1ZR0A

Crystal structure of kunitz domain 1 of tissue factor pathway inhibitor-2 with bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSTSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Kunitz domain 1 (KD1) of tissue factor pathway inhibitor-2 in complex with trypsin. Implications for KD1 specificity of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zr0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zr0A02
2G81E 1EOLA 1MMJN 3SNEA 2J34A 3SV6A 3OY6U 5LPEA 3M36A 3LGIA 3NCLA 1N8OC 1O30A 2KAIB 2BD5A 8KME2 1TE0A 2VGCC 3F9FA 4WH8A 5HXFA 3HK6B 1YPGH 1SGTA 3B8JA 1O3KA 1JIMA 1CGHA 3UNSA 1AN1E 4GCHF 1O3HA 2ESTE 2GCTB 2P94A 1GBLA 1GWAA 2XNIA 2A1DB 3UY9A 2ZCHP 1T32A 3U69H 1F7ZA 1EZUC 2QXJA 3DUXH 5EPNA 2PGQB 4GHQA 1VZQH 2BY9X 2VINA 1CU1A 1EZXC 1AE5A 2PHBA 1MTVA 2Y5HA 4A1VA 1ZR0A 3F6UH 1A61H 1DANH 2W26A 1BMAA 1K28D 3EDXB 4JK6A 3A7VA 4X1NU 2WV5A 2G52A 2GX4A 4FUCA 2F91A 5A0AE 1SLWB 1MD8A 1C5TA 1TWXB 1N8OB 5DGJA 1EJMA 1O5EH 1Y3UA 3K6YA 2CF8H 1S6HA 4B74A 4WH6A 3W94A 1T7CA 5TJXA 1AKSB 2XRCA 1N1LA 1T4VH 3E3TA 1SOZA 5L6NH 4DGJA 2PKAB 1GMHG 4Y8YA 3K9XB 3BTKE 1AVGH 1XUIA 1QRWA 3PMBB 1O39A 5JB8S 1FN8A 2EC9H 1DLEA 2F9UA 2J94A 1RJXB 1GL0E 3UFAA 1Z7KA 1GBHA 2PR3A 2XC0A 1YLDA 3O8BA 2WPMS 1CA0B 1C1UH 2D8WA 2H1UA 4CBOA 1NRSH 3LIWA 3GDSA 1UJ1A 1ZJKA 1ZRKA 3SO3A 4I7YH 1WTGH 4X8SH 2HRVA 2AIPA 1GJ6A 2G4UA 1C2EA 2PKSC 2PSYA 2IPHA 2WPHS 2WPIS 5EQSA 1K21H 1P3CA 4NSYA 1C1OA 3RXUA 1PFXC 4OS6A 2GT8A 2O8UA 2VIVA 2FI3E 3ZZ7A 1C2DA 4DJZB 3S7KB 1BB0B 2CHAC 4HTCH 3N7OA 4X1PU 1SFIA 3TH2H 1C2JA 2FOAA 4D7GA 1HAHH 1CO7E 4K8BA 2F9NA 3GCOA 1KXEA 1S84A 3TGKE 1DSUA 4O03A 1UHBA 1MU6B 2ZU2A 1QBOA 1ESTA 3Q76A 4K1TA 3A8BA 4Y8ZA 3LJOA 3ZVBA 2I6SA 3LH1A 1O5AB 4O3TA 1NN6A 1MTWA 1RIWC 2J9NA 1EAXA 1C5NH 3PYHA 1C5VA 1Q3XA 2W3IA 2Z9JA 3ZV9A 1FXYA 2ZKSA 5FBIA 3E0PB 2BLWA 3H7TA 2XC5A 4ZXXH 1ELTA 3H7OA 1QJ6B 1W7XH 3BTFE 1FIWA 4ABGA 3QUMP 2BDHA 3MTYA 4FUFA 1PQ8A 1GBKA 2ZQ1A 1J17T 1FIZA 1DM4B 3DD2H 4A6LA 1Z6EA 1HLTH 4E7RG 1BHXB 1GBJA 1AWFH 2W3KA 2FOCA 5AHGH 1GHAG 2YOLA 1SGYE 1K1LA 2R3YA 1O5CB 2F9VA 3MU8A 2V3HH 2GKVE 3HKJB 3RMNH 1ZPZA 5EODA 1EUFA 5HYOA 5T6GA 1O36A 2BQ6B 1OYQA 1HIAA 3K6ZA 3V13A 2FPZA 3PWBA 1ABJH 2UUKB 1C4V2 1JRSA 4FUDA 5C5OA 3PROA 1FLEE 5T3HA 3RLWH 3H5CB 4UONA 1HAXB 1K22H 1AIXH 1BTZA 4X0WU 5BPEA 4YM9A 1EAUA 2BXUH 8GCHG 5E2PA 4Y11E 4AB8A 4ZAEA 1O2VA 1XXDA 2VWOA 3FAOA 1ESBA 3BTME 1TA6A 1VCPA 5J4SA 2ZWLH 1F5LA 4WF8A 1LHDH 3UNRA 3QDZB 2OCVB 2XWBI 1OSSA 5JBAS 1Y3VA 3SUDA 1YBWA 1G30B 2QXHA 3QN7A 2SGEE 2XTTB 2HNTC 1IAUA 1YP9A 2PW8H 3S9AA 2P16A 1NRPH 1V2VT 1O2PA 4HFPB 4BXSA 2KAIA 1HRTH 2WPLS 2CGAA 1RXPA 2XC4A 1BTPA 3NUMA 4JZ1A 3GOVB 1FY1A 3VGCB 1WQSA 1ARBA 3A85A 3O8RA 1O2XA 4U2WA 1ZMNA 3LC3A 1O3JA 1NFYA 4FXGH 4Q7XA 1ZMJA 4ZROA 3TNSA 1O2GH 3PMAB 1PPFE 3LDXH 1SFQB 1WUNH 2AGEX 5DP9A 3EAJA 1HUTH 1TNJA 2AS9A 1BTYA 3S7HB 4KGAA 3SHAH 1LKBA 3MNBA 3SI3H 1D9IA 5FX5A 1J15A 2OBOA 4D76A 1B7XB 1O3NA 1XKAC 3MFJA 4XFQA 4X1SU 2ZECA 5CHAB 1ZYOA 1C2MA 4AYVB 3KF2A 3BTDE 3M3SA 3TPIZ 1GGDC 2ZPSA 3A7YA 2G5NA 4DT7B 3KIDU 4FUBA 3GDVA 4A5TS 1BQYA 4F49A 5JBBS 1S82A 3MH6A 2Z3CA 2CJIA 2GTBA 2VVCA 4RSPA 1GI2A 4UDWH 2BMGB 1AQ7A 4I8GA 4E06H 1AY6H 3T62A 3P6ZB 1C9PA 5DJ7A 2PWXA 1AI8H 3EGKH 1TBQH 2BY5X 1V2MT 2C3SA 3Q3XA 2RA0A 4ZKNU 2ALPA 1V2PT 1AB9B 1SLXB 4O9VA 1HXEH 2FTMA 3GCTG 3GY5A 4X6MA 5AVDA 1GMDG 1O2KA 4CRAA 1SI5H 1GHYH 1AVWA 1QL9A 3TGJE 2HWLB 4JYUH 4YO9A 2OD3B 3C1KA 2Z94A 2AMPA 4DOQA 1BRUP 2QA9E 4UFGH 3L3TA 3SJ8A 1C1NA 2FOFA 1Z8IB 3EQ0H 4JK5A 5TCCA 1S83A 5F8XA 3MMGA 1KTTB 1YGCH 1DXWA 2SGAA 1O2OA 3ZZ3A 1L4ZA 2ZU5A 5DP7A 1SSXA 4YT7H 3OSYA 4NA8A 4ESTE 3MHWU 1W7GH 3T28A 1SLUB 3ATMA 2BLVA 2W7SA 4H4FA 1FDPA 2PSXA 3PO1C 3R3GB 4CRFA 2R0KA 1UHBB 2ZHDA 1QIXB 1TMBH 3SV9A 1QBVH 1TFXA 3KCGH 1FONA 2BDYA 1KXFA 3RM2H 1GI3A 2STAE 3ZZ9A 3CENA 3P8OA 4FVBA 3RXVA 1MKXH 2B8OH 3F9HA 4ISNA 3A8AA 8GCHF 2XW9A 1K1NA 2EI6A 5AFZH 1IQMA 4TY7A 1H8IH 1K1PA 5L2ZH 1H9IE 3RXBA 1EAIA 1C9TA 2J38A 1BBRH 4YLQH 2ZFPH 1XKBC 1O5DH 2CHAB 2NWNA 2BDBA 3SUFA 4BXWA 2H6MA 2QAAA 2ZNKH 5H4IB 3QLPH 3SUEA 1C5OH 1LMWB 1W11U 1Y8TA 3RXTA 1D3TB 1O34A 1UK4A 1MQ6A 2ZP0H 1OX1A 1C5ZB 2EEKA 5BRRE 2P95A 4KTUA 5HGGA 1QA7A 3A86A 4IGDA 1Y3YA 1AHTH 2P3FH 4OGYA 1TPOA 5FBEA 1CA0C 1ZZZA 3PLKA 2F9PA 1SG8B 3M3TA 3SN8A 2VIOA 4Y6DA 1ZSJA 3SU5A 1QRXA 1O3PB 3A8DA 2Y81A 1KLTA 2PFEA 2OXSA 1GGDB 2OC7A 1OWIA 3A84A 4YOJA 5PTPA 1PPBH 1O32A 1IQJA 4ABBA 1FY5A 3U1IB 2OTVA 2STBE 4CHAC 1OP2A 2A2QH 1O2HA 2HGTH 3MWIU 2R9PA 2TRMA 4NZQA 2BQ7B 2OBQA 5JDUB 2VIPA 1J8AA 3PTBA 2UWOA 5DP3A 4NIXA 3LT3A 1GHWH 3U8TH 3B9FH 1O37A 2PV9B 3VEQB 3LGWA 3K2UA 4DW2U 1D3DB 4AYYB 1BCUH 1BUIA 1K1JA 2ZHWH 1QB1A 3BSQA 1LVOA 2NU0E 3BTHE 5C1UA 4IS5A 1AZ8A 1GCTC 1HAPH 2GZ8A 1FUJA 4Y0YE 1IQFA 1WAYB 2ULLA 3RU4E 1ZHRA 3GCTF 1O35A 2Z9LA 1P2JA 8ESTE 4PROA 1O3CA 2PLXA 4ZXYH 3P17H 1BTUA 1YPLH 5GCHF 2OC0A 1F92A 1YCPH 3RXJA 3Q77A 2GCTC 2R0LA 2GZ7A 3VXFH 1ANCA 1PQ7A 4NIWA 5G4BA 1GMCG 1PYTC 2PGBB 2B9LA 2ZDNA 3C27B 2ZGXH 4FUJA 