA 3H3VK 1MW7A 5LGUA 3TP3A 3ZQ7A 4RDUA 5F64A 2HXOA 2DTZA 2M0MA 4XQFA 1FZPB 3OV8A 1IO2A 2JVGA 3KZZA 3HM5A 3FKJA 2LTPA 4G8XA 4MO7A 4LIVA 3CUQC 2JSCA 2L7FP 2XF7A 4DJAA 2R5YB 4DGWB 2B0LA 2VB6A 2O6GE 4NHJA 2VBZA 3AAFA 1WH5A 3CCLI 2E7WA 2X51A 1ZARA 1D0XA 4PFOA 1TZLA 1YIOA 1Y8RB 1ENHA 2PMUA 3C3WA 1J75A 2A5YB 4LOCA 2EIJH 2FNAA 3OYHA 3O3KA 5EG0A 2WA0A 4IHVA 1QA6A 2L54A 1FIAA 1TBXA 3KIOA 1EKEA 2DODA 5AONA 1VQKI 4EV0A 3AL0C 4ZYGA 1Z77A 2Q2EB 2QSGX 2JSPA 3K1MA 2L0KA 3F72A 1PVEA 1XGNA 2R4GA 4EJUA 1HXDA 4AVZA 2HNHA 3AG2H 1LKXA 4BHPA 4A0XA 2ACJA 1PP8F 2R7UA 1I1SA 1YE9A 3CJTB 1QZZA 5FKKA 3L2QA 2CUFA 1F1ZA 3WTXC 1LVKA 2P81A 3K4LA 3CLOA 3K10A 5GP9A 4AVPA 2MGQA 2P5KA 3K0LA 3OWTA 3HTSB 2DT6A 3HGGA 1MJ9A 3H1CA 4HF0A 2L9NA 2V9KA 4XKWA 3VDXA 1N25A 3GTPJ 3CC4I 2VC1A 3A01B 5JVGF 1YFHA 4HDVA 3J7AY 3IHUA 2KQRA 3JREA 2E1MC 5D8LB 1QZYA 4FE4A 2F5VA 4EJWA 2DDBA 4HA8A 3GWZA 1OCOH 3H92A 2BHZA 2B7EA 3HSFA 4LITA 5FLMJ 4U0YA 3CCSI 3FXUA 1YX5A 2EZLA 4E6KG 3JSOA 3WGHA 4MNUA 5K7ZA 4EEFG 3S32A 2ZXHA 3DWLE 4A69C 4IHTA 2DJIA 4A0ZA 1NK3P 3ZQIA 3BTJA 4PCQA 3KZIC 2X0LA 4PGGA 2Z16A 4CCOA 3CLQA 2DA5A 5FKNA 2VXZA 3HOUJ 4X0GA 4XRSG 2ZJRF 1F36A 5IT9Z 3FF5A 4YIIA 4YIRX 1W5TA 3VYTB 4UXNA 2V1NA 4L0YB 3C2HA 3CJQB 3PO2J 4BXUA 5FLXZ 2FXAA 3CCRI 5JLWA 3OYIA 1IC8A 3JRIA 4C2UA 3I64A 1QVUA 1CF7B 1MSFC 4LJZF 3OYLA 5B5EC 3HPHA 5LBQA 4RAYA 4BE1A 4PK4A 4F92B 5HLTA 5IYDJ 3GO5A 5ICCA 3FK6A 1MKMA 1X1BA 1K83J 4UB6C 3BJOA 1Y39A 2Y69H 1R4NB 1UHSA 4BQOA 2R7OA 2E1MB 3G6EI 1W0TA 2L5QA 3K69A 1A31A 2MSYA 4L9JA 3DTIA 1BOAA 2X9DA 2DFFA 3E1SA 3BLYA 1P4AA 2D1HA 4A5NA 3VWBA 1FMWA 2W00A 2EBIA 2ZSHB 3C1DA 1FLIA 5BOXA 3GUDA 1YW7A 2VC0A 4UNOA 5GADJ 1EH8A 1TWGJ 2GA2A 2QQ8A 3BPVA 2PMHA 2MC4A 3LSJA 5GAGJ 1FPQA 4LB6B 3VODA 1J09A 2COMA 4GYIA 3TO6A 4AYBA 5HLGA 1SAXA 5IYBJ 4FHTA 3VOEA 2OZUA 1OQYA 2GOXB 2K9LA 1DU6A 3DKXA 4WK8F 3D5RC 1QZEA 1MSEC 2ID6A 1PP7U 4HNTA 5E3NA 4ABZA 1VTNC 1VQNI 3OY9A 3ABTA 1SFEA 2XB0X 2KDZA 1HDDC 1IRGA 4YG2F 2IEKA 2JMWA 2HQAA 2DA2A 4EATA 1V55H 4XN0A 4H0EA 3JW4A 4XN3A 2FOWA 1FNNA 3IC7A 2D5VA 2M5WA 2ZSIB 3F22A 2VONA 4Q48A 3ZQHA 4AUXA 2RVCA 4WXCA 2ME0A 3K2ZA 4L9NA 1FOKA 4IRIA 4PZJA 2CG4A 4RM3A 4P96A 4F3QA 3E3VA 5A2QZ 5IPAA 1GXQA 3HOVJ 5FGMA 4RGRA 3WGGA 3P5JA 3KEYA 4JP0A 1W36D 1BBYA 3K7AJ 5K7FA 1YO5C 1G3TA 3DU6A 3W6KB 3D5SC 4JBAA 3ESWB 3HIFA 1KU7A 1IXRC 1JJ8C 4WF2A 1R1VA 3E97A 2K40A 5GAHJ 3K70C 1STZA 4A3MJ 1U78A 2E36A 1ZLJA 1ZTRA 1UHMA 2NNNA 1U2WA 4QPQA 2LK2A 2YR2A 2OCEA 3WODF 2DCEA 1D1AA 2QBYA 1CQTA 3DEWA 3TO9A 5CLSA 3J80K 4W1UA 2M1BA 1XSDA 4N9HA 3HOTA 1ZLKA 3AG3H 3GTLJ 1ON2A 1G8XA 2HU9A 3RKXA 2LF7A 1LPQA 3I9V2 3HHHA 1HC8A 1YX3A 1YG2A 3CDIA 3LFKA 4ASNA 3RPQA 3TOAA 4CDGA 2GM4A 3DTEA 1EF4A 2QGUA 3MAJA 4XM3A 1Z7UA 4JOMA 3HB9A 3RKQA 4YFKF 4M6VA 3EPZA 5EEHA 1JT6A 3SZTA 5EYRA 1I6HJ 1Y6IA 3EUKL 3PNVA 1YQAA 4FTHA 3LSHA 3U9GA 2QM3A 2ZNZA 2BXZA 3KLOA 3W6VA 1HOMA 2QCOA 3AG4H 2Y0MA 5JVTA 2E1OA 2Z5UA 4FT8A 3CO6C 4IHYA 2XIGA 5HNHA 4HAMA 2PJPA 1XCBA 2Z99A 5LHGA 1X1DA 3HC7A 1KONA 4DOZA 3HL2A 3HSEA 2LY1A 2UZKA 1HW2A 4MQ9F 5BPIA 4EM1A 1AU7A 2NRAC 1A5JA 2ADUA 4DW6A 2MG4A 1DGRM 3RZOJ 2XASA 1XGMA 2QSFX 2BBYA 3DKWA 2NS0A 2HXIA 2M4GA 3FXMA 3WTWC 3GTGJ 1X4PA 2X1EA 5LLQA 3U2RA 1FBUA 4BJ5C 2BY3A 1SEUA 1FT9A 1RZ4A 1U5TC 2OTLI 2DT7B 5KK1A 3M7GA 2P0WA 3BR1A 4L5JA 4LG0B 2HOAA 1RC9A 2WV0A 2DBBA 2VBWA 4C2MJ 2D2WA 3OYMA 3GLXA 4ON0A 3MKZA 5KCMA 4DZPA 2HQNA 3Q0WA 1ZGAA 3MD2A 5HVQC 3JRCA 1MBFA 1DP7P 3R0JA 4BDYA 3RTRA 1SD5A 1WJCA 5C4JJ 2QLZA 3CCEI 2ZXIA 1K6YA 3I55I 2JUCA 2OBPA 2PLYA 5BMZA 1VQ5I 3KP4A 2F2EA 2K5CA 1IJWC 1BJZA 3N4MA 4BBRJ 4ENMA 4ZDLA 3CP2A 3JAMZ 3E6DA 3VPRA 4IHWA 1EH7A 2PQ8A 3BG5A 4BHBA 3BTCA 4DNCA 4HX7A 1MMNA 4AM3A 5FO5A 4U87A 4EMSA 1RR7A 1FYMA 1TQIA 1D5YA 4FETA 1ZAOA 2BW3A 2DQLA 1JTXA 4XLPF 4P55A 4ZZLA 1YLFA 3ABLH 3BDDA 1NH3A 1HKTA 2DK8A 3DXJF 1K7AA 2ZMEC 4DBRA 2I8DA 2L2OA 3A0BC 3CMEI 1ODDA 5E17F 4B3XA 4BJ6C 2HI3A 3BR3A 2K4BA 3ABKH 5CYVA 4CCNA 5FJ8J 2Q1ZB 2A68F 3BR5A 1XMAA 4BJTA 4XOTA 2JK3A 2ZO4A 4D7MA 2PBIA 2VL8A 4EJVA 2VT2A 5HDKA 2XC7A 1XC5A 2DQRA 3FX3A 3KYCB 3LQRA 4Y13A 4XIDA 1TWFJ 1MIJA 3HOYJ 3HOXJ 1KQ0A 2HPIA 3KP6A 3BZKA 3L2RA 4D5CA 3GTJJ 5EGOB 5EF6A 4RGXA 1W1WE 3KEOA 1BI1A 1B8IB 1JI8A 1TNTA 2EA4A 3PL8A 5H20A 3U1KA 1W4MA 1O7LA 5GPAA 2ZBKA 1XGSA 5LD2C 1T95A 2UV1A 4XMYA 3W6JB 1USSA 1BOBA 2AQEA 1YW8A 2BXYA 2H8WA 3VEPA 1IN8A 3RJPA 3VYUB 3W2AA 1O3QA 2GXGA 4UUSA 1Z3YA 2E34A 4RGSA 4O5VA 2Z2SB 3OIPA 4X6AJ 2H6CA 4BKXA 1W5SA 3DU5A 1E3PA 2H1LA 3NQOA 2Y0SA 2FQ3A 3Q0VA 1S8NA 3K4KA 2WWYA 4RMNA 1R4MB 5LEKA 2IPQX 2VKDA 4KICA 2K3FA 2Y48A 1MNMC 2K85A 2VJ5A 2RGVA 4BE2A 4UY8I 2WC2A 2WAEA 4AWXB 2QKMB 1X1AA 2FQ4A 1FTTA 2PN6A 1WJAA 3D0SA 1OJLA 4MEXF 1EJ9A 1LE8A 1IN5A 3E6MA 2ETHA 2K3PA 3KX2A 3ZP5A 3L2VA 5JI6A 2MH9A 5E3LA 1HF0A 2K02A 3TEDA 1SD6A 2N8GA 2CQNA 3HRMA 4BHCA 2LOOA 2HDWA 1H9GA 2MD5A 2ISZA 2VT3A 4XRMA 3ZMSA 1IF1A 3GTOJ 1G59A 5IY5H 2F6CA 4KFCA 1S3JA 1QRYA 4KN4X 3A0HC 1YRNA 2P7CB 2R0QC 1OR7C 1VF9A 4FCYA 4LFUA 5TGTA 2L7KA 3CC2I 1ZREA 2ZXWH 3JCUC 2L02A 2W4SA 1IXCA 4LG3A 2R7SA 1TTYA 3GCMA 4PJ0C 1MH4A 3G1OA 2HKXA 4M6XA 1G4DA 5LEJA 1SFOJ 1Z3XA 3SEQA 4A12A 1F4KA 3CUOA 3GYHX 1ZELA 3LA2A 3CCVI 5TRDA 5IP9J 1IV8A 3PSIA 4G7HF 2DMTA 1VQ8I 4I01A 3T1BA 2JT1A 4RAGA 4KYWA 1W36C 2ZC2A 1SAUA 3H5NA 2E5ZA 2IS2A 4I76A 4C9YA 4I99C 2YU9J 4NBQA 2EIMH 4II2A 4Q5SF 3FWEA 1RKWA 5HODA 4R79A 2PX9A 3BTIA 5EEAA 2VQGA 3HTUA 3M4OJ 3V8JA 5J47A 3EUAA 5LGTA 1XD7A 2BVMA 3R6SA 1U3EM 1U9OA 1JE8A 1YRNB 2H94A 2Q0OA 2MFZA 3OIOA 4G6QA 3JTGA 1F43A 1XMXA 3RYPA 1IN7A 4JX4A 2DA3A 4EGYA 4MQVA 1VQMI 1QNTA 1RNLA 5CJ9A 1T98A 1TW3A 5F0HA 1OYIA 1ETKA 1B59A 4YFNF 2EK5A 2E19A 2O61A 2P5VA 2ELHA 3NAUA 2LY9A 2F5FA 1ZN2A 2DYRH 2R3SA 2EV0A 3DEUA 1KGSA 1E3HA 1MMGA 2IP2A 4XICA 4KA4A 1HW1A 2HOTA 2X48A 2VJJA 3QU6A 4AYBN 4O3MA 3DEEA 3LSTA 1T39A 3K4BA 1ZYRF 3PFYA 1LFUP 4YIFA 5GTHC 3AL0B 3DQVC 4HF2A 1A36A 1TWCJ 1S5LC 4PJMA 3EYIA 3A02A 3ZXSA 2RNGA 1BI2A 2XRLA 3MVPA 4BAYA 3TDUC 2C6YA 3T5XA 3GW2A 1UMQA 2GAUA 4RLFA 1UELB 2R5YA 3BG7A 3OOUA 1SVMA 4BEHA 1QQIA 3M3YJ 2FOKA 2QQBA 2GA1A 2NXNB 1F5TA 2PJRB 1J9IA 3WTUC 3BG9A 3K4MA 1W7PD 4XRFA 3AFHA 3NARA 3J7YJ 1E3OC 4PJJA 3CCJI 4OIQF 5DCFA 3KYLA 3S3NA 2IRFG 1OYWA 1KQ9A 3S1QJ 2EFPA 2F5EA 2O3FA 3DBLB 1P92A 3GFLA 5FRMA 2LYCA 3LFUA 3M1EA 1MH3A 2X1DA 1YS7A 4CICA 5L3BA 3HRTA 3TKYA 3GTMJ 3Q9SA 4HSTA 3RQIA 3J7ZI 3ZQGA 3T8TA 4M73A 1OFCX 2H8RA 3KFWX 1G3WA 3DV8A 1VI0A 2JQ7A 2R5ZB 2A6TA 5FFXA 3WTVC 2P8TA 3S2DJ 2V1UA 1ETVA 1JHFA 2HWVA 3PUFA 4V19K 5EEGA 2K9NA 2WTEA 3LSIA 3BJ6A 2IA0A 3OR2C 1M1EB 1WVRA 3DPTA 4MHGA 3WTYC 2RNJA 2XVCA 3SDBA 4N0BA 3F8BA 1R6RA 1LDKB 3C2BA 3RZDJ 3CUQB 2BEOA 3IH4A 4FX4A 2M4KA 3GFJA 2QSHX 1IN4A 3PIPF 2WB1N 2KZGA 2LDUA 3A1YA 3H0GJ 3MKWB 1KU2A 1X58A 5H6RA 1UG0A 4XL9A 1LUJB 1FOXA 4I6ZA 1ZR4A 1XX5A 3ZN1A 3K70D 1MJAA 4D1QA 2M7BA 1IV6A 5D6FA 2KZVA 4F93B 1VFCA 3H9GA 3DCFA 1AHDP 4I0AA 1FIPA 3V42A 5H2FC 3UKGA 4B09A 2R7QA 2YPRA 1S7EA 1YTYA 3BG6A 2D45A 3Q0UA 5TJJA 2BV6A 2DA4A 5BPDA 1BJAA 2X6XA 1IW7F 3KYDB 3BZ6A 2M45A 1TT0A 3JRAA 2BOLA 4DYCA 5M3MJ 3DLLF 2STWA 2LSOA 4UVAA 2RQQA 4M3GA 2ZXJA 4OINF 2QEXI 4ESJA 4GXOA 5D8KB 1Z6RA 3E5UA 1QPMA 3AG1H 3E5QA 1XN7A 3I4MJ 2XSDC 2O0YA 2KJBA 2RKHA 2FE3A 1LJ9A 2R7XA 4EVIA 3IH3A 1O3SA 3P9KA 4BACA 3A4CA 2BY1A 1B9NA 3ZGKA 1TWHJ 5D6EA 5LHHA 3ERED 4G9YA 2V26A 3LWFA 3CCUI 2BZTA 5LRSA 1T8IA 3CMYA 1D1BA 4OIRF 1Z9CA 2NS7A 2DOAA 1O7FA 3RYRA 1LE8B 1K78B 4YEJA 4NC8A 3D1NI 2Y9YA 2LC2A 5E8IA 5K5QA 4F7ZA 3SDGA 2ZJPF 2XHKA 5CPRB 1P7IA 5E1XA 3DLAA 3AKZA 2JA7J 4IQJA 4XBFA 3QODA 4RM2A 3SZGA 2K4JA 2ZJQF 4A3DJ 1UB9A 2ZMEA 5FKMA 2VXDA 1ZGWA 2CW7A 4CH7A 2JTVA 2O9LA 4XONA 4R1HA 3H36A 4AC0A 1Y56A 3LAPA 1LFBA 4P5OA 4FASD 3FXQA 2UUZA 3WHCA 2E35A 1I50J 3SYTA 3BP8A 4IRHA 1OYYA 