1ZQ3P

Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.
pubmed doi rcsb
molecule keywords 5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3'
molecule tags Transcription/dna
source organism Drosophila melanogaster
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zq3P00
1UG2A 2X6OA 1JUPA 3WHCA 4DZJA 4C3JJ 2DMTA 2ID3A 1BJZA 5JLWA 1P7IA 2R93J 5FKLA 4BKXA 5K7HA 3E7LA 2Y9ZA 4MFDA 2ECCA 1ZK8A 1ZTRA 1UHSA 3BTIA 4JX4A 5C3EJ 3LSGA 1FJLA 2M0CA 3B6CA 2Y2ZA 3OOUA 1PUFB 1FEXA 1NK2P 5F1JA 3BR0A 2EZHA 3HOWJ 3HB9A 2K9QA 4BY1J 5GP9A 1HDPA 3TP0A 1FTZA 1RKWA 4V2FA 4JX5A 1VF9A 4UUSB 1Z0XA 5IP7J 4AYBN 1JT0A 2OPTA 5J1RA 2IAIA 3HM5A 2O9LA 3HOUJ 1DU0A 1AKHA 2JA7J 2EH3A 3SJMA 2QF7A 4M3GA 4BXXJ 3HDDA 2ME0A 4JX6A 3LSPA 3CMYA 1AU7A 5BNGA 2LVSA 3A03A 4FE4A 1VNDA 4W97A 1ZQ3P 2XGEA 2H8RA 3PO3J 1IGNA 2MGQA 2Y30A 3BQZA 2AHQA 2O8KA 3SFIA 4Y7NJ 5C44J 1TWAJ 2NOGA 1IDYA 3LSJA 3HOZJ 1MSFC 3GBGA 2R5ZA 2M34A 4FTHA 3BR1A 1HCRA 1B8IA 2XGDA 4S0HB 3GTKJ 3PO2J 2CRGA 2DMQA 1APLC 2VPRA 4BBSJ 5FLVA 3GTOJ 1TWCJ 4XIDA 1DU6A 2CQXA 3S16J 2IBDA 1X2NA 2KT0A 1LE8A 5IOYA 2X9DA 5J1UA 3MN2A 1MBJA 4FISA 1GT0C 1SFOJ 1WCMJ 1P7JA 2HQ5A 4A3CJ 1A5JA 3TW7A 4B1RA 1POGA 3QQAA 3TEDA 1WH7A 2LK2A 2DN0A 1Z77A 3JRCA 1MNMC 3K7AJ 1FIPA 1JJ6C 2VKEA 1YRNA 1ETVA 5IP6A 2EBIA 1JKQC 3O8GA 5FKMA 3FIWA 2E2HJ 2DMPA 1GDTA 2LFBA 3F0CA 1IUFA 1U78A 4RDUA 3JRAA 2Y9YA 1ETQA 4IHVA 5EG0B 1QRYA 2R5ZB 3HKZN 1Y1WJ 4A93J 1U9NA 2R0QC 3Q0VA 1HF0A 1B8IB 2ZB9A 2FD5A 1MBFA 3G1LA 1WGXA 3TW6A 4A3FJ 5E3MA 2DA7A 4A3JJ 3S1QJ 3BG9A 1T33A 4GFBA 2CUFA 3S15J 2NS8A 4FCYA 4QSHA 2K40A 5FKNA 1JJ8C 4DYRA 5FJ8J 1OCTC 1HOMA 1R9TJ 2E2IJ 3JREA 2LY9A 1LE8B 2E1OA 2XSDC 4CYCB 2NVTJ 1MBKA 3FK6A 1JKRC 3ZQIA 2K9SA 1MBHA 1QPIA 2P81A 3BR2A 1H89C 1X2MA 1CQTA 1B72A 3HOXJ 1X58A 4MFEA 4A3EJ 1EF4A 1E3OC 4DYCA 1VFCA 1W0TA 2L7FP 4DW6A 3GTQJ 3BTCA 2WV1A 2VI6A 3DEWA 5DS9A 2XPUA 2LTPA 1QVTA 2JA6J 2G0EA 4A3GJ 5HODA 3G1OA 1ETWA 2ID6A 2HXOA 4M6VA 1D5YA 1AHDP 4A3LJ 1YRNB 3CDLA 3JRFA 5IYBJ 2PMZN 2JA8J 2FJ1A 3S1MJ 2NVQJ 2XGCA 3BTLA 4FE7A 3A01B 1LFBA 1NK3P 5F0FA 3VPRA 3OSGA 1GV2A 4XK4A 1IC8A 1FTTA 3BT9A 1A6IA 5E3OA 4X6AJ 3ZQFA 3BG3A 4IHYA 4LOCA 2MG4A 2MSYA 1T56A 1GUUA 2CUEA 1VI0A 5EDNA 1MBEA 5EZHA 4AUXA 1TWGJ 1LFUP 1MH3A 3JR9A 4BY7J 1MSEC 3ZQHA 3Q0UA 2OF7A 1I3QJ 4M3EA 5M5YJ 5FLMJ 3HEFA 1HDDC 2JJ7A 1MH4A 4RBOA 2R7ZJ 2XPWA 4A3BJ 2LLKA 3WHBA 1NTCA 4XRSG 3JRDA 3BG5A 3L1PA 1F36A 3B6AA 2M9HA 3HGYA 2Y0SN 3CCYA 5GPCA 2E2JJ 3K2AA 4Y52J 9ANTA 3SDGA 2EQRA 2LP0A 3RQIA 2N8GA 4B3AA 5M5WJ 4A3DJ 2DTZA 5J1YA 1RKTA 1WH5A 5C4JJ 1JUSA 1IG7A 4I6ZA 1AKHB 2DA1A 1O4XA 1ZGWA 1ETYA 2WB1N 1OCPA 4C2MJ 2DA2A 4QTRA 1ETXA 4M3BA 2GLOA 5M5XJ 5EEAA 2JMWA 1G2HA 1JTXA 3H3VK 4DZPA 3S1NJ 1WPKA 2W48A 2WAQN 3MKLA 3ZQGA 2B63J 3IH3A 5M3MJ 2L0KA 3LOCA 3ZOBA 2CQQA 1ETOA 2LR8A 1PUFA 4AC0A 5GPAA 3IH4A 3JRHA 2YU9J 2DMNA 2X48A 2HYJA 1H88C 4UUTA 2Y31A 2R5YA 4XICA 2K9NA 1HLVA 3HOYJ 3PM1A 5C4XJ 2HOAA 4MLOA 3TP3A 1XS9A 4DYQA 5E3NA 1H8AC 4NDLA 1QVUA 1IV6A 3M4OJ 2CU7A 2AO9A 1ZR4A 1W0UA 1JUMA 4C3IJ 3ZQCA 2R92J 1RPWA 2COBA 1JGGA 5EF6A 4IHWA 4W1UA 3A02A 4A3KJ 2JN6A 2HI3A 4D5CA 5FKKA 5K7FA 3QPLA 1K61A 1RR7A 4BBRJ 2DA4A 5F27A 2CJJA 3GTJJ 1BW5A 3GTPJ 1JTYA 2XPVA 3GTLJ 5F0CA 2EZKA 1XC5A 3FK7A 2JWTA 1JKPC 2L7ZA 3I4NJ 1F43A 4IEJA 3ZQLA 4IHXA 1TC3C 1Y1VJ 2LKXA 4I76A 4JYKA 2YS9A 2ECBA 1OFCX 2EZIA 5EGOA 3RZDJ 2NVXJ 4HNVA 2EZLA 2MW8A 3Q3SA 2VKVA 3HGGA 4G12A 2DA3A 4QIWN 1ORKA 2L7MP 1IDZA 3CQZJ 4V2GA 1JT6A 3LNQA 2FQ4A 2RAEA 4A3MJ 2R5YB 2M2EA 1RESA 1IJWC 2TRTA 2H1KA 3S17J 3G1MA 4EEFG 2VUMJ 3S2DJ 4D7NA 5F0HA 2DJNA 1I50J 4A3IJ 3JRBA 2DA6A 3HBLA 4A69C 2I10A 4M3FA 1XG1A 2HOTA 1BA5A 1RETA 2XRLA 3Q0WA 1UMQA 5FKOA 1I6HJ 3S1RJ 2D5VA 2XB5A 3FISA 3NARA 2O7OA 4XRSA 1IRZA 2JK3A 1B72B 3O8HA 5F08A 3RKQA 1ZR2A 5EG0A 2QCOA 3MVPA 1WI3A 2JA5J 1ETKA 3LSRA 3W6VA 2IEKA 2GM4A 2FX0A 1TWHJ 2NVYJ 3BR5A 5K7ZA 1BL0A 2M8GX 3GTMJ 1K83J 1GVDA 1U8BA 5IPAA 3IV5A 3OIOA 5EGOB 1TWFJ 5DTDA 5F04A 4CYCA 4JP0A 3D1NI 4MO7A 3S2HJ 4L5EA 3GTGJ 2XB0X 2HXIA 4D7MA 1U9OA 1MBGA 2ELKA 2L9RA 1JKOC 1OJLA 2HDDA 3HOVJ 2YUSA 5IYCJ 2E19A 3FKIJ 4D5FA 2GBYA 4X1EA 4UUSA 3QPSA 2HOSA 1BW6A 3IH2A 3BTJA 5IOZA 3OSFA 5IP9J 1ENHA 3BQYA 5JLXA 2ME6A 3JRIA 5EYRA 2NS7A 1ITYA 3UKGA 3H0GJ 5J3LA 3JRGA 3M3YJ 1SANA 3C2BA 1FIAA 4MIMA 4B4CA 5IYDJ 2LD5A 3A01A 3I4MJ 3NAUA 2DMUA 4M3DA 4J19A 3S14J 1GV5A 5E3LA 3RZOJ 4C3HJ 4XRMA 1S7EA 1Q1VA 3BR3A 5M3FJ 2KDZA 1ZKGA 2TCTA 2DA5A 5EZGA 3BR6A 4ABZA 3DCFA
chains in the Genus database with same CATH superfamily
1RRJA 1UG2A 4KIFA 3VSKA 4B8XA 4EJTA 1BI1A 5CVVA 2CW8A 4ZZDA 1TQMA 3WHCA 3WU1B 2R93J 1BJZA 2V9VA 5L3BA 2K7LA 5FKLA 4BKXA 3E6BA 3E7LA 3U9GA 2P5KA 2F5FA 2ECCA 4NNJA 4L0ZB 5C3EJ 3J81Z 1A6QA 1PDNC 2M7BA 1ERDA 2WTEA 3OYIA 1PUFB 1I1SA 4TV7A 1MGTA 3DKYA 1BJAA 2EWNA 4ZZLA 4Z2YA 1ZG3A 5CVJA 2DODA 4IXAA 4UB8C 5GP9A 3MFKA 3ISPA 3DTEA 2QEXI 1IV8A 1FTZA 3HHHA 4V2FA 1IO2A 1DP7P 4ON0A 1GXPA 1VF9A 2EINH 5J1RA 4MTEA 3KP7A 2DPUA 3SJMA 4M3GA 3JAMZ 1YJNI 3I64A 4IVNA 3AKZA 1AU7A 5BNGA 4PJ0C 2QSFX 1R23A 4FE4A 4DQ2A 1YX3A 1VNDA 3M8JA 3DTKA 3QU3A 4P5OA 3KE2A 2XGEA 2H8RA 4KICA 2MGQA 2Y30A 4L9JA 5ILUA 4CYDA 3NRVA 1P2FA 1Q1HA 3MZHA 3SFIA 1HSJA 2EIJH 2WADA 4M9XA 2R3SA 4UY8I 2WAEA 2IS1A 3GBGA 3ML6A 4LFUA 5TGTA 4FTHA 2DXIA 4XKBA 2IS6A 1QPMA 5E79C 1MKMA 2K3FA 4HV5A 3V7CA 1B8IA 3GTKJ 4HAMA 1IW7F 2R7TA 1TBXA 2Z1DA 4LMYA 1TZLA 3GTOJ 1HQCA 5CPRB 1ZH5A 1DU6A 2OJED 4L9VA 4E70A 5BPIA 5LGNA 1F9NA 1SC7A 4ZC3A 2KT0A 2E5ZA 5J1UA 2A69F 5E8IA 4ZH4F 1RNLA 4YIIA 4FISA 1MZBA 1HKQA 1LVKA 2WC2A 3K4NA 2HVQA 1KU7A 3ZCOA 1TL8A 4GCVA 3C2HA 5HDNA 3M1EA 5D5UB 4ENNA 1YX5A 2HU9A 5LGUA 3I71A 1TT0A 5J4YA 4N4NB 4B1RA 2QVOA 3QQAA 1WH7A 5E18F 2LK2A 1XD7A 2FU4A 2NNNA 1YRNA 2OZUA 3A0BC 4P1WA 1S72I 4IOAF 3BG7A 1U5TC 2OQRA 2E2HJ 2I8DA 2F4MB 3GO5A 2MD5A 3DPTA 2LFBA 2QUFA 1GDTA 1WJDA 4DBQA 4RGXA 1IUFA 3VFZA 2Y9YA 3IKVA 1R4NB 1QRYA 1LNWA 1UFMA 2CQKA 5E8GA 3HRUA 1RC9A 3R0JA 4PSWA 2KHMA 4EMSA 1ZRFA 4A93J 3S2WA 3DLLF 1U9NA 2ZSIB 3EUAA 4L5IA 4HEA2 3Q0VA 1KZHA 4EM1A 3HOTA 3DV8A 1ZREA 1J2XA 2XAGA 3EUHC 1X1PA 2DA7A 4AIDA 2R7SA 2L54A 1T33A 4N9HA 2L02A 1S8NA 2CUFA 2EFNA 2MYSA 4WCGA 1G59A 4KMFA 4HSTA 2K40A 5D5XB 2VN2A 1AA7A 5DUIA 2QGUA 3B02A 5JVTA 2AS5F 3CJQB 4EJUA 1HOMA 2LY9A 4OAZA 1G3SA 2F5VA 1LE8B 3QU6A 5KK1A 3K4CA 3GW2A 3FK6A 1JKRC 3EDPA 2W57A 5L3DA 4BJTA 5DEQA 4Y13A 1H89C 1X2MA 3CJNA 4UVCA 3HOXJ 4A3EJ 2Y75A 4ANJA 1VFCA 4HZFA 1N77A 2R7XA 4IJAA 2X4HA 1W0TA 3M7GA 2H6BA 1QZEA 2JSPA 1YJWI 2Q2EB 4EV0A 3PUFA 1S7AA 3LSMA 3GMEA 3V8KA 1FSHA 4D9JA 5HDGA 4LJZF 1ETWA 2LG4A 3CC4I 3GYHX 3ZQQA 1KYWA 3CF5F 4A3LJ 3LFUA 2E34A 5J4VA 1Z9CA 3RI4A 2MH2A 2YX7A 4OU0A 5H6RA 2JA8J 2AXTC 2UWMA 2V1DA 3RKYA 2NVQJ 3L9FA 1KQ8A 2O8XA 2MA3A 3T8TA 2ESNA 2E1NA 1D3YA 3H92A 3MEXA 3OY9A 1K78A 1JHHA 3OSGA 1OR7C 1U2WA 3CCRI 3K4LA 2K9MA 2G9WA 1IC8A 3H36A 2R7VA 1IUYA 4X6AJ 1GLNA 4LOCA 2ELHA 5KVRA 4M6YA 1QHGA 1NH3A 2GOMA 4GGGA 2CUEA 4BQAA 1KU9A 1SFXA 1R58A 1MBEA 1ZYRF 4O3MA 1TWGJ 4N9IA 1UAAA 3Q0UA 3P9IA 5M5YJ 1KU2A 1BR4A 2KJCA 3C3WA 5CKTA 4RBOA 4A3BJ 2LNBA 2FEZA 1NTCA 3JRDA 4E7LA 3E6CC 1RUOA 4XBFA 4HDVA 1GVJA 3HKZA 2B7EA 2DYRH 3BZCA 4Y52J 2E5NA 3SDGA 2LP0A 1Z1DA 1I5ZA 1UELB 1X19A 2E71A 3HRSA 4O6JA 4ZYDA 2DTZA 3M8EA 5M5WJ 4A12A 4YG2F 4A3DJ 1RKTA 1ZAOA 3I4PA 1IG7A 2K85A 4ZYHA 2G7HA 2XDVA 3OS2A 2WB1N 3NWSA 1R1UA 4IZZA 4XN0A 2GXAA 3H5RA 1WVRA 3PQJA 2X0LA 1XSDA 3KP2A 3GZNB 3VYTB 2XROA 1XDUA 1Y56A 2DA2A 3ZRGA 2BW3A 4ESJA 2B9SA 2XKPA 5EEAA 4H4KC 1YG2A 4PDKA 2DLLA 1G2HA 3U21A 3LSTA 4LLLA 2ZFWA 3LA2A 1VQMI 2YU3A 1SVMA 1SMTA 4K2EA 1R5GA 4AC0A 3RIRA 2HQNA 1HSTA 3HSFA 5GPAA 3JRHA 2DMNA 2W1OA 4G7OF 1TQPA 4XMYA 4UUTA 2Y31A 1EKEA 4P9FA 1QU3A 4PCQA 1RUNA 2XAFA 3HOYJ 3PM1A 3AG1H 3BPVA 2W4SA 2X6XA 4DYQA 1DUXC 5D4SA 2R7RA 4MHGA 4RM2A 1QVUA 3L2VA 3WTSC 3GUDA 1BIBA 1ZR4A 1H0MA 4MEXF 1JUMA 4BACA 2CMPA 4CGZA 2R92J 2CFOA 2V6CA 2R7DA 1VQ5I 3OYGA 1TW3A 1KA8A 4G6DA 3HRTA 3J7ZI 2E1MC 4IHWA 1YJ9I 2L01A 3A02A 3MKYB 2BHZA 4A3KJ 3LL7A 2HTJA 1EH7A 4XKWA 4F3QA 1SFUA 1OMIA 3WTUC 1W7PA 3FXKA 4F91B 2A6HF 2X1EA 4FASD 1P6RA 2BGCA 1VQOI 1ZRCA 3FMRA 3CO6C 4HOBA 1BW5A 2MC3A 5F0CA 2QKMB 3FK7A 2JUGA 4BEHA 4P9UA 2HGCA 2KIQA 2ZMEB 4CCLA 4FT8A 2LKXA 4E7JA 4MTDA 1IZ1A 2YS9A 4JYKA 4BAYA 1OFCX 4IOCF 2EZLA 3K70C 2VKVA 2PEXA 2DA3A 2M45A 3H3UA 2BY3A 4YFXF 1JT6A 3LNQA 2VBXA 4A3MJ 2R5YB 1RESA 1ZARA 2H1KA 5D8LB 3VEPA 4A0XA 1G6NA 2XUBA 3K70D 1USSA 2ZNZA 2WAFA 4AU7A 2VONA 5DCMB 3E6MA 1I50J 4A3IJ 3HG9A 3HBLA 3I0TA 4U0WA 4A69C 2L4AA 1EV7A 4NC8A 3DP7A 2ZJRF 1STZA 2BBYA 1Z21A 1XG1A 4N0BA 1MNEA 1LUJB 2XRLA 3HTUA 5BOXA 2WAQA 4BHPA 5JFRA 3LQQA 2CW7A 5CQGA 1QA6A 2A6TA 3DBLB 1W5TA 2ZSHB 5HNFA 2FRHA 1ZR2A 2OZ6A 4IO9F 