1GHXH 2XWAA 1SGFA 1WSSH 5IDKA 2BDIA 4NFFA 1J9CH 2R3UA 1P02A 1FMGA 4BOHA 1K9OE 1HB0B 3KN2A 3ZZ4A 1YPJH 4SGAE 1UCYE 1C1RA 1TRMA 2SNVA 3I29A 1LHCH 1VGCB 3KQDA 2AEIH 5DP4A 3DHKH 1V2KT 2SNWA 3E16B 3GY8A 4DY7B 3JZ2B 4CR5A 1W3CA 1MKWK 3O8CA 4IC6A 2P8OB 3ZVDA 2FIRH 3ZZAA 1BTXA 1H8DH 6GCHG 3VB4A 2Y82A 1QRZA 1BOQA 4YTAA 3HGNA 1JRTA 1P2IA 1Z8GA 3RMOH 3GDUA 2AERH 2Z9KA 3E8LA 1Y59T 4TWYA 1C5PA 1V3XA 3HGPA 1MAXA 2ZFQH 4MVNA 2QCYA 1T31A 4HZHA 3RXCA 3NK8A 5FHTA 3SU6A 3M7QA 1EQ9A 4A1XA 3AW0A 1HFDA 1MBQA 1MBMA 5DP6A 1NFUA 1Z8RA 4NIYA 1Y3WA 2F9OA 1GBDA 3ZZDA 3VB6A 1H9HE 2SGFE 1P2NA 4GCHG 4BTUB 2ZFFH 1TNIA 1MKWH 1G37A 2VWMA 5I46H 3RMLH 1ELEE 1K1MA 4ASHA 4AZ2B 1P9SA 1ELVA 1GHAF 4H6SB 1LTOA 1O2UA 1A46H 3VPKA 1FI8A 2ILNA 1XXFA 3M7UA 1OPHB 1GJ5H 4I31A 1A5IA 5GCHG 4ABJA 2GP9B 1OWEA 1HNEE 3GY3A 1GVLA 2BB4A 2C93B 2Z3EA 1EP5A 4AX9H 3RXPA 1KIGH 5EXNA 3KL6A 1P8VC 1TNGA 3HK3B 1PJPA 3HPTB 1AKSA 3ZVEA 1CSOE 3RC4A 4GLYA 1YPMH 4Y8XA 1GI1A 4K3JA 1A3EH 5F8ZA 5C67A 2ZGHA 3GICB 2FOGA 1A7SA 4MNXA 1TGBA 4Q80A 1EB1H 1TALA 1ZLRA 4CH2B 2ZU1A 3RUOA 4ISIH 1BIOA 1L4DA 1XVMA 4MDSA 4DG4A 4IMQA 2FYQA 3TH3H 5CHAC 4UE7H 3AVZA 2ZEBA 3LGUA 2O8MA 1C2IA 1AFEH 1V2LT 1XX9A 4B2AA 2ZQ2A 1C1VH 4RKJB 4YOIA 3TJNA 3KQEA 3UNQA 5FCKA 4Y79A 1DWBH 3P92A 5A09A 1C2KA 3GY6A 2FX6A 2FOMB 5EQQA 2A4RA 4TWWA 1TGSZ 3STIA 3AAVA 5EQRA 3S9BA 5GIBA 1UTJA 1BHXF 1SQOA 1GI5A 2RCEA 1SR5C 1F0SA 1MQ5A 1BTHH 1XUFA 1DWCH 3EE0B 3V12A 4TPYA 1TRNA 2XBVA 2BOHB 1LPGB 1NM6A 1XM1A 2FX4A 5F8TA 2TGPZ 1INCA 3GCHB 1Y5AT 2FEQH 1MAYA 3QGNB 1ZMLA 1MCVA 4THNH 1ZPCA 2G00A 2ALVA 2YNAA 4JZDH 1AGJA 1RTFB 4H42U 4YLUA 3LONA 1A0JA 1E0FD 1NS3A 2A4OA 3UIRA 2PKAA 2VGCB 2FM2A 3GCHC 1LO6A 3MNSA 3GY7A 1Y5BT 1GHBG 1QA0A 1BT7A 1CHOG 3AASA 3NPSA 1PPGE 1G2MA 4ABIA 2GT7A 1W12U 1YCPK 4ZHLU 1QFKH 3ITIA 1IHTH 1QQ4A 1D6RA 2TGTA 3SGQE 5A8XA 2SFAA 2TBSA 4MPXA 1SHYA 2ZZUH 4X2VA 2G51A 1AU8A 6CHAB 1LVBA 2BZAA 1C5QA 3OX7U 3SJIA 4GPGA 1YM0A 1KYNA 3PV4A 2Q6DA 4JZIA 1GBEA 3RXGA 2A7HA 1UVTH 4GVUA 2FS8A 3SU3A 5E0GA 5IYTA 1A5HA 2Y7ZA 4KP0A 2BX4A 1P11E 1KSNA 1CT0E 4HGCA 4QT8C 2TGAA 1D4PB 1O0DH 3F9EA 1XUGA 1QBNA 1GJ7B 4JMYA 2V35A 5JBTA 3M5NA 1ORFA 1ZSKA 4AORA 3O8DA 1AD8H 2GMTC 5FXLA 2O8LA 2ZO3H 1ZGIA 1QL7A 1V2ST 2ZFSA 1TPAE 1DX5M 3RMMH 2XBWA 3BN9A 1OWKA 4ZKSU 3QWCH 2A31A 2W7UA 4BAMB 1ETTH 1SQTA 2VIQA 4WMDA 3RXDA 2BOKA 4MPUA 3T5FH 2ZFTA 2R2MB 3Q3YA 4LK4A 3RXHA 1TPPA 3LKWA 2HPPH 4Y10E 4BAKB 1G3BA 1CHOF 2Q6GA 1RGQA 1YCPM 6LPRA 4WWYA 1P2OA 3TJVA 4IMZA 3SUGA 3TK5A 2P59A 2Y80A 4AN7A 2DE8A 5A0CA 2H9HA 1S0RA 2WYJA 3VXEH 2VWNA 2I6QA 2O9QA 2QYIA 1DOJA 2RG3A 1EATA 2XYAA 4YT6H 1BMNH 3ATLA 4X6OA 1ANDA 2GZ9A 5GDSH 1GBFA 1H1BA 1MD7A 3BTGE 1FPHH 1TYNA 3SORA 1O2WA 1F5KU 1KXAA 1ZTJA 3CS0A 3LH3A 1EZQA 3FFGA 5A8YA 3LGTA 2EI8A 1KDQB 1P10A 1Z6JH 2BZ6H 3A87A 3MNXA 2ZDKA 3FVFB 2ZPRA 1ZJDA 2H2ZA 3ODFA 5FCRA 1HDTH 1HCGA 2A7JA 3E0NB 3MH7A 4NWKA 1ARCA 4HI3A 3A82A 1NESE 3M5OA 5K7RA 4XE4A 1KDQA 1O2QA 3OY5U 1S0QA 3A7XA 1AUJA 2JETB 4XBBA 1VGCC 1C2GA 1ELDE 2OUAA 2AYWA 4A92A 2QY0B 1BMLA 2D26C 1QNJA 4NSVA 4X2WA 2BM2A 3URDA 1UVPA 3Q3KA 1TNLA 6CHAC 4ZUHA 3ZYEA 1CE5A 2BDAA 1T8OA 2ZTZA 3EYDA 2JKHA 2QV1A 1D3QB 3SNBA 3M35A 1N6XA 4ABAA 2XCNA 1RD3B 2FTLE 2TIOA 3DT0H 4GUXA 5T6FA 1GI8B 3RXKA 1IQKA 2UUYA 4X6NA 2XBXA 2HALA 1AFQC 2JH0D 2BLOA 1C4U2 1EOJA 2DUCA 3A7TA 3MU5A 1AFQB 3DFLA 1GCTB 4U32A 4DVAU 3M5LA 4FVDA 4BTTB 1QQUA 3BTWE 1JIRA 1OP0A 1H4WA 4R0IA 3FZDA 1SGNE 3MI4A 3MO6A 1C1QA 5B6OA 3GYMA 4FU9A 5F03A 1LHGH 1GJ8B 2GV6A 4O97A 1O2MA 5DO4H 1EAWA 1GVZA 2BLQA 2FMJA 2ZCLP 3QK1A 1ZRBA 1AO5A 1DY8A 1CHGA 2TPIZ 2BQWB 2THFB 2QXIA 5HMAA 1NT1A 1FN6A 2A32A 1GI0A 4H6TA 4CHAB 1GJDB 4CRBA 1P05A 2ANMH 3P8FA 1O3IA 1W0YH 3BTTE 1O2IA 7GCHF 1SLVB 4Y0ZE 1BBRE 5GPIB 3STJA 3ZVCA 4GHTA 1C1PA 3MH4A 4K5ZA 2JETC 4RN6A 2FI5E 2BD7A 3FP8E 4INKA 1EZSC 1SQAA 2FOEA 1TABE 3BTEE 4YZUA 1P3EA 2P3TB 2WUBA 2H5CA 3ATKA 5DPAA 1ELBA 1MTNB 1YF4A 1DWEH 3NXPA 1V2WT 2NU3E 1T4UH 1F5RA 2AGGX 3UR9A 4XOJA 1Z71A 3FANA 5EOKA 4BAOB 1IHSH 1C5RA 1DVAH 1E35B 2Y7XA 1V2TT 1YPKH 3SW2B 1GI7B 1Z8JB 2FESH 1W13U 2BD8A 1D6WA 3V7TA 2ZTYA 3LPRA 2ASUB 1UCYH 1SVPA 1NC6A 2HLCA 2H9EH 3GY2A 1G2LA 4CH8B 2GGVB 3OYPA 3TLOA 1A5GH 1C5XB 6GCHF 2Y5FA 1JOUB 2H9TH 1VCQA 1YC0A 1ELCA 1V2RT 3HATH 4NWLA 4XDEA 2UUJB 2XXLA 4D8NA 4AFZA 4X8VH 3R0FA 1UTPA 1O3EA 2XCFA 4ABHA 2C4FH 3F9GA 3LGVA 3UTUH 7LPRA 3PO1B 1Z1JA 2O8TA 4IW4E 1EP6A 5CE1A 4B75A 1OWHA 1C5SA 3V3MA 3G01A 1BJVA 1UO6A 1PPHE 1QL8A 1F0UA 1SGRE 1A0LA 2A4GA 1A0HB 3JZ1B 3AAUA 4I8JA 2K1QA 4M7GA 2F3CE 1V2OT 1SBWA 2EI7A 2JH5D 1KY9A 2GVFA 5SGAE 1NROH 2AFQB 1OS8A 3SNDA 3TK9A 1TONA 3BEUA 1ZTLA 2AMQA 4FUIA 4I33A 3E1XB 1TMUH 1FQ3A 4UFDH 1V2QT 2NU2E 1CT2E 3BIUH 1UTOA 3P8GA 2ZA5A 1RRKA 4LZ4B 1THRH 1WCZA 4B2CA 1ZSLA 1GJAB 3BG4C 2ZDVH 2Y5GA 3ZZ8A 1HYLA 3M7TA 3LC5A 3W95A 3RU4D 2ZDAH 1GHVH 1GCDA 1ZTKA 1M9UA 3P95A 2ANKH 3ELAH 3B23B 1HJAC 1HPGA 2BDGA 5I25A 3MU1A 1V2UT 4WMFA 1BA8B 1UVOA 1DE7H 3U8RH 5C2ZA 4AFSA 2FXRA 5T6DA 1FPCH 3UQVA 3LU9B 2G4TA 1BDAA 3KEEA 