1JTYA 2XAUA 3TW6A 4PSWA 2LFBA 1JJ6C 2GIVA 1X19A 5HNFA 3WE2A 2LKSA 3R61A 1LVAA 1YHQI 2LLKA 2IAIA 3EUHC 3GFMA 1HA8A 2ISYA 4BY1J 2DPDA 3BTLA 3EDPA 1GV2A 1B4AA 2VLAA 3BC8A 3J80Z 3L1PA 2K9MA 4P1WA 1YJ9I 2JUGA 3ZMTA 2EFWA 1OCRH 2UWMA 2X6YA 2AXLA 2M0CA 3SFIA 2XV4S 5GAEJ 2HYGD 2DA1A 1DPUA 4NB5A 2A61A 2KRFA 3FZVA 4HOBA 1MBHA 2IXSA 2FMYA 4E70A 1WRJA 3OYJA 1KQ8A 4CYCA 3CMAI 1O4XA 3BR6A 3GLLA 4MEYF 4XLHA 2PEXA 4CSWA 4EM2A 4M9ZA 3J81K 2EFNA 4EM0B 1ZR2A 2CWEA 3S1MJ 2ZFUA 4KITB 5M5YJ 4A3FJ 1N77A 2Y9ZA 4A5MA 5LGNA 2JA5J 3IH2A 2NVUB 1VQLI 3RKWA 4KUMA 2HS5A 1Z6TA 1V54H 1FC3A 1R22A 2X85A 1G3YA 5DUKA 5DM7F 4HLYA 3OYBA 3S1NJ 1BC7C 3S16J 3S2WA 5F0CA 2E2JJ 2VKHA 4UUSB 3BG3A 1BC8C 4GO1A 5E8GA 5HS7A 2OF7A 2V4JC 2KIMA 4HG2A 3FBIB 5FD5A 3IAM2 4HQMA 3GX4X 4HSRA 4L5IA 3CD6I 1Q1HA 2IT0A 3CCYA 3MMYB 4BYYA 1U5TB 1Y0NA 2K27A 4WX9A 2L7ZA 1B72B 2Z33A 1JKRC 4L9TA 2CQQA 4B48A 1DGWY 3O8HA 3OSFA 3TW7A 3E6CC 4BL0B 4IO9F 2OAZA 1LEAA 3M8EA 2EQRA 1S29A 3F8FA 2EZHA 2O5RA 2CO5A 2WV1A 2JZYA 2A69F 3BY6A 1YI2I 2XKOA 4RAZA 3OYCA 1Y1VJ 3ONQA 2CSOA 5D4RA 5DCMA 2EFOA 1I3QJ 1S9HA 2IVMA 3QPSA 1QO0D 2X6OA 4G7OF 1MD0A 1P2FA 3FKIJ 3RQ4A 4QLCU 3WTSC 1TNSA 2E71A 3U1DA 5LFAA 1BA5A 3M07A 3SQNA 2VPRA 1U0JA 1ORKA 4PFPA 3VFZA 4KNYA 1D1CA 3CF5F 1UG2A 2DFHA 5E1WA 1JKPC 4PUSA 1FBQA 1FOYA 2DT5A 2H6BA 2WY7Q 4U0VA 2EPFA 2R7WA 2Y2ZA 2OUMA 2Y75A 4MLOA 1RRJA 2XAGA 2TDXA 1H88C 2KRCA 2BY0A 1OCTC 2VQHA 5E1ZB 2Y0SN 5ILUA 1R5ID 5KAIC 1G3SA 1OPCA 3GVAA 2HTJA 2KJCA 3CO7C 3IP4B 2ZMEB 3DFGA 2YS9A 4ZDPA 1DP3A 1A6IA 1D8JA 3ROUA 2CQXA 2CYYA 3BZCA 3D5LA 2ZNYA 2CUZA 1XPXA 2L9RA 3QWLA 4KMUX 3ZCOA 5E18F 2FUG2 4UUVA 3L09A 5BS6A 2MYSA 1Y1WJ 4FQGA 3LQQA 1NG6A 2B63J 1OISA 2OV7A 3HOZJ 3M9AA 2JA8J 2YX7A 3H5AA 4N4OB 3RCOA 2RC4A 4K2EA 4IZZA 1MMAA 2D1VA 3BWGA 2J5PA 5HLHA 4CCJA 2MH2A 2FA5A 5KVRA 5J3LA 1G2HA 3M8FA 3KETA 2F5CA 3B02A 2E60A 2X4HA 3OYKA 3FHNA 4BS9A 2IW5A 1HKQA 2EV6A 2WBMA 1V5GA 4S04A 2EILH 2JA2A 4HF1A 5M5XJ 1WZ2A 3RDIA 2Y31A 2LG4A 3TQNA 2JRTA 5ICEA 1NK2P 2OCCH 5KAFC 3EYYA 3DKYA 5DCMB 2VQCA 3I5UA 5J6XA 2QF7A 5J1RA 4A3CJ 4A93J 4HQEA 3JRHA 4B3AA 1W7PA 2GOMA 2A05A 3H0DA 1ZG1A 5L3DA 2LMDA 5J40A 3KCCA 4XORA 4QTRA 5ILSA 3UNGC 3GZ5A 1ZH5A 4BH9A 2L01A 4QIWN 1IAWA 2XROA 1N75A 3CJNA 1HSTA 3E5XA 4I7HA 1Z21A 1RESA 2CUJA 1E2XA 4RAFA 5DDGA 4EGZA 1UHWA 3KZYA 1BR4A 1FWZA 4PDKA 1K61A 2KRHA 3RPUD 2M9HA 4RB2C 5KHDA 3WG9A 3HXLA 4EJTA 1HKSA 4OMZA 1P7JA 1Y0UA 3LSMA 3W3CA 1TLHB 3Q9VA 4C3JJ 4BXXJ 2OQRA 4P9UA 4M3BA 5C4XJ 2MC3A 2CV2A 1TT5B 2IJLA 2F4IA 2DPUA 1XTAA 2FX0A 2QYOA 4JK1X 5ED4A 2STTA 1R00A 2BHYA 1RPWA 2NNYA 4CZCA 3REOA 3WG7H 3V7RA 1NTCA 3ULQB 5E20A 3ECHA 1JXSA 3LAJA 3FXRA 2M34A 3K9TA 4M72A 3BQYA 4MFEA 5B1AH 4IQ4A 2DXIA 2P4WA 2W24A 4KIBA 4HPQA 2ECCA 3PNTA 1X1CA 4E7KA 3KP5A 1GT0C 1MNDA 3CCQI 3TBIA 3OL4A 1IUFA 1V5EA 3FXOA 3LSGA 3VYSB 5FB2A 1CGPA 5EZGA 1TWAJ 4KN7X 4O6JA 2FU4A 5IP7J 2E5NA 5LHIA 1R23A 2M8GX 2DO7A 4ZYHA 2BY2A 3VSKA 3FISA 4B4CA 2QBYB 1WWXA 1H89C 4A3JJ 3DBRB 3COAC 4C3IJ 3ZQCA 4PGHA 4DQ2A 4GCVA 2KFDA 4IF4A 3N97A 2R7FA 1DQUA 3GFIA 3GBGA 5IP6A 3F9KA 3HGYA 4Z2YA 1RUOA 5JLXA 1ETXA 2LBFB 2LNBA 3F6VA 3HZJA 4I98B 1O3TA 4KJZA 2IS1A 2HQ5A 3K4NA 4GGGA 2VE8A 2A6EF 2RQPA 3IWFA 1ERDA 4NC6A 2A6HF 2VJIA 2IGNA 3S14J 2M3AA 2OJED 2W84A 1MJBA 3QOEA 1MBGA 4RA2A 4LGWA 1SVLA 4ZYAA 1X4OA 3H9JA 4ENNA 5DUIA 1BI3A 3ELKA 3EETA 2ZB9A 2KLOA 1YJNI 3ZQFA 5EZHA 2QA4I 1R1TA 3F21A 4B43A 2L9SA 3QQAA 1WJ5A 5CQGA 3OOPA 1TW2A 1IRFA 2VQLA 2EJRA 2R5ZA 2LKPA 3DPUA 1Z05A 5GTIC 2GLOA 3BR0A 2KPMA 1TP4A 2QWWA 2QQAA 1XG1A 1IRXA 3C7JA 3CDLA 3LA7A 2NVQJ 5CQEA 3S2HJ 1QPIA 1QBJA 2Q2EA 1IZ1A 1RR8C 2LH9A 2HVSA 3H3ZA 1WCMJ 1JHHA 3ZMUA 2M30A 3CUQA 5L3FA 3I59A 1LFPA 4YELA 4IOAF 4AIJA 4NQWB 2AS5F 2XKPA 4A3GJ 2W25A 1BIBA 1FJLA 3HOSA 4HX8A 4A0YA 1T0FC 1XSXA 4QPOA 1GLNA 2BW3B 2K7LA 3K2AA 3DBHB 5F27A 2Z1DA 2FRHA 3O6BB 4F55A 2HDDA 2CW0F 4BY7J 4L9VA 3OYAA 3OR1C 2AXTC 2LY2A 1F9NA 2DAOA 2XAHA 4Y52J 2QENA 2XF6A 4BXFA 1YITI 3EUHA 3X2QH 2V79A 4BE0A 3T0YA 1V4RA 1T0FA 2ICWG 1X2NA 3PUBA 2IA2A 1T08B 4LD5A 3OYEA 2V1DA 2XF5A 2CU7A 1GV5A 1I3AA 3OIQA 9ANTA 4D9JA 2LR8A 3PFIA 2M2EA 1R71A 1TL8A 4JQFA 5C3EJ 1TQMA 4HZFA 4U88A 2H1KA 4LK0F 2Q8KA 5FLVA 4YRVA 3L2CA 1UZCA 4RGUA 2R7DA 2RV8A 2XPVA 3C18A 4ZTJA 2HEOA 2CQKA 1J59A 1X1PA 2MA3A 3FXLA 2OU2A 1PUFA 2XPUA 1XGOA 3ZOBA 1JUMA 4XNFA 3OS2A 5J4YA 3IV5A 2G7UA 4BEHB 1BR2A 1QGPA 2VOOA 5TISC 4ESFA 2UXXA 3E6BA 4CUGA 2JPBA 1LQ1A 3KLNA 1FX7A 4XKCA 2NOJB 1HSJA 1WKMA 2XRNA 1SD4A 1RETA 4CO8A 3CESA 5CVRA 1DU0A 3K4JA 1P4WA 3ML6A 4I2OA 1PUFB 2O03A 5B66C 3PQJA 4IL6C 4M3DA 5IYCJ 3BJAA 2ELJA 4Z6YA 4IHXA 4AD9A 3HEFA 4RBOA 3JRBA 2A07F 2PMZN 2IS6A 2J5OA 4XLNF 1QVTA 2Y30A 2G9WA 3CCMI 3H3UA 3TP0A 1LEBA 2VJ4A 2P6TA 4Y3OA 4F52A 1IN6A 3H5RA 4UHTA 2DJNA 3KE2A 2JN6A 2EB7A 2PMZA 4CCLA 3KP3A 1AWCA 2HFHA 2KIUA 3HBLA 2DN0A 2VIXA 3F8MA 1X3WB 3BPXA 3TO7A 5IOZA 1Z1DA 2LVSA 3B6CA 1V5FA 3F0CA 2WAQA 5L3CA 2COBA 5E3OA 4IHSA 2P5LC 2KKOA 2VBXA 2NOGA 1JKQC 1GDTA 2ID3A 1D3YA 1KYWA 4MGRA 2GZWA 2F4MB 3WU2C 4KT6A 3DF8A 4BGDA 3WGIA 3OSGA 4OIOF 2WB1A 4A3KJ 2ESNA 5EJCA 4WWCA 2K86A 1T38A 3GXOA 4BQQA 1J2XA 1MNEA 2FEZA 5K5OA 4EQQA 2DU9A 3OYNA 2ELKA 3B73A 2DMPA 2ME6A 1ON1A 4M74A 3BR2A 4HV5A 2WY8Q 2VN2A 3NRVA 4MIMA 5EG0B 1JKOC 3GZ6A 3L2WA 1P6RA 3MKYB 5IOYA 3M8JA 3DP7A 3QAHA 3H9QA 3JR9A 1ZGJA 2R93J 3S8PA 4A3EJ 2VASA 3HUGA 2M8EA 5F6FA 2JRMA 4HV6A 2OQGA 4A3LJ 2XAQA 4HW0A 1SMYF 1H9TA 2IA1A 4Y33A 1RKTA 1OCPA 3VSLA 1PUEE 3F3XA 3MWMA 2DYSH 2L7MP 3J7AO 2CRGA 1D8KA 2P6SA 4Y15A 4RLQA 4WCGA 4ZYDA 1FP1D 4AIKA 3SZPA 4KISA 4WXDA 2VPLA 1B6AA 3OYDA 1T56A 4CCKA 2BVLA 2NS8A 4BUPA 3V7SA 3ABMH 5GPCA 4OAYA 3LSRA 1QU3A 1EH6A 2X6WA 2FJ1A 1JUPA 1FMVA 4XK4A 2VE9A 5CVJA 3T8RA 1I27A 2KDOA 4RB3C 2FNPA 4HBLA 2DMQA 4CXFA 3W2VA 2PG4A 2VBYA 1R5GA 4TV7A 2GQQA 4HNUA 4ZJZA 2DFIA 3S93A 2VODA 4LG0A 2BE5F 2V6EA 1A04A 1SANA 4UB8C 5KNLA 1U8BA 1BI0A 5D5XB 2EWNA 1HW5A 2GXBA 1WSUA 2IGKA 1MMDA 4LIUA 4E7LA 3SXYA 2W57A 6PAXA 1RI7A 3VB2A 4UUTA 4MTEA 2FBHA 3C2GA 4MFDA 3HYIA 3OS0A 1X2MA 3L9FA 5HS8A 3IUOA 4C2TA 5JHFA 5HOOA 1K4TA 5F0FA 1EA3A 3ERMA 4HNVA 4IPAA 4RB0A 4CCMA 2NYXA 3KPHA 4ZH4F 3PO3J 4BBSJ 2JWTA 1WPKA 4NQWA 3IRQA 2E7XA 2XDVA 4FISA 1B1BA 1OLTA 5F1JA 3PJRA 3G1LA 1SMTA 4ZTFA 1KU9A 2ZKZA 2WAFA 2KIQA 4DZJA 3BROA 5HLIA 1G6NA 3RI4A 1ACIA 3S1RJ 4ZC3A 4NNJA 4R8HA 1FEXA 4A6DA 1I6XA 1U6GA 3I3LA 1ONVA 4B47A 2QZ8A 3CDHA 2V9PA 2KISA 5DYMA 3Q5FA 2GBYA 3JSPA 2Z3YA 3WU1B 4HYEA 1R7JA 2BYVE 2MW8A 3FBNB 1S6LA 3FK7A 4UV8A 3MQ0A 4B44A 5D5WB 2L4AA 2E2IJ 3V7CA 3HG9A 1MGTA 3RIRA 3IRRA 3CP8A 3OMYA 4V2FA 1J7KA 2CW8A 1FYLA 4G6DA 1ETYA 4UVCA 2OD5A 3ZQQA 1ZRDA 2CFXA 4U0WA 4BDZA 3NWTA 1VQ4I 5IT9K 3GEZA 4E7SA 3HOWJ 1MZBA 5DV5A 2DOFA 4KMFA 4AIDA 1K6OA 4A2UA 4A6EA 2NVXJ 2ESHA 1BR1A 1T2KA 4W97A 3ASNH 3QYEA 5DTDA 1FBSA 4M9XA 2HDCA 4D0PA 1Z0XA 2K9SA 3DPLC 2F48A 5AIQA 3V8KA 2DDAA 2M7AA 3HSRA 3PM1A 3S15J 4NUBA 1OKRA 1LDJA 2M87A 2CV1A 2DTRA 4ESBA 2R7TA 4U7DA 1HCRA 3TMOA 2IGOA 1KZHA 2NVTJ 3GTQJ 2V6CA 3FMSA 4CYDA 3FXKA 1LNWA 2HQRA 3RSNA 5JFRA 1R1UA 1UCRA 3PQKA 5B3SH 1HLVA 4KDPA 1HDPA 4NC7A 1PDNC 2IGMA 1L0OC 4FE7A 1KU3A 2AO9A 1S72I 3I59B 1XCVA 2YUSA 4GDFA 3JTHA 2RDPA 4WXHA 3DTKA 5F1RA 4IVNA 3ABUA 2DW4A 3IWZA 3HKZN 2GXAA 1R36A 3BQZA 1YJWI 1UAAA 4GFBA 2EZKA 4XRSA 2L3DA 4GYGA 2JVHA 3QPLA 4XLCA 2W7NA 2R7RA 1W7PB 2AHQA 2XAFA 2LP0A 5CKTA 5HS9A 1AKHA 4IRGA 2LF8A 2H27A 2EA2A 3BCBA 1OCZH 2TCTA 2YSRA 1VQ6I 1ZG3A 3R60A 1K78A 3W2WA 1D0YA 1WQ2A 2KP6A 4ZYEA 1SFUA 1PJRA 1W0UA 2FSWA 1VQOI 4Y7NJ 1D5VA 4QSHA 4G12A 3U21A 4JX5A 1Z91A 2O7OA 5ICGA 2JJ7A 2V7FA 4II3A 1K79A 1SFXA 2FBIA 1APLC 2MLKA 2LBFA 4UVBA 3FM3A 3GMEA 4IX7A 2XGEA 1IG7A 4CZZA 2G7HA 1XS9A 2HZDA 4M9SA 3I4NJ 2OC6A 5DS9A 3WHBA 2Z9OA 2JA6J 1WI9A 2JPCA 2LREA 1MBKA 2OZ6A 3QOPA 3FXJA 2V9VA 4E4HA 3IKVA 1BW6A 1E17A 2XGXA 3H35A 3PSFA 3G4SI 2OA4A 2ECBA 2CV0A 3KP7A 2TRTA 3MZ8A 3NWSA 1VNDA 4C3HJ 1R9TJ 4CHUA 3I54A 2YU3A 1GHCA 3CMMA 1QHGA 3WTTC 3B6AA 4GRIA 3ZMZA 1R49A 2WADA 1O57A 4JX6A 3LL7A 4LLNA 2XUBA 3FHZA 3LSPA 1C0WA 3K1NA 1L3LA 4IEJA 3HDDA 2ZJ2A 1XDUA 3JRGA 1JGGA 1IXSB 2DMUA 4RB1A 4DYQA 4S05A 1YIJI 4X1EA 2LD5A 1IGNA 2QQ9A 3ASOH 1JGSA 2UXNA 4G94A 3ZMVA 2DA6A 1BM9A 2HPMA 4MTDA 4ANJA 2I10A 3G1MA 1AKHB 1U8RA 1ZK8A 2VKVA 5DM6F 1ZG5A 1FYKA 4DYRA 2KT0A 1ZHFA 4N4NB 4DIQA 2RAEA 3OYGA 4M3FA 4ENKA 2DFEA 3WE3A 2E1CA 2VUMJ 4XSXF 2EV5A 1MDMA 3G2BA 3KP2A 3UR3C 5FFZA 5FROA 1J0RA 4XOPA 5K7HA 3RKYA 3CQZJ 1S7OA 3Q3SA 1MBEA 4OMYA 3R0AA 5ERIA 2VOPA 2NVYJ 3HHGA 3BOQA 3CZ6A 5F04A 3MEXA 2WAQN 1B8IA 2DK5A 5EGOA