5JR3A 3CCLI 3MVPA 2Y69H 3ZP5A 2STTA 2OCEA 2DK5A 1S9HA 3LSRA 2CS3A 4UV9A 1G3TA 3W3CA 2VKHA 3OYKA 2DPDA 4BNCA 3BP8A 3ONQA 2JPCA 1YIJI 1K4SA 1K83J 5FLXZ 1HXDA 1FWZA 1YOVB 3IHUA 4U88A 3OIOA 3ZMDA 1TWFJ 2CFXA 1IN5A 2VT3A 2DO7A 1UJ8A 3DEUA 4CYCA 2FF4A 2ZJQF 1YO5C 1X4PA 5K5QA 2LF7A 2LY1A 4D7MA 1R7JA 1U9OA 2L9RA 3PNVA 4IHSA 2CYYA 3IL2A 5L3EA 3ABMH 3KEQA 3WTWC 5IYCJ 3DU6A 3HC7A 3OS1A 3NQOA 4D5FA 5FLXK 3ABTA 3K4BA 1HKTA 2P5LC 5ERIA 3P9CA 3IH2A 4YIFA 3BTJA 5IOZA 3OSFA 2E7XA 3ZN1A 3BQYA 3SDBA 2RQQA 3MZYA 1Z3YA 1O57A 3G3ZA 1ITYA 3H0GJ 4KN7X 2HZTA 1ZELA 1SANA 5D8KB 1RI7A 2A5YB 4B4CA 2BXYA 2LD5A 4XQFA 4KNYA 1FX7A 4M3DA 1J09A 4A6DA 3KLOA 3F6OA 1GV5A 3BG6A 5E3LA 3RZOJ 4CDGA 1DPUA 5ILSA 2RC4A 3HRMA 3VYSB 3F8NA 5M3FJ 4ENJA 4HNTA 1ZG1A 2O61A 3GLXA 3LAPA 1KONA 2IA0A 1KQ9A 3MZ8A 3CCUI 4GYIA 1SFKA 4B43A 3CZ6A 4BH9A 1JUPA 3GEZA 5HLHA 2HOEA 4EGYA 1TNTA 3F8FA 3CCQI 4OIRF 4MFDA 3LFKA 4JX4A 1UHSA 4CICA 2L2OA 3FXLA 5HLGA 1XCBA 2OU2A 4ZDLA 2ADUA 5DD8A 4V19K 1FMWA 4M73A 5F1JA 2EZHA 4E7KA 4BY1J 1O7LA 2EFOA 2VQCA 2Y0SA 2Z33A 1HDPA 1RKWA 2ELJA 5D5WB 4M9ZA 3ABUA 4AYBN 1JT0A 4NC6A 4U7BA 3RDIA 2JA7J 2QZ8A 3OYNA 3SXYA 1PVEA 2RNJA 3VDXA 3R0AA 1BOAA 1Z7LA 1FZPB 2LDUA 2ME0A 4JX6A 1Z6TA 3CMYA 2GA2A 2WWYA 3HUGB 2HNHA 3A03A 2F5CA 2ZBKA 2JUCA 3CMAI 2VQLA 4XRFA 3DFGA 5LEKA 2AHQA 5L3CA 2IT0A 2O8KA 1V4RA 3EUHA 1TP4A 4Y7NJ 2F4IA 2NOGA 2LH9A 3HOZJ 1MSFC 3M9AA 2R5ZA 2RNGA 1YW8A 2FMYA 4FX0A 1XSXA 2BEOA 1YQAA 2P4WA 3T5XA 1UHMA 4CCJA 5EJCA 1HCRA 3E5UA 3PNYA 4S0HB 1R5ID 4JK1X 3VODA 1APLC 2CV0A 4XOPA 4BBSJ 5FLVA 2KIFA 3I53A 3BWGA 4RGSA 1BI0A 1JHFA 4LK0F 4Y4RA 1IN8A 3IUOA 3S16J 2IBDA 1FYKA 4BDZA 2HKOA 3MN2A 4M72A 2W24A 2XF5A 2AXLA 1MBJA 2LC2A 1T95A 4WXCA 1VQ6I 1P7JA 1IN4A 3Q9SA 3KIOA 2XSJC 2ZJ2A 3F72A 3OYCA 1DP3A 1QO0D 3QOEA 4ZJZA 3TEDA 1J0RA 2XF7A 2ETHA 1ZLJA 2EIMH 2LSOA 3RCOA 2A6EF 5IP6A 5FKMA 3FIWA 1OISA 4GRIA 4CCNA 5LRRA 3WTYC 3W2WA 2XAJA 4II2A 1XGOA 1ODDA 3F3XA 1X4OA 3DU5A 4IHVA 3SEQA 1FPQA 2B0LA 1Y1WJ 3MMYB 4X0GA 2QQ9A 5J47A 1B8IB 4I02A 2ZB9A 3HPHA 3KYDB 3G1LA 5HOOA 3BDDA 4BQNA 2M0MA 3F8CA 5E3MA 1A04A 1SD6A 3S1QJ 2XASA 3BG9A 1VQ4I 1XX5A 3S15J 3DBHB 4XLHA 4A0YA 5FKNA 5ICCA 3QYFA 2D45A 2BV6A 2H09A 2DDAA 5FJ8J 1OCTC 2KPMA 3C2GA 4KJZA 5H20A 3WE3A 3PJRA 4GXOA 4QPOA 3IWZA 2XC7A 1D1CA 1R9TJ 1A35A 2FE3A 2E2IJ 4Y33A 3EPZA 2GXBA 5FD5A 2E1OA 1XMKA 4BDYA 2NVTJ 1PP8F 1MBKA 3U1KA 1T0FA 1QPIA 1JXSA 2KP6A 3I56I 1CQTA 1B72A 4XSXF 2P7CB 4I98B 2J5OA 4ENMA 6PAXA 4FETA 3S3MA 4RB0A 3EYYA 3FF5A 4R1HA 4D0PA 3BTCA 2X6YA 2WV1A 2VI6A 2BY1A 2XPUA 3M8FA 1BR1A 2BY0A 2JA6J 2F5DA 2G0EA 1JI8A 3V4GA 4DBRA 2ID6A 2FMLA 1YITI 4YEJA 5BMZA 1YRNB 1W4MA 3CDLA 3JRFA 1CF7B 1FC3A 4AM3A 3J81K 4E7HA 3E0JB 3S1MJ 2XGCA 3ZR8X 3FBIB 3R4KA 3H3ZA 1JGSA 3P5JA 2ZMEC 5B3SH 4F52A 2MLGA 1KQ0A 2JTVA 2W7NA 1OLTA 2FBHA 4ESFA 2H6CA 1A31A 2FA5A 2ZO4A 5E3OA 3OYMA 4D1QA 2GOXB 3MWMA 3BG3A 3H35A 2M30A 5BQTA 2MSYA 1MMGA 1GUUA 3JAMK 3CUQB 2Y0MA 2JA2A 1VI0A 4KMUX 1V54H 1VTNC 4MQVA 5EZHA 4NC7A 5BPDA 4AUXA 3O3KA 3QPTA 1XB4A 1ZGAA 1LFPA 2RVCA 2E36A 2OF7A 4RAYA 3PL8A 4PGGA 3IRQA 1MH4A 2UZKA 4XRSG 3B73A 4PFPA 1BIAA 2OV7A 2FOWA 5D6FA 1USTA 2Z99A 4R79A 2PJRB 5D5VB 1SAUA 4KA4A 5GPCA 2E2JJ 4OMZA 3ERMA 9ANTA 2IJLA 3I9V2 4B3AA 1XPXA 2P7VB 2HPIA 4I6ZA 1AKHB 3OS0A 1O4XA 2DT5A 4HX8A 1HA8A 2LYCA 5IT9Z 2HVRA 3H5NA 3RPQA 3BJOA 2DTRA 2F5EA 3DBRB 3OIQA 4IQJA 3AL0B 1W36C 2X1CA 5M5XJ 2OTJI 1U0JA 2QBYA 1LDKB 1JTXA 3H3VK 2ZNYA 3S1NJ 3C7JA 3ZQGA 2PI0A 2COMA 5FRNA 2L0KA 3LOCA 3DKWA 2CQQA 1ETOA 2QKLB 2LR8A 4HNUA 4BXFA 1MNDA 1PUFA 4LIUA 2DFIA 3F6VA 5B1BH 3GFIA 3OOPA 5DM7F 3KEOA 3SFZA 1J59A 4XICA 2KMUA 2K9NA 1ULYA 1HLVA 3GFLA 3OYEA 3P7NA 4KN4X 1NHAA 5FRMA 3TP3A 1XS9A 1EH8A 5E3NA 2PG4A 1BI3A 1UZCA 4WXDA 1S29A 4XONA 2CU7A 4C3IJ 4F7ZA 2A61A 3HSRA 4G6QA 3Q9VA 5HNHA 3AG2H 2IVMA 1JGGA 2V1XA 3QOPA 4W1UA 1IRFA 3MD2A 4UVAA 2KL4A 2A5WA 4MGRA 3D5SC 2HI3A 1RR8C 4LIVA 3Q5FA 2RQPA 3QPLA 3JCUC 5DM6F 1RR7A 1Y8QB 2M8EA 1BC7C 4CO8A 2VJJA 2OCCH 4L9TA 3FXUA 3I4NJ 2HTSA 3ZQLA 1HBXG 1TC3C 2HEOA 2GIZA 1KU3A 5ILVA 4BYYA 2EZIA 5EGOA 2MW8A 2XKOA 3Q3SA 4G12A 3KYCB 3FXJA 3MQ0A 3S3OA 4V2GA 2EILH 4CA0A 3MKZA 4LLNA 4CUGA 1K79A 2OD5A 1FP2A 3S17J 4HQMA 1P4WA 2OA4A 2VUMJ 3S2DJ 4D7NA 3DF8A 1VQ8I 2O5RA 5F0HA 4KISA 3G6EI 1P9QC 2WB1A 1WJBA 1ON1A 1LB2A 2DA6A 4DGWB 4DNCA 5HDKA 4AD9A 1R1TA 5K5OA 1YS6A 1E0EA 3OMYA 2R7OA 1RETA 5F6FA 1FBUA 1UMQA 3H1CA 2IRFG 2M7AA 4EATA 5FKOA 3S1RJ 2D5VA 2XB5A 1E2XA 2ZCWA 2O7OA 1IRZA 4PUSA 1E17A 1BC8C 4M6XA 2DBBA 1MJ9A 1W7PB 3IP4B 4ENKA 5F08A 1OCRH 3RKQA 4ZTJA 2VJ5A 4M71A 4NHJA 2OBPA 5TJJA 3ESWB 1T39A 1WI3A 2M3AA 4U87A 1Z6RA 5DD4A 3CC7I 2FX0A 4OOIA 3FHZA 1TWHJ 1OKRA 3VYRB 2MC4A 2NVYJ 3R6SA 5FB2A 3KP4A 1XMAA 2BVLA 1V3FA 2VOOA 1GVDA 4IF4A 2EPFA 2WBMA 4WXHA 5A2QZ 5IPAA 1I27A 4F92B 3LA7A 3FXQA 1AWCA 4CH7A 4XOTA 3LAJA 3ELKA 4JP0A 3MAJA 1MMDA 4L5EA 1X3WB 4Y17A 3DLAA 1NG6A 3RYRA 1SVOA 3DQVC 5H6QA 4L5JA 1MBGA 2ELKA 2Z5UA 3KLNA 1HC8A 2HQAA 1JKOC 1XMXA 1QZZA 2EFPA 3HOVJ 2YUSA 2XVCA 2E19A 2Q2EA 4L0YB 1SMYF 2WV0A 4X1EA 2D1HA 3W6JB 5BS6A 4UUSA 3CJRB 1P92A 3CDIA 3HIFA 2ZJPF 1D8JA 3RYPA 1BW6A 1G3YA 3A2KA 4J00A 2DFEA 5IP9J 2M4KA 2VQHA 2ME6A 3WTXC 2K86A 5EYRA 3I59B 2R4GA 4QWQA 5DYMA 2RV8A 3JRGA 3K2ZA 1FOWA 2VBYA 4KYWA 3H0DA 2RKHA 4YFKF 1D0XA 1E3PA 1LVAA 4IKFA 3QWLA 3SZTA 1K6YA 4E7IA 3PSIA 3I4MJ 2UV1A 1UB9A 2DMUA 4G6TB 3CTAA 2A3SA 4EM2A 2F2EA 1I3AA 4IQ4A 3V7RA 4PFOA 1QGPA 1IF1A 4RB3C 5TRDA 5EZGA 4F93B 3L09A 3PFYA 4AVPA 3F23A 3DCFA 2AQEA 2CO5A 2X6OA 4F55A 3K1PA 4A5NA 3KP3A 5HVQC 4C3JJ 2DMTA 2HDWA 1T38A 2ID3A 3T1BA 5JLWA 1P7IA 5K7HA 3OV8A 5E1XA 1SVLA 1ZK8A 1OYYA 1ZTRA 3J7AO 3E97A 3LSGA 1BM9A 3B6CA 3FMSA 2GIVA 2K4BA 4Z6YA 1SD7A 4NBQA 2XRNA 1FOKA 1FEXA 1NK2P 5CQEA 2YSRA 4KUMA 4AWXB 4Q5SF 3HOWJ 2GXGA 2K9QA 1OPCA 4XLCA 4YELA 2BY2A 3OL3A 4OAYA 2H27A 2QM3A 1Z0XA 5IP7J 1X1BA 2OPTA 3PNTA 4UUVA 3OR1C 1BN5A 2IAIA 2DFHA 3HM5A 5JHUA 1VQLI 4I7HA 3KP6A 2VT2A 2EH3A 4H0EA 2QF7A 2KLOA 2P6SA 1WJCA 1SAXA 3IAM2 3FHNA 4Q47A 4AIJA 3ROUA 3QP5A 2KRCA 4W97A 4RAFA 2DDBA 2PMUA 5J8CA 4OMYA 3ZGKA 1IGNA 2IA1A 3K4MA 4GO1A 4LD5A 2VPLA 5C44J 4LG0A 2BYVE 4RAGA 1TWAJ 1IDYA 3LMMA 3TKYA 3R61A 4M9SA 1T2KA 3G4SI 5JHFA 1K6OA 1XGSA 4XN3A 2L9SA 2XGDA 5J8FA 3PO2J 4PJNA 4BE1A 1SEUA 1MDMB 2CGPA 4AIKA 3WGHA 4B3XA 1MIJA 2F48A 1TWCJ 4XIDA 4HLYA 3FWEA 3CUQC 2R7WA 1YW7A 1T6SA 2M4GA 5J40A 4RB1A 1WSUA 1X2NA 3TQNA 2KRFA 3WODF 4RA2A 2LBFB 2IGNA 2E60A 1REPC 1QNTA 1BR2A 3PSFA 2NRAC 4OIPF 1YYVA 2XAHA 2KRHA 4DOZA 2Q0OA 1SFOJ 1WCMJ 3L2QA 3K1MA 4A3CJ 5FO5A 1WJ5A 2JVGA 3N97A 2KDOA 5CYVA 1I6XA 3OL4A 2K02A 3ZQ7A 3SEZA 4WK8F 3WTZA 3VSLA 1YIOA 3E3VA 3HZJA 2DN0A 3JRCA 1MNMC 3QYBA 3TBIA 3COAC 1LJ9A 3K7AJ 1JJ6C 4ZDOA 3LQRA 2E35A 3ASNH 2V79A 4S05A 3WG9A 3R60A 2XAQA 1Z3XA 4XLFA 2HYGD 3EETA 2DMPA 1N25A 2DU9A 2DAOA 3BJAA 2X51A 3FX3A 5H2FC 1U78A 4RDUA 3JRAA 3AL0C 2GAUA 3TO9A 5EG0B 1PUEE 2R5ZB 2DI3A 2FOKA 2VKDA 1HF0A 4AYBA 1ONVA 2FD5A 5GAHJ 4CZCA 2DOEA 3BZ6A 3TW6A 3WGIA 3H5AA 1X1DA 2QSGX 1KGSA 3S8PA 3L2CA 3I55I 4GFBA 2NS8A 4FCYA 3K6GA 2DT7B 2W85A 3HTSB 4OINF 4NQWB 3N4MA 3GZ5A 4XORA 1FP1D 3ZQIA 1EA3A 5FFZA 1ON2A 5HLIA 1EF4A 1VQNI 1E3OC 4DYCA 3CD6I 1GHCA 5LEJA 2NS0A 1G4DA 4G94A 4DW6A 3GTQJ 1TT5B 2EV5A 2BE5F 1V5FA 4HSRA 3DKXA 2LTPA 3F9KA 1QVTA 1VQPI 2V1UA 3C18A 3L2WA 2L3DA 3KZIC 3AG4H 1K4TA 2WA0A 3G1OA 2HR3A 2HXOA 3GVAA 2NOJB 1U3EM 1D5YA 3GLLA 1D0ZA 1U5TA 1U6GA 5IYBJ 2PMZN 3PFIA 1EH6A 2IA2A 3BTLA 4FE7A 3TO6A 1QBJA 3A01B 1LFBA 1NK3P 2WY8Q 4GDFA 1P4AA 3VPRA 4L18B 4CSWA 5J6XA 3CCEI 2ZXHA 4ESBA 1B6AA 1H9TA 2V9PA 4UV8A 3BT9A 5ICFA 2X1DA 3TO7A 2BZTA 3ZQFA 4IHYA 5LBQA 2MG4A 4LITA 3CO7C 3CMEI 1F4KA 1FY7A 4HA8A 5EDNA 4A6EA 4G9YA 5GTIC 4EVIA 2UUZA 4BU2A 1L0OC 4I0AA 3WU2C 1MH3A 5AONA 3CCJI 4BY7J 1ZRDA 1MSEC 3CJTB 1HW5A 2VC1A 4CHUA 4M3EA 5FLMJ 1T98A 3TDUC 4G7HF 3HEFA 1HDDC 2R7ZJ 2VL8A 3OYLA 4CCKA 3BG5A 1YS7A 3GX4X 2H8WA 3VWBA 2IGOA 1DPRA 4I2OA 4C2UA 1R4MB 2Y0SN 1Y0NA 3QPHA 2FSWA 2N8GA 2DQRA 3OYHA 1H9GA 1I1GA 2GWRA 5IT3A 4AVZA 3EUKL 3NEUA 2UXNA 1R00A 4E7SA 3ERED 2K5CA 2Q8KA 1ZGWA 2KIUA 2CV1A 4ZYGA 1G8XA 2DK8A 3KETA 1LQ1A 2E7WA 1ETXA 4A5MA 4PJMA 4UXNA 1WWXA 3DPLC 2JMWA 5CVIA 2VOPA 3J7YJ 1WPKA 1WQ2A 2W48A 3MKLA 3HOSA 3SHFA 2VODA 3J80Z 3IH3A 1OR7A 4DIQA 1G3WA 2Z2SB 3ZOBA 2VB6A 2ISZA 2YU9J 1DGRM 4XLAA 1FOXA 5D6EA 1H88C 2EA4A 4BXUA 5JI6A 2AQFA 2L5QA 4FX4A 3QAHA 4XKCA 2LY2A 3V42A 4MLOA 3OYAA 1H8AC 4IRGA 1DDNA 3BCAA 3S32A 5LLQA 4Y3OA 3M4OJ 1VQ9I 1W0UA 5CVUA 2BOLA 2CG4A 2LKPA 2IXSA 4EJVA 4BQQA 2VBWA 3BROA 4RM3A 3FKJA 3DXJF 2XF6A 4ZDPA 2KQRA 3GFMA 1J5YA 2M5WA 3ABLH 2YX4A 1CGPA 5FKKA 5K7FA 2P6TA 2EA2A 4BS9A 2O03A 3ZPLA 3SZGA 3ECHA 2CJJA 2JSCA 2L9NA 4B48A 2XV4S 3GTPJ 1JTYA 1ZHFA 3M07A 