1ZQ3P

Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3'
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zq3P00
1F43A 3S2DJ 3LNQA 3LSJA 5FKMA 1GUUA 4M6VA 2DTZA 5M5XJ 2CU7A 1UMQA 1HOMA 3TP0A 1OFCX 2DA5A 3Q0UA 2NVTJ 1H89C 5IPAA 2Y2ZA 3HOXJ 3QPLA 5GP9A 3GTMJ 1AU7A 4M3BA 1VF9A 4Y7NJ 3GTLJ 5FJ8J 4J19A 4A93J 3HM5A 1YRNB 5K7ZA 5J1UA 3A01B 3FK6A 1TWGJ 5K7HA 2EH3A 3CDLA 4C3JJ 3JRGA 1XC5A 4QIWN 1ETKA 5EEAA 1ENHA 4A3EJ 3NAUA 4X6AJ 2DN0A 1MBGA 2IAIA 2WAQN 5F0HA 2JA8J 2M0CA 5IOZA 2EZIA 3PO2J 5HODA 3H0GJ 4A3FJ 2D5VA 1WI3A 3HKZN 3A02A 3BR0A 3BG5A 3LOCA 3S1RJ 1FTTA 4JP0A 1FTZA 2NOGA 1TWCJ 1LFUP 3M3YJ 4DZPA 3JRFA 3JRIA 3TP3A 2HYJA 3ZQFA 1MBFA 2LY9A 5DTDA 2COBA 4A3BJ 3G1OA 1AKHB 2Y30A 2ID3A 3GTGJ 2DMTA 4QTRA 5E3NA 1WCMJ 1RETA 1Z0XA 3BQYA 4AC0A 1T33A 4BY7J 3HEFA 3CCYA 1GV5A 1JJ8C 2IBDA 1RKWA 4I76A 1JUMA 5IP7J 3BQZA 1HCRA 2NS8A 3BTCA 5M5YJ 3JR9A 1PUFB 1BA5A 4B1RA 3Q0VA 5FKKA 1ETWA 4IHYA 3O8GA 2XB5A 4UUSA 1JKPC 1B8IA 2WV1A 4C2MJ 4XICA 1SFOJ 1ETOA 5M5WJ 1R9TJ 4EEFG 2DA2A 4D5CA 3JRCA 4AYBN 1VI0A 1ZR4A 2JMWA 4DYRA 2FJ1A 3MN2A 1RESA 3BG9A 2HOAA 1NTCA 2K9SA 3M4OJ 4W97A 5IOYA 4M3EA 1U8BA 1GV2A 1OCPA 2LKXA 3RZDJ 1JT6A 1MH3A 3PO3J 1CQTA 3DEWA 1JKOC 2X6OA 2DJNA 2EZKA 3GTOJ 2MG4A 1IJWC 3HBLA 3ZQLA 2ECCA 5JLWA 3JREA 2R5YB 5IP6A 3OSFA 1A6IA 2KDZA 1YRNA 5E3MA 3CQZJ 3HOVJ 1PUFA 4XK4A 5F27A 1FIPA 1APLC 4BBRJ 2WB1N 1LFBA 2GM4A 2HOSA 3RQIA 2L7FP 5DS9A 4V2FA 1P7IA 2QF7A 2R7ZJ 2HXOA 9ANTA 3S1MJ 2M34A 3SJMA 2HOTA 3W6VA 1IC8A 3GTPJ 2L0KA 5J1YA 2LLKA 1I50J 1MH4A 3LSGA 1GDTA 4D5FA 3A01A 2B63J 3O8HA 2P81A 2M2EA 4RDUA 4CYCA 1TWHJ 3RKQA 2X48A 1ETVA 5GPAA 2O7OA 2HDDA 3HGGA 3IH2A 3ZOBA 2HXIA 4DYQA 3JRHA 5E3OA 2I10A 2DA3A 2XGEA 1S7EA 1BL0A 3BR1A 2O8KA 2DMQA 2YU9J 5EYRA 1W0TA 1JUPA 3A03A 1W0UA 4FTHA 4MIMA 2GLOA 3GTQJ 4HNVA 5EG0A 2CUFA 3GTKJ 4MO7A 2G0EA 3UKGA 1ETQA 3ZQGA 3H3VK 2ZB9A 1F36A 3B6CA 3BR6A 5FKOA 4DZJA 1VFCA 2NVQJ 1U9OA 1T56A 3HOWJ 3TW6A 4C3HJ 1WH7A 5EZGA 1QRYA 4S0HB 1NK3P 1IDZA 1I3QJ 2XGDA 3PM1A 2CJJA 2JA5J 2O9LA 2E1OA 2H8RA 3B6AA 1WH5A 3BG3A 2K40A 3BTIA 1FJLA 1HF0A 4IHXA 1MBJA 3HGYA 2CUEA 3NARA 5C44J 3LSRA 3HOUJ 4JYKA 3HOZJ 1K83J 4MFEA 2DMUA 4D7MA 1HLVA 4IHVA 1ITYA 3IV5A 3HDDA 1POGA 1RKTA 3OSGA 1NK2P 4V2GA 3FK7A 4FE7A 3LSPA 3S14J 1X2NA 3BTLA 3TEDA 2NS7A 3JRAA 2R0QC 2MW8A 2R5YA 1GT0C 1BW6A 2L7ZA 2KT0A 4IEJA 4B4CA 2H1KA 5M3FJ 2E19A 4M3GA 1H8AC 3K2AA 2E2IJ 4L5EA 3MVPA 1XG1A 1MSEC 1JKRC 2R93J 1A5JA 2VI6A 2XSDC 4JX4A 3BR3A 4G12A 5EZHA 4FCYA 4JX6A 2DA4A 1AKHA 2DMNA 4FISA 5EGOA 3BR2A 1IRZA 2LK2A 3Q0WA 4NDLA 2EBIA 2ME6A 1TC3C 2NVXJ 2K9QA 1JKQC 2TRTA 2JWTA 2FD5A 1MBHA 1BW5A 5EDNA 1QPIA 2MSYA 1ZGWA 1Y1WJ 1EF4A 1TWFJ 1B72B 1AHDP 1GVDA 5EF6A 5IYDJ 3DCFA 4FE4A 3WHCA 2MGQA 2LP0A 2YUSA 2Y9YA 4A3DJ 1QVUA 2Y0SN 5FKNA 3G1LA 3HB9A 3IH4A 1U78A 2ECBA 3S1NJ 1ZTRA 3JRBA 5M3MJ 2JA6J 1HDPA 2XB0X 1ORKA 2OPTA 3GTJJ 5IYCJ 2X9DA 4A3MJ 2JA7J 3IH3A 5F04A 5K7FA 1OCTC 5EG0B 4XRSG 5BNGA 3FIWA 4CYCB 2W48A 4GFBA 5F0FA 5C3EJ 2HQ5A 2LVSA 2DA1A 1DU0A 4A3GJ 3FKIJ 1QVTA 5F08A 3MKLA 1MNMC 2CRGA 2JN6A 3OIOA 2JJ7A 1JTXA 5J3LA 5FLMJ 1B72A 1RR7A 2NVYJ 5FLVA 1U9NA 2VPRA 2LFBA 4M3DA 5GPCA 3ZQHA 1X58A 1IG7A 4UUTA 1JT0A 4BY1J 1UG2A 3F0CA 3S2HJ 2CQQA 3VPRA 1IV6A 1ZQ3P 2DA7A 4JX5A 3QQAA 2DA6A 1IDYA 3TW7A 2R92J 1ZK8A 1O4XA 3K7AJ 3Q3SA 1BJZA 3FISA 4AUXA 4BXXJ 2HI3A 1SANA 5C4XJ 3RZOJ 2FX0A 1MSFC 2VKEA 1LE8A 4XIDA 2XPVA 2TCTA 1B8IB 4A3IJ 4IHWA 3S15J 4BKXA 2XGCA 1ZKGA 2RAEA 2FQ4A 2IEKA 4Y52J 1WGXA 5JLXA 2R5ZB 3E7LA 3JRDA 1Z77A 4QSHA 1I6HJ 1ETYA 2GBYA 3I4MJ 4DYCA 1K61A 1G2HA 1Y1VJ 1LE8B 5FKLA 5J1RA 3BT9A 1FIAA 2CQXA 2ID6A 3S16J 2Y31A 5F0CA 2EZLA 2R5ZA 4W1UA 5F1JA 2PMZN 2LR8A 2JK3A 4C3IJ 4A3JJ 2L7MP 4A69C 1HDDC 1JUSA 3OOUA 2LTPA 2XRLA 4UUSB 3S17J 3BR5A 1Q1VA 2L9RA 3ZQIA 1H88C 4MLOA 2AHQA 3CMYA 2EQRA 5E3LA 2VUMJ 2QCOA 2K9NA 1P7JA 4A3LJ 1ZR2A 1OJLA 5EGOB 3HOYJ 3WHBA 3SDGA 2OF7A 4DW6A 4RBOA 2M8GX 4ABZA 1VNDA 2LD5A 1MBEA 3I4NJ 3SFIA 3QPSA 4A3KJ 4MFDA 3D1NI 4BBSJ 1JGGA 2ELKA 1JJ6C 3BTJA 4M3FA 4X1EA 3G1MA 3GBGA 1RPWA 1WPKA 1D5YA 2EZHA 2YS9A 4I6ZA 3L1PA 2XPWA 1ETXA 1X2MA 2XPUA 3C2BA 2N8GA 4B3AA 4A3CJ 1IUFA 5C4JJ 4XRSA 1DU6A 5IP9J 3S1QJ 1UHSA 2E2HJ 1IGNA 1FEXA 5IYBJ 4D7NA 2E2JJ 1TWAJ 2AO9A 4XRMA 1E3OC 2DMPA 2VKVA 4LOCA 2M9HA 2ME0A 3ZQCA 1XS9A 1MBKA 1JTYA 2Y9ZA
chains in the Genus database with same CATH superfamily
1SFXA 3S2DJ 3A1YA 2XSJC 2AXTC 4BQQA 5CYVA 2OA4A 1FOXA 5FKMA 1GUUA 1SD6A 4AWXB 1GXQA 2VBYA 3H3UA 3DTEA 3F8BA 2DTZA 4WX9A 1UMQA 2DCEA 1OFCX 2EFNA 2JA2A 2NVTJ 1R5GA 2XC7A 2BW3A 4Y7NJ 4OIQF 5FJ8J 3QAHA 3E6CC 2DYSH 2O61A 5CVUA 2F4OB 5GTHC 3H5AA 4C3JJ 5CKTA 2A07F 1HKQA 1XC5A 2VE9A 4U0YA 1KU9A 2HVQA 4M9XA 3W6JB 2EIMH 4CCNA 1V5EA 2XGXA 3TOBA 2C6YA 2WAQN 5F0HA 4DQ2A 2QSHX 2EZIA 2EFOA 4BUPA 5J47A 5HODA 2E1MB 5TRDA 2NNYA 4XN0A 1R58A 4OU0A 3LWFA 1YI2I 1MIJA 3U2RA 2ISYA 1IN4A 3J7ZI 4WK8F 2HYFA 2NOGA 1K6YA 4BHBA 4DZPA 2ADUA 3JRFA 5HNHA 2HYJA 5ICEA 2DODA 2KLOA 4HX7A 1MBFA 2DT7B 4A3BJ 2JVHA 3QPHA 2EJRA 3Q5FA 3LAJA 3VODA 3OR2C 2CFOA 1Y0NA 3ECOA 3BJ6A 4BDZA 3RKXA 4KYWA 3L9FA 1T33A 4P96A 4BY7J 2ESNA 3VYUB 1SVLA 4A0YA 1OCRH 1ON1A 2MC3A 1UJ8A 4E4HA 2MBFA 1EH8A 1JUMA 2XIGA 2NS8A 2VIXA 4L5IA 3Q0VA 2A61A 3IWZA 4CO8A 3R61A 4B47A 4FETA 4LITA 4NNJA 1KYWA 2WV1A 2X6XA 5TJJA 3OYAA 2DA2A 5E18F 5DCFA 4WCGA 2HNHA 2ZCWA 2Y0MA 4Y13A 1LEBA 1MMDA 5LD2C 1XGMA 4II2A 1ZR4A 2JMWA 4DYRA 3CC7I 2FJ1A 5LGTA 1SAXA 3BOQA 1RESA 3EUKL 2VOOA 2HDWA 2K9SA 4KN7X 4W97A 1UHMA 2OZ6A 3JTHA 5IOYA 1XPXA 3QOPA 2GXGA 2D1VA 4M3EA 5F64A 2VJ4A 3KEQA 4Y15A 2PG4A 5KVRA 1KYZA 4HF1A 3PO3J 3K0LA 1BI3A 3DEWA 4F52A 1CGPA 2DJNA 5HLGA 2EZKA 3F8MA 2QM3A 3L7WA 4IL6C 4EVIA 1L3LA 5H6QA 5JLWA 1FP1D 2GZWA 2R5YB 2BZTA 3TGNA 4G6DA 2KDZA 2O5RA 1WWXA 2BYVE 5B1AH 2W7NA 5F27A 1FIPA 3K4LA 3VEPA 2QENA 2LBFB 3G4SI 2X1DA 4OIOF 1O57A 1P4AA 2QGUA 3HHGA 1P7IA 2QWWA 3TQNA 3L2QA 2QF7A 3HRUA 2E71A 3CLQA 4PJLA 1VQ4I 5DD4A 3E3VA 2HOTA 5FB2A 3DKWA 1QA6A 4CZCA 2L0KA 3F8NA 3FM5A 3UR3C 5CVVA 2UV1A 3HRMA 1I50J 4HX8A 2E36A 4Y17A 2BHYA 3RJPA 3ZXSA 4BE1A 1YO5C 1MJAA 4XM3A 2HDDA 1NG7A 2J5PA 4ESJA 4L9TA 5E8GA 3BZ6A 2HXIA 4XSZF 3ZOBA 4E7HA 3RPUA 2RVCA 5KAFC 3NWTA 4DYQA 2DA3A 3CMAI 2OCEA 2V1XA 1YIJI 1S29A 2BY1A 3OOPA 3BR1A 4DGWB 3A03A 3GZNB 3GWZA 3GX4X 4C9YA 2F48A 2JPBA 2L02A 2XUBA 4HNVA 4LLGF 2VBZA 4U7BA 2AQFA 3ZMTA 1SD4A 3BROA 3D5RC 4KT5C 4A5MA 4QLCU 3WODF 1YOVB 4Q47A 4EJWA 1E17A 4NB5A 3B6CA 5TGTA 2DLLA 1ZGJA 2P0WA 4ZDLA 5D4SA 4CZZA 1VFCA 4R1HA 5FRMA 3HOWJ 3I55I 2KP6A 3BP8A 1NK3P 3HG9A 1MD0A 4N0BA 4QPOA 1UFMA 3GZ6A 3J81Z 2JA5J 3WTWC 4IF4A 1JXSA 1HF0A 3VB2A 2QQAA 3HGYA 2ZFUA 3H1CA 2XROA 3LSRA 5D5WB 1P92A 1O7LA 2LYCA 3PNTA 4KNYA 3HOZJ 3D0SA 1BR4A 3E5QA 2DMUA 2CW7A 4ON0A 1ITYA 2PJRB 1GHCA 4Y33A 1RKTA 5DEQA 1VQMI 1DPRA 3OSGA 1PVEA 4FHTA 4V2GA 3VDXA 4FE7A 2VXDA 3QYEA 3RDIA 1U3EM 3K4JA 3CDHA 1OCOH 2DU9A 2NS7A 2R0QC 4L0ZB 1W36D 1GT0C 3MEXA 3HIFA 2XAHA 4I02A 2H1KA 5LEKA 4M3GA 2WA0A 1BIBA 1R36A 3OMYA 3BDDA 1IF1A 1DQUA 3MVPA 3RI4A 3W2AA 3BCBA 1UAAA 1A5JA 3EETA 1LVKA 3BR3A 2KMUA 2ZXHA 2DA4A 1HW5A 1GVJA 1OR7C 1YX3A 1AKHA 2FNPA 6PAXA 1EKEA 3Q0WA 2QBYB 3SXYA 2H6CA 2IW5A 2ME6A 4E7IA 2NVXJ 2JWTA 2Q1ZB 1IV8A 4F7ZA 2VJIA 2MSYA 3FXLA 1Y1WJ 4NC8A 3WGIA 1J2XA 2VPLA 2QQ9A 1TWFJ 2F6CA 3OR1C 5EF6A 4UUVA 1OYWA 3DCFA 4HQMA 2YUSA 3QYFA 3REOA 1LVAA 1OCCH 2DT5A 3WE2A 5FKNA 5AIQA 4LLLA 4DBQA 5DV5A 2ECBA 3DPUA 2HR3A 1ZTRA 3CUQB 3L2UA 2XV4S 3I0TA 1E0EA 2MC4A 3FDYA 4CA0A 2AS5F 2DOEA 2OAZA 2XKPA 2IA0A 3EUHC 5L3EA 3IHUA 2IVMA 4RAZA 3IH3A 1SD5A 2EK5A 3FIWA 3I9V2 2EWNA 4B09A 4BE2A 4A12A 2CMPA 3W2WA 3DV8A 2GQQA 2CWEA 3M8EA 3F6OA 2WTEA 2CW8A 2UWMA 1P2FA 2DA1A 2JSCA 3E6MA 3DLAA 1GXPA 2F5EA 4HV6A 5F08A 1TL8A 1VQ7I 3OYNA 3S2WA 2CRGA 2FOKA 2JN6A 3GLXA 2JJ7A 4HEA2 4U87A 4KA4A 2OC6A 1XMAA 2YU3A 2NVYJ 4YEJA 4M3DA 5GPCA 3P7NA 3CCSI 1K4SA 3LSHA 3ZQHA 1X58A 3A0HC 2BVMA 2M7AA 3ISPA 1T0FC 2XVCA 3W2VA 4S04A 3S2HJ 3KP5A 3E97A 2QKMB 4AIHA 3VPRA 2EA4A 1SVMA 2DA7A 3QQAA 3MWMA 3L00A 2CS3A 1ZK8A 3K7AJ 1BJZA 3GCMA 2YR2A 2HI3A 1G3TA 2EILH 2XPVA 3AG4H 3PIOF 3F9KA 4Q4ZF 3TMOA 2RAEA 2IEKA 4Y52J 2R5ZB 3E7LA 1G4DA 3EPZA 1D1CA 2YX7A 3S8PA 2GBYA 1X1DA 4DYCA 1K61A 1G2HA 1TT0A 3CLOA 5LFAA 5H6RA 2X51A 2VT2A 5ILUA 4S05A 4M71A 2GIVA 4B43A 1M1EB 5EEGA 1R22A 3SHFA 3CCLI 2R5ZA 1QNTA 1B59A 4N9IA 2G7UA 2Z2SB 1YTYA 4C3IJ 4F55A 5KCMA 1JUSA 4E70A 4XQFA 3WGHA 5B66C 1H0MA 1ZN2A 2ZSHB 4UUSB 2BE5F 1Z7LA 4BJTA 1Q1VA 3CUQA 3P5JA 4GYIA 1FLIA 1FBUA 1T95A 1TQMA 2LG4A 2EQRA 5E3LA 4UV9A 1FY7A 2VUMJ 3SEZA 2WC2A 3BPVA 2JTVA 5EGOB 2P7CB 1L0OC 4PJNA 2OF7A 4DW6A 1SFUA 4G6QA 3MZYA 3KP4A 2VC1A 2X1CA 4ABZA 1HSJA 4G8XA 2OV7A 4ZYHA 4AVZA 2BOLA 2B7EA 2LC2A 1MBEA 3E5XA 5FGMA 1BI2A 