1ZQ3P

Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
b'GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3'
publication title The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zq3P00
2M2EA 4MO7A 3FK6A 4DW6A 2Y9YA 3BT9A 5F27A 1GT0C 4FCYA 2HXIA 1LFBA 1I50J 1T33A 4UUSA 5C3EJ 4M3EA 4CYCB 2HOAA 1IRZA 3Q0VA 2LR8A 3HOZJ 2R92J 4XK4A 9ANTA 1BJZA 3H0GJ 2DA5A 2E2JJ 4L5EA 2MSYA 3Q0WA 2H8RA 2JMWA 2YU9J 3RZOJ 1G2HA 1CQTA 2L7ZA 4Y52J 5K7ZA 5J1UA 3A01B 4A93J 5E3MA 4FTHA 2TCTA 4HNVA 2G0EA 3IV5A 2DN0A 5IYDJ 2DMUA 5IOYA 1XG1A 1BA5A 3S1MJ 2LY9A 1SANA 2JA5J 1ENHA 1ITYA 1BW6A 1IUFA 4V2FA 1O4XA 1I6HJ 2AO9A 4C2MJ 5C44J 2ECBA 2WAQN 2WV1A 5J3LA 2X48A 1VNDA 2M0CA 3MVPA 3FK7A 3LSJA 1ETXA 2DA6A 3WHCA 2GBYA 3Q3SA 4J19A 5C4XJ 1VFCA 1AKHB 1TWHJ 5C4JJ 2Y9ZA 4XIDA 5F08A 3JRGA 5M3FJ 2FQ4A 5IP9J 2LVSA 1SFOJ 1MBGA 3JRCA 1F43A 2Y31A 1FIAA 2R93J 5F0HA 2P81A 1QVUA 3BG9A 3O8HA 4DYCA 2HOTA 4C3JJ 2RAEA 3QPLA 1IV6A 1WGXA 1RR7A 1LE8A 1XC5A 3F0CA 1H8AC 1MBEA 2B63J 3S1RJ 1JT0A 3FKIJ 2ELKA 1TWCJ 4D5FA 2XSDC 2L7FP 2I10A 5E3NA 4D5CA 1UHSA 1X58A 3NARA 2DMQA 3CMYA 2ID6A 2FD5A 2R5YA 2NVQJ 3ZQHA 2IAIA 1S7EA 2HQ5A 2QCOA 1TWFJ 1HLVA 2MG4A 2IBDA 1TWGJ 2EQRA 5EGOB 3M3YJ 4W97A 1IDZA 1X2MA 2NOGA 4A3JJ 1B72B 5EG0B 3I4MJ 2EZKA 1VI0A 2DA4A 4A3IJ 1ZGWA 1RPWA 3O8GA 5E3LA 4MIMA 1HOMA 1BW5A 2GLOA 3QQAA 1DU0A 3LSGA 3JRHA 1RETA 2HXOA 1POGA 3OSFA 4G12A 3BR3A 2NVTJ 4IHWA 1JT6A 2K40A 2JN6A 4A69C 3GBGA 2DMTA 4IEJA 2ID3A 3GTGJ 3S1QJ 3W6VA 1TWAJ 2ZB9A 2MW8A 3JR9A 1XS9A 1ZR2A 3HGGA 1Q1VA 4LOCA 3SJMA 1QPIA 3I4NJ 1ZK8A 1ZR4A 1LFUP 1HDPA 3GTLJ 5FKOA 2CQXA 1U8BA 1X2NA 3A02A 3UKGA 1P7JA 1ZKGA 2ECCA 1R9TJ 1HF0A 1GV2A 5JLXA 4JX5A 5IPAA 2MGQA 1WI3A 2CRGA 4AUXA 2CQQA 1PUFB 2DA3A 5IYBJ 1A5JA 1ETOA 3BTCA 4XRSA 4IHXA 1U9NA 5FKMA 1OJLA 3HB9A 2L0KA 2LK2A 1Z77A 3FIWA 4FE7A 2O8KA 1F36A 4BY1J 4MLOA 3PO2J 1VF9A 1WCMJ 2FJ1A 4CYCA 1H88C 2LFBA 1FIPA 4C3HJ 2IEKA 2DA2A 3Q0UA 3ZQIA 2HYJA 3VPRA 1HCRA 5M5XJ 1FTTA 4NDLA 4A3BJ 2XGEA 1B8IB 3BR0A 1MBKA 1K83J 4JX4A 2K9NA 1ETWA 2TRTA 3HGYA 4D7NA 1UMQA 3A01A 2CU7A 3HM5A 2H1KA 2CJJA 4A3DJ 1I3QJ 2K9SA 3QPSA 1ZQ3P 1ORKA 3K2AA 5E3OA 2XB0X 3OIOA 2X6OA 5FLVA 1IJWC 1JJ8C 2D5VA 2R7ZJ 1MBJA 2LLKA 3BR6A 2VPRA 2JWTA 3IH2A 1IDYA 1JGGA 3CDLA 5IOZA 3CQZJ 3OSGA 1HDDC 2KT0A 5M5YJ 3JRAA 5FKKA 4S0HB 2FX0A 4B1RA 4FISA 1AKHA 5FLMJ 2EZHA 4UUTA 1P7IA 2LTPA 1Y1VJ 5FKLA 1ETYA 4RBOA 2Y0SN 3FISA 3M4OJ 1FEXA 1Y1WJ 1MBHA 1JKRC 3G1LA 1H89C 5K7FA 4A3MJ 5EDNA 4AC0A 1JKQC 2DMNA 3ZQGA 1IGNA 5EEAA 4M3BA 4M6VA 3ZQLA 5F1JA 3MKLA 1WPKA 2KDZA 5GPCA 5J1RA 3OOUA 5EF6A 2LD5A 1BL0A 1NTCA 4A3GJ 3IH4A 3LSPA 4IHVA 5EGOA 5HODA 4M3FA 4A3FJ 1JTYA 3BR5A 3PM1A 5DS9A 3B6AA 1B72A 5EG0A 2ME0A 1ETQA 2CUFA 2HDDA 3GTQJ 3HKZN 3G1OA 3WHBA 1RKTA 2XPUA 3JREA 2VUMJ 1TC3C 5F0FA 3G1MA 2JA8J 5K7HA 4M3GA 2PMZN 1YRNB 2DMPA 2E2IJ 3HEFA 3BG5A 4BY7J 1MBFA 5M3MJ 5J1YA 2O7OA 3S14J 2WB1N 5BNGA 4ABZA 1WH7A 4MFDA 1JJ6C 2R5ZB 1JUMA 4A3LJ 2COBA 1GUUA 1QRYA 2YUSA 2W48A 5FJ8J 3HOXJ 3S17J 3GTKJ 1FTZA 5EZHA 2ME6A 3TP3A 3H3VK 1T56A 1Z0XA 2AHQA 3S16J 3BR1A 2LP0A 4JYKA 2JA6J 1AHDP 5M5WJ 2JA7J 1RKWA 3NAUA 2K9QA 3PO3J 4UUSB 1E3OC 3L1PA 4V2GA 1W0TA 2M34A 2OF7A 1PUFA 2EBIA 2CUEA 3K7AJ 3ZOBA 1U9OA 2NS7A 3A03A 4I76A 4DZPA 4RDUA 2OPTA 1ETVA 2M9HA 3TW6A 2NS8A 3LNQA 3JRFA 4BBRJ 2N8GA 2HI3A 2NVYJ 3BG3A 1OFCX 3BQZA 5DTDA 5GPAA 3DEWA 2DA7A 4Y7NJ 2VKEA 5EYRA 1GV5A 1B8IA 2VI6A 3IH3A 3LOCA 4BKXA 3HDDA 5JLWA 2E1OA 3GTPJ 3JRBA 3RKQA 1MH3A 3SDGA 1W0UA 4EEFG 3S15J 1MSEC 2XB5A 2XPVA 4W1UA 3S2DJ 1JTXA 3RQIA 5GP9A 2EZLA 2L9RA 4X1EA 1EF4A 3HBLA 1IG7A 1GVDA 2M8GX 2X9DA 1RESA 4XICA 1D5YA 2GM4A 4X6AJ 2JJ7A 2Y30A 3DCFA 2YS9A 4JX6A 1NK3P 2HOSA 1ZTRA 1JKPC 4BBSJ 1LE8B 5EZGA 2XPWA 4MFEA 5IP6A 3TEDA 1MNMC 3GTOJ 3BTJA 3S1NJ 3TW7A 4FE4A 4B4CA 3CCYA 4A3EJ 2R5YB 1MH4A 2JK3A 1QVTA 1A6IA 3RZDJ 4A3CJ 1K61A 3GTMJ 1OCPA 2LKXA 2DTZA 4I6ZA 3B6CA 3LSRA 4DZJA 4AYBN 1JUPA 2R0QC 3HOUJ 4XRSG 2O9LA 4C3IJ 3E7LA 3JRIA 3HOWJ 2VKVA 1FJLA 3TP0A 4IHYA 4JP0A 1ETKA 4BXXJ 3ZQCA 4M3DA 2EH3A 1AU7A 2L7MP 3BTLA 1WH5A 3HOVJ 2XGDA 4DYRA 2QF7A 5FKNA 4DYQA 4D7MA 3ZQFA 1GDTA 2DJNA 1IC8A 4A3KJ 2DA1A 2E19A 1APLC 3BR2A 2E2HJ 3D1NI 2XRLA 4GFBA 1JUSA 4QIWN 3HOYJ 2NVXJ 1YRNA 4QTRA 3MN2A 4QSHA 5IP7J 1OCTC 1UG2A 1U78A 3GTJJ 4XRMA 1JKOC 5IYCJ 1MSFC 3BQYA 2R5ZA 3BTIA 1DU6A 2XGCA 3C2BA 2EZIA 3JRDA 3SFIA 4B3AA 3S2HJ 5F0CA 5F04A 2Y2ZA 1NK2P
chains in the Genus database with same CATH superfamily
3FMSA 2WAFA 4L9JA 2B7EA 3BWGA 3BT9A 2E1NA 3TL4X 4A0YA 1EA3A 1I50J 3C18A 3G2BA 5ILSA 3I56I 3HRMA 2WAQA 3HUGA 3LSTA 3Q0VA 1GVJA 1K4TA 3NEUA 2P7VB 2R92J 4AIHA 4ESBA 4ZYHA 1OR7A 1BJZA 1E2XA 2V1NA 2IS1A 5DEQA 4CHUA 2DA5A 2L4AA 2E2JJ 2H8RA 3HTUA 1HKQA 1CQTA 1MDMA 3OR1C 2L7ZA 4FASD 3CCQI 4Y52J 3LA3A 2FXAA 1KONA 3L2UA 4ZJZA 2GWRA 4FTHA 3FHNA 4HNVA 2ZSHB 2XUBA 1XG1A 4RB0A 3KIOA 4NNJA 1MMSA 2JA5J 1BR2A 2XF5A 3GFIA 1ENHA 1ITYA 2HVRA 1BW6A 4ZYGA 1R00A 4V2FA 1YFHA 2G7UA 4NC8A 1VQ9I 3ONQA 2Z99A 5JVGF 1T95A 3CTAA 4DBQA 5J3LA 3T5XA 1VNDA 1MJBA 4JQFA 1HQCA 1PJRA 4NBQA 1ETXA 2DA6A 4BHBA 4YFNF 2GBYA 3GVAA 3Q3SA 4XLHA 4CCMA 4J19A 4HF2A 3BLYA 4OOIA 5F64A 2PG4A 4CZZA 2FQ4A 5IP9J 2PLYA 1X1PA 3E5UA 1X1BA 1X1CA 3WGGA 2IGMA 3AKZA 2IA0A 3BG9A 3J7ZI 1RNLA 3CCVI 1VQ7I 3I64A 3I3LA 2VN2A 1A35A 1LE8A 1R5ID 2GQQA 5D6FA 2VBZA 4HAMA 2R7WA 1YO5C 2ZXWH 2XSDC 1OCOH 5E3NA 1QPMA 3NARA 5JFRA 2LYCA 2FD5A 1FY7A 1WHUA 4IKFA 1WRJA 2JRMA 1HLVA 3CDHA 3PQKA 2JA2A 3OYDA 4MEYF 4I99C 1S8NA 4PSWA 1IDZA 3E1SA 4B3XA 1BC8C 2M4KA 2A3SA 1T08B 4PZJA 5D4RA 4KNYA 3KZIC 4B48A 1LDKB 1RPWA 5GAHJ 4MIMA 1MNDA 3BG7A 1KU7A 3REOA 1LVAA 1BW5A 1LKXA 2W82A 3LSGA 3JRHA 1USSA 2NNYA 5J6XA 3OSFA 2XIGA 2DU9A 2CO5A 3PIOF 2VL8A 2XKOA 1YQAA 4A69C 3SDBA 1ODDA 2ID3A 4BEHA 3GTGJ 3S1QJ 1YOVB 1MKMA 3FXKA 5DV5A 4KICA 1Z3XA 4GCVA 4HQMA 3DEUA 3HGGA 2XF7A 4UHTA 1U2WA 4XSZF 2PN6A 4LOCA 4OIQF 2VOOA 1Q1HA 3GTLJ 5TGTA 3PNYA 1LPQA 1U8BA 2Z9OA 1G3WA 3A02A 3E6DA 5EEGA 1XCBA 2ECCA 4KT5C 3NWTA 4P96A 4ZH4F 4CUGA 1U5TC 2CRGA 1SVMA 1D0XA 3L00A 2DPUA 4AUXA 3IP4B 3E5QA 1PUFB 1A5JA 3BTCA 3DEEA 2WWYA 1U9NA 4RAGA 3HB9A 4AD9A 4KIGA 1WJCA 4HPQA 3WTYC 5ICEA 1Z77A 3BG6A 4PJJA 4EJWA 1S72I 2O8KA 4IRIA 1P9QC 4XLEA 4G7OF 5HS7A 1D8JA 1LEAA 2FJ1A 2K9LA 2FBKA 5HS9A 3MCZA 2MLKA 1FIPA 3CUQC 3CMAI 4C3HJ 2IEKA 3ZQIA 1Z1DA 2HYJA 2WC2A 3CLOA 1RRJA 3LA7A 3OIPA 3CMMA 1FTTA 3ECOA 3CCJI 2QVOA 2VQCA 2MC3A 1DGWY 1K83J 1R5HA 3G6EI 4IQJA 1MMDA 2K9NA 1W36C 4UY8I 1ETWA 4D7NA 1Y0NA 1UMQA 2CH0A 2CU7A 2BVMA 4OIPF 1VTNC 3KETA 5LFAA 5A2QK 5LGTA 1T98A 2BVLA 4FETA 2VE9A 1IN8A 2XRNA 2F4MB 3K2AA 2MA3A 2XB0X 1KYZA 1IJWC 3HJEA 2D5VA 2LLKA 1YYVA 3CJRB 2DI3A 5LGNA 3IH2A 4HSRA 2K86A 3CQZJ 3OSGA 4KT6A 4F3QA 2KT0A 1ZG3A 3GF2A 2XASA 3DU5A 4S0HB 1I3AA 2FX0A 2JTVA 1VQMI 2AQFA 2H8WA 5B1BH 3A4CA 1DP3A 1QHHD 2NNNA 1EH8A 3IUOA 2CGPA 5FKLA 4HRIA 1Z6RA 4PUSA 3HRSA 2EWNA 2MH2A 1H89C 5EDNA 1JKQC 1Z21A 2DMNA 4N4NB 3ZR8X 3CESA 2PMZA 2L9VA 3J80Z 1K6OA 4E70A 2M3AA 5F1JA 1XPXA 1YIOA 1WPKA 1I27A 3ABKH 5J1RA 1YJWI 1W5TA 1J75A 4ZTFA 1W5CC 1K78B 4CCOA 3TGNA 1WVRA 1HW5A 2X0LA 2XV4S 2O8XA 2Z3YA 5DS9A 1C0WA 1CGPA 3F72A 4U88A 1E3HA 1XD7A 2CUFA 2EA2A 2HDDA 3TOBA 3KLNA 3FKJA 2K27A 1B4AA 1HA8A 1U6GA 3O3KA 2RNGA 2W57A 3LA2A 3QAHA 2JT1A 5IY5H 2PMHA 3OY9A 4N4OB 2D45A 3V8JA 3G1MA 2V1XA 3LFKA 4M3GA 1YRNB 2P8TA 2E2IJ 2FQ3A 3HEFA 3M07A 3BG5A 5D8LB 1UZCA 4C2UA 5D6EA 1FSEA 4XOTA 3FDYA 5LHHA 2P6TA 1O7LA 3EUHA 1R7JA 2XF6A 3KP5A 3QOPA 2X6YA 1DP7P 2ZXIA 4MTEA 4J01A 4CA0A 3IWZA 1UELB 1ZH5A 1P4XA 4C2TA 1D0YA 5L3GA 1QRYA 2YUSA 3GW2A 5FJ8J 3J7YJ 2DT7B 4IJAA 3H9JA 3CP8A 1Z05A 4UV8A 1XGSA 1DPUA 1FBQA 1SFKA 5ERIA 1RKWA 3NAUA 3ZQQA 2WV0A 4BYYA 3FX3A 3A1YA 5LEKA 3SZTA 2P0WA 1UAAA 2I8DA 1FOYA 3BPVA 3VB2A 2X1EA 3CCSI 1PUFA 2A07F 1ZAOA 3K7AJ 2ZNYA 4A5NA 4IHTA 3ZOBA 3Q9SA 2NS7A 1S6LA 1WQ2A 4I76A 4GDFA 2JZYA 3KP4A 2OPTA 4KN7X 2ZMEB 1YG2A 5CPRB 2F2EA 2VB6A 2N8GA 3IC7A 3QP6A 2OTLI 1YTYA 1RC9A 2MYSA 2R7SA 1T0FA 5TISC 4AIJA 3I55I 1XSVA 3BQZA 5DTDA 2DA7A 3V8LA 4E7LA 3N4MA 3G3ZA 3SXYA 3MWMA 4BKXA 2CFOA 3PIPF 1SMYF 1KA8A 2W24A 1P6RA 2KLOA 3S15J 2XB5A 2FMLA 3RQIA 2P6SA 3BOQA 1MNEA 1N78A 4XKWA 4OIOF 3ABMH 2FOWA 4RGRA 3BJ6A 2BY3A 1GVDA 4XONA 3E97A 4NQWB 1IN5A 3RKXA 3RDIA 4IF4A 3EPZA 1FMVA 1D8KA 3RIRA 2O03A 3CCUI 3DPTA 3F9KA 2LY1A 1B9MA 2DDAA 4NC6A 1JKPC 3PUFA 2GAUA 2XC7A 5HLIA 1W7PB 3R6SA 4FE4A 5FLXK 1BI1A 4B4CA 4KMFA 1PP8F 1UB9A 4LG3A 1MH4A 2Q1ZB 2JK3A 2CUJA 3F8MA 1A6IA 2FU4A 3RZDJ 3FXJA 3WU2C 2DTZA 3P7NA 5JHUA 4P9UA 5L3BA 3LSRA 4DZJA 1MZBA 2F48A 3V7CA 1JUPA 2R0QC 4DNCA 1L0OC 4KISA 2O9LA 4MQ9F 2PX9A 4KDPA 3JRIA 4L5IA 3CJQB 4RLFA 3EYYA 4D9JA 2R7RA 2XROA 4IHYA 4JP0A 3IL2A 2E1CA 1Z7LA 4M74A 1K78A 2EH3A 2L7MP 2YX4A 