1PJRA 2EZKA 4PK4A 2JWTA 4HQEA 1JKPC 1F43A 2OAZA 2QSHX 2QBYB 1IN7A 2CQNA 2Y48A 1Y1VJ 4BJ6C 1S3JA 5HLTA 3WTTC 2ESHA 5B1AH 4ETSA 3REOA 2ECBA 2RGVA 1T8IA 2NVXJ 1SD5A 2EFWA 4HNVA 4RLFA 1R36A 3HGGA 5AIQA 4QIWN 1IDZA 1ORKA 2DJIA 3CQZJ 4HBLA 3ZMVA 2LREA 2F6CA 2KIMA 2M2EA 4KT6A 2TRTA 2VQGA 2MD0A 2V4JC 4LG3A 2JPBA 4NUBA 2KZVA 3QYEA 2QLZA 4EEFG 3MCZA 4YFNF 2O6GE 4U0YA 2DJNA 2EV6A 3JRBA 4EGZA 3RSNA 4EJOA 1N75A 2ZXWH 2I10A 2JT1A 2PQ8A 2OC6A 3SZPA 2QQBA 4ZYAA 3WTVC 3QRFF 4IL6C 1XTAA 1BA5A 2PLYA 3Q0WA 5GTHC 2ACJA 2QQAA 1J7KA 1Z67A 3MKWB 1I6HJ 1IAWA 2A05A 3F8MA 1X3ZB 3IKTA 4XRSA 2DW4A 2L4MA 2JK3A 2VC0A 2IS4A 3CESA 4RLQA 3O8HA 2FBIA 3KCCA 1IXSB 1FT9A 1MW7A 2QCOA 3KZYA 5E1ZB 4XM3A 4J01A 2E1CA 5E17F 3FM3A 4JBAA 1KYZA 4JOMA 1V5EA 2DQLA 3DEEA 4HF0A 4CCOA 2IEKA 1W5SA 2A07F 1YHQI 1NG7A 4HG2A 4AIHA 3BR5A 5K7ZA 2DFFA 2M8GX 4I99C 2HVSA 4XLPF 3E1SA 2IPQX 4Q48A 3FMQA 2BVMA 2K4JA 5FGMA 5EGOB 2NVUB 2VIXA 2R7UA 5DTDA 1B1BA 5F04A 1SD4A 2H1LA 2DYSH 3C1DA 3ABKH 4XLEA 3S2HJ 4HLXA 1GXQA 2HFHA 1K78B 2JRMA 2HXIA 1SFEA 1WJEA 3CLQA 1W36D 3TDZC 3W6KB 2CH0A 1OJLA 2HDDA 2LOOA 3RKWA 1QHHD 3FKIJ 2GBYA 2GZWA 1FYMA 5IT9K 1B9NA 3OYDA 3QPSA 5B66C 2D2WA 5F1RA 4LB5A 3WG7H 1ENHA 5JLXA 2KKOA 1CF7A 3JRIA 2NS7A 4ASNA 2PN6A 3PIOF 1Y0UA 3KEYA 5J3LA 1Y6IA 3M3YJ 5FD6A 1OCCH 2FNAA 2DCEA 2STWA 1F1ZA 4KFCA 2MLKA 3C2BA 2KFDA 1BI2A 1FIAA 4MIMA 3RPUD 2PFBA 3V8JA 3ZMTA 4EJWA 4S04A 3G73A 3TOAA 5IYDJ 3NAUA 3TGNA 2EV0A 5L3GA 5CJ9A 2ZXJA 1V55H 4RB2C 5L3FA 4C3HJ 3SQNA 4XRMA 1Q1VA 2HS5A 2FQ3A 4BGDA 3D5RC 2RN7A 3JTGA 1UCRA 1ZKGA 2TCTA 1LDDA 2DA5A 5EEHA 1XSVA 1K7AA 3BLYA 3CUQA 3CCSI 1J75A 3A4CA 4YRVA 4KIGA 4NB5A 1E3HA 3GZ6A 4IRIA 4DZJA 3BCBA 1X1CA 2BW3B 3WE2A 1FOYA 4RAZA 1WFXA 2Y9ZA 1C0WA 3BZKA 2A68F 3BTIA 2I5UA 1FJLA 3DTIA 3LSHA 2M0CA 2TDXA 2Y2ZA 1RIOH 3OOUA 2PJRA 2HKXA 3A1YA 1QZYA 1U8RA 4BUPA 3BR0A 1IXCA 3HB9A 2EB7A 2W25A 1Z91A 4ZYEA 3DWLE 4XSZF 3TP0A 2K3PA 3IWFA 4EQQA 4JX5A 2NNYA 4HX4A 4UUSB 1QQIA 4XNFA 3U1DA 3RTRA 2O9LA 3HOUJ 1DU0A 1AKHA 3KPHA 2M87A 3T8RA 1VQ7I 2KJBA 3FM5A 3KYLA 3E5XA 4BXXJ 3HDDA 3LSPA 2W00A 1FBSA 5ICEA 4L9NA 2LVSA 1YI2I 1W1WE 4I01A 4E4HA 4PJJA 2M1BA 1ZQ3P 3H9GA 3T0YA 2VASA 3PO3J 3BQZA 3FXMA 3FDYA 1I39A 3CCMI 1T08B 4Y15A 2KISA 3LSJA 4WX9A 1XGNA 2QWWA 2JRTA 4HRIA 2M34A 1WJAA 1O7FA 3BR1A 1WJFA 1FMVA 2L9VA 2CRGA 3P9KA 2DMQA 2VPRA 5LD2C 4BEHB 5LHHA 3S93A 5LGTA 4KT5C 1IRGA 3K0LA 2BXZA 2CQXA 3JSOA 3WGGA 1PP7U 1R49A 4E7ZA 2NAZA 1PYVA 4Q4ZF 1ZN2A 5KNLA 1LEAA 5TISC 3V8LA 3K69A 2C6YA 2IS2A 4IPAA 1LE8A 3H9JA 5IOYA 2X9DA 1UG0A 2J5PA 4XKVA 5FFXA 3VB2A 1TQIA 1T0FC 2YPRA 1R71A 1GT0C 2IW5A 2HZDA 3IRRA 2HQ5A 4UNOA 1A5JA 1IN6A 4PZJA 2HDCA 2LMDA 3E5QA 3TW7A 1M1EB 1XCVA 2CW0F 4DJAA 2EK5A 5LHGA 1POGA 4MNUA 5K5RA 4IX7A 5A2QK 3K4JA 3ASOH 4MEYF 1Z7UA 1Z77A 3GFJA 3ECOA 1FIPA 3HYIA 2VKEA 1JE8A 1OYIA 3CLOA 1O3RA 4KDPA 2MABA 1ETVA 2DOFA 2EBIA 1JKQC 3O8GA 5GADJ 3WU0A 2R7FA 2D1VA 3IAS2 3F0CA 5FROA 2NYXA 1MJAA 5LFAA 4LG0B 5JVGF 1YTYA 1B9MA 3D5LA 1ETQA 1TW2A 2FNPA 4P55A 4OWRB 1IRXA 1L3LA 3HKZN 5B5EC 1O3TA 3AG3H 2R0QC 1D5VA 2P8TA 2V9KA 4LB6B 2MFZA 1MBFA 4RMNA 1WGXA 4A3FJ 4XLNF 1XN7A 4A3JJ 5DCFA 4E6KG 1WKMA 4IRHA 2XGXA 3CUOA 4QSHA 1JJ8C 1MMAA 2RDPA 3D0SA 4DYRA 3AAFA 1BBYA 1OCOH 1FSEA 3JREA 2XSDC 4CYCB 2K9SA 1MBHA 4XL9A 2VXZA 2P81A 3BR2A 3GCMA 1X58A 4MFEA 4QPQA 2HYFA 3ZXSA 5CLSA 5KCMA 2EJRA 3BY6A 3TMOA 4IHTA 3W2AA 2L7FP 3RQ4A 4PJLA 2VJIA 3DEWA 5DS9A 2V6EA 3KP5A 1X1AA 4A3GJ 1J9IA 1RZ4A 5HODA 1YFHA 4CZZA 4M6VA 1AHDP 3L2RA 1VQKI 2K9LA 1W5CC 2F4OB 4I09A 4CCMA 2FJ1A 3SYTA 5HS8A 3JTHA 2DT6A 2OUMA 5LHIA 4WWCA 3QP6A 2X85A 4FQGA 4HX7A 1O3QA 5HS7A 1N78A 5F0FA 4BE2A 4C2TA 1GV2A 4FHTA 3GXOA 4XK4A 1O3SA 3X2QH 1WRJA 3K1NA 1FTTA 1A6IA 2V26A 3FXOA 4UB6C 1D8KA 1T56A 2ZXIA 2ZKZA 4II3A 4C30A 3BOQA 5DV5A 3G2BA 5D4RA 2VBZA 1MJBA 2EIKH 1LFUP 3O6BB 1WHUA 5E1WA 3JR9A 2KZGA 5HS9A 3I59A 3ZQHA 1I3QJ 3AFHA 3DPUA 2JJ7A 2XPWA 3LWFA 4GYGA 4EM0B 2LLKA 5KAIC 1Z05A 3WHBA 4G7ZF 3L00A 2K27A 3L1PA 2P0WA 1F36A 4BHCA 3L2UA 1A36A 1UHWA 3B6AA 2M9HA 3HGYA 3CC2I 3W2VA 3CCYA 2VJ4A 3K2AA 2EQRA 3RQIA 4HF2A 5J1YA 2GQQA 1WH5A 2CSOA 2JQ7A 1R1VA 1JUSA 5C4JJ 4YIRX 4UHTA 2DA1A 1TTYA 4UVBA 1U5TB 3KFWX 1ZG5A 1ETYA 1S6LA 2JVHA 1LPQA 2VLAA 1OCPA 4QLCU 4C2MJ 3NWTA 3K10A 4QTRA 3I54A 4M3BA 2GLOA 2OTLI 1VZ0A 2W84A 2ZMEA 4PSXA 4DZPA 2WAQN 2DOAA 4RGUA 2B63J 5KHDA 5M3MJ 3RKXA 5IY5H 2VXDA 3IH4A 5GAEJ 2X48A 3CDHA 4LGWA 3S3NA 2L7KA 3VYUB 2HYJA 4M74A 3K4KA 3RJPA 2R5YA 1DQUA 4I0BA 1D1AA 2EFQA 5C4XJ 2Q1ZB 2V1NA 2HOAA 5DCMA 5ICGA 4NDLA 4OIQF 3PIPF 4WF2A 3CP2A 1HW1A 2IGMA 2PX9A 3PQKA 1IV6A 2PMZA 2AO9A 4BHBA 5AIPA 3F21A 3ZQCA 2VE8A 1P4XA 1WI9A 1RPWA 3QODA 1IXRC 2LF8A 2COBA 2CV2A 1XDSA 1FLIA 5EF6A 3IC7A 3CCVI 1Y39A 2CUJA 2JN6A 2RREA 2ZC2A 3HXLA 4HV6A 3G71I 1HW2A 4U0VA 3JSPA 4D5CA 5EEGA 1K61A 4XR6A 3EQLF 2VE9A 4BBRJ 2DA4A 5F27A 3GTJJ 4HPQA 2Z9OA 5F64A 2XAUA 1LKXA 3E6DA 2XPVA 3GTLJ 3JW4A 3TL4X 1MDMA 1XC5A 1F5TA 2LRDA 2O0YA 4OIOF 2L7ZA 4IEJA 4KITB 1OQYA 3CP8A 1MMSA 3ZMZA 3K9TA 4IHXA 3BPXA 4I76A 3FXRA 1DGWY 2QA4I 3RZDJ 2GA1A 1LDJA 2PBIA 2L7MP 2MH9A 2HWVA 2LBFA 5CVRA 2FUG2 3FBNB 2ISYA 2IGKA 2UXXA 2FQ4A 2RAEA 1TNSA 1IJWC 2BHYA 3I3LA 2MBFA 2R7QA 3CF2A 3G1MA 3RPUA 2FBKA 2FXAA 5KAFC 5K1YA 1FNNA 4BL0B 1ZGJA 2CUZA 3BC8A 4B47A 1YLFA 3GF2A 4LLGF 2OQGA 3LSIA 1R22A 3OR2C 2P5VA 3GWZA 4A2UA 4M3FA 1LEBA 1D1BA 2HOTA 3L7WA 3OYFA 4HDUA 1V5GA 3TOBA 1WZ2A 3H9QA 1TLHB 5DUKA 2PMHA 3FISA 2YR2A 2HQRA 3NARA 3ZMUA 2NXNB 1YE9A 2O3FA 2QYOA 4HYEA 4G8XA 1B72B 3ZN0A 2HPMA 3I5UA 5EG0A 3EYIA 3UR3C 5LRSA 1BOBA 3F22A 2JZYA 2JA5J 1ETKA 1MD0A 1XGMA 4O5VA 3W6VA 2W82A 2GM4A 1D0YA 3A0HC 4A0ZA 3HL2A 1B4AA 3FZVA 1BL0A 4ZTFA 2ZFUA 3GTMJ 2XIGA 4B09A 1S7OA 1U8BA 3O2PE 4C9YA 3IV5A 3M1CA 3VOEA 1W7PD 3OIPA 4PGHA 1YW9A 4NQWA 3D1NI 4MO7A 2Z3YA 2XHKA 2XB0X 4U7DA 3GTGJ 3OWTA 1R6RA 2ICWG 4CXFA 3HSEA 2H94A 3J7AY 2V7FA 4N4OB 3V7SA 4HF1A 3I58A 3LSKA 1Y8RB 3U2RA 1X3UA 4R8HA 1AOYA 3UNGC 4RGRA 1S5LC 1ZLKA 3F8BA 3HJEA 4LK1F 5ED4A 1R5HA 2HOSA 2X6WA 2G7UA 2CWEA 2E1MB 4JQFA 4BJ5C 2WY7Q 3ULQB 3PUBA 2QQ8A 5E20A 3UKGA 3J80K 1FYLA 2CQ7A 4RS8A 3HUGA 4ITVA 1HKSA 1ACIA 5GAGJ 4MQ9F 3KZZA 3ZMSA 3OYJA 3A01A 1MMNA 2PJPA 1B59A 3OYBA 1OYWA 4J19A 4BE0A 3N05A 3HHGA 3S14J 1OCZH 1FBQA 3LA3A 3CMMA 4P96A 5DDGA 1EJ9A 4BQOA 1S7EA 2IP2A 3BR3A 3KX2A 3HPGA 4B44A 4KIBA 2KDZA 3BJ6A 2QENA 4HW0A 2Z16A 3BR6A 4ABZA 2LKSA
chains in the Genus database with same CATH topology
1UG2A 2X6OA 1JUPA 3WHCA 4DZJA 4C3JJ 2DMTA 2ID3A 1BJZA 5JLWA 1P7IA 2R93J 5FKLA 4BKXA 5K7HA 3E7LA 2Y9ZA 4MFDA 2ECCA 1ZK8A 1ZTRA 1UHSA 3BTIA 4JX4A 5C3EJ 3LSGA 1FJLA 2M0CA 3B6CA 2Y2ZA 3OOUA 1PUFB 1FEXA 1NK2P 5F1JA 3BR0A 2EZHA 3HOWJ 3HB9A 2K9QA 4BY1J 5GP9A 1HDPA 3TP0A 1FTZA 1RKWA 4V2FA 4JX5A 1VF9A 4UUSB 1Z0XA 5IP7J 4AYBN 1JT0A 2OPTA 5J1RA 2IAIA 3HM5A 2O9LA 3HOUJ 1DU0A 1AKHA 2JA7J 2EH3A 3SJMA 2QF7A 4M3GA 4BXXJ 3HDDA 2ME0A 4JX6A 3LSPA 3CMYA 1AU7A 5BNGA 2LVSA 3A03A 4FE4A 1VNDA 4W97A 1ZQ3P 2XGEA 2H8RA 3PO3J 1IGNA 2MGQA 2Y30A 3BQZA 2AHQA 2O8KA 3SFIA 4Y7NJ 5C44J 1TWAJ 2NOGA 1IDYA 3LSJA 3HOZJ 1MSFC 3GBGA 2R5ZA 2M34A 4FTHA 3BR1A 1HCRA 1B8IA 2XGDA 4S0HB 3GTKJ 3PO2J 2CRGA 2DMQA 1APLC 2VPRA 4BBSJ 5FLVA 3GTOJ 1TWCJ 4XIDA 1DU6A 2CQXA 3S16J 2IBDA 1X2NA 2KT0A 1LE8A 5IOYA 2X9DA 5J1UA 3MN2A 1MBJA 4FISA 1GT0C 1SFOJ 1WCMJ 1P7JA 2HQ5A 4A3CJ 1A5JA 3TW7A 4B1RA 1POGA 3QQAA 3TEDA 1WH7A 2LK2A 2DN0A 1Z77A 3JRCA 1MNMC 3K7AJ 1FIPA 1JJ6C 2VKEA 1YRNA 1ETVA 5IP6A 2EBIA 1JKQC 3O8GA 5FKMA 3FIWA 2E2HJ 2DMPA 1GDTA 2LFBA 3F0CA 1IUFA 1U78A 4RDUA 3JRAA 2Y9YA 1ETQA 4IHVA 5EG0B 1QRYA 2R5ZB 3HKZN 1Y1WJ 4A93J 1U9NA 2R0QC 3Q0VA 1HF0A 1B8IB 2ZB9A 2FD5A 1MBFA 3G1LA 1WGXA 3TW6A 4A3FJ 5E3MA 2DA7A 4A3JJ 3S1QJ 3BG9A 1T33A 4GFBA 2CUFA 3S15J 2NS8A 4FCYA 4QSHA 2K40A 5FKNA 1JJ8C 4DYRA 5FJ8J 1OCTC 1HOMA 1R9TJ 2E2IJ 3JREA 2LY9A 1LE8B 2E1OA 2XSDC 4CYCB 2NVTJ 1MBKA 3FK6A 1JKRC 3ZQIA 2K9SA 1MBHA 1QPIA 2P81A 3BR2A 1H89C 1X2MA 1CQTA 1B72A 3HOXJ 1X58A 4MFEA 4A3EJ 1EF4A 1E3OC 4DYCA 1VFCA 1W0TA 2L7FP 4DW6A 3GTQJ 3BTCA 2WV1A 2VI6A 3DEWA 5DS9A 2XPUA 2LTPA 1QVTA 2JA6J 2G0EA 4A3GJ 5HODA 3G1OA 1ETWA 2ID6A 2HXOA 4M6VA 1D5YA 1AHDP 4A3LJ 1YRNB 3CDLA 3JRFA 5IYBJ 2PMZN 2JA8J 2FJ1A 3S1MJ 2NVQJ 2XGCA 3BTLA 4FE7A 3A01B 1LFBA 1NK3P 5F0FA 3VPRA 3OSGA 1GV2A 4XK4A 1IC8A 1FTTA 3BT9A 1A6IA 5E3OA 4X6AJ 3ZQFA 3BG3A 4IHYA 4LOCA 2MG4A 2MSYA 1T56A 1GUUA 2CUEA 1VI0A 5EDNA 1MBEA 5EZHA 4AUXA 1TWGJ 1LFUP 1MH3A 3JR9A 4BY7J 1MSEC 3ZQHA 3Q0UA 2OF7A 1I3QJ 4M3EA 5M5YJ 5FLMJ 3HEFA 1HDDC 2JJ7A 1MH4A 4RBOA 2R7ZJ 2XPWA 4A3BJ 2LLKA 3WHBA 1NTCA 4XRSG 3JRDA 3BG5A 3L1PA 1F36A 3B6AA 2M9HA 3HGYA 2Y0SN 3CCYA 5GPCA 2E2JJ 3K2AA 4Y52J 9ANTA 3SDGA 2EQRA 2LP0A 3RQIA 2N8GA 4B3AA 5M5WJ 4A3DJ 2DTZA 5J1YA 1RKTA 