4A3KJ 2JZYA 3KX2A 3D1NI 3F21A 4BBSJ 2FMLA 2DOFA 1JJ6C 3VSLA 2VKDA 1TTYA 4HRIA 3BTJA 4KJZA 4CCKA 2A6EF 1HA8A 2R7TA 5B1BH 4G7HF 2IA1A 3GF2A 4I6ZA 2XPWA 3ABLH 2XPUA 4L9JA 4A3CJ 5C4JJ 1BC7C 4BU2A 3OYHA 5IP9J 1FEXA 2DDAA 2DMPA 2VKVA 3ZMZA 5A2QK 1J5YA 1TW3A 1A31A 3OYEA 2Y9ZA 1S8NA 2Z33A 4I0BA 3H36A 3PIPF 1J7KA 3LSJA 1FOKA 3C18A 3RPQA 3NEUA 3V8KA 2CV0A 1YW8A 5ILSA 2XASA 3IKVA 3CMMA 1BJAA 2BY2A 2CU7A 2MH9A 3TP0A 3Q0UA 3GFMA 1BR1A 1MNEA 2Y2ZA 4BEHA 2W1OA 3IAS2 3SDBA 1AU7A 4M3BA 1K78A 2V9KA 3HM5A 4KISA 4I99C 5K7ZA 5J1UA 3FK6A 3DBHB 3V42A 1TWGJ 5K7HA 3COAC 3WU2C 3ZMVA 4QIWN 1ETKA 1GLNA 1DGRM 3NAUA 4LIUA 4X6AJ 3V7RA 4BDYA 1KGSA 3KZIC 2DN0A 3HYIA 1TBXA 1YHQI 1F1ZA 2O0YA 2M0CA 4P9FA 4ENMA 3K4CA 1FPQA 2F5VA 4BHPA 2M4GA 3H0GJ 2Z1DA 4A3FJ 3MZHA 4DIQA 4CGZA 1WI3A 3JAMK 1D1AA 3BZKA 3A02A 2R7QA 3BG5A 3QYBA 3S1RJ 3OYLA 1N75A 4O5VA 3QODA 1TWCJ 3FKJA 4XN3A 1YFHA 4HAMA 3ML6A 1X3UA 1WJEA 2LY9A 2B0LA 4XLNF 2CYYA 2DFIA 1A6QA 1VZ0A 2Y30A 5HLTA 3PUFA 2ZMEC 5E3NA 1WCMJ 2IJLA 1D0XA 1Z0XA 4ANJA 3BQYA 4OMYA 2O03A 2M8EA 3ZR8X 4HSTA 1EV7A 2J5OA 3OYBA 2IBDA 1B1BA 4AIJA 3KPHA 4IPAA 2YPRA 3BTCA 3C2HA 3KYDB 4HNTA 5M5YJ 3JR9A 1BA5A 2OQGA 5LGNA 4IHYA 3FXOA 5AIPA 2X6YA 2F4MB 1MMGA 1Y56A 2M45A 2KFDA 2BW3B 2W24A 2XAQA 1R9TJ 1XSDA 2BXYA 3HSEA 1XB4A 2NNNA 3QP6A 4L5JA 4AYBN 1IRXA 5FROA 4WXHA 4LG3A 4KITB 1XGOA 1IAWA 3F8CA 2I5UA 2ACJA 3FX3A 2R7VA 3IRRA 3FF5A 4GGGA 4UV8A 5LRRA 3M4OJ 3CJQB 3MZ8A 3MD2A 2QBYA 3CO6C 1GV2A 2DXIA 1LKXA 4CUGA 2ICWG 4A6EA 2IS1A 3RZDJ 1FYKA 1MH3A 4XLAA 2IS4A 1K4TA 2MG4A 2BXZA 2IT0A 3CP8A 2ECCA 3ZQLA 3ZQQA 2KISA 2LOOA 5IP6A 2A68F 1XDUA 2L5QA 2V1NA 2NYXA 1YRNA 3W6KB 5E3MA 1PUFA 1FWZA 4N4NB 1V5GA 3HPGA 4PUSA 2P5VA 1IN7A 2DI3A 2EFPA 1APLC 4L9VA 4BBRJ 3TO7A 2WB1N 1LFBA 4BH9A 4MQ9F 1FSHA 4V2FA 5FO5A 1S5LC 2GOMA 9ANTA 3U9GA 3W6VA 1X4PA 3R60A 3U21A 1IC8A 2HDCA 5GAGJ 1MZBA 2VN2A 4CDGA 2LLKA 3I3LA 4BAYA 4U0VA 3DU6A 3ZP5A 1FX7A 4D5FA 3A01A 5CVJA 3O8HA 2M2EA 4RDUA 3QWLA 3FXMA 1TWHJ 4CYCA 3WTTC 2WV0A 2QVOA 4CXFA 3RKQA 2DPUA 2FRHA 2BEOA 3T8TA 2NXNB 4E7SA 1ETVA 1QZYA 2D1HA 1Z05A 3TO6A 2Q0OA 3IH2A 2ISZA 1V5FA 2ZJRF 3QP5A 5JVTA 1WVRA 5E3OA 5CVRA 1S7EA 1BL0A 3VOEA 2HGCA 1FMWA 5DUIA 2DMQA 1OPCA 2ZBKA 5EYRA 2FA5A 1W0TA 1I1SA 2FF4A 3EUAA 3GTQJ 2VBXA 5EG0A 2CUFA 3KP6A 2K27A 3JAMZ 2E60A 3AL0B 4MO7A 1ETQA 4LGWA 3ZQGA 1BOBA 2DQRA 3C3WA 4RGUA 3ZCOA 2QEXI 1F36A 3BR6A 4RA2A 5FKOA 1MJ9A 4LIVA 1CF7B 3CC2I 5ERIA 1T56A 1XX5A 4UNOA 3D5LA 1R5ID 4C3HJ 1WH7A 1G3WA 2F4IA 2EV6A 5EZGA 3NWSA 3UNGC 4S0HB 2WBMA 2LSOA 1I3QJ 4EJTA 2FNAA 2XGDA 3FHZA 3GW2A 3PM1A 5ED4A 1BR2A 2EFQA 2E1OA 4BS9A 3FXQA 4XKCA 4ZH4F 3CCRI 2H8RA 2O9LA 1A04A 4BYYA 1BN5A 2K40A 1FJLA 2IGOA 2CUEA 3NARA 4AM3A 5C44J 1FZPB 3K4NA 1YX5A 4JYKA 1AA7A 2EFWA 4P1WA 4IHVA 3I5UA 1TZLA 4XLFA 1SC7A 3O3KA 5BPDA 4L9NA 3HTSB 3CZ6A 4ESFA 2GIZA 1SVOA 3LSPA 3RKYA 2LNBA 3SQNA 4F91B 1ZRDA 2LBFA 3TEDA 1ZARA 3U1KA 3ERED 5KNLA 3JRAA 2RN7A 2RKHA 3OWTA 1XMKA 2A3SA 2FSWA 2I8DA 3WU1B 5A2QZ 3CCUI 2P6SA 2LREA 2QZ8A 1IN6A 4OIRF 1LJ9A 4PJJA 5K5OA 2E2IJ 1XG1A 1IRFA 4HV5A 5DD8A 3RYRA 4BEHB 3BJOA 1JKRC 1FBSA 5HDKA 4JX4A 1NH3A 4G12A 1WJBA 4FCYA 1U2WA 1ZAOA 3WTXC 2KIFA 1G3SA 4M9ZA 2D45A 4BXFA 2DMNA 4ZDPA 5EGOA 1IRZA 3E0JB 4NDLA 3U1DA 1K6OA 4F93B 1KONA 4RLFA 5FFXA 1JKQC 3BZCA 1MBHA 2NOJB 2P5KA 4E7ZA 1BW5A 2LH9A 3J7YJ 1EF4A 1B72B 1Z21A 1GVDA 4HOBA 3K4KA 4WXCA 2WAEA 2KRFA 2MGQA 3GZ5A 3WHCA 2Y9YA 3LMMA 1IXSB 1CF7A 1QVUA 1X3ZB 1QPMA 2Y0SN 2H94A 1LNWA 3S1NJ 2JA6J 1MDMA 2XB0X 2L9SA 2BY0A 5LLQA 2X9DA 3OL4A 3T8RA 4F92B 2A05A 5HLHA 1OCTC 1FSEA 3IKTA 3CD6I 4XRSG 2Z9OA 2RNGA 2BHZA 2MH2A 2P5LC 2W48A 5F0FA 4YELA 3DKXA 2L2OA 2LVSA 2R7RA 1WJ5A 5D8KB 3PNVA 4G94A 1Y39A 1J9IA 2R7FA 3F72A 3T1BA 3MKLA 1MNMC 1FMVA 3OIOA 5FLMJ 1JTXA 1B72A 2M1BA 2IS2A 3FMSA 1RR7A 5LGUA 4KUMA 1U9NA 2F5DA 1Z1DA 3KE2A 4J01A 4XR6A 3T5XA 1B6AA 2HU9A 4MHGA 4UUTA 1YITI 2IRFG 2R7XA 2EINH 3H5RA 3KETA 4HDUA 2LF7A 2WB1A 1A36A 3E5UA 3RQ4A 4LB5A 1IV6A 3WTZA 3HHHA 4LFUA 1TNSA 3I53A 4JX5A 1D0YA 4EM1A 3GVAA 3CJTB 4IXAA 4AUXA 4DBRA 1SANA 2FX0A 3JSOA 1MSFC 5H20A 2OJED 4ZTJA 3L2CA 1LB2A 2QQ8A 4IHWA 4LG0B 2R7SA 4IRGA 2KKOA 2FQ4A 3CUQC 3SEQA 3GYHX 5JLXA 1QO0D 3LSIA 3CF5F 3VYRB 2VOPA 3F8FA 4QSHA 3I4MJ 1Y1VJ 4MEXF 5J1RA 2R4GA 1R1TA 3BT9A 4PGGA 4U88A 4EATA 2ID6A 1RUNA 3S16J 4M6XA 2Y31A 3M1EA 3CTAA 3J7AY 4KICA 3N97A 2R7OA 3JCUC 5ICGA 5CPRB 5F1JA 2V6EA 5FRNA 2LR8A 1MMSA 5F6FA 3M1CA 4A3JJ 3DPLC 3QPTA 3HJEA 4AD9A 5D8LB 3JTGA 2VQLA 1ONVA 4NC7A 3A0BC 3HRTA 2AHQA 4OMZA 4OWRB 4A3LJ 1OJLA 1Y8QB 3HPHA 4XLPF 5FD5A 3HOYJ 3OYCA 2V7FA 3I59A 4FX0A 3EUHA 4XKWA 3SDGA 4RBOA 1S7AA 1T6SA 4OAYA 5CQEA 3CCEI 5E1ZB 1ULYA 3AG1H 1UB9A 1BOAA 1IW7F 4HDVA 2A5YB 3A4CA 2GOXB 1O7FA 3KP7A 2DW4A 3KYLA 2A6TA 4A5NA 2M7BA 1XSVA 2JSPA 2P8TA 3MAJA 4MNUA 3V7SA 4ENKA 1ERDA 2Z99A 2DYRH 3KFWX 3B73A 4MQVA 1YQAA 2MABA 1PUEE 3IWFA 2P7VB 4X1EA 1WPKA 1D5YA 4G7OF 4Q5SF 2RREA 3RSNA 1ETXA 4UB6C 4XLCA 4B3AA 1IUFA 2DAOA 2Z5UA 3MCZA 4XRSA 1OKRA 2HTJA 3HXLA 2KDOA 4LLNA 1UHSA 3G73A 1IN5A 1QQIA 2MLGA 4D7NA 1TWAJ 4XRMA 3LA3A 1USTA 1WJFA 4IOAF 4RS8A 3MFKA 3AG2H 5HNFA 3KP3A 1F43A 4FX4A 2K7LA 1WSUA 5DM6F 3DEEA 2HVSA 3H5NA 1B4AA 1VQLI 3M8FA 4II3A 4M6VA 5M5XJ 1HOMA 2JRTA 2H6BA 4L18B 1QZEA 2E1MC 4B8XA 1DUXC 4CCOA 1HKSA 1R5HA 3ZMUA 3GTMJ 4XKVA 5B3SH 1VF9A 3OS0A 3FMQA 3KYCB 4J19A 1W5TA 4A93J 1YRNB 2EH3A 1STZA 2IGMA 2V6CA 2IGNA 5L3CA 4JBAA 3JRGA 3ELKA 1ENHA 3GMEA 1AWCA 4A3EJ 1WZ2A 4ENNA 3OYDA 4HYEA 1W36C 1XN7A 4CCMA 2JQ7A 1ZELA 1ODDA 1OISA 2F5CA 2WWYA 2ZJQF 1QBJA 2DTRA 2JA8J 2R7DA 4LJZF 1PDNC 3DBLB 4IX7A 2ZSIB 1XD7A 3PO2J 1T98A 5FLXK 4BE0A 5D6FA 4WXDA 3DWLE 1I27A 4KIGA 2EIJH 2L7KA 2X4HA 3LOCA 3BR0A 3M7GA 1FTTA 4JP0A 2BGCA 4RGXA 2VJ5A 2MD0A 3JRIA 1V55H 3TP3A 3GFJA 3BC8A 4UHTA 3ZQFA 2NAZA 5DTDA 1S9HA 1TP4A 2VB6A 3E6BA 5ILVA 1ZG3A 2W25A 3G1OA 4I01A 3KP2A 5D4RA 4HA8A 4ZJZA 2OTJI 3S32A 1AKHB 2ID3A 2PEXA 3GTGJ 2O8XA 2DJIA 1U0JA 2GA1A 1UELB 3WTUC 4AC0A 3ONQA 3J80K 4DJAA 3HEFA 3CCYA 3H9JA 3LQQA 5BQTA 3H9QA 4EM0B 3I64A 1JJ8C 1RKWA 4CCLA 1EA3A 1PUFB 5FKKA 2A69F 2Y48A 1ETWA 1I6XA 4ESBA 3EYYA 2E35A 4XORA 3J7AO 2V1DA 1OQYA 4UUSA 4MTDA 3DEUA 4EEFG 5IY5H 4D5CA 1W5SA 2LKPA 3G6EI 1VI0A 3PSFA 1LPQA 3LL7A 3ZMSA 3HRSA 2DFHA 4GCVA 2XF5A 3MN2A 4YFXF 3SZTA 4B48A 1QHHD 3LQRA 3BG9A 3SFZA 3DU5A 2HOAA 2FEZA 4XMYA 4KMFA 2G7HA 3NRVA 2M4KA 2KIQA 2ETHA 2HWVA 2QSGX 1QHGA 5JI6A 2HOEA 1K7AA 5DDGA 2KZGA 4F3QA 2YX4A 3DTKA 1U8RA 2H1LA 4UXNA 1CQTA 4BQNA 3K6GA 4ZC3A 2X6OA 5K5RA 2G9WA 2HKXA 1IJWC 3L2RA 4E6KG 3JREA 1USSA 5GTIC 1BI0A 4RLQA 2CUJA 4AVPA 5IT3A 3K4MA 4EGYA 4IKFA 4XK4A 4NHJA 4ZYEA 3OS2A 2IP2A 3W3CA 1V54H 3FHNA 2KIMA 1VQ8I 3HZJA 3ZN0A 3RQIA 2L7FP 2HOSA 2HKOA 1D3YA 4PZJA 2VLAA 3KEOA 1FYLA 2FBHA 2HXOA 3S1MJ 4E7JA 4FT8A 5LHGA 1K79A 1QZZA 4BQAA 2FBKA 1XTAA 5HDNA 3TDUC 3FWEA 2O6GE 1V3FA 5J1YA 4M9SA 2VKHA 4U0WA 3LFKA 2K85A 4ITVA 3LSGA 1KU2A 1GDTA 1KA8A 1FOWA 4UVCA 2L01A 2P81A 3DQVC 1D8KA 2QUFA 2VASA 4GRIA 1O3RA 3AKZA 1J59A 2XF7A 2HS5A 3QU3A 3I54A 3PL8A 5GPAA 2O7OA 3OL3A 1RR8C 3HGGA 2ZJPF 1LUJB 2QYOA 2ESHA 1IRGA 5LBQA 4O3MA 1E3PA 3JRHA 1HXDA 1ZREA 1BI1A 3DPTA 1YYVA 2O8KA 2GWRA 2FQ3A 1JUPA 1Z67A 2Y75A 3ABUA 1W0UA 2K02A 2OTLI 4MIMA 4HQEA 2MYSA 2GLOA 3ABTA 1T0FA 4ZTFA 3GTKJ 3UKGA 2K9LA 3PJRA 3H3VK 2E1NA 2ZB9A 4DZJA 2NVQJ 1G8XA 1U9OA 3G2BA 3TW6A 4IJAA 4KFCA 4MTEA 3GUDA 4BNCA 5E1XA 4UB8C 4JK1X 4LK1F 1PP8F 1R4NB 4Q48A 3FBNB 5FD6A 3DKYA 2PN6A 1W4MA 1XSXA 2CJJA 2HFHA 1IXCA 2V9VA 3B6AA 1WH5A 2LF8A 3ASNH 2OZUA 4BHCA 4RB1A 3BTIA 4IHXA 1MBJA 2HZDA 2DOAA 2QQBA 4I2OA 4HW0A 2VQHA 3HOUJ 3MKWB 1KZHA 4MFEA 4D7MA 1HLVA 5E17F 3IV5A 4LG0A 1VQ9I 4D9JA 2FBIA 1POGA 3HDDA 3F6VA 4IHTA 5JFRA 1I3AA 1Q1HA 3FK7A 3H9GA 4ZZLA 3AAFA 1VQ6I 5J6XA 2VJJA 4IHSA 3V8LA 3F23A 4AIKA 3S14J 2L3DA 2CW0F 4HPQA 1S7OA 2ZC2A 2MW8A 2EPFA 1EH7A 3N4MA 4LD5A 1R1VA 2ZMEB 2KRHA 1B9NA 2WY7Q 2L7ZA 1FYMA 2KT0A 4IEJA 2CV1A 1FC3A 2H8WA 4NQWB 5M3FJ 1G6NA 3CUOA 3OYFA 3K2AA 1H8AC 2R93J 2AXLA 2PJRA 1TNTA 2XSDC 1OYIA 4ASNA 5KAIC 3K70D 4G7ZF 4Y3OA 4GO1A 3ASOH 1ZG5A 2BVLA 3L2VA 1SAUA 2HZTA 1I5ZA 4BJ6C 1T08B 3V8JA 3BR2A 2LK2A 3RPUD 3ZMDA 4PJ0C 4YG2F 3CDIA 1IZ1A 3K4BA 2K9QA 2DK5A 2TRTA 1UHWA 3RIRA 3ZN1A 2FD5A 3ABMH 2PQ8A 2E34A 2K3PA 4X0GA 1QPIA 1ZGWA 5HS9A 3K1PA 4FE4A 4A3DJ 5HLIA 5AONA 2NVUB 2ZXWH 5L3BA 3G1LA 1U78A 1JGSA 3JRBA 1EH6A 5M3MJ 2ZFWA 1N78A 3P9IA 4I98B 3O6BB 1ORKA 2OPTA 3VYSB 1BM9A 1WI9A 3WTVC 4PCQA 4A3MJ 5F04A 4CYDA 2ZO4A 2A6HF 5EG0B 1T8IA 1HBXG 4NC6A 1REPC 1I1GA 3S3OA 2AQEA 3I4PA 5HOOA 1U5TA 5GAEJ 3SZGA 1ZRFA 1D5VA 5DCMA 4XSXF 3M9AA 1Z7UA 1DU0A 4A3GJ 1KU3A 3FKIJ 2D2WA 1QVTA 1Z3XA 4FASD 2Z3YA 5J3LA 2UXNA 1VQPI 2PMZA 5FLVA 1NHAA 1HC8A 3OYGA 4HX4A 