1IN7A 2XGDA 3GFMA 1ULYA 4DYRA 3HOVJ 3S3MA 1ZLKA 4D7MA 3ZQFA 4EQQA 4B8XA 2I5UA 4ZDLA 4ZYDA 4A3KJ 3FXQA 2A69F 2GIVA 3BR2A 3L2VA 4PDKA 3EYIA 3CZ6A 1QZYA 5E18F 4X0GA 1AWCA 4Z6YA 5K5RA 1JUSA 2X4HA 4QIWN 3K4CA 1XMKA 1SFEA 3OYMA 2MLGA 4DGWB 4QTRA 2Y48A 1YRNA 4XBFA 3IAS2 3IHUA 4HQEA 1O3RA 4BQNA 1OCTC 4L9VA 3I4PA 1BOAA 3GTJJ 3CO7C 2EINH 1BBYA 2DT6A 4ZC3A 1WJAA 3HIFA 1Z9CA 4EJOA 2CWEA 2STTA 2A6EF 3WTVC 2QYOA 3B02A 2RQQA 2P5KA 2ZC2A 4GYGA 4II2A 5JVTA 3CF5F 2L02A 4LB5A 2OJED 2OAZA 2FE3A 2F5DA 3SZGA 3HG9A 4TV7A 3I0TA 1WJFA 2HZTA 4HF1A 5H20A 4RAYA 2VC1A 2DOAA 3FK6A 2KKOA 3D0SA 2Y9YA 2BBYA 4Q4ZF 4E7ZA 3H5RA 3KP6A 4RGXA 5C3EJ 4M3EA 1X3UA 2HOAA 2EPFA 2LR8A 4XK4A 2O3FA 3H0GJ 4U0WA 2ZCWA 1HW2A 4XR6A 4LB6B 2MSYA 2JMWA 2DTRA 2YU9J 3TMOA 3J7AO 2IPQX 2ZMEA 2CUZA 4BHCA 2H94A 2IGOA 2K02A 5E17F 4BJ5C 1LNWA 1X1DA 5J1UA 1FWZA 3WTUC 3A01B 4A93J 2EFNA 5E3MA 5B5EC 2G0EA 2XAQA 2DN0A 3S1MJ 3CC4I 2LY9A 1Y8QB 2BHYA 1AA7A 3VFZA 1IW7F 2LKSA 1O4XA 1DUXC 1FBUA 2AQEA 2AO9A 5CJ9A 4ON0A 3QRFF 4OIRF 2R7FA 4PGGA 2WAQN 2IA2A 1TLHB 2DO7A 4G7HF 1XX5A 2BGCA 3K1PA 3VWBA 1P2FA 3DBHB 3FK7A 3LSJA 5IT9Z 3WHCA 3TDUC 5C4XJ 4XRFA 1R5GA 2V1DA 1TWHJ 1R1TA 5C4JJ 3H5AA 2Y9ZA 5F08A 4NQWA 2OC6A 1VQNI 3MQ0A 1SFOJ 3I58A 2GA2A 1MBGA 4Y4RA 3JRCA 1P4AA 2Y31A 1FIAA 2R93J 2P81A 2VC0A 3C7JA 2HQNA 1SD6A 3VSKA 4C3JJ 2RAEA 1B59A 1KU2A 4EJTA 1XC5A 3F0CA 1VQ8I 3ISPA 2QZ8A 1PDNC 3WODF 3CCRI 4MQVA 1Y39A 5LRSA 4PK4A 3OYFA 1W7PA 3X2QH 3R60A 2DMQA 4P1WA 3CMYA 2NVQJ 4IZZA 1G3YA 3MKYB 2HVQA 1X3ZB 2FOKA 2IAIA 1S7EA 4HF0A 3LWFA 2HQ5A 2QCOA 1TWFJ 2KIFA 4H4KC 4XKCA 3CCEI 1S7AA 3FXRA 1TWGJ 1DPRA 2DOFA 2Q8KA 3RSNA 2L01A 1KGSA 1UHWA 3FBIB 5DYMA 4A3IJ 1RR8C 1WFXA 1ZGWA 4RM3A 2HVSA 2PQ8A 3O8GA 2X6WA 3KYDB 1QA6A 3HPGA 2QENA 5B66C 2NAZA 3QQAA 1BI2A 3K70D 1POGA 3H3ZA 4XN3A 3LMMA 1JT6A 1V54H 2VXDA 4WF2A 4HW0A 1LQ1A 1X1AA 4EM0B 1KU3A 2JSPA 3OWTA 1ZLJA 4DBRA 3CC2I 1TWAJ 1V5FA 1UFMA 5K1YA 3AL0B 1XS9A 1ZR2A 3ESWB 4XLPF 1Q1VA 3SJMA 2RDPA 4RS8A 2HYGD 1IO2A 5CVJA 1LFUP 1HDPA 2QGUA 3L2QA 4LIVA 1D0ZA 1X2NA 2J5OA 3GZ5A 1IZ1A 2TDXA 5CVIA 1DDNA 3DU6A 4ENMA 1R9TJ 3EQLF 4JX5A 2IS2A 1F9NA 2OD5A 3OYKA 2VJJA 4JOMA 2COMA 1TW3A 2VJIA 3WGIA 2DA3A 2E34A 4HBLA 1ETOA 5IYBJ 5D8KB 2ZJQF 4IHXA 3VYRB 5FKMA 4G7ZF 5GAEJ 3FIWA 5CYVA 4U7DA 1F36A 1P4WA 4MLOA 3M9AA 1WCMJ 2CMPA 2FNPA 2LFBA 3TO9A 3DTEA 5E79C 1QHGA 1HCRA 4HLYA 1XDSA 1V5EA 1LEBA 2E1MC 4ZZLA 4I01A 4NDLA 3OYGA 1REPC 4A3BJ 2FF4A 1Z6TA 2TRTA 4E7HA 3H5NA 3LSKA 1U0JA 3A01A 3JAMZ 2DFFA 4UVCA 3IRQA 1I3QJ 1KQ0A 1SC7A 5GTIC 1A6QA 3F21A 1Z3YA 2MFZA 2X6OA 3I53A 2F5EA 3MZ8A 2R7ZJ 4AM3A 1K6YA 3M1CA 2VPRA 2PFBA 2DYRH 2LBFB 1HDDC 4I2OA 5FKKA 3GZ6A 1R23A 3FXUA 2OCEA 4B1RA 2R3SA 3ZP5A 6PAXA 2R7TA 5L3CA 4MHGA 5FLMJ 1R49A 3K70C 1ETYA 4LG0B 3MEXA 4Y15A 1TQIA 2OU2A 4BACA 1W36D 3MKZA 1S29A 1XB4A 1FEXA 1D3YA 2Z1DA 1MBHA 1JKRC 2R7UA 1QO0D 2OQRA 2K7LA 4AC0A 3M8JA 4WXCA 3D5LA 1FBSA 2M87A 2Z5UA 4M6VA 3ZQLA 1OR7C 2BYVE 1WJ5A 3K4LA 1KQ9A 3MKLA 1ZRDA 1FLIA 1B9NA 5E1WA 3CMEI 4IRGA 2V4JC 3HYIA 2LY2A 5L3FA 2H1LA 3IH4A 3LSPA 1H9GA 2AXLA 2JQ7A 3ERMA 3E3VA 2KL4A 4M3FA 5BPDA 2F6CA 3PM1A 2KIMA 3B6AA 5FD5A 2M7BA 3H1CA 3GX4X 3GCMA 3K4NA 3GTQJ 3HKZN 4LFUA 4M73A 4AVZA 3W2AA 2VLAA 2BY2A 3EUAA 3JREA 3KP7A 3H0DA 2VUMJ 5F0FA 5HNHA 1AOYA 2PMZN 4CDGA 1ON1A 4I02A 2DMPA 2R4GA 2ADUA 3W2VA 1OYYA 4BY7J 5M3MJ 3SEZA 4UNOA 1ZREA 3S14J 4BXUA 2OZUA 4ABZA 1WH7A 2VASA 3SHFA 3SQNA 2ELHA 5DD4A 1XGOA 2COBA 4IL6C 1S5LC 2W48A 4UVAA 3HOXJ 4ENKA 3ABLH 5EZHA 3TQNA 3OIQA 1TBXA 2OUMA 2CG4A 3TP3A 4YIRX 3H3VK 5FO5A 2UXXA 1TT0A 4Y3OA 1Z0XA 1R1VA 3BR1A 2LP0A 2M45A 1AHDP 1R36A 4EM1A 2XKPA 2BY1A 3TO6A 3B73A 3DP7A 3PO3J 3L1PA 1W0TA 4HV6A 2M34A 5HLGA 4B44A 3C2GA 4XLCA 2CUEA 2GIZA 3KCCA 5KNLA 2DFIA 4HNTA 3JTGA 3G73A 2A5WA 3A03A 4YELA 4G9YA 3GEZA 1SD4A 2CW0F 4B43A 1XDUA 2YPRA 3OR2C 1SAXA 1ZRCA 2OBPA 1IN6A 4HX4A 2VBYA 4WK8F 4MEXF 3BG3A 3J80K 4BQOA 3L9FA 4BE0A 2VKEA 2CV1A 2VI6A 3IH3A 3K2ZA 3LOCA 2NRAC 3V8KA 3ZN1A 3WTWC 1MH3A 3SDGA 3BZ6A 3OMYA 1YW8A 4EEFG 1OCZH 1IRXA 3MZYA 3ZN0A 3IRRA 3S2DJ 2PJRB 4A2UA 2L9RA 3RJPA 3KEQA 1D5VA 5J8CA 3L09A 4AYBA 1FP2A 4LD5A 4WCGA 4BQAA 2X9DA 3W3CA 1RESA 1HKSA 2L3DA 1D5YA 1XN7A 2OZ6A 2FRHA 2QQBA 2LBFA 3ZXSA 1H9TA 4ESJA 1ZHFA 1ZELA 3H9QA 4R79A 4X6AJ 4I98B 4HG2A 2IP2A 3DCFA 3HKZA 2HOSA 1YS6A 4EV0A 2V79A 5AIPA 5J40A 4HNUA 4XMYA 1QNTA 5EZGA 5L3DA 3VYSB 3GLXA 4EVIA 2D2WA 5BQTA 4UUVA 5IP6A 1NG6A 3BTJA 1IN4A 4LG0A 4Y17A 3F8BA 3TW7A 2EIMH 1FPQA 2VE8A 3QYEA 2Q2EB 3CCYA 3DKWA 4BL0B 4F92B 2IS6A 2VT2A 3N97A 4U0VA 1LDJA 3BZCA 3HHGA 4P55A 4BS9A 4A3CJ 4E7KA 1D1AA 2OQGA 1Y6IA 1IRGA 2RC4A 2MD0A 2E71A 5HS8A 4QPOA 3E7LA 1Z91A 4LMYA 4M9ZA 4M6YA 2ETHA 5JHFA 1ETKA 2E36A 2FA5A 3BP8A 4BXXJ 2W4SA 3M1EA 4FX4A 4M3DA 3PSIA 1EH7A 3BTLA 1WH5A 2ISYA 2ACJA 2E7XA 3QU6A 4KJZA 3HSRA 3MKWB 1G6NA 1T2KA 4G6DA 4PFPA 2VOPA 1T8IA 3TBIA 1RUOA 2X1DA 5F1RA 1H0MA 1PP7U 4OINF 2E2HJ 3D1NI 5FB2A 1XGMA 1I6XA 1QQIA 3FM3A 1PVEA 4MNUA 5CLSA 1U3EM 3HOSA 2A6TA 3L2CA 4GFBA 2HPMA 3E6BA 2XDVA 3TOAA 3K4JA 1YI2I 5GAGJ 2NVXJ 4HOBA 2HDCA 2HEOA 3MAJA 2X51A 4F7ZA 3K9TA 2UXNA 1T6SA 4LITA 3QWLA 4II3A 3RTRA 4CGZA 1BIAA 2B0LA 3ZMZA 2XAJA 1DU6A 3PL8A 3C2BA 4L0ZB 2HYFA 2EZIA 1W4MA 3SZPA 2F5CA 1OCCH 4B3AA 4XOPA 2IJLA 5F04A 1O3QA 3COAC 3KP2A 1NK2P 4L18B 4Q5SF 4MO7A 2EIKH 1G3SA 3DXJF 3GMEA 4YRVA 5F27A 2A61A 2HXIA 1LFBA 2NYXA 4XN0A 3GLLA 3P9IA 2AS5F 4UB6C 3ZCOA 1IRZA 2L9SA 4PSXA 4BXFA 2ZJPF 1F1ZA 3HOZJ 1J5YA 3M8EA 3V4GA 1WSUA 9ANTA 2V6CA 2DCEA 2E5NA 5AONA 5HDKA 4L5EA 3RZOJ 5KAFC 1G2HA 1R4NB 3CC7I 4RGSA 4AVPA 5K7ZA 2W84A 4Q48A 1O3SA 5IYDJ 3PJRA 5IOYA 2DK5A 1USTA 1SANA 4L9TA 1OPCA 4IX7A 2KMUA 1IRFA 1YW9A 1IUFA 3WTTC 4G94A 4XKBA 3EUHC 4C2MJ 5C44J 2ECBA 1NG7A 4I7HA 4XLFA 3U1KA 2P7CB 2EV6A 4XLNF 1JI8A 5FFXA 2PJRA 4RA2A 5HVQC 4IOCF 2M0CA 3MVPA 3SFZA 3FM5A 3HSFA 1AKHB 2E5ZA 4R8HA 2STWA 1BOBA 2HR3A 4CSWA 4XIDA 5M3FJ 1A31A 4RM2A 4RAZA 2MD5A 1FOWA 4BJTA 2O0YA 2HOTA 3QPLA 4XKVA 1OLTA 2RKHA 1WGXA 1RR7A 2KRHA 3PFYA 4LK0F 5DUIA 2LSOA 1H8AC 2M0MA 5FRMA 4BU2A 4AWXB 3S1RJ 1TQPA 2P5VA 2BW3B 2ELKA 2XAHA 4D5FA 2I10A 4ZYAA 5HLHA 2Q2EA 1T39A 4YIFA 4BAYA 1X58A 3L7WA 1BR1A 5FRNA 2HKXA 2CW8A 3ZQHA 1FYKA 3H35A 3R0AA 3E0JB 1X19A 2DT5A 4PGHA 2IBDA 5E8IA 2PI0A 2HWVA 2KRCA 5EGOB 3OS0A 5DDGA 3F22A 1JHFA 1T0FC 4A12A 4A3JJ 3KP3A 3OV8A 3I4MJ 2EZKA 5K5QA 3ASOH 1XMXA 4P5OA 1JHHA 1G59A 3AFHA 2LDUA 1BR4A 1T38A 4XSXF 2QQ8A 2BXZA 3WU0A 2G9WA 1NHAA 3IWFA 4A0XA 1DU0A 2GLOA 2EB7A 2HXOA 3JW4A 2R7QA 3BR3A 3T8RA 3OYBA 5LBQA 5KK1A 1K7AA 1RI7A 1A36A 4IHWA 2VJ4A 3V7RA 1YJNI 2K40A 3FMQA 3GBGA 2M1BA 1HC8A 3RPQA 3PSFA 1DQUA 1EH6A 2KQRA 1KU9A 1O7FA 5E1XA 2ZSIB 1HW1A 2ZB9A 2MW8A 5CKTA 4FHTA 2A68F 4B47A 1XSDA 1QPIA 3K0LA 3I4NJ 1ZK8A 3M7GA 5CVUA 1ZR4A 4HZFA 4CO8A 4ZDOA 3BCAA 1MMAA 3ZPLA 3UKGA 2KDOA 1P7JA 2Y69H 2GOXB 2LKPA 1QBJA 3RPUD 1S7OA 2W00A 3K1NA 1RUNA 1BN5A 3IKVA 5IT9K 2K5CA 2MGQA 1OKRA 1WI3A 3FWEA 4XL9A 5LGUA 2FMYA 2V9PA 4XQFA 4MTDA 1ZG1A 5H6QA 2CQQA 1BI3A 3BZKA 2QSFX 4XRSA 4RMNA 3J81K 3HL2A 1OJLA 3MMYB 5D5WB 2L0KA 1STZA 2LK2A 1ZARA 3WG9A 4ZDPA 3GO5A 1EJ9A 1XTAA 1H88C 3DFGA 3DTKA 4UXNA 2QSGX 3FMRA 2L7KA 1FYMA 1TP4A 4BNCA 4IXAA 5HDNA 3FXLA 2OTJI 1J09A 2ZO4A 5M5XJ 2UWMA 3P9KA 2XGEA 3VDXA 4LIUA 4XORA 1MBKA 5LHIA 2BEOA 4CZCA 2VJ5A 2X1CA 3HGYA 3HC7A 1FNNA 4KYWA 2CJJA 4A3DJ 3K4MA 3DKYA 1X4PA 4YG2F 1ORKA 5L3EA 2CW7A 4EATA 3OIOA 2QKLB 2VIXA 5CVRA 4IO9F 2QKMB 1LJ9A 2JWTA 3BC8A 1IDYA 3CDLA 2RREA 5FFZA 1I39A 4CH7A 2IS4A 4WXDA 1Y8RB 3HHHA 1ZN2A 4KMUX 2J5PA 1ZG5A 1AKHA 5GADJ 3VSLA 1VQOI 4UUTA 2R7XA 1P7IA 5E8GA 1CF7B 1R1UA 2LNBA 2Y0MA 4RBOA 3CP2A 2Y0SN 3HRTA 3FISA 2E60A 4RB2C 2F5FA 2QM3A 5ICFA 4E7SA 2HTJA 2RN7A 3G1LA 2HPIA 1K4SA 1U5TB 4O6JA 1YX3A 3H92A 5CQGA 3ZQGA 2BW3A 3J7AY 1IGNA 3CCMI 4M3BA 2C6YA 4UVBA 1E17A 3OYAA 2DOEA 3KZZA 3F8FA 5GPCA 2VONA 1QZZA 2ESNA 2E7WA 3JTHA 2LD5A 2ZMEC 4HEA2 1BL0A 3CUQB 5J8FA 5F6FA 5EGOA 4QLCU 5HODA 2HGCA 4A3FJ 5JR3A 1JTYA 3OL4A 4OU0A 3K6GA 2CV0A 3ELKA 1RZ4A 2G7HA 2X6XA 1OMIA 3E6MA 3AAFA 1BM9A 1YW7A 5KHDA 3U1DA 2ZNZA 2XPUA 2IT0A 3GFLA 4NB5A 1R58A 5ICGA 4GXOA 4ASNA 1LFPA 2JA8J 2XAUA 3RI4A 2HOEA 3K1MA 5BS6A 1VQLI 2VXZA 3QPTA 1MBFA 2O7OA 3F23A 2WB1N 5BNGA 1I5ZA 1TW2A 3P5JA 2VPLA 3QPHA 2RNJA 3LFUA 1SFUA 2OV7A 2VQGA 2EFPA 1GUUA 4IOAF 1TZLA 3S17J 3GTKJ 3I9V2 2ME6A 4E6KG 2XHKA 4XM3A 3RYPA 3A0BC 2AHQA 2M30A 3HTSB 2JA6J 2HU9A 4A6DA 3F8CA 5DD8A 1FOKA 3G4SI 4UUSB 1E3OC 3QP5A 1Y0UA 2MABA 2OF7A 2WA0A 3ZMTA 2M4GA 3FF5A 1SD5A 3DBRB 3KEYA 3ASNH 3CCLI 2DPDA 1MIJA 4GYIA 3C3WA 1XMAA 5K5OA 2V9KA 1U9OA 3AG3H 1WZ2A 3LL7A 4YIIA 4RDUA 3ERED 3CF2A 2M9HA 3TW6A 2Y0SA 3LNQA 4RLQA 3JRFA 4BBRJ 3S8PA 2NVYJ 2VBWA 2VQHA 2ZJ2A 4ETSA 2LRDA 2QSHX 1N77A 3DEWA 