1WH5A 5C4JJ 1JUSA 1IG7A 4I6ZA 1AKHB 2DA1A 1O4XA 1ZGWA 1ETYA 2WB1N 1OCPA 4C2MJ 2DA2A 4QTRA 1ETXA 4M3BA 2GLOA 5M5XJ 5EEAA 2JMWA 1G2HA 1JTXA 3H3VK 4DZPA 3S1NJ 1WPKA 2W48A 2WAQN 3MKLA 3ZQGA 2B63J 3IH3A 5M3MJ 2L0KA 3LOCA 3ZOBA 2CQQA 1ETOA 2LR8A 1PUFA 4AC0A 5GPAA 3IH4A 3JRHA 2YU9J 2DMNA 2X48A 2HYJA 1H88C 4UUTA 2Y31A 2R5YA 4XICA 2K9NA 1HLVA 3HOYJ 3PM1A 5C4XJ 2HOAA 4MLOA 3TP3A 1XS9A 4DYQA 5E3NA 1H8AC 4NDLA 1QVUA 1IV6A 3M4OJ 2CU7A 2AO9A 1ZR4A 1W0UA 1JUMA 4C3IJ 3ZQCA 2R92J 1RPWA 2COBA 1JGGA 5EF6A 4IHWA 4W1UA 3A02A 4A3KJ 2JN6A 2HI3A 4D5CA 5FKKA 5K7FA 3QPLA 1K61A 1RR7A 4BBRJ 2DA4A 5F27A 2CJJA 3GTJJ 1BW5A 3GTPJ 1JTYA 2XPVA 3GTLJ 5F0CA 2EZKA 1XC5A 3FK7A 2JWTA 1JKPC 2L7ZA 3I4NJ 1F43A 4IEJA 3ZQLA 4IHXA 1TC3C 1Y1VJ 2LKXA 4I76A 4JYKA 2YS9A 2ECBA 1OFCX 2EZIA 5EGOA 3RZDJ 2NVXJ 4HNVA 2EZLA 2MW8A 3Q3SA 2VKVA 3HGGA 4G12A 2DA3A 4QIWN 1ORKA 2L7MP 1IDZA 3CQZJ 4V2GA 1JT6A 3LNQA 2FQ4A 2RAEA 4A3MJ 2R5YB 2M2EA 1RESA 1IJWC 2TRTA 2H1KA 3S17J 3G1MA 4EEFG 2VUMJ 3S2DJ 4D7NA 5F0HA 2DJNA 1I50J 4A3IJ 3JRBA 2DA6A 3HBLA 4A69C 2I10A 4M3FA 1XG1A 2HOTA 1BA5A 1RETA 2XRLA 3Q0WA 1UMQA 5FKOA 1I6HJ 3S1RJ 2D5VA 2XB5A 3FISA 3NARA 2O7OA 4XRSA 1IRZA 2JK3A 1B72B 3O8HA 5F08A 3RKQA 1ZR2A 5EG0A 2QCOA 3MVPA 1WI3A 2JA5J 1ETKA 3LSRA 3W6VA 2IEKA 2GM4A 2FX0A 1TWHJ 2NVYJ 3BR5A 5K7ZA 1BL0A 2M8GX 3GTMJ 1K83J 1GVDA 1U8BA 5IPAA 3IV5A 3OIOA 5EGOB 1TWFJ 5DTDA 5F04A 4CYCA 4JP0A 3D1NI 4MO7A 3S2HJ 4L5EA 3GTGJ 2XB0X 2HXIA 4D7MA 1U9OA 1MBGA 2ELKA 2L9RA 1JKOC 1OJLA 2HDDA 3HOVJ 2YUSA 5IYCJ 2E19A 3FKIJ 4D5FA 2GBYA 4X1EA 4UUSA 3QPSA 2HOSA 1BW6A 3IH2A 3BTJA 5IOZA 3OSFA 5IP9J 1ENHA 3BQYA 5JLXA 2ME6A 3JRIA 5EYRA 2NS7A 1ITYA 3UKGA 3H0GJ 5J3LA 3JRGA 3M3YJ 1SANA 3C2BA 1FIAA 4MIMA 4B4CA 5IYDJ 2LD5A 3A01A 3I4MJ 3NAUA 2DMUA 4M3DA 4J19A 3S14J 1GV5A 5E3LA 3RZOJ 4C3HJ 4XRMA 1S7EA 1Q1VA 3BR3A 5M3FJ 2KDZA 1ZKGA 2TCTA 2DA5A 5EZGA 3BR6A 4ABZA 3DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG2 A;  2X6O A;  1JUP A;  3WHC A;  4DZJ A;  4C3J J;  2DMT A;  2ID3 A;  1BJZ A;  5JLW A;  1P7I A;  2R93 J;  5FKL A;  4BKX A;  5K7H A;  3E7L A;  2Y9Z A;  4MFD A;  2ECC A;  1ZK8 A;  1ZTR A;  1UHS A;  3BTI A;  4JX4 A;  5C3E J;  3LSG A;  1FJL A;  2M0C A;  3B6C A;  2Y2Z A;  3OOU A;  1PUF B;  1FEX A;  1NK2 P;  5F1J A;  3BR0 A;  2EZH A;  3HOW J;  3HB9 A;  2K9Q A;  4BY1 J;  5GP9 A;  1HDP A;  3TP0 A;  1FTZ A;  1RKW A;  4V2F A;  4JX5 A;  1VF9 A;  4UUS B;  1Z0X A;  5IP7 J;  4AYB N;  1JT0 A;  2OPT A;  5J1R A;  2IAI A;  3HM5 A;  2O9L A;  3HOU J;  1DU0 A;  1AKH A;  2JA7 J;  2EH3 A;  3SJM A;  2QF7 A;  4M3G A;  4BXX J;  3HDD A;  2ME0 A;  4JX6 A;  3LSP A;  3CMY A;  1AU7 A;  5BNG A;  2LVS A;  3A03 A;  4FE4 A;  1VND A;  4W97 A;  1ZQ3 P;  2XGE A;  2H8R A;  3PO3 J;  1IGN A;  2MGQ A;  2Y30 A;  3BQZ A;  2AHQ A;  2O8K A;  3SFI A;  4Y7N J;  5C44 J;  1TWA J;  2NOG A;  1IDY A;  3LSJ A;  3HOZ J;  1MSF C;  3GBG A;  2R5Z A;  2M34 A;  4FTH A;  3BR1 A;  1HCR A;  1B8I A;  2XGD A;  4S0H B;  3GTK J;  3PO2 J;  2CRG A;  2DMQ A;  1APL C;  2VPR A;  4BBS J;  5FLV A;  3GTO J;  1TWC J;  4XID A;  1DU6 A;  2CQX A;  3S16 J;  2IBD A;  1X2N A;  2KT0 A;  1LE8 A;  5IOY A;  2X9D A;  5J1U A;  3MN2 A;  1MBJ A;  4FIS A;  1GT0 C;  1SFO J;  1WCM J;  1P7J A;  2HQ5 A;  4A3C J;  1A5J A;  3TW7 A;  4B1R A;  1POG A;  3QQA A;  3TED A;  1WH7 A;  2LK2 A;  2DN0 A;  1Z77 A;  3JRC A;  1MNM C;  3K7A J;  1FIP A;  1JJ6 C;  2VKE A;  1YRN A;  1ETV A;  5IP6 A;  2EBI A;  1JKQ C;  3O8G A;  5FKM A;  3FIW A;  2E2H J;  2DMP A;  1GDT A;  2LFB A;  3F0C A;  1IUF A;  1U78 A;  4RDU A;  3JRA A;  2Y9Y A;  1ETQ A;  4IHV A;  5EG0 B;  1QRY A;  2R5Z B;  3HKZ N;  1Y1W J;  4A93 J;  1U9N A;  2R0Q C;  3Q0V A;  1HF0 A;  1B8I B;  2ZB9 A;  2FD5 A;  1MBF A;  3G1L A;  1WGX A;  3TW6 A;  4A3F J;  5E3M A;  2DA7 A;  4A3J J;  3S1Q J;  3BG9 A;  1T33 A;  4GFB A;  2CUF A;  3S15 J;  2NS8 A;  4FCY A;  4QSH A;  2K40 A;  5FKN A;  1JJ8 C;  4DYR A;  5FJ8 J;  1OCT C;  1HOM A;  1R9T J;  2E2I J;  3JRE A;  2LY9 A;  1LE8 B;  2E1O A;  2XSD C;  4CYC B;  2NVT J;  1MBK A;  3FK6 A;  1JKR C;  3ZQI A;  2K9S A;  1MBH A;  1QPI A;  2P81 A;  3BR2 A;  1H89 C;  1X2M A;  1CQT A;  1B72 A;  3HOX J;  1X58 A;  4MFE A;  4A3E J;  1EF4 A;  1E3O C;  4DYC A;  1VFC A;  1W0T A;  2L7F P;  4DW6 A;  3GTQ J;  3BTC A;  2WV1 A;  2VI6 A;  3DEW A;  5DS9 A;  2XPU A;  2LTP A;  1QVT A;  2JA6 J;  2G0E A;  4A3G J;  5HOD A;  3G1O A;  1ETW A;  2ID6 A;  2HXO A;  4M6V A;  1D5Y A;  1AHD P;  4A3L J;  1YRN B;  3CDL A;  3JRF A;  5IYB J;  2PMZ N;  2JA8 J;  2FJ1 A;  3S1M J;  2NVQ J;  2XGC A;  3BTL A;  4FE7 A;  3A01 B;  1LFB A;  1NK3 P;  5F0F A;  3VPR A;  3OSG A;  1GV2 A;  4XK4 A;  1IC8 A;  1FTT A;  3BT9 A;  1A6I A;  5E3O A;  4X6A J;  3ZQF A;  3BG3 A;  4IHY A;  4LOC A;  2MG4 A;  2MSY A;  1T56 A;  1GUU A;  2CUE A;  1VI0 A;  5EDN A;  1MBE A;  5EZH A;  4AUX A;  1TWG J;  1LFU P;  1MH3 A;  3JR9 A;  4BY7 J;  1MSE C;  3ZQH A;  3Q0U A;  2OF7 A;  1I3Q J;  4M3E A;  5M5Y J;  5FLM J;  3HEF A;  1HDD C;  2JJ7 A;  1MH4 A;  4RBO A;  2R7Z J;  2XPW A;  4A3B J;  2LLK A;  3WHB A;  1NTC A;  4XRS G;  3JRD A;  3BG5 A;  3L1P A;  1F36 A;  3B6A A;  2M9H A;  3HGY A;  2Y0S N;  3CCY A;  5GPC A;  2E2J J;  3K2A A;  4Y52 J;  9ANT A;  3SDG A;  2EQR A;  2LP0 A;  3RQI A;  2N8G A;  4B3A A;  5M5W J;  4A3D J;  2DTZ A;  5J1Y A;  1RKT A;  1WH5 A;  5C4J J;  1JUS A;  1IG7 A;  4I6Z A;  1AKH B;  2DA1 A;  1O4X A;  1ZGW A;  1ETY A;  2WB1 N;  1OCP A;  4C2M J;  2DA2 A;  4QTR A;  1ETX A;  4M3B A;  2GLO A;  5M5X J;  5EEA A;  2JMW A;  1G2H A;  1JTX A;  3H3V K;  4DZP A;  3S1N J;  1WPK A;  2W48 A;  2WAQ N;  3MKL A;  3ZQG A;  2B63 J;  3IH3 A;  5M3M J;  2L0K A;  3LOC A;  3ZOB A;  2CQQ A;  1ETO A;  2LR8 A;  1PUF A;  4AC0 A;  5GPA A;  3IH4 A;  3JRH A;  2YU9 J;  2DMN A;  2X48 A;  2HYJ A;  1H88 C;  4UUT A;  2Y31 A;  2R5Y A;  4XIC A;  2K9N A;  1HLV A;  3HOY J;  3PM1 A;  5C4X J;  2HOA A;  4MLO A;  3TP3 A;  1XS9 A;  4DYQ A;  5E3N A;  1H8A C;  4NDL A;  1QVU A;  1IV6 A;  3M4O J;  2CU7 A;  2AO9 A;  1ZR4 A;  1W0U A;  1JUM A;  4C3I J;  3ZQC A;  2R92 J;  1RPW A;  2COB A;  1JGG A;  5EF6 A;  4IHW A;  4W1U A;  3A02 A;  4A3K J;  2JN6 A;  2HI3 A;  4D5C A;  5FKK A;  5K7F A;  3QPL A;  1K61 A;  1RR7 A;  4BBR J;  2DA4 A;  5F27 A;  2CJJ A;  3GTJ J;  1BW5 A;  3GTP J;  1JTY A;  2XPV A;  3GTL J;  5F0C A;  2EZK A;  1XC5 A;  3FK7 A;  2JWT A;  1JKP C;  2L7Z A;  3I4N J;  1F43 A;  4IEJ A;  3ZQL A;  4IHX A;  1TC3 C;  1Y1V J;  2LKX A;  4I76 A;  4JYK A;  2YS9 A;  2ECB A;  1OFC X;  2EZI A;  5EGO A;  3RZD J;  2NVX J;  4HNV A;  2EZL A;  2MW8 A;  3Q3S A;  2VKV A;  3HGG A;  4G12 A;  2DA3 A;  4QIW N;  1ORK A;  2L7M P;  1IDZ A;  3CQZ J;  4V2G A;  1JT6 A;  3LNQ A;  2FQ4 A;  2RAE A;  4A3M J;  2R5Y B;  2M2E A;  1RES A;  1IJW C;  2TRT A;  2H1K A;  3S17 J;  3G1M A;  4EEF G;  2VUM J;  3S2D J;  4D7N A;  5F0H A;  2DJN A;  1I50 J;  4A3I J;  3JRB A;  2DA6 A;  3HBL A;  4A69 C;  2I10 A;  4M3F A;  1XG1 A;  2HOT A;  1BA5 A;  1RET A;  2XRL A;  3Q0W A;  1UMQ A;  5FKO A;  1I6H J;  3S1R J;  2D5V A;  2XB5 A;  3FIS A;  3NAR A;  2O7O A;  4XRS A;  1IRZ A;  2JK3 A;  1B72 B;  3O8H A;  5F08 A;  3RKQ A;  1ZR2 A;  5EG0 A;  2QCO A;  3MVP A;  1WI3 A;  2JA5 J;  1ETK A;  3LSR A;  3W6V A;  2IEK A;  2GM4 A;  2FX0 A;  1TWH J;  2NVY J;  3BR5 A;  5K7Z A;  1BL0 A;  2M8G X;  3GTM J;  1K83 J;  1GVD A;  1U8B A;  5IPA A;  3IV5 A;  3OIO A;  5EGO B;  1TWF J;  5DTD A;  5F04 A;  4CYC A;  4JP0 A;  3D1N I;  4MO7 A;  3S2H J;  4L5E A;  3GTG J;  2XB0 X;  2HXI A;  4D7M A;  1U9O A;  1MBG A;  2ELK A;  2L9R A;  1JKO C;  1OJL A;  2HDD A;  3HOV J;  2YUS A;  5IYC J;  2E19 A;  3FKI J;  4D5F A;  2GBY A;  4X1E A;  4UUS A;  3QPS A;  2HOS A;  1BW6 A;  3IH2 A;  3BTJ A;  5IOZ A;  3OSF A;  5IP9 J;  1ENH A;  3BQY A;  5JLX A;  2ME6 A;  3JRI A;  5EYR A;  2NS7 A;  1ITY A;  3UKG A;  3H0G J;  5J3L A;  3JRG A;  3M3Y J;  1SAN A;  3C2B A;  1FIA A;  4MIM A;  4B4C A;  5IYD J;  2LD5 A;  3A01 A;  3I4M J;  3NAU A;  2DMU A;  4M3D A;  4J19 A;  3S14 J;  1GV5 A;  5E3L A;  3RZO J;  4C3H J;  4XRM A;  1S7E A;  1Q1V A;  3BR3 A;  5M3F J;  2KDZ A;  1ZKG A;  2TCT A;  2DA5 A;  5EZG A;  3BR6 A;  4ABZ A;  3DCF A; 
#chains in the Genus database with same CATH topology