1IG7A 2OBPA 3CC4I 3ECHA 1HKTA 1YJWI 4G6TB 1UG2A 5ICFA 3GFIA 2FE3A 3RTRA 2BV6A 2PMHA 4KIFA 2L9VA 4CH7A 1W5CC 4MEYF 3Q3SA 4BQOA 4ZYDA 4BXXJ 3RZOJ 1LDKB 2NRAC 1LE8A 4XIDA 3BG7A 1B8IB 1KU7A 4A3IJ 3S15J 4IOCF 2VC0A 4BKXA 2UZKA 2XAUA 2KPMA 2VL8A 3LSMA 3I56I 1UZCA 3SYTA 5D5XB 4CSWA 1WKMA 3JRDA 3OY9A 1ETYA 2Q8KA 3LSKA 5FKLA 3ABKH 2X6WA 1FIAA 1MW7A 2VT3A 2EV5A 4N4OB 5HS7A 2CFXA 4IRHA 3WE3A 2EZLA 4W1UA 1W7PB 1TLHB 1X3WB 3ROUA 1ACIA 2JT1A 1ZGAA 3KCCA 2JK3A 1HDDC 2LTPA 4B3XA 3GXOA 3K69A 2XRLA 3S17J 3BR5A 2L9RA 4MLOA 2ZJ2A 3CMYA 2K9NA 1P7JA 2X0LA 2EA2A 4PK4A 3BJAA 4YFKF 3PFIA 3VYTB 4KMUX 1BBYA 3IAM2 2L4MA 4I09A 3KZYA 1X4OA 4RB2C 3T0YA 1VNDA 1ZHFA 2L9NA 2XAJA 2RC4A 3K2ZA 4M74A 4N9HA 3G71I 4H4KC 3SFIA 4UY8I 3QPSA 1YJNI 5FFZA 3ZQ7A 1KQ0A 3HL2A 2LRDA 2VODA 5HDGA 3Q9VA 3S3NA 1WJAA 2XRNA 4QWQA 4OOIA 3O2PE 2BY3A 3G1MA 3GBGA 4J00A 2OD5A 1RPWA 2EZHA 3PSIA 3L1PA 3DBRB 4BGDA 3C2BA 4U7DA 4IQJA 2XAFA 4WF2A 4HSRA 1LEAA 4C30A 3TDZC 1Y0UA 3BLYA 4Z6YA 4HNUA 2NS0A 1MNDA 2DBBA 5JHUA 2CSOA 1R6RA 3IC7A 2FXAA 3KZZA 3S1QJ 5IYBJ 5IT9K 2AO9A 1E3OC 1ZYRF 2LY1A 5DCMB 4K2EA 4LOCA 1FBQA 2M9HA 1XS9A 2M3AA 3X2QH 1N25A 3C1DA 1UCRA 2PLYA 4EV0A 1RUOA 3LNQA 1JHFA 5LHIA 1D0ZA 2Z16A 3FXJA 4XL9A 4CHUA 3BG6A 3MQ0A 1OLTA 5BOXA 2DQLA 5D5VB 4E7KA 2DA5A 1H89C 5IPAA 5EEHA 4EM2A 4RM3A 3HOXJ 1IUYA 3QPLA 5GP9A 3I59B 3S3MA 2DT6A 4EGZA 2RGVA 1HW2A 5ICCA 1LDDA 3GTLJ 3TOAA 3A01B 3A2KA 4O6JA 4GYGA 2V1UA 2KIUA 4NUBA 4A2UA 3CDLA 2GXAA 5EEAA 2UXXA 4RB3C 2LMDA 1SD7A 2JVGA 1EJ9A 1MBGA 1U5TC 2IAIA 5J8CA 2E5ZA 1DP7P 4RGSA 4PJMA 2PJPA 5CVIA 3F22A 3G3ZA 5IOZA 2XHKA 5KHDA 2D5VA 4XLHA 4KN4X 2ZXIA 1S72I 1YS6A 2K86A 2WAFA 3HKZN 3TBIA 2EIKH 1YIOA 2IA2A 1FTZA 2RQPA 3S93A 4H0EA 1LFUP 3M3YJ 4ZDOA 2Q2EA 4R79A 2XDVA 5K5QA 5DM7F 2STTA 4YIIA 3TO9A 4HG2A 3OYJA 5L3DA 3CCJI 3R0AA 2COBA 4ETSA 1E3HA 5K1YA 1F5TA 4XLEA 4RMNA 4KIBA 2HQAA 3J80Z 3F3XA 3WTSC 2DMTA 4QTRA 4WWCA 1RETA 2M5WA 1XDSA 1I39A 3KIOA 3WG7H 3LSTA 5E20A 1R00A 2ZNZA 4BL0B 3L09A 4EJUA 3CF2A 5DYMA 1G59A 1F4KA 1GV5A 1DDNA 3QRFF 5LHHA 2KZVA 5L3FA 2DPDA 3PFYA 4I76A 5BS6A 3BQZA 4FQGA 5IP7J 1HCRA 2W00A 2E5NA 4B1RA 5L3GA 2CQNA 2K3FA 4ZZDA 1JHHA 1A35A 3O8GA 1KQ8A 2XB5A 1JKPC 1B8IA 3OIPA 4C2MJ 4XICA 2V4JC 5JHFA 1ETOA 5M5WJ 1SFOJ 1WRJA 4RAYA 2GXBA 1BC8C 3JSPA 5FLXZ 3JRCA 2UUZA 2CUZA 1XCBA 3DP7A 1R49A 4D1QA 1MGTA 1X19A 3DLLF 4IRIA 1IXRC 3OIQA 4PFPA 4ZYGA 3OYMA 2W84A 4M73A 3V7CA 2X85A 2L54A 3JW4A 1QGPA 1NTCA 3FZVA 1Z3YA 4XONA 3VWBA 2HQRA 3IL2A 3WGGA 2M30A 3FXUA 1U8BA 3QU6A 5LRSA 1OCPA 2LKXA 1H9GA 1WHUA 1W7PD 4IQ4A 1SMTA 1JT6A 3I58A 1MDMB 1JKOC 3AL0C 1T38A 1YG2A 2JPCA 2W82A 3GTOJ 1W7PA 4GDFA 3HBLA 4BJ5C 2JRMA 2HVRA 1VQOI 2OCCH 3RKWA 3OSFA 1A6IA 2X1EA 1Z6RA 3CQZJ 4RAGA 5D6EA 3HOVJ 2CH0A 1U5TB 1FP2A 4R8HA 3NQOA 1TQPA 5J40A 3EDPA 4D0PA 3DXJF 4OAZA 1Z9CA 2GM4A 4ZYAA 1TQIA 2MLKA 2RNJA 5DS9A 4XOTA 1UG0A 2R7ZJ 2W4SA 2PMUA 2M34A 2Y0SA 5KK1A 3SJMA 3M07A 2M87A 2VBWA 3GTPJ 4PSWA 3ZPLA 5HS8A 2HEOA 1MH4A 1R71A 5J8FA 2KRCA 4LK0F 4RM2A 3IRQA 3CO7C 5E1WA 2PBIA 2B63J 3ULQB 1PP7U 2X48A 2K4JA 2ZXJA 3BPXA 4KT6A 4RAFA 5CJ9A 1QU3A 1O3SA 2HQNA 3WTYC 2E1CA 2K4BA 1ZRCA 2M0MA 4EMSA 2I10A 2XGEA 2DDBA 1OCZH 4YIFA 2YU9J 1S3JA 4P9UA 1P4XA 2COMA 4FTHA 3KLNA 5D5UB 4OINF 1HQCA 4ENJA 2G0EA 5B5EC 1XGNA 1IN8A 4NQWA 2W57A 5JR3A 3CCQI 3ZGKA 4C2TA 1R1UA 2TDXA 3MMYB 2MA3A 1V4RA 5LEJA 3GLLA 2H27A 2HPMA 2EV0A 3HC7A 4YRVA 1QRYA 3FXKA 1XCVA 2GA2A 3HTUA 1IDZA 2QA4I 1YLFA 1ZLJA 5BPIA 2W85A 4XNFA 1ZG1A 1OMIA 2QSFX 1HSTA 5J4VA 3DFGA 2ELJA 1P4WA 3BG3A 2KQRA 4PDKA 3HKZA 1IO2A 3GFLA 2OU2A 3HSRA 1Y8RB 3SZPA 4YFNF 1K83J 3C2GA 1T2KA 1D8JA 2ZKZA 2CG4A 3VFZA 5EJCA 1ON2A 1SMYF 4KDPA 3DF8A 1NK2P 1JI8A 1MMAA 3PQKA 2MD5A 1H9TA 1OR7A 2VE8A 3GO5A 5DUKA 4M6YA 1VQ5I 3EYIA 1PJRA 3M8JA 4A6DA 1X2NA 3E6DA 3BTLA 2VONA 2HTSA 1P6RA 3CCVI 1VTNC 3AFHA 2R5YA 1VQKI 4EJOA 1Z91A 5GAHJ 4I7HA 3HUGB 3D5SC 1BW6A 4AYBA 2CQKA 4B4CA 2RDPA 2E19A 3J81K 4A0XA 5IT9Z 1AOYA 3HOTA 4JQFA 2R7WA 5H2FC 4RB0A 4BXUA 2QLZA 1X1PA 2FU4A 4L5EA 1FNNA 4CICA 1MSEC 2VI6A 2CO5A 1KQ9A 5EZHA 3MKYB 4IO9F 4V19K 3B02A 4JX6A 4AU7A 4CCJA 1DGWY 2PFBA 3FMRA 4FISA 4Y4RA 2DFEA 2XKOA 1SFEA 2EBIA 1WFXA 1TC3C 1WJDA 4GXOA 1N77A 1OYYA 2IS6A 1X1AA 1WJCA 5EDNA 4HLYA 1JE8A 3HOSA 3K10A 4NBQA 1F9NA 1AHDP 1RRJA 3CJRB 3L2WA 3CP2A 5IYDJ 4UVBA 2LP0A 3PQJA 4XRFA 1MMNA 3H35A 3HB9A 1HW1A 3IH4A 4G9YA 2WAQA 2QKLB 1R4MB 1HDPA 2CV2A 3TKYA 3R4KA 4XOPA 1Z6TA 4I0AA 3I71A 3GTJJ 1W1WE 5IYCJ 3HUGA 2JA7J 1O3TA 2KL4A 5K7FA 1SFKA 3CCMI 1LDJA 5BNGA 1R7JA 2IGKA 4E7LA 1YJ9I 2F5FA 3FXRA 1O3QA 3ZRGA 3K1MA 3QOEA 4CYCB 4HF2A 1YS7A 2PX9A 1BIAA 4GFBA 3LA2A 2LDUA 2XF6A 5C3EJ 2HQ5A 2K5CA 2BBYA 4L0YB 1RIOH 1DPUA 4B44A 3H92A 2VQCA 2ZMEA 5BMZA 1S6LA 3LA7A 1LQ1A 3ESWB 3AG3H 1RZ4A 2DK8A 2WADA 3VSKA 3R6SA 5E79C 2CQ7A 4MGRA 3TL4X 3OV8A 1PYVA 4C2UA 2VPRA 2LFBA 2F2EA 2XAGA 2WY8Q 3FM3A 1JT0A 2Q2EB 2K9MA 1SEUA 4BY1J 4DNCA 3HSFA 3F0CA 2HYGD 2CQQA 3EQLF 3LFUA 3CESA 1ZQ3P 2HPIA 1P9QC 2GAUA 2JUGA 2IXSA 2DA6A 1IDYA 3K70C 4HZFA 3TW7A 3DTIA 2P6TA 2R92J 3KLOA 3WU0A 2H09A 1O4XA 1YW7A 2KHMA 3RCOA 3FISA 4Z2YA 5C4XJ 5J4YA 2IPQX 1B9MA 2LKSA 2VKEA 3BWGA 4HLXA 4PSXA 4EJVA 4IZZA 1NG6A 3K9TA 2TCTA 3GEZA 3CMEI 2R7UA 2XGCA 2B9SA 2A5WA 2YSRA 1RI7A 1ZKGA 2O3FA 1WGXA 3ERMA 4XBFA 1J0RA 2FUG2 2MFZA 1Z77A 1I6HJ 4BACA 4HBLA 3PNYA 1TT5B 2LY2A 1R23A 2R3SA 1LE8B 4TV7A 1U6GA 2CQXA 4OIPF 3OYIA 3IUOA 2L4AA 2E7XA 1J75A 5CLSA 5F0CA 2KJBA 2RQQA 4IVNA 3H0DA 5F1RA 2STWA 2PMZN 2L7MP 4A69C 3OOUA 2OUMA 1VQNI 4LB6B 1X1BA 3N05A 1FOYA 1ZLKA 5GADJ 3ZQIA 1H88C 4PGHA 3RYPA 3BY6A 2QCOA 1J09A 1C0WA 2V79A 4P55A 1ZR2A 1YE9A 2FMYA 4JOMA 3WHBA 2CGPA 4QPQA 1MKMA 3P9CA 3KEYA 4HF0A 5E8IA 1XMXA 4AIDA 3P9KA 2M8GX 3V4GA 3LAPA 4DOZA 5JVGF 4P5OA 4YIRX 3R0JA 3C7JA 3IP4B 1XGSA 1G3YA 2EB7A 1E2XA 2FOWA 1RNLA 1X1CA 2DO7A 2LD5A 3I4NJ 2JUCA 5HVQC 3MKZA 3WG9A 1D1BA 4MFDA 2ELHA 3E1SA 4M72A 1JGGA 1FT9A 2RV8A 2ELKA 2P4WA 5CQGA 4M3FA 2DFFA 2VXZA 3H3ZA 3CJNA 5TISC 1WQ2A 2YS9A 2OQRA 3FBIB 4EQQA 2KJCA 1X2MA 1Y6IA 2N8GA 2E7WA 1ZH5A 2PI0A 1YW9A 3OS1A 1T39A 2Y69H 4PFOA 1DU6A 3BCAA 1RC9A 3K1NA 1DP3A 2E2HJ 1IGNA 4UVAA 4LMYA 2E2JJ 2V26A 2VQGA 2V9PA 4XKBA 1MJBA 1TW2A 3Q9SA 2ME0A 3ZQCA 1K78B 3OYKA 4A0ZA 3PUBA 4RGRA 1MBKA 1JTYA 1LFPA 2ZNYA
chains in the Genus database with same CATH topology
1F43A 3S2DJ 3LNQA 3LSJA 5FKMA 1GUUA 4M6VA 2DTZA 5M5XJ 2CU7A 1UMQA 1HOMA 3TP0A 1OFCX 2DA5A 3Q0UA 2NVTJ 1H89C 5IPAA 2Y2ZA 3HOXJ 3QPLA 5GP9A 3GTMJ 1AU7A 4M3BA 1VF9A 4Y7NJ 3GTLJ 5FJ8J 4J19A 4A93J 3HM5A 1YRNB 5K7ZA 5J1UA 3A01B 3FK6A 1TWGJ 5K7HA 2EH3A 3CDLA 4C3JJ 3JRGA 1XC5A 4QIWN 1ETKA 5EEAA 1ENHA 4A3EJ 3NAUA 4X6AJ 2DN0A 1MBGA 2IAIA 2WAQN 5F0HA 2JA8J 2M0CA 5IOZA 2EZIA 3PO2J 5HODA 3H0GJ 4A3FJ 2D5VA 1WI3A 3HKZN 3A02A 3BR0A 3BG5A 3LOCA 3S1RJ 1FTTA 4JP0A 1FTZA 2NOGA 1TWCJ 1LFUP 3M3YJ 4DZPA 3JRFA 3JRIA 3TP3A 2HYJA 3ZQFA 1MBFA 2LY9A 5DTDA 2COBA 4A3BJ 3G1OA 1AKHB 2Y30A 2ID3A 3GTGJ 2DMTA 4QTRA 5E3NA 1WCMJ 1RETA 1Z0XA 3BQYA 4AC0A 1T33A 4BY7J 3HEFA 3CCYA 1GV5A 1JJ8C 2IBDA 1RKWA 4I76A 1JUMA 5IP7J 3BQZA 1HCRA 2NS8A 3BTCA 5M5YJ 3JR9A 1PUFB 1BA5A 4B1RA 3Q0VA 5FKKA 1ETWA 4IHYA 3O8GA 2XB5A 4UUSA 1JKPC 1B8IA 2WV1A 4C2MJ 4XICA 1SFOJ 1ETOA 5M5WJ 1R9TJ 4EEFG 2DA2A 4D5CA 3JRCA 4AYBN 1VI0A 1ZR4A 2JMWA 4DYRA 2FJ1A 3MN2A 1RESA 3BG9A 2HOAA 1NTCA 2K9SA 3M4OJ 4W97A 5IOYA 4M3EA 1U8BA 1GV2A 1OCPA 2LKXA 3RZDJ 1JT6A 1MH3A 3PO3J 1CQTA 3DEWA 1JKOC 2X6OA 2DJNA 2EZKA 3GTOJ 2MG4A 1IJWC 3HBLA 3ZQLA 2ECCA 5JLWA 3JREA 2R5YB 5IP6A 3OSFA 1A6IA 2KDZA 1YRNA 5E3MA 3CQZJ 3HOVJ 1PUFA 4XK4A 5F27A 1FIPA 1APLC 4BBRJ 2WB1N 1LFBA 2GM4A 2HOSA 3RQIA 2L7FP 5DS9A 4V2FA 1P7IA 2QF7A 2R7ZJ 2HXOA 9ANTA 3S1MJ 2M34A 3SJMA 2HOTA 3W6VA 1IC8A 3GTPJ 2L0KA 5J1YA 2LLKA 1I50J 1MH4A 3LSGA 1GDTA 4D5FA 3A01A 2B63J 3O8HA 2P81A 2M2EA 4RDUA 4CYCA 1TWHJ 3RKQA 2X48A 1ETVA 5GPAA 2O7OA 2HDDA 3HGGA 3IH2A 3ZOBA 2HXIA 4DYQA 3JRHA 5E3OA 2I10A 2DA3A 2XGEA 1S7EA 1BL0A 3BR1A 2O8KA 2DMQA 2YU9J 5EYRA 1W0TA 1JUPA 3A03A 1W0UA 4FTHA 4MIMA 2GLOA 3GTQJ 4HNVA 5EG0A 2CUFA 3GTKJ 4MO7A 2G0EA 3UKGA 1ETQA 3ZQGA 3H3VK 2ZB9A 1F36A 3B6CA 3BR6A 5FKOA 4DZJA 1VFCA 2NVQJ 1U9OA 1T56A 3HOWJ 3TW6A 4C3HJ 1WH7A 5EZGA 1QRYA 4S0HB 1NK3P 1IDZA 1I3QJ 2XGDA 3PM1A 2CJJA 2JA5J 2O9LA 2E1OA 2H8RA 3B6AA 1WH5A 3BG3A 2K40A 3BTIA 1FJLA 1HF0A 4IHXA 1MBJA 3HGYA 2CUEA 3NARA 5C44J 3LSRA 3HOUJ 4JYKA 3HOZJ 1K83J 4MFEA 2DMUA 4D7MA 1HLVA 4IHVA 1ITYA 3IV5A 3HDDA 1POGA 1RKTA 3OSGA 1NK2P 4V2GA 3FK7A 4FE7A 3LSPA 3S14J 1X2NA 3BTLA 3TEDA 2NS7A 3JRAA 2R0QC 2MW8A 2R5YA 1GT0C 1BW6A 2L7ZA 2KT0A 4IEJA 4B4CA 2H1KA 5M3FJ 2E19A 4M3GA 1H8AC 3K2AA 2E2IJ 4L5EA 3MVPA 1XG1A 1MSEC 1JKRC 2R93J 1A5JA 2VI6A 2XSDC 4JX4A 3BR3A 4G12A 5EZHA 4FCYA 4JX6A 