1W8BH 2R2WU 1DLKB 3PLBA 2VWLA 3RXSA 1L1NA 5FAHA 6ESTA 1BJUA 2FLRH 1DUAA 4ABFA 1D3PB 2G55A 3SV2H 3SNCA 3RU4T 4MNWA 4R8TB 1LPZB 1W0ZU 8LPRA 1A3BH 2BYAX 2BDCA 4VGCC 1AZZA 1W14U 4BTIB 7GCHG 3BV9B 1G36A 1IQGA 1GDUA 1O3FA 4CR9A 2ZHFH 3TJUA 7ESTE 1RTLA 2HNTF 2ANWA 4NCYA 4DURA 1O2JA 2A4QA 2BX3A 2J92A 2QIQA 1C5WB 1EPTB 1FY3A 4WXIA 1NU7B 3FZZA 1Y5UT 2VJ1A 4MPWA 1IQNA 4TYDA 4KELA 1GJBB 4X6PA 1SGFG 1A2CH 5LPFA 4I32A 3AW1A 4Q2KA 3QX5H 2GD4B 3UQOA 1EJNA 1L0ZA 3RC5A 3T25A 3S9CA 1G3EA 1HAVB 2ZF0H 2VU8E 2RA3A 4FUGA 1T8NA 3L33A 4O3UA 5HM9A 1YPEH 1VCWA 2AMDA 1DSTA 4ZMAH 3MO3A 4MPVA 5A8ZA 3ZYDA 1KLJH 2Z3DA 4B2BA 4B76A 1BZXE 5LPRA 4CRCA 1SGCA 3T2NA 2D2DA 2WPKS 2W5EA 3M3VA 4AOQA 4DCDA 4F4OC 4OS5A 2VVUA 3SI4H 1DS2E 1SMFE 3EA8A 4OS7A 4D9QA 1SL3A 2A5AA 2OQUA 4FUEA 3SZNA 4D9RA 1GMDF 4TY6A 4NZLA 3T27A 1C2LA 3A89A 3UOPA 1DPOA 1ZHMA 1GL1A 1S6FA 5A0BA 4KKDA 3E91A 1BRBE 1O5BB 4JZEH 3RXRA 1F0RA 4Q7ZA 1A4WH 1SPJA 1VJ9U 3NWUA 2OINA 3SBKA 1UTLM 3U8OH 5EPYA 1AMHA 1GMHF 1L1GA 1MTUA 3SQEE 3NKKA 2A7CA 1CBWB 2VVVA 3CP7A 4JYTA 3P8NA 1DWDH 1EKBB 4X1RU 3M61U 3MOCA 2H5DA 4AB9A 3D49H 2ZC9H 1MUEB 1WQVH 4Y76A 1HAOH 1BITA 2FP7B 1O2YA 2B0FA 5EU8A 5EG4A 3RC6A 5DKMA 1SGQE 2BD2A 4B71A 5C3NA 1GMCF 1OYTH 1TOMH 4TPIZ 1HAZB 2ZGCA 1MCTA 4NG9H 2J4IA 5EGMA 1GBBA 2HPQH 1LQDB 2FZZA 2LNCA 1UVUH 4WXVA 3FP7E 3VB3A 1QB9A 2C8ZB 2A45B 1B0FA 1TPSA 1DY9A 1O2ZA 1O3BA 1CGIE 1O3MA 4X2YA 1C1MA 2C8WB 4MQAA 1NFWA 1UCYK 1UK3A 2FLBH 4CRDA 5F6MA 2ZG0H 4FU8A 2VIWA 1RIWB 1RFNA 1LCYA 1FY8E 5ETXA 1FJSA 4UFFH 1CGJE 4CREA 1NTPA 1TB6H 5LH8A 2ZFRH 2CN0H 2GCHF 1LVYA 1CBWC 3DFJA 1QGFA 1C5MD 1TMTH 3MH5A 3GY4A 3RXEA 5E0JA 3MYWA 5K0HA 1O38A 4INLA 4MTBA 4RKOB 1TA2A 1FAXA 2HVXA 1OWDA 1AB9C 2GCHG 3RXMA 1DICA 1EB2A 2FO9A 1FZZA 3VB5A 3MU0A 5FX6A 3IITA 1WOFA 1OKXA 3V0XA 3SU4A 3SU1A 1DDJA 1HAYB 2WV4A 3RLYH 1TGNA 5FPSA 3ODDA 2J95A 3SOSA 1V2JT 1P57B 2FOHA 3A7ZA 3FP6E 1YYY1 1C5UA 2VB0A 1LKAA 4IN1A 4BNRA 4AFUA 1OWJA 1TBRH 2GV7A 4UEHH 4JYVH 3KGPA 1GI9B 3ZVFA 1HGTH 4AFQA 4AG2A 1ELGA 4Q7YA 1IOEA 1SOTA 2V6NA 2C90B 2FOBA 1W10U 1GHBF 4X8UH 1PYTD 1GI6A 1X7AC 4ZHAA 4NFEA 3A81A 1G9IE 4DIHH 4NA7A 1EX3A 3SQHE 3KHVA 3SGBE 2ZPQA 2J2UA 3HKIB 1P09A 3M5MA 3UR6A 3F1SB 4I8KA 1EASA 3TJOA 1NY22 2AH4X 4MNYA 2FODA 1AVXA 5L30H 1S81A 3Q00A 1TLDA 4AGJA 2ODQA 1EPTC 2G5VA 3QTVH 3URCA 1MTSA 3UPEA 1O31A 5C20A 3RXQA 2QC2A 2BD9A 1TIOA 5E2OA 3TITA 1TQ7B 3PTNA 1IQHA 3BEIB 1CT4E 1TRYA 3T29A 2Y6TA 3SU2A 1C1SA 4MG3A 3TIUA 3SJ9A 1P2QA 3QGJA 1O5FH 1FNIA 3VGCC 1UTMA 2A2XH 1BBRK 1VITF 2BVXH 2B7DH 7KMEH 3S69A 4ABEA 3QO6A 4OS2A 1V6DA 2FWWA 3LGYA 4VGCB 5JYIA 2A5IA 5DP8A 1UK2A 5DP5A 1DXPA 1NRRH 1C5YB 3UWJH 3SV8A 1EJAA 3DA9B 4MNVA 5E0HA 1HJAB 1UMAH 3A83A 1B5GH 3PLPA 2ZU3A 1QJ1B 4NA9H 1GJ9B 1MU8B 3D62A 3ZZ6A 1SC8U 3D23A 1VR1H 2OP9A 1HIAB 1THPB 2ODYB 3IWMA 3WY8A 1TGTA 1MZDA 4ZKRU 2ZGBH 3RXOA 1QJ7B 5L2YH 1GJCB 1A1RA 3EA9A 4AG1A 3SV7A 3KQCA 1YPHE 3ZVGA 2Q1JA 5J4QA 1ANBA 1G3CA 1HAIH 1LHFH 3T26A 1P0SH 2FS9A 3I77A 3QZQA 3BIVH 1THSH 4YESB 2VH6A 5AFYH 1Z1IA 2A0QB 1GBIA 1O3OA 1S5SA 1ELFA 2Q6FA 1O2NA 3OU0A 1BMMH 1ZOMA 3UOUA 1AUTC 3SGAE 1P04A 1SHHB 4YOGA 1OOKB 4AGKA 1GBCA 2YNBA 1ZPBA 4E05H 4ISOA 4CBNA 3A80A 4K69A 2CMYA 1TQ0B 2D1JA 3BF6H 2QXGA 2ZDMA 3TVJB 1S85A 2IN2A 1LDTT 2SGPE 1KXDA 3K65B 1KXCA 2ZGJA 9ESTA 1XUKA 2TGDA 5GWZA 2ZIQH 1O3GA 5ESTE 2XBYA 1SGEE 1IQLA 5ABWA 1XUJA 1C4Y2 1DUEA 3UWIA 3E90B 3BTQE 1WU1A 4X8TH 1AE8H 2ZHEH 3PM3A 1PPEE 4IBLH 3EA7A 3UREA 4KTSA 5EW1H 2HNTE 3LOXA 1N6YA 1O2SA 3MU4A 4A7IB 3M37A 1U6QA 1JBUH 1WV7H 4XSKU 4I8HA 2BTCE 2Z6BD 5C1XA 2OQ5A 4BAHB 3LJJA 2OC8A 2PUXB 1VITH 2UWLA 3BG8A 4CRGA 5EXLA 3QZRA 1Y3XA 3F68H 5C1YA 1NO9H 1GG6B 2QF3A 2PKSB 1EXFA 2VNTA 2ZDLA 1TAWA 2IJOB 1GDNA 3U1JB 1FV9A 4U30A 1QCPA 3RXIA 1ANEA 1JMOH 2RDLA 4NIVA 1E37B 1TX8A 4ZKOU 3TGIE 2A5KA 1KLIH 1PQ5A 3I78A 4GSOA 4UD9H 1BRAA 1P9UA 1SGPE 2ZI2H 1WTHD 3SHCH 1GBAA 2BD4A 4ZHMU 2CF9H 3RXAA 1KTSB 3SU0A 4SGBE 2AGIX 1J16A 1YLCA 1E34B 5JB9S 3A7WA 3S0NA 1ELAA 3ZZ5A 3MO9A 1G3DA 4GAWA 2BD3A 2P3UB 1QR3E 1B0EA 2BY7X 3VFEA 3ZZBA 1RTKA 4ZH8A 1LQEA 4XBCA 1O5GH 1TGCA 1XUHA 9LPRA 1NPMA 4E7NA 1HJ8A 3TK6A 2BY6X 5JPMH 5JBCS 1LHEH 1K1IA 1CA8B 2WINI 3BEFB 1UVSH 1C5LH 4ISHH 4D7FA 4A1TA 1IQEA 2B5TB 1HAGE 1ID5H 2BVSH 2SGDE 4OS1A 2GDDA 5GXPA 3TNTA 1DFPA 2UWPA 4X1QU 2QN5T 1O2TA 1K2I1 1CQQA 4I8LA 1LVMA 2WUCA 1UTKA 2Z9IA 4BANB 4K2YA 1QY6A 1ACBE 4K60A 5FPTA 4Y7AA 2CXVA 3E6PH 3IG6B 5DG6A 1KXBA 3SJKA 1C1TA 1TX6A 4DIIH 4B1TA 1QTFA 4B73A 1BTWA 3KNXA 5TCAA 1XVOA 5HM2A 2UUFB 4FU7A 2BY8X 1P01A 3L6PA 3ZV8A 2QGRA 1HAVA 2NU1E 5GJ4B 5EW2H 1LPKB 3UUZA 1G32B 3SJOA 1J14A 1GVKB 4JCNA 1O2LA 1ETSH 3GCNA 4Z6AH 1ABIH 1H9LB 1BRCE 2F9BH 3QTOH 1VJAU 5LGOA 1GJ4H 1TNHA 4INHA 4IC5A 1MZAA 4OGXA 1SB1H 1GBMA 1O2RA 3OTJE 3BG4B 1GDQA 1O33A 1T8MA 3TU7H 1K1OA 4ABDA 1XMNB 4WMEA 2ZU4A 1YPHC 3ATIA 4UFEH 1MKXK 1PQAA 1Q2WA 2Z7FE 2V3OH 2EA3A 3PMJA 5ESBA 2C8YB 3A8CA 2QF0A 4NGAH 1F2SE 1QHRB 5AF9H 4X2XA 1GBTA 1SGDE 4BAQB 4Z0KA 1E38B 2HOBA 1YKTA 2WYGA 1PPZA 3RP2A 4WY3A 3ZZCA 