3VEPA 4Y7NJ 2L4MA 5EYRA 3WU1B 1GV5A 3HDDA 4M6XA 2E1OA 4H0EA 3GTPJ 3FXMA 2GOMA 3HOTA 4RAFA 3RKWA 4HDVA 4BDYA 1W0UA 1A04A 2NS0A 2FBIA 1MSEC 2XPVA 4W1UA 1JTXA 5DCMB 3OS1A 2EZLA 2VBXA 1VQ6I 3S93A 2FSWA 5FD6A 1S9HA 2K4BA 2KJCA 2M8GX 4GO1A 2ICWG 3F6VA 1MJ9A 4ANJA 2OCCH 3ZMSA 2JJ7A 3O6BB 2IRFG 4OMYA 2BHZA 3RYRA 3OYNA 1MGTA 2YS9A 4JX6A 3TDZC 1NK3P 3VOEA 2QQ9A 1J9IA 1BIBA 3IAM2 4KIFA 4WXHA 3K69A 4MFEA 1MNMC 1CF7A 4ENJA 4I09A 2KRFA 5J4YA 1OYIA 2PEXA 2R5YB 1JGSA 1QVTA 2PMUA 2CQKA 1OCPA 2WB1A 1U5TA 3JCUC 2UV1A 4AYBN 5GTHC 4M9XA 3WGHA 3HOUJ 3LSIA 1QU3A 3PFIA 2MBFA 4XNFA 3UR3C 4XRSG 3KX2A 5EEHA 4BGDA 2VKVA 2NVUB 5B1AH 1IUYA 3TP0A 2OA4A 2XAGA 3DV8A 5DM6F 5D5XB 1O57A 3CUQA 1E0EA 3SEQA 5HNFA 2D1VA 2QF7A 1R6RA 4DYQA 1J7KA 4KUMA 4BH9A 1YJ9I 1X4OA 1S3JA 5EJCA 1IC8A 1FOXA 4M71A 1XSXA 2VQLA 4G6QA 1TNTA 1OCRH 1OYWA 1FP1D 4U87A 2XRLA 2W25A 2L2OA 4NC7A 3IKTA 2W85A 1IV8A 5KVRA 1OISA 1XCVA 2QBYB 3ZMDA 1MW7A 1UHMA 3E5XA 1YE9A 2XSJC 3JSOA 3HOYJ 1ZGJA 3C2HA 4KITB 3MN2A 4QSHA 1M1EB 4A6EA 5IP7J 2YU3A 4HX7A 3M8FA 1UG2A 5FROA 1V5GA 4R1HA 2XAFA 3W6JB 1U78A 4XRMA 3VYUB 2LF7A 2CYYA 2H09A 3BDDA 3ZMUA 2IXSA 3LSMA 2ESHA 3ZQ7A 3R0JA 5IYCJ 4EGYA 5FGMA 3BQYA 1G3TA 2L9NA 3OYIA 2K3PA 3BTIA 5H2FC 1FSHA 1V3FA 2ZKZA 3DKXA 2FEZA 3BY6A 3H3UA 3GYHX 2EA4A 2E35A 4UV9A 1LUJB 2K3FA 5ILUA 3JRDA 3ML6A 4HDUA 3SFIA 5HLTA 3DTIA 5F0CA 2Y2ZA 2M2EA 2V7FA 2VT3A 2BV6A 3KYCB 5D5VB 4DW6A 1UCRA 2LMDA 3C1DA 4IPAA 2QUFA 4N0BA 1GT0C 4FCYA 5HOOA 1T33A 4UUSA 2CFXA 3KEOA 3QU3A 1VQ5I 1LVKA 1J0RA 2DJIA 3FXOA 4CYCB 2F5VA 3K4KA 1I1GA 3QODA 3LSHA 4CXFA 2Y75A 4WX9A 5LD2C 3DPLC 2EV0A 3T1BA 5BOXA 2A05A 1VQ4I 3Q0WA 2WTEA 4E7IA 4JK1X 2DQLA 4HSTA 1LDDA 5D4SA 4O3MA 3CDIA 3VODA 2GXGA 2LREA 3BROA 2TCTA 4RB1A 3F3XA 3IV5A 1O3TA 2IA1A 1TT5B 2DMUA 1BA5A 2P5LC 1SD7A 5HDGA 4QPQA 1YITI 1V55H 2B9SA 3Q9VA 1IXCA 2EFQA 1I6HJ 2ZFWA 3PUBA 4NHJA 3SYTA 2V1UA 2RV8A 5DCMA 4FQGA 2WV1A 3A0HC 2L54A 3OL3A 4P9FA 2LOOA 4DQ2A 2X48A 5DM7F 1GLNA 3D5SC 3ZRGA 3AL0C 1ZGAA 1VFCA 4ITVA 4LLNA 3JRGA 3DWLE 2UZKA 2LVSA 1D1CA 1YX5A 3V7SA 1F43A 4EJUA 5F0HA 4I0AA 1QVUA 3O8HA 1MJAA 4DYCA 2VKDA 3MZHA 3S32A 1IV6A 2YSRA 3VYTB 1I1SA 2WAEA 5E1ZB 2HZDA 3CLQA 3KPHA 1K79A 1MBEA 2KIQA 2RVCA 1JT0A 2B63J 3FKIJ 3GZNB 3EUKL 4G6TB 2V6EA 1TWCJ 2EK5A 4C9YA 2L7FP 4D5CA 4EM2A 1UHSA 4S04A 5E20A 1DGRM 2R5YA 2ID6A 2PBIA 1WKMA 2M8EA 4F52A 2D1HA 4CCLA 4BDZA 3EDPA 1WJDA 2MG4A 2JVGA 2RQPA 3LQRA 4CYDA 5LLQA 1MD0A 2EQRA 3M3YJ 4W97A 5A2QZ 1X2MA 2AXTC 4AU7A 3CD6I 2Z16A 2NOGA 1IF1A 3CJTB 1B72B 5EG0B 2Z33A 4RB3C 1Z67A 1VI0A 2MH9A 2DA4A 4MGRA 5KCMA 1U8RA 4GGGA 4JBAA 1TTYA 5E3LA 2HTSA 2BOLA 4BUPA 1HOMA 5BPIA 1G4DA 2M5WA 4HA8A 1RETA 2V26A 2ZJRF 2YX7A 4G12A 3OS2A 1WJEA 5BMZA 2NVTJ 1YIJI 3KE2A 1GXQA 2MC4A 2JN6A 3R61A 3KZYA 3I59B 2DMTA 4IEJA 5LHGA 2QBYA 4RGUA 3W6VA 1V4RA 1KQ8A 1W1WE 1ERDA 2QLZA 4HX8A 1UJ8A 2FBHA 3JR9A 1FYLA 2JPCA 1FT9A 4AIKA 5FKOA 2CQXA 1XGNA 2M7AA 2Z2SB 3P9CA 2KZVA 1TL8A 1ZKGA 2QQAA 2XGXA 2KP6A 4V19K 1HF0A 1GV2A 5JLXA 5IPAA 2WBMA 4F93B 2DW4A 4HV5A 1GHCA 2EJRA 1ON2A 3PNVA 2IW5A 2IGKA 3KLOA 1LB2A 2KISA 2A6HF 2R7OA 1BJAA 3ABUA 4U7BA 3N05A 4FT8A 3NQOA 4KIBA 4FE7A 3GXOA 1JXSA 4D1QA 4BY1J 3PO2J 1VF9A 4ESFA 4CYCA 5CVVA 4DJAA 4M9SA 4KN4X 3H9GA 3FHZA 2DA2A 3Q0UA 3VPRA 3O2PE 1F5TA 4KA4A 3D5RC 3W2WA 3HXLA 2XVCA 3ECHA 1WI9A 1YHQI 2W7NA 1BI0A 4WWCA 5IT3A 5H6RA 2NOJB 1P92A 2ZXJA 3BR0A 1B8IB 4LGWA 2PJPA 2DFEA 4JX4A 1R4MB 4OWRB 3W6KB 4E7JA 2ISZA 4PJ0C 3Q5FA 2DLLA 3HM5A 1Z7UA 2H1KA 4NUBA 5LRRA 3QPSA 2K9SA 3NWSA 1ZQ3P 1HKTA 3QYBA 3RKYA 4K2EA 3HRUA 4S05A 5E3OA 2H6BA 3GWZA 3U2RA 5FLVA 5KAIC 1FC3A 1JJ8C 3LAPA 1MBJA 3BR6A 3DF8A 1R22A 1L3LA 1JGGA 3TKYA 2O61A 5IOZA 3S3NA 2R7DA 4PJLA 3NRVA 2HS5A 2LF8A 1N25A 4DIQA 5M5YJ 3I71A 4FX0A 4IQ4A 3JRAA 1W5SA 2UUZA 1MMGA 2HKOA 3AG4H 4L5JA 4GRIA 2GXAA 3LQQA 3GUDA 2W1OA 4FISA 2WADA 3OYHA 2EZHA 1GXPA 4ENNA 1G8XA 1Y1VJ 2LTPA 5TJJA 4HYEA 2F4OB 3M4OJ 2DFHA 4ZZDA 1Y1WJ 2GZWA 2JUCA 1ACIA 2QWWA 5CQEA 2BXYA 2DBBA 1F4KA 5K7FA 4A3MJ 4IHSA 2QEXI 4XLAA 2KHMA 1X3WB 1SVOA 2K85A 1YS7A 2L5QA 1UG0A 5EEAA 4C30A 5J4VA 3K4BA 3K10A 1SFXA 3ZMVA 3WTZA 3HZJA 4BHPA 2KDZA 3FBNB 4PJMA 1N75A 1YLFA 3OOUA 1FMWA 5EF6A 1JE8A 4A3GJ 1NTCA 4L0YB 1FX7A 3WTSC 1RIOH 4IHVA 2WY8Q 2CS3A 4EJVA 2DODA 2E1MB 3BR5A 1B72A 5EG0A 2ME0A 3F8NA 4BE2A 1ETQA 1ZRFA 1FZPB 4N9HA 2HFHA 4M72A 3G1OA 4PJNA 3WHBA 4EGZA 1RKTA 3KYLA 1TC3C 2CSOA 5K7HA 1VQKI 2JSCA 4YFKF 2HNHA 5DUKA 2H27A 4KFCA 5J1YA 4F55A 3CO6C 2QA4I 2IGNA 3I59A 1BC7C 2DDBA 2A5YB 5FLXZ 4MFDA 1JJ6C 3DPUA 2R5ZB 1JUMA 1E3PA 4A3LJ 3FZVA 2KJBA 1SMTA 4Z2YA 3OYJA 4BE1A 2JUGA 1D1BA 3ZGKA 3T8TA 5ILVA 4U0YA 3PNTA 1FTZA 3U21A 2EFWA 1B1BA 2YR2A 3I5UA 3RQ4A 2P4WA 3BPXA 5ICCA 2FUG2 1T56A 4ZYEA 3RCOA 3MFKA 1SVLA 3S16J 4JYKA 2JA7J 2ELJA 5M5WJ 3L2WA 2CV2A 1J59A 2K9QA 2JVHA 3DQVC 1NH3A 4LJZF 4LLLA 5LEJA 4V2GA 2KIUA 1EKEA 2Q0OA 3HUGB 4LK1F 2KZGA 3G71I 2EBIA 1SEUA 1WJBA 3ROUA 1IAWA 1SAUA 2HDWA 4DZPA 5DCFA 1ETVA 4YEJA 2NS8A 2FNAA 1MDMB 1MMNA 4AIDA 2NXNB 4CCJA 4ZTJA 2HI3A 4UB8C 2DYSH 2O6GE 1QGPA 1Y56A 5B3SH 1OFCX 2ZBKA 5GPAA 3T0YA 1TNSA 4CCNA 1J2XA 1B8IA 2O5RA 2VODA 1W7PD 5JLWA 2WY7Q 4BQQA 3JRBA 3RKQA 1ONVA 4D0PA 2GA1A 3RPUA 2R7VA 4YFXF 2LG4A 1TQMA 1VQPI 2F4IA 3OYEA 3A2KA 5GP9A 1WWXA 2DK8A 4X1EA 2V9VA 3WTXC 1EF4A 2EFOA 3HBLA 1IG7A 4XICA 3JSPA 4LLGF 4L9NA 2GM4A 1R71A 3BJOA 4Q47A 2BE5F 2KFDA 4J00A 4OAZA 3CUOA 1HBXG 2Y30A 1ZTRA 3OYCA 4BBSJ 2VKHA 3DBLB 1LE8B 2XPWA 2ZXHA 1KZHA 2DXIA 2HQAA 3V42A 3J81Z 3TEDA 3GTOJ 3R4KA 3BCBA 4EMSA 3BJAA 4OAYA 3S1NJ 3H36A 4Y13A 3AG1H 3S2WA 3WE3A 1HSJA 2CQ7A 4DOZA 4A3EJ 3U9GA 3EETA 4PCQA 3GFJA 1K61A 4BJ6C 2LKXA 3GTMJ 4A0ZA 3WG7H 4I6ZA 1QZEA 3B6CA 2BY0A 4F91B 5TRDA 3F6OA 1EV7A 2IVMA 3KFWX 2H6CA 1ZYRF 4C3IJ 5JI6A 1OQYA 4A5MA 3HOWJ 3E6CC 2JPBA 1FJLA 2BZTA 3ULQB 2ZFUA 5D5UB 3ZQCA 3DLLF 1AU7A 2K9MA 4Y33A 2EV5A 3L2RA 3S3OA 3AG2H 3TO7A 1VZ0A 5FKNA 1GDTA 2DJNA 4HLXA 2DA1A 4IRHA 2E19A 1APLC 2HQRA 5ED4A 1KYWA 4N9IA 2DAOA 2EIJH 4G8XA 1PYVA 5AIQA 1IXRC 4O5VA 2GXBA 4BEHB 2LC2A 2LH9A 4I0BA 3QYFA 3OYLA 4OMZA 4IVNA 3JAMK 3UNGC 5J47A 3PQJA 4QWQA 3I54A 1PUEE 3OOPA 1JKOC 4CCKA 3LAJA 2KPMA 4E4HA 3MD2A 1MSFC 2RGVA 2R5ZA 3QOEA 2X85A 2JRTA 4CICA 1B6AA 2DQRA 3HPHA 3HSEA 1HXDA 4B09A 3DLAA 2XGCA 2K4JA 3CJNA 1IXSB 2EILH 4PFOA 3S2HJ 3WE2A 2CQNA 1HSTA 3ABTA
chains in the Genus database with same CATH topology
2M2EA 4MO7A 3FK6A 4DW6A 2Y9YA 3BT9A 5F27A 1GT0C 4FCYA 2HXIA 1LFBA 1I50J 1T33A 4UUSA 5C3EJ 4M3EA 4CYCB 2HOAA 1IRZA 3Q0VA 2LR8A 3HOZJ 2R92J 4XK4A 9ANTA 1BJZA 3H0GJ 2DA5A 2E2JJ 4L5EA 2MSYA 3Q0WA 2H8RA 2JMWA 2YU9J 3RZOJ 1G2HA 1CQTA 2L7ZA 4Y52J 5K7ZA 5J1UA 3A01B 4A93J 5E3MA 4FTHA 2TCTA 4HNVA 2G0EA 3IV5A 2DN0A 5IYDJ 2DMUA 5IOYA 1XG1A 1BA5A 3S1MJ 2LY9A 1SANA 2JA5J 1ENHA 1ITYA 1BW6A 1IUFA 4V2FA 1O4XA 1I6HJ 2AO9A 4C2MJ 5C44J 2ECBA 2WAQN 2WV1A 5J3LA 2X48A 1VNDA 2M0CA 3MVPA 3FK7A 3LSJA 1ETXA 2DA6A 3WHCA 2GBYA 3Q3SA 4J19A 5C4XJ 1VFCA 1AKHB 1TWHJ 5C4JJ 2Y9ZA 4XIDA 5F08A 3JRGA 5M3FJ 2FQ4A 5IP9J 2LVSA 1SFOJ 1MBGA 3JRCA 1F43A 2Y31A 1FIAA 2R93J 5F0HA 2P81A 1QVUA 3BG9A 3O8HA 4DYCA 2HOTA 4C3JJ 2RAEA 3QPLA 1IV6A 1WGXA 1RR7A 1LE8A 1XC5A 3F0CA 1H8AC 1MBEA 2B63J 3S1RJ 1JT0A 3FKIJ 2ELKA 1TWCJ 4D5FA 2XSDC 2L7FP 2I10A 5E3NA 4D5CA 1UHSA 1X58A 3NARA 2DMQA 3CMYA 2ID6A 2FD5A 2R5YA 2NVQJ 3ZQHA 2IAIA 1S7EA 2HQ5A 2QCOA 1TWFJ 1HLVA 2MG4A 2IBDA 1TWGJ 2EQRA 5EGOB 3M3YJ 4W97A 1IDZA 1X2MA 2NOGA 4A3JJ 1B72B 5EG0B 3I4MJ 2EZKA 1VI0A 2DA4A 4A3IJ 1ZGWA 1RPWA 3O8GA 5E3LA 4MIMA 1HOMA 1BW5A 2GLOA 3QQAA 1DU0A 3LSGA 3JRHA 1RETA 2HXOA 1POGA 3OSFA 4G12A 3BR3A 2NVTJ 4IHWA 1JT6A 2K40A 2JN6A 4A69C 3GBGA 2DMTA 4IEJA 2ID3A 3GTGJ 3S1QJ 3W6VA 1TWAJ 2ZB9A 2MW8A 3JR9A 1XS9A 1ZR2A 3HGGA 1Q1VA 4LOCA 3SJMA 1QPIA 3I4NJ 1ZK8A 1ZR4A 1LFUP 1HDPA 3GTLJ 5FKOA 2CQXA 1U8BA 1X2NA 3A02A 3UKGA 1P7JA 1ZKGA 2ECCA 1R9TJ 1HF0A 1GV2A 5JLXA 4JX5A 5IPAA 2MGQA 1WI3A 2CRGA 4AUXA 2CQQA 1PUFB 2DA3A 5IYBJ 1A5JA 1ETOA 3BTCA 4XRSA 4IHXA 1U9NA 5FKMA 1OJLA 3HB9A 2L0KA 2LK2A 1Z77A 3FIWA 4FE7A 2O8KA 1F36A 4BY1J 4MLOA 3PO2J 1VF9A 1WCMJ 2FJ1A 4CYCA 1H88C 2LFBA 1FIPA 4C3HJ 2IEKA 2DA2A 3Q0UA 3ZQIA 2HYJA 3VPRA 1HCRA 5M5XJ 1FTTA 4NDLA 4A3BJ 2XGEA 1B8IB 3BR0A 1MBKA 1K83J 4JX4A 2K9NA 1ETWA 2TRTA 3HGYA 4D7NA 1UMQA 3A01A 2CU7A 3HM5A 2H1KA 2CJJA 4A3DJ 1I3QJ 2K9SA 3QPSA 1ZQ3P 1ORKA 3K2AA 5E3OA 2XB0X 3OIOA 2X6OA 5FLVA 1IJWC 1JJ8C 2D5VA 2R7ZJ 1MBJA 2LLKA 3BR6A 2VPRA 2JWTA 3IH2A 1IDYA 1JGGA 3CDLA 5IOZA 3CQZJ 3OSGA 1HDDC 2KT0A 5M5YJ 3JRAA 5FKKA 4S0HB 2FX0A 4B1RA 4FISA 1AKHA 5FLMJ 2EZHA 4UUTA 1P7IA 2LTPA 1Y1VJ 5FKLA 1ETYA 4RBOA 2Y0SN 3FISA 3M4OJ 1FEXA 1Y1WJ 1MBHA 1JKRC 3G1LA 1H89C 5K7FA 4A3MJ 5EDNA 4AC0A 1JKQC 2DMNA 3ZQGA 1IGNA 5EEAA 4M3BA 4M6VA 3ZQLA 