chains in the Genus database with same CATH topology
4ABZA 1WGXA 2G0EA 1IV6A 3K2AA 2XB0X 5F27A 2KDZA 1HDDC 2IEKA 1VFCA 2JMWA 2DA2A 3DCFA 1AHDP 2HDDA 1FIPA 4BY7J 3UKGA 1S7EA 1ETOA 2D5VA 4Y52J 2W48A 3Q0UA 2DA7A 2DA4A 3ZQHA 4AUXA 3JRDA 2ME0A 5J1UA 5F08A 5IPAA 3HOVJ 1X2NA 3JRAA 4DYCA 5M3MJ 2CU7A 1GV5A 4JP0A 9ANTA 4M3GA 3E7LA 2LR8A 2M2EA 5C3EJ 5C44J 2H1KA 5FLVA 3K7AJ 5K7FA 2LKXA 5E3MA 1ZKGA 2XPVA 2O8KA 3I4MJ 2XSDC 2E2HJ 1PUFA 1JJ8C 2XPUA 2K40A 3FIWA 3ZOBA 3IH3A 1JUMA 4A3MJ 1WH7A 3IV5A 1U78A 1IDZA 2EH3A 1ZTRA 1TC3C 1Q1VA 3BT9A 1TWHJ 2LK2A 1H8AC 1CQTA 3DEWA 3CMYA 4W1UA 3GTLJ 1RETA 1DU0A 2NS7A 1PUFB 5M3FJ 1LE8B 4CYCB 4M3DA 3D1NI 2Y9YA 5IYCJ 2GM4A 1T33A 3SDGA 1POGA 4IHXA 1EF4A 1MBJA 4M3EA 3HEFA 2IBDA 4RBOA 3JRBA 2PMZN 1P7IA 3HB9A 3RKQA 1QVTA 4M6VA 2JA7J 1JT6A 2Y30A 5EYRA 3TP0A 1I6HJ 4FTHA 4A3DJ 5FKMA 1ZGWA 2DJNA 1HOMA 3W6VA 2JN6A 2O9LA 2QCOA 1BW5A 3ZQLA 2E1OA 5BNGA 3HBLA 2DN0A 4AC0A 2VI6A 4IHYA 1LFBA 5IOZA 2LVSA 3B6CA 3F0CA 5E3OA 1WI3A 3WHCA 2COBA 1I50J 2NOGA 1AU7A 1JKQC 1GDTA 2ID3A 2XPWA 1JTYA 3TW6A 4DW6A 1ITYA 1ETWA 3MKLA 2MG4A 3RZOJ 2LFBA 1JJ6C 3OSGA 2LLKA 4A3KJ 2IAIA 2HXIA 3GTGJ 3LNQA 2XGCA 4BY1J 3BTLA 1GV2A 2ELKA 2DMPA 2ME6A 3L1PA 3BR2A 3O8GA 4MIMA 5EG0B 2XGDA 1JKOC 3BR1A 4NDLA 1B72A 2HOAA 2M0CA 5IOYA 3SFIA 2DA1A 4C2MJ 1GUUA 2EZIA 3JR9A 1MBHA 2R93J 2R7ZJ 4A3EJ 4DZPA 3LOCA 3Q0WA 3JRCA 4B1RA 1MBFA 4JYKA 4CYCA 1O4XA 3BR6A 4S0HB 4D5FA 2CJJA 4A3LJ 5C4JJ 1ZR2A 3S1MJ 2K9QA 5M5YJ 1RKTA 1OCPA 4A3FJ 1FJLA 2HYJA 2Y9ZA 2JA5J 3IH2A 2L7MP 3A01A 2CRGA 3A03A 1IJWC 1BJZA 4BBRJ 3VPRA 4IHWA 3S1NJ 2XB5A 3BG5A 3S16J 3BTCA 1T56A 5F0CA 2NS8A 5GPCA 3LSRA 2E2JJ 4UUSB 3BG3A 2FJ1A 3GTKJ 1JUPA 1RR7A 4XK4A 4A3BJ 1D5YA 2OF7A 1U9NA 2DMQA 1JTXA 4A3IJ 3CCYA 4V2GA 1ETQA 2L7ZA 1B72B 2FD5A 1JKRC 2HI3A 3BR3A 1SANA 2CQQA 3O8HA 5FJ8J 1U8BA 3BR5A 3OSFA 3TW7A 2CUEA 2JK3A 4D7MA 2HOSA 2EQRA 2EZHA 4UUTA 1XC5A 2WV1A 4MFDA 3MN2A 5FKOA 1X2MA 4XIDA 1Y1VJ 1TWFJ 5F0FA 3HOYJ 3HOXJ 4HNVA 4D7NA 4D5CA 3GTJJ 5EGOB 1I3QJ 3PO3J 4BBSJ 3QPSA 5EF6A 1JT0A 2JWTA 1WPKA 1B8IB 4FISA 5F1JA 1BL0A 3G1LA 2X6OA 3FKIJ 4DZJA 5GPAA 1BA5A 3S1RJ 1GVDA 1ZQ3P 2VPRA 5J1YA 1ORKA 1FEXA 1UG2A 4L5EA 1JKPC 2DMNA 2Y2ZA 4MLOA 4UUSA 5M5WJ 1H88C 2GBYA 4X6AJ 2R92J 1OCTC 2Y0SN 4BKXA 2MW8A 3Q0VA 1IDYA 2VKEA 2YS9A 3FK7A 1A6IA 2E2IJ 2CQXA 1ZR4A 1IRZA 2L9RA 1MNMC 1FTZA 3JRFA 4V2FA 5FKLA 1Y1WJ 2OPTA 2B63J 3S17J 1ETYA 3HOZJ 4J19A 2JA8J 2FQ4A 5EDNA 3SJMA 1FTTA 1OJLA 1LE8A 1JUSA 3H3VK 3TP3A 5J3LA 1G2HA 4RDUA 3HOWJ 2HXOA 2DTZA 5E3LA 1HF0A 3TEDA 2NVXJ 3HM5A 2N8GA 2LTPA 4MO7A 2L7FP 4XRMA 2R5YB 4W97A 5DTDA 5M5XJ 1WH5A 3GTOJ 2Y31A 1Z0XA 2K9SA 1ENHA 3PM1A 1QRYA 3S15J 1YRNA 1NK2P 2R0QC 1VF9A 4FCYA 4LOCA 2QF7A 1HCRA 5J1RA 4A3CJ 5EG0A 4A93J 4IHVA 3JRHA 4B3AA 2NVTJ 3GTQJ 1FIAA 1MH4A 3G1OA 1SFOJ 4QTRA 1Z77A 4QIWN 2L0KA 1HLVA 5IP9J 1HDPA 2DMTA 4FE7A 2AO9A 1RESA 4I76A 2YUSA 2YU9J 1K61A 5FKKA 1RKWA 2M9HA 2CUFA 5HODA 3BTIA 2P81A 5EEAA 3M4OJ 5GP9A 1P7JA 1U9OA 4C3JJ 3HKZN 3BQZA 1YRNB 2MGQA 4BXXJ 4M3BA 2EZKA 4XRSA 4GFBA 5C4XJ 3HGGA 3QPLA 3OIOA 2AHQA 1AKHA 1F43A 2LP0A 4JX4A 2DA3A 2FX0A 3GTPJ 2TCTA 1RPWA 5F0HA 3A01B 1ETKA 2E19A 3JREA 3NAUA 1NTCA 2LY9A 1W0UA 4FE4A 4Y7NJ 4XICA 2M34A 4QSHA 4G12A 5FLMJ 2HOTA 3BQYA 4MFEA 2X48A 4JX5A 2O7OA 4AYBN 2ECCA 2JJ7A 2EZLA 1GT0C 1LFUP 1APLC 5K7ZA 4EEFG 1IUFA 1IG7A 4A69C 3LSGA 2XGEA 1TWCJ 5EZGA 1XS9A 1TWAJ 3ZQIA 3A02A 3BTJA 5IP7J 1NK3P 3I4NJ 5DS9A 3WHBA 2JA6J 2XRLA 3MVPA 2M8GX 1MBKA 2DA5A 3FISA 4B4CA 1UMQA 5FKNA 3HOUJ 1BW6A 2R5YA 1H89C 4XRSG 4A3JJ 1F36A 3OOUA 4C3IJ 3ZQCA 3M3YJ 2ECBA 2TRTA 4C3HJ 1VNDA 1R9TJ 3BG9A 3PO2J 3GBGA 5IP6A 3B6AA 3HGYA 3NARA 5JLXA 1ETXA 5JLWA 1E3OC 1IC8A 3JRIA 4JX6A 1QVUA 1MSFC 2HQ5A 3LSPA 3S1QJ 5IYDJ 3S14J 4IEJA 3FK6A 1MBGA 3HDDA 3JRGA 1JGGA 1K83J 2DMUA 1MH3A 1UHSA 4DYQA 3GTMJ 4X1EA 2ZB9A 2LD5A 1IGNA 1W0TA 3RQIA 3ZQFA 5EZHA 3ZQGA 2MSYA 2X9DA 2DA6A 1OFCX 2H8RA 3QQAA 2I10A 3G1MA 1VI0A 2EBIA 1AKHB 2R5ZB 1ZK8A 2VKVA 4DYRA 2KT0A 2R5ZA 3S2DJ 1ETVA 2RAEA 4M3FA 2GLOA 2VUMJ 1TWGJ 3BR0A 3LSJA 1XG1A 2K9NA 3CDLA 2NVQJ 3S2HJ 1QPIA 3C2BA 3RZDJ 3IH4A 5K7HA 3CQZJ 1WCMJ 1MBEA 3Q3SA 5IYBJ 2NVYJ 2WB1N 1DU6A 3H0GJ 5F04A 2WAQN 1X58A 1B8IA 4A3GJ 1MSEC 1A5JA 2ID6A 5EGOA 4I6ZA 5E3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABZ A;  1WGX A;  2G0E A;  1IV6 A;  3K2A A;  2XB0 X;  5F27 A;  2KDZ A;  1HDD C;  2IEK A;  1VFC A;  2JMW A;  2DA2 A;  3DCF A;  1AHD P;  2HDD A;  1FIP A;  4BY7 J;  3UKG A;  1S7E A;  1ETO A;  2D5V A;  4Y52 J;  2W48 A;  3Q0U A;  2DA7 A;  2DA4 A;  3ZQH A;  4AUX A;  3JRD A;  2ME0 A;  5J1U A;  5F08 A;  5IPA A;  3HOV J;  1X2N A;  3JRA A;  4DYC A;  5M3M J;  2CU7 A;  1GV5 A;  4JP0 A;  9ANT A;  4M3G A;  3E7L A;  2LR8 A;  2M2E A;  5C3E J;  5C44 J;  2H1K A;  5FLV A;  3K7A J;  5K7F A;  2LKX A;  5E3M A;  1ZKG A;  2XPV A;  2O8K A;  3I4M J;  2XSD C;  2E2H J;  1PUF A;  1JJ8 C;  2XPU A;  2K40 A;  3FIW A;  3ZOB A;  3IH3 A;  1JUM A;  4A3M J;  1WH7 A;  3IV5 A;  1U78 A;  1IDZ A;  2EH3 A;  1ZTR A;  1TC3 C;  1Q1V A;  3BT9 A;  1TWH J;  2LK2 A;  1H8A C;  1CQT A;  3DEW A;  3CMY A;  4W1U A;  3GTL J;  1RET A;  1DU0 A;  2NS7 A;  1PUF B;  5M3F J;  1LE8 B;  4CYC B;  4M3D A;  3D1N I;  2Y9Y A;  5IYC J;  2GM4 A;  1T33 A;  3SDG A;  1POG A;  4IHX A;  1EF4 A;  1MBJ A;  4M3E A;  3HEF A;  2IBD A;  4RBO A;  3JRB A;  2PMZ N;  1P7I A;  3HB9 A;  3RKQ A;  1QVT A;  4M6V A;  2JA7 J;  1JT6 A;  2Y30 A;  5EYR A;  3TP0 A;  1I6H J;  4FTH A;  4A3D J;  5FKM A;  1ZGW A;  2DJN A;  1HOM A;  3W6V A;  2JN6 A;  2O9L A;  2QCO A;  1BW5 A;  3ZQL A;  2E1O A;  5BNG A;  3HBL A;  2DN0 A;  4AC0 A;  2VI6 A;  4IHY A;  1LFB A;  5IOZ A;  2LVS A;  3B6C A;  3F0C A;  5E3O A;  1WI3 A;  3WHC A;  2COB A;  1I50 J;  2NOG A;  1AU7 A;  1JKQ C;  1GDT A;  2ID3 A;  2XPW A;  1JTY A;  3TW6 A;  4DW6 A;  1ITY A;  1ETW A;  3MKL A;  2MG4 A;  3RZO J;  2LFB A;  1JJ6 C;  3OSG A;  2LLK A;  4A3K J;  2IAI A;  2HXI A;  3GTG J;  3LNQ A;  2XGC A;  4BY1 J;  3BTL A;  1GV2 A;  2ELK A;  2DMP A;  2ME6 A;  3L1P A;  3BR2 A;  3O8G A;  4MIM A;  5EG0 B;  2XGD A;  1JKO C;  3BR1 A;  4NDL A;  1B72 A;  2HOA A;  2M0C A;  5IOY A;  3SFI A;  2DA1 A;  4C2M J;  1GUU A;  2EZI A;  3JR9 A;  1MBH A;  2R93 J;  2R7Z J;  4A3E J;  4DZP A;  3LOC A;  3Q0W A;  3JRC A;  4B1R A;  1MBF A;  4JYK A;  4CYC A;  1O4X A;  3BR6 A;  4S0H B;  4D5F A;  2CJJ A;  4A3L J;  5C4J J;  1ZR2 A;  3S1M J;  2K9Q A;  5M5Y J;  1RKT A;  1OCP A;  4A3F J;  1FJL A;  2HYJ A;  2Y9Z A;  2JA5 J;  3IH2 A;  2L7M P;  3A01 A;  2CRG A;  3A03 A;  1IJW C;  1BJZ A;  4BBR J;  3VPR A;  4IHW A;  3S1N J;  2XB5 A;  3BG5 A;  3S16 J;  3BTC A;  1T56 A;  5F0C A;  2NS8 A;  5GPC A;  3LSR A;  2E2J J;  4UUS B;  3BG3 A;  2FJ1 A;  3GTK J;  1JUP A;  1RR7 A;  4XK4 A;  4A3B J;  1D5Y A;  2OF7 A;  1U9N A;  2DMQ A;  1JTX A;  4A3I J;  3CCY A;  4V2G A;  1ETQ A;  2L7Z A;  1B72 B;  2FD5 A;  1JKR C;  2HI3 A;  3BR3 A;  1SAN A;  2CQQ A;  3O8H A;  5FJ8 J;  1U8B A;  3BR5 A;  3OSF A;  3TW7 A;  2CUE A;  2JK3 