1QB6A 4J1YA 2BVRH 4FUHA 3D65E 4ISLA 3TH4H 1L2EA 1DITH 2OLGA 2PTCE 3GISB 1NU9A 1T8LA 1L1JA 3ZVAA 2V0BA 4U01A 1PPCE 5E8EH 1NRQH 1O3AA 3ESTA 1ETRH 4MLFB 1GG6C 3ATWA 1P06A 5C5NA 2FYRA 1HV7A 1P2MA 1JWTA 2JH6D 1GPZA 2BXTH 2O8WA 2SGQE 4K1EA 1OP8A 1FY4A 1VITG 4KTCA 1SGIB 1DT2A 2C8XB 1GI4A 4LZ1H 1QURH 3NZIA 1TOCB 3CS7A 2M5TA 1F0TA 2ZHQH 1IQIA 1C2FA 1RS0A 2G8TA 1HXFH 4XBDA 3RDZA 1OXGA 4WVPE 1E36B 4J2YB 1W2KH 2ANYA 5A2MH 1HBTH 1UTQA 2PTNA 2ODPA 3SNAA 1TNKA 2ZTXA 2FDAA 3PWCA 5FPYA 1P03A 1C2HA 2CV3A 2BHGA 2OC1A 2NU4E 1O3LA 1TBZH 1Q31A 2IOTA 4Y7BA 2ZCKP 2LPRA 3PB1E 2Z9GA 1NRNH 1EPTA 1MH0A 1ZHPA 3PMHB 4JZFH 4K8YA 2VIDA 1FAKH 3RXFA 2WPJS 3MNCA 2AIQA 5DK1A 4K1SA 4LOYH 2GMTB 4OS4A 2FI4E 1GHZA 1WYKA 1AWHB 2P93A 1UTNA 1CVWH 1MTNC 2F83A 1NZQH 3RM0H 3U98H 1ESAA 2P8OC 3VB7A 1WBGB 3P70B 1C1WH 5CMXH 3U9AH 1V2NT 4WJG2 4IN2A 1P2KA 2PUQH 4Y71A 2VH0A 2GDEH 3ENSB 3A88A 1JXPA 3KQBA 3GYLB 3RXLA 1HJ9A 2DE9A 4LXBH 1O3DA 1ZGVA 1P12E 1TX7A 5EXMA 1NFXA
chains in the Genus database with same CATH superfamily
2G81E 1EOLA 1MMJN 3SNEA 2J34A 3SV6A 3OY6U 5LPEA 3M36A 3FO8D 3LGIA 3NCLA 1N8OC 1O30A 2KAIB 2BD5A 8KME2 1TE0A 2VGCC 3F9FA 4WH8A 4AC9A 5HXFA 3HK6B 1YPGH 1SGTA 3B8JA 1O3KA 1JIMA 1CGHA 3UNSA 1AN1E 4GCHF 1O3HA 2ESTE 2GCTB 2P94A 1GBLA 1GWAA 2XNIA 2A1DB 3UY9A 2ZCHP 1T32A 3U69H 1F7ZA 1EZUC 2QXJA 3DUXH 5EPNA 2PGQB 4GHQA 1VZQH 2BY9X 4XD7D 2VINA 1CU1A 1EZXC 1AE5A 5DSFA 2PHBA 1MTVA 2Y5HA 4A1VA 1ZR0A 3F6UH 1A61H 1DANH 2W26A 1BMAA 1K28D 3EDXB 4JK6A 3A7VA 4X1NU 2WZQA 2WV5A 2G52A 2GX4A 4FUCA 2F91A 5A0AE 1SLWB 3F2HA 1MD8A 1C5TA 1TWXB 4RI0A 1N8OB 5DGJA 1EJMA 1O5EH 1Y3UA 3K6YA 2CF8H 1S6HA 4B74A 4WH6A 3W94A 1T7CA 5TJXA 1AKSB 2XRCA 1N1LA 1T4VH 3E3TA 1SOZA 5L6NH 4DGJA 2PKAB 1GMHG 4Y8YA 3K9XB 3BTKE 1AVGH 1XUIA 1QRWA 3PMBB 1O39A 5JB8S 1FN8A 2EC9H 1BMFD 1DLEA 2F9UA 2J94A 1RJXB 1GL0E 3UFAA 1Z7KA 4YXWD 1GBHA 2PR3A 2XC0A 1YLDA 3O8BA 2WPMS 1CA0B 1C1UH 2D8WA 2H1UA 4CBOA 1NRSH 3LIWA 3GDSA 1UJ1A 1ZJKA 1ZRKA 3SO3A 4I7YH 1WTGH 4X8SH 2HRVA 2AIPA 1GJ6A 2G4UA 1C2EA 2PKSC 2PSYA 2IPHA 2WPHS 2WPIS 5EQSA 1K21H 1P3CA 4NSYA 1C1OA 3RXUA 1PFXC 4OS6A 2GT8A 2O8UA 2VIVA 2FI3E 3ZZ7A 1C2DA 4DJZB 3S7KB 1BB0B 2CHAC 4HTCH 3N7OA 2KM0A 4X1PU 1SFIA 3TH2H 1C2JA 2FOAA 4D7GA 1HAHH 1CO7E 4K8BA 2F9NA 3GCOA 1KXEA 1S84A 3TGKE 1DSUA 4O03A 1UHBA 1MU6B 2ZU2A 1QBOA 1ESTA 3Q76A 4K1TA 3A8BA 4Y8ZA 3LJOA 3ZVBA 2I6SA 3LH1A 1O5AB 4O3TA 1NN6A 1MTWA 1RIWC 2J9NA 1EAXA 1C5NH 3PYHA 1C5VA 1Q3XA 2W3IA 2Z9JA 3ZV9A 1FXYA 2ZKSA 5FBIA 3E0PB 2BLWA 3H7TA 2XC5A 4ZXXH 1ELTA 3H7OA 1QJ6B 1W7XH 3BTFE 1FIWA 4ABGA 3QUMP 2BDHA 3MTYA 4FUFA 1PQ8A 1GBKA 2ZQ1A 1J17T 2WV9A 1FIZA 1DM4B 3DD2H 4A6LA 1Z6EA 1VKYA 3ZIAD 1HLTH 4E7RG 1BHXB 1GBJA 1AWFH 2W3KA 2FOCA 5AHGH 1GHAG 2YOLA 1SGYE 1K1LA 2R3YA 1O5CB 2F9VA 3MU8A 2V3HH 5B6LA 2GKVE 3HKJB 3RMNH 1ZPZA 5EODA 1EUFA 5HYOA 3MQKC 5T6GA 1O36A 2BQ6B 1OYQA 1HIAA 3K6ZA 3V13A 2FPZA 3PWBA 1ABJH 2UUKB 1C4V2 2XOKD 1JRSA 4FUDA 5C5OA 3PROA 5C0TA 1FLEE 5T3HA 3RLWH 3H5CB 4UONA 1HAXB 3OEED 1K22H 1AIXH 1BTZA 4X0WU 5BPEA 4YM9A 1EAUA 2BXUH 8GCHG 5KEDA 5E2PA 4Y11E 4AB8A 4ZAEA 1O2VA 1XXDA 2VWOA 3FAOA 1ESBA 1E79D 3BTME 1TA6A 1VCPA 5J4SA 1COWD 2ZWLH 1F5LA 4WF8A 1LHDH 3UNRA 3QDZB 2OCVB 2KCOA 2XWBI 1OSSA 5CHBA 5JBAS 1YY3A 1Y3VA 3SUDA 1YBWA 1G30B 2QXHA 3QN7A 2SGEE 2XTTB 2HNTC 1IAUA 1YP9A 2PW8H 4P02A 3S9AA 3KYGA 2P16A 1NRPH 1V2VT 1O2PA 4HFPB 4BXSA 2KAIA 1HRTH 2WPLS 2CGAA 1RXPA 2XC4A 1BTPA 3NUMA 4JZ1A 3GOVB 1FY1A 3VGCB 1WQSA 1ARBA 3A85A 3O8RA 1O2XA 4U2WA 1ZMNA 3LC3A 1O3JA 1NFYA 4FXGH 4Q7XA 1ZMJA 4ZROA 3TNSA 1O2GH 3PMAB 3EE7A 1PPFE 3LDXH 2HLDD 1SFQB 2KCPA 4Q4LA 1WUNH 2AGEX 2GJGA 5DP9A 3EAJA 1HUTH 1TNJA 2AS9A 1BTYA 2YMSB 3S7HB 4KGAA 3SHAH 1LKBA 3MNBA 3SI3H 1D9IA 5FX5A 1J15A 2OBOA 4D76A 1B7XB 1O3NA 1XKAC 3MFJA 4XFQA 4X1SU 2ZECA 5CHAB 1ZYOA 1C2MA 4AYVB 3KF2A 3BTDE 3M3SA 3TPIZ 1GGDC 2ZPSA 3A7YA 2G5NA 3UAIC 4DT7B 3KIDU 4FUBA 3GDVA 4A5TS 1BQYA 5KGOA 4F49A 5JBBS 2JDID 1S82A 3MH6A 2Z3CA 2CJIA 2GTBA 2VVCA 4RSPA 1GI2A 1E1RD 4UDWH 2BMGB 1AQ7A 4I8GA 4E06H 1AY6H 3T62A 3P6ZB 1C9PA 5DJ7A 2PWXA 1AI8H 3EGKH 1TBQH 2BY5X 1V2MT 2C3SA 3Q3XA 2RA0A 4ZKNU 2ALPA 1V2PT 1AB9B 1SLXB 4O9VA 1HXEH 2W6ID 2FTMA 3GCTG 1YWUA 3GY5A 4X6MA 5AVDA 1GMDG 1O2KA 4CRAA 1SI5H 1GHYH 1AVWA 1QL9A 3TGJE 2HWLB 4JYUH 4YO9A 2OD3B 3C1KA 2Z94A 2AMPA 4DOQA 3UB0A 1BRUP 2QA9E 4UFGH 3L3TA 3SJ8A 1C1NA 5KECA 2FOFA 1Z8IB 3EQ0H 4JK5A 5TCCA 1S83A 5F8XA 3MMGA 1KTTB 1YGCH 1DXWA 2SGAA 1O2OA 3ZZ3A 1L4ZA 2ZU5A 5DP7A 1SSXA 4YT7H 3OSYA 4NA8A 4ESTE 3MHWU 1W7GH 1W0KD 3T28A 4F55A 1SLUB 3ATMA 2BLVA 2W7SA 4H4FA 1FDPA 2PSXA 3PO1C 3R3GB 4CRFA 2R0KA 1UHBB 2ZHDA 1QIXB 1TMBH 3SV9A 1QBVH 1TFXA 3KCGH 1FONA 2BDYA 1KXFA 3RM2H 1GI3A 2STAE 3ZZ9A 3CENA 3P8OA 4FVBA 3RXVA 1MKXH 2B8OH 3F9HA 4ISNA 3A8AA 8GCHF 2XW9A 1K1NA 2EI6A 5AFZH 1IQMA 4TY7A 1H8IH 1K1PA 5L2ZH 1H9IE 3RXBA 1EAIA 1C9TA 2J38A 1BBRH 4YLQH 2ZFPH 1XKBC 1O5DH 2CHAB 2NWNA 2BDBA 3SUFA 4BXWA 2H6MA 2QAAA 2ZNKH 5H4IB 3QLPH 3SUEA 2VBCA 1C5OH 1LMWB 1W11U 1Y8TA 3RXTA 1D3TB 1O34A 4Q63A 