2DA4A 1AKHA 2DMNA 4FISA 5EGOA 3BR2A 1IRZA 2LK2A 3Q0WA 4NDLA 2EBIA 2ME6A 1TC3C 2NVXJ 2K9QA 1JKQC 2TRTA 2JWTA 2FD5A 1MBHA 1BW5A 5EDNA 1QPIA 2MSYA 1ZGWA 1Y1WJ 1EF4A 1TWFJ 1B72B 1AHDP 1GVDA 5EF6A 5IYDJ 3DCFA 4FE4A 3WHCA 2MGQA 2LP0A 2YUSA 2Y9YA 4A3DJ 1QVUA 2Y0SN 5FKNA 3G1LA 3HB9A 3IH4A 1U78A 2ECBA 3S1NJ 1ZTRA 3JRBA 5M3MJ 2JA6J 1HDPA 2XB0X 1ORKA 2OPTA 3GTJJ 5IYCJ 2X9DA 4A3MJ 2JA7J 3IH3A 5F04A 5K7FA 1OCTC 5EG0B 4XRSG 5BNGA 3FIWA 4CYCB 2W48A 4GFBA 5F0FA 5C3EJ 2HQ5A 2LVSA 2DA1A 1DU0A 4A3GJ 3FKIJ 1QVTA 5F08A 3MKLA 1MNMC 2CRGA 2JN6A 3OIOA 2JJ7A 1JTXA 5J3LA 5FLMJ 1B72A 1RR7A 2NVYJ 5FLVA 1U9NA 2VPRA 2LFBA 4M3DA 5GPCA 3ZQHA 1X58A 1IG7A 4UUTA 1JT0A 4BY1J 1UG2A 3F0CA 3S2HJ 2CQQA 3VPRA 1IV6A 1ZQ3P 2DA7A 4JX5A 3QQAA 2DA6A 1IDYA 3TW7A 2R92J 1ZK8A 1O4XA 3K7AJ 3Q3SA 1BJZA 3FISA 4AUXA 4BXXJ 2HI3A 1SANA 5C4XJ 3RZOJ 2FX0A 1MSFC 2VKEA 1LE8A 4XIDA 2XPVA 2TCTA 1B8IB 4A3IJ 4IHWA 3S15J 4BKXA 2XGCA 1ZKGA 2RAEA 2FQ4A 2IEKA 4Y52J 1WGXA 5JLXA 2R5ZB 3E7LA 3JRDA 1Z77A 4QSHA 1I6HJ 1ETYA 2GBYA 3I4MJ 4DYCA 1K61A 1G2HA 1Y1VJ 1LE8B 5FKLA 5J1RA 3BT9A 1FIAA 2CQXA 2ID6A 3S16J 2Y31A 5F0CA 2EZLA 2R5ZA 4W1UA 5F1JA 2PMZN 2LR8A 2JK3A 4C3IJ 4A3JJ 2L7MP 4A69C 1HDDC 1JUSA 3OOUA 2LTPA 2XRLA 4UUSB 3S17J 3BR5A 1Q1VA 2L9RA 3ZQIA 1H88C 4MLOA 2AHQA 3CMYA 2EQRA 5E3LA 2VUMJ 2QCOA 2K9NA 1P7JA 4A3LJ 1ZR2A 1OJLA 5EGOB 3HOYJ 3WHBA 3SDGA 2OF7A 4DW6A 4RBOA 2M8GX 4ABZA 1VNDA 2LD5A 1MBEA 3I4NJ 3SFIA 3QPSA 4A3KJ 4MFDA 3D1NI 4BBSJ 1JGGA 2ELKA 1JJ6C 3BTJA 4M3FA 4X1EA 3G1MA 3GBGA 1RPWA 1WPKA 1D5YA 2EZHA 2YS9A 4I6ZA 3L1PA 2XPWA 1ETXA 1X2MA 2XPUA 3C2BA 2N8GA 4B3AA 4A3CJ 1IUFA 5C4JJ 4XRSA 1DU6A 5IP9J 3S1QJ 1UHSA 2E2HJ 1IGNA 1FEXA 5IYBJ 4D7NA 2E2JJ 1TWAJ 2AO9A 4XRMA 1E3OC 2DMPA 2VKVA 4LOCA 2M9HA 2ME0A 3ZQCA 1XS9A 1MBKA 1JTYA 2Y9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F43 A;  3S2D J;  3LNQ A;  3LSJ A;  5FKM A;  1GUU A;  4M6V A;  2DTZ A;  5M5X J;  2CU7 A;  1UMQ A;  1HOM A;  3TP0 A;  1OFC X;  2DA5 A;  3Q0U A;  2NVT J;  1H89 C;  5IPA A;  2Y2Z A;  3HOX J;  3QPL A;  5GP9 A;  3GTM J;  1AU7 A;  4M3B A;  1VF9 A;  4Y7N J;  3GTL J;  5FJ8 J;  4J19 A;  4A93 J;  3HM5 A;  1YRN B;  5K7Z A;  5J1U A;  3A01 B;  3FK6 A;  1TWG J;  5K7H A;  2EH3 A;  3CDL A;  4C3J J;  3JRG A;  1XC5 A;  4QIW N;  1ETK A;  5EEA A;  1ENH A;  4A3E J;  3NAU A;  4X6A J;  2DN0 A;  1MBG A;  2IAI A;  2WAQ N;  5F0H A;  2JA8 J;  2M0C A;  5IOZ A;  2EZI A;  3PO2 J;  5HOD A;  3H0G J;  4A3F J;  2D5V A;  1WI3 A;  3HKZ N;  3A02 A;  3BR0 A;  3BG5 A;  3LOC A;  3S1R J;  1FTT A;  4JP0 A;  1FTZ A;  2NOG A;  1TWC J;  1LFU P;  3M3Y J;  4DZP A;  3JRF A;  3JRI A;  3TP3 A;  2HYJ A;  3ZQF A;  1MBF A;  2LY9 A;  5DTD A;  2COB A;  4A3B J;  3G1O A;  1AKH B;  2Y30 A;  2ID3 A;  3GTG J;  2DMT A;  4QTR A;  5E3N A;  1WCM J;  1RET A;  1Z0X A;  3BQY A;  4AC0 A;  1T33 A;  4BY7 J;  3HEF A;  3CCY A;  1GV5 A;  1JJ8 C;  2IBD A;  1RKW A;  4I76 A;  1JUM A;  5IP7 J;  3BQZ A;  1HCR A;  2NS8 A;  3BTC A;  5M5Y J;  3JR9 A;  1PUF B;  1BA5 A;  4B1R A;  3Q0V A;  5FKK A;  1ETW A;  4IHY A;  3O8G A;  2XB5 A;  4UUS A;  1JKP C;  1B8I A;  2WV1 A;  4C2M J;  4XIC A;  1SFO J;  1ETO A;  5M5W J;  1R9T J;  4EEF G;  2DA2 A;  4D5C A;  3JRC A;  4AYB N;  1VI0 A;  1ZR4 A;  2JMW A;  4DYR A;  2FJ1 A;  3MN2 A;  1RES A;  3BG9 A;  2HOA A;  1NTC A;  2K9S A;  3M4O J;  4W97 A;  5IOY A;  4M3E A;  1U8B A;  1GV2 A;  1OCP A;  2LKX A;  3RZD J;  1JT6 A;  1MH3 A;  3PO3 J;  1CQT A;  3DEW A;  1JKO C;  2X6O A;  2DJN A;  2EZK A;  3GTO J;  2MG4 A;  1IJW C;  3HBL A;  3ZQL A;  2ECC A;  5JLW A;  3JRE A;  2R5Y B;  5IP6 A;  3OSF A;  1A6I A;  2KDZ A;  1YRN A;  5E3M A;  3CQZ J;  3HOV J;  1PUF A;  4XK4 A;  5F27 A;  1FIP A;  1APL C;  4BBR J;  2WB1 N;  1LFB A;  2GM4 A;  2HOS A;  3RQI A;  2L7F P;  5DS9 A;  4V2F A;  1P7I A;  2QF7 A;  2R7Z J;  2HXO A;  9ANT A;  3S1M J;  2M34 A;  3SJM A;  2HOT A;  3W6V A;  1IC8 A;  3GTP J;  2L0K A;  5J1Y A;  2LLK A;  1I50 J;  1MH4 A;  3LSG A;  1GDT A;  4D5F A;  3A01 A;  2B63 J;  3O8H A;  2P81 A;  2M2E A;  4RDU A;  4CYC A;  1TWH J;  3RKQ A;  2X48 A;  1ETV A;  5GPA A;  2O7O A;  2HDD A;  3HGG A;  3IH2 A;  3ZOB A;  2HXI A;  4DYQ A;  3JRH A;  5E3O A;  2I10 A;  2DA3 A;  2XGE A;  1S7E A;  1BL0 A;  3BR1 A;  2O8K A;  2DMQ A;  2YU9 J;  5EYR A;  1W0T A;  1JUP A;  3A03 A;  1W0U A;  4FTH A;  4MIM A;  2GLO A;  3GTQ J;  4HNV A;  5EG0 A;  2CUF A;  3GTK J;  4MO7 A;  2G0E A;  3UKG A;  1ETQ A;  3ZQG A;  3H3V K;  2ZB9 A;  1F36 A;  3B6C A;  3BR6 A;  5FKO A;  4DZJ A;  1VFC A;  2NVQ J;  1U9O A;  1T56 A;  3HOW J;  3TW6 A;  4C3H J;  1WH7 A;  5EZG A;  1QRY A;  4S0H B;  1NK3 P;  1IDZ A;  1I3Q J;  2XGD A;  3PM1 A;  2CJJ A;  2JA5 J;  2O9L A;  2E1O A;  2H8R A;  3B6A A;  1WH5 A;  3BG3 A;  2K40 A;  3BTI A;  1FJL A;  1HF0 A;  4IHX A;  1MBJ A;  3HGY A;  2CUE A;  3NAR A;  5C44 J;  3LSR A;  3HOU J;  4JYK A;  3HOZ J;  1K83 J;  4MFE A;  2DMU A;  4D7M A;  1HLV A;  4IHV A;  1ITY A;  3IV5 A;  3HDD A;  1POG A;  1RKT A;  3OSG A;  1NK2 P;  4V2G A;  3FK7 A;  4FE7 A;  3LSP A;  3S14 J;  1X2N A;  3BTL A;  3TED A;  2NS7 A;  3JRA A;  2R0Q C;  2MW8 A;  2R5Y A;  1GT0 C;  1BW6 A;  2L7Z A;  2KT0 A;  4IEJ A;  4B4C A;  2H1K A;  5M3F J;  2E19 A;  4M3G A;  1H8A C;  3K2A A;  2E2I J;  4L5E A;  3MVP A;  1XG1 A;  1MSE C;  1JKR C;  2R93 J;  1A5J A;  2VI6 A;  2XSD C;  4JX4 A;  3BR3 A;  4G12 A;  5EZH A;  4FCY A;  4JX6 A;  2DA4 A;  1AKH A;  2DMN A;  4FIS A;  5EGO A;  3BR2 A;  1IRZ A;  2LK2 A;  3Q0W A;  4NDL A;  2EBI A;  2ME6 A;  1TC3 C;  2NVX J;  2K9Q A;  1JKQ C;  2TRT A;  2JWT A;  2FD5 A;  1MBH A;  1BW5 A;  5EDN A;  1QPI A;  2MSY A;  1ZGW A;  1Y1W J;  1EF4 A;  1TWF J;  1B72 B;  1AHD P;  1GVD A;  5EF6 A;  5IYD J;  3DCF A;  4FE4 A;  3WHC A;  2MGQ A;  2LP0 A;  2YUS A;  2Y9Y A;  4A3D J;  1QVU A;  2Y0S N;  5FKN A;  3G1L A;  3HB9 A;  3IH4 A;  1U78 A;  2ECB A;  3S1N J;  1ZTR A;  3JRB A;  5M3M J;  2JA6 J;  1HDP A;  2XB0 X;  1ORK A;  2OPT A;  3GTJ J;  5IYC J;  2X9D A;  4A3M J;  2JA7 J;  3IH3 A;  5F04 A;  5K7F A;  1OCT C;  5EG0 B;  4XRS G;  5BNG A;  3FIW A;  4CYC B;  2W48 A;  4GFB A;  5F0F A;  5C3E J;  2HQ5 A;  2LVS A;  2DA1 A;  1DU0 A;  4A3G J;  3FKI J;  1QVT A;  5F08 A;  3MKL A;  1MNM C;  2CRG A;  2JN6 A;  3OIO A;  2JJ7 A;  1JTX A;  5J3L A;  5FLM J;  1B72 A;  1RR7 A;  2NVY J;  5FLV A;  1U9N A;  2VPR A;  2LFB A;  4M3D A;  5GPC A;  3ZQH A;  1X58 A;  1IG7 A;  4UUT A;  1JT0 A;  4BY1 J;  1UG2 A;  3F0C A;  3S2H J;  2CQQ A;  3VPR A;  1IV6 A;  1ZQ3 P;  2DA7 A;  4JX5 A;  3QQA A;  2DA6 A;  1IDY A;  3TW7 A;  2R92 J;  1ZK8 A;  1O4X A;  3K7A J;  3Q3S A;  1BJZ A;  3FIS A;  4AUX A;  4BXX J;  2HI3 A;  1SAN A;  5C4X J;  3RZO J;  2FX0 A;  1MSF C;  2VKE A;  1LE8 A;  4XID A;  2XPV A;  2TCT A;  1B8I B;  4A3I J;  4IHW A;  3S15 J;  4BKX A;  2XGC A;  1ZKG A;  2RAE A;  2FQ4 A;  2IEK A;  4Y52 J;  1WGX A;  5JLX A;  2R5Z B;  3E7L A;  3JRD A;  1Z77 A;  4QSH A;  1I6H J;  1ETY A;  2GBY A;  3I4M J;  4DYC A;  1K61 A;  1G2H A;  1Y1V J;  1LE8 B;  5FKL A;  5J1R A;  3BT9 A;  1FIA A;  2CQX A;  2ID6 A;  3S16 J;  2Y31 A;  5F0C A;  2EZL A;  2R5Z A;  4W1U A;  5F1J A;  2PMZ N;  2LR8 A;  2JK3 A;  4C3I J;  4A3J J;  2L7M P;  4A69 C;  1HDD C;  1JUS A;  3OOU A;  2LTP A;  2XRL A;  4UUS B;  3S17 J;  3BR5 A;  1Q1V A;  2L9R A;  3ZQI A;  1H88 C;  4MLO A;  2AHQ A;  3CMY A;  2EQR A;  5E3L A;  2VUM J;  2QCO A;  2K9N A;  1P7J A;  4A3L J;  1ZR2 A;  1OJL A;  5EGO B;  3HOY J;  3WHB A;  3SDG A;  2OF7 A;  4DW6 A;  4RBO A;  2M8G X;  4ABZ A;  1VND A;  2LD5 A;  1MBE A;  3I4N J;  3SFI A;  3QPS A;  4A3K J;  4MFD A;  3D1N I;  4BBS J;  1JGG A;  2ELK A;  1JJ6 C;  3BTJ A;  4M3F A;  4X1E A;  3G1M A;  3GBG A;  1RPW A;  1WPK A;  1D5Y A;  2EZH A;  2YS9 A;  4I6Z A;  3L1P A;  2XPW A;  1ETX A;  1X2M A;  2XPU A;  3C2B A;  2N8G A;  4B3A A;  4A3C J;  1IUF A;  5C4J J;  4XRS A;  1DU6 A;  5IP9 J;  3S1Q J;  1UHS A;  2E2H J;  1IGN A;  1FEX A;  5IYB J;  4D7N A;  2E2J J;  1TWA J;  2AO9 A;  4XRM A;  1E3O C;  2DMP A;  2VKV A;  4LOC A;  2M9H A;  2ME0 A;  3ZQC A;  1XS9 A;  1MBK A;  1JTY A;  2Y9Z A; 
#chains in the Genus database with same CATH topology