A;  4D7M A;  2HOS A;  2EQR A;  2EZH A;  4UUT A;  1XC5 A;  2WV1 A;  4MFD A;  3MN2 A;  5FKO A;  1X2M A;  4XID A;  1Y1V J;  1TWF J;  5F0F A;  3HOY J;  3HOX J;  4HNV A;  4D7N A;  4D5C A;  3GTJ J;  5EGO B;  1I3Q J;  3PO3 J;  4BBS J;  3QPS A;  5EF6 A;  1JT0 A;  2JWT A;  1WPK A;  1B8I B;  4FIS A;  5F1J A;  1BL0 A;  3G1L A;  2X6O A;  3FKI J;  4DZJ A;  5GPA A;  1BA5 A;  3S1R J;  1GVD A;  1ZQ3 P;  2VPR A;  5J1Y A;  1ORK A;  1FEX A;  1UG2 A;  4L5E A;  1JKP C;  2DMN A;  2Y2Z A;  4MLO A;  4UUS A;  5M5W J;  1H88 C;  2GBY A;  4X6A J;  2R92 J;  1OCT C;  2Y0S N;  4BKX A;  2MW8 A;  3Q0V A;  1IDY A;  2VKE A;  2YS9 A;  3FK7 A;  1A6I A;  2E2I J;  2CQX A;  1ZR4 A;  1IRZ A;  2L9R A;  1MNM C;  1FTZ A;  3JRF A;  4V2F A;  5FKL A;  1Y1W J;  2OPT A;  2B63 J;  3S17 J;  1ETY A;  3HOZ J;  4J19 A;  2JA8 J;  2FQ4 A;  5EDN A;  3SJM A;  1FTT A;  1OJL A;  1LE8 A;  1JUS A;  3H3V K;  3TP3 A;  5J3L A;  1G2H A;  4RDU A;  3HOW J;  2HXO A;  2DTZ A;  5E3L A;  1HF0 A;  3TED A;  2NVX J;  3HM5 A;  2N8G A;  2LTP A;  4MO7 A;  2L7F P;  4XRM A;  2R5Y B;  4W97 A;  5DTD A;  5M5X J;  1WH5 A;  3GTO J;  2Y31 A;  1Z0X A;  2K9S A;  1ENH A;  3PM1 A;  1QRY A;  3S15 J;  1YRN A;  1NK2 P;  2R0Q C;  1VF9 A;  4FCY A;  4LOC A;  2QF7 A;  1HCR A;  5J1R A;  4A3C J;  5EG0 A;  4A93 J;  4IHV A;  3JRH A;  4B3A A;  2NVT J;  3GTQ J;  1FIA A;  1MH4 A;  3G1O A;  1SFO J;  4QTR A;  1Z77 A;  4QIW N;  2L0K A;  1HLV A;  5IP9 J;  1HDP A;  2DMT A;  4FE7 A;  2AO9 A;  1RES A;  4I76 A;  2YUS A;  2YU9 J;  1K61 A;  5FKK A;  1RKW A;  2M9H A;  2CUF A;  5HOD A;  3BTI A;  2P81 A;  5EEA A;  3M4O J;  5GP9 A;  1P7J A;  1U9O A;  4C3J J;  3HKZ N;  3BQZ A;  1YRN B;  2MGQ A;  4BXX J;  4M3B A;  2EZK A;  4XRS A;  4GFB A;  5C4X J;  3HGG A;  3QPL A;  3OIO A;  2AHQ A;  1AKH A;  1F43 A;  2LP0 A;  4JX4 A;  2DA3 A;  2FX0 A;  3GTP J;  2TCT A;  1RPW A;  5F0H A;  3A01 B;  1ETK A;  2E19 A;  3JRE A;  3NAU A;  1NTC A;  2LY9 A;  1W0U A;  4FE4 A;  4Y7N J;  4XIC A;  2M34 A;  4QSH A;  4G12 A;  5FLM J;  2HOT A;  3BQY A;  4MFE A;  2X48 A;  4JX5 A;  2O7O A;  4AYB N;  2ECC A;  2JJ7 A;  2EZL A;  1GT0 C;  1LFU P;  1APL C;  5K7Z A;  4EEF G;  1IUF A;  1IG7 A;  4A69 C;  3LSG A;  2XGE A;  1TWC J;  5EZG A;  1XS9 A;  1TWA J;  3ZQI A;  3A02 A;  3BTJ A;  5IP7 J;  1NK3 P;  3I4N J;  5DS9 A;  3WHB A;  2JA6 J;  2XRL A;  3MVP A;  2M8G X;  1MBK A;  2DA5 A;  3FIS A;  4B4C A;  1UMQ A;  5FKN A;  3HOU J;  1BW6 A;  2R5Y A;  1H89 C;  4XRS G;  4A3J J;  1F36 A;  3OOU A;  4C3I J;  3ZQC A;  3M3Y J;  2ECB A;  2TRT A;  4C3H J;  1VND A;  1R9T J;  3BG9 A;  3PO2 J;  3GBG A;  5IP6 A;  3B6A A;  3HGY A;  3NAR A;  5JLX A;  1ETX A;  5JLW A;  1E3O C;  1IC8 A;  3JRI A;  4JX6 A;  1QVU A;  1MSF C;  2HQ5 A;  3LSP A;  3S1Q J;  5IYD J;  3S14 J;  4IEJ A;  3FK6 A;  1MBG A;  3HDD A;  3JRG A;  1JGG A;  1K83 J;  2DMU A;  1MH3 A;  1UHS A;  4DYQ A;  3GTM J;  4X1E A;  2ZB9 A;  2LD5 A;  1IGN A;  1W0T A;  3RQI A;  3ZQF A;  5EZH A;  3ZQG A;  2MSY A;  2X9D A;  2DA6 A;  1OFC X;  2H8R A;  3QQA A;  2I10 A;  3G1M A;  1VI0 A;  2EBI A;  1AKH B;  2R5Z B;  1ZK8 A;  2VKV A;  4DYR A;  2KT0 A;  2R5Z A;  3S2D J;  1ETV A;  2RAE A;  4M3F A;  2GLO A;  2VUM J;  1TWG J;  3BR0 A;  3LSJ A;  1XG1 A;  2K9N A;  3CDL A;  2NVQ J;  3S2H J;  1QPI A;  3C2B A;  3RZD J;  3IH4 A;  5K7H A;  3CQZ J;  1WCM J;  1MBE A;  3Q3S A;  5IYB J;  2NVY J;  2WB1 N;  1DU6 A;  3H0G J;  5F04 A;  2WAQ N;  1X58 A;  1B8I A;  4A3G J;  1MSE C;  1A5J A;  2ID6 A;  5EGO A;  4I6Z A;  5E3N A; 
#chains in the Genus database with same CATH topology
 1ZRC A;  4XKV A;  1WGX A;  2G0E A;  3QYF A;  4XR6 A;  3TOB A;  4Y4R A;  1BN5 A;  3K6G A;  4LMY A;  4LK1 F;  1KYZ A;  1ULY A;  3K1P A;  1I39 A;  4FX0 A;  2PJR A;  2E1N A;  5BQT A;  5FRN A;  1U5T A;  3PIO F;  4BQN A;  1CF7 A;  1ETO A;  2HYF A;  3ZPL A;  2W48 A;  3L7W A;  1SFK A;  2DA7 A;  3QPT A;  3JRD A;  4XLE A;  5J1U A;  5F08 A;  1HBX G;  4Y17 A;  4BNC A;  5CVU A;  4HDU A;  4IKF A;  4BU2 A;  3P7N A;  3S3O A;  1XDS A;  1YYV A;  1Y8Q B;  5ILV A;  3OYF A;  1P9Q C;  2DLL A;  1N78 A;  2PFB A;  3E7L A;  3EQL F;  3ISP A;  4E7Z A;  5A2Q K;  5C44 J;  1WJB A;  2LKX A;  4OAZ A;  3N05 A;  1ZKG A;  5E3M A;  4EJO A;  4M71 A;  2O8K A;  1UJ8 A;  4P9F A;  3F8C A;  2CS3 A;  2E2H J;  5FD6 A;  5E79 C;  3FIW A;  2P7V B;  1IUY A;  2HZT A;  2XSJ C;  1WH7 A;  3MZY A;  5L3E A;  5K1Y A;  5DEQ A;  2GWR A;  2EFQ A;  4E7J A;  4I0B A;  1IDZ A;  2ZFW A;  2EH3 A;  4DBQ A;  2MLG A;  1Q1V A;  3BT9 A;  4OOI A;  5HDN A;  3F23 A;  3V4G A;  1TC3 C;  1FOW A;  1V3F A;  1X3U A;  3LSK A;  1E0E A;  2QUF A;  2W1O A;  1H8A C;  3ECO A;  1VQP I;  2MAB A;  2OTJ I;  2XAJ A;  5J4V A;  4KT5 C;  1WFX A;  2MD0 A;  4XLA A;  1OCC H;  5M3F J;  4ZZD A;  2I5U A;  1MDM B;  4CYC B;  1ZRF A;  2KIF A;  4HLX A;  3HUG B;  3IAS 2;  3HPG A;  5L3G A;  1T33 A;  2KHM A;  2HGC A;  3ZN0 A;  1POG A;  4ITV A;  1MBJ A;  4M3E A;  2V1X A;  2IBD A;  1YOV B;  1R58 A;  2L4M A;  3MFK A;  1NHA A;  5DD8 A;  4BQA A;  1R5H A;  4L18 B;  3FDY A;  2IS4 A;  2W82 A;  5HDG A;  3G71 I;  4QWQ A;  3O2P E;  1BW5 A;  1I5Z A;  3ZQL A;  5BNG A;  3GZN B;  2QKL B;  4XLF A;  2HOE A;  2VI6 A;  2F4O B;  1WI3 A;  3VYR B;  1TQP A;  4J01 A;  5DD4 A;  4U7B A;  1EV7 A;  5JHU A;  1ITY A;  2XPW A;  4IOC F;  3HRS A;  1ETW A;  3WTZ A;  3MKL A;  1LB2 A;  4PSX A;  2AQF A;  1B9M A;  2HKO A;  2W85 A;  4G6T B;  2HVR A;  3LNQ A;  4Q47 A;  2XGC A;  3I71 A;  4OIP F;  3TL4 X;  2CQ7 A;  3HRU A;  1SC7 A;  1XSV A;  2O8X A;  4I09 A;  3F6O A;  5D4S A;  3O8G A;  3OL3 A;  5CVI A;  2RRE A;  2XGD A;  3MZH A;  4NDL A;  1B72 A;  4AU7 A;  4B8X A;  3QP6 A;  5B1B H;  1GUU A;  1UST A;  2KMU A;  2EZI A;  1HQC A;  3FMR A;  2R7Z J;  3QRF F;  3LOC A;  3LMM A;  4ZDO A;  2H09 A;  1FSE A;  3BCA A;  3QPH A;  4B1R A;  1K4S A;  4JYK A;  4ETS A;  2CMP A;  2FBK A;  4S0H B;  4D5F A;  1GXP A;  2QVO A;  2CJJ A;  1NG7 A;  1T6S A;  3I0T A;  3P9I A;  2K9Q A;  3HKZ A;  2HYJ A;  3M1C A;  3IKT A;  1Z67 A;  1XB4 A;  5H6Q A;  1RUN A;  4ENJ A;  1OMI A;  3ZR8 X;  3A01 A;  3A03 A;  4HX4 A;  3SEZ A;  3A2K A;  4J00 A;  3F8N A;  1YW9 A;  3GF2 A;  1YS6 A;  4XSZ F;  2XB5 A;  5CVV A;  3CC7 I;  4HEA 2;  3OS1 A;  2EIN H;  2FML A;  3K4C A;  1KA8 A;  2BGC A;  3GTK J;  1AA7 A;  4A3B J;  1VZ0 A;  3V8L A;  3I4P A;  3JAM K;  2EIK H;  1XMK A;  5ICF A;  4I02 A;  2NAZ A;  2KL4 A;  1U9N A;  5D5U B;  3S3M A;  3R4K A;  3QYB A;  4A3I J;  2HR3 A;  1X3Z B;  1REP C;  3I56 I;  2GIZ A;  3E0J B;  4V2G A;  2LRD A;  3FM5 A;  5K5R A;  5J8C A;  1ETQ A;  1MMS A;  1OR7 A;  2FD5 A;  2ZCW A;  4PJL A;  4E7I A;  2CGP A;  4LB5 A;  1AOY A;  1WJD A;  2CUE A;  4OU0 A;  2B9S A;  2HOS A;  1A6Q A;  4CA0 A;  4M6Y A;  1WHU A;  3ZRG A;  1J5Y A;  2CFO A;  4KIG A;  4IXA A;  2FF4 A;  3MN2 A;  5FKO A;  3FMQ A;  3HJE A;  3QU3 A;  1FY7 A;  1DPR A;  3ZMD A;  4D7N A;  1FSH A;  3NEU A;  1DDN A;  2YX4 A;  1FP2 A;  3CTA A;  4HRI A;  4Q4Z F;  1JT0 A;  3KEQ A;  1W5C C;  3SHF A;  1BL0 A;  1GVJ A;  2HVQ A;  4G7Z F;  2HTS A;  1S7A A;  4F91 B;  4H4K C;  3PNY A;  1WJE A;  3L2U A;  2R7V A;  1SVO A;  3G3Z A;  4E7H A;  1I1G A;  4LLL A;  1GVD A;  2DI3 A;  1ZQ3 P;  4L0Z B;  5J1Y A;  3I58 A;  1A35 A;  1SD7 A;  4RS8 A;  2X1C A;  3SFZ A;  5JR3 A;  4L5E A;  1VQ7 I;  3IL2 A;  3P9C A;  2DMN A;  2L9V A;  4YFX F;  3CJR B;  2PI0 A;  2A3S A;  5LRR A;  1DUX C;  2DOE A;  5M5W J;  5IT3 A;  3CF2 A;  5FLX K;  4XKB A;  1PYV A;  1D0Z A;  2R92 J;  4AIH A;  4IJA A;  1QHH D;  5AIP A;  1O3R A;  4C30 A;  4PJN A;  1IDY A;  2MBF A;  2VKE A;  1WJF A;  3RPU A;  1Z7L A;  1IRZ A;  1LDD A;  3TGN A;  4OWR B;  3I53 A;  4KIF A;  1H0M A;  2A5W A;  2F5D A;  3JRF A;  3G73 A;  1FTZ A;  5FKL A;  