 1RRJ A;  1UG2 A;  4KIF A;  3VSK A;  4B8X A;  4EJT A;  1BI1 A;  5CVV A;  2CW8 A;  4ZZD A;  1TQM A;  3WHC A;  3WU1 B;  2R93 J;  1BJZ A;  2V9V A;  5L3B A;  2K7L A;  5FKL A;  4BKX A;  3E6B A;  3E7L A;  3U9G A;  2P5K A;  2F5F A;  2ECC A;  4NNJ A;  4L0Z B;  5C3E J;  3J81 Z;  1A6Q A;  1PDN C;  2M7B A;  1ERD A;  2WTE A;  3OYI A;  1PUF B;  1I1S A;  4TV7 A;  1MGT A;  3DKY A;  1BJA A;  2EWN A;  4ZZL A;  4Z2Y A;  1ZG3 A;  5CVJ A;  2DOD A;  4IXA A;  4UB8 C;  5GP9 A;  3MFK A;  3ISP A;  3DTE A;  2QEX I;  1IV8 A;  1FTZ A;  3HHH A;  4V2F A;  1IO2 A;  1DP7 P;  4ON0 A;  1GXP A;  1VF9 A;  2EIN H;  5J1R A;  4MTE A;  3KP7 A;  2DPU A;  3SJM A;  4M3G A;  3JAM Z;  1YJN I;  3I64 A;  4IVN A;  3AKZ A;  1AU7 A;  5BNG A;  4PJ0 C;  2QSF X;  1R23 A;  4FE4 A;  4DQ2 A;  1YX3 A;  1VND A;  3M8J A;  3DTK A;  3QU3 A;  4P5O A;  3KE2 A;  2XGE A;  2H8R A;  4KIC A;  2MGQ A;  2Y30 A;  4L9J A;  5ILU A;  4CYD A;  3NRV A;  1P2F A;  1Q1H A;  3MZH A;  3SFI A;  1HSJ A;  2EIJ H;  2WAD A;  4M9X A;  2R3S A;  4UY8 I;  2WAE A;  2IS1 A;  3GBG A;  3ML6 A;  4LFU A;  5TGT A;  4FTH A;  2DXI A;  4XKB A;  2IS6 A;  1QPM A;  5E79 C;  1MKM A;  2K3F A;  4HV5 A;  3V7C A;  1B8I A;  3GTK J;  4HAM A;  1IW7 F;  2R7T A;  1TBX A;  2Z1D A;  4LMY A;  1TZL A;  3GTO J;  1HQC A;  5CPR B;  1ZH5 A;  1DU6 A;  2OJE D;  4L9V A;  4E70 A;  5BPI A;  5LGN A;  1F9N A;  1SC7 A;  4ZC3 A;  2KT0 A;  2E5Z A;  5J1U A;  2A69 F;  5E8I A;  4ZH4 F;  1RNL A;  4YII A;  4FIS A;  1MZB A;  1HKQ A;  1LVK A;  2WC2 A;  3K4N A;  2HVQ A;  1KU7 A;  3ZCO A;  1TL8 A;  4GCV A;  3C2H A;  5HDN A;  3M1E A;  5D5U B;  4ENN A;  1YX5 A;  2HU9 A;  5LGU A;  3I71 A;  1TT0 A;  5J4Y A;  4N4N B;  4B1R A;  2QVO A;  3QQA A;  1WH7 A;  5E18 F;  2LK2 A;  1XD7 A;  2FU4 A;  2NNN A;  1YRN A;  2OZU A;  3A0B C;  4P1W A;  1S72 I;  4IOA F;  3BG7 A;  1U5T C;  2OQR A;  2E2H J;  2I8D A;  2F4M B;  3GO5 A;  2MD5 A;  3DPT A;  2LFB A;  2QUF A;  1GDT A;  1WJD A;  4DBQ A;  4RGX A;  1IUF A;  3VFZ A;  2Y9Y A;  3IKV A;  1R4N B;  1QRY A;  1LNW A;  1UFM A;  2CQK A;  5E8G A;  3HRU A;  1RC9 A;  3R0J A;  4PSW A;  2KHM A;  4EMS A;  1ZRF A;  4A93 J;  3S2W A;  3DLL F;  1U9N A;  2ZSI B;  3EUA A;  4L5I A;  4HEA 2;  3Q0V A;  1KZH A;  4EM1 A;  3HOT A;  3DV8 A;  1ZRE A;  1J2X A;  2XAG A;  3EUH C;  1X1P A;  2DA7 A;  4AID A;  2R7S A;  2L54 A;  1T33 A;  4N9H A;  2L02 A;  1S8N A;  2CUF A;  2EFN A;  2MYS A;  4WCG A;  1G59 A;  4KMF A;  4HST A;  2K40 A;  5D5X B;  2VN2 A;  1AA7 A;  5DUI A;  2QGU A;  3B02 A;  5JVT A;  2AS5 F;  3CJQ B;  4EJU A;  1HOM A;  2LY9 A;  4OAZ A;  1G3S A;  2F5V A;  1LE8 B;  3QU6 A;  5KK1 A;  3K4C A;  3GW2 A;  3FK6 A;  1JKR C;  3EDP A;  2W57 A;  5L3D A;  4BJT A;  5DEQ A;  4Y13 A;  1H89 C;  1X2M A;  3CJN A;  4UVC A;  3HOX J;  4A3E J;  2Y75 A;  4ANJ A;  1VFC A;  4HZF A;  1N77 A;  2R7X A;  4IJA A;  2X4H A;  1W0T A;  3M7G A;  2H6B A;  1QZE A;  2JSP A;  1YJW I;  2Q2E B;  4EV0 A;  3PUF A;  1S7A A;  3LSM A;  3GME A;  3V8K A;  1FSH A;  4D9J A;  5HDG A;  4LJZ F;  1ETW A;  2LG4 A;  3CC4 I;  3GYH X;  3ZQQ A;  1KYW A;  3CF5 F;  4A3L J;  3LFU A;  2E34 A;  5J4V A;  1Z9C A;  3RI4 A;  2MH2 A;  2YX7 A;  4OU0 A;  5H6R A;  2JA8 J;  2AXT C;  2UWM A;  2V1D A;  3RKY A;  2NVQ J;  3L9F A;  1KQ8 A;  2O8X A;  2MA3 A;  3T8T A;  2ESN A;  2E1N A;  1D3Y A;  3H92 A;  3MEX A;  3OY9 A;  1K78 A;  1JHH A;  3OSG A;  1OR7 C;  1U2W A;  3CCR I;  3K4L A;  2K9M A;  2G9W A;  1IC8 A;  3H36 A;  2R7V A;  1IUY A;  4X6A J;  1GLN A;  4LOC A;  2ELH A;  5KVR A;  4M6Y A;  1QHG A;  1NH3 A;  2GOM A;  4GGG A;  2CUE A;  4BQA A;  1KU9 A;  1SFX A;  1R58 A;  1MBE A;  1ZYR F;  4O3M A;  1TWG J;  4N9I A;  1UAA A;  3Q0U A;  3P9I A;  5M5Y J;  1KU2 A;  1BR4 A;  2KJC A;  3C3W A;  5CKT A;  4RBO A;  4A3B J;  2LNB A;  2FEZ A;  1NTC A;  3JRD A;  4E7L A;  3E6C C;  1RUO A;  4XBF A;  4HDV A;  1GVJ A;  3HKZ A;  2B7E A;  2DYR H;  3BZC A;  4Y52 J;  2E5N A;  3SDG A;  2LP0 A;  1Z1D A;  1I5Z A;  1UEL B;  1X19 A;  2E71 A;  3HRS A;  4O6J A;  4ZYD A;  2DTZ A;  3M8E A;  5M5W J;  4A12 A;  4YG2 F;  4A3D J;  1RKT A;  1ZAO A;  3I4P A;  1IG7 A;  2K85 A;  4ZYH A;  2G7H A;  2XDV A;  3OS2 A;  2WB1 N;  3NWS A;  1R1U A;  4IZZ A;  4XN0 A;  2GXA A;  3H5R A;  1WVR A;  3PQJ A;  2X0L A;  1XSD A;  3KP2 A;  3GZN B;  3VYT B;  2XRO A;  1XDU A;  1Y56 A;  2DA2 A;  3ZRG A;  2BW3 A;  4ESJ A;  2B9S A;  2XKP A;  5EEA A;  4H4K C;  1YG2 A;  4PDK A;  2DLL A;  1G2H A;  3U21 A;  3LST A;  4LLL A;  2ZFW A;  3LA2 A;  1VQM I;  2YU3 A;  1SVM A;  1SMT A;  4K2E A;  1R5G A;  4AC0 A;  3RIR A;  2HQN A;  1HST A;  3HSF A;  5GPA A;  3JRH A;  2DMN A;  2W1O A;  4G7O F;  1TQP A;  4XMY A;  4UUT A;  2Y31 A;  1EKE A;  4P9F A;  1QU3 A;  4PCQ A;  1RUN A;  2XAF A;  3HOY J;  3PM1 A;  3AG1 H;  3BPV A;  2W4S A;  2X6X A;  4DYQ A;  1DUX C;  5D4S A;  2R7R A;  4MHG A;  4RM2 A;  1QVU A;  3L2V A;  3WTS C;  3GUD A;  1BIB A;  1ZR4 A;  1H0M A;  4MEX F;  1JUM A;  4BAC A;  2CMP A;  4CGZ A;  2R92 J;  2CFO A;  2V6C A;  2R7D A;  1VQ5 I;  3OYG A;  1TW3 A;  1KA8 A;  4G6D A;  3HRT A;  3J7Z I;  2E1M C;  4IHW A;  1YJ9 I;  2L01 A;  3A02 A;  3MKY B;  2BHZ A;  4A3K J;  3LL7 A;  2HTJ A;  1EH7 A;  4XKW A;  4F3Q A;  1SFU A;  1OMI A;  3WTU C;  1W7P A;  3FXK A;  4F91 B;  2A6H F;  2X1E A;  4FAS D;  1P6R A;  2BGC A;  1VQO I;  1ZRC A;  3FMR A;  3CO6 C;  4HOB A;  1BW5 A;  2MC3 A;  5F0C A;  2QKM B;  3FK7 A;  2JUG A;  4BEH A;  4P9U A;  2HGC A;  2KIQ A;  2ZME B;  4CCL A;  4FT8 A;  2LKX A;  4E7J A;  4MTD A;  1IZ1 A;  2YS9 A;  4JYK A;  4BAY A;  1OFC X;  4IOC F;  2EZL A;  3K70 C;  2VKV A;  2PEX A;  2DA3 A;  2M45 A;  3H3U A;  2BY3 A;  4YFX F;  1JT6 A;  3LNQ A;  2VBX A;  4A3M J;  2R5Y B;  1RES A;  1ZAR A;  2H1K A;  5D8L B;  3VEP A;  4A0X A;  1G6N A;  2XUB A;  3K70 D;  1USS A;  2ZNZ A;  2WAF A;  4AU7 A;  2VON A;  5DCM B;  3E6M A;  1I50 J;  4A3I J;  3HG9 A;  3HBL A;  3I0T A;  4U0W A;  4A69 C;  2L4A A;  1EV7 A;  4NC8 A;  3DP7 A;  2ZJR F;  1STZ A;  2BBY A;  1Z21 A;  1XG1 A;  4N0B A;  1MNE A;  1LUJ B;  2XRL A;  3HTU A;  5BOX A;  2WAQ A;  4BHP A;  5JFR A;  3LQQ A;  2CW7 A;  5CQG A;  1QA6 A;  2A6T A;  3DBL B;  1W5T A;  2ZSH B;  5HNF A;  2FRH A;  1ZR2 A;  2OZ6 A;  4IO9 F;  5JR3 A;  3CCL I;  3MVP A;  2Y69 H;  3ZP5 A;  2STT A;  2OCE A;  2DK5 A;  1S9H A;  3LSR A;  2CS3 A;  4UV9 A;  1G3T A;  3W3C A;  2VKH A;  3OYK A;  2DPD A;  4BNC A;  3BP8 A;  3ONQ A;  2JPC A;  1YIJ I;  1K4S A;  1K83 J;  5FLX Z;  1HXD A;  1FWZ A;  1YOV B;  3IHU A;  4U88 A;  3OIO A;  3ZMD A;  1TWF J;  2CFX A;  1IN5 A;  2VT3 A;  2DO7 A;  1UJ8 A;  3DEU A;  4CYC A;  2FF4 A;  2ZJQ F;  1YO5 C;  1X4P A;  5K5Q A;  2LF7 A;  2LY1 A;  4D7M A;  1R7J A;  1U9O A;  2L9R A;  3PNV A;  4IHS A;  2CYY A;  3IL2 A;  5L3E A;  3ABM H;  3KEQ A;  3WTW C;  5IYC J;  3DU6 A;  3HC7 A;  3OS1 A;  3NQO A;  4D5F A;  5FLX K;  3ABT A;  3K4B A;  1HKT A;  2P5L C;  5ERI A;  3P9C A;  3IH2 A;  4YIF A;  3BTJ A;  5IOZ A;  3OSF A;  2E7X A;  3ZN1 A;  3BQY A;  3SDB A;  2RQQ A;  3MZY A;  1Z3Y A;  1O57 A;  3G3Z A;  1ITY A;  3H0G J;  4KN7 X;  2HZT A;  1ZEL A;  1SAN A;  5D8K B;  1RI7 A;  2A5Y B;  4B4C A;  2BXY A;  2LD5 A;  4XQF A;  4KNY A;  1FX7 A;  4M3D A;  1J09 A;  4A6D A;  3KLO A;  3F6O A;  1GV5 A;  3BG6 A;  5E3L A;  3RZO J;  4CDG A;  1DPU A;  5ILS A;  2RC4 A;  3HRM A;  3VYS B;  3F8N A;  5M3F J;  4ENJ A;  4HNT A;  1ZG1 A;  2O61 A;  3GLX A;  3LAP A;  1KON A;  2IA0 A;  1KQ9 A;  3MZ8 A;  3CCU I;  4GYI A;  1SFK A;  4B43 A;  3CZ6 A;  4BH9 A;  1JUP A;  3GEZ A;  5HLH A;  2HOE A;  4EGY A;  1TNT A;  3F8F A;  3CCQ I;  4OIR F;  4MFD A;  3LFK A;  4JX4 A;  1UHS A;  4CIC A;  2L2O A;  3FXL A;  5HLG A;  1XCB A;  2OU2 A;  4ZDL A;  2ADU A;  5DD8 A;  4V19 K;  1FMW A;  4M73 A;  5F1J A;  2EZH A;  4E7K A;  4BY1 J;  1O7L A;  2EFO A;  2VQC A;  2Y0S A;  2Z33 A;  1HDP A;  1RKW A;  2ELJ A;  5D5W B;  4M9Z A;  3ABU A;  4AYB N;  1JT0 A;  4NC6 A;  4U7B A;  3RDI A;  2JA7 J;  2QZ8 A;  3OYN A;  3SXY A;  1PVE A;  2RNJ A;  3VDX A;  3R0A A;  1BOA A;  1Z7L A;  1FZP B;  2LDU A;  2ME0 A;  4JX6 A;  1Z6T A;  3CMY A;  2GA2 A;  2WWY A;  3HUG B;  2HNH A;  3A03 A;  2F5C A;  2ZBK A;  2JUC A;  3CMA I;  2VQL A;  4XRF A;  3DFG A;  5LEK A;  2AHQ A;  5L3C A;  2IT0 A;  2O8K A;  1V4R A;  3EUH A;  1TP4 A;  4Y7N J;  2F4I A;  2NOG A;  2LH9 A;  3HOZ J;  1MSF C;  3M9A A;  2R5Z A;  2RNG A;  1YW8 A;  2FMY A;  4FX0 A;  1XSX A;  2BEO A;  1YQA A;  2P4W A;  3T5X A;  1UHM A;  4CCJ A;  5EJC A;  1HCR A;  3E5U A;  3PNY A;  4S0H B;  1R5I D;  4JK1 X;  3VOD A;  1APL C;  2CV0 A;  4XOP A;  4BBS J;  5FLV A;  2KIF A;  3I53 A;  3BWG A;  4RGS A;  1BI0 A;  1JHF A;  4LK0 F;  4Y4R A;  1IN8 A;  3IUO A;  3S16 J;  2IBD A;  1FYK A;  4BDZ A;  2HKO A;  3MN2 A;  4M72 A;  2W24 A;  2XF5 A;  2AXL A;  1MBJ A;  2LC2 A;  1T95 A;  4WXC A;  1VQ6 I;  1P7J A;  1IN4 A;  3Q9S A;  3KIO A;  2XSJ C;  2ZJ2 A;  3F72 A;  3OYC A;  1DP3 A;  1QO0 D;  3QOE A;  4ZJZ A;  3TED A;  1J0R A;  2XF7 A;  2ETH A;  1ZLJ A;  2EIM H;  2LSO A;  3RCO A;  2A6E F;  5IP6 A;  5FKM A;  3FIW A;  1OIS A;  4GRI A;  4CCN A;  5LRR A;  3WTY