 1SFX A;  3S2D J;  3A1Y A;  2XSJ C;  2AXT C;  4BQQ A;  5CYV A;  2OA4 A;  1FOX A;  5FKM A;  1GUU A;  1SD6 A;  4AWX B;  1GXQ A;  2VBY A;  3H3U A;  3DTE A;  3F8B A;  2DTZ A;  4WX9 A;  1UMQ A;  2DCE A;  1OFC X;  2EFN A;  2JA2 A;  2NVT J;  1R5G A;  2XC7 A;  2BW3 A;  4Y7N J;  4OIQ F;  5FJ8 J;  3QAH A;  3E6C C;  2DYS H;  2O61 A;  5CVU A;  2F4O B;  5GTH C;  3H5A A;  4C3J J;  5CKT A;  2A07 F;  1HKQ A;  1XC5 A;  2VE9 A;  4U0Y A;  1KU9 A;  2HVQ A;  4M9X A;  3W6J B;  2EIM H;  4CCN A;  1V5E A;  2XGX A;  3TOB A;  2C6Y A;  2WAQ N;  5F0H A;  4DQ2 A;  2QSH X;  2EZI A;  2EFO A;  4BUP A;  5J47 A;  5HOD A;  2E1M B;  5TRD A;  2NNY A;  4XN0 A;  1R58 A;  4OU0 A;  3LWF A;  1YI2 I;  1MIJ A;  3U2R A;  2ISY A;  1IN4 A;  3J7Z I;  4WK8 F;  2HYF A;  2NOG A;  1K6Y A;  4BHB A;  4DZP A;  2ADU A;  3JRF A;  5HNH A;  2HYJ A;  5ICE A;  2DOD A;  2KLO A;  4HX7 A;  1MBF A;  2DT7 B;  4A3B J;  2JVH A;  3QPH A;  2EJR A;  3Q5F A;  3LAJ A;  3VOD A;  3OR2 C;  2CFO A;  1Y0N A;  3ECO A;  3BJ6 A;  4BDZ A;  3RKX A;  4KYW A;  3L9F A;  1T33 A;  4P96 A;  4BY7 J;  2ESN A;  3VYU B;  1SVL A;  4A0Y A;  1OCR H;  1ON1 A;  2MC3 A;  1UJ8 A;  4E4H A;  2MBF A;  1EH8 A;  1JUM A;  2XIG A;  2NS8 A;  2VIX A;  4L5I A;  3Q0V A;  2A61 A;  3IWZ A;  4CO8 A;  3R61 A;  4B47 A;  4FET A;  4LIT A;  4NNJ A;  1KYW A;  2WV1 A;  2X6X A;  5TJJ A;  3OYA A;  2DA2 A;  5E18 F;  5DCF A;  4WCG A;  2HNH A;  2ZCW A;  2Y0M A;  4Y13 A;  1LEB A;  1MMD A;  5LD2 C;  1XGM A;  4II2 A;  1ZR4 A;  2JMW A;  4DYR A;  3CC7 I;  2FJ1 A;  5LGT A;  1SAX A;  3BOQ A;  1RES A;  3EUK L;  2VOO A;  2HDW A;  2K9S A;  4KN7 X;  4W97 A;  1UHM A;  2OZ6 A;  3JTH A;  5IOY A;  1XPX A;  3QOP A;  2GXG A;  2D1V A;  4M3E A;  5F64 A;  2VJ4 A;  3KEQ A;  4Y15 A;  2PG4 A;  5KVR A;  1KYZ A;  4HF1 A;  3PO3 J;  3K0L A;  1BI3 A;  3DEW A;  4F52 A;  1CGP A;  2DJN A;  5HLG A;  2EZK A;  3F8M A;  2QM3 A;  3L7W A;  4IL6 C;  4EVI A;  1L3L A;  5H6Q A;  5JLW A;  1FP1 D;  2GZW A;  2R5Y B;  2BZT A;  3TGN A;  4G6D A;  2KDZ A;  2O5R A;  1WWX A;  2BYV E;  5B1A H;  2W7N A;  5F27 A;  1FIP A;  3K4L A;  3VEP A;  2QEN A;  2LBF B;  3G4S I;  2X1D A;  4OIO F;  1O57 A;  1P4A A;  2QGU A;  3HHG A;  1P7I A;  2QWW A;  3TQN A;  3L2Q A;  2QF7 A;  3HRU A;  2E71 A;  3CLQ A;  4PJL A;  1VQ4 I;  5DD4 A;  3E3V A;  2HOT A;  5FB2 A;  3DKW A;  1QA6 A;  4CZC A;  2L0K A;  3F8N A;  3FM5 A;  3UR3 C;  5CVV A;  2UV1 A;  3HRM A;  1I50 J;  4HX8 A;  2E36 A;  4Y17 A;  2BHY A;  3RJP A;  3ZXS A;  4BE1 A;  1YO5 C;  1MJA A;  4XM3 A;  2HDD A;  1NG7 A;  2J5P A;  4ESJ A;  4L9T A;  5E8G A;  3BZ6 A;  2HXI A;  4XSZ F;  3ZOB A;  4E7H A;  3RPU A;  2RVC A;  5KAF C;  3NWT A;  4DYQ A;  2DA3 A;  3CMA I;  2OCE A;  2V1X A;  1YIJ I;  1S29 A;  2BY1 A;  3OOP A;  3BR1 A;  4DGW B;  3A03 A;  3GZN B;  3GWZ A;  3GX4 X;  4C9Y A;  2F48 A;  2JPB A;  2L02 A;  2XUB A;  4HNV A;  4LLG F;  2VBZ A;  4U7B A;  2AQF A;  3ZMT A;  1SD4 A;  3BRO A;  3D5R C;  4KT5 C;  4A5M A;  4QLC U;  3WOD F;  1YOV B;  4Q47 A;  4EJW A;  1E17 A;  4NB5 A;  3B6C A;  5TGT A;  2DLL A;  1ZGJ A;  2P0W A;  4ZDL A;  5D4S A;  4CZZ A;  1VFC A;  4R1H A;  5FRM A;  3HOW J;  3I55 I;  2KP6 A;  3BP8 A;  1NK3 P;  3HG9 A;  1MD0 A;  4N0B A;  4QPO A;  1UFM A;  3GZ6 A;  3J81 Z;  2JA5 J;  3WTW C;  4IF4 A;  1JXS A;  1HF0 A;  3VB2 A;  2QQA A;  3HGY A;  2ZFU A;  3H1C A;  2XRO A;  3LSR A;  5D5W B;  1P92 A;  1O7L A;  2LYC A;  3PNT A;  4KNY A;  3HOZ J;  3D0S A;  1BR4 A;  3E5Q A;  2DMU A;  2CW7 A;  4ON0 A;  1ITY A;  2PJR B;  1GHC A;  4Y33 A;  1RKT A;  5DEQ A;  1VQM I;  1DPR A;  3OSG A;  1PVE A;  4FHT A;  4V2G A;  3VDX A;  4FE7 A;  2VXD A;  3QYE A;  3RDI A;  1U3E M;  3K4J A;  3CDH A;  1OCO H;  2DU9 A;  2NS7 A;  2R0Q C;  4L0Z B;  1W36 D;  1GT0 C;  3MEX A;  3HIF A;  2XAH A;  4I02 A;  2H1K A;  5LEK A;  4M3G A;  2WA0 A;  1BIB A;  1R36 A;  3OMY A;  3BDD A;  1IF1 A;  1DQU A;  3MVP A;  3RI4 A;  3W2A A;  3BCB A;  1UAA A;  1A5J A;  3EET A;  1LVK A;  3BR3 A;  2KMU A;  2ZXH A;  2DA4 A;  1HW5 A;  1GVJ A;  1OR7 C;  1YX3 A;  1AKH A;  2FNP A;  6PAX A;  1EKE A;  3Q0W A;  2QBY B;  3SXY A;  2H6C A;  2IW5 A;  2ME6 A;  4E7I A;  2NVX J;  2JWT A;  2Q1Z B;  1IV8 A;  4F7Z A;  2VJI A;  2MSY A;  3FXL A;  1Y1W J;  4NC8 A;  3WGI A;  1J2X A;  2VPL A;  2QQ9 A;  1TWF J;  2F6C A;  3OR1 C;  5EF6 A;  4UUV A;  1OYW A;  3DCF A;  4HQM A;  2YUS A;  3QYF A;  3REO A;  1LVA A;  1OCC H;  2DT5 A;  3WE2 A;  5FKN A;  5AIQ A;  4LLL A;  4DBQ A;  5DV5 A;  2ECB A;  3DPU A;  2HR3 A;  1ZTR A;  3CUQ B;  3L2U A;  2XV4 S;  3I0T A;  1E0E A;  2MC4 A;  3FDY A;  4CA0 A;  2AS5 F;  2DOE A;  2OAZ A;  2XKP A;  2IA0 A;  3EUH C;  5L3E A;  3IHU A;  2IVM A;  4RAZ A;  3IH3 A;  1SD5 A;  2EK5 A;  3FIW A;  3I9V 2;  2EWN A;  4B09 A;  4BE2 A;  4A12 A;  2CMP A;  3W2W A;  3DV8 A;  2GQQ A;  2CWE A;  3M8E A;  3F6O A;  2WTE A;  2CW8 A;  2UWM A;  1P2F A;  2DA1 A;  2JSC A;  3E6M A;  3DLA A;  1GXP A;  2F5E A;  4HV6 A;  5F08 A;  1TL8 A;  1VQ7 I;  3OYN A;  3S2W A;  2CRG A;  2FOK A;  2JN6 A;  3GLX A;  2JJ7 A;  4HEA 2;  4U87 A;  4KA4 A;  2OC6 A;  1XMA A;  2YU3 A;  2NVY J;  4YEJ A;  4M3D A;  5GPC A;  3P7N A;  3CCS I;  1K4S A;  3LSH A;  3ZQH A;  1X58 A;  3A0H C;  2BVM A;  2M7A A;  3ISP A;  1T0F C;  2XVC A;  3W2V A;  4S04 A;  3S2H J;  3KP5 A;  3E97 A;  2QKM B;  4AIH A;  3VPR A;  2EA4 A;  1SVM A;  2DA7 A;  3QQA A;  3MWM A;  3L00 A;  2CS3 A;  1ZK8 A;  3K7A J;  1BJZ A;  3GCM A;  2YR2 A;  2HI3 A;  1G3T A;  2EIL H;  2XPV A;  3AG4 H;  3PIO F;  3F9K A;  4Q4Z F;  3TMO A;  2RAE A;  2IEK A;  4Y52 J;  2R5Z B;  3E7L A;  1G4D A;  3EPZ A;  1D1C A;  2YX7 A;  3S8P A;  2GBY A;  1X1D A;  4DYC A;  1K61 A;  1G2H A;  1TT0 A;  3CLO A;  5LFA A;  5H6R A;  2X51 A;  2VT2 A;  5ILU A;  4S05 A;  4M71 A;  2GIV A;  4B43 A;  1M1E B;  5EEG A;  1R22 A;  3SHF A;  3CCL I;  2R5Z A;  1QNT A;  1B59 A;  4N9I A;  2G7U A;  2Z2S B;  1YTY A;  4C3I J;  4F55 A;  5KCM A;  1JUS A;  4E70 A;  4XQF A;  3WGH A;  5B66 C;  1H0M A;  1ZN2 A;  2ZSH B;  4UUS B;  2BE5 F;  1Z7L A;  4BJT A;  1Q1V A;  3CUQ A;  3P5J A;  4GYI A;  1FLI A;  1FBU A;  1T95 A;  1TQM A;  2LG4 A;  2EQR A;  5E3L A;  4UV9 A;  1FY7 A;  2VUM J;  3SEZ A;  2WC2 A;  3BPV A;  2JTV A;  5EGO B;  2P7C B;  1L0O C;  4PJN A;  2OF7 A;  4DW6 A;  1SFU A;  4G6Q A;  3MZY A;  3KP4 A;  2VC1 A;  2X1C A;  4ABZ A;  1HSJ A;  4G8X A;  2OV7 A;  4ZYH A;  4AVZ A;  2BOL A;  2B7E A;  2LC2 A;  1MBE A;  3E5X A;  5FGM A;  1BI2 A;  4A3K J;  2JZY A;  3KX2 A;  3D1N I;  3F21 A;  4BBS J;  2FML A;  2DOF A;  1JJ6 C;  3VSL A;  2VKD A;  1TTY A;  4HRI A;  3BTJ A;  4KJZ A;  4CCK A;  2A6E F;  1HA8 A;  2R7T A;  5B1B H;  4G7H F;  2IA1 A;  3GF2 A;  4I6Z A;  2XPW A;  3ABL H;  2XPU A;  4L9J A;  4A3C J;  5C4J J;  1BC7 C;  4BU2 A;  3OYH A;  5IP9 J;  1FEX A;  2DDA A;  2DMP A;  2VKV A;  3ZMZ A;  5A2Q K;  1J5Y A;  1TW3 A;  1A31 A;  3OYE A;  2Y9Z A;  1S8N A;  2Z33 A;  4I0B A;  3H36 A;  3PIP F;  1J7K A;  3LSJ A;  1FOK A;  3C18 A;  3RPQ A;  3NEU A;  3V8K A;  2CV0 A;  1YW8 A;  5ILS A;  2XAS A;  3IKV A;  3CMM A;  1BJA A;  2BY2 A;  2CU7 A;  2MH9 A;  3TP0 A;  3Q0U A;  3GFM A;  1BR1 A;  1MNE A;  2Y2Z A;  4BEH A;  2W1O A;  3IAS 2;  3SDB A;  1AU7 A;  4M3B A;  1K78 A;  2V9K A;  3HM5 A;  4KIS A;  4I99 C;  5K7Z A;  5J1U A;  3FK6 A;  3DBH B;  3V42 A;  1TWG J;  5K7H A;  3COA C;  3WU2 C;  3ZMV A;  4QIW N;  1ETK A;  1GLN A;  1DGR M;  3NAU A;  4LIU A;  4X6A J;  3V7R A;  4BDY A;  1KGS A;  3KZI C;  2DN0 A;  3HYI A;  1TBX A;  1YHQ I;  1F1Z A;  2O0Y A;  2M0C A;  4P9F A;  4ENM A;  3K4C A;  1FPQ A;  2F5V A;  4BHP A;  2M4G A;  3H0G J;  2Z1D A;  4A3F J;  3MZH A;  4DIQ A;  4CGZ A;  1WI3 A;  3JAM K;  1D1A A;  3BZK A;  3A02 A;  2R7Q A;  3BG5 A;  3QYB A;  3S1R J;  3OYL A;  1N75 A;  4O5V A;  3QOD A;  1TWC J;  3FKJ A;  4XN3 A;  1YFH A;  4HAM A;  3ML6 A;  1X3U A;  1WJE A;  2LY9 A;  2B0L A;  4XLN F;  2CYY A;  2DFI A;  1A6Q A;  1VZ0 A;  2Y30 A;  5HLT A;  3PUF A;  2ZME C;  5E3N A;  1WCM J;  2IJL A;  1D0X A;  1Z0X A;  4ANJ A;  3BQY A;  4OMY A;  2O03 A;  2M8E A;  3ZR8 X;  4HST A;  1EV7 A;  2J5O A;  3OYB A;  2IBD A;  1B1B A;  4AIJ A;  3KPH A;  4IPA A;  2YPR A;  3BTC A;  3C2H A;  3KYD B;  4HNT A;  5M5Y J;  3JR9 A;  1BA5 A;  2OQG A;  5LGN A;  4IHY A;  3FXO A;  5AIP A;  2X6Y A;  2F4M B;  1MMG A;  1Y56 A;  2M45 A;  2KFD A;  2BW3 B;  2W24 A;  2XAQ A;  1R9T J;  1XSD A;  2BXY A;  3HSE A;  1XB4 A;  2NNN A;  3QP6 A;  4L5J A;  4AYB N;  1IRX A;  5FRO A;  4WXH A;  4LG3 A;  4KIT B;  1XGO A;  1IAW A;  3F8C A;  2I5U A;  2ACJ A;  3FX3 A;  2R7V A;  3IRR A;  3FF5 A;  4GGG A;  4UV8 A;  5LRR A;  3M4O J;  3CJQ B;  3MZ8 A;  3MD2 A;  2QBY A;  3CO6 C;  1GV2 A;  2DXI A;  1LKX A;  4CUG A;  2ICW G;  4A6E A;  2IS1 A;  3RZD J;  1FYK A;  1MH3 A;  4XLA A;  2IS4 A;  1K4T A;  2MG4 A;  2BXZ A;  2IT0 A;  3CP8 A;  2ECC A;  3ZQL A;  3ZQQ A;  2KIS A;  2LOO A;  5IP6 A;  2A68 F;  1XDU A;  2L5Q A;  2V1N A;  2NYX A;  1YRN A;  3W6K B;  5E3M A;  1PUF A;  1FWZ A;  4N4N B;  1V5G A;  3HPG A;  4PUS A;  2P5V A;  1IN7 A;  2DI3 A;  2EFP A;  1APL C;  4L9V A;  4BBR J;  3TO7 A;  2WB1 N;  1LFB A;  4BH9 A;  4MQ9 F;  1FSH A;  4V2F A;  5FO5 A;  1S5L