3WU0 A;  3LA3 A;  1VQ9 I;  4N9I A;  2CH0 A;  1UFM A;  5D5V B;  2OPT A;  4LLG F;  3S17 J;  2RN7 A;  3QP5 A;  3J81 Z;  4J19 A;  1P4X A;  5J8F A;  5EDN A;  3SJM A;  3TDZ C;  3MCZ A;  4CGZ A;  1RIO H;  4UV9 A;  1JUS A;  3L00 A;  1BIA A;  3H3V K;  1MW7 A;  5LGU A;  3TP3 A;  3ZQ7 A;  4RDU A;  5F64 A;  2HXO A;  2DTZ A;  2M0M A;  4XQF A;  1FZP B;  3OV8 A;  1IO2 A;  2JVG A;  3KZZ A;  3HM5 A;  3FKJ A;  2LTP A;  4G8X A;  4MO7 A;  4LIV A;  3CUQ C;  2JSC A;  2L7F P;  2XF7 A;  4DJA A;  2R5Y B;  4DGW B;  2B0L A;  2VB6 A;  2O6G E;  4NHJ A;  2VBZ A;  3AAF A;  1WH5 A;  3CCL I;  2E7W A;  2X51 A;  1ZAR A;  1D0X A;  4PFO A;  1TZL A;  1YIO A;  1Y8R B;  1ENH A;  2PMU A;  3C3W A;  1J75 A;  2A5Y B;  4LOC A;  2EIJ H;  2FNA A;  3OYH A;  3O3K A;  5EG0 A;  2WA0 A;  4IHV A;  1QA6 A;  2L54 A;  1FIA A;  1TBX A;  3KIO A;  1EKE A;  2DOD A;  5AON A;  1VQK I;  4EV0 A;  3AL0 C;  4ZYG A;  1Z77 A;  2Q2E B;  2QSG X;  2JSP A;  3K1M A;  2L0K A;  3F72 A;  1PVE A;  1XGN A;  2R4G A;  4EJU A;  1HXD A;  4AVZ A;  2HNH A;  3AG2 H;  1LKX A;  4BHP A;  4A0X A;  2ACJ A;  1PP8 F;  2R7U A;  1I1S A;  1YE9 A;  3CJT B;  1QZZ A;  5FKK A;  3L2Q A;  2CUF A;  1F1Z A;  3WTX C;  1LVK A;  2P81 A;  3K4L A;  3CLO A;  3K10 A;  5GP9 A;  4AVP A;  2MGQ A;  2P5K A;  3K0L A;  3OWT A;  3HTS B;  2DT6 A;  3HGG A;  1MJ9 A;  3H1C A;  4HF0 A;  2L9N A;  2V9K A;  4XKW A;  3VDX A;  1N25 A;  3GTP J;  3CC4 I;  2VC1 A;  3A01 B;  5JVG F;  1YFH A;  4HDV A;  3J7A Y;  3IHU A;  2KQR A;  3JRE A;  2E1M C;  5D8L B;  1QZY A;  4FE4 A;  2F5V A;  4EJW A;  2DDB A;  4HA8 A;  3GWZ A;  1OCO H;  3H92 A;  2BHZ A;  2B7E A;  3HSF A;  4LIT A;  5FLM J;  4U0Y A;  3CCS I;  3FXU A;  1YX5 A;  2EZL A;  4E6K G;  3JSO A;  3WGH A;  4MNU A;  5K7Z A;  4EEF G;  3S32 A;  2ZXH A;  3DWL E;  4A69 C;  4IHT A;  2DJI A;  4A0Z A;  1NK3 P;  3ZQI A;  3BTJ A;  4PCQ A;  3KZI C;  2X0L A;  4PGG A;  2Z16 A;  4CCO A;  3CLQ A;  2DA5 A;  5FKN A;  2VXZ A;  3HOU J;  4X0G A;  4XRS G;  2ZJR F;  1F36 A;  5IT9 Z;  3FF5 A;  4YII A;  4YIR X;  1W5T A;  3VYT B;  4UXN A;  2V1N A;  4L0Y B;  3C2H A;  3CJQ B;  3PO2 J;  4BXU A;  5FLX Z;  2FXA A;  3CCR I;  5JLW A;  3OYI A;  1IC8 A;  3JRI A;  4C2U A;  3I64 A;  1QVU A;  1CF7 B;  1MSF C;  4LJZ F;  3OYL A;  5B5E C;  3HPH A;  5LBQ A;  4RAY A;  4BE1 A;  4PK4 A;  4F92 B;  5HLT A;  5IYD J;  3GO5 A;  5ICC A;  3FK6 A;  1MKM A;  1X1B A;  1K83 J;  4UB6 C;  3BJO A;  1Y39 A;  2Y69 H;  1R4N B;  1UHS A;  4BQO A;  2R7O A;  2E1M B;  3G6E I;  1W0T A;  2L5Q A;  3K69 A;  1A31 A;  2MSY A;  4L9J A;  3DTI A;  1BOA A;  2X9D A;  2DFF A;  3E1S A;  3BLY A;  1P4A A;  2D1H A;  4A5N A;  3VWB A;  1FMW A;  2W00 A;  2EBI A;  2ZSH B;  3C1D A;  1FLI A;  5BOX A;  3GUD A;  1YW7 A;  2VC0 A;  4UNO A;  5GAD J;  1EH8 A;  1TWG J;  2GA2 A;  2QQ8 A;  3BPV A;  2PMH A;  2MC4 A;  3LSJ A;  5GAG J;  1FPQ A;  4LB6 B;  3VOD A;  1J09 A;  2COM A;  4GYI A;  3TO6 A;  4AYB A;  5HLG A;  1SAX A;  5IYB J;  4FHT A;  3VOE A;  2OZU A;  1OQY A;  2GOX B;  2K9L A;  1DU6 A;  3DKX A;  4WK8 F;  3D5R C;  1QZE A;  1MSE C;  2ID6 A;  1PP7 U;  4HNT A;  5E3N A;  4ABZ A;  1VTN C;  1VQN I;  3OY9 A;  3ABT A;  1SFE A;  2XB0 X;  2KDZ A;  1HDD C;  1IRG A;  4YG2 F;  2IEK A;  2JMW A;  2HQA A;  2DA2 A;  4EAT A;  1V55 H;  4XN0 A;  4H0E A;  3JW4 A;  4XN3 A;  2FOW A;  1FNN A;  3IC7 A;  2D5V A;  2M5W A;  2ZSI B;  3F22 A;  2VON A;  4Q48 A;  3ZQH A;  4AUX A;  2RVC A;  4WXC A;  2ME0 A;  3K2Z A;  4L9N A;  1FOK A;  4IRI A;  4PZJ A;  2CG4 A;  4RM3 A;  4P96 A;  4F3Q A;  3E3V A;  5A2Q Z;  5IPA A;  1GXQ A;  3HOV J;  5FGM A;  4RGR A;  3WGG A;  3P5J A;  3KEY A;  4JP0 A;  1W36 D;  1BBY A;  3K7A J;  5K7F A;  1YO5 C;  1G3T A;  3DU6 A;  3W6K B;  3D5S C;  4JBA A;  3ESW B;  3HIF A;  1KU7 A;  1IXR C;  1JJ8 C;  4WF2 A;  1R1V A;  3E97 A;  2K40 A;  5GAH J;  3K70 C;  1STZ A;  4A3M J;  1U78 A;  2E36 A;  1ZLJ A;  1ZTR A;  1UHM A;  2NNN A;  1U2W A;  4QPQ A;  2LK2 A;  2YR2 A;  2OCE A;  3WOD F;  2DCE A;  1D1A A;  2QBY A;  1CQT A;  3DEW A;  3TO9 A;  5CLS A;  3J80 K;  4W1U A;  2M1B A;  1XSD A;  4N9H A;  3HOT A;  1ZLK A;  3AG3 H;  3GTL J;  1ON2 A;  1G8X A;  2HU9 A;  3RKX A;  2LF7 A;  1LPQ A;  3I9V 2;  3HHH A;  1HC8 A;  1YX3 A;  1YG2 A;  3CDI A;  3LFK A;  4ASN A;  3RPQ A;  3TOA A;  4CDG A;  2GM4 A;  3DTE A;  1EF4 A;  2QGU A;  3MAJ A;  4XM3 A;  1Z7U A;  4JOM A;  3HB9 A;  3RKQ A;  4YFK F;  4M6V A;  3EPZ A;  5EEH A;  1JT6 A;  3SZT A;  5EYR A;  1I6H J;  1Y6I A;  3EUK L;  3PNV A;  1YQA A;  4FTH A;  3LSH A;  3U9G A;  2QM3 A;  2ZNZ A;  2BXZ A;  3KLO A;  3W6V A;  1HOM A;  2QCO A;  3AG4 H;  2Y0M A;  5JVT A;  2E1O A;  2Z5U A;  4FT8 A;  3CO6 C;  4IHY A;  2XIG A;  5HNH A;  4HAM A;  2PJP A;  1XCB A;  2Z99 A;  5LHG A;  1X1D A;  3HC7 A;  1KON A;  4DOZ A;  3HL2 A;  3HSE A;  2LY1 A;  2UZK A;  1HW2 A;  4MQ9 F;  5BPI A;  4EM1 A;  1AU7 A;  2NRA C;  1A5J A;  2ADU A;  4DW6 A;  2MG4 A;  1DGR M;  3RZO J;  2XAS A;  1XGM A;  2QSF X;  2BBY A;  3DKW A;  2NS0 A;  2HXI A;  2M4G A;  3FXM A;  3WTW C;  3GTG J;  1X4P A;  2X1E A;  5LLQ A;  3U2R A;  1FBU A;  4BJ5 C;  2BY3 A;  1SEU A;  1FT9 A;  1RZ4 A;  1U5T C;  2OTL I;  2DT7 B;  5KK1 A;  3M7G A;  2P0W A;  3BR1 A;  4L5J A;  4LG0 B;  2HOA A;  1RC9 A;  2WV0 A;  2DBB A;  2VBW A;  4C2M J;  2D2W A;  3OYM A;  3GLX A;  4ON0 A;  3MKZ A;  5KCM A;  4DZP A;  2HQN A;  3Q0W A;  1ZGA A;  3MD2 A;  5HVQ C;  3JRC A;  1MBF A;  1DP7 P;  3R0J A;  4BDY A;  3RTR A;  1SD5 A;  1WJC A;  5C4J J;  2QLZ A;  3CCE I;  2ZXI A;  1K6Y A;  3I55 I;  2JUC A;  2OBP A;  2PLY A;  5BMZ A;  1VQ5 I;  3KP4 A;  2F2E A;  2K5C A;  1IJW C;  1BJZ A;  3N4M A;  4BBR J;  4ENM A;  4ZDL A;  3CP2 A;  3JAM Z;  3E6D A;  3VPR A;  4IHW A;  1EH7 A;  2PQ8 A;  3BG5 A;  4BHB A;  3BTC A;  4DNC A;  4HX7 A;  1MMN A;  4AM3 A;  5FO5 A;  4U87 A;  4EMS A;  1RR7 A;  1FYM A;  1TQI A;  1D5Y A;  4FET A;  1ZAO A;  2BW3 A;  2DQL A;  1JTX A;  4XLP F;  4P55 A;  4ZZL A;  1YLF A;  3ABL H;  3BDD A;  1NH3 A;  1HKT A;  2DK8 A;  3DXJ F;  1K7A A;  2ZME C;  4DBR A;  2I8D A;  2L2O A;  3A0B C;  3CME I;  1ODD A;  5E17 F;  4B3X A;  4BJ6 C;  2HI3 A;  3BR3 A;  2K4B A;  3ABK H;  5CYV A;  4CCN A;  5FJ8 J;  2Q1Z B;  2A68 F;  3BR5 A;  1XMA A;  4BJT A;  4XOT A;  2JK3 A;  2ZO4 A;  4D7M A;  2PBI A;  2VL8 A;  4EJV A;  2VT2 A;  5HDK A;  2XC7 A;  1XC5 A;  2DQR A;  3FX3 A;  3KYC B;  3LQR A;  4Y13 A;  4XID A;  1TWF J;  1MIJ A;  3HOY J;  3HOX J;  1KQ0 A;  2HPI A;  3KP6 A;  3BZK A;  3L2R A;  4D5C A;  3GTJ J;  5EGO B;  5EF6 A;  4RGX A;  1W1W E;  3KEO A;  1BI1 A;  1B8I B;  1JI8 A;  1TNT A;  2EA4 A;  3PL8 A;  5H20 A;  3U1K A;  1W4M A;  1O7L A;  5GPA A;  2ZBK A;  1XGS A;  5LD2 C;  1T95 A;  2UV1 A;  4XMY A;  3W6J B;  1USS A;  1BOB A;  2AQE A;  1YW8 A;  2BXY A;  2H8W A;  3VEP A;  1IN8 A;  3RJP A;  3VYU B;  3W2A A;  1O3Q A;  2GXG A;  4UUS A;  1Z3Y A;  2E34 A;  4RGS A;  4O5V A;  2Z2S B;  3OIP A;  4X6A J;  2H6C A;  4BKX A;  1W5S A;  3DU5 A;  1E3P A;  2H1L A;  3NQO A;  2Y0S A;  2FQ3 A;  3Q0V A;  1S8N A;  3K4K A;  2WWY A;  4RMN A;  1R4M B;  5LEK A;  2IPQ X;  2VKD A;  4KIC A;  2K3F A;  2Y48 A;  1MNM C;  2K85 A;  2VJ5 A;  2RGV A;  4BE2 A;  4UY8 I;  2WC2 A;  2WAE A;  4AWX B;  2QKM B;  1X1A A;  2FQ4 A;  1FTT A;  2PN6 A;  1WJA A;  3D0S A;  1OJL A;  4MEX F;  1EJ9 A;  1LE8 A;  1IN5 A;  3E6M A;  2ETH A;  2K3P A;  3KX2 A;  3ZP5 A;  3L2V A;  5JI6 A;  2MH9 A;  5E3L A;  1HF0 A;  2K02 A;  3TED A;  1SD6 A;  2N8G A;  2CQN A;  3HRM A;  4BHC A;  2LOO A;  2HDW A;  1H9G A;  2MD5 A;  2ISZ A;  2VT3 A;  4XRM A;  3ZMS A;  1IF1 A;  3GTO J;  1G59 A;  5IY5 H;  2F6C A;  4KFC A;  1S3J A;  1QRY A;  4KN4 X;  3A0H C;  1YRN A;  2P7C B;  2R0Q C;  1OR7 C;  1VF9 A;  4FCY A;  4LFU A;  5TGT A;  2L7K A;  3CC2 I;  1ZRE A;  2ZXW H;  3JCU C;  2L02 A;  2W4S A;  1IXC A;  4LG3 A;  2R7S A;  1TTY A;  3GCM A;  4PJ0 C;  1MH4 A;  3G1O A;  2HKX A;  4M6X A;  1G4D A;  5LEJ A;  1SFO J;  1Z3X A;  3SEQ A;  4A12 A;  1F4K A;  3CUO A;  3GYH X;  1ZEL A;  3LA2 A;  3CCV I;  5TRD A;  5IP9 J;  1IV8 A;  3PSI A;  4G7H F;  2DMT A;  1VQ8 I;  4I01 A;  3T1B A;  2JT1 A;  4RAG A;  4KYW A;  1W36 C;  2ZC2 A;  1SAU A;  3H5N A;  2E5Z A;  2IS2 A;  4I76 A;  4C9Y A;  4I99 C;  2YU9 J;  4NBQ A;  2EIM H;  4II2 A;  4Q5S F;  3FWE A;  1RKW A;  5HOD A;  4R79 A;  2PX9 A;  3BTI A;  5EEA A;  2VQG A;  3HTU A;  3M4O J;  3V8J A;  5J47 A;  3EUA A;  5LGT A;  1XD7 A;  2BVM A;  3R6S A;  1U3E M;  1U9O A;  1JE8 A;  1YRN B;  2H94 A;  2Q0O A;  2MFZ A;  3OIO A;  4G6Q A;  3JTG A;  1F43 A;  1XMX A;  3RYP A;  1IN7 A;  4JX4 A;  2DA3 A;  4EGY A;  4MQV A;  1VQM I;  1QNT A;  1RNL A;  5CJ9 A;  1T98 A;  1TW3 A;  5F0H A;  1OYI A;  1ETK A;  1B59 A;  4YFN F;  2EK5 A;  2E19 A;  2O61 A;  2P5V A;  2ELH A;  3NAU A;  2LY9 A;  2F5F A;  1ZN2 A;  2DYR H;  2R3S A;  2EV0 A;  3DEU A;  1KGS A;  1E3H A;  1MMG A;  2IP2 A;  4XIC A;  4KA4 A;  1HW1 A;  2HOT A;  2X48 A;  2VJJ A;  3QU6 A;  4AYB N;  4O3M A;  3DEE A;  3LST A;  1T39 A;  3K4B A;  1ZYR F;  3PFY A;  1LFU P;  4YIF A;  5GTH C;  3AL0 B;  3DQV C;  4HF2 A;  1A36 A;  1TWC J;  1S5L C;  4PJM A;  3EYI A;  3A02 A;  3ZXS A;  2RNG A;  1BI2 A;  2XRL A;  3MVP A;  4BAY A;  3TDU C;  2C6Y A;  3T5X A;  3GW2 A;  1UMQ A;  2GAU A;  4RLF A;  1UEL B;  2R5Y A;  3BG7 A;  3OOU A;  1SVM A;  4BEH A;  1QQI A;  3M3Y J;  2FOK A;  2QQB A;  2GA1 A;  2NXN B;  1F5T A;  2PJR B;  1J9I A;  3WTU C;  3BG9 A;  3K4M A;  1W7P D;  4XRF A;  3AFH A;  3NAR A;  3J7Y J;  1E3O C;  4PJJ A;  3CCJ I;  4OIQ F;  5DCF A;  3KYL A;  3S3N A;  2IRF G;  1OYW A;  1KQ9 A;  3S1Q J;  2EFP A;  2F5E A;  2O3F A;  3DBL B;  1P92 A;  3GFL A;  5FRM A;  2LYC A;  3LFU A;  3M1E A;  1MH3 A;  2X1D A;  1YS7 A;  4CIC A;  5L3B A;  3HRT A;  3TKY A;  3GTM J;  3Q9S A;  4HST A;  3RQI A;  3J7Z I;  3ZQG A;  3T8T A;  4M73 A;  1OFC X;  2H8R A;  3KFW X;  1G3W A;  3DV8 A;  1VI0 A;  2JQ7 A;  2R5Z B;  2A6T A;  5FFX A;  3WTV C;  2P8T A;  3S2D J;  2V1U A;  1ETV A;  1JHF A;  2HWV A;  3PUF A;  4V19 K;  5EEG A;  2K9N A;  2WTE A;  3LSI A;  3BJ6 A;  2IA0 A;  3OR2 C;  1M1E B;  1WVR A;  3DPT A;  4MHG A;  3WTY C;  2RNJ A;  2XVC A;  3SDB A;  4N0B A;  3F8B A;  1R6R A;  1LDK B;  3C2B A;  3RZD J;  3CUQ B;  2BEO A;  3IH4 A;  4FX4 A;  2M4K A;  3GFJ A;  2QSH X;  1IN4 A;  3PIP F;  2WB1 N;  2KZG A;  2LDU A;  3A1Y A;  3H0G J;  3MKW B;  1KU2 A;  1X58 A;  5H6R A;  1UG0 A;  4XL9 A;  1LUJ B;  1FOX A;  4I6Z A;  1ZR4 A;  1XX5 A;  3ZN1 A;  3K70 D;  1MJA A;  4D1Q A;  2M7B A;  1IV6 A;  5D6F A;  2KZV A;  4F93 B;  1VFC A;  3H9G A;  3DCF A;  1AHD P;  4I0A A;  1FIP A;  3V42 A;  5H2F C;  3UKG A;  4B09 A;  2R7Q A;  2YPR A;  1S7E A;  1YTY A;  3BG6 A;  2D45 A;  3Q0U A;  5TJJ A;  2BV6 A;  2DA4 A;  5BPD A;  1BJA A;  2X6X A;  1IW7 F;  3KYD B;  3BZ6 A;  2M45 A;  1TT0 A;  3JRA A;  2BOL A;  4DYC A;  5M3M J;  3DLL F;  2STW A;  2LSO A;  4UVA A;  2RQQ A;  4M3G A;  2ZXJ A;  4OIN F;  2QEX I;  4ESJ A;  4GXO A;  5D8K B;  1Z6R A;  3E5U A;  1QPM A;  3AG1 H;  3E5Q A;  1XN7 A;  3I4M J;  2XSD C;  2O0Y A;  2KJB A;  2RKH A;  2FE3 A;  1LJ9 A;  2R7X A;  4EVI A;  3IH3 A;  1O3S A;  3P9K A;  4BAC A;  3A4C A;  2BY1 A;  1B9N A;  3ZGK A;  1TWH J;  5D6E A;  5LHH A;  3ERE D;  4G9Y A;  2V26 A;  3LWF A;  3CCU I;  2BZT A;  5LRS A;  1T8I A;  3CMY A;  1D1B A;  4OIR F;  1Z9C A;  2NS7 A;  2DOA A;  1O7F A;  3RYR A;  1LE8 B;  1K78 B;  4YEJ A;  4NC8 A;  3D1N I;  2Y9Y A;  2LC2 A;  5E8I A;  5K5Q A;  4F7Z A;  3SDG A;  2ZJP F;  2XHK A;  5CPR B;  1P7I A;  5E1X A;  3DLA A;  3AKZ A;  2JA7 J;  4IQJ A;  4XBF A;  3QOD A;  4RM2 A;  3SZG A;  2K4J A;  2ZJQ F;  4A3D J;  1UB9 A;  2ZME A;  5FKM A;  2VXD A;  1ZGW A;  2CW7 A;  4CH7 A;  2JTV A;  2O9L A;  4XON A;  4R1H A;  3H36 A;  4AC0 A;  1Y56 A;  3LAP A;  1LFB A;  4P5O A;  4FAS D;  3FXQ A;  2UUZ A;  3WHC A;  2E35 A;  1I50 J;  3SYT A;  3BP8 A;  4IRH A;  1OYY A;  1JTY A;  2XAU A;  3TW6 A;  4PSW A;  2LFB A;  1JJ6 C;  2GIV A;  1X19 A;  5HNF A;  3WE2 A;  2LKS A;  3R61 A;  1LVA A;  1YHQ I;  2LLK A;  2IAI A;  3EUH C;  3GFM A;  1HA8 A;  2ISY A;  4BY1 J;  2DPD A;  3BTL A;  3EDP A;  1GV2 A;  1B4A A;  2VLA A;  3BC8 A;  3J80 Z;  3L1P A;  2K9M A;  4P1W A;  1YJ9 I;  2JUG A;  3ZMT A;  2EFW A;  1OCR H;  2UWM A;  2X6Y A;  2AXL A;  2M0C A;  3SFI A;  2XV4 S;  5GAE J;  2HYG D;  2DA1 A;  1DPU A;  4NB5 A;  2A61 A;  2KRF A;  3FZV A;  4HOB A;  1MBH A;  2IXS A;  2FMY A;  4E70 A;  1WRJ A;  3OYJ A;  1KQ8 A;  4CYC A;  3CMA I;  1O4X A;  3BR6 A;  3GLL A;  4MEY F;  4XLH A;  2PEX A;  4CSW A;  4EM2 A;  4M9Z A;  3J81 K;  2EFN A;  4EM0 B;  1ZR2 A;  2CWE A;  3S1M J;  2ZFU A;  4KIT B;  5M5Y J;  4A3F J;  1N77 A;  2Y9Z A;  4A5M A;  5LGN A;  2JA5 J;  3IH2 A;  2NVU B;  1VQL I;  3RKW A;  4KUM A;  2HS5 A;  1Z6T A;  1V54 H;  1FC3 A;  1R22 A;  2X85 A;  1G3Y A;  5DUK A;  5DM7 F;  4HLY A;  3OYB A;  3S1N J;  1BC7 C;  3S16 J;  3S2W A;  5F0C A;  2E2J J;  2VKH A;  4UUS B;  3BG3 A;  1BC8 C;  4GO1 A;  5E8G A;  5HS7 A;  2OF7 A;  2V4J C;  2KIM A;  4HG2 A;  3FBI B;  5FD5 A;  3IAM 2;  4HQM A;  3GX4 X;  4HSR A;  4L5I A;  3CD6 I;  1Q1H A;  2IT0 A;  3CCY A;  3MMY B;  4BYY A;  1U5T B;  1Y0N A;  2K27 A;  4WX9 A;  2L7Z A;  1B72 B;  2Z33 A;  1JKR C;  4L9T A;  2CQQ A;  4B48 A;  1DGW Y;  3O8H A;  3OSF A;  3TW7 A;  3E6C C;  4BL0 B;  4IO9 F;  2OAZ A;  1LEA A;  3M8E A;  2EQR A;  1S29 A;  3F8F A;  2EZH A;  2O5R A;  2CO5 A;  2WV1 A;  2JZY A;  2A69 F;  3BY6 A;  1YI2 I;  2XKO A;  4RAZ A;  3OYC A;  1Y1V J;  3ONQ A;  2CSO A;  5D4R A;  5DCM A;  2EFO A;  1I3Q J;  1S9H A;  2IVM A;  3QPS A;  1QO0 D;  2X6O A;  4G7O F;  1MD0 A;  1P2F A;  3FKI J;  3RQ4 A;  4QLC U;  3WTS C;  1TNS A;  2E71 A;  3U1D A;  5LFA A;  1BA5 A;  3M07 A;  3SQN A;  2VPR A;  1U0J A;  1ORK A;  4PFP A;  3VFZ A;  4KNY A;  1D1C A;  3CF5 F;  1UG2 A;  2DFH A;  5E1W A;  1JKP C;  4PUS A;  1FBQ A;  1FOY A;  2DT5 A;  2H6B A;  2WY7 Q;  4U0V A;  2EPF A;  2R7W A;  2Y2Z A;  2OUM A;  2Y75 A;  4MLO A;  1RRJ A;  2XAG A;  2TDX A;  1H88 C;  2KRC A;  2BY0 A;  1OCT C;  2VQH A;  5E1Z B;  2Y0S N;  5ILU A;  1R5I D;  5KAI C;  1G3S A;  1OPC A;  3GVA A;  2HTJ A;  2KJC A;  3CO7 C;  3IP4 B;  2ZME B;  3DFG A;  2YS9 A;  4ZDP A;  1DP3 A;  1A6I A;  1D8J A;  3ROU A;  2CQX A;  2CYY A;  3BZC A;  3D5L A;  2ZNY A;  2CUZ A;  1XPX A;  2L9R A;  3QWL A;  4KMU X;  3ZCO A;  5E18 F;  2FUG 2;  4UUV A;  3L09 A;  5BS6 A;  2MYS A;  1Y1W J;  4FQG A;  3LQQ A;  1NG6 A;  2B63 J;  1OIS A;  2OV7 A;  3HOZ J;  3M9A A;  2JA8 J;  2YX7 A;  3H5A A;  4N4O B;  3RCO A;  2RC4 A;  4K2E A;  4IZZ A;  1MMA A;  2D1V A;  3BWG A;  2J5P A;  5HLH A;  4CCJ A;  2MH2 A;  2FA5 A;  5KVR A;  5J3L A;  1G2H A;  3M8F A;  3KET A;  2F5C A;  3B02 A;  2E60 A;  2X4H A;  3OYK A;  3FHN A;  4BS9 A;  2IW5 A;  1HKQ A;  2EV6 A;  2WBM A;  1V5G A;  4S04 A;  2EIL H;  2JA2 A;  4HF1 A;  5M5X J;  1WZ2 A;  3RDI A;  2Y31 A;  2LG4 A;  3TQN A;  2JRT A;  5ICE A;  1NK2 P;  2OCC H;  5KAF C;  3EYY A;  3DKY A;  5DCM B;  2VQC A;  3I5U A;  5J6X A;  2QF7 A;  5J1R A;  4A3C J;  4A93 J;  4HQE A;  3JRH A;  4B3A A;  1W7P A;  2GOM A;  2A05 A;  3H0D A;  1ZG1 A;  5L3D A;  2LMD A;  5J40 A;  3KCC A;  4XOR A;  4QTR A;  5ILS A;  3UNG C;  3GZ5 A;  1ZH5 A;  4BH9 A;  2L01 A;  4QIW N;  1IAW A;  2XRO A;  1N75 A;  3CJN A;  1HST A;  3E5X A;  4I7H A;  1Z21 A;  1RES A;  2CUJ A;  1E2X A;  4RAF A;  5DDG A;  4EGZ A;  1UHW A;  3KZY A;  1BR4 A;  1FWZ A;  4PDK A;  1K61 A;  2KRH A;  3RPU D;  2M9H A;  4RB2 C;  5KHD A;  3WG9 A;  3HXL A;  4EJT A;  1HKS A;  4OMZ A;  