5F1JA 3MKLA 1WPKA 2KDZA 5GPCA 5J1RA 3OOUA 5EF6A 2LD5A 1BL0A 1NTCA 4A3GJ 3IH4A 3LSPA 4IHVA 5EGOA 5HODA 4M3FA 4A3FJ 1JTYA 3BR5A 3PM1A 5DS9A 3B6AA 1B72A 5EG0A 2ME0A 1ETQA 2CUFA 2HDDA 3GTQJ 3HKZN 3G1OA 3WHBA 1RKTA 2XPUA 3JREA 2VUMJ 1TC3C 5F0FA 3G1MA 2JA8J 5K7HA 4M3GA 2PMZN 1YRNB 2DMPA 2E2IJ 3HEFA 3BG5A 4BY7J 1MBFA 5M3MJ 5J1YA 2O7OA 3S14J 2WB1N 5BNGA 4ABZA 1WH7A 4MFDA 1JJ6C 2R5ZB 1JUMA 4A3LJ 2COBA 1GUUA 1QRYA 2YUSA 2W48A 5FJ8J 3HOXJ 3S17J 3GTKJ 1FTZA 5EZHA 2ME6A 3TP3A 3H3VK 1T56A 1Z0XA 2AHQA 3S16J 3BR1A 2LP0A 4JYKA 2JA6J 1AHDP 5M5WJ 2JA7J 1RKWA 3NAUA 2K9QA 3PO3J 4UUSB 1E3OC 3L1PA 4V2GA 1W0TA 2M34A 2OF7A 1PUFA 2EBIA 2CUEA 3K7AJ 3ZOBA 1U9OA 2NS7A 3A03A 4I76A 4DZPA 4RDUA 2OPTA 1ETVA 2M9HA 3TW6A 2NS8A 3LNQA 3JRFA 4BBRJ 2N8GA 2HI3A 2NVYJ 3BG3A 1OFCX 3BQZA 5DTDA 5GPAA 3DEWA 2DA7A 4Y7NJ 2VKEA 5EYRA 1GV5A 1B8IA 2VI6A 3IH3A 3LOCA 4BKXA 3HDDA 5JLWA 2E1OA 3GTPJ 3JRBA 3RKQA 1MH3A 3SDGA 1W0UA 4EEFG 3S15J 1MSEC 2XB5A 2XPVA 4W1UA 3S2DJ 1JTXA 3RQIA 5GP9A 2EZLA 2L9RA 4X1EA 1EF4A 3HBLA 1IG7A 1GVDA 2M8GX 2X9DA 1RESA 4XICA 1D5YA 2GM4A 4X6AJ 2JJ7A 2Y30A 3DCFA 2YS9A 4JX6A 1NK3P 2HOSA 1ZTRA 1JKPC 4BBSJ 1LE8B 5EZGA 2XPWA 4MFEA 5IP6A 3TEDA 1MNMC 3GTOJ 3BTJA 3S1NJ 3TW7A 4FE4A 4B4CA 3CCYA 4A3EJ 2R5YB 1MH4A 2JK3A 1QVTA 1A6IA 3RZDJ 4A3CJ 1K61A 3GTMJ 1OCPA 2LKXA 2DTZA 4I6ZA 3B6CA 3LSRA 4DZJA 4AYBN 1JUPA 2R0QC 3HOUJ 4XRSG 2O9LA 4C3IJ 3E7LA 3JRIA 3HOWJ 2VKVA 1FJLA 3TP0A 4IHYA 4JP0A 1ETKA 4BXXJ 3ZQCA 4M3DA 2EH3A 1AU7A 2L7MP 3BTLA 1WH5A 3HOVJ 2XGDA 4DYRA 2QF7A 5FKNA 4DYQA 4D7MA 3ZQFA 1GDTA 2DJNA 1IC8A 4A3KJ 2DA1A 2E19A 1APLC 3BR2A 2E2HJ 3D1NI 2XRLA 4GFBA 1JUSA 4QIWN 3HOYJ 2NVXJ 1YRNA 4QTRA 3MN2A 4QSHA 5IP7J 1OCTC 1UG2A 1U78A 3GTJJ 4XRMA 1JKOC 5IYCJ 1MSFC 3BQYA 2R5ZA 3BTIA 1DU6A 2XGCA 3C2BA 2EZIA 3JRDA 3SFIA 4B3AA 3S2HJ 5F0CA 5F04A 2Y2ZA 1NK2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2E A;  4MO7 A;  3FK6 A;  4DW6 A;  2Y9Y A;  3BT9 A;  5F27 A;  1GT0 C;  4FCY A;  2HXI A;  1LFB A;  1I50 J;  1T33 A;  4UUS A;  5C3E J;  4M3E A;  4CYC B;  2HOA A;  1IRZ A;  3Q0V A;  2LR8 A;  3HOZ J;  2R92 J;  4XK4 A;  9ANT A;  1BJZ A;  3H0G J;  2DA5 A;  2E2J J;  4L5E A;  2MSY A;  3Q0W A;  2H8R A;  2JMW A;  2YU9 J;  3RZO J;  1G2H A;  1CQT A;  2L7Z A;  4Y52 J;  5K7Z A;  5J1U A;  3A01 B;  4A93 J;  5E3M A;  4FTH A;  2TCT A;  4HNV A;  2G0E A;  3IV5 A;  2DN0 A;  5IYD J;  2DMU A;  5IOY A;  1XG1 A;  1BA5 A;  3S1M J;  2LY9 A;  1SAN A;  2JA5 J;  1ENH A;  1ITY A;  1BW6 A;  1IUF A;  4V2F A;  1O4X A;  1I6H J;  2AO9 A;  4C2M J;  5C44 J;  2ECB A;  2WAQ N;  2WV1 A;  5J3L A;  2X48 A;  1VND A;  2M0C A;  3MVP A;  3FK7 A;  3LSJ A;  1ETX A;  2DA6 A;  3WHC A;  2GBY A;  3Q3S A;  4J19 A;  5C4X J;  1VFC A;  1AKH B;  1TWH J;  5C4J J;  2Y9Z A;  4XID A;  5F08 A;  3JRG A;  5M3F J;  2FQ4 A;  5IP9 J;  2LVS A;  1SFO J;  1MBG A;  3JRC A;  1F43 A;  2Y31 A;  1FIA A;  2R93 J;  5F0H A;  2P81 A;  1QVU A;  3BG9 A;  3O8H A;  4DYC A;  2HOT A;  4C3J J;  2RAE A;  3QPL A;  1IV6 A;  1WGX A;  1RR7 A;  1LE8 A;  1XC5 A;  3F0C A;  1H8A C;  1MBE A;  2B63 J;  3S1R J;  1JT0 A;  3FKI J;  2ELK A;  1TWC J;  4D5F A;  2XSD C;  2L7F P;  2I10 A;  5E3N A;  4D5C A;  1UHS A;  1X58 A;  3NAR A;  2DMQ A;  3CMY A;  2ID6 A;  2FD5 A;  2R5Y A;  2NVQ J;  3ZQH A;  2IAI A;  1S7E A;  2HQ5 A;  2QCO A;  1TWF J;  1HLV A;  2MG4 A;  2IBD A;  1TWG J;  2EQR A;  5EGO B;  3M3Y J;  4W97 A;  1IDZ A;  1X2M A;  2NOG A;  4A3J J;  1B72 B;  5EG0 B;  3I4M J;  2EZK A;  1VI0 A;  2DA4 A;  4A3I J;  1ZGW A;  1RPW A;  3O8G A;  5E3L A;  4MIM A;  1HOM A;  1BW5 A;  2GLO A;  3QQA A;  1DU0 A;  3LSG A;  3JRH A;  1RET A;  2HXO A;  1POG A;  3OSF A;  4G12 A;  3BR3 A;  2NVT J;  4IHW A;  1JT6 A;  2K40 A;  2JN6 A;  4A69 C;  3GBG A;  2DMT A;  4IEJ A;  2ID3 A;  3GTG J;  3S1Q J;  3W6V A;  1TWA J;  2ZB9 A;  2MW8 A;  3JR9 A;  1XS9 A;  1ZR2 A;  3HGG A;  1Q1V A;  4LOC A;  3SJM A;  1QPI A;  3I4N J;  1ZK8 A;  1ZR4 A;  1LFU P;  1HDP A;  3GTL J;  5FKO A;  2CQX A;  1U8B A;  1X2N A;  3A02 A;  3UKG A;  1P7J A;  1ZKG A;  2ECC A;  1R9T J;  1HF0 A;  1GV2 A;  5JLX A;  4JX5 A;  5IPA A;  2MGQ A;  1WI3 A;  2CRG A;  4AUX A;  2CQQ A;  1PUF B;  2DA3 A;  5IYB J;  1A5J A;  1ETO A;  3BTC A;  4XRS A;  4IHX A;  1U9N A;  5FKM A;  1OJL A;  3HB9 A;  2L0K A;  2LK2 A;  1Z77 A;  3FIW A;  4FE7 A;  2O8K A;  1F36 A;  4BY1 J;  4MLO A;  3PO2 J;  1VF9 A;  1WCM J;  2FJ1 A;  4CYC A;  1H88 C;  2LFB A;  1FIP A;  4C3H J;  2IEK A;  2DA2 A;  3Q0U A;  3ZQI A;  2HYJ A;  3VPR A;  1HCR A;  5M5X J;  1FTT A;  4NDL A;  4A3B J;  2XGE A;  1B8I B;  3BR0 A;  1MBK A;  1K83 J;  4JX4 A;  2K9N A;  1ETW A;  2TRT A;  3HGY A;  4D7N A;  1UMQ A;  3A01 A;  2CU7 A;  3HM5 A;  2H1K A;  2CJJ A;  4A3D J;  1I3Q J;  2K9S A;  3QPS A;  1ZQ3 P;  1ORK A;  3K2A A;  5E3O A;  2XB0 X;  3OIO A;  2X6O A;  5FLV A;  1IJW C;  1JJ8 C;  2D5V A;  2R7Z J;  1MBJ A;  2LLK A;  3BR6 A;  2VPR A;  2JWT A;  3IH2 A;  1IDY A;  1JGG A;  3CDL A;  5IOZ A;  3CQZ J;  3OSG A;  1HDD C;  2KT0 A;  5M5Y J;  3JRA A;  5FKK A;  4S0H B;  2FX0 A;  4B1R A;  4FIS A;  1AKH A;  5FLM J;  2EZH A;  4UUT A;  1P7I A;  2LTP A;  1Y1V J;  5FKL A;  1ETY A;  4RBO A;  2Y0S N;  3FIS A;  3M4O J;  1FEX A;  1Y1W J;  1MBH A;  1JKR C;  3G1L A;  1H89 C;  5K7F A;  4A3M J;  5EDN A;  4AC0 A;  1JKQ C;  2DMN A;  3ZQG A;  1IGN A;  5EEA A;  4M3B A;  4M6V A;  3ZQL A;  5F1J A;  3MKL A;  1WPK A;  2KDZ A;  5GPC A;  5J1R A;  3OOU A;  5EF6 A;  2LD5 A;  1BL0 A;  1NTC A;  4A3G J;  3IH4 A;  3LSP A;  4IHV A;  5EGO A;  5HOD A;  4M3F A;  4A3F J;  1JTY A;  3BR5 A;  3PM1 A;  5DS9 A;  3B6A A;  1B72 A;  5EG0 A;  2ME0 A;  1ETQ A;  2CUF A;  2HDD A;  3GTQ J;  3HKZ N;  3G1O A;  3WHB A;  1RKT A;  2XPU A;  3JRE A;  2VUM J;  1TC3 C;  5F0F A;  3G1M A;  2JA8 J;  5K7H A;  4M3G A;  2PMZ N;  1YRN B;  2DMP A;  2E2I J;  3HEF A;  3BG5 A;  4BY7 J;  1MBF A;  5M3M J;  5J1Y A;  2O7O A;  3S14 J;  2WB1 N;  5BNG A;  4ABZ A;  1WH7 A;  4MFD A;  1JJ6 C;  2R5Z B;  1JUM A;  4A3L J;  2COB A;  1GUU A;  1QRY A;  2YUS A;  2W48 A;  5FJ8 J;  3HOX J;  3S17 J;  3GTK J;  1FTZ A;  5EZH A;  2ME6 A;  3TP3 A;  3H3V K;  1T56 A;  1Z0X A;  2AHQ A;  3S16 J;  3BR1 A;  2LP0 A;  4JYK A;  2JA6 J;  1AHD P;  5M5W J;  2JA7 J;  1RKW A;  3NAU A;  2K9Q A;  3PO3 J;  4UUS B;  1E3O C;  3L1P A;  4V2G A;  1W0T A;  2M34 A;  2OF7 A;  1PUF A;  2EBI A;  2CUE A;  3K7A J;  3ZOB A;  1U9O A;  2NS7 A;  3A03 A;  4I76 A;  4DZP A;  4RDU A;  2OPT A;  1ETV A;  2M9H A;  3TW6 A;  2NS8 A;  3LNQ A;  3JRF A;  4BBR J;  2N8G A;  2HI3 A;  2NVY J;  3BG3 A;  1OFC X;  3BQZ A;  5DTD A;  5GPA A;  3DEW A;  2DA7 A;  4Y7N J;  2VKE A;  5EYR A;  1GV5 A;  1B8I A;  2VI6 A;  3IH3 A;  3LOC A;  4BKX A;  3HDD A;  5JLW A;  2E1O A;  3GTP J;  3JRB A;  3RKQ A;  1MH3 A;  3SDG A;  1W0U A;  4EEF G;  3S15 J;  1MSE C;  2XB5 A;  2XPV A;  4W1U A;  3S2D J;  1JTX A;  3RQI A;  5GP9 A;  2EZL A;  2L9R A;  4X1E A;  1EF4 A;  3HBL A;  1IG7 A;  1GVD A;  2M8G X;  2X9D A;  1RES A;  4XIC A;  1D5Y A;  2GM4 A;  4X6A J;  2JJ7 A;  2Y30 A;  3DCF A;  2YS9 A;  4JX6 A;  1NK3 P;  2HOS A;  1ZTR A;  1JKP C;  4BBS J;  1LE8 B;  5EZG A;  2XPW A;  4MFE A;  5IP6 A;  3TED A;  1MNM C;  3GTO J;  3BTJ A;  3S1N J;  3TW7 A;  4FE4 A;  4B4C A;  3CCY A;  4A3E J;  2R5Y B;  1MH4 A;  2JK3 A;  1QVT A;  1A6I A;  3RZD J;  4A3C J;  1K61 A;  3GTM J;  1OCP A;  2LKX A;  2DTZ A;  4I6Z A;  3B6C A;  3LSR A;  4DZJ A;  4AYB N;  1JUP A;  2R0Q C;  3HOU J;  4XRS G;  2O9L A;  4C3I J;  3E7L A;  3JRI A;  3HOW J;  2VKV A;  1FJL A;  3TP0 A;  4IHY A;  4JP0 A;  1ETK A;  4BXX J;  3ZQC A;  4M3D A;  2EH3 A;  1AU7 A;  2L7M P;  3BTL A;  1WH5 A;  3HOV J;  2XGD A;  4DYR A;  2QF7 A;  5FKN A;  4DYQ A;  4D7M A;  3ZQF A;  1GDT A;  2DJN A;  1IC8 A;  4A3K J;  2DA1 A;  2E19 A;  1APL C;  3BR2 A;  2E2H J;  3D1N I;  2XRL A;  4GFB A;  1JUS A;  4QIW N;  3HOY J;  2NVX J;  1YRN A;  4QTR A;  3MN2 A;  4QSH A;  5IP7 J;  1OCT C;  1UG2 A;  1U78 A;  3GTJ J;  4XRM A;  1JKO C;  5IYC J;  1MSF C;  3BQY A;  2R5Z A;  3BTI A;  1DU6 A;  2XGC A;  3C2B A;  2EZI A;  3JRD A;  3SFI A;  4B3A A;  3S2H J;  5F0C A;  5F04 A;  2Y2Z A;  1NK2 P; 
#chains in the Genus database with same CATH topology