1UK4A 1MQ6A 2ZP0H 1OX1A 1C5ZB 2EEKA 5BRRE 2P95A 4KTUA 5HGGA 1QA7A 3A86A 4IGDA 1Y3YA 1AHTH 2P3FH 4OGYA 1TPOA 5FBEA 1CA0C 1ZZZA 3PLKA 2F9PA 1SG8B 3M3TA 3SN8A 2VIOA 4Y6DA 1ZSJA 3SU5A 1QRXA 1O3PB 3A8DA 2Y81A 1KLTA 2PFEA 2OXSA 1GGDB 2OC7A 1OWIA 3A84A 4YOJA 5PTPA 1PPBH 1O32A 1IQJA 4ABBA 3CNRA 1FY5A 3U1IB 2OTVA 2STBE 2W6JD 4CHAC 1OP2A 2A2QH 1O2HA 2HGTH 3MWIU 2R9PA 2TRMA 4NZQA 2BQ7B 2OBQA 5JDUB 2VIPA 1J8AA 3PTBA 2UWOA 5DP3A 2JJ2D 4NIXA 3LT3A 1GHWH 3U8TH 3B9FH 1O37A 2PV9B 3VEQB 3LGWA 3K2UA 4DW2U 1D3DB 4AYYB 1BCUH 1BUIA 1K1JA 2ZHWH 1QB1A 3BSQA 1LVOA 2NU0E 3BTHE 5C1UA 4IS5A 1AZ8A 1GCTC 1HAPH 2GZ8A 1FUJA 4Y0YE 1IQFA 1WAYB 2ULLA 3RU4E 1ZHRA 3GCTF 1O35A 2Z9LA 1P2JA 8ESTE 3DCLA 4PROA 1O3CA 2PLXA 4ZXYH 2L74A 3P17H 1BTUA 1YPLH 5GCHF 2OC0A 1F92A 1YCPH 3RXJA 3Q77A 2GCTC 2R0LA 2GZ7A 3VXFH 1ANCA 1PQ7A 4NIWA 5G4BA 1GMCG 1PYTC 2PGBB 2B9LA 2ZDNA 3C27B 3KYFA 2ZGXH 4FUJA 1GHXH 2XWAA 1SGFA 1WSSH 5IDKA 2V3MA 2BDIA 4NFFA 1J9CH 2R3UA 1P02A 1FMGA 4BOHA 1K9OE 1HB0B 3KN2A 3ZZ4A 1YPJH 4SGAE 1UCYE 1C1RA 1TRMA 2SNVA 3I29A 1LHCH 1VGCB 3KQDA 2AEIH 5DP4A 2LELA 3DHKH 1V2KT 2SNWA 3E16B 3WW7A 3GY8A 4DY7B 3JZ2B 4CR5A 1W3CA 1NBME 4HG6A 1MKWK 3O8CA 4IC6A 2P8OB 3ZVDA 2FIRH 3ZZAA 1BTXA 1H8DH 6GCHG 4P00A 3VB4A 2Y82A 3N7DA 1QRZA 1BOQA 5HIZA 4YTAA 3HGNA 1JRTA 1P2IA 3SZEA 1Z8GA 3RMOH 3GDUA 2AERH 2Z9KA 3E8LA 1Y59T 3GS9A 4TWYA 1C5PA 1V3XA 3HGPA 1MAXA 2ZFQH 4MVNA 2QCYA 4I86A 1T31A 4HZHA 3RXCA 3NK8A 5FHTA 3SU6A 3M7QA 1EQ9A 4A1XA 3AW0A 1HFDA 1MBQA 1MBMA 5DP6A 1NFUA 1Z8RA 4NIYA 1Y3WA 2F9OA 1GBDA 3ZZDA 3VB6A 1H9HE 2SGFE 1P2NA 4GCHG 4BTUB 2ZFFH 1TNIA 1MKWH 1G37A 2VWMA 5I46H 5HIYA 3RMLH 1ELEE 1K1MA 4ASHA 4AZ2B 1P9SA 1ELVA 1GHAF 4H6SB 1LTOA 1O2UA 1A46H 3VPKA 1FI8A 2ILNA 1XXFA 3M7UA 1OPHB 1GJ5H 4I31A 1A5IA 5GCHG 4ABJA 2GP9B 2K0QA 5C17A 1OWEA 1HNEE 3GY3A 1GVLA 2BB4A 2C93B 2Z3EA 1EP5A 4AX9H 3RXPA 1KIGH 1E1QD 5EXNA 3KL6A 3FKSD 1P8VC 1TNGA 3HK3B 1PJPA 3HPTB 1AKSA 3ZVEA 1CSOE 3RC4A 4GLYA 1NBMD 1YPMH 4Y8XA 1GI1A 4K3JA 1A3EH 5F8ZA 5C67A 2ZGHA 3GICB 2FOGA 1A7SA 4MNXA 1TGBA 1KMHB 4Q80A 1EB1H 1TALA 1ZLRA 4CH2B 2ZU1A 3RUOA 4ISIH 1BIOA 1L4DA 3H09A 1XVMA 4MDSA 4DG4A 4IMQA 2FYQA 3TH3H 5CHAC 4UE7H 3AVZA 2ZEBA 3LGUA 2O8MA 1C2IA 1AFEH 1V2LT 1XX9A 4B2AA 2ZQ2A 1C1VH 4RKJB 4YOIA 2KR7A 3TJNA 3KQEA 3UNQA 5FCKA 4Y79A 1DWBH 3P92A 5A09A 1C2KA 3GY6A 2FX6A 2FOMB 5EQQA 2A4RA 2J98A 4Z1MD 2EY4C 4TWWA 1TGSZ 3STIA 3AAVA 5EQRA 3S9BA 5GIBA 1UTJA 1BHXF 1SQOA 1GI5A 2QE7D 2RCEA 1SR5C 1F0SA 1MQ5A 1BTHH 1XUFA 1DWCH 4RT1A 3EE0B 3V12A 4TPYA 1TRNA 2XBVA 2BOHB 1LPGB 1NM6A 1XM1A 2FX4A 5F8TA 2TGPZ 1INCA 3GCHB 1Y5AT 2FEQH 1MAYA 3QGNB 1ZMLA 1MCVA 4THNH 2QF5A 1ZPCA 2G00A 2ALVA 2YNAA 4JZDH 1AGJA 1RTFB 4H42U 4YLUA 3LONA 1A0JA 1E0FD 1NS3A 2A4OA 3UIRA 2PKAA 2VGCB 3F3BA 2FM2A 3GCHC 1S6LA 1LO6A 3MNSA 3GY7A 1Y5BT 1GHBG 1QA0A 1BT7A 1CHOG 3AASA 3NPSA 1PPGE 1G2MA 4ABIA 2GT7A 1W12U 1YCPK 4ZHLU 1QFKH 3ITIA 1IHTH 1QQ4A 1D6RA 2TGTA 3SGQE 5A8XA 2SFAA 2TBSA 4MPXA 1SHYA 2ZZUH 4X2VA 2G51A 3SYJA 1AU8A 6CHAB 1LVBA 2BZAA 1C5QA 3OX7U 3SJIA 4GPGA 1YM0A 1KYNA 3PV4A 2Q6DA 4JZIA 1GBEA 3RXGA 2A7HA 1UVTH 4GVUA 2FS8A 3SU3A 5E0GA 5IYTA 3OAAD 5EJLA 1A5HA 2Y7ZA 4KP0A 2BX4A 1P11E 1KSNA 1CT0E 4HGCA 4QT8C 2TGAA 1D4PB 1O0DH 3F9EA 1XUGA 1QBNA 1GJ7B 4JMYA 2V35A 5JBTA 3M5NA 1ORFA 1ZSKA 4AORA 3O8DA 1AD8H 2GMTC 5FXLA 2O8LA 2ZO3H 1ZGIA 1QL7A 1V2ST 2ZFSA 1TPAE 5EIYA 1DX5M 3RMMH 2XBWA 3BN9A 1OWKA 3N99A 4ZKSU 3QWCH 2A31A 2W7UA 4BAMB 2KX4A 1ETTH 1SQTA 2VIQA 4WMDA 3RXDA 2BOKA 4MPUA 3T5FH 2ZFTA 2R2MB 3Q3YA 4LK4A 3RXHA 1TPPA 3LKWA 2HPPH 2V7QD 4Y10E 4BAKB 1G3BA 1CHOF 2Q6GA 1RGQA 1YCPM 6LPRA 4WWYA 1P2OA 3TJVA 4IMZA 3SUGA 3TK5A 2P59A 2Y80A 4AN7A 2DE8A 5A0CA 2H9HA 1S0RA 2WYJA 3VXEH 2I6QA 2VWNA 2O9QA 2F43B 2QYIA 1DOJA 2RG3A 1EATA 2XYAA 4YT6H 1BMNH 3ATLA 4X6OA 1ANDA 2AHME 2PP6A 2GZ9A 2WPDD 1GBFA 1H1BA 5GDSH 1MD7A 1YLNA 3BTGE 1FPHH 1TYNA 3SORA 1O2WA 1F5KU 1KXAA 1ZTJA 2K8IA 3CS0A 3LH3A 1EZQA 3FFGA 5A8YA 3LGTA 2EI8A 1KDQB 1P10A 1Z6JH 2BZ6H 3A87A 3MNXA 2ZDKA 3FVFB 2XNDD 2ZPRA 3F0PA 1ZJDA 2H2ZA 3ODFA 5FCRA 1HDTH 1HCGA 2A7JA 3E0NB 3MH7A 4NWKA 1ARCA 4HI3A 3A82A 1NESE 3M5OA 5K7RA 4XE4A 1KDQA 1O2QA 3OY5U 1S0QA 3A7XA 1AUJA 2JETB 4XBBA 1VGCC 1C2GA 1ELDE 2OUAA 2AYWA 3FN8A 4A92A 2QY0B 1BMLA 1QZ8A 2D26C 1QNJA 4NSVA 4X2WA 2BM2A 3URDA 1UVPA 2YMSD 3Q3KA 1TNLA 6CHAC 4ZUHA 3ZYEA 1CE5A 1H8ED 2BDAA 1T8OA 2ZTZA 3EYDA 2JKHA 2QV1A 1D3QB 3SNBA 3M35A 1N6XA 4ABAA 2XCNA 1RD3B 2FTLE 2TIOA 2EQNA 3DT0H 4GUXA 5T6FA 1GI8B 3RXKA 1IQKA 2UUYA 4X6NA 2XBXA 2HALA 1AFQC 2JH0D 2BLOA 1C4U2 1EOJA 2DUCA 3A7TA 3MU5A 1AFQB 3DFLA 1GCTB 4U32A 4DVAU 3M5LA 4FVDA 4BTTB 1QQUA 3BTWE 1JIRA 1OP0A 1H4WA 4R0IA 3FZDA 1SGNE 4M9FA 3MI4A 3MO6A 1C1QA 5B6OA 3GYMA 4B6FA 4FU9A 5F03A 1LHGH 1GJ8B 2GV6A 4O97A 1O2MA 5DO4H 1EAWA 1GVZA 2BLQA 2FMJA 2ZCLP 3QK1A 1ZRBA 1AO5A 1DY8A 1CHGA 2TPIZ 2BQWB 2THFB 2QXIA 5HMAA 1NT1A 1FN6A 2A32A 1GI0A 4H6TA 4CHAB 1GJDB 4CRBA 1P05A 2ANMH 3P8FA 1O3IA 1W0YH 3BTTE 1O2IA 7GCHF 1SLVB 4Y0ZE 1BBRE 5GPIB 3OEHD 3STJA 4GHTA 1C1PA 3ZVCA 3F2GA 