1P7J A;  1Y0U A;  3LSM A;  3W3C A;  1TLH B;  3Q9V A;  4C3J J;  4BXX J;  2OQR A;  4P9U A;  4M3B A;  5C4X J;  2MC3 A;  2CV2 A;  1TT5 B;  2IJL A;  2F4I A;  2DPU A;  1XTA A;  2FX0 A;  2QYO A;  4JK1 X;  5ED4 A;  2STT A;  1R00 A;  2BHY A;  1RPW A;  2NNY A;  4CZC A;  3REO A;  3WG7 H;  3V7R A;  1NTC A;  3ULQ B;  5E20 A;  3ECH A;  1JXS A;  3LAJ A;  3FXR A;  2M34 A;  3K9T A;  4M72 A;  3BQY A;  4MFE A;  5B1A H;  4IQ4 A;  2DXI A;  2P4W A;  2W24 A;  4KIB A;  4HPQ A;  2ECC A;  3PNT A;  1X1C A;  4E7K A;  3KP5 A;  1GT0 C;  1MND A;  3CCQ I;  3TBI A;  3OL4 A;  1IUF A;  1V5E A;  3FXO A;  3LSG A;  3VYS B;  5FB2 A;  1CGP A;  5EZG A;  1TWA J;  4KN7 X;  4O6J A;  2FU4 A;  5IP7 J;  2E5N A;  5LHI A;  1R23 A;  2M8G X;  2DO7 A;  4ZYH A;  2BY2 A;  3VSK A;  3FIS A;  4B4C A;  2QBY B;  1WWX A;  1H89 C;  4A3J J;  3DBR B;  3COA C;  4C3I J;  3ZQC A;  4PGH A;  4DQ2 A;  4GCV A;  2KFD A;  4IF4 A;  3N97 A;  2R7F A;  1DQU A;  3GFI A;  3GBG A;  5IP6 A;  3F9K A;  3HGY A;  4Z2Y A;  1RUO A;  5JLX A;  1ETX A;  2LBF B;  2LNB A;  3F6V A;  3HZJ A;  4I98 B;  1O3T A;  4KJZ A;  2IS1 A;  2HQ5 A;  3K4N A;  4GGG A;  2VE8 A;  2A6E F;  2RQP A;  3IWF A;  1ERD A;  4NC6 A;  2A6H F;  2VJI A;  2IGN A;  3S14 J;  2M3A A;  2OJE D;  2W84 A;  1MJB A;  3QOE A;  1MBG A;  4RA2 A;  4LGW A;  1SVL A;  4ZYA A;  1X4O A;  3H9J A;  4ENN A;  5DUI A;  1BI3 A;  3ELK A;  3EET A;  2ZB9 A;  2KLO A;  1YJN I;  3ZQF A;  5EZH A;  2QA4 I;  1R1T A;  3F21 A;  4B43 A;  2L9S A;  3QQA A;  1WJ5 A;  5CQG A;  3OOP A;  1TW2 A;  1IRF A;  2VQL A;  2EJR A;  2R5Z A;  2LKP A;  3DPU A;  1Z05 A;  5GTI C;  2GLO A;  3BR0 A;  2KPM A;  1TP4 A;  2QWW A;  2QQA A;  1XG1 A;  1IRX A;  3C7J A;  3CDL A;  3LA7 A;  2NVQ J;  5CQE A;  3S2H J;  1QPI A;  1QBJ A;  2Q2E A;  1IZ1 A;  1RR8 C;  2LH9 A;  2HVS A;  3H3Z A;  1WCM J;  1JHH A;  3ZMU A;  2M30 A;  3CUQ A;  5L3F A;  3I59 A;  1LFP A;  4YEL A;  4IOA F;  4AIJ A;  4NQW B;  2AS5 F;  2XKP A;  4A3G J;  2W25 A;  1BIB A;  1FJL A;  3HOS A;  4HX8 A;  4A0Y A;  1T0F C;  1XSX A;  4QPO A;  1GLN A;  2BW3 B;  2K7L A;  3K2A A;  3DBH B;  5F27 A;  2Z1D A;  2FRH A;  3O6B B;  4F55 A;  2HDD A;  2CW0 F;  4BY7 J;  4L9V A;  3OYA A;  3OR1 C;  2AXT C;  2LY2 A;  1F9N A;  2DAO A;  2XAH A;  4Y52 J;  2QEN A;  2XF6 A;  4BXF A;  1YIT I;  3EUH A;  3X2Q H;  2V79 A;  4BE0 A;  3T0Y A;  1V4R A;  1T0F A;  2ICW G;  1X2N A;  3PUB A;  2IA2 A;  1T08 B;  4LD5 A;  3OYE A;  2V1D A;  2XF5 A;  2CU7 A;  1GV5 A;  1I3A A;  3OIQ A;  9ANT A;  4D9J A;  2LR8 A;  3PFI A;  2M2E A;  1R71 A;  1TL8 A;  4JQF A;  5C3E J;  1TQM A;  4HZF A;  4U88 A;  2H1K A;  4LK0 F;  2Q8K A;  5FLV A;  4YRV A;  3L2C A;  1UZC A;  4RGU A;  2R7D A;  2RV8 A;  2XPV A;  3C18 A;  4ZTJ A;  2HEO A;  2CQK A;  1J59 A;  1X1P A;  2MA3 A;  3FXL A;  2OU2 A;  1PUF A;  2XPU A;  1XGO A;  3ZOB A;  1JUM A;  4XNF A;  3OS2 A;  5J4Y A;  3IV5 A;  2G7U A;  4BEH B;  1BR2 A;  1QGP A;  2VOO A;  5TIS C;  4ESF A;  2UXX A;  3E6B A;  4CUG A;  2JPB A;  1LQ1 A;  3KLN A;  1FX7 A;  4XKC A;  2NOJ B;  1HSJ A;  1WKM A;  2XRN A;  1SD4 A;  1RET A;  4CO8 A;  3CES A;  5CVR A;  1DU0 A;  3K4J A;  1P4W A;  3ML6 A;  4I2O A;  1PUF B;  2O03 A;  5B66 C;  3PQJ A;  4IL6 C;  4M3D A;  5IYC J;  3BJA A;  2ELJ A;  4Z6Y A;  4IHX A;  4AD9 A;  3HEF A;  4RBO A;  3JRB A;  2A07 F;  2PMZ N;  2IS6 A;  2J5O A;  4XLN F;  1QVT A;  2Y30 A;  2G9W A;  3CCM I;  3H3U A;  3TP0 A;  1LEB A;  2VJ4 A;  2P6T A;  4Y3O A;  4F52 A;  1IN6 A;  3H5R A;  4UHT A;  2DJN A;  3KE2 A;  2JN6 A;  2EB7 A;  2PMZ A;  4CCL A;  3KP3 A;  1AWC A;  2HFH A;  2KIU A;  3HBL A;  2DN0 A;  2VIX A;  3F8M A;  1X3W B;  3BPX A;  3TO7 A;  5IOZ A;  1Z1D A;  2LVS A;  3B6C A;  1V5F A;  3F0C A;  2WAQ A;  5L3C A;  2COB A;  5E3O A;  4IHS A;  2P5L C;  2KKO A;  2VBX A;  2NOG A;  1JKQ C;  1GDT A;  2ID3 A;  1D3Y A;  1KYW A;  4MGR A;  2GZW A;  2F4M B;  3WU2 C;  4KT6 A;  3DF8 A;  4BGD A;  3WGI A;  3OSG A;  4OIO F;  2WB1 A;  4A3K J;  2ESN A;  5EJC A;  4WWC A;  2K86 A;  1T38 A;  3GXO A;  4BQQ A;  1J2X A;  1MNE A;  2FEZ A;  5K5O A;  4EQQ A;  2DU9 A;  3OYN A;  2ELK A;  3B73 A;  2DMP A;  2ME6 A;  1ON1 A;  4M74 A;  3BR2 A;  4HV5 A;  2WY8 Q;  2VN2 A;  3NRV A;  4MIM A;  5EG0 B;  1JKO C;  3GZ6 A;  3L2W A;  1P6R A;  3MKY B;  5IOY A;  3M8J A;  3DP7 A;  3QAH A;  3H9Q A;  3JR9 A;  1ZGJ A;  2R93 J;  3S8P A;  4A3E J;  2VAS A;  3HUG A;  2M8E A;  5F6F A;  2JRM A;  4HV6 A;  2OQG A;  4A3L J;  2XAQ A;  4HW0 A;  1SMY F;  1H9T A;  2IA1 A;  4Y33 A;  1RKT A;  1OCP A;  3VSL A;  1PUE E;  3F3X A;  3MWM A;  2DYS H;  2L7M P;  3J7A O;  2CRG A;  1D8K A;  2P6S A;  4Y15 A;  4RLQ A;  4WCG A;  4ZYD A;  1FP1 D;  4AIK A;  3SZP A;  4KIS A;  4WXD A;  2VPL A;  1B6A A;  3OYD A;  1T56 A;  4CCK A;  2BVL A;  2NS8 A;  4BUP A;  3V7S A;  3ABM H;  5GPC A;  4OAY A;  3LSR A;  1QU3 A;  1EH6 A;  2X6W A;  2FJ1 A;  1JUP A;  1FMV A;  4XK4 A;  2VE9 A;  5CVJ A;  3T8R A;  1I27 A;  2KDO A;  4RB3 C;  2FNP A;  4HBL A;  2DMQ A;  4CXF A;  3W2V A;  2PG4 A;  2VBY A;  1R5G A;  4TV7 A;  2GQQ A;  4HNU A;  4ZJZ A;  2DFI A;  3S93 A;  2VOD A;  4LG0 A;  2BE5 F;  2V6E A;  1A04 A;  1SAN A;  4UB8 C;  5KNL A;  1U8B A;  1BI0 A;  5D5X B;  2EWN A;  1HW5 A;  2GXB A;  1WSU A;  2IGK A;  1MMD A;  4LIU A;  4E7L A;  3SXY A;  2W57 A;  6PAX A;  1RI7 A;  3VB2 A;  4UUT A;  4MTE A;  2FBH A;  3C2G A;  4MFD A;  3HYI A;  3OS0 A;  1X2M A;  3L9F A;  5HS8 A;  3IUO A;  4C2T A;  5JHF A;  5HOO A;  1K4T A;  5F0F A;  1EA3 A;  3ERM A;  4HNV A;  4IPA A;  4RB0 A;  4CCM A;  2NYX A;  3KPH A;  4ZH4 F;  3PO3 J;  4BBS J;  2JWT A;  1WPK A;  4NQW A;  3IRQ A;  2E7X A;  2XDV A;  4FIS A;  1B1B A;  1OLT A;  5F1J A;  3PJR A;  3G1L A;  1SMT A;  4ZTF A;  1KU9 A;  2ZKZ A;  2WAF A;  2KIQ A;  4DZJ A;  3BRO A;  5HLI A;  1G6N A;  3RI4 A;  1ACI A;  3S1R J;  4ZC3 A;  4NNJ A;  4R8H A;  1FEX A;  4A6D A;  1I6X A;  1U6G A;  3I3L A;  1ONV A;  4B47 A;  2QZ8 A;  3CDH A;  2V9P A;  2KIS A;  5DYM A;  3Q5F A;  2GBY A;  3JSP A;  2Z3Y A;  3WU1 B;  4HYE A;  1R7J A;  2BYV E;  2MW8 A;  3FBN B;  1S6L A;  3FK7 A;  4UV8 A;  3MQ0 A;  4B44 A;  5D5W B;  2L4A A;  2E2I J;  3V7C A;  3HG9 A;  1MGT A;  3RIR A;  3IRR A;  3CP8 A;  3OMY A;  4V2F A;  1J7K A;  2CW8 A;  1FYL A;  4G6D A;  1ETY A;  4UVC A;  2OD5 A;  3ZQQ A;  1ZRD A;  2CFX A;  4U0W A;  4BDZ A;  3NWT A;  1VQ4 I;  5IT9 K;  3GEZ A;  4E7S A;  3HOW J;  1MZB A;  5DV5 A;  2DOF A;  4KMF A;  4AID A;  1K6O A;  4A2U A;  4A6E A;  2NVX J;  2ESH A;  1BR1 A;  1T2K A;  4W97 A;  3ASN H;  3QYE A;  5DTD A;  1FBS A;  4M9X A;  2HDC A;  4D0P A;  1Z0X A;  2K9S A;  3DPL C;  2F48 A;  5AIQ A;  3V8K A;  2DDA A;  2M7A A;  3HSR A;  3PM1 A;  3S15 J;  4NUB A;  1OKR A;  1LDJ A;  2M87 A;  2CV1 A;  2DTR A;  4ESB A;  2R7T A;  4U7D A;  1HCR A;  3TMO A;  2IGO A;  1KZH A;  2NVT J;  3GTQ J;  2V6C A;  3FMS A;  4CYD A;  3FXK A;  1LNW A;  2HQR A;  3RSN A;  5JFR A;  1R1U A;  1UCR A;  3PQK A;  5B3S H;  1HLV A;  4KDP A;  1HDP A;  4NC7 A;  1PDN C;  2IGM A;  1L0O C;  4FE7 A;  1KU3 A;  2AO9 A;  1S72 I;  3I59 B;  1XCV A;  2YUS A;  4GDF A;  3JTH A;  2RDP A;  4WXH A;  3DTK A;  5F1R A;  4IVN A;  3ABU A;  2DW4 A;  3IWZ A;  3HKZ N;  2GXA A;  1R36 A;  3BQZ A;  1YJW I;  1UAA A;  4GFB A;  2EZK A;  4XRS A;  2L3D A;  4GYG A;  2JVH A;  3QPL A;  4XLC A;  2W7N A;  2R7R A;  1W7P B;  2AHQ A;  2XAF A;  2LP0 A;  5CKT A;  5HS9 A;  1AKH A;  4IRG A;  2LF8 A;  2H27 A;  2EA2 A;  3BCB A;  1OCZ H;  2TCT A;  2YSR A;  1VQ6 I;  1ZG3 A;  3R60 A;  1K78 A;  3W2W A;  1D0Y A;  1WQ2 A;  2KP6 A;  4ZYE A;  1SFU A;  1PJR A;  1W0U A;  2FSW A;  1VQO I;  4Y7N J;  1D5V A;  4QSH A;  4G12 A;  3U21 A;  4JX5 A;  1Z91 A;  2O7O A;  5ICG A;  2JJ7 A;  2V7F A;  4II3 A;  1K79 A;  1SFX A;  2FBI A;  1APL C;  