 3FMS A;  2WAF A;  4L9J A;  2B7E A;  3BWG A;  3BT9 A;  2E1N A;  3TL4 X;  4A0Y A;  1EA3 A;  1I50 J;  3C18 A;  3G2B A;  5ILS A;  3I56 I;  3HRM A;  2WAQ A;  3HUG A;  3LST A;  3Q0V A;  1GVJ A;  1K4T A;  3NEU A;  2P7V B;  2R92 J;  4AIH A;  4ESB A;  4ZYH A;  1OR7 A;  1BJZ A;  1E2X A;  2V1N A;  2IS1 A;  5DEQ A;  4CHU A;  2DA5 A;  2L4A A;  2E2J J;  2H8R A;  3HTU A;  1HKQ A;  1CQT A;  1MDM A;  3OR1 C;  2L7Z A;  4FAS D;  3CCQ I;  4Y52 J;  3LA3 A;  2FXA A;  1KON A;  3L2U A;  4ZJZ A;  2GWR A;  4FTH A;  3FHN A;  4HNV A;  2ZSH B;  2XUB A;  1XG1 A;  4RB0 A;  3KIO A;  4NNJ A;  1MMS A;  2JA5 J;  1BR2 A;  2XF5 A;  3GFI A;  1ENH A;  1ITY A;  2HVR A;  1BW6 A;  4ZYG A;  1R00 A;  4V2F A;  1YFH A;  2G7U A;  4NC8 A;  1VQ9 I;  3ONQ A;  2Z99 A;  5JVG F;  1T95 A;  3CTA A;  4DBQ A;  5J3L A;  3T5X A;  1VND A;  1MJB A;  4JQF A;  1HQC A;  1PJR A;  4NBQ A;  1ETX A;  2DA6 A;  4BHB A;  4YFN F;  2GBY A;  3GVA A;  3Q3S A;  4XLH A;  4CCM A;  4J19 A;  4HF2 A;  3BLY A;  4OOI A;  5F64 A;  2PG4 A;  4CZZ A;  2FQ4 A;  5IP9 J;  2PLY A;  1X1P A;  3E5U A;  1X1B A;  1X1C A;  3WGG A;  2IGM A;  3AKZ A;  2IA0 A;  3BG9 A;  3J7Z I;  1RNL A;  3CCV I;  1VQ7 I;  3I64 A;  3I3L A;  2VN2 A;  1A35 A;  1LE8 A;  1R5I D;  2GQQ A;  5D6F A;  2VBZ A;  4HAM A;  2R7W A;  1YO5 C;  2ZXW H;  2XSD C;  1OCO H;  5E3N A;  1QPM A;  3NAR A;  5JFR A;  2LYC A;  2FD5 A;  1FY7 A;  1WHU A;  4IKF A;  1WRJ A;  2JRM A;  1HLV A;  3CDH A;  3PQK A;  2JA2 A;  3OYD A;  4MEY F;  4I99 C;  1S8N A;  4PSW A;  1IDZ A;  3E1S A;  4B3X A;  1BC8 C;  2M4K A;  2A3S A;  1T08 B;  4PZJ A;  5D4R A;  4KNY A;  3KZI C;  4B48 A;  1LDK B;  1RPW A;  5GAH J;  4MIM A;  1MND A;  3BG7 A;  1KU7 A;  3REO A;  1LVA A;  1BW5 A;  1LKX A;  2W82 A;  3LSG A;  3JRH A;  1USS A;  2NNY A;  5J6X A;  3OSF A;  2XIG A;  2DU9 A;  2CO5 A;  3PIO F;  2VL8 A;  2XKO A;  1YQA A;  4A69 C;  3SDB A;  1ODD A;  2ID3 A;  4BEH A;  3GTG J;  3S1Q J;  1YOV B;  1MKM A;  3FXK A;  5DV5 A;  4KIC A;  1Z3X A;  4GCV A;  4HQM A;  3DEU A;  3HGG A;  2XF7 A;  4UHT A;  1U2W A;  4XSZ F;  2PN6 A;  4LOC A;  4OIQ F;  2VOO A;  1Q1H A;  3GTL J;  5TGT A;  3PNY A;  1LPQ A;  1U8B A;  2Z9O A;  1G3W A;  3A02 A;  3E6D A;  5EEG A;  1XCB A;  2ECC A;  4KT5 C;  3NWT A;  4P96 A;  4ZH4 F;  4CUG A;  1U5T C;  2CRG A;  1SVM A;  1D0X A;  3L00 A;  2DPU A;  4AUX A;  3IP4 B;  3E5Q A;  1PUF B;  1A5J A;  3BTC A;  3DEE A;  2WWY A;  1U9N A;  4RAG A;  3HB9 A;  4AD9 A;  4KIG A;  1WJC A;  4HPQ A;  3WTY C;  5ICE A;  1Z77 A;  3BG6 A;  4PJJ A;  4EJW A;  1S72 I;  2O8K A;  4IRI A;  1P9Q C;  4XLE A;  4G7O F;  5HS7 A;  1D8J A;  1LEA A;  2FJ1 A;  2K9L A;  2FBK A;  5HS9 A;  3MCZ A;  2MLK A;  1FIP A;  3CUQ C;  3CMA I;  4C3H J;  2IEK A;  3ZQI A;  1Z1D A;  2HYJ A;  2WC2 A;  3CLO A;  1RRJ A;  3LA7 A;  3OIP A;  3CMM A;  1FTT A;  3ECO A;  3CCJ I;  2QVO A;  2VQC A;  2MC3 A;  1DGW Y;  1K83 J;  1R5H A;  3G6E I;  4IQJ A;  1MMD A;  2K9N A;  1W36 C;  4UY8 I;  1ETW A;  4D7N A;  1Y0N A;  1UMQ A;  2CH0 A;  2CU7 A;  2BVM A;  4OIP F;  1VTN C;  3KET A;  5LFA A;  5A2Q K;  5LGT A;  1T98 A;  2BVL A;  4FET A;  2VE9 A;  1IN8 A;  2XRN A;  2F4M B;  3K2A A;  2MA3 A;  2XB0 X;  1KYZ A;  1IJW C;  3HJE A;  2D5V A;  2LLK A;  1YYV A;  3CJR B;  2DI3 A;  5LGN A;  3IH2 A;  4HSR A;  2K86 A;  3CQZ J;  3OSG A;  4KT6 A;  4F3Q A;  2KT0 A;  1ZG3 A;  3GF2 A;  2XAS A;  3DU5 A;  4S0H B;  1I3A A;  2FX0 A;  2JTV A;  1VQM I;  2AQF A;  2H8W A;  5B1B H;  3A4C A;  1DP3 A;  1QHH D;  2NNN A;  1EH8 A;  3IUO A;  2CGP A;  5FKL A;  4HRI A;  1Z6R A;  4PUS A;  3HRS A;  2EWN A;  2MH2 A;  1H89 C;  5EDN A;  1JKQ C;  1Z21 A;  2DMN A;  4N4N B;  3ZR8 X;  3CES A;  2PMZ A;  2L9V A;  3J80 Z;  1K6O A;  4E70 A;  2M3A A;  5F1J A;  1XPX A;  1YIO A;  1WPK A;  1I27 A;  3ABK H;  5J1R A;  1YJW I;  1W5T A;  1J75 A;  4ZTF A;  1W5C C;  1K78 B;  4CCO A;  3TGN A;  1WVR A;  1HW5 A;  2X0L A;  2XV4 S;  2O8X A;  2Z3Y A;  5DS9 A;  1C0W A;  1CGP A;  3F72 A;  4U88 A;  1E3H A;  1XD7 A;  2CUF A;  2EA2 A;  2HDD A;  3TOB A;  3KLN A;  3FKJ A;  2K27 A;  1B4A A;  1HA8 A;  1U6G A;  3O3K A;  2RNG A;  2W57 A;  3LA2 A;  3QAH A;  2JT1 A;  5IY5 H;  2PMH A;  3OY9 A;  4N4O B;  2D45 A;  3V8J A;  3G1M A;  2V1X A;  3LFK A;  4M3G A;  1YRN B;  2P8T A;  2E2I J;  2FQ3 A;  3HEF A;  3M07 A;  3BG5 A;  5D8L B;  1UZC A;  4C2U A;  5D6E A;  1FSE A;  4XOT A;  3FDY A;  5LHH A;  2P6T A;  1O7L A;  3EUH A;  1R7J A;  2XF6 A;  3KP5 A;  3QOP A;  2X6Y A;  1DP7 P;  2ZXI A;  4MTE A;  4J01 A;  4CA0 A;  3IWZ A;  1UEL B;  1ZH5 A;  1P4X A;  4C2T A;  1D0Y A;  5L3G A;  1QRY A;  2YUS A;  3GW2 A;  5FJ8 J;  3J7Y J;  2DT7 B;  4IJA A;  3H9J A;  3CP8 A;  1Z05 A;  4UV8 A;  1XGS A;  1DPU A;  1FBQ A;  1SFK A;  5ERI A;  1RKW A;  3NAU A;  3ZQQ A;  2WV0 A;  4BYY A;  3FX3 A;  3A1Y A;  5LEK A;  3SZT A;  2P0W A;  1UAA A;  2I8D A;  1FOY A;  3BPV A;  3VB2 A;  2X1E A;  3CCS I;  1PUF A;  2A07 F;  1ZAO A;  3K7A J;  2ZNY A;  4A5N A;  4IHT A;  3ZOB A;  3Q9S A;  2NS7 A;  1S6L A;  1WQ2 A;  4I76 A;  4GDF A;  2JZY A;  3KP4 A;  2OPT A;  4KN7 X;  2ZME B;  1YG2 A;  5CPR B;  2F2E A;  2VB6 A;  2N8G A;  3IC7 A;  3QP6 A;  2OTL I;  1YTY A;  1RC9 A;  2MYS A;  2R7S A;  1T0F A;  5TIS C;  4AIJ A;  3I55 I;  1XSV A;  3BQZ A;  5DTD A;  2DA7 A;  3V8L A;  4E7L A;  3N4M A;  3G3Z A;  3SXY A;  3MWM A;  4BKX A;  2CFO A;  3PIP F;  1SMY F;  1KA8 A;  2W24 A;  1P6R A;  2KLO A;  3S15 J;  2XB5 A;  2FML A;  3RQI A;  2P6S A;  3BOQ A;  1MNE A;  1N78 A;  4XKW A;  4OIO F;  3ABM H;  2FOW A;  4RGR A;  3BJ6 A;  2BY3 A;  1GVD A;  4XON A;  3E97 A;  4NQW B;  1IN5 A;  3RKX A;  3RDI A;  4IF4 A;  3EPZ A;  1FMV A;  1D8K A;  3RIR A;  2O03 A;  3CCU I;  3DPT A;  3F9K A;  2LY1 A;  1B9M A;  2DDA A;  4NC6 A;  1JKP C;  3PUF A;  2GAU A;  2XC7 A;  5HLI A;  1W7P B;  3R6S A;  4FE4 A;  5FLX K;  1BI1 A;  4B4C A;  4KMF A;  1PP8 F;  1UB9 A;  4LG3 A;  1MH4 A;  2Q1Z B;  2JK3 A;  2CUJ A;  3F8M A;  1A6I A;  2FU4 A;  3RZD J;  3FXJ A;  3WU2 C;  2DTZ A;  3P7N A;  5JHU A;  4P9U A;  5L3B A;  3LSR A;  4DZJ A;  1MZB A;  2F48 A;  3V7C A;  1JUP A;  2R0Q C;  4DNC A;  1L0O C;  4KIS A;  2O9L A;  4MQ9 F;  2PX9 A;  4KDP A;  3JRI A;  4L5I A;  3CJQ B;  4RLF A;  3EYY A;  4D9J A;  2R7R A;  2XRO A;  4IHY A;  4JP0 A;  3IL2 A;  2E1C A;  1Z7L A;  4M74 A;  1K78 A;  2EH3 A;  2L7M P;  2YX4 A;  1IN7 A;  2XGD A;  3GFM A;  1ULY A;  4DYR A;  3HOV J;  3S3M A;  1ZLK A;  4D7M A;  3ZQF A;  4EQQ A;  4B8X A;  2I5U A;  4ZDL A;  4ZYD A;  4A3K J;  3FXQ A;  2A69 F;  2GIV A;  3BR2 A;  3L2V A;  4PDK A;  3EYI A;  3CZ6 A;  1QZY A;  5E18 F;  4X0G A;  1AWC A;  4Z6Y A;  5K5R A;  1JUS A;  2X4H A;  4QIW N;  3K4C A;  1XMK A;  1SFE A;  3OYM A;  2MLG A;  4DGW B;  4QTR A;  2Y48 A;  1YRN A;  4XBF A;  3IAS 2;  3IHU A;  4HQE A;  1O3R A;  4BQN A;  1OCT C;  4L9V A;  3I4P A;  1BOA A;  3GTJ J;  3CO7 C;  2EIN H;  1BBY A;  2DT6 A;  4ZC3 A;  1WJA A;  3HIF A;  1Z9C A;  4EJO A;  2CWE A;  2STT A;  2A6E F;  3WTV C;  2QYO A;  3B02 A;  2RQQ A;  2P5K A;  2ZC2 A;  4GYG A;  4II2 A;  5JVT A;  3CF5 F;  2L02 A;  4LB5 A;  2OJE D;  2OAZ A;  2FE3 A;  2F5D A;  3SZG A;  3HG9 A;  4TV7 A;  3I0T A;  1WJF A;  2HZT A;  4HF1 A;  5H20 A;  4RAY A;  2VC1 A;  2DOA A;  3FK6 A;  2KKO A;  3D0S A;  2Y9Y A;  2BBY A;  4Q4Z F;  4E7Z A;  3H5R A;  3KP6 A;  4RGX A;  5C3E J;  4M3E A;  1X3U A;  2HOA A;  2EPF A;  2LR8 A;  4XK4 A;  2O3F A;  3H0G J;  4U0W A;  2ZCW A;  1HW2 A;  4XR6 A;  4LB6 B;  2MSY A;  2JMW A;  2DTR A;  2YU9 J;  3TMO A;  3J7A O;  2IPQ X;  2ZME A;  2CUZ A;  4BHC A;  2H94 A;  2IGO A;  2K02 A;  5E17 F;  4BJ5 C;  1LNW A;  1X1D A;  5J1U A;  1FWZ A;  3WTU C;  3A01 B;  4A93 J;  2EFN A;  5E3M A;  5B5E C;  2G0E A;  2XAQ A;  2DN0 A;  3S1M J;  3CC4 I;  2LY9 A;  1Y8Q B;  2BHY A;  1AA7 A;  3VFZ A;  1IW7 F;  2LKS A;  1O4X A;  1DUX C;  1FBU A;  2AQE A;  2AO9 A;  5CJ9 A;  4ON0 A;  3QRF F;  4OIR F;  2R7F A;  4PGG A;  2WAQ N;  2IA2 A;  1TLH B;  2DO7 A;  4G7H F;  1XX5 A;  2BGC A;  3K1P A;  3VWB A;  1P2F A;  3DBH B;  3FK7 A;  3LSJ A;  5IT9 Z;  3WHC A;  3TDU C;  5C4X J;  4XRF A;  1R5G A;  2V1D A;  1TWH J;  1R1T A;  5C4J J;  3H5A A;  2Y9Z A;  5F08 A;  4NQW A;  2OC6 A;  1VQN I;  3MQ0 A;  1SFO J;  3I58 A;  2GA2 A;  1MBG A;  4Y4R A;  3JRC A;  1P4A A;  2Y31 A;  1FIA A;  2R93 J;  2P81 A;  2VC0 A;  3C7J A;  2HQN A;  1SD6 A;  3VSK A;  4C3J J;  2RAE A;  1B59 A;  1KU2 A;  4EJT A;  1XC5 A;  3F0C A;  1VQ8 I;  3ISP A;  2QZ8 A;  1PDN C;  3WOD F;  3CCR I;  4MQV A;  1Y39 A;  5LRS A;  4PK4 A;  3OYF A;  1W7P A;  3X2Q H;  3R60 A;  2DMQ A;  4P1W A;  3CMY A;  2NVQ J;  4IZZ A;  1G3Y A;  3MKY B;  2HVQ A;  1X3Z B;  2FOK A;  2IAI A;  1S7E A;  4HF0 A;  3LWF A;  2HQ5 A;  2QCO A;  1TWF J;  2KIF A;  4H4K C;  4XKC A;  3CCE I;  1S7A A;  3FXR A;  1TWG J;  1DPR A;  2DOF A;  2Q8K A;  3RSN A;  2L01 A;  1KGS A;  1UHW A;  3FBI B;  5DYM A;  4A3I J;  1RR8 C;  1WFX A;  1ZGW A;  4RM3 A;  2HVS A;  2PQ8 A;  3O8G A;  2X6W A;  3KYD B;  1QA6 A;  3HPG A;  2QEN A;  5B66 C;  2NAZ A;  3QQA A;  1BI2 A;  3K70 D;  1POG A;  3H3Z A;  4XN3 A;  3LMM A;  1JT6 A;  1V54 H;  2VXD A;  4WF2 A;  4HW0 A;  1LQ1 A;  