C;  3W2W A;  2XAJ A;  4II2 A;  1XGO A;  1ODD A;  3F3X A;  1X4O A;  3DU5 A;  4IHV A;  3SEQ A;  1FPQ A;  2B0L A;  1Y1W J;  3MMY B;  4X0G A;  2QQ9 A;  5J47 A;  1B8I B;  4I02 A;  2ZB9 A;  3HPH A;  3KYD B;  3G1L A;  5HOO A;  3BDD A;  4BQN A;  2M0M A;  3F8C A;  5E3M A;  1A04 A;  1SD6 A;  3S1Q J;  2XAS A;  3BG9 A;  1VQ4 I;  1XX5 A;  3S15 J;  3DBH B;  4XLH A;  4A0Y A;  5FKN A;  5ICC A;  3QYF A;  2D45 A;  2BV6 A;  2H09 A;  2DDA A;  5FJ8 J;  1OCT C;  2KPM A;  3C2G A;  4KJZ A;  5H20 A;  3WE3 A;  3PJR A;  4GXO A;  4QPO A;  3IWZ A;  2XC7 A;  1D1C A;  1R9T J;  1A35 A;  2FE3 A;  2E2I J;  4Y33 A;  3EPZ A;  2GXB A;  5FD5 A;  2E1O A;  1XMK A;  4BDY A;  2NVT J;  1PP8 F;  1MBK A;  3U1K A;  1T0F A;  1QPI A;  1JXS A;  2KP6 A;  3I56 I;  1CQT A;  1B72 A;  4XSX F;  2P7C B;  4I98 B;  2J5O A;  4ENM A;  6PAX A;  4FET A;  3S3M A;  4RB0 A;  3EYY A;  3FF5 A;  4R1H A;  4D0P A;  3BTC A;  2X6Y A;  2WV1 A;  2VI6 A;  2BY1 A;  2XPU A;  3M8F A;  1BR1 A;  2BY0 A;  2JA6 J;  2F5D A;  2G0E A;  1JI8 A;  3V4G A;  4DBR A;  2ID6 A;  2FML A;  1YIT I;  4YEJ A;  5BMZ A;  1YRN B;  1W4M A;  3CDL A;  3JRF A;  1CF7 B;  1FC3 A;  4AM3 A;  3J81 K;  4E7H A;  3E0J B;  3S1M J;  2XGC A;  3ZR8 X;  3FBI B;  3R4K A;  3H3Z A;  1JGS A;  3P5J A;  2ZME C;  5B3S H;  4F52 A;  2MLG A;  1KQ0 A;  2JTV A;  2W7N A;  1OLT A;  2FBH A;  4ESF A;  2H6C A;  1A31 A;  2FA5 A;  2ZO4 A;  5E3O A;  3OYM A;  4D1Q A;  2GOX B;  3MWM A;  3BG3 A;  3H35 A;  2M30 A;  5BQT A;  2MSY A;  1MMG A;  1GUU A;  3JAM K;  3CUQ B;  2Y0M A;  2JA2 A;  1VI0 A;  4KMU X;  1V54 H;  1VTN C;  4MQV A;  5EZH A;  4NC7 A;  5BPD A;  4AUX A;  3O3K A;  3QPT A;  1XB4 A;  1ZGA A;  1LFP A;  2RVC A;  2E36 A;  2OF7 A;  4RAY A;  3PL8 A;  4PGG A;  3IRQ A;  1MH4 A;  2UZK A;  4XRS G;  3B73 A;  4PFP A;  1BIA A;  2OV7 A;  2FOW A;  5D6F A;  1UST A;  2Z99 A;  4R79 A;  2PJR B;  5D5V B;  1SAU A;  4KA4 A;  5GPC A;  2E2J J;  4OMZ A;  3ERM A;  9ANT A;  2IJL A;  3I9V 2;  4B3A A;  1XPX A;  2P7V B;  2HPI A;  4I6Z A;  1AKH B;  3OS0 A;  1O4X A;  2DT5 A;  4HX8 A;  1HA8 A;  2LYC A;  5IT9 Z;  2HVR A;  3H5N A;  3RPQ A;  3BJO A;  2DTR A;  2F5E A;  3DBR B;  3OIQ A;  4IQJ A;  3AL0 B;  1W36 C;  2X1C A;  5M5X J;  2OTJ I;  1U0J A;  2QBY A;  1LDK B;  1JTX A;  3H3V K;  2ZNY A;  3S1N J;  3C7J A;  3ZQG A;  2PI0 A;  2COM A;  5FRN A;  2L0K A;  3LOC A;  3DKW A;  2CQQ A;  1ETO A;  2QKL B;  2LR8 A;  4HNU A;  4BXF A;  1MND A;  1PUF A;  4LIU A;  2DFI A;  3F6V A;  5B1B H;  3GFI A;  3OOP A;  5DM7 F;  3KEO A;  3SFZ A;  1J59 A;  4XIC A;  2KMU A;  2K9N A;  1ULY A;  1HLV A;  3GFL A;  3OYE A;  3P7N A;  4KN4 X;  1NHA A;  5FRM A;  3TP3 A;  1XS9 A;  1EH8 A;  5E3N A;  2PG4 A;  1BI3 A;  1UZC A;  4WXD A;  1S29 A;  4XON A;  2CU7 A;  4C3I J;  4F7Z A;  2A61 A;  3HSR A;  4G6Q A;  3Q9V A;  5HNH A;  3AG2 H;  2IVM A;  1JGG A;  2V1X A;  3QOP A;  4W1U A;  1IRF A;  3MD2 A;  4UVA A;  2KL4 A;  2A5W A;  4MGR A;  3D5S C;  2HI3 A;  1RR8 C;  4LIV A;  3Q5F A;  2RQP A;  3QPL A;  3JCU C;  5DM6 F;  1RR7 A;  1Y8Q B;  2M8E A;  1BC7 C;  4CO8 A;  2VJJ A;  2OCC H;  4L9T A;  3FXU A;  3I4N J;  2HTS A;  3ZQL A;  1HBX G;  1TC3 C;  2HEO A;  2GIZ A;  1KU3 A;  5ILV A;  4BYY A;  2EZI A;  5EGO A;  2MW8 A;  2XKO A;  3Q3S A;  4G12 A;  3KYC B;  3FXJ A;  3MQ0 A;  3S3O A;  4V2G A;  2EIL H;  4CA0 A;  3MKZ A;  4LLN A;  4CUG A;  1K79 A;  2OD5 A;  1FP2 A;  3S17 J;  4HQM A;  1P4W A;  2OA4 A;  2VUM J;  3S2D J;  4D7N A;  3DF8 A;  1VQ8 I;  2O5R A;  5F0H A;  4KIS A;  3G6E I;  1P9Q C;  2WB1 A;  1WJB A;  1ON1 A;  1LB2 A;  2DA6 A;  4DGW B;  4DNC A;  5HDK A;  4AD9 A;  1R1T A;  5K5O A;  1YS6 A;  1E0E A;  3OMY A;  2R7O A;  1RET A;  5F6F A;  1FBU A;  1UMQ A;  3H1C A;  2IRF G;  2M7A A;  4EAT A;  5FKO A;  3S1R J;  2D5V A;  2XB5 A;  1E2X A;  2ZCW A;  2O7O A;  1IRZ A;  4PUS A;  1E17 A;  1BC8 C;  4M6X A;  2DBB A;  1MJ9 A;  1W7P B;  3IP4 B;  4ENK A;  5F08 A;  1OCR H;  3RKQ A;  4ZTJ A;  2VJ5 A;  4M71 A;  4NHJ A;  2OBP A;  5TJJ A;  3ESW B;  1T39 A;  1WI3 A;  2M3A A;  4U87 A;  1Z6R A;  5DD4 A;  3CC7 I;  2FX0 A;  4OOI A;  3FHZ A;  1TWH J;  1OKR A;  3VYR B;  2MC4 A;  2NVY J;  3R6S A;  5FB2 A;  3KP4 A;  1XMA A;  2BVL A;  1V3F A;  2VOO A;  1GVD A;  4IF4 A;  2EPF A;  2WBM A;  4WXH A;  5A2Q Z;  5IPA A;  1I27 A;  4F92 B;  3LA7 A;  3FXQ A;  1AWC A;  4CH7 A;  4XOT A;  3LAJ A;  3ELK A;  4JP0 A;  3MAJ A;  1MMD A;  4L5E A;  1X3W B;  4Y17 A;  3DLA A;  1NG6 A;  3RYR A;  1SVO A;  3DQV C;  5H6Q A;  4L5J A;  1MBG A;  2ELK A;  2Z5U A;  3KLN A;  1HC8 A;  2HQA A;  1JKO C;  1XMX A;  1QZZ A;  2EFP A;  3HOV J;  2YUS A;  2XVC A;  2E19 A;  2Q2E A;  4L0Y B;  1SMY F;  2WV0 A;  4X1E A;  2D1H A;  3W6J B;  5BS6 A;  4UUS A;  3CJR B;  1P92 A;  3CDI A;  3HIF A;  2ZJP F;  1D8J A;  3RYP A;  1BW6 A;  1G3Y A;  3A2K A;  4J00 A;  2DFE A;  5IP9 J;  2M4K A;  2VQH A;  2ME6 A;  3WTX C;  2K86 A;  5EYR A;  3I59 B;  2R4G A;  4QWQ A;  5DYM A;  2RV8 A;  3JRG A;  3K2Z A;  1FOW A;  2VBY A;  4KYW A;  3H0D A;  2RKH A;  4YFK F;  1D0X A;  1E3P A;  1LVA A;  4IKF A;  3QWL A;  3SZT A;  1K6Y A;  4E7I A;  3PSI A;  3I4M J;  2UV1 A;  1UB9 A;  2DMU A;  4G6T B;  3CTA A;  2A3S A;  4EM2 A;  2F2E A;  1I3A A;  4IQ4 A;  3V7R A;  4PFO A;  1QGP A;  1IF1 A;  4RB3 C;  5TRD A;  5EZG A;  4F93 B;  3L09 A;  3PFY A;  4AVP A;  3F23 A;  3DCF A;  2AQE A;  2CO5 A;  2X6O A;  4F55 A;  3K1P A;  4A5N A;  3KP3 A;  5HVQ C;  4C3J J;  2DMT A;  2HDW A;  1T38 A;  2ID3 A;  3T1B A;  5JLW A;  1P7I A;  5K7H A;  3OV8 A;  5E1X A;  1SVL A;  1ZK8 A;  1OYY A;  1ZTR A;  3J7A O;  3E97 A;  3LSG A;  1BM9 A;  3B6C A;  3FMS A;  2GIV A;  2K4B A;  4Z6Y A;  1SD7 A;  4NBQ A;  2XRN A;  1FOK A;  1FEX A;  1NK2 P;  5CQE A;  2YSR A;  4KUM A;  4AWX B;  4Q5S F;  3HOW J;  2GXG A;  2K9Q A;  1OPC A;  4XLC A;  4YEL A;  2BY2 A;  3OL3 A;  4OAY A;  2H27 A;  2QM3 A;  1Z0X A;  5IP7 J;  1X1B A;  2OPT A;  3PNT A;  4UUV A;  3OR1 C;  1BN5 A;  2IAI A;  2DFH A;  3HM5 A;  5JHU A;  1VQL I;  4I7H A;  3KP6 A;  2VT2 A;  2EH3 A;  4H0E A;  2QF7 A;  2KLO A;  2P6S A;  1WJC A;  1SAX A;  3IAM 2;  3FHN A;  4Q47 A;  4AIJ A;  3ROU A;  3QP5 A;  2KRC A;  4W97 A;  4RAF A;  2DDB A;  2PMU A;  5J8C A;  4OMY A;  3ZGK A;  1IGN A;  2IA1 A;  3K4M A;  4GO1 A;  4LD5 A;  2VPL A;  5C44 J;  4LG0 A;  2BYV E;  4RAG A;  1TWA J;  1IDY A;  3LMM A;  3TKY A;  3R61 A;  4M9S A;  1T2K A;  3G4S I;  5JHF A;  1K6O A;  1XGS A;  4XN3 A;  2L9S A;  2XGD A;  5J8F A;  3PO2 J;  4PJN A;  4BE1 A;  1SEU A;  1MDM B;  2CGP A;  4AIK A;  3WGH A;  4B3X A;  1MIJ A;  2F48 A;  1TWC J;  4XID A;  4HLY A;  3FWE A;  3CUQ C;  2R7W A;  1YW7 A;  1T6S A;  2M4G A;  5J40 A;  4RB1 A;  1WSU A;  1X2N A;  3TQN A;  2KRF A;  3WOD F;  4RA2 A;  2LBF B;  2IGN A;  2E60 A;  1REP C;  1QNT A;  1BR2 A;  3PSF A;  2NRA C;  4OIP F;  1YYV A;  2XAH A;  2KRH A;  4DOZ A;  2Q0O A;  1SFO J;  1WCM J;  3L2Q A;  3K1M A;  4A3C J;  5FO5 A;  1WJ5 A;  2JVG A;  3N97 A;  2KDO A;  5CYV A;  1I6X A;  3OL4 A;  2K02 A;  3ZQ7 A;  3SEZ A;  4WK8 F;  3WTZ A;  3VSL A;  1YIO A;  3E3V A;  3HZJ A;  2DN0 A;  3JRC A;  1MNM C;  3QYB A;  3TBI A;  3COA C;  1LJ9 A;  3K7A J;  1JJ6 C;  4ZDO A;  3LQR A;  2E35 A;  3ASN H;  2V79 A;  4S05 A;  3WG9 A;  3R60 A;  2XAQ A;  1Z3X A;  4XLF A;  2HYG D;  3EET A;  2DMP A;  1N25 A;  2DU9 A;  2DAO A;  3BJA A;  2X51 A;  3FX3 A;  5H2F C;  1U78 A;  4RDU A;  3JRA A;  3AL0 C;  2GAU A;  3TO9 A;  5EG0 B;  1PUE E;  2R5Z B;  2DI3 A;  2FOK A;  2VKD A;  1HF0 A;  4AYB A;  1ONV A;  2FD5 A;  5GAH J;  4CZC A;  2DOE A;  3BZ6 A;  3TW6 A;  3WGI A;  3H5A A;  1X1D A;  2QSG X;  1KGS A;  3S8P A;  3L2C A;  3I55 I;  4GFB A;  2NS8 A;  4FCY A;  3K6G A;  2DT7 B;  2W85 A;  3HTS B;  4OIN F;  4NQW B;  3N4M A;  3GZ5 A;  4XOR A;  1FP1 D;  3ZQI A;  1EA3 A;  5FFZ A;  1ON2 A;  5HLI A;  1EF4 A;  1VQN I;  1E3O C;  4DYC A;  3CD6 I;  1GHC A;  5LEJ A;  2NS0 A;  1G4D A;  4G94 A;  4DW6 A;  3GTQ J;  1TT5 B;  2EV5 A;  2BE5 F;  1V5F A;  4HSR A;  3DKX A;  2LTP A;  3F9K A;  1QVT A;  1VQP I;  2V1U A;  3C18 A;  3L2W A;  2L3D A;  3KZI C;  3AG4 H;  1K4T A;  2WA0 A;  3G1O A;  2HR3 A;  2HXO A;  3GVA A;  2NOJ B;  1U3E M;  1D5Y A;  3GLL A;  1D0Z A;  1U5T A;  1U6G A;  5IYB J;  2PMZ N;  3PFI A;  1EH6 A;  2IA2 A;  3BTL A;  4FE7 A;  3TO6 A;  1QBJ A;  3A01 B;  1LFB A;  1NK3 P;  2WY8 Q;  4GDF A;  1P4A A;  3VPR A;  4L18 B;  4CSW A;  5J6X A;  3CCE I;  2ZXH A;  4ESB A;  1B6A A;  1H9T A;  2V9P A;  4UV8 A;  3BT9 A;  5ICF A;  2X1D A;  3TO7 A;  2BZT A;  3ZQF A;  4IHY A;  5LBQ A;  2MG4 A;  4LIT A;  3CO7 C;  3CME I;  1F4K A;  1FY7 A;  4HA8 A;  5EDN A;  4A6E A;  4G9Y A;  5GTI C;  4EVI A;  2UUZ A;  4BU2 A;  1L0O C;  4I0A A;  3WU2 C;  