C;  2GOM A;  9ANT A;  3U9G A;  3W6V A;  1X4P A;  3R60 A;  3U21 A;  1IC8 A;  2HDC A;  5GAG J;  1MZB A;  2VN2 A;  4CDG A;  2LLK A;  3I3L A;  4BAY A;  4U0V A;  3DU6 A;  3ZP5 A;  1FX7 A;  4D5F A;  3A01 A;  5CVJ A;  3O8H A;  2M2E A;  4RDU A;  3QWL A;  3FXM A;  1TWH J;  4CYC A;  3WTT C;  2WV0 A;  2QVO A;  4CXF A;  3RKQ A;  2DPU A;  2FRH A;  2BEO A;  3T8T A;  2NXN B;  4E7S A;  1ETV A;  1QZY A;  2D1H A;  1Z05 A;  3TO6 A;  2Q0O A;  3IH2 A;  2ISZ A;  1V5F A;  2ZJR F;  3QP5 A;  5JVT A;  1WVR A;  5E3O A;  5CVR A;  1S7E A;  1BL0 A;  3VOE A;  2HGC A;  1FMW A;  5DUI A;  2DMQ A;  1OPC A;  2ZBK A;  5EYR A;  2FA5 A;  1W0T A;  1I1S A;  2FF4 A;  3EUA A;  3GTQ J;  2VBX A;  5EG0 A;  2CUF A;  3KP6 A;  2K27 A;  3JAM Z;  2E60 A;  3AL0 B;  4MO7 A;  1ETQ A;  4LGW A;  3ZQG A;  1BOB A;  2DQR A;  3C3W A;  4RGU A;  3ZCO A;  2QEX I;  1F36 A;  3BR6 A;  4RA2 A;  5FKO A;  1MJ9 A;  4LIV A;  1CF7 B;  3CC2 I;  5ERI A;  1T56 A;  1XX5 A;  4UNO A;  3D5L A;  1R5I D;  4C3H J;  1WH7 A;  1G3W A;  2F4I A;  2EV6 A;  5EZG A;  3NWS A;  3UNG C;  4S0H B;  2WBM A;  2LSO A;  1I3Q J;  4EJT A;  2FNA A;  2XGD A;  3FHZ A;  3GW2 A;  3PM1 A;  5ED4 A;  1BR2 A;  2EFQ A;  2E1O A;  4BS9 A;  3FXQ A;  4XKC A;  4ZH4 F;  3CCR I;  2H8R A;  2O9L A;  1A04 A;  4BYY A;  1BN5 A;  2K40 A;  1FJL A;  2IGO A;  2CUE A;  3NAR A;  4AM3 A;  5C44 J;  1FZP B;  3K4N A;  1YX5 A;  4JYK A;  1AA7 A;  2EFW A;  4P1W A;  4IHV A;  3I5U A;  1TZL A;  4XLF A;  1SC7 A;  3O3K A;  5BPD A;  4L9N A;  3HTS B;  3CZ6 A;  4ESF A;  2GIZ A;  1SVO A;  3LSP A;  3RKY A;  2LNB A;  3SQN A;  4F91 B;  1ZRD A;  2LBF A;  3TED A;  1ZAR A;  3U1K A;  3ERE D;  5KNL A;  3JRA A;  2RN7 A;  2RKH A;  3OWT A;  1XMK A;  2A3S A;  2FSW A;  2I8D A;  3WU1 B;  5A2Q Z;  3CCU I;  2P6S A;  2LRE A;  2QZ8 A;  1IN6 A;  4OIR F;  1LJ9 A;  4PJJ A;  5K5O A;  2E2I J;  1XG1 A;  1IRF A;  4HV5 A;  5DD8 A;  3RYR A;  4BEH B;  3BJO A;  1JKR C;  1FBS A;  5HDK A;  4JX4 A;  1NH3 A;  4G12 A;  1WJB A;  4FCY A;  1U2W A;  1ZAO A;  3WTX C;  2KIF A;  1G3S A;  4M9Z A;  2D45 A;  4BXF A;  2DMN A;  4ZDP A;  5EGO A;  1IRZ A;  3E0J B;  4NDL A;  3U1D A;  1K6O A;  4F93 B;  1KON A;  4RLF A;  5FFX A;  1JKQ C;  3BZC A;  1MBH A;  2NOJ B;  2P5K A;  4E7Z A;  1BW5 A;  2LH9 A;  3J7Y J;  1EF4 A;  1B72 B;  1Z21 A;  1GVD A;  4HOB A;  3K4K A;  4WXC A;  2WAE A;  2KRF A;  2MGQ A;  3GZ5 A;  3WHC A;  2Y9Y A;  3LMM A;  1IXS B;  1CF7 A;  1QVU A;  1X3Z B;  1QPM A;  2Y0S N;  2H94 A;  1LNW A;  3S1N J;  2JA6 J;  1MDM A;  2XB0 X;  2L9S A;  2BY0 A;  5LLQ A;  2X9D A;  3OL4 A;  3T8R A;  4F92 B;  2A05 A;  5HLH A;  1OCT C;  1FSE A;  3IKT A;  3CD6 I;  4XRS G;  2Z9O A;  2RNG A;  2BHZ A;  2MH2 A;  2P5L C;  2W48 A;  5F0F A;  4YEL A;  3DKX A;  2L2O A;  2LVS A;  2R7R A;  1WJ5 A;  5D8K B;  3PNV A;  4G94 A;  1Y39 A;  1J9I A;  2R7F A;  3F72 A;  3T1B A;  3MKL A;  1MNM C;  1FMV A;  3OIO A;  5FLM J;  1JTX A;  1B72 A;  2M1B A;  2IS2 A;  3FMS A;  1RR7 A;  5LGU A;  4KUM A;  1U9N A;  2F5D A;  1Z1D A;  3KE2 A;  4J01 A;  4XR6 A;  3T5X A;  1B6A A;  2HU9 A;  4MHG A;  4UUT A;  1YIT I;  2IRF G;  2R7X A;  2EIN H;  3H5R A;  3KET A;  4HDU A;  2LF7 A;  2WB1 A;  1A36 A;  3E5U A;  3RQ4 A;  4LB5 A;  1IV6 A;  3WTZ A;  3HHH A;  4LFU A;  1TNS A;  3I53 A;  4JX5 A;  1D0Y A;  4EM1 A;  3GVA A;  3CJT B;  4IXA A;  4AUX A;  4DBR A;  1SAN A;  2FX0 A;  3JSO A;  1MSF C;  5H20 A;  2OJE D;  4ZTJ A;  3L2C A;  1LB2 A;  2QQ8 A;  4IHW A;  4LG0 B;  2R7S A;  4IRG A;  2KKO A;  2FQ4 A;  3CUQ C;  3SEQ A;  3GYH X;  5JLX A;  1QO0 D;  3LSI A;  3CF5 F;  3VYR B;  2VOP A;  3F8F A;  4QSH A;  3I4M J;  1Y1V J;  4MEX F;  5J1R A;  2R4G A;  1R1T A;  3BT9 A;  4PGG A;  4U88 A;  4EAT A;  2ID6 A;  1RUN A;  3S16 J;  4M6X A;  2Y31 A;  3M1E A;  3CTA A;  3J7A Y;  4KIC A;  3N97 A;  2R7O A;  3JCU C;  5ICG A;  5CPR B;  5F1J A;  2V6E A;  5FRN A;  2LR8 A;  1MMS A;  5F6F A;  3M1C A;  4A3J J;  3DPL C;  3QPT A;  3HJE A;  4AD9 A;  5D8L B;  3JTG A;  2VQL A;  1ONV A;  4NC7 A;  3A0B C;  3HRT A;  2AHQ A;  4OMZ A;  4OWR B;  4A3L J;  1OJL A;  1Y8Q B;  3HPH A;  4XLP F;  5FD5 A;  3HOY J;  3OYC A;  2V7F A;  3I59 A;  4FX0 A;  3EUH A;  4XKW A;  3SDG A;  4RBO A;  1S7A A;  1T6S A;  4OAY A;  5CQE A;  3CCE I;  5E1Z B;  1ULY A;  3AG1 H;  1UB9 A;  1BOA A;  1IW7 F;  4HDV A;  2A5Y B;  3A4C A;  2GOX B;  1O7F A;  3KP7 A;  2DW4 A;  3KYL A;  2A6T A;  4A5N A;  2M7B A;  1XSV A;  2JSP A;  2P8T A;  3MAJ A;  4MNU A;  3V7S A;  4ENK A;  1ERD A;  2Z99 A;  2DYR H;  3KFW X;  3B73 A;  4MQV A;  1YQA A;  2MAB A;  1PUE E;  3IWF A;  2P7V B;  4X1E A;  1WPK A;  1D5Y A;  4G7O F;  4Q5S F;  2RRE A;  3RSN A;  1ETX A;  4UB6 C;  4XLC A;  4B3A A;  1IUF A;  2DAO A;  2Z5U A;  3MCZ A;  4XRS A;  1OKR A;  2HTJ A;  3HXL A;  2KDO A;  4LLN A;  1UHS A;  3G73 A;  1IN5 A;  1QQI A;  2MLG A;  4D7N A;  1TWA J;  4XRM A;  3LA3 A;  1UST A;  1WJF A;  4IOA F;  4RS8 A;  3MFK A;  3AG2 H;  5HNF A;  3KP3 A;  1F43 A;  4FX4 A;  2K7L A;  1WSU A;  5DM6 F;  3DEE A;  2HVS A;  3H5N A;  1B4A A;  1VQL I;  3M8F A;  4II3 A;  4M6V A;  5M5X J;  1HOM A;  2JRT A;  2H6B A;  4L18 B;  1QZE A;  2E1M C;  4B8X A;  1DUX C;  4CCO A;  1HKS A;  1R5H A;  3ZMU A;  3GTM J;  4XKV A;  5B3S H;  1VF9 A;  3OS0 A;  3FMQ A;  3KYC B;  4J19 A;  1W5T A;  4A93 J;  1YRN B;  2EH3 A;  1STZ A;  2IGM A;  2V6C A;  2IGN A;  5L3C A;  4JBA A;  3JRG A;  3ELK A;  1ENH A;  3GME A;  1AWC A;  4A3E J;  1WZ2 A;  4ENN A;  3OYD A;  4HYE A;  1W36 C;  1XN7 A;  4CCM A;  2JQ7 A;  1ZEL A;  1ODD A;  1OIS A;  2F5C A;  2WWY A;  2ZJQ F;  1QBJ A;  2DTR A;  2JA8 J;  2R7D A;  4LJZ F;  1PDN C;  3DBL B;  4IX7 A;  2ZSI B;  1XD7 A;  3PO2 J;  1T98 A;  5FLX K;  4BE0 A;  5D6F A;  4WXD A;  3DWL E;  1I27 A;  4KIG A;  2EIJ H;  2L7K A;  2X4H A;  3LOC A;  3BR0 A;  3M7G A;  1FTT A;  4JP0 A;  2BGC A;  4RGX A;  2VJ5 A;  2MD0 A;  3JRI A;  1V55 H;  3TP3 A;  3GFJ A;  3BC8 A;  4UHT A;  3ZQF A;  2NAZ A;  5DTD A;  1S9H A;  1TP4 A;  2VB6 A;  3E6B A;  5ILV A;  1ZG3 A;  2W25 A;  3G1O A;  4I01 A;  3KP2 A;  5D4R A;  4HA8 A;  4ZJZ A;  2OTJ I;  3S32 A;  1AKH B;  2ID3 A;  2PEX A;  3GTG J;  2O8X A;  2DJI A;  1U0J A;  2GA1 A;  1UEL B;  3WTU C;  4AC0 A;  3ONQ A;  3J80 K;  4DJA A;  3HEF A;  3CCY A;  3H9J A;  3LQQ A;  5BQT A;  3H9Q A;  4EM0 B;  3I64 A;  1JJ8 C;  1RKW A;  4CCL A;  1EA3 A;  1PUF B;  5FKK A;  2A69 F;  2Y48 A;  1ETW A;  1I6X A;  4ESB A;  3EYY A;  2E35 A;  4XOR A;  3J7A O;  2V1D A;  1OQY A;  4UUS A;  4MTD A;  3DEU A;  4EEF G;  5IY5 H;  4D5C A;  1W5S A;  2LKP A;  3G6E I;  1VI0 A;  3PSF A;  1LPQ A;  3LL7 A;  3ZMS A;  3HRS A;  2DFH A;  4GCV A;  2XF5 A;  3MN2 A;  4YFX F;  3SZT A;  4B48 A;  1QHH D;  3LQR A;  3BG9 A;  3SFZ A;  3DU5 A;  2HOA A;  2FEZ A;  4XMY A;  4KMF A;  2G7H A;  3NRV A;  2M4K A;  2KIQ A;  2ETH A;  2HWV A;  2QSG X;  1QHG A;  5JI6 A;  2HOE A;  1K7A A;  5DDG A;  2KZG A;  4F3Q A;  2YX4 A;  3DTK A;  1U8R A;  2H1L A;  4UXN A;  1CQT A;  4BQN A;  3K6G A;  4ZC3 A;  2X6O A;  5K5R A;  2G9W A;  2HKX A;  1IJW C;  3L2R A;  4E6K G;  3JRE A;  1USS A;  5GTI C;  1BI0 A;  4RLQ A;  2CUJ A;  4AVP A;  5IT3 A;  3K4M A;  4EGY A;  4IKF A;  4XK4 A;  4NHJ A;  4ZYE A;  3OS2 A;  2IP2 A;  3W3C A;  1V54 H;  3FHN A;  2KIM A;  1VQ8 I;  3HZJ A;  3ZN0 A;  3RQI A;  2L7F P;  2HOS A;  2HKO A;  1D3Y A;  4PZJ A;  2VLA A;  3KEO A;  1FYL A;  2FBH A;  2HXO A;  3S1M J;  4E7J A;  4FT8 A;  5LHG A;  1K79 A;  1QZZ A;  4BQA A;  2FBK A;  1XTA A;  5HDN A;  3TDU C;  3FWE A;  2O6G E;  1V3F A;  5J1Y A;  4M9S A;  2VKH A;  4U0W A;  3LFK A;  2K85 A;  4ITV A;  3LSG A;  1KU2 A;  1GDT A;  1KA8 A;  1FOW A;  4UVC A;  2L01 A;  2P81 A;  3DQV C;  1D8K A;  2QUF A;  2VAS A;  4GRI A;  1O3R A;  3AKZ A;  1J59 A;  2XF7 A;  2HS5 A;  3QU3 A;  3I54 A;  3PL8 A;  5GPA A;  2O7O A;  3OL3 A;  1RR8 C;  3HGG A;  2ZJP F;  1LUJ B;  2QYO A;  2ESH A;  1IRG A;  5LBQ A;  4O3M A;  1E3P A;  3JRH A;  1HXD A;  1ZRE A;  1BI1 A;  3DPT A;  1YYV A;  2O8K A;  2GWR A;  2FQ3 A;  1JUP A;  1Z67 A;  2Y75 A;  3ABU A;  1W0U A;  2K02 A;  2OTL I;  4MIM A;  4HQE A;  2MYS A;  2GLO A;  3ABT A;  1T0F A;  4ZTF A;  3GTK J;  3UKG A;  2K9L A;  3PJR A;  3H3V K;  2E1N A;  2ZB9 A;  4DZJ A;  2NVQ J;  1G8X A;  1U9O A;  3G2B A;  3TW6 A;  4IJA A;  4KFC A;  4MTE A;  3GUD A;  4BNC A;  5E1X A;  4UB8 C;  4JK1 X;  4LK1 F;  1PP8 F;  1R4N B;  4Q48 A;  3FBN B;  5FD6 A;  3DKY A;  2PN6 A;  1W4M A;  1XSX A;  2CJJ A;  2HFH A;  1IXC A;  2V9V A;  3B6A A;  1WH5 A;  2LF8 A;  3ASN H;  2OZU A;  4BHC A;  4RB1 A;  3BTI A;  4IHX A;  1MBJ A;  2HZD A;  2DOA A;  2QQB A;  4I2O A;  4HW0 A;  2VQH A;  3HOU J;  3MKW B;  1KZH A;  4MFE A;  4D7M A;  1HLV