1X1A A;  4EM0 B;  1KU3 A;  2JSP A;  3OWT A;  1ZLJ A;  4DBR A;  3CC2 I;  1TWA J;  1V5F A;  1UFM A;  5K1Y A;  3AL0 B;  1XS9 A;  1ZR2 A;  3ESW B;  4XLP F;  1Q1V A;  3SJM A;  2RDP A;  4RS8 A;  2HYG D;  1IO2 A;  5CVJ A;  1LFU P;  1HDP A;  2QGU A;  3L2Q A;  4LIV A;  1D0Z A;  1X2N A;  2J5O A;  3GZ5 A;  1IZ1 A;  2TDX A;  5CVI A;  1DDN A;  3DU6 A;  4ENM A;  1R9T J;  3EQL F;  4JX5 A;  2IS2 A;  1F9N A;  2OD5 A;  3OYK A;  2VJJ A;  4JOM A;  2COM A;  1TW3 A;  2VJI A;  3WGI A;  2DA3 A;  2E34 A;  4HBL A;  1ETO A;  5IYB J;  5D8K B;  2ZJQ F;  4IHX A;  3VYR B;  5FKM A;  4G7Z F;  5GAE J;  3FIW A;  5CYV A;  4U7D A;  1F36 A;  1P4W A;  4MLO A;  3M9A A;  1WCM J;  2CMP A;  2FNP A;  2LFB A;  3TO9 A;  3DTE A;  5E79 C;  1QHG A;  1HCR A;  4HLY A;  1XDS A;  1V5E A;  1LEB A;  2E1M C;  4ZZL A;  4I01 A;  4NDL A;  3OYG A;  1REP C;  4A3B J;  2FF4 A;  1Z6T A;  2TRT A;  4E7H A;  3H5N A;  3LSK A;  1U0J A;  3A01 A;  3JAM Z;  2DFF A;  4UVC A;  3IRQ A;  1I3Q J;  1KQ0 A;  1SC7 A;  5GTI C;  1A6Q A;  3F21 A;  1Z3Y A;  2MFZ A;  2X6O A;  3I53 A;  2F5E A;  3MZ8 A;  2R7Z J;  4AM3 A;  1K6Y A;  3M1C A;  2VPR A;  2PFB A;  2DYR H;  2LBF B;  1HDD C;  4I2O A;  5FKK A;  3GZ6 A;  1R23 A;  3FXU A;  2OCE A;  4B1R A;  2R3S A;  3ZP5 A;  6PAX A;  2R7T A;  5L3C A;  4MHG A;  5FLM J;  1R49 A;  3K70 C;  1ETY A;  4LG0 B;  3MEX A;  4Y15 A;  1TQI A;  2OU2 A;  4BAC A;  1W36 D;  3MKZ A;  1S29 A;  1XB4 A;  1FEX A;  1D3Y A;  2Z1D A;  1MBH A;  1JKR C;  2R7U A;  1QO0 D;  2OQR A;  2K7L A;  4AC0 A;  3M8J A;  4WXC A;  3D5L A;  1FBS A;  2M87 A;  2Z5U A;  4M6V A;  3ZQL A;  1OR7 C;  2BYV E;  1WJ5 A;  3K4L A;  1KQ9 A;  3MKL A;  1ZRD A;  1FLI A;  1B9N A;  5E1W A;  3CME I;  4IRG A;  2V4J C;  3HYI A;  2LY2 A;  5L3F A;  2H1L A;  3IH4 A;  3LSP A;  1H9G A;  2AXL A;  2JQ7 A;  3ERM A;  3E3V A;  2KL4 A;  4M3F A;  5BPD A;  2F6C A;  3PM1 A;  2KIM A;  3B6A A;  5FD5 A;  2M7B A;  3H1C A;  3GX4 X;  3GCM A;  3K4N A;  3GTQ J;  3HKZ N;  4LFU A;  4M73 A;  4AVZ A;  3W2A A;  2VLA A;  2BY2 A;  3EUA A;  3JRE A;  3KP7 A;  3H0D A;  2VUM J;  5F0F A;  5HNH A;  1AOY A;  2PMZ N;  4CDG A;  1ON1 A;  4I02 A;  2DMP A;  2R4G A;  2ADU A;  3W2V A;  1OYY A;  4BY7 J;  5M3M J;  3SEZ A;  4UNO A;  1ZRE A;  3S14 J;  4BXU A;  2OZU A;  4ABZ A;  1WH7 A;  2VAS A;  3SHF A;  3SQN A;  2ELH A;  5DD4 A;  1XGO A;  2COB A;  4IL6 C;  1S5L C;  2W48 A;  4UVA A;  3HOX J;  4ENK A;  3ABL H;  5EZH A;  3TQN A;  3OIQ A;  1TBX A;  2OUM A;  2CG4 A;  3TP3 A;  4YIR X;  3H3V K;  5FO5 A;  2UXX A;  1TT0 A;  4Y3O A;  1Z0X A;  1R1V A;  3BR1 A;  2LP0 A;  2M45 A;  1AHD P;  1R36 A;  4EM1 A;  2XKP A;  2BY1 A;  3TO6 A;  3B73 A;  3DP7 A;  3PO3 J;  3L1P A;  1W0T A;  4HV6 A;  2M34 A;  5HLG A;  4B44 A;  3C2G A;  4XLC A;  2CUE A;  2GIZ A;  3KCC A;  5KNL A;  2DFI A;  4HNT A;  3JTG A;  3G73 A;  2A5W A;  3A03 A;  4YEL A;  4G9Y A;  3GEZ A;  1SD4 A;  2CW0 F;  4B43 A;  1XDU A;  2YPR A;  3OR2 C;  1SAX A;  1ZRC A;  2OBP A;  1IN6 A;  4HX4 A;  2VBY A;  4WK8 F;  4MEX F;  3BG3 A;  3J80 K;  4BQO A;  3L9F A;  4BE0 A;  2VKE A;  2CV1 A;  2VI6 A;  3IH3 A;  3K2Z A;  3LOC A;  2NRA C;  3V8K A;  3ZN1 A;  3WTW C;  1MH3 A;  3SDG A;  3BZ6 A;  3OMY A;  1YW8 A;  4EEF G;  1OCZ H;  1IRX A;  3MZY A;  3ZN0 A;  3IRR A;  3S2D J;  2PJR B;  4A2U A;  2L9R A;  3RJP A;  3KEQ A;  1D5V A;  5J8C A;  3L09 A;  4AYB A;  1FP2 A;  4LD5 A;  4WCG A;  4BQA A;  2X9D A;  3W3C A;  1RES A;  1HKS A;  2L3D A;  1D5Y A;  1XN7 A;  2OZ6 A;  2FRH A;  2QQB A;  2LBF A;  3ZXS A;  1H9T A;  4ESJ A;  1ZHF A;  1ZEL A;  3H9Q A;  4R79 A;  4X6A J;  4I98 B;  4HG2 A;  2IP2 A;  3DCF A;  3HKZ A;  2HOS A;  1YS6 A;  4EV0 A;  2V79 A;  5AIP A;  5J40 A;  4HNU A;  4XMY A;  1QNT A;  5EZG A;  5L3D A;  3VYS B;  3GLX A;  4EVI A;  2D2W A;  5BQT A;  4UUV A;  5IP6 A;  1NG6 A;  3BTJ A;  1IN4 A;  4LG0 A;  4Y17 A;  3F8B A;  3TW7 A;  2EIM H;  1FPQ A;  2VE8 A;  3QYE A;  2Q2E B;  3CCY A;  3DKW A;  4BL0 B;  4F92 B;  2IS6 A;  2VT2 A;  3N97 A;  4U0V A;  1LDJ A;  3BZC A;  3HHG A;  4P55 A;  4BS9 A;  4A3C J;  4E7K A;  1D1A A;  2OQG A;  1Y6I A;  1IRG A;  2RC4 A;  2MD0 A;  2E71 A;  5HS8 A;  4QPO A;  3E7L A;  1Z91 A;  4LMY A;  4M9Z A;  4M6Y A;  2ETH A;  5JHF A;  1ETK A;  2E36 A;  2FA5 A;  3BP8 A;  4BXX J;  2W4S A;  3M1E A;  4FX4 A;  4M3D A;  3PSI A;  1EH7 A;  3BTL A;  1WH5 A;  2ISY A;  2ACJ A;  2E7X A;  3QU6 A;  4KJZ A;  3HSR A;  3MKW B;  1G6N A;  1T2K A;  4G6D A;  4PFP A;  2VOP A;  1T8I A;  3TBI A;  1RUO A;  2X1D A;  5F1R A;  1H0M A;  1PP7 U;  4OIN F;  2E2H J;  3D1N I;  5FB2 A;  1XGM A;  1I6X A;  1QQI A;  3FM3 A;  1PVE A;  4MNU A;  5CLS A;  1U3E M;  3HOS A;  2A6T A;  3L2C A;  4GFB A;  2HPM A;  3E6B A;  2XDV A;  3TOA A;  3K4J A;  1YI2 I;  5GAG J;  2NVX J;  4HOB A;  2HDC A;  2HEO A;  3MAJ A;  2X51 A;  4F7Z A;  3K9T A;  2UXN A;  1T6S A;  4LIT A;  3QWL A;  4II3 A;  3RTR A;  4CGZ A;  1BIA A;  2B0L A;  3ZMZ A;  2XAJ A;  1DU6 A;  3PL8 A;  3C2B A;  4L0Z B;  2HYF A;  2EZI A;  1W4M A;  3SZP A;  2F5C A;  1OCC H;  4B3A A;  4XOP A;  2IJL A;  5F04 A;  1O3Q A;  3COA C;  3KP2 A;  1NK2 P;  4L18 B;  4Q5S F;  4MO7 A;  2EIK H;  1G3S A;  3DXJ F;  3GME A;  4YRV A;  5F27 A;  2A61 A;  2HXI A;  1LFB A;  2NYX A;  4XN0 A;  3GLL A;  3P9I A;  2AS5 F;  4UB6 C;  3ZCO A;  1IRZ A;  2L9S A;  4PSX A;  4BXF A;  2ZJP F;  1F1Z A;  3HOZ J;  1J5Y A;  3M8E A;  3V4G A;  1WSU A;  9ANT A;  2V6C A;  2DCE A;  2E5N A;  5AON A;  5HDK A;  4L5E A;  3RZO J;  5KAF C;  1G2H A;  1R4N B;  3CC7 I;  4RGS A;  4AVP A;  5K7Z A;  2W84 A;  4Q48 A;  1O3S A;  5IYD J;  3PJR A;  5IOY A;  2DK5 A;  1UST A;  1SAN A;  4L9T A;  1OPC A;  4IX7 A;  2KMU A;  1IRF A;  1YW9 A;  1IUF A;  3WTT C;  4G94 A;  4XKB A;  3EUH C;  4C2M J;  5C44 J;  2ECB A;  1NG7 A;  4I7H A;  4XLF A;  3U1K A;  2P7C B;  2EV6 A;  4XLN F;  1JI8 A;  5FFX A;  2PJR A;  4RA2 A;  5HVQ C;  4IOC F;  2M0C A;  3MVP A;  3SFZ A;  3FM5 A;  3HSF A;  1AKH B;  2E5Z A;  4R8H A;  2STW A;  1BOB A;  2HR3 A;  4CSW A;  4XID A;  5M3F J;  1A31 A;  4RM2 A;  4RAZ A;  2MD5 A;  1FOW A;  4BJT A;  2O0Y A;  2HOT A;  3QPL A;  4XKV A;  1OLT A;  2RKH A;  1WGX A;  1RR7 A;  2KRH A;  3PFY A;  4LK0 F;  5DUI A;  2LSO A;  1H8A C;  2M0M A;  5FRM A;  4BU2 A;  4AWX B;  3S1R J;  1TQP A;  2P5V A;  2BW3 B;  2ELK A;  2XAH A;  4D5F A;  2I10 A;  4ZYA A;  5HLH A;  2Q2E A;  1T39 A;  4YIF A;  4BAY A;  1X58 A;  3L7W A;  1BR1 A;  5FRN A;  2HKX A;  2CW8 A;  3ZQH A;  1FYK A;  3H35 A;  3R0A A;  3E0J B;  1X19 A;  2DT5 A;  4PGH A;  2IBD A;  5E8I A;  2PI0 A;  2HWV A;  2KRC A;  5EGO B;  3OS0 A;  5DDG A;  3F22 A;  1JHF A;  1T0F C;  4A12 A;  4A3J J;  3KP3 A;  3OV8 A;  3I4M J;  2EZK A;  5K5Q A;  3ASO H;  1XMX A;  4P5O A;  1JHH A;  1G59 A;  3AFH A;  2LDU A;  1BR4 A;  1T38 A;  4XSX F;  2QQ8 A;  2BXZ A;  3WU0 A;  2G9W A;  1NHA A;  3IWF A;  4A0X A;  1DU0 A;  2GLO A;  2EB7 A;  2HXO A;  3JW4 A;  2R7Q A;  3BR3 A;  3T8R A;  3OYB A;  5LBQ A;  5KK1 A;  1K7A A;  1RI7 A;  1A36 A;  4IHW A;  2VJ4 A;  3V7R A;  1YJN I;  2K40 A;  3FMQ A;  3GBG A;  2M1B A;  1HC8 A;  3RPQ A;  3PSF A;  1DQU A;  1EH6 A;  2KQR A;  1KU9 A;  1O7F A;  5E1X A;  2ZSI B;  1HW1 A;  2ZB9 A;  2MW8 A;  5CKT A;  4FHT A;  2A68 F;  4B47 A;  1XSD A;  1QPI A;  3K0L A;  3I4N J;  1ZK8 A;  3M7G A;  5CVU A;  1ZR4 A;  4HZF A;  4CO8 A;  4ZDO A;  3BCA A;  1MMA A;  3ZPL A;  3UKG A;  2KDO A;  1P7J A;  2Y69 H;  2GOX B;  2LKP A;  1QBJ A;  3RPU D;  1S7O A;  2W00 A;  3K1N A;  1RUN A;  1BN5 A;  3IKV A;  5IT9 K;  2K5C A;  2MGQ A;  1OKR A;  1WI3 A;  3FWE A;  4XL9 A;  5LGU A;  2FMY A;  2V9P A;  4XQF A;  4MTD A;  1ZG1 A;  5H6Q A;  2CQQ A;  1BI3 A;  3BZK A;  2QSF X;  4XRS A;  4RMN A;  3J81 K;  3HL2 A;  1OJL A;  3MMY B;  5D5W B;  2L0K A;  1STZ A;  2LK2 A;  1ZAR A;  3WG9 A;  4ZDP A;  3GO5 A;  1EJ9 A;  1XTA A;  1H88 C;  3DFG A;  3DTK A;  4UXN A;  2QSG X;  3FMR A;  2L7K A;  1FYM A;  1TP4 A;  4BNC A;  4IXA A;  5HDN A;  3FXL A;  2OTJ I;  1J09 A;  2ZO4 A;  5M5X J;  2UWM A;  3P9K A;  2XGE A;  3VDX A;  4LIU A;  4XOR A;  1MBK A;  5LHI A;  2BEO A;  4CZC A;  2VJ5 A;  2X1C A;  3HGY A;  3HC7 A;  1FNN A;  4KYW A;  2CJJ A;  4A3D J;  3K4M A;  3DKY A;  1X4P A;  4YG2 F;  1ORK A;  5L3E A;  2CW7 A;  4EAT A;  3OIO A;  2QKL B;  2VIX A;  5CVR A;  4IO9 F;  2QKM B;  1LJ9 A;  2JWT A;  3BC8 A;  1IDY A;  3CDL A;  2RRE A;  5FFZ A;  1I39 A;  4CH7 A;  2IS4 A;  4WXD A;  1Y8R B;  3HHH A;  1ZN2 A;  4KMU X;  2J5P A;  1ZG5 A;  1AKH A;  5GAD J;  3VSL A;  1VQO I;  4UUT A;  2R7X A;  1P7I A;  5E8G A;  1CF7 B;  1R1U A;  2LNB A;  2Y0M A;  4RBO A;  3CP2 A;  2Y0S N;  3HRT A;  3FIS A;  2E60 A;  4RB2 C;  2F5F A;  2QM3 A;  5ICF A;  4E7S A;  2HTJ A;  2RN7 A;  3G1L A;  2HPI A;  1K4S A;  1U5T B;  4O6J A;  1YX3 A;  3H92 A;  5CQG A;  3ZQG A;  2BW3 A;  3J7A Y;  1IGN A;  3CCM I;  4M3B A;  2C6Y A;  4UVB A;  1E17 A;  3OYA A;  2DOE A;  3KZZ A;  3F8F A;  5GPC A;  2VON A;  1QZZ A;  2ESN A;  2E7W A;  3JTH A;  2LD5 A;  2ZME C;  4HEA 2;  1BL0 A;  3CUQ B;  5J8F A;  5F6F A;  5EGO A;  4QLC U;  5HOD A;  2HGC A;  4A3F J;  5JR3 A;  1JTY A;  3OL4 A;  4OU0 A;  3K6G A;  2CV0 A;  3ELK A;  1RZ4 A;  2G7H A;  2X6X A;  1OMI A;  3E6M A;  3AAF A;  1BM9 A;  1YW7 A;  5KHD A;  3U1D A;  2ZNZ A;  2XPU A;  2IT0 A;  3GFL A;  4NB5 A;  1R58 A;  5ICG A;  4GXO A;  4ASN A;  1LFP A;  2JA8 J;  2XAU A;  3RI4 A;  2HOE A;  3K1M A;  5BS6 A;  1VQL I;  2VXZ A;  3QPT A;  1MBF A;  2O7O A;  3F23 A;  2WB1 N;  5BNG A;  1I5Z A;  1TW2 A;  3P5J A;  2VPL A;  3QPH A;  2RNJ A;  3LFU A;  1SFU A;  2OV7 A;  2VQG A;  2EFP A;  1GUU A;  4IOA F;  1TZL A;  3S17 J;  3GTK J;  3I9V 2;  2ME6 A;  4E6K G;  2XHK A;  4XM3 A;  3RYP A;  3A0B C;  2AHQ A;  2M30 A;  3HTS B;  2JA6 J;  2HU9 A;  4A6D A;  3F8C A;  5DD8 A;  1FOK A;  3G4S I;  4UUS B;  1E3O C;  3QP5 A;  1Y0U A;  2MAB A;  2OF7 A;  2WA0 A;  3ZMT A;  2M4G A;  3FF5 A;  1SD5 A;  3DBR B;  3KEY A;  3ASN H;  3CCL I;  2DPD A;  1MIJ A;  4GYI A;  3C3W A;  1XMA A;  5K5O A;  2V9K A;  1U9O A;  3AG3 H;  1WZ2 A;  3LL7 A;  4YII A;  4RDU A;  3ERE D;  3CF2 A;  2M9H A;  3TW6 A;  2Y0S A;  3LNQ A;  4RLQ A;  3JRF A;  4BBR J;  3S8P A;  2NVY J;  2VBW A;  2VQH A;  2ZJ2 A;  4ETS A;  2LRD A;  2QSH X;  1N77 A;  3DEW A;  3VEP A;  4Y7N J;  2L4M A;  5EYR A;  3WU1 B;  1GV5 A;  3HDD A;  4M6X A;  2E1O A;  4H0E A;  3GTP J;  3FXM A;  2GOM A;  3HOT A;  4RAF A;  3RKW A;  4HDV A;  4BDY A;  1W0U A;  1A04 A;  2NS0 A;  2FBI A;  1MSE C;  2XPV A;  4W1U A;  1JTX A;  5DCM B;  3OS1 A;  2EZL A;  2VBX A;  1VQ6 I;  3S93 A;  2FSW A;  5FD6 A;  1S9H A;  2K4B A;  2KJC A;  2M8G X;  4GO1 A;  2ICW G;  3F6V A;  1MJ9 A;  4ANJ A;  2OCC H;  3ZMS A;  2JJ7 A;  3O6B B;  2IRF G;  4OMY A;  2BHZ A;  3RYR A;  3OYN A;  1MGT A;  2YS9 A;  4JX6 A;  3TDZ C;  1NK3 P;  3VOE A;  2QQ9 A;  1J9I A;  1BIB A;  3IAM 2;  4KIF A;  4WXH A;  3K69 A;  4MFE A;  1MNM C;  1CF7 A;  4ENJ A;  4I09 A;  2KRF A;  5J4Y A;  1OYI A;  2PEX A;  2R5Y B;  1JGS A;  1QVT A;  2PMU A;  2CQK A;  1OCP A;  2WB1 A;  1U5T A;  3JCU C;  2UV1 A;  4AYB N;  5GTH C;  4M9X A;  3WGH A;  3HOU J;  3LSI A;  1QU3 A;  3PFI A;  2MBF A;  4XNF A;  3UR3 C;  4XRS G;  3KX2 A;  5EEH A;  4BGD A;  2VKV A;  2NVU B;  5B1A H;  1IUY A;  3TP0 A;  2OA4 A;  2XAG A;  3DV8 A;  5DM6 F;  5D5X B;  1O57 A;  3CUQ A;  1E0E A;  3SEQ A;  5HNF A;  2D1V A;  2QF7 A;  1R6R A;  4DYQ A;  1J7K A;  4KUM A;  4BH9 A;  1YJ9 I;  1X4O A;  1S3J A;  5EJC A;  1IC8 A;  1FOX A;  4M71 A;  1XSX A;  2VQL A;  4G6Q A;  1TNT A;  1OCR H;  1OYW A;  1FP1 D;  4U87 A;  2XRL A;  2W25 A;  2L2O A;  4NC7 A;  3IKT A;  2W85 A;  1IV8 A;  5KVR A;  1OIS A;  1XCV A;  2QBY B;  3ZMD A;  1MW7 A;  1UHM A;  3E5X A;  1YE9 A;  2XSJ C;  3JSO A;  3HOY J;  1ZGJ A;  3C2H A;  4KIT B;  3MN2 A;  4QSH A;  1M1E B;  4A6E A;  5IP7 J;  2YU3 A;  4HX7 A;  3M8F A;  1UG2 A;  5FRO A;  1V5G A;  4R1H A;  2XAF A;  3W6J B;  1U78 A;  4XRM A;  3VYU B;  2LF7 A;  2CYY A;  2H09 A;  3BDD A;  3ZMU A;  2IXS A;  3LSM A;  2ESH A;  3ZQ7 A;  3R0J A;  5IYC J;  4EGY A;  5FGM A;  3BQY A;  1G3T A;  2L9N A;  3OYI A;  2K3P A;  3BTI A;  5H2F C;  1FSH A;  1V3F A;  2ZKZ A;  3DKX A;  2FEZ A;  3BY6 A;  3H3U A;  3GYH X;  2EA4 A;  2E35 A;  4UV9 A;  1LUJ B;  2K3F A;  5ILU A;  3JRD A;  3ML6 A;  4HDU A;  3SFI A;  5HLT A;  3DTI A;  5F0C A;  2Y2Z A;  2M2E A;  2V7F A;  2VT3 A;  2BV6 A;  3KYC B;  5D5V B;  4DW6 A;  1UCR A;  2LMD A;  3C1D A;  4IPA A;  2QUF A;  4N0B A;  1GT0 C;  4FCY A;  5HOO A;  1T33 A;  4UUS A;  2CFX A;  3KEO A;  3QU3 A;  1VQ5 I;  1LVK A;  1J0R A;  2DJI A;  3FXO A;  4CYC B;  2F5V A;  3K4K A;  1I1G A;  3QOD A;  3LSH A;  4CXF A;  2Y75 A;  4WX9 A;  5LD2 C;  3DPL C;  2EV0 A;  3T1B A;  5BOX A;  2A05 A;  1VQ4 I;  3Q0W A;  2WTE A;  4E7I A;  4JK1 X;  2DQL A;  4HST A;  1LDD A;  5D4S A;  4O3M A;  3CDI A;  3VOD A;  2GXG A;  2LRE A;  3BRO A;  2TCT A;  4RB1 A;  3F3X A;  3IV5 A;  1O3T A;  2IA1 A;  1TT5 B;  2DMU A;  1BA5 A;  2P5L C;  1SD7 A;  5HDG A;  4QPQ A;  1YIT I;  1V55 H;  2B9S A;  3Q9V A;  1IXC A;  2EFQ A;  1I6H J;  2ZFW A;  3PUB A;  4NHJ A;  3SYT A;  2V1U A;  2RV8 A;  5DCM A;  4FQG A;  2WV1 A;  3A0H C;  2L54 A;  3OL3 A;  4P9F A;  2LOO A;  4DQ2 A;  2X48 A;  5DM7 F;  1GLN A;  3D5S C;  3ZRG A;  3AL0 C;  1ZGA A;  1VFC A;  4ITV A;  4LLN A;  3JRG A;  3DWL E;  2UZK A;  2LVS A;  1D1C A;  1YX5 A;  3V7S A;  1F43 A;  4EJU A;  5F0H A;  4I0A A;  1QVU A;  3O8H A;  1MJA A;  4DYC A;  2VKD A;  3MZH A;  3S32 A;  1IV6 A;  2YSR A;  3VYT B;  1I1S A;  2WAE A;  5E1Z B;  2HZD A;  3CLQ A;  3KPH A;  1K79 A;  1MBE A;  2KIQ A;  2RVC A;  1JT0 A;  2B63 J;  3FKI J;  3GZN B;  3EUK L;  4G6T B;  2V6E A;  1TWC J;  2EK5 A;  4C9Y A;  2L7F P;  4D5C A;  4EM2 A;  1UHS A;  4S04 A;  5E20 A;  1DGR M;  2R5Y A;  2ID6 A;  2PBI A;  1WKM A;  2M8E A;  4F52 A;  2D1H A;  4CCL A;  4BDZ A;  3EDP A;  1WJD A;  2MG4 A;  2JVG A;  2RQP A;  3LQR A;  4CYD A;  5LLQ A;  1MD0 A;  2EQR A;  3M3Y J;  4W97 A;  5A2Q Z;  1X2M A;  2AXT C;  4AU7 A;  3CD6 I;  2Z16 A;  2NOG A;  1IF1 A;  3CJT B;  1B72 B;  5EG0 B;  2Z33 A;  4RB3 C;  1Z67 A;  1VI0 A;  2MH9 A;  2DA4 A;  4MGR A;  5KCM A;  1U8R A;  4GGG A;  4JBA A;  1TTY A;  5E3L A;  2HTS A;  2BOL A;  4BUP A;  1HOM A;  5BPI A;  1G4D A;  2M5W A;  4HA8 A;  1RET A;  2V26 A;  2ZJR F;  2YX7 A;  4G12 A;  3OS2 A;  1WJE A;  5BMZ A;  2NVT J;  1YIJ I;  3KE2 A;  1GXQ A;  2MC4 A;  2JN6 A;  3R61 A;  3KZY A;  3I59 B;  2DMT A;  4IEJ A;  5LHG A;  2QBY A;  4RGU A;  3W6V A;  1V4R A;  1KQ8 A;  1W1W E;  1ERD A;  2QLZ A;  4HX8 A;  1UJ8 A;  2FBH A;  3JR9 A;  1FYL A;  2JPC A;  1FT9 A;  4AIK A;  5FKO A;  2CQX A;  1XGN A;  2M7A A;  2Z2S B;  3P9C A;  2KZV A;  1TL8 A;  1ZKG A;  2QQA A;  2XGX A;  2KP6 A;  4V19 K;  1HF0 A;  1GV2 A;  5JLX A;  5IPA A;  2WBM A;  4F93 B;  2DW4 A;  4HV5 A;  1GHC A;  2EJR A;  1ON2 A;  3PNV A;  2IW5 A;  2IGK A;  3KLO A;  1LB2 A;  2KIS A;  2A6H F;  2R7O A;  1BJA A;  3ABU A;  4U7B A;  3N05 A;  4FT8 A;  3NQO A;  4KIB A;  4FE7 A;  3GXO A;  1JXS A;  4D1Q A;  4BY1 J;  3PO2 J;  1VF9 A;  4ESF A;  4CYC A;  5CVV A;  4DJA A;  4M9S A;  4KN4 X;  3H9G A;  3FHZ A;  2DA2 A;  3Q0U A;  3VPR A;  3O2P E;  1F5T A;  4KA4 A;  3D5R C;  3W2W A;  3HXL A;  2XVC A;  3ECH A;  1WI9 A;  1YHQ I;  2W7N A;  1BI0 A;  4WWC A;  5IT3 A;  5H6R A;  2NOJ B;  1P92 A;  2ZXJ A;  3BR0 A;  1B8I B;  4LGW A;  2PJP A;  2DFE A;  4JX4 A;  1R4M B;  4OWR B;  3W6K B;  4E7J A;  2ISZ A;  4PJ0 C;  3Q5F A;  2DLL A;  3HM5 A;  1Z7U A;  2H1K A;  4NUB A;  5LRR A;  3QPS A;  2K9S A;  3NWS A;  1ZQ3 P;  1HKT A;  3QYB A;  3RKY A;  4K2E A;  3HRU A;  4S05 A;  5E3O A;  2H6B A;  3GWZ A;  3U2R A;  5FLV A;  5KAI C;  1FC3 A;  1JJ8 C;  3LAP A;  1MBJ A;  3BR6 A;  3DF8 A;  1R22 A;  1L3L A;  1JGG A;  3TKY A;  2O61 A;  5IOZ A;  3S3N A;  2R7D A;  4PJL A;  3NRV A;  2HS5 A;  2LF8 A;  1N25 A;  4DIQ A;  5M5Y J;  3I71 A;  4FX0 A;  4IQ4 A;  3JRA A;  1W5S A;  2UUZ A;  1MMG A;  2HKO A;  3AG4 H;  4L5J A;  4GRI A;  2GXA A;  3LQQ A;  3GUD A;  2W1O A;  4FIS A;  2WAD A;  3OYH A;  2EZH A;  1GXP A;  4ENN A;  1G8X A;  1Y1V J;  2LTP A;  5TJJ A;  4HYE A;  2F4O B;  3M4O J;  2DFH A;  4ZZD A;  1Y1W J;  2GZW A;  2JUC A;  1ACI A;  2QWW A;  5CQE A;  2BXY A;  2DBB A;  1F4K A;  5K7F A;  4A3M J;  4IHS A;  2QEX I;  4XLA A;  2KHM A;  1X3W B;  1SVO A;  2K85 A;  1YS7 A;  2L5Q A;  1UG0 A;  5EEA A;  4C30 A;  5J4V A;  3K4B A;  3K10 A;  1SFX A;  3ZMV A;  3WTZ A;  3HZJ A;  4BHP A;  2KDZ A;  3FBN B;  4PJM A;  1N75 A;  1YLF A;  3OOU A;  1FMW A;  5EF6 A;  1JE8 A;  4A3G J;  1NTC A;  4L0Y B;  1FX7 A;  3WTS C;  1RIO H;  4IHV A;  2WY8 Q;  2CS3 A;  4EJV A;  2DOD A;  2E1M B;  3BR5 A;  1B72 A;  5EG0 A;  2ME0 A;  3F8N A;  4BE2 A;  1ETQ A;  1ZRF A;  1FZP B;  4N9H A;  2HFH A;  4M72 A;  3G1O A;  4PJN A;  3WHB A;  4EGZ A;  1RKT A;  3KYL A;  1TC3 C;  2CSO A;  5K7H A;  1VQK I;  2JSC A;  4YFK F;  2HNH A;  5DUK A;  2H27 A;  4KFC A;  5J1Y A;  4F55 A;  3CO6 C;  2QA4 I;  2IGN A;  3I59 A;  1BC7 C;  2DDB A;  2A5Y B;  5FLX Z;  4MFD A;  1JJ6 C;  3DPU A;  2R5Z B;  1JUM A;  1E3P A;  4A3L J;  3FZV A;  2KJB A;  1SMT A;  4Z2Y A;  3OYJ A;  4BE1 A;  2JUG A;  1D1B A;  3ZGK A;  3T8T A;  5ILV A;  4U0Y A;  3PNT A;  1FTZ A;  3U21 A;  2EFW A;  1B1B A;  2YR2 A;  3I5U A;  3RQ4 A;  2P4W A;  3BPX A;  5ICC A;  2FUG 2;  1T56 A;  4ZYE A;  3RCO A;  3MFK A;  1SVL A;  3S16 J;  4JYK A;  2JA7 