1MH3 A;  5AON A;  3CCJ I;  4BY7 J;  1ZRD A;  1MSE C;  3CJT B;  1HW5 A;  2VC1 A;  4CHU A;  4M3E A;  5FLM J;  1T98 A;  3TDU C;  4G7H F;  3HEF A;  1HDD C;  2R7Z J;  2VL8 A;  3OYL A;  4CCK A;  3BG5 A;  1YS7 A;  3GX4 X;  2H8W A;  3VWB A;  2IGO A;  1DPR A;  4I2O A;  4C2U A;  1R4M B;  2Y0S N;  1Y0N A;  3QPH A;  2FSW A;  2N8G A;  2DQR A;  3OYH A;  1H9G A;  1I1G A;  2GWR A;  5IT3 A;  4AVZ A;  3EUK L;  3NEU A;  2UXN A;  1R00 A;  4E7S A;  3ERE D;  2K5C A;  2Q8K A;  1ZGW A;  2KIU A;  2CV1 A;  4ZYG A;  1G8X A;  2DK8 A;  3KET A;  1LQ1 A;  2E7W A;  1ETX A;  4A5M A;  4PJM A;  4UXN A;  1WWX A;  3DPL C;  2JMW A;  5CVI A;  2VOP A;  3J7Y J;  1WPK A;  1WQ2 A;  2W48 A;  3MKL A;  3HOS A;  3SHF A;  2VOD A;  3J80 Z;  3IH3 A;  1OR7 A;  4DIQ A;  1G3W A;  2Z2S B;  3ZOB A;  2VB6 A;  2ISZ A;  2YU9 J;  1DGR M;  4XLA A;  1FOX A;  5D6E A;  1H88 C;  2EA4 A;  4BXU A;  5JI6 A;  2AQF A;  2L5Q A;  4FX4 A;  3QAH A;  4XKC A;  2LY2 A;  3V42 A;  4MLO A;  3OYA A;  1H8A C;  4IRG A;  1DDN A;  3BCA A;  3S32 A;  5LLQ A;  4Y3O A;  3M4O J;  1VQ9 I;  1W0U A;  5CVU A;  2BOL A;  2CG4 A;  2LKP A;  2IXS A;  4EJV A;  4BQQ A;  2VBW A;  3BRO A;  4RM3 A;  3FKJ A;  3DXJ F;  2XF6 A;  4ZDP A;  2KQR A;  3GFM A;  1J5Y A;  2M5W A;  3ABL H;  2YX4 A;  1CGP A;  5FKK A;  5K7F A;  2P6T A;  2EA2 A;  4BS9 A;  2O03 A;  3ZPL A;  3SZG A;  3ECH A;  2CJJ A;  2JSC A;  2L9N A;  4B48 A;  2XV4 S;  3GTP J;  1JTY A;  1ZHF A;  3M07 A;  1PJR A;  2EZK A;  4PK4 A;  2JWT A;  4HQE A;  1JKP C;  1F43 A;  2OAZ A;  2QSH X;  2QBY B;  1IN7 A;  2CQN A;  2Y48 A;  1Y1V J;  4BJ6 C;  1S3J A;  5HLT A;  3WTT C;  2ESH A;  5B1A H;  4ETS A;  3REO A;  2ECB A;  2RGV A;  1T8I A;  2NVX J;  1SD5 A;  2EFW A;  4HNV A;  4RLF A;  1R36 A;  3HGG A;  5AIQ A;  4QIW N;  1IDZ A;  1ORK A;  2DJI A;  3CQZ J;  4HBL A;  3ZMV A;  2LRE A;  2F6C A;  2KIM A;  2M2E A;  4KT6 A;  2TRT A;  2VQG A;  2MD0 A;  2V4J C;  4LG3 A;  2JPB A;  4NUB A;  2KZV A;  3QYE A;  2QLZ A;  4EEF G;  3MCZ A;  4YFN F;  2O6G E;  4U0Y A;  2DJN A;  2EV6 A;  3JRB A;  4EGZ A;  3RSN A;  4EJO A;  1N75 A;  2ZXW H;  2I10 A;  2JT1 A;  2PQ8 A;  2OC6 A;  3SZP A;  2QQB A;  4ZYA A;  3WTV C;  3QRF F;  4IL6 C;  1XTA A;  1BA5 A;  2PLY A;  3Q0W A;  5GTH C;  2ACJ A;  2QQA A;  1J7K A;  1Z67 A;  3MKW B;  1I6H J;  1IAW A;  2A05 A;  3F8M A;  1X3Z B;  3IKT A;  4XRS A;  2DW4 A;  2L4M A;  2JK3 A;  2VC0 A;  2IS4 A;  3CES A;  4RLQ A;  3O8H A;  2FBI A;  3KCC A;  1IXS B;  1FT9 A;  1MW7 A;  2QCO A;  3KZY A;  5E1Z B;  4XM3 A;  4J01 A;  2E1C A;  5E17 F;  3FM3 A;  4JBA A;  1KYZ A;  4JOM A;  1V5E A;  2DQL A;  3DEE A;  4HF0 A;  4CCO A;  2IEK A;  1W5S A;  2A07 F;  1YHQ I;  1NG7 A;  4HG2 A;  4AIH A;  3BR5 A;  5K7Z A;  2DFF A;  2M8G X;  4I99 C;  2HVS A;  4XLP F;  3E1S A;  2IPQ X;  4Q48 A;  3FMQ A;  2BVM A;  2K4J A;  5FGM A;  5EGO B;  2NVU B;  2VIX A;  2R7U A;  5DTD A;  1B1B A;  5F04 A;  1SD4 A;  2H1L A;  2DYS H;  3C1D A;  3ABK H;  4XLE A;  3S2H J;  4HLX A;  1GXQ A;  2HFH A;  1K78 B;  2JRM A;  2HXI A;  1SFE A;  1WJE A;  3CLQ A;  1W36 D;  3TDZ C;  3W6K B;  2CH0 A;  1OJL A;  2HDD A;  2LOO A;  3RKW A;  1QHH D;  3FKI J;  2GBY A;  2GZW A;  1FYM A;  5IT9 K;  1B9N A;  3OYD A;  3QPS A;  5B66 C;  2D2W A;  5F1R A;  4LB5 A;  3WG7 H;  1ENH A;  5JLX A;  2KKO A;  1CF7 A;  3JRI A;  2NS7 A;  4ASN A;  2PN6 A;  3PIO F;  1Y0U A;  3KEY A;  5J3L A;  1Y6I A;  3M3Y J;  5FD6 A;  1OCC H;  2FNA A;  2DCE A;  2STW A;  1F1Z A;  4KFC A;  2MLK A;  3C2B A;  2KFD A;  1BI2 A;  1FIA A;  4MIM A;  3RPU D;  2PFB A;  3V8J A;  3ZMT A;  4EJW A;  4S04 A;  3G73 A;  3TOA A;  5IYD J;  3NAU A;  3TGN A;  2EV0 A;  5L3G A;  5CJ9 A;  2ZXJ A;  1V55 H;  4RB2 C;  5L3F A;  4C3H J;  3SQN A;  4XRM A;  1Q1V A;  2HS5 A;  2FQ3 A;  4BGD A;  3D5R C;  2RN7 A;  3JTG A;  1UCR A;  1ZKG A;  2TCT A;  1LDD A;  2DA5 A;  5EEH A;  1XSV A;  1K7A A;  3BLY A;  3CUQ A;  3CCS I;  1J75 A;  3A4C A;  4YRV A;  4KIG A;  4NB5 A;  1E3H A;  3GZ6 A;  4IRI A;  4DZJ A;  3BCB A;  1X1C A;  2BW3 B;  3WE2 A;  1FOY A;  4RAZ A;  1WFX A;  2Y9Z A;  1C0W A;  3BZK A;  2A68 F;  3BTI A;  2I5U A;  1FJL A;  3DTI A;  3LSH A;  2M0C A;  2TDX A;  2Y2Z A;  1RIO H;  3OOU A;  2PJR A;  2HKX A;  3A1Y A;  1QZY A;  1U8R A;  4BUP A;  3BR0 A;  1IXC A;  3HB9 A;  2EB7 A;  2W25 A;  1Z91 A;  4ZYE A;  3DWL E;  4XSZ F;  3TP0 A;  2K3P A;  3IWF A;  4EQQ A;  4JX5 A;  2NNY A;  4HX4 A;  4UUS B;  1QQI A;  4XNF A;  3U1D A;  3RTR A;  2O9L A;  3HOU J;  1DU0 A;  1AKH A;  3KPH A;  2M87 A;  3T8R A;  1VQ7 I;  2KJB A;  3FM5 A;  3KYL A;  3E5X A;  4BXX J;  3HDD A;  3LSP A;  2W00 A;  1FBS A;  5ICE A;  4L9N A;  2LVS A;  1YI2 I;  1W1W E;  4I01 A;  4E4H A;  4PJJ A;  2M1B A;  1ZQ3 P;  3H9G A;  3T0Y A;  2VAS A;  3PO3 J;  3BQZ A;  3FXM A;  3FDY A;  1I39 A;  3CCM I;  1T08 B;  4Y15 A;  2KIS A;  3LSJ A;  4WX9 A;  1XGN A;  2QWW A;  2JRT A;  4HRI A;  2M34 A;  1WJA A;  1O7F A;  3BR1 A;  1WJF A;  1FMV A;  2L9V A;  2CRG A;  3P9K A;  2DMQ A;  2VPR A;  5LD2 C;  4BEH B;  5LHH A;  3S93 A;  5LGT A;  4KT5 C;  1IRG A;  3K0L A;  2BXZ A;  2CQX A;  3JSO A;  3WGG A;  1PP7 U;  1R49 A;  4E7Z A;  2NAZ A;  1PYV A;  4Q4Z F;  1ZN2 A;  5KNL A;  1LEA A;  5TIS C;  3V8L A;  3K69 A;  2C6Y A;  2IS2 A;  4IPA A;  1LE8 A;  3H9J A;  5IOY A;  2X9D A;  1UG0 A;  2J5P A;  4XKV A;  5FFX A;  3VB2 A;  1TQI A;  1T0F C;  2YPR A;  1R71 A;  1GT0 C;  2IW5 A;  2HZD A;  3IRR A;  2HQ5 A;  4UNO A;  1A5J A;  1IN6 A;  4PZJ A;  2HDC A;  2LMD A;  3E5Q A;  3TW7 A;  1M1E B;  1XCV A;  2CW0 F;  4DJA A;  2EK5 A;  5LHG A;  1POG A;  4MNU A;  5K5R A;  4IX7 A;  5A2Q K;  3K4J A;  3ASO H;  4MEY F;  1Z7U A;  1Z77 A;  3GFJ A;  3ECO A;  1FIP A;  3HYI A;  2VKE A;  1JE8 A;  1OYI A;  3CLO A;  1O3R A;  4KDP A;  2MAB A;  1ETV A;  2DOF A;  2EBI A;  1JKQ C;  3O8G A;  5GAD J;  3WU0 A;  2R7F A;  2D1V A;  3IAS 2;  3F0C A;  5FRO A;  2NYX A;  1MJA A;  5LFA A;  4LG0 B;  5JVG F;  1YTY A;  1B9M A;  3D5L A;  1ETQ A;  1TW2 A;  2FNP A;  4P55 A;  4OWR B;  1IRX A;  1L3L A;  3HKZ N;  5B5E C;  1O3T A;  3AG3 H;  2R0Q C;  1D5V A;  2P8T A;  2V9K A;  4LB6 B;  2MFZ A;  1MBF A;  4RMN A;  1WGX A;  4A3F J;  4XLN F;  1XN7 A;  4A3J J;  5DCF A;  4E6K G;  1WKM A;  4IRH A;  2XGX A;  3CUO A;  4QSH A;  1JJ8 C;  1MMA A;  2RDP A;  3D0S A;  4DYR A;  3AAF A;  1BBY A;  1OCO H;  1FSE A;  3JRE A;  2XSD C;  4CYC B;  2K9S A;  1MBH A;  4XL9 A;  2VXZ A;  2P81 A;  3BR2 A;  3GCM A;  1X58 A;  4MFE A;  4QPQ A;  2HYF A;  3ZXS A;  5CLS A;  5KCM A;  2EJR A;  3BY6 A;  3TMO A;  4IHT A;  3W2A A;  2L7F P;  3RQ4 A;  4PJL A;  2VJI A;  3DEW A;  5DS9 A;  2V6E A;  3KP5 A;  1X1A A;  4A3G J;  1J9I A;  1RZ4 A;  5HOD A;  1YFH A;  4CZZ A;  4M6V A;  1AHD P;  3L2R A;  1VQK I;  2K9L A;  1W5C C;  2F4O B;  4I09 A;  4CCM A;  2FJ1 A;  3SYT A;  5HS8 A;  3JTH A;  2DT6 A;  2OUM A;  5LHI A;  4WWC A;  3QP6 A;  2X85 A;  4FQG A;  4HX7 A;  1O3Q A;  5HS7 A;  1N78 A;  5F0F A;  4BE2 A;  4C2T A;  1GV2 A;  4FHT A;  3GXO A;  4XK4 A;  1O3S A;  3X2Q H;  1WRJ A;  3K1N A;  1FTT A;  1A6I A;  2V26 A;  3FXO A;  4UB6 C;  1D8K A;  1T56 A;  2ZXI A;  2ZKZ A;  4II3 A;  4C30 A;  3BOQ A;  5DV5 A;  3G2B A;  5D4R A;  2VBZ A;  1MJB A;  2EIK H;  1LFU P;  3O6B B;  1WHU A;  5E1W A;  3JR9 A;  2KZG A;  5HS9 A;  3I59 A;  3ZQH A;  1I3Q J;  3AFH A;  3DPU A;  2JJ7 A;  2XPW A;  3LWF A;  4GYG A;  4EM0 B;  2LLK A;  5KAI C;  1Z05 A;  3WHB A;  4G7Z F;  3L00 A;  2K27 A;  3L1P A;  2P0W A;  1F36 A;  4BHC A;  3L2U A;  1A36 A;  1UHW A;  3B6A A;  2M9H A;  3HGY A;  3CC2 I;  3W2V A;  3CCY A;  2VJ4 A;  3K2A A;  2EQR A;  3RQI A;  4HF2 A;  5J1Y A;  2GQQ A;  1WH5 A;  2CSO A;  2JQ7 A;  1R1V A;  1JUS A;  5C4J J;  4YIR X;  4UHT A;  2DA1 A;  1TTY A;  4UVB A;  1U5T B;  3KFW X;  1ZG5 A;  1ETY A;  1S6L A;  2JVH A;  1LPQ A;  2VLA A;  1OCP A;  4QLC U;  4C2M J;  3NWT A;  3K10 A;  4QTR A;  3I54 A;  4M3B A;  2GLO A;  2OTL I;  1VZ0 A;  2W84 A;  2ZME A;  4PSX A;  4DZP A;  2WAQ N;  2DOA A;  4RGU A;  2B63 J;  5KHD A;  5M3M J;  3RKX A;  5IY5 H;  2VXD A;  3IH4 A;  5GAE J;  2X48 A;  3CDH A;  4LGW A;  3S3N A;  2L7K A;  3VYU B;  2HYJ A;  4M74 A;  3K4K A;  3RJP A;  2R5Y A;  1DQU A;  4I0B A;  1D1A A;  2EFQ A;  5C4X J;  2Q1Z B;  2V1N A;  2HOA A;  5DCM A;  5ICG A;  4NDL A;  4OIQ F;  3PIP F;  4WF2 A;  3CP2 A;  1HW1 A;  2IGM A;  2PX9 A;  3PQK A;  1IV6 A;  2PMZ A;  2AO9 A;  4BHB A;  5AIP A;  3F21 A;  3ZQC A;  2VE8 A;  1P4X A;  1WI9 A;  1RPW A;  3QOD A;  1IXR C;  2LF8 A;  2COB A;  2CV2 A;  1XDS A;  1FLI A;  5EF6 A;  3IC7 A;  3CCV I;  1Y39 A;  2CUJ A;  2JN6 A;  2RRE A;  2ZC2 A;  3HXL A;  4HV6 A;  3G71 I;  1HW2 A;  4U0V A;  3JSP A;  4D5C A;  5EEG A;  1K61 A;  4XR6 A;  