A;  5E17 F;  3IV5 A;  4LG0 A;  1VQ9 I;  4D9J A;  2FBI A;  1POG A;  3HDD A;  3F6V A;  4IHT A;  5JFR A;  1I3A A;  1Q1H A;  3FK7 A;  3H9G A;  4ZZL A;  3AAF A;  1VQ6 I;  5J6X A;  2VJJ A;  4IHS A;  3V8L A;  3F23 A;  4AIK A;  3S14 J;  2L3D A;  2CW0 F;  4HPQ A;  1S7O A;  2ZC2 A;  2MW8 A;  2EPF A;  1EH7 A;  3N4M A;  4LD5 A;  1R1V A;  2ZME B;  2KRH A;  1B9N A;  2WY7 Q;  2L7Z A;  1FYM A;  2KT0 A;  4IEJ A;  2CV1 A;  1FC3 A;  2H8W A;  4NQW B;  5M3F J;  1G6N A;  3CUO A;  3OYF A;  3K2A A;  1H8A C;  2R93 J;  2AXL A;  2PJR A;  1TNT A;  2XSD C;  1OYI A;  4ASN A;  5KAI C;  3K70 D;  4G7Z F;  4Y3O A;  4GO1 A;  3ASO H;  1ZG5 A;  2BVL A;  3L2V A;  1SAU A;  2HZT A;  1I5Z A;  4BJ6 C;  1T08 B;  3V8J A;  3BR2 A;  2LK2 A;  3RPU D;  3ZMD A;  4PJ0 C;  4YG2 F;  3CDI A;  1IZ1 A;  3K4B A;  2K9Q A;  2DK5 A;  2TRT A;  1UHW A;  3RIR A;  3ZN1 A;  2FD5 A;  3ABM H;  2PQ8 A;  2E34 A;  2K3P A;  4X0G A;  1QPI A;  1ZGW A;  5HS9 A;  3K1P A;  4FE4 A;  4A3D J;  5HLI A;  5AON A;  2NVU B;  2ZXW H;  5L3B A;  3G1L A;  1U78 A;  1JGS A;  3JRB A;  1EH6 A;  5M3M J;  2ZFW A;  1N78 A;  3P9I A;  4I98 B;  3O6B B;  1ORK A;  2OPT A;  3VYS B;  1BM9 A;  1WI9 A;  3WTV C;  4PCQ A;  4A3M J;  5F04 A;  4CYD A;  2ZO4 A;  2A6H F;  5EG0 B;  1T8I A;  1HBX G;  4NC6 A;  1REP C;  1I1G A;  3S3O A;  2AQE A;  3I4P A;  5HOO A;  1U5T A;  5GAE J;  3SZG A;  1ZRF A;  1D5V A;  5DCM A;  4XSX F;  3M9A A;  1Z7U A;  1DU0 A;  4A3G J;  1KU3 A;  3FKI J;  2D2W A;  1QVT A;  1Z3X A;  4FAS D;  2Z3Y A;  5J3L A;  2UXN A;  1VQP I;  2PMZ A;  5FLV A;  1NHA A;  1HC8 A;  3OYG A;  4HX4 A;  1IG7 A;  2OBP A;  3CC4 I;  3ECH A;  1HKT A;  1YJW I;  4G6T B;  1UG2 A;  5ICF A;  3GFI A;  2FE3 A;  3RTR A;  2BV6 A;  2PMH A;  4KIF A;  2L9V A;  4CH7 A;  1W5C C;  4MEY F;  3Q3S A;  4BQO A;  4ZYD A;  4BXX J;  3RZO J;  1LDK B;  2NRA C;  1LE8 A;  4XID A;  3BG7 A;  1B8I B;  1KU7 A;  4A3I J;  3S15 J;  4IOC F;  2VC0 A;  4BKX A;  2UZK A;  2XAU A;  2KPM A;  2VL8 A;  3LSM A;  3I56 I;  1UZC A;  3SYT A;  5D5X B;  4CSW A;  1WKM A;  3JRD A;  3OY9 A;  1ETY A;  2Q8K A;  3LSK A;  5FKL A;  3ABK H;  2X6W A;  1FIA A;  1MW7 A;  2VT3 A;  2EV5 A;  4N4O B;  5HS7 A;  2CFX A;  4IRH A;  3WE3 A;  2EZL A;  4W1U A;  1W7P B;  1TLH B;  1X3W B;  3ROU A;  1ACI A;  2JT1 A;  1ZGA A;  3KCC A;  2JK3 A;  1HDD C;  2LTP A;  4B3X A;  3GXO A;  3K69 A;  2XRL A;  3S17 J;  3BR5 A;  2L9R A;  4MLO A;  2ZJ2 A;  3CMY A;  2K9N A;  1P7J A;  2X0L A;  2EA2 A;  4PK4 A;  3BJA A;  4YFK F;  3PFI A;  3VYT B;  4KMU X;  1BBY A;  3IAM 2;  2L4M A;  4I09 A;  3KZY A;  1X4O A;  4RB2 C;  3T0Y A;  1VND A;  1ZHF A;  2L9N A;  2XAJ A;  2RC4 A;  3K2Z A;  4M74 A;  4N9H A;  3G71 I;  4H4K C;  3SFI A;  4UY8 I;  3QPS A;  1YJN I;  5FFZ A;  3ZQ7 A;  1KQ0 A;  3HL2 A;  2LRD A;  2VOD A;  5HDG A;  3Q9V A;  3S3N A;  1WJA A;  2XRN A;  4QWQ A;  4OOI A;  3O2P E;  2BY3 A;  3G1M A;  3GBG A;  4J00 A;  2OD5 A;  1RPW A;  2EZH A;  3PSI A;  3L1P A;  3DBR B;  4BGD A;  3C2B A;  4U7D A;  4IQJ A;  2XAF A;  4WF2 A;  4HSR A;  1LEA A;  4C30 A;  3TDZ C;  1Y0U A;  3BLY A;  4Z6Y A;  4HNU A;  2NS0 A;  1MND A;  2DBB A;  5JHU A;  2CSO A;  1R6R A;  3IC7 A;  2FXA A;  3KZZ A;  3S1Q J;  5IYB J;  5IT9 K;  2AO9 A;  1E3O C;  1ZYR F;  2LY1 A;  5DCM B;  4K2E A;  4LOC A;  1FBQ A;  2M9H A;  1XS9 A;  2M3A A;  3X2Q H;  1N25 A;  3C1D A;  1UCR A;  2PLY A;  4EV0 A;  1RUO A;  3LNQ A;  1JHF A;  5LHI A;  1D0Z A;  2Z16 A;  3FXJ A;  4XL9 A;  4CHU A;  3BG6 A;  3MQ0 A;  1OLT A;  5BOX A;  2DQL A;  5D5V B;  4E7K A;  2DA5 A;  1H89 C;  5IPA A;  5EEH A;  4EM2 A;  4RM3 A;  3HOX J;  1IUY A;  3QPL A;  5GP9 A;  3I59 B;  3S3M A;  2DT6 A;  4EGZ A;  2RGV A;  1HW2 A;  5ICC A;  1LDD A;  3GTL J;  3TOA A;  3A01 B;  3A2K A;  4O6J A;  4GYG A;  2V1U A;  2KIU A;  4NUB A;  4A2U A;  3CDL A;  2GXA A;  5EEA A;  2UXX A;  4RB3 C;  2LMD A;  1SD7 A;  2JVG A;  1EJ9 A;  1MBG A;  1U5T C;  2IAI A;  5J8C A;  2E5Z A;  1DP7 P;  4RGS A;  4PJM A;  2PJP A;  5CVI A;  3F22 A;  3G3Z A;  5IOZ A;  2XHK A;  5KHD A;  2D5V A;  4XLH A;  4KN4 X;  2ZXI A;  1S72 I;  1YS6 A;  2K86 A;  2WAF A;  3HKZ N;  3TBI A;  2EIK H;  1YIO A;  2IA2 A;  1FTZ A;  2RQP A;  3S93 A;  4H0E A;  1LFU P;  3M3Y J;  4ZDO A;  2Q2E A;  4R79 A;  2XDV A;  5K5Q A;  5DM7 F;  2STT A;  4YII A;  3TO9 A;  4HG2 A;  3OYJ A;  5L3D A;  3CCJ I;  3R0A A;  2COB A;  4ETS A;  1E3H A;  5K1Y A;  1F5T A;  4XLE A;  4RMN A;  4KIB A;  2HQA A;  3J80 Z;  3F3X A;  3WTS C;  2DMT A;  4QTR A;  4WWC A;  1RET A;  2M5W A;  1XDS A;  1I39 A;  3KIO A;  3WG7 H;  3LST A;  5E20 A;  1R00 A;  2ZNZ A;  4BL0 B;  3L09 A;  4EJU A;  3CF2 A;  5DYM A;  1G59 A;  1F4K A;  1GV5 A;  1DDN A;  3QRF F;  5LHH A;  2KZV A;  5L3F A;  2DPD A;  3PFY A;  4I76 A;  5BS6 A;  3BQZ A;  4FQG A;  5IP7 J;  1HCR A;  2W00 A;  2E5N A;  4B1R A;  5L3G A;  2CQN A;  2K3F A;  4ZZD A;  1JHH A;  1A35 A;  3O8G A;  1KQ8 A;  2XB5 A;  1JKP C;  1B8I A;  3OIP A;  4C2M J;  4XIC A;  2V4J C;  5JHF A;  1ETO A;  5M5W J;  1SFO J;  1WRJ A;  4RAY A;  2GXB A;  1BC8 C;  3JSP A;  5FLX Z;  3JRC A;  2UUZ A;  2CUZ A;  1XCB A;  3DP7 A;  1R49 A;  4D1Q A;  1MGT A;  1X19 A;  3DLL F;  4IRI A;  1IXR C;  3OIQ A;  4PFP A;  4ZYG A;  3OYM A;  2W84 A;  4M73 A;  3V7C A;  2X85 A;  2L54 A;  3JW4 A;  1QGP A;  1NTC A;  3FZV A;  1Z3Y A;  4XON A;  3VWB A;  2HQR A;  3IL2 A;  3WGG A;  2M30 A;  3FXU A;  1U8B A;  3QU6 A;  5LRS A;  1OCP A;  2LKX A;  1H9G A;  1WHU A;  1W7P D;  4IQ4 A;  1SMT A;  1JT6 A;  3I58 A;  1MDM B;  1JKO C;  3AL0 C;  1T38 A;  1YG2 A;  2JPC A;  2W82 A;  3GTO J;  1W7P A;  4GDF A;  3HBL A;  4BJ5 C;  2JRM A;  2HVR A;  1VQO I;  2OCC H;  3RKW A;  3OSF A;  1A6I A;  2X1E A;  1Z6R A;  3CQZ J;  4RAG A;  5D6E A;  3HOV J;  2CH0 A;  1U5T B;  1FP2 A;  4R8H A;  3NQO A;  1TQP A;  5J40 A;  3EDP A;  4D0P A;  3DXJ F;  4OAZ A;  1Z9C A;  2GM4 A;  4ZYA A;  1TQI A;  2MLK A;  2RNJ A;  5DS9 A;  4XOT A;  1UG0 A;  2R7Z J;  2W4S A;  2PMU A;  2M34 A;  2Y0S A;  5KK1 A;  3SJM A;  3M07 A;  2M87 A;  2VBW A;  3GTP J;  4PSW A;  3ZPL A;  5HS8 A;  2HEO A;  1MH4 A;  1R71 A;  5J8F A;  2KRC A;  4LK0 F;  4RM2 A;  3IRQ A;  3CO7 C;  5E1W A;  2PBI A;  2B63 J;  3ULQ B;  1PP7 U;  2X48 A;  2K4J A;  2ZXJ A;  3BPX A;  4KT6 A;  4RAF A;  5CJ9 A;  1QU3 A;  1O3S A;  2HQN A;  3WTY C;  2E1C A;  2K4B A;  1ZRC A;  2M0M A;  4EMS A;  2I10 A;  2XGE A;  2DDB A;  1OCZ H;  4YIF A;  2YU9 J;  1S3J A;  4P9U A;  1P4X A;  2COM A;  4FTH A;  3KLN A;  5D5U B;  4OIN F;  1HQC A;  4ENJ A;  2G0E A;  5B5E C;  1XGN A;  1IN8 A;  4NQW A;  2W57 A;  5JR3 A;  3CCQ I;  3ZGK A;  4C2T A;  1R1U A;  2TDX A;  3MMY B;  2MA3 A;  1V4R A;  5LEJ A;  3GLL A;  2H27 A;  2HPM A;  2EV0 A;  3HC7 A;  4YRV A;  1QRY A;  3FXK A;  1XCV A;  2GA2 A;  3HTU A;  1IDZ A;  2QA4 I;  1YLF A;  1ZLJ A;  5BPI A;  2W85 A;  4XNF A;  1ZG1 A;  1OMI A;  2QSF X;  1HST A;  5J4V A;  3DFG A;  2ELJ A;  1P4W A;  3BG3 A;  2KQR A;  4PDK A;  3HKZ A;  1IO2 A;  3GFL A;  2OU2 A;  3HSR A;  1Y8R B;  3SZP A;  4YFN F;  1K83 J;  3C2G A;  1T2K A;  1D8J A;  2ZKZ A;  2CG4 A;  3VFZ A;  5EJC A;  1ON2 A;  1SMY F;  4KDP A;  3DF8 A;  1NK2 P;  1JI8 A;  1MMA A;  3PQK A;  2MD5 A;  1H9T A;  1OR7 A;  2VE8 A;  3GO5 A;  5DUK A;  4M6Y A;  1VQ5 I;  3EYI A;  1PJR A;  3M8J A;  4A6D A;  1X2N A;  3E6D A;  3BTL A;  2VON A;  2HTS A;  1P6R A;  3CCV I;  1VTN C;  3AFH A;  2R5Y A;  1VQK I;  4EJO A;  1Z91 A;  5GAH J;  4I7H A;  3HUG B;  3D5S C;  1BW6 A;  4AYB A;  2CQK A;  4B4C A;  2RDP A;  2E19 A;  3J81 K;  4A0X A;  5IT9 Z;  1AOY A;  3HOT A;  4JQF A;  2R7W A;  5H2F C;  4RB0 A;  4BXU A;  2QLZ A;  1X1P A;  2FU4 A;  4L5E A;  1FNN A;  4CIC A;  1MSE C;  2VI6 A;  2CO5 A;  1KQ9 A;  5EZH A;  3MKY B;  4IO9 F;  4V19 K;  3B02 A;  4JX6 A;  4AU7 A;  4CCJ A;  1DGW Y;  2PFB A;  3FMR A;  4FIS A;  4Y4R A;  2DFE A;  2XKO A;  1SFE A;  2EBI A;  1WFX A;  1TC3 C;  1WJD A;  4GXO A;  1N77 A;  1OYY A;  2IS6 A;  1X1A A;  1WJC A;  5EDN A;  4HLY A;  1JE8 A;  3HOS A;  3K10 A;  4NBQ A;  1F9N A;  1AHD P;  1RRJ A;  3CJR B;  3L2W A;  3CP2 A;  5IYD J;  4UVB A;  2LP0 A;  3PQJ A;  4XRF A;  1MMN A;  3H35 A;  3HB9 A;  1HW1 A;  3IH4 A;  4G9Y A;  2WAQ A;  2QKL B;  1R4M B;  1HDP A;  2CV2 A;  3TKY A;  3R4K A;  4XOP A;  1Z6T A;  4I0A A;  3I71 A;  3GTJ J;  1W1W E;  5IYC J;  3HUG A;  2JA7 J;  1O3T A;  2KL4 A;  5K7F A;  1SFK A;  3CCM I;  1LDJ A;  5BNG A;  1R7J A;  2IGK A;  4E7L A;  1YJ9 I;  2F5F A;  3FXR A;  1O3Q A;  3ZRG A;  3K1M A;  3QOE A;  4CYC B;  4HF2 A;  1YS7 A;  2PX9 A;  1BIA A;  4GFB A;  3LA2 A;  2LDU A;  2XF6 A;  5C3E J;  2HQ5 A;  2K5C A;  2BBY A;  4L0Y B;  1RIO H;  1DPU A;  4B44 A;  3H92 A;  2VQC A;  2ZME