3MH4A 4K5ZA 2JETC 4RN6A 3OFND 2FI5E 2BD7A 3FP8E 4INKA 1EZSC 1SQAA 2FOEA 1TABE 3BTEE 4YZUA 1P3EA 2P3TB 2WUBA 3DSOA 2H5CA 3ATKA 5DPAA 1ELBA 1MTNB 1YF4A 1DWEH 3NXPA 1V2WT 2NU3E 1T4UH 3OE7D 1F5RA 2AGGX 3UR9A 4XOJA 1Z71A 3FANA 5EOKA 4BAOB 1IHSH 1C5RA 1DVAH 1E35B 2Y7XA 1V2TT 2KFWA 2KCAA 1YPKH 3SW2B 1GI7B 1Z8JB 5DN6D 2FESH 1W13U 2BD8A 1D6WA 3V7TA 2ZTYA 1UW7A 3LPRA 2ASUB 1UCYH 1SVPA 1NC6A 2HLCA 2H9EH 3GY2A 1G2LA 4CH8B 2GGVB 3OYPA 3TLOA 1OHHD 1A5GH 2IJD1 1C5XB 6GCHF 2Y5FA 1JOUB 2H9TH 3DSPA 1VCQA 1YC0A 1ELCA 1V2RT 2CK3D 3HATH 4NWLA 4XDEA 2UUJB 2XXLA 4D8NA 4AFZA 3W1EA 4X8VH 3R0FA 1UTPA 1O3EA 2XCFA 4ABHA 2C4FH 3F9GA 3LGVA 3UTUH 7LPRA 3PO1B 1Z1JA 2O8TA 4IW4E 1EP6A 5CE1A 4B75A 1OWHA 1C5SA 3V3MA 3G01A 1BJVA 1UO6A 1PPHE 1QL8A 1F0UA 1SGRE 1A0LA 2A4GA 1A0HB 3JZ1B 3AAUA 4I8JA 2K1QA 4M7GA 2F3CE 5IK2D 1V2OT 1SBWA 2EI7A 2JH5D 1KY9A 2GVFA 5SGAE 1NROH 2AFQB 1OS8A 3SNDA 3TK9A 1TONA 3BEUA 1ZTLA 2AMQA 4FUIA 4I33A 3E1XB 1TMUH 1FQ3A 4UFDH 1V2QT 2NU2E 1CT2E 3BIUH 1UTOA 3P8GA 2ZA5A 1RRKA 4LZ4B 1THRH 1WCZA 4B2CA 1ZSLA 1GJAB 3BG4C 2ZDVH 2Y5GA 3ZZ8A 1HYLA 3M7TA 3LC5A 3W95A 3RU4D 2ZDAH 1GHVH 1GCDA 1ZTKA 1M9UA 3P95A 2ANKH 3ELAH 3B23B 1HJAC 1HPGA 2BDGA 3VG8A 5I25A 3MU1A 1V2UT 4WMFA 1BA8B 1UVOA 1DE7H 3U8RH 5C2ZA 4AFSA 2FXRA 5T6DA 1FPCH 3UQVA 3LU9B 2G4TA 1BDAA 3KEEA 1W8BH 2R2WU 1DLKB 3PLBA 2VWLA 3RXSA 1L1NA 5FAHA 6ESTA 1BJUA 2FLRH 1DUAA 4ABFA 1D3PB 2G55A 3SV2H 3SNCA 3RU4T 4MNWA 4R8TB 1LPZB 1W0ZU 8LPRA 1A3BH 2BYAX 2BDCA 4VGCC 1AZZA 1W14U 4BTIB 7GCHG 2YMSC 4FETA 4OM9A 3BV9B 1G36A 1IQGA 1GDUA 1O3FA 1EFRD 4CR9A 2ZHFH 3TJUA 7ESTE 1RTLA 2HNTF 2ANWA 4NCYA 4DURA 1O2JA 2A4QA 2BX3A 2J92A 2QIQA 1C5WB 1EPTB 1WDIA 1FY3A 4WXIA 1NU7B 3FZZA 1Y5UT 2VJ1A 4MPWA 1IQNA 4TYDA 4KELA 1GJBB 4ASUD 4X6PA 1SGFG 1A2CH 5LPFA 4I32A 3AW1A 1FX0B 4Q2KA 3QX5H 2GD4B 3UQOA 1EJNA 1L0ZA 3RC5A 3T25A 3S9CA 1G3EA 1HAVB 2ZF0H 2VU8E 2RA3A 4FUGA 1T8NA 3L33A 4O3UA 5HM9A 1YPEH 1VCWA 2AMDA 1DSTA 4ZMAH 3MO3A 4MPVA 5A8ZA 3ZYDA 1KLJH 2Z3DA 4B2BA 4B76A 1BZXE 5LPRA 4CRCA 1SGCA 3T2NA 2D2DA 1SQRA 2WPKS 2W5EA 3M3VA 2RFKC 4AOQA 4DCDA 4F4OC 4OS5A 2LP6A 2VVUA 2L6OA 3SI4H 2HVYB 1DS2E 1SMFE 3EA8A 4OS7A 4D9QA 4TSFD 1SL3A 3WWFA 2A5AA 2J97A 2OQUA 4FUEA 3SZNA 4D9RA 1GMDF 4TY6A 4NZLA 3T27A 1C2LA 3A89A 2KCYA 3PV5A 1MABB 3UOPA 1DPOA 1ZHMA 1GL1A 1S6FA 5A0BA 4KKDA 3E91A 5FL7D 1BRBE 1O5BB 4JZEH 3RXRA 1F0RA 4Q7ZA 1K0HA 1A4WH 1SPJA 1VJ9U 3NWUA 2OINA 3SBKA 1WXRA 1UTLM 3U8OH 5EPYA 1AMHA 1GMHF 1L1GA 1MTUA 3SQEE 3NKKA 2A7CA 1CBWB 2VVVA 3CP7A 4JYTA 3P8NA 1DWDH 1EKBB 4X1RU 3M61U 3MOCA 2H5DA 4AB9A 3D49H 2ZC9H 1MUEB 1WQVH 4Y76A 1HAOH 1BITA 2FP7B 1O2YA 2B0FA 5EU8A 5EG4A 3RC6A 5DKMA 1SGQE 2BD2A 4B71A 5C3NA 1GMCF 5HKKD 1OYTH 1TOMH 4TPIZ 1HAZB 2ZGCA 1MCTA 4NG9H 2J4IA 5EGMA 1GBBA 2HPQH 1LQDB 2FZZA 2LNCA 1UVUH 4WXVA 3FP7E 3VB3A 1QB9A 2C8ZB 2A45B 4DT4A 1B0FA 1TPSA 1DY9A 1O2ZA 1O3BA 1CGIE 1O3MA 4X2YA 1C1MA 2C8WB 4MQAA 1NFWA 1UCYK 1UK3A 2FLBH 4CRDA 5F6MA 2ZG0H 4FU8A 2VIWA 1RIWB 1RFNA 1LCYA 1FY8E 5ETXA 1FJSA 4UFFH 1CGJE 4CREA 1NTPA 1TB6H 2M2AA 2ZFRH 2CN0H 2GCHF 5LH8A 1LVYA 1CBWC 3DFJA 1QGFA 1C5MD 1TMTH 3MH5A 3GY4A 3RXEA 5E0JA 3MYWA 5K0HA 1O38A 4INLA 4MTBA 4RKOB 1TA2A 1FAXA 2HVXA 1OWDA 1AB9C 2GCHG 3RXMA 1DICA 1EB2A 2FO9A 1FZZA 3VB5A 4F48B 3MU0A 5FX6A 3IITA 1WOFA 1OKXA 3V0XA 3F0OA 3OTPA 3SU4A 3SU1A 1DDJA 1HAYB 2WV4A 3RLYH 1TGNA 5FPSA 3ODDA 2J95A 3SOSA 1V2JT 1P57B 2FOHA 3A7ZA 3FP6E 1YYY1 1C5UA 2VB0A 1LKAA 4IN1A 4BNRA 4AFUA 1OWJA 1TBRH 2GV7A 4UEHH 4JYVH 3KGPA 1GI9B 3ZVFA 1HGTH 4AFQA 4AG2A 1ELGA 4Q7YA 1IOEA 1SOTA 2V6NA 2C90B 2FOBA 1W10U 1GHBF 4X8UH 1PYTD 1GI6A 1X7AC 4ZHAA 4NFEA 3A81A 1G9IE 2WHXA 4DIHH 2JJ1D 5C0UA 4NA7A 1EX3A 3SQHE 3KHVA 3SGBE 2ZPQA 2J2UA 3HKIB 2J98B 1P09A 3M5MA 3UR6A 3F1SB 4I8KA 1EASA 3TJOA 1NY22 2AH4X 4MNYA 2FODA 1AVXA 1W0JD 5L30H 1S81A 3Q00A 5T1VA 3U28C 1TLDA 4AGJA 2ODQA 1EPTC 2G5VA 3QTVH 3URCA 1MTSA 3UPEA 1O31A 5C20A 3RXQA 2QC2A 2BD9A 1TIOA 5E2OA 3TITA 1TQ7B 3N7EA 1IQHA 3BEIB 3PTNA 5EJ1A 1CT4E 1TRYA 3T29A 2Y6TA 3SU2A 1C1SA 4MG3A 3WWBA 3TIUA 3SJ9A 5GNDA 1P2QA 3QGJA 1O5FH 1FNIA 3VGCC 1UTMA 2A2XH 1BBRK 1VITF 2BVXH 2B7DH 7KMEH 3S69A 4ABEA 3QO6A 4OS2A 1V6DA 2FWWA 3LGYA 2JIZD 4VGCB 5JYIA 2A5IA 5DP8A 1UK2A 5DP5A 1DXPA 1NRRH 1C5YB 3UWJH 3SV8A 1EJAA 3DA9B 4MNVA 5E0HA 1HJAB 1UMAH 3A83A 1B5GH 3PLPA 2ZU3A 1QJ1B 4NA9H 1GJ9B 1MU8B 3D62A 3ZZ6A 1SC8U 3D23A 1VR1H 2OP9A 1HIAB 1THPB 2ODYB 3IWMA 3WY8A 1TGTA 1MZDA 4ZKRU 2ZGBH 3RXOA 1QJ7B 5L2YH 1GJCB 3NRLA 1A1RA 3EA9A 4AG1A 3SV7A 3KQCA 1YPHE 3ZVGA 2Q1JA 4RT0A 5J4QA 1ANBA 1G3CA 1HAIH 1LHFH 3T26A 1P0SH 2FS9A 3I77A 3QZQA 3BIVH 1THSH 4YESB 2VH6A 5AFYH 1Z1IA 2A0QB 1GBIA 3DSGA 1O3OA 1S5SA 1ELFA 2Q6FA 1O2NA 3OU0A 1BMMH 1ZOMA 3UOUA 1AUTC 3SGAE 1P04A 1SHHB 4YOGA 1OOKB 4AGKA 1GBCA 2YNBA 1ZPBA 4E05H 4ISOA 4CBNA 3A80A 4K69A 2CMYA 3PRBA 1TQ0B 2D1JA 3BF6H 2QXGA 2ZDMA 3TVJB 1S85A 2IN2A 1LDTT 2SGPE 1KXDA 3K65B 1KXCA 2ZGJA 9ESTA 4XRNA 1XUKA 2TGDA 5GWZA 2ZIQH 2OK5A 1O3GA 5ESTE 2XBYA 1SGEE 1IQLA 5ABWA 1XUJA 1C4Y2 1DUEA 3UWIA 3E90B 3BTQE 