3EQL F;  2VE9 A;  4BBR J;  2DA4 A;  5F27 A;  3GTJ J;  4HPQ A;  2Z9O A;  5F64 A;  2XAU A;  1LKX A;  3E6D A;  2XPV A;  3GTL J;  3JW4 A;  3TL4 X;  1MDM A;  1XC5 A;  1F5T A;  2LRD A;  2O0Y A;  4OIO F;  2L7Z A;  4IEJ A;  4KIT B;  1OQY A;  3CP8 A;  1MMS A;  3ZMZ A;  3K9T A;  4IHX A;  3BPX A;  4I76 A;  3FXR A;  1DGW Y;  2QA4 I;  3RZD J;  2GA1 A;  1LDJ A;  2PBI A;  2L7M P;  2MH9 A;  2HWV A;  2LBF A;  5CVR A;  2FUG 2;  3FBN B;  2ISY A;  2IGK A;  2UXX A;  2FQ4 A;  2RAE A;  1TNS A;  1IJW C;  2BHY A;  3I3L A;  2MBF A;  2R7Q A;  3CF2 A;  3G1M A;  3RPU A;  2FBK A;  2FXA A;  5KAF C;  5K1Y A;  1FNN A;  4BL0 B;  1ZGJ A;  2CUZ A;  3BC8 A;  4B47 A;  1YLF A;  3GF2 A;  4LLG F;  2OQG A;  3LSI A;  1R22 A;  3OR2 C;  2P5V A;  3GWZ A;  4A2U A;  4M3F A;  1LEB A;  1D1B A;  2HOT A;  3L7W A;  3OYF A;  4HDU A;  1V5G A;  3TOB A;  1WZ2 A;  3H9Q A;  1TLH B;  5DUK A;  2PMH A;  3FIS A;  2YR2 A;  2HQR A;  3NAR A;  3ZMU A;  2NXN B;  1YE9 A;  2O3F A;  2QYO A;  4HYE A;  4G8X A;  1B72 B;  3ZN0 A;  2HPM A;  3I5U A;  5EG0 A;  3EYI A;  3UR3 C;  5LRS A;  1BOB A;  3F22 A;  2JZY A;  2JA5 J;  1ETK A;  1MD0 A;  1XGM A;  4O5V A;  3W6V A;  2W82 A;  2GM4 A;  1D0Y A;  3A0H C;  4A0Z A;  3HL2 A;  1B4A A;  3FZV A;  1BL0 A;  4ZTF A;  2ZFU A;  3GTM J;  2XIG A;  4B09 A;  1S7O A;  1U8B A;  3O2P E;  4C9Y A;  3IV5 A;  3M1C A;  3VOE A;  1W7P D;  3OIP A;  4PGH A;  1YW9 A;  4NQW A;  3D1N I;  4MO7 A;  2Z3Y A;  2XHK A;  2XB0 X;  4U7D A;  3GTG J;  3OWT A;  1R6R A;  2ICW G;  4CXF A;  3HSE A;  2H94 A;  3J7A Y;  2V7F A;  4N4O B;  3V7S A;  4HF1 A;  3I58 A;  3LSK A;  1Y8R B;  3U2R A;  1X3U A;  4R8H A;  1AOY A;  3UNG C;  4RGR A;  1S5L C;  1ZLK A;  3F8B A;  3HJE A;  4LK1 F;  5ED4 A;  1R5H A;  2HOS A;  2X6W A;  2G7U A;  2CWE A;  2E1M B;  4JQF A;  4BJ5 C;  2WY7 Q;  3ULQ B;  3PUB A;  2QQ8 A;  5E20 A;  3UKG A;  3J80 K;  1FYL A;  2CQ7 A;  4RS8 A;  3HUG A;  4ITV A;  1HKS A;  1ACI A;  5GAG J;  4MQ9 F;  3KZZ A;  3ZMS A;  3OYJ A;  3A01 A;  1MMN A;  2PJP A;  1B59 A;  3OYB A;  1OYW A;  4J19 A;  4BE0 A;  3N05 A;  3HHG A;  3S14 J;  1OCZ H;  1FBQ A;  3LA3 A;  3CMM A;  4P96 A;  5DDG A;  1EJ9 A;  4BQO A;  1S7E A;  2IP2 A;  3BR3 A;  3KX2 A;  3HPG A;  4B44 A;  4KIB A;  2KDZ A;  3BJ6 A;  2QEN A;  4HW0 A;  2Z16 A;  3BR6 A;  4ABZ A;  2LKS A; 
#chains in the Genus database with same CATH homology
 1UG2 A;  2X6O A;  1JUP A;  3WHC A;  4DZJ A;  4C3J J;  2DMT A;  2ID3 A;  1BJZ A;  5JLW A;  1P7I A;  2R93 J;  5FKL A;  4BKX A;  5K7H A;  3E7L A;  2Y9Z A;  4MFD A;  2ECC A;  1ZK8 A;  1ZTR A;  1UHS A;  3BTI A;  4JX4 A;  5C3E J;  3LSG A;  1FJL A;  2M0C A;  3B6C A;  2Y2Z A;  3OOU A;  1PUF B;  1FEX A;  1NK2 P;  5F1J A;  3BR0 A;  2EZH A;  3HOW J;  3HB9 A;  2K9Q A;  4BY1 J;  5GP9 A;  1HDP A;  3TP0 A;  1FTZ A;  1RKW A;  4V2F A;  4JX5 A;  1VF9 A;  4UUS B;  1Z0X A;  5IP7 J;  4AYB N;  1JT0 A;  2OPT A;  5J1R A;  2IAI A;  3HM5 A;  2O9L A;  3HOU J;  1DU0 A;  1AKH A;  2JA7 J;  2EH3 A;  3SJM A;  2QF7 A;  4M3G A;  4BXX J;  3HDD A;  2ME0 A;  4JX6 A;  3LSP A;  3CMY A;  1AU7 A;  5BNG A;  2LVS A;  3A03 A;  4FE4 A;  1VND A;  4W97 A;  1ZQ3 P;  2XGE A;  2H8R A;  3PO3 J;  1IGN A;  2MGQ A;  2Y30 A;  3BQZ A;  2AHQ A;  2O8K A;  3SFI A;  4Y7N J;  5C44 J;  1TWA J;  2NOG A;  1IDY A;  3LSJ A;  3HOZ J;  1MSF C;  3GBG A;  2R5Z A;  2M34 A;  4FTH A;  3BR1 A;  1HCR A;  1B8I A;  2XGD A;  4S0H B;  3GTK J;  3PO2 J;  2CRG A;  2DMQ A;  1APL C;  2VPR A;  4BBS J;  5FLV A;  3GTO J;  1TWC J;  4XID A;  1DU6 A;  2CQX A;  3S16 J;  2IBD A;  1X2N A;  2KT0 A;  1LE8 A;  5IOY A;  2X9D A;  5J1U A;  3MN2 A;  1MBJ A;  4FIS A;  1GT0 C;  1SFO J;  1WCM J;  1P7J A;  2HQ5 A;  4A3C J;  1A5J A;  3TW7 A;  4B1R A;  1POG A;  3QQA A;  3TED A;  1WH7 A;  2LK2 A;  2DN0 A;  1Z77 A;  3JRC A;  1MNM C;  3K7A J;  1FIP A;  1JJ6 C;  2VKE A;  1YRN A;  1ETV A;  5IP6 A;  2EBI A;  1JKQ C;  3O8G A;  5FKM A;  3FIW A;  2E2H J;  2DMP A;  1GDT A;  2LFB A;  3F0C A;  1IUF A;  1U78 A;  4RDU A;  3JRA A;  2Y9Y A;  1ETQ A;  4IHV A;  5EG0 B;  1QRY A;  2R5Z B;  3HKZ N;  1Y1W J;  4A93 J;  1U9N A;  2R0Q C;  3Q0V A;  1HF0 A;  1B8I B;  2ZB9 A;  2FD5 A;  1MBF A;  3G1L A;  1WGX A;  3TW6 A;  4A3F J;  5E3M A;  2DA7 A;  4A3J J;  3S1Q J;  3BG9 A;  1T33 A;  4GFB A;  2CUF A;  3S15 J;  2NS8 A;  4FCY A;  4QSH A;  2K40 A;  5FKN A;  1JJ8 C;  4DYR A;  5FJ8 J;  1OCT C;  1HOM A;  1R9T J;  2E2I J;  3JRE A;  2LY9 A;  1LE8 B;  2E1O A;  2XSD C;  4CYC B;  2NVT J;  1MBK A;  3FK6 A;  1JKR C;  3ZQI A;  2K9S A;  1MBH A;  1QPI A;  2P81 A;  3BR2 A;  1H89 C;  1X2M A;  1CQT A;  1B72 A;  3HOX J;  1X58 A;  4MFE A;  4A3E J;  1EF4 A;  1E3O C;  4DYC A;  1VFC A;  1W0T A;  2L7F P;  4DW6 A;  3GTQ J;  3BTC A;  2WV1 A;  2VI6 A;  3DEW A;  5DS9 A;  2XPU A;  2LTP A;  1QVT A;  2JA6 J;  2G0E A;  4A3G J;  5HOD A;  3G1O A;  1ETW A;  2ID6 A;  2HXO A;  4M6V A;  1D5Y A;  1AHD P;  4A3L J;  1YRN B;  3CDL A;  3JRF A;  5IYB J;  2PMZ N;  2JA8 J;  2FJ1 A;  3S1M J;  2NVQ J;  2XGC A;  3BTL A;  4FE7 A;  3A01 B;  1LFB A;  1NK3 P;  5F0F A;  3VPR A;  3OSG A;  1GV2 A;  4XK4 A;  1IC8 A;  1FTT A;  3BT9 A;  1A6I A;  5E3O A;  4X6A J;  3ZQF A;  3BG3 A;  4IHY A;  4LOC A;  2MG4 A;  2MSY A;  1T56 A;  1GUU A;  2CUE A;  1VI0 A;  5EDN A;  1MBE A;  5EZH A;  4AUX A;  1TWG J;  1LFU P;  1MH3 A;  3JR9 A;  4BY7 J;  1MSE C;  3ZQH A;  3Q0U A;  2OF7 A;  1I3Q J;  4M3E A;  5M5Y J;  5FLM J;  3HEF A;  1HDD C;  2JJ7 A;  1MH4 A;  4RBO A;  2R7Z J;  2XPW A;  4A3B J;  2LLK A;  3WHB A;  1NTC A;  4XRS G;  3JRD A;  3BG5 A;  3L1P A;  1F36 A;  3B6A A;  2M9H A;  3HGY A;  2Y0S N;  3CCY A;  5GPC A;  2E2J J;  3K2A A;  4Y52 J;  9ANT A;  3SDG A;  2EQR A;  2LP0 A;  3RQI A;  2N8G A;  4B3A A;  5M5W J;  4A3D J;  2DTZ A;  5J1Y A;  1RKT A;  1WH5 A;  5C4J J;  1JUS A;  1IG7 A;  4I6Z A;  1AKH B;  2DA1 A;  1O4X A;  1ZGW A;  1ETY A;  2WB1 N;  1OCP A;  4C2M J;  2DA2 A;  4QTR A;  1ETX A;  4M3B A;  2GLO A;  5M5X J;  5EEA A;  2JMW A;  1G2H A;  1JTX A;  3H3V K;  4DZP A;  3S1N J;  1WPK A;  2W48 A;  2WAQ N;  3MKL A;  3ZQG A;  2B63 J;  3IH3 A;  5M3M J;  2L0K A;  3LOC A;  3ZOB A;  2CQQ A;  1ETO A;  2LR8 A;  1PUF A;  4AC0 A;  5GPA A;  3IH4 A;  3JRH A;  2YU9 J;  2DMN A;  2X48 A;  2HYJ A;  1H88 C;  4UUT A;  2Y31 A;  2R5Y A;  4XIC A;  2K9N A;  1HLV A;  3HOY J;  3PM1 A;  5C4X J;  2HOA A;  4MLO A;  3TP3 A;  1XS9 A;  4DYQ A;  5E3N A;  1H8A C;  4NDL A;  1QVU A;  1IV6 A;  3M4O J;  2CU7 A;  2AO9 A;  1ZR4 A;  1W0U A;  1JUM A;  4C3I J;  3ZQC A;  2R92 J;  1RPW A;  2COB A;  1JGG A;  5EF6 A;  4IHW A;  4W1U A;  3A02 A;  4A3K J;  2JN6 A;  2HI3 A;  4D5C A;  5FKK A;  5K7F A;  3QPL A;  1K61 A;  1RR7 A;  4BBR J;  2DA4 A;  5F27 A;  2CJJ A;  3GTJ J;  1BW5 A;  3GTP J;  1JTY A;  2XPV A;  3GTL J;  5F0C A;  2EZK A;  1XC5 A;  3FK7 A;  2JWT A;  1JKP C;  2L7Z A;  3I4N J;  1F43 A;  4IEJ A;  3ZQL A;  4IHX A;  1TC3 C;  1Y1V J;  2LKX A;  4I76 A;  4JYK A;  2YS9 A;  2ECB A;  1OFC X;  2EZI A;  5EGO A;  3RZD J;  2NVX J;  4HNV A;  2EZL A;  2MW8 A;  3Q3S A;  2VKV A;  3HGG A;  4G12 A;  2DA3 A;  4QIW N;  1ORK A;  2L7M P;  1IDZ A;  3CQZ J;  4V2G A;  1JT6 A;  3LNQ A;  2FQ4 A;  2RAE A;  4A3M J;  2R5Y B;  2M2E A;  1RES A;  1IJW C;  2TRT A;  2H1K A;  3S17 J;  3G1M A;  4EEF G;  2VUM J;  3S2D J;  4D7N A;  5F0H A;  2DJN A;  1I50 J;  4A3I J;  3JRB A;  2DA6 A;  3HBL A;  4A69 C;  2I10 A;  4M3F A;  1XG1 A;  2HOT A;  1BA5 A;  1RET A;  2XRL A;  3Q0W A;  1UMQ A;  5FKO A;  1I6H J;  3S1R J;  2D5V A;  2XB5 A;  3FIS A;  3NAR A;  2O7O A;  4XRS A;  1IRZ A;  2JK3 A;  1B72 B;  3O8H A;  5F08 A;  3RKQ A;  1ZR2 A;  5EG0 A;  2QCO A;  3MVP A;  1WI3 A;  2JA5 J;  1ETK A;  3LSR A;  3W6V A;  2IEK A;  2GM4 A;  2FX0 A;  1TWH J;  2NVY J;  3BR5 A;  5K7Z A;  1BL0 A;  2M8G X;  3GTM J;  1K83 J;  1GVD A;  1U8B A;  5IPA A;  3IV5 A;  3OIO A;  5EGO B;  1TWF J;  5DTD A;  5F04 A;  4CYC A;  4JP0 A;  3D1N I;  4MO7 A;  3S2H J;  4L5E A;  3GTG J;  2XB0 X;  2HXI A;  4D7M A;  1U9O A;  1MBG A;  2ELK A;  2L9R A;  1JKO C;  1OJL A;  2HDD A;  3HOV J;  2YUS A;  5IYC J;  2E19 A;  3FKI J;  4D5F A;  2GBY A;  4X1E A;  4UUS A;  3QPS A;  2HOS A;  1BW6 A;  3IH2 A;  3BTJ A;  5IOZ A;  3OSF A;  5IP9 J;  1ENH A;  3BQY A;  5JLX A;  2ME6 A;  3JRI A;  5EYR A;  2NS7 A;  1ITY A;  3UKG A;  3H0G J;  5J3L A;  3JRG A;  3M3Y J;  1SAN A;  3C2B A;  1FIA A;  4MIM A;  4B4C A;  5IYD J;  2LD5 A;  3A01 A;  3I4M J;  3NAU A;  2DMU A;  4M3D A;  4J19 A;  3S14 J;  1GV5 A;  5E3L A;  3RZO J;  4C3H J;  4XRM A;  1S7E A;  1Q1V A;  3BR3 A;  5M3F J;  2KDZ A;  1ZKG A;  2TCT A;  2DA5 A;  5EZG A;  3BR6 A;  4ABZ A;  3DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...