A;  5BMZ A;  1S6L A;  3LA7 A;  1LQ1 A;  3ESW B;  3AG3 H;  1RZ4 A;  2DK8 A;  2WAD A;  3VSK A;  3R6S A;  5E79 C;  2CQ7 A;  4MGR A;  3TL4 X;  3OV8 A;  1PYV A;  4C2U A;  2VPR A;  2LFB A;  2F2E A;  2XAG A;  2WY8 Q;  3FM3 A;  1JT0 A;  2Q2E B;  2K9M A;  1SEU A;  4BY1 J;  4DNC A;  3HSF A;  3F0C A;  2HYG D;  2CQQ A;  3EQL F;  3LFU A;  3CES A;  1ZQ3 P;  2HPI A;  1P9Q C;  2GAU A;  2JUG A;  2IXS A;  2DA6 A;  1IDY A;  3K70 C;  4HZF A;  3TW7 A;  3DTI A;  2P6T A;  2R92 J;  3KLO A;  3WU0 A;  2H09 A;  1O4X A;  1YW7 A;  2KHM A;  3RCO A;  3FIS A;  4Z2Y A;  5C4X J;  5J4Y A;  2IPQ X;  1B9M A;  2LKS A;  2VKE A;  3BWG A;  4HLX A;  4PSX A;  4EJV A;  4IZZ A;  1NG6 A;  3K9T A;  2TCT A;  3GEZ A;  3CME I;  2R7U A;  2XGC A;  2B9S A;  2A5W A;  2YSR A;  1RI7 A;  1ZKG A;  2O3F A;  1WGX A;  3ERM A;  4XBF A;  1J0R A;  2FUG 2;  2MFZ A;  1Z77 A;  1I6H J;  4BAC A;  4HBL A;  3PNY A;  1TT5 B;  2LY2 A;  1R23 A;  2R3S A;  1LE8 B;  4TV7 A;  1U6G A;  2CQX A;  4OIP F;  3OYI A;  3IUO A;  2L4A A;  2E7X A;  1J75 A;  5CLS A;  5F0C A;  2KJB A;  2RQQ A;  4IVN A;  3H0D A;  5F1R A;  2STW A;  2PMZ N;  2L7M P;  4A69 C;  3OOU A;  2OUM A;  1VQN I;  4LB6 B;  1X1B A;  3N05 A;  1FOY A;  1ZLK A;  5GAD J;  3ZQI A;  1H88 C;  4PGH A;  3RYP A;  3BY6 A;  2QCO A;  1J09 A;  1C0W A;  2V79 A;  4P55 A;  1ZR2 A;  1YE9 A;  2FMY A;  4JOM A;  3WHB A;  2CGP A;  4QPQ A;  1MKM A;  3P9C A;  3KEY A;  4HF0 A;  5E8I A;  1XMX A;  4AID A;  3P9K A;  2M8G X;  3V4G A;  3LAP A;  4DOZ A;  5JVG F;  4P5O A;  4YIR X;  3R0J A;  3C7J A;  3IP4 B;  1XGS A;  1G3Y A;  2EB7 A;  1E2X A;  2FOW A;  1RNL A;  1X1C A;  2DO7 A;  2LD5 A;  3I4N J;  2JUC A;  5HVQ C;  3MKZ A;  3WG9 A;  1D1B A;  4MFD A;  2ELH A;  3E1S A;  4M72 A;  1JGG A;  1FT9 A;  2RV8 A;  2ELK A;  2P4W A;  5CQG A;  4M3F A;  2DFF A;  2VXZ A;  3H3Z A;  3CJN A;  5TIS C;  1WQ2 A;  2YS9 A;  2OQR A;  3FBI B;  4EQQ A;  2KJC A;  1X2M A;  1Y6I A;  2N8G A;  2E7W A;  1ZH5 A;  2PI0 A;  1YW9 A;  3OS1 A;  1T39 A;  2Y69 H;  4PFO A;  1DU6 A;  3BCA A;  1RC9 A;  3K1N A;  1DP3 A;  2E2H J;  1IGN A;  4UVA A;  4LMY A;  2E2J J;  2V26 A;  2VQG A;  2V9P A;  4XKB A;  1MJB A;  1TW2 A;  3Q9S A;  2ME0 A;  3ZQC A;  1K78 B;  3OYK A;  4A0Z A;  3PUB A;  4RGR A;  1MBK A;  1JTY A;  1LFP A;  2ZNY A; 
#chains in the Genus database with same CATH homology
 1F43 A;  3S2D J;  3LNQ A;  3LSJ A;  5FKM A;  1GUU A;  4M6V A;  2DTZ A;  5M5X J;  2CU7 A;  1UMQ A;  1HOM A;  3TP0 A;  1OFC X;  2DA5 A;  3Q0U A;  2NVT J;  1H89 C;  5IPA A;  2Y2Z A;  3HOX J;  3QPL A;  5GP9 A;  3GTM J;  1AU7 A;  4M3B A;  1VF9 A;  4Y7N J;  3GTL J;  5FJ8 J;  4J19 A;  4A93 J;  3HM5 A;  1YRN B;  5K7Z A;  5J1U A;  3A01 B;  3FK6 A;  1TWG J;  5K7H A;  2EH3 A;  3CDL A;  4C3J J;  3JRG A;  1XC5 A;  4QIW N;  1ETK A;  5EEA A;  1ENH A;  4A3E J;  3NAU A;  4X6A J;  2DN0 A;  1MBG A;  2IAI A;  2WAQ N;  5F0H A;  2JA8 J;  2M0C A;  5IOZ A;  2EZI A;  3PO2 J;  5HOD A;  3H0G J;  4A3F J;  2D5V A;  1WI3 A;  3HKZ N;  3A02 A;  3BR0 A;  3BG5 A;  3LOC A;  3S1R J;  1FTT A;  4JP0 A;  1FTZ A;  2NOG A;  1TWC J;  1LFU P;  3M3Y J;  4DZP A;  3JRF A;  3JRI A;  3TP3 A;  2HYJ A;  3ZQF A;  1MBF A;  2LY9 A;  5DTD A;  2COB A;  4A3B J;  3G1O A;  1AKH B;  2Y30 A;  2ID3 A;  3GTG J;  2DMT A;  4QTR A;  5E3N A;  1WCM J;  1RET A;  1Z0X A;  3BQY A;  4AC0 A;  1T33 A;  4BY7 J;  3HEF A;  3CCY A;  1GV5 A;  1JJ8 C;  2IBD A;  1RKW A;  4I76 A;  1JUM A;  5IP7 J;  3BQZ A;  1HCR A;  2NS8 A;  3BTC A;  5M5Y J;  3JR9 A;  1PUF B;  1BA5 A;  4B1R A;  3Q0V A;  5FKK A;  1ETW A;  4IHY A;  3O8G A;  2XB5 A;  4UUS A;  1JKP C;  1B8I A;  2WV1 A;  4C2M J;  4XIC A;  1SFO J;  1ETO A;  5M5W J;  1R9T J;  4EEF G;  2DA2 A;  4D5C A;  3JRC A;  4AYB N;  1VI0 A;  1ZR4 A;  2JMW A;  4DYR A;  2FJ1 A;  3MN2 A;  1RES A;  3BG9 A;  2HOA A;  1NTC A;  2K9S A;  3M4O J;  4W97 A;  5IOY A;  4M3E A;  1U8B A;  1GV2 A;  1OCP A;  2LKX A;  3RZD J;  1JT6 A;  1MH3 A;  3PO3 J;  1CQT A;  3DEW A;  1JKO C;  2X6O A;  2DJN A;  2EZK A;  3GTO J;  2MG4 A;  1IJW C;  3HBL A;  3ZQL A;  2ECC A;  5JLW A;  3JRE A;  2R5Y B;  5IP6 A;  3OSF A;  1A6I A;  2KDZ A;  1YRN A;  5E3M A;  3CQZ J;  3HOV J;  1PUF A;  4XK4 A;  5F27 A;  1FIP A;  1APL C;  4BBR J;  2WB1 N;  1LFB A;  2GM4 A;  2HOS A;  3RQI A;  2L7F P;  5DS9 A;  4V2F A;  1P7I A;  2QF7 A;  2R7Z J;  2HXO A;  9ANT A;  3S1M J;  2M34 A;  3SJM A;  2HOT A;  3W6V A;  1IC8 A;  3GTP J;  2L0K A;  5J1Y A;  2LLK A;  1I50 J;  1MH4 A;  3LSG A;  1GDT A;  4D5F A;  3A01 A;  2B63 J;  3O8H A;  2P81 A;  2M2E A;  4RDU A;  4CYC A;  1TWH J;  3RKQ A;  2X48 A;  1ETV A;  5GPA A;  2O7O A;  2HDD A;  3HGG A;  3IH2 A;  3ZOB A;  2HXI A;  4DYQ A;  3JRH A;  5E3O A;  2I10 A;  2DA3 A;  2XGE A;  1S7E A;  1BL0 A;  3BR1 A;  2O8K A;  2DMQ A;  2YU9 J;  5EYR A;  1W0T A;  1JUP A;  3A03 A;  1W0U A;  4FTH A;  4MIM A;  2GLO A;  3GTQ J;  4HNV A;  5EG0 A;  2CUF A;  3GTK J;  4MO7 A;  2G0E A;  3UKG A;  1ETQ A;  3ZQG A;  3H3V K;  2ZB9 A;  1F36 A;  3B6C A;  3BR6 A;  5FKO A;  4DZJ A;  1VFC A;  2NVQ J;  1U9O A;  1T56 A;  3HOW J;  3TW6 A;  4C3H J;  1WH7 A;  5EZG A;  1QRY A;  4S0H B;  1NK3 P;  1IDZ A;  1I3Q J;  2XGD A;  3PM1 A;  2CJJ A;  2JA5 J;  2O9L A;  2E1O A;  2H8R A;  3B6A A;  1WH5 A;  3BG3 A;  2K40 A;  3BTI A;  1FJL A;  1HF0 A;  4IHX A;  1MBJ A;  3HGY A;  2CUE A;  3NAR A;  5C44 J;  3LSR A;  3HOU J;  4JYK A;  3HOZ J;  1K83 J;  4MFE A;  2DMU A;  4D7M A;  1HLV A;  4IHV A;  1ITY A;  3IV5 A;  3HDD A;  1POG A;  1RKT A;  3OSG A;  1NK2 P;  4V2G A;  3FK7 A;  4FE7 A;  3LSP A;  3S14 J;  1X2N A;  3BTL A;  3TED A;  2NS7 A;  3JRA A;  2R0Q C;  2MW8 A;  2R5Y A;  1GT0 C;  1BW6 A;  2L7Z A;  2KT0 A;  4IEJ A;  4B4C A;  2H1K A;  5M3F J;  2E19 A;  4M3G A;  1H8A C;  3K2A A;  2E2I J;  4L5E A;  3MVP A;  1XG1 A;  1MSE C;  1JKR C;  2R93 J;  1A5J A;  2VI6 A;  2XSD C;  4JX4 A;  3BR3 A;  4G12 A;  5EZH A;  4FCY A;  4JX6 A;  2DA4 A;  1AKH A;  2DMN A;  4FIS A;  5EGO A;  3BR2 A;  1IRZ A;  2LK2 A;  3Q0W A;  4NDL A;  2EBI A;  2ME6 A;  1TC3 C;  2NVX J;  2K9Q A;  1JKQ C;  2TRT A;  2JWT A;  2FD5 A;  1MBH A;  1BW5 A;  5EDN A;  1QPI A;  2MSY A;  1ZGW A;  1Y1W J;  1EF4 A;  1TWF J;  1B72 B;  1AHD P;  1GVD A;  5EF6 A;  5IYD J;  3DCF A;  4FE4 A;  3WHC A;  2MGQ A;  2LP0 A;  2YUS A;  2Y9Y A;  4A3D J;  1QVU A;  2Y0S N;  5FKN A;  3G1L A;  3HB9 A;  3IH4 A;  1U78 A;  2ECB A;  3S1N J;  1ZTR A;  3JRB A;  5M3M J;  2JA6 J;  1HDP A;  2XB0 X;  1ORK A;  2OPT A;  3GTJ J;  5IYC J;  2X9D A;  4A3M J;  2JA7 J;  3IH3 A;  5F04 A;  5K7F A;  1OCT C;  5EG0 B;  4XRS G;  5BNG A;  3FIW A;  4CYC B;  2W48 A;  4GFB A;  5F0F A;  5C3E J;  2HQ5 A;  2LVS A;  2DA1 A;  1DU0 A;  4A3G J;  3FKI J;  1QVT A;  5F08 A;  3MKL A;  1MNM C;  2CRG A;  2JN6 A;  3OIO A;  2JJ7 A;  1JTX A;  5J3L A;  5FLM J;  1B72 A;  1RR7 A;  2NVY J;  5FLV A;  1U9N A;  2VPR A;  2LFB A;  4M3D A;  5GPC A;  3ZQH A;  1X58 A;  1IG7 A;  4UUT A;  1JT0 A;  4BY1 J;  1UG2 A;  3F0C A;  3S2H J;  2CQQ A;  3VPR A;  1IV6 A;  1ZQ3 P;  2DA7 A;  4JX5 A;  3QQA A;  2DA6 A;  1IDY A;  3TW7 A;  2R92 J;  1ZK8 A;  1O4X A;  3K7A J;  3Q3S A;  1BJZ A;  3FIS A;  4AUX A;  4BXX J;  2HI3 A;  1SAN A;  5C4X J;  3RZO J;  2FX0 A;  1MSF C;  2VKE A;  1LE8 A;  4XID A;  2XPV A;  2TCT A;  1B8I B;  4A3I J;  4IHW A;  3S15 J;  4BKX A;  2XGC A;  1ZKG A;  2RAE A;  2FQ4 A;  2IEK A;  4Y52 J;  1WGX A;  5JLX A;  2R5Z B;  3E7L A;  3JRD A;  1Z77 A;  4QSH A;  1I6H J;  1ETY A;  2GBY A;  3I4M J;  4DYC A;  1K61 A;  1G2H A;  1Y1V J;  1LE8 B;  5FKL A;  5J1R A;  3BT9 A;  1FIA A;  2CQX A;  2ID6 A;  3S16 J;  2Y31 A;  5F0C A;  2EZL A;  2R5Z A;  4W1U A;  5F1J A;  2PMZ N;  2LR8 A;  2JK3 A;  4C3I J;  4A3J J;  2L7M P;  4A69 C;  1HDD C;  1JUS A;  3OOU A;  2LTP A;  2XRL A;  4UUS B;  3S17 J;  3BR5 A;  1Q1V A;  2L9R A;  3ZQI A;  1H88 C;  4MLO A;  2AHQ A;  3CMY A;  2EQR A;  5E3L A;  2VUM J;  2QCO A;  2K9N A;  1P7J A;  4A3L J;  1ZR2 A;  1OJL A;  5EGO B;  3HOY J;  3WHB A;  3SDG A;  2OF7 A;  4DW6 A;  4RBO A;  2M8G X;  4ABZ A;  1VND A;  2LD5 A;  1MBE A;  3I4N J;  3SFI A;  3QPS A;  4A3K J;  4MFD A;  3D1N I;  4BBS J;  1JGG A;  2ELK A;  1JJ6 C;  3BTJ A;  4M3F A;  4X1E A;  3G1M A;  3GBG A;  1RPW A;  1WPK A;  1D5Y A;  2EZH A;  2YS9 A;  4I6Z A;  3L1P A;  2XPW A;  1ETX A;  1X2M A;  2XPU A;  3C2B A;  2N8G A;  4B3A A;  4A3C J;  1IUF A;  5C4J J;  4XRS A;  1DU6 A;  5IP9 J;  3S1Q J;  1UHS A;  2E2H J;  1IGN A;  1FEX A;  5IYB J;  4D7N A;  2E2J J;  1TWA J;  2AO9 A;  4XRM A;  1E3O C;  2DMP A;  2VKV A;  4LOC A;  2M9H A;  2ME0 A;  3ZQC A;  1XS9 A;  1MBK A;  1JTY A;  2Y9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...