J;  2ELJ A;  5M5W J;  3L2W A;  2CV2 A;  1J59 A;  2K9Q A;  2JVH A;  3DQV C;  1NH3 A;  4LJZ F;  4LLL A;  5LEJ A;  4V2G A;  2KIU A;  1EKE A;  2Q0O A;  3HUG B;  4LK1 F;  2KZG A;  3G71 I;  2EBI A;  1SEU A;  1WJB A;  3ROU A;  1IAW A;  1SAU A;  2HDW A;  4DZP A;  5DCF A;  1ETV A;  4YEJ A;  2NS8 A;  2FNA A;  1MDM B;  1MMN A;  4AID A;  2NXN B;  4CCJ A;  4ZTJ A;  2HI3 A;  4UB8 C;  2DYS H;  2O6G E;  1QGP A;  1Y56 A;  5B3S H;  1OFC X;  2ZBK A;  5GPA A;  3T0Y A;  1TNS A;  4CCN A;  1J2X A;  1B8I A;  2O5R A;  2VOD A;  1W7P D;  5JLW A;  2WY7 Q;  4BQQ A;  3JRB A;  3RKQ A;  1ONV A;  4D0P A;  2GA1 A;  3RPU A;  2R7V A;  4YFX F;  2LG4 A;  1TQM A;  1VQP I;  2F4I A;  3OYE A;  3A2K A;  5GP9 A;  1WWX A;  2DK8 A;  4X1E A;  2V9V A;  3WTX C;  1EF4 A;  2EFO A;  3HBL A;  1IG7 A;  4XIC A;  3JSP A;  4LLG F;  4L9N A;  2GM4 A;  1R71 A;  3BJO A;  4Q47 A;  2BE5 F;  2KFD A;  4J00 A;  4OAZ A;  3CUO A;  1HBX G;  2Y30 A;  1ZTR A;  3OYC A;  4BBS J;  2VKH A;  3DBL B;  1LE8 B;  2XPW A;  2ZXH A;  1KZH A;  2DXI A;  2HQA A;  3V42 A;  3J81 Z;  3TED A;  3GTO J;  3R4K A;  3BCB A;  4EMS A;  3BJA A;  4OAY A;  3S1N J;  3H36 A;  4Y13 A;  3AG1 H;  3S2W A;  3WE3 A;  1HSJ A;  2CQ7 A;  4DOZ A;  4A3E J;  3U9G A;  3EET A;  4PCQ A;  3GFJ A;  1K61 A;  4BJ6 C;  2LKX A;  3GTM J;  4A0Z A;  3WG7 H;  4I6Z A;  1QZE A;  3B6C A;  2BY0 A;  4F91 B;  5TRD A;  3F6O A;  1EV7 A;  2IVM A;  3KFW X;  2H6C A;  1ZYR F;  4C3I J;  5JI6 A;  1OQY A;  4A5M A;  3HOW J;  3E6C C;  2JPB A;  1FJL A;  2BZT A;  3ULQ B;  2ZFU A;  5D5U B;  3ZQC A;  3DLL F;  1AU7 A;  2K9M A;  4Y33 A;  2EV5 A;  3L2R A;  3S3O A;  3AG2 H;  3TO7 A;  1VZ0 A;  5FKN A;  1GDT A;  2DJN A;  4HLX A;  2DA1 A;  4IRH A;  2E19 A;  1APL C;  2HQR A;  5ED4 A;  1KYW A;  4N9I A;  2DAO A;  2EIJ H;  4G8X A;  1PYV A;  5AIQ A;  1IXR C;  4O5V A;  2GXB A;  4BEH B;  2LC2 A;  2LH9 A;  4I0B A;  3QYF A;  3OYL A;  4OMZ A;  4IVN A;  3JAM K;  3UNG C;  5J47 A;  3PQJ A;  4QWQ A;  3I54 A;  1PUE E;  3OOP A;  1JKO C;  4CCK A;  3LAJ A;  2KPM A;  4E4H A;  3MD2 A;  1MSF C;  2RGV A;  2R5Z A;  3QOE A;  2X85 A;  2JRT A;  4CIC A;  1B6A A;  2DQR A;  3HPH A;  3HSE A;  1HXD A;  4B09 A;  3DLA A;  2XGC A;  2K4J A;  3CJN A;  1IXS B;  2EIL H;  4PFO A;  3S2H J;  3WE2 A;  2CQN A;  1HST A;  3ABT A; 
#chains in the Genus database with same CATH homology
 2M2E A;  4MO7 A;  3FK6 A;  4DW6 A;  2Y9Y A;  3BT9 A;  5F27 A;  1GT0 C;  4FCY A;  2HXI A;  1LFB A;  1I50 J;  1T33 A;  4UUS A;  5C3E J;  4M3E A;  4CYC B;  2HOA A;  1IRZ A;  3Q0V A;  2LR8 A;  3HOZ J;  2R92 J;  4XK4 A;  9ANT A;  1BJZ A;  3H0G J;  2DA5 A;  2E2J J;  4L5E A;  2MSY A;  3Q0W A;  2H8R A;  2JMW A;  2YU9 J;  3RZO J;  1G2H A;  1CQT A;  2L7Z A;  4Y52 J;  5K7Z A;  5J1U A;  3A01 B;  4A93 J;  5E3M A;  4FTH A;  2TCT A;  4HNV A;  2G0E A;  3IV5 A;  2DN0 A;  5IYD J;  2DMU A;  5IOY A;  1XG1 A;  1BA5 A;  3S1M J;  2LY9 A;  1SAN A;  2JA5 J;  1ENH A;  1ITY A;  1BW6 A;  1IUF A;  4V2F A;  1O4X A;  1I6H J;  2AO9 A;  4C2M J;  5C44 J;  2ECB A;  2WAQ N;  2WV1 A;  5J3L A;  2X48 A;  1VND A;  2M0C A;  3MVP A;  3FK7 A;  3LSJ A;  1ETX A;  2DA6 A;  3WHC A;  2GBY A;  3Q3S A;  4J19 A;  5C4X J;  1VFC A;  1AKH B;  1TWH J;  5C4J J;  2Y9Z A;  4XID A;  5F08 A;  3JRG A;  5M3F J;  2FQ4 A;  5IP9 J;  2LVS A;  1SFO J;  1MBG A;  3JRC A;  1F43 A;  2Y31 A;  1FIA A;  2R93 J;  5F0H A;  2P81 A;  1QVU A;  3BG9 A;  3O8H A;  4DYC A;  2HOT A;  4C3J J;  2RAE A;  3QPL A;  1IV6 A;  1WGX A;  1RR7 A;  1LE8 A;  1XC5 A;  3F0C A;  1H8A C;  1MBE A;  2B63 J;  3S1R J;  1JT0 A;  3FKI J;  2ELK A;  1TWC J;  4D5F A;  2XSD C;  2L7F P;  2I10 A;  5E3N A;  4D5C A;  1UHS A;  1X58 A;  3NAR A;  2DMQ A;  3CMY A;  2ID6 A;  2FD5 A;  2R5Y A;  2NVQ J;  3ZQH A;  2IAI A;  1S7E A;  2HQ5 A;  2QCO A;  1TWF J;  1HLV A;  2MG4 A;  2IBD A;  1TWG J;  2EQR A;  5EGO B;  3M3Y J;  4W97 A;  1IDZ A;  1X2M A;  2NOG A;  4A3J J;  1B72 B;  5EG0 B;  3I4M J;  2EZK A;  1VI0 A;  2DA4 A;  4A3I J;  1ZGW A;  1RPW A;  3O8G A;  5E3L A;  4MIM A;  1HOM A;  1BW5 A;  2GLO A;  3QQA A;  1DU0 A;  3LSG A;  3JRH A;  1RET A;  2HXO A;  1POG A;  3OSF A;  4G12 A;  3BR3 A;  2NVT J;  4IHW A;  1JT6 A;  2K40 A;  2JN6 A;  4A69 C;  3GBG A;  2DMT A;  4IEJ A;  2ID3 A;  3GTG J;  3S1Q J;  3W6V A;  1TWA J;  2ZB9 A;  2MW8 A;  3JR9 A;  1XS9 A;  1ZR2 A;  3HGG A;  1Q1V A;  4LOC A;  3SJM A;  1QPI A;  3I4N J;  1ZK8 A;  1ZR4 A;  1LFU P;  1HDP A;  3GTL J;  5FKO A;  2CQX A;  1U8B A;  1X2N A;  3A02 A;  3UKG A;  1P7J A;  1ZKG A;  2ECC A;  1R9T J;  1HF0 A;  1GV2 A;  5JLX A;  4JX5 A;  5IPA A;  2MGQ A;  1WI3 A;  2CRG A;  4AUX A;  2CQQ A;  1PUF B;  2DA3 A;  5IYB J;  1A5J A;  1ETO A;  3BTC A;  4XRS A;  4IHX A;  1U9N A;  5FKM A;  1OJL A;  3HB9 A;  2L0K A;  2LK2 A;  1Z77 A;  3FIW A;  4FE7 A;  2O8K A;  1F36 A;  4BY1 J;  4MLO A;  3PO2 J;  1VF9 A;  1WCM J;  2FJ1 A;  4CYC A;  1H88 C;  2LFB A;  1FIP A;  4C3H J;  2IEK A;  2DA2 A;  3Q0U A;  3ZQI A;  2HYJ A;  3VPR A;  1HCR A;  5M5X J;  1FTT A;  4NDL A;  4A3B J;  2XGE A;  1B8I B;  3BR0 A;  1MBK A;  1K83 J;  4JX4 A;  2K9N A;  1ETW A;  2TRT A;  3HGY A;  4D7N A;  1UMQ A;  3A01 A;  2CU7 A;  3HM5 A;  2H1K A;  2CJJ A;  4A3D J;  1I3Q J;  2K9S A;  3QPS A;  1ZQ3 P;  1ORK A;  3K2A A;  5E3O A;  2XB0 X;  3OIO A;  2X6O A;  5FLV A;  1IJW C;  1JJ8 C;  2D5V A;  2R7Z J;  1MBJ A;  2LLK A;  3BR6 A;  2VPR A;  2JWT A;  3IH2 A;  1IDY A;  1JGG A;  3CDL A;  5IOZ A;  3CQZ J;  3OSG A;  1HDD C;  2KT0 A;  5M5Y J;  3JRA A;  5FKK A;  4S0H B;  2FX0 A;  4B1R A;  4FIS A;  1AKH A;  5FLM J;  2EZH A;  4UUT A;  1P7I A;  2LTP A;  1Y1V J;  5FKL A;  1ETY A;  4RBO A;  2Y0S N;  3FIS A;  3M4O J;  1FEX A;  1Y1W J;  1MBH A;  1JKR C;  3G1L A;  1H89 C;  5K7F A;  4A3M J;  5EDN A;  4AC0 A;  1JKQ C;  2DMN A;  3ZQG A;  1IGN A;  5EEA A;  4M3B A;  4M6V A;  3ZQL A;  5F1J A;  3MKL A;  1WPK A;  2KDZ A;  5GPC A;  5J1R A;  3OOU A;  5EF6 A;  2LD5 A;  1BL0 A;  1NTC A;  4A3G J;  3IH4 A;  3LSP A;  4IHV A;  5EGO A;  5HOD A;  4M3F A;  4A3F J;  1JTY A;  3BR5 A;  3PM1 A;  5DS9 A;  3B6A A;  1B72 A;  5EG0 A;  2ME0 A;  1ETQ A;  2CUF A;  2HDD A;  3GTQ J;  3HKZ N;  3G1O A;  3WHB A;  1RKT A;  2XPU A;  3JRE A;  2VUM J;  1TC3 C;  5F0F A;  3G1M A;  2JA8 J;  5K7H A;  4M3G A;  2PMZ N;  1YRN B;  2DMP A;  2E2I J;  3HEF A;  3BG5 A;  4BY7 J;  1MBF A;  5M3M J;  5J1Y A;  2O7O A;  3S14 J;  2WB1 N;  5BNG A;  4ABZ A;  1WH7 A;  4MFD A;  1JJ6 C;  2R5Z B;  1JUM A;  4A3L J;  2COB A;  1GUU A;  1QRY A;  2YUS A;  2W48 A;  5FJ8 J;  3HOX J;  3S17 J;  3GTK J;  1FTZ A;  5EZH A;  2ME6 A;  3TP3 A;  3H3V K;  1T56 A;  1Z0X A;  2AHQ A;  3S16 J;  3BR1 A;  2LP0 A;  4JYK A;  2JA6 J;  1AHD P;  5M5W J;  2JA7 J;  1RKW A;  3NAU A;  2K9Q A;  3PO3 J;  4UUS B;  1E3O C;  3L1P A;  4V2G A;  1W0T A;  2M34 A;  2OF7 A;  1PUF A;  2EBI A;  2CUE A;  3K7A J;  3ZOB A;  1U9O A;  2NS7 A;  3A03 A;  4I76 A;  4DZP A;  4RDU A;  2OPT A;  1ETV A;  2M9H A;  3TW6 A;  2NS8 A;  3LNQ A;  3JRF A;  4BBR J;  2N8G A;  2HI3 A;  2NVY J;  3BG3 A;  1OFC X;  3BQZ A;  5DTD A;  5GPA A;  3DEW A;  2DA7 A;  4Y7N J;  2VKE A;  5EYR A;  1GV5 A;  1B8I A;  2VI6 A;  3IH3 A;  3LOC A;  4BKX A;  3HDD A;  5JLW A;  2E1O A;  3GTP J;  3JRB A;  3RKQ A;  1MH3 A;  3SDG A;  1W0U A;  4EEF G;  3S15 J;  1MSE C;  2XB5 A;  2XPV A;  4W1U A;  3S2D J;  1JTX A;  3RQI A;  5GP9 A;  2EZL A;  2L9R A;  4X1E A;  1EF4 A;  3HBL A;  1IG7 A;  1GVD A;  2M8G X;  2X9D A;  1RES A;  4XIC A;  1D5Y A;  2GM4 A;  4X6A J;  2JJ7 A;  2Y30 A;  3DCF A;  2YS9 A;  4JX6 A;  1NK3 P;  2HOS A;  1ZTR A;  1JKP C;  4BBS J;  1LE8 B;  5EZG A;  2XPW A;  4MFE A;  5IP6 A;  3TED A;  1MNM C;  3GTO J;  3BTJ A;  3S1N J;  3TW7 A;  4FE4 A;  4B4C A;  3CCY A;  4A3E J;  2R5Y B;  1MH4 A;  2JK3 A;  1QVT A;  1A6I A;  3RZD J;  4A3C J;  1K61 A;  3GTM J;  1OCP A;  2LKX A;  2DTZ A;  4I6Z A;  3B6C A;  3LSR A;  4DZJ A;  4AYB N;  1JUP A;  2R0Q C;  3HOU J;  4XRS G;  2O9L A;  4C3I J;  3E7L A;  3JRI A;  3HOW J;  2VKV A;  1FJL A;  3TP0 A;  4IHY A;  4JP0 A;  1ETK A;  4BXX J;  3ZQC A;  4M3D A;  2EH3 A;  1AU7 A;  2L7M P;  3BTL A;  1WH5 A;  3HOV J;  2XGD A;  4DYR A;  2QF7 A;  5FKN A;  4DYQ A;  4D7M A;  3ZQF A;  1GDT A;  2DJN A;  1IC8 A;  4A3K J;  2DA1 A;  2E19 A;  1APL C;  3BR2 A;  2E2H J;  3D1N I;  2XRL A;  4GFB A;  1JUS A;  4QIW N;  3HOY J;  2NVX J;  1YRN A;  4QTR A;  3MN2 A;  4QSH A;  5IP7 J;  1OCT C;  1UG2 A;  1U78 A;  3GTJ J;  4XRM A;  1JKO C;  5IYC J;  1MSF C;  3BQY A;  2R5Z A;  3BTI A;  1DU6 A;  2XGC A;  3C2B A;  2EZI A;  3JRD A;  3SFI A;  4B3A A;  3S2H J;  5F0C A;  5F04 A;  2Y2Z A;  1NK2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...