2MLK A;  2LBF A;  4UVB A;  3FM3 A;  3GME A;  4IX7 A;  2XGE A;  1IG7 A;  4CZZ A;  2G7H A;  1XS9 A;  2HZD A;  4M9S A;  3I4N J;  2OC6 A;  5DS9 A;  3WHB A;  2Z9O A;  2JA6 J;  1WI9 A;  2JPC A;  2LRE A;  1MBK A;  2OZ6 A;  3QOP A;  3FXJ A;  2V9V A;  4E4H A;  3IKV A;  1BW6 A;  1E17 A;  2XGX A;  3H35 A;  3PSF A;  3G4S I;  2OA4 A;  2ECB A;  2CV0 A;  3KP7 A;  2TRT A;  3MZ8 A;  3NWS A;  1VND A;  4C3H J;  1R9T J;  4CHU A;  3I54 A;  2YU3 A;  1GHC A;  3CMM A;  1QHG A;  3WTT C;  3B6A A;  4GRI A;  3ZMZ A;  1R49 A;  2WAD A;  1O57 A;  4JX6 A;  3LL7 A;  4LLN A;  2XUB A;  3FHZ A;  3LSP A;  1C0W A;  3K1N A;  1L3L A;  4IEJ A;  3HDD A;  2ZJ2 A;  1XDU A;  3JRG A;  1JGG A;  1IXS B;  2DMU A;  4RB1 A;  4DYQ A;  4S05 A;  1YIJ I;  4X1E A;  2LD5 A;  1IGN A;  2QQ9 A;  3ASO H;  1JGS A;  2UXN A;  4G94 A;  3ZMV A;  2DA6 A;  1BM9 A;  2HPM A;  4MTD A;  4ANJ A;  2I10 A;  3G1M A;  1AKH B;  1U8R A;  1ZK8 A;  2VKV A;  5DM6 F;  1ZG5 A;  1FYK A;  4DYR A;  2KT0 A;  1ZHF A;  4N4N B;  4DIQ A;  2RAE A;  3OYG A;  4M3F A;  4ENK A;  2DFE A;  3WE3 A;  2E1C A;  2VUM J;  4XSX F;  2EV5 A;  1MDM A;  3G2B A;  3KP2 A;  3UR3 C;  5FFZ A;  5FRO A;  1J0R A;  4XOP A;  5K7H A;  3RKY A;  3CQZ J;  1S7O A;  3Q3S A;  1MBE A;  4OMY A;  3R0A A;  5ERI A;  2VOP A;  2NVY J;  3HHG A;  3BOQ A;  3CZ6 A;  5F04 A;  3MEX A;  2WAQ N;  1B8I A;  2DK5 A;  5EGO A; 
#chains in the Genus database with same CATH homology
 4ABZ A;  1WGX A;  2G0E A;  1IV6 A;  3K2A A;  2XB0 X;  5F27 A;  2KDZ A;  1HDD C;  2IEK A;  1VFC A;  2JMW A;  2DA2 A;  3DCF A;  1AHD P;  2HDD A;  1FIP A;  4BY7 J;  3UKG A;  1S7E A;  1ETO A;  2D5V A;  4Y52 J;  2W48 A;  3Q0U A;  2DA7 A;  2DA4 A;  3ZQH A;  4AUX A;  3JRD A;  2ME0 A;  5J1U A;  5F08 A;  5IPA A;  3HOV J;  1X2N A;  3JRA A;  4DYC A;  5M3M J;  2CU7 A;  1GV5 A;  4JP0 A;  9ANT A;  4M3G A;  3E7L A;  2LR8 A;  2M2E A;  5C3E J;  5C44 J;  2H1K A;  5FLV A;  3K7A J;  5K7F A;  2LKX A;  5E3M A;  1ZKG A;  2XPV A;  2O8K A;  3I4M J;  2XSD C;  2E2H J;  1PUF A;  1JJ8 C;  2XPU A;  2K40 A;  3FIW A;  3ZOB A;  3IH3 A;  1JUM A;  4A3M J;  1WH7 A;  3IV5 A;  1U78 A;  1IDZ A;  2EH3 A;  1ZTR A;  1TC3 C;  1Q1V A;  3BT9 A;  1TWH J;  2LK2 A;  1H8A C;  1CQT A;  3DEW A;  3CMY A;  4W1U A;  3GTL J;  1RET A;  1DU0 A;  2NS7 A;  1PUF B;  5M3F J;  1LE8 B;  4CYC B;  4M3D A;  3D1N I;  2Y9Y A;  5IYC J;  2GM4 A;  1T33 A;  3SDG A;  1POG A;  4IHX A;  1EF4 A;  1MBJ A;  4M3E A;  3HEF A;  2IBD A;  4RBO A;  3JRB A;  2PMZ N;  1P7I A;  3HB9 A;  3RKQ A;  1QVT A;  4M6V A;  2JA7 J;  1JT6 A;  2Y30 A;  5EYR A;  3TP0 A;  1I6H J;  4FTH A;  4A3D J;  5FKM A;  1ZGW A;  2DJN A;  1HOM A;  3W6V A;  2JN6 A;  2O9L A;  2QCO A;  1BW5 A;  3ZQL A;  2E1O A;  5BNG A;  3HBL A;  2DN0 A;  4AC0 A;  2VI6 A;  4IHY A;  1LFB A;  5IOZ A;  2LVS A;  3B6C A;  3F0C A;  5E3O A;  1WI3 A;  3WHC A;  2COB A;  1I50 J;  2NOG A;  1AU7 A;  1JKQ C;  1GDT A;  2ID3 A;  2XPW A;  1JTY A;  3TW6 A;  4DW6 A;  1ITY A;  1ETW A;  3MKL A;  2MG4 A;  3RZO J;  2LFB A;  1JJ6 C;  3OSG A;  2LLK A;  4A3K J;  2IAI A;  2HXI A;  3GTG J;  3LNQ A;  2XGC A;  4BY1 J;  3BTL A;  1GV2 A;  2ELK A;  2DMP A;  2ME6 A;  3L1P A;  3BR2 A;  3O8G A;  4MIM A;  5EG0 B;  2XGD A;  1JKO C;  3BR1 A;  4NDL A;  1B72 A;  2HOA A;  2M0C A;  5IOY A;  3SFI A;  2DA1 A;  4C2M J;  1GUU A;  2EZI A;  3JR9 A;  1MBH A;  2R93 J;  2R7Z J;  4A3E J;  4DZP A;  3LOC A;  3Q0W A;  3JRC A;  4B1R A;  1MBF A;  4JYK A;  4CYC A;  1O4X A;  3BR6 A;  4S0H B;  4D5F A;  2CJJ A;  4A3L J;  5C4J J;  1ZR2 A;  3S1M J;  2K9Q A;  5M5Y J;  1RKT A;  1OCP A;  4A3F J;  1FJL A;  2HYJ A;  2Y9Z A;  2JA5 J;  3IH2 A;  2L7M P;  3A01 A;  2CRG A;  3A03 A;  1IJW C;  1BJZ A;  4BBR J;  3VPR A;  4IHW A;  3S1N J;  2XB5 A;  3BG5 A;  3S16 J;  3BTC A;  1T56 A;  5F0C A;  2NS8 A;  5GPC A;  3LSR A;  2E2J J;  4UUS B;  3BG3 A;  2FJ1 A;  3GTK J;  1JUP A;  1RR7 A;  4XK4 A;  4A3B J;  1D5Y A;  2OF7 A;  1U9N A;  2DMQ A;  1JTX A;  4A3I J;  3CCY A;  4V2G A;  1ETQ A;  2L7Z A;  1B72 B;  2FD5 A;  1JKR C;  2HI3 A;  3BR3 A;  1SAN A;  2CQQ A;  3O8H A;  5FJ8 J;  1U8B A;  3BR5 A;  3OSF A;  3TW7 A;  2CUE A;  2JK3 A;  4D7M A;  2HOS A;  2EQR A;  2EZH A;  4UUT A;  1XC5 A;  2WV1 A;  4MFD A;  3MN2 A;  5FKO A;  1X2M A;  4XID A;  1Y1V J;  1TWF J;  5F0F A;  3HOY J;  3HOX J;  4HNV A;  4D7N A;  4D5C A;  3GTJ J;  5EGO B;  1I3Q J;  3PO3 J;  4BBS J;  3QPS A;  5EF6 A;  1JT0 A;  2JWT A;  1WPK A;  1B8I B;  4FIS A;  5F1J A;  1BL0 A;  3G1L A;  2X6O A;  3FKI J;  4DZJ A;  5GPA A;  1BA5 A;  3S1R J;  1GVD A;  1ZQ3 P;  2VPR A;  5J1Y A;  1ORK A;  1FEX A;  1UG2 A;  4L5E A;  1JKP C;  2DMN A;  2Y2Z A;  4MLO A;  4UUS A;  5M5W J;  1H88 C;  2GBY A;  4X6A J;  2R92 J;  1OCT C;  2Y0S N;  4BKX A;  2MW8 A;  3Q0V A;  1IDY A;  2VKE A;  2YS9 A;  3FK7 A;  1A6I A;  2E2I J;  2CQX A;  1ZR4 A;  1IRZ A;  2L9R A;  1MNM C;  1FTZ A;  3JRF A;  4V2F A;  5FKL A;  1Y1W J;  2OPT A;  2B63 J;  3S17 J;  1ETY A;  3HOZ J;  4J19 A;  2JA8 J;  2FQ4 A;  5EDN A;  3SJM A;  1FTT A;  1OJL A;  1LE8 A;  1JUS A;  3H3V K;  3TP3 A;  5J3L A;  1G2H A;  4RDU A;  3HOW J;  2HXO A;  2DTZ A;  5E3L A;  1HF0 A;  3TED A;  2NVX J;  3HM5 A;  2N8G A;  2LTP A;  4MO7 A;  2L7F P;  4XRM A;  2R5Y B;  4W97 A;  5DTD A;  5M5X J;  1WH5 A;  3GTO J;  2Y31 A;  1Z0X A;  2K9S A;  1ENH A;  3PM1 A;  1QRY A;  3S15 J;  1YRN A;  1NK2 P;  2R0Q C;  1VF9 A;  4FCY A;  4LOC A;  2QF7 A;  1HCR A;  5J1R A;  4A3C J;  5EG0 A;  4A93 J;  4IHV A;  3JRH A;  4B3A A;  2NVT J;  3GTQ J;  1FIA A;  1MH4 A;  3G1O A;  1SFO J;  4QTR A;  1Z77 A;  4QIW N;  2L0K A;  1HLV A;  5IP9 J;  1HDP A;  2DMT A;  4FE7 A;  2AO9 A;  1RES A;  4I76 A;  2YUS A;  2YU9 J;  1K61 A;  5FKK A;  1RKW A;  2M9H A;  2CUF A;  5HOD A;  3BTI A;  2P81 A;  5EEA A;  3M4O J;  5GP9 A;  1P7J A;  1U9O A;  4C3J J;  3HKZ N;  3BQZ A;  1YRN B;  2MGQ A;  4BXX J;  4M3B A;  2EZK A;  4XRS A;  4GFB A;  5C4X J;  3HGG A;  3QPL A;  3OIO A;  2AHQ A;  1AKH A;  1F43 A;  2LP0 A;  4JX4 A;  2DA3 A;  2FX0 A;  3GTP J;  2TCT A;  1RPW A;  5F0H A;  3A01 B;  1ETK A;  2E19 A;  3JRE A;  3NAU A;  1NTC A;  2LY9 A;  1W0U A;  4FE4 A;  4Y7N J;  4XIC A;  2M34 A;  4QSH A;  4G12 A;  5FLM J;  2HOT A;  3BQY A;  4MFE A;  2X48 A;  4JX5 A;  2O7O A;  4AYB N;  2ECC A;  2JJ7 A;  2EZL A;  1GT0 C;  1LFU P;  1APL C;  5K7Z A;  4EEF G;  1IUF A;  1IG7 A;  4A69 C;  3LSG A;  2XGE A;  1TWC J;  5EZG A;  1XS9 A;  1TWA J;  3ZQI A;  3A02 A;  3BTJ A;  5IP7 J;  1NK3 P;  3I4N J;  5DS9 A;  3WHB A;  2JA6 J;  2XRL A;  3MVP A;  2M8G X;  1MBK A;  2DA5 A;  3FIS A;  4B4C A;  1UMQ A;  5FKN A;  3HOU J;  1BW6 A;  2R5Y A;  1H89 C;  4XRS G;  4A3J J;  1F36 A;  3OOU A;  4C3I J;  3ZQC A;  3M3Y J;  2ECB A;  2TRT A;  4C3H J;  1VND A;  1R9T J;  3BG9 A;  3PO2 J;  3GBG A;  5IP6 A;  3B6A A;  3HGY A;  3NAR A;  5JLX A;  1ETX A;  5JLW A;  1E3O C;  1IC8 A;  3JRI A;  4JX6 A;  1QVU A;  1MSF C;  2HQ5 A;  3LSP A;  3S1Q J;  5IYD J;  3S14 J;  4IEJ A;  3FK6 A;  1MBG A;  3HDD A;  3JRG A;  1JGG A;  1K83 J;  2DMU A;  1MH3 A;  1UHS A;  4DYQ A;  3GTM J;  4X1E A;  2ZB9 A;  2LD5 A;  1IGN A;  1W0T A;  3RQI A;  3ZQF A;  5EZH A;  3ZQG A;  2MSY A;  2X9D A;  2DA6 A;  1OFC X;  2H8R A;  3QQA A;  2I10 A;  3G1M A;  1VI0 A;  2EBI A;  1AKH B;  2R5Z B;  1ZK8 A;  2VKV A;  4DYR A;  2KT0 A;  2R5Z A;  3S2D J;  1ETV A;  2RAE A;  4M3F A;  2GLO A;  2VUM J;  1TWG J;  3BR0 A;  3LSJ A;  1XG1 A;  2K9N A;  3CDL A;  2NVQ J;  3S2H J;  1QPI A;  3C2B A;  3RZD J;  3IH4 A;  5K7H A;  3CQZ J;  1WCM J;  1MBE A;  3Q3S A;  5IYB J;  2NVY J;  2WB1 N;  1DU6 A;  3H0G J;  5F04 A;  2WAQ N;  1X58 A;  1B8I A;  4A3G J;  1MSE C;  1A5J A;  2ID6 A;  5EGO A;  4I6Z A;  5E3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...