1WU1A 4X8TH 1AE8H 2ZHEH 3PM3A 1PPEE 4IBLH 3EA7A 3UREA 4KTSA 5EW1H 2HNTE 3LOXA 1N6YA 1O2SA 3MU4A 4A7IB 3M37A 1U6QA 1JBUH 1WV7H 4XSKU 4I8HA 2BTCE 2RDEA 2Z6BD 5C1XA 2OQ5A 4BAHB 3LJJA 2OC8A 2PUXB 1VITH 2UWLA 3BG8A 4CRGA 5EXLA 3QZRA 1Y3XA 3F68H 5C1YA 1NO9H 1GG6B 2QF3A 5CDFE 2PKSB 1EXFA 2QF4A 2VNTA 2ZDLA 2IJOB 1TAWA 1SKYE 1GDNA 3U1JB 1FV9A 4U30A 1QCPA 3RXIA 1ANEA 1JMOH 2RDLA 4NIVA 1E37B 1TX8A 4ZKOU 3TGIE 2A5KA 1KLIH 1PQ5A 3I78A 4GSOA 4UD9H 1BRAA 1P9UA 1SGPE 2ZI2H 1WTHD 3SHCH 1GBAA 2BD4A 4ZHMU 2CF9H 3RXAA 5F53A 1KTSB 3SU0A 4SGBE 2AGIX 1J16A 1YLCA 1E34B 5JB9S 3FOAA 3A7WA 3S0NA 1ELAA 3ZZ5A 3MO9A 1G3DA 4GAWA 4ZCNA 2J5UA 2BD3A 2P3UB 1QR3E 1B0EA 2BY7X 3VFEA 3ZZBA 1RTKA 4ZH8A 1LQEA 4XBCA 1O5GH 1TGCA 1XUHA 9LPRA 1NPMA 4E7NA 1HJ8A 3TK6A 2BY6X 5JPMH 5JBCS 1LHEH 1K1IA 1CA8B 2WINI 3BEFB 1UVSH 2IPQX 1C5LH 4ISHH 4D7FA 4A1TA 4TT3D 1IQEA 2B5TB 1HAGE 1ID5H 2BVSH 2SGDE 4OS1A 2GDDA 5GXPA 3TNTA 1DFPA 2UWPA 4X1QU 2QN5T 1O2TA 1K2I1 1CQQA 4I8LA 1LVMA 2WUCA 1UTKA 2Z9IA 4BANB 4K2YA 1QY6A 1ACBE 4K60A 5FPTA 4Y7AA 2CXVA 3F2FA 3E6PH 3IG6B 5DG6A 1KXBA 3SJKA 1C1TA 1TX6A 4DIIH 4B1TA 1QTFA 4B73A 1BTWA 3KNXA 5TCAA 1XVOA 5HM2A 2UUFB 4FU7A 2BY8X 1P01A 3L6PA 3ZV8A 2QGRA 1HAVA 2NU1E 5GJ4B 5EW2H 1LPKB 3UUZA 1G32B 3SJOA 1J14A 3KQ5A 1GVKB 4JCNA 1O2LA 1ETSH 3GCNA 4Z6AH 1ABIH 1H9LB 1BRCE 2F9BH 3QTOH 1VJAU 5LGOA 1GJ4H 1TNHA 4INHA 4IC5A 1MZAA 4OGXA 1SB1H 1GBMA 1O2RA 3OTJE 3BG4B 1GDQA 1O33A 1T8MA 3TU7H 1K1OA 4ABDA 1XMNB 4WMEA 2ZU4A 4B6EA 1YPHC 3ATIA 4UFEH 1MKXK 1PQAA 1Q2WA 2Z7FE 2V3OH 2EA3A 3PMJA 5ESBA 2C8YB 3A8CA 2QF0A 4NGAH 1F2SE 1QHRB 5AF9H 4X2XA 1GBTA 1SGDE 4BAQB 4FOUC 4Z0KA 1E38B 2HOBA 1YKTA 2WYGA 1PPZA 3RP2A 4WY3A 3ZZCA 1QB6A 4J1YA 1H8HD 2BVRH 4FUHA 3D65E 4ISLA 3TH4H 1L2EA 1DITH 2OLGA 2PTCE 3GISB 1NU9A 1T8LA 1L1JA 3ZVAA 2V0BA 4U01A 1PPCE 5E8EH 1NRQH 1O3AA 3ESTA 1ETRH 4MLFB 1GG6C 3ATWA 1P06A 5C5NA 2FYRA 1HV7A 1P2MA 1JWTA 2JH6D 1GPZA 2BXTH 2O8WA 2SGQE 5C94A 4K1EA 1OP8A 1FY4A 1VITG 4KTCA 1SGIB 1DT2A 2C8XB 1GI4A 2WSSD 1QURH 3NZIA 1TOCB 3CS7A 2M5TA 4LZ1H 4ACBA 1F0TA 2ZHQH 1IQIA 1C2FA 2F4LA 1RS0A 2G8TA 1HXFH 4XBDA 3RDZA 4ACAA 1OXGA 4WVPE 1E36B 4J2YB 1W2KH 2ANYA 5A2MH 1HBTH 1UTQA 2PTNA 3AK5A 2ODPA 3SNAA 1TNKA 2ZTXA 2FDAA 3PWCA 5FPYA 1P03A 1C2HA 2CV3A 2BHGA 2OC1A 2NU4E 1O3LA 1TBZH 1Q31A 2IOTA 4Y7BA 2ZCKP 2LPRA 3PB1E 2Z9GA 1NRNH 1EPTA 1MH0A 1ZHPA 3PMHB 4JZFH 4K8YA 2VIDA 1FAKH 3RXFA 2WPJS 3MNCA 3PV2A 2AIQA 5DK1A 4K1SA 4LOYH 2GMTB 4OS4A 2FI4E 1GHZA 1WYKA 1AWHB 2P93A 1UTNA 1CVWH 1MTNC 2F83A 3PRDA 1NZQH 3RM0H 3U98H 1ESAA 2P8OC 3VB7A 1WBGB 3P70B 1C1WH 5CMXH 3U9AH 1V2NT 4WJG2 4IN2A 1P2KA 2PUQH 4Y71A 2VH0A 2GDEH 2KZ4A 3ENSB 3A88A 1JXPA 3KQBA 3GYLB 3RXLA 1HJ9A 2DE9A 4LXBH 5EJZA 1O3DA 1ZGVA 1P12E 1TX7A 5EXMA 1NFXA
chains in the Genus database with same CATH topology
2G81E 1EOLA 1MMJN 3SNEA 2J34A 3SV6A 3OY6U 5LPEA 3M36A 3LGIA 3NCLA 1N8OC 1O30A 2KAIB 2BD5A 8KME2 1TE0A 2VGCC 3F9FA 4WH8A 5HXFA 3HK6B 1YPGH 1SGTA 3B8JA 1O3KA 1JIMA 1CGHA 3UNSA 1AN1E 4GCHF 1O3HA 2ESTE 2GCTB 2P94A 1GBLA 1GWAA 2XNIA 2A1DB 3UY9A 2ZCHP 1T32A 3U69H 1F7ZA 1EZUC 2QXJA 3DUXH 5EPNA 2PGQB 4GHQA 1VZQH 2BY9X 2VINA 1CU1A 1EZXC 1AE5A 2PHBA 1MTVA 2Y5HA 4A1VA 1ZR0A 3F6UH 1A61H 1DANH 2W26A 1BMAA 1K28D 3EDXB 4JK6A 3A7VA 4X1NU 2WV5A 2G52A 2GX4A 4FUCA 2F91A 5A0AE 1SLWB 1MD8A 1C5TA 1TWXB 1N8OB 5DGJA 1EJMA 1O5EH 1Y3UA 3K6YA 2CF8H 1S6HA 4B74A 4WH6A 3W94A 1T7CA 5TJXA 1AKSB 2XRCA 1N1LA 1T4VH 3E3TA 1SOZA 5L6NH 4DGJA 2PKAB 1GMHG 4Y8YA 3K9XB 3BTKE 1AVGH 1XUIA 1QRWA 3PMBB 1O39A 5JB8S 1FN8A 2EC9H 1DLEA 2F9UA 2J94A 1RJXB 1GL0E 3UFAA 1Z7KA 1GBHA 2PR3A 2XC0A 1YLDA 3O8BA 2WPMS 1CA0B 1C1UH 2D8WA 2H1UA 4CBOA 1NRSH 3LIWA 3GDSA 1UJ1A 1ZJKA 1ZRKA 3SO3A 4I7YH 1WTGH 4X8SH 2HRVA 2AIPA 1GJ6A 2G4UA 1C2EA 2PKSC 2PSYA 2IPHA 2WPHS 2WPIS 5EQSA 1K21H 1P3CA 4NSYA 1C1OA 3RXUA 1PFXC 4OS6A 2GT8A 2O8UA 2VIVA 2FI3E 3ZZ7A 1C2DA 4DJZB 3S7KB 1BB0B 2CHAC 4HTCH 3N7OA 4X1PU 1SFIA 3TH2H 1C2JA 2FOAA 4D7GA 1HAHH 1CO7E 4K8BA 2F9NA 3GCOA 1KXEA 1S84A 3TGKE 1DSUA 4O03A 1UHBA 1MU6B 2ZU2A 1QBOA 1ESTA 3Q76A 4K1TA 3A8BA 4Y8ZA 3LJOA 3ZVBA 2I6SA 3LH1A 1O5AB 4O3TA 1NN6A 1MTWA 1RIWC 2J9NA 1EAXA 1C5NH 3PYHA 1C5VA 1Q3XA 2W3IA 2Z9JA 3ZV9A 1FXYA 2ZKSA 5FBIA 3E0PB 2BLWA 3H7TA 2XC5A 4ZXXH 1ELTA 3H7OA 1QJ6B 1W7XH 3BTFE 1FIWA 4ABGA 3QUMP 2BDHA 3MTYA 4FUFA 1PQ8A 1GBKA 2ZQ1A 1J17T 1FIZA 1DM4B 3DD2H 4A6LA 1Z6EA 1HLTH 4E7RG 1BHXB 1GBJA 1AWFH 2W3KA 2FOCA 5AHGH 1GHAG 2YOLA 1SGYE 1K1LA 2R3YA 1O5CB 2F9VA 3MU8A 2V3HH 2GKVE 3HKJB 3RMNH 1ZPZA 5EODA 1EUFA 5HYOA 5T6GA 1O36A 2BQ6B 1OYQA 1HIAA 3K6ZA 3V13A 2FPZA 3PWBA 1ABJH 2UUKB 1C4V2 1JRSA 4FUDA 5C5OA 3PROA 1FLEE 5T3HA 3RLWH 3H5CB 4UONA 1HAXB 1K22H 1AIXH 1BTZA 4X0WU 5BPEA 4YM9A 1EAUA 2BXUH 8GCHG 5E2PA 4Y11E 4AB8A 4ZAEA 1O2VA 1XXDA 2VWOA 3FAOA 1ESBA 3BTME 1TA6A 1VCPA 5J4SA 2ZWLH 1F5LA 4WF8A 1LHDH 3UNRA 3QDZB 2OCVB 2XWBI 1OSSA 5JBAS 1Y3VA 3SUDA 1YBWA 1G30B 2QXHA 3QN7A 2SGEE 2XTTB 2HNTC 1IAUA 1YP9A 2PW8H 3S9AA 2P16A 1NRPH 1V2VT 1O2PA 4HFPB 4BXSA 2KAIA 1HRTH 2WPLS 2CGAA 1RXPA 2XC4A 1BTPA 3NUMA 4JZ1A 3GOVB 1FY1A 3VGCB 1WQSA 1ARBA 3A85A 3O8RA 1O2XA 4U2WA 1ZMNA 3LC3A 1O3JA 1NFYA 4FXGH 4Q7XA 1ZMJA 4ZROA 3TNSA 1O2GH 3PMAB 1PPFE 3LDXH 1SFQB 1WUNH 2AGEX 5DP9A 3EAJA 1HUTH 1TNJA 2AS9A 1BTYA 3S7HB 4KGAA 3SHAH 1LKBA 3MNBA 3SI3H 1D9IA 5FX5A 1J15A 2OBOA 4D76A 1B7XB 1O3NA 1XKAC 3MFJA 4XFQA 4X1SU 2ZECA 5CHAB 1ZYOA 1C2MA 4AYVB 3KF2A 3BTDE 3M3SA 3TPIZ 1GGDC 2ZPSA 3A7YA 2G5NA 4DT7B 3KIDU 4FUBA 3GDVA 4A5TS 1BQYA 4F49A 5JBBS 1S82A 3MH6A 2Z3CA 2CJIA 2GTBA 2VVCA 4RSPA 1GI2A 4UDWH 2BMGB 1AQ7A 4I8GA 4E06H 1AY6H 3T62A 3P6ZB 1C9PA 5DJ7A 2PWXA 1AI8H 3EGKH 1TBQH 2BY5X 1V2MT 2C3SA 3Q3XA 2RA0A 4ZKNU 2ALPA 1V2PT 1AB9B 1SLXB 4O9VA 1HXEH 2FTMA 3GCTG 3GY5A 4X6MA 5AVDA 1GMDG 1O2KA 4CRAA 1SI5H 1GHYH 1AVWA 1QL9A 3TGJE 2HWLB 4JYUH 4YO9A 2OD3B 3C1KA 2Z94A 2AMPA 4DOQA 1BRUP 2QA9E 4UFGH 3L3TA 3SJ8A 1C1NA 2FOFA 1Z8IB 3EQ0H 4JK5A 5TCCA 1S83A 5F8XA 3MMGA 1KTTB 1YGCH 1DXWA 2SGAA 1O2OA 3ZZ3A 1L4ZA 2ZU5A 5DP7A 1SSXA 4YT7H 3OSYA 4NA8A 4ESTE 3MHWU 1W7GH 3T28A 1SLUB 3ATMA 2BLVA 2W7SA 4H4FA 1FDPA 2PSXA 3PO1C 3R3GB 4CRFA 2R0KA 1UHBB 2ZHDA 1QIXB 1TMBH 3SV9A 1QBVH 1TFXA 3KCGH 1FONA 2BDYA 1KXFA 3RM2H 1GI3A 2STAE 3ZZ9A 3CENA 3P8OA 4FVBA 3RXVA 1MKXH 2B8OH 3F9HA 4ISNA 3A8AA 8GCHF 2XW9A 1K1NA 2EI6A 5AFZH 1IQMA 4TY7A 1H8IH 1K1PA 5L2ZH 1H9IE 3RXBA 1EAIA 1C9TA 2J38A 1BBRH 4YLQH 2ZFPH 1XKBC 1O5DH 2CHAB 2NWNA 2BDBA 3SUFA 4BXWA 2H6MA 2QAAA 2ZNKH 5H4IB 3QLPH 3SUEA 1C5OH 1LMWB 1W11U 1Y8TA 3RXTA 1D3TB 1O34A 1UK4A 1MQ6A 2ZP0H 1OX1A 1C5ZB 2EEKA 5BRRE 2P95A 4KTUA 5HGGA 1QA7A 3A86A 4IGDA 1Y3YA 1AHTH 2P3FH 4OGYA 1TPOA 5FBEA 1CA0C 1ZZZA 3PLKA 2F9PA 1SG8B 3M3TA 3SN8A 2VIOA 4Y6DA 1ZSJA 3SU5A 1QRXA 1O3PB 3A8DA 2Y81A 1KLTA 2PFEA 2OXSA 1GGDB 2OC7A 1OWIA 3A84A 4YOJA 5PTPA 1PPBH 1O32A 1IQJA 4ABBA 1FY5A 3U1IB 2OTVA 2STBE 4CHAC 1OP2A 2A2QH 1O2HA 2HGTH 3MWIU 2R9PA 2TRMA 4NZQA 2BQ7B 2OBQA 5JDUB 2VIPA 1J8AA 3PTBA 2UWOA 5DP3A 4NIXA 3LT3A 1GHWH 3U8TH 3B9FH 1O37A 2PV9B 3VEQB 3LGWA 3K2UA 4DW2U 1D3DB 4AYYB 1BCUH 1BUIA 1K1JA 2ZHWH 1QB1A 3BSQA 1LVOA 2NU0E 3BTHE 5C1UA 4IS5A 1AZ8A 1GCTC 1HAPH 2GZ8A 1FUJA 4Y0YE 1IQFA 1WAYB 2ULLA 3RU4E 1ZHRA 3GCTF 1O35A 2Z9LA 1P2JA 8ESTE 4PROA 1O3CA 2PLXA 4ZXYH 3P17H 1BTUA 1YPLH 5GCHF 2OC0A 1F92A 1YCPH 3RXJA 3Q77A 2GCTC 2R0LA 2GZ7A 3VXFH 1ANCA 1PQ7A 4NIWA 5G4BA 1GMCG 1PYTC 2PGBB 2B9LA 2ZDNA 3C27B 2ZGXH 4FUJA 1GHXH 2XWAA 1SGFA 1WSSH 5IDKA 2BDIA 4NFFA 1J9CH 2R3UA 1P02A 1FMGA 4BOHA 1K9OE 1HB0B 3KN2A 3ZZ4A 1YPJH 4SGAE 1UCYE 1C1RA 1TRMA 2SNVA 3I29A 1LHCH 1VGCB 3KQDA 2AEIH 5DP4A 3DHKH 1V2KT 2SNWA 3E16B 3GY8A 4DY7B 3JZ2B 4CR5A 1W3CA 1MKWK 3O8CA 4IC6A 2P8OB 3ZVDA 2FIRH 3ZZAA 1BTXA 1H8DH 6GCHG 3VB4A 2Y82A 1QRZA 1BOQA 4YTAA 3HGNA 1JRTA 1P2IA 1Z8GA 3RMOH 3GDUA 2AERH 2Z9KA 3E8LA 1Y59T 4TWYA 1C5PA 1V3XA 3HGPA 1MAXA 2ZFQH 4MVNA 2QCYA 1T31A 4HZHA 3RXCA 3NK8A 5FHTA 3SU6A 3M7QA 1EQ9A 4A1XA 3AW0A 1HFDA 1MBQA 1MBMA 5DP6A 1NFUA 1Z8RA 4NIYA 1Y3WA 2F9OA 1GBDA 3ZZDA 3VB6A 1H9HE 2SGFE 1P2NA 4GCHG 4BTUB 2ZFFH 1TNIA 1MKWH 1G37A 2VWMA 5I46H 3RMLH 1ELEE 1K1MA 4ASHA 4AZ2B 1P9SA 1ELVA 1GHAF 4H6SB 1LTOA 1O2UA 1A46H 3VPKA 1FI8A 2ILNA 1XXFA 3M7UA 1OPHB 1GJ5H 4I31A 1A5IA 5GCHG 4ABJA 2GP9B 1OWEA 1HNEE 3GY3A 1GVLA 2BB4A 2C93B 2Z3EA 1EP5A 4AX9H 3RXPA 1KIGH 5EXNA 3KL6A 1P8VC 1TNGA 3HK3B 1PJPA 3HPTB 1AKSA 3ZVEA 1CSOE 3RC4A 4GLYA 1YPMH 4Y8XA 1GI1A 4K3JA 1A3EH 5F8ZA 5C67A 2ZGHA 3GICB 2FOGA 1A7SA 4MNXA 1TGBA 4Q80A 1EB1H 1TALA 1ZLRA 4CH2B 2ZU1A 3RUOA 4ISIH 1BIOA 1L4DA 1XVMA 4MDSA 4DG4A 4IMQA 2FYQA 3TH3H 5CHAC 4UE7H 3AVZA 2ZEBA 3LGUA 2O8MA 1C2IA 1AFEH 1V2LT 1XX9A 4B2AA 2ZQ2A 1C1VH 4RKJB 4YOIA 3TJNA 3KQEA 3UNQA 5FCKA 4Y79A 1DWBH 3P92A 5A09A 1C2KA 3GY6A 2FX6A 2FOMB 5EQQA 2A4RA 4TWWA 1TGSZ 3STIA 3AAVA 5EQRA 3S9BA 5GIBA 1UTJA 1BHXF 1SQOA 1GI5A 2RCEA 1SR5C 1F0SA 1MQ5A 1BTHH 1XUFA 1DWCH 3EE0B 3V12A 4TPYA 1TRNA 2XBVA 2BOHB 1LPGB 1NM6A 1XM1A 2FX4A 5F8TA 2TGPZ 1INCA 3GCHB 1Y5AT 2FEQH 1MAYA 3QGNB 1ZMLA 1MCVA 4THNH 1ZPCA 2G00A 2ALVA 2YNAA 4JZDH 1AGJA 1RTFB 4H42U 4YLUA 3LONA 1A0JA 1E0FD 1NS3A 2A4OA 3UIRA 2PKAA 2VGCB 2FM2A 3GCHC 1LO6A 3MNSA 3GY7A 1Y5BT 1GHBG 1QA0A 1BT7A 1CHOG 3AASA 3NPSA 1PPGE 1G2MA 4ABIA 2GT7A 1W12U 1YCPK 4ZHLU 1QFKH 3ITIA 1IHTH 1QQ4A 1D6RA 2TGTA 3SGQE 5A8XA 2SFAA 2TBSA 4MPXA 1SHYA 2ZZUH 4X2VA 2G51A 1AU8A 6CHAB 1LVBA 2BZAA 1C5QA 3OX7U 3SJIA 4GPGA 1YM0A 1KYNA 3PV4A 2Q6DA 4JZIA 1GBEA 3RXGA 2A7HA 1UVTH 4GVUA 2FS8A 3SU3A 5E0GA 5IYTA 1A5HA 2Y7ZA 4KP0A 2BX4A 1P11E 1KSNA 1CT0E 4HGCA 4QT8C 2TGAA 1D4PB 1O0DH 3F9EA 1XUGA 1QBNA 1GJ7B 4JMYA 2V35A 5JBTA 3M5NA 1ORFA 1ZSKA 4AORA 3O8DA 1AD8H 2GMTC 5FXLA 2O8LA 2ZO3H 1ZGIA 1QL7A 1V2ST 2ZFSA 1TPAE 1DX5M 3RMMH 2XBWA 3BN9A 1OWKA 4ZKSU 3QWCH 2A31A 2W7UA 4BAMB 1ETTH 1SQTA 2VIQA 4WMDA 3RXDA 2BOKA 4MPUA 3T5FH 2ZFTA 2R2MB 3Q3YA 4LK4A 3RXHA 1TPPA 3LKWA 2HPPH 4Y10E 4BAKB 1G3BA 1CHOF 2Q6GA 1RGQA 1YCPM 6LPRA 4WWYA 1P2OA 3TJVA 4IMZA 3SUGA 3TK5A 2P59A 2Y80A 4AN7A 2DE8A 5A0CA 2H9HA 1S0RA 2WYJA 3VXEH 2VWNA 2I6QA 2O9QA 2QYIA 1DOJA 2RG3A 1EATA 2XYAA 4YT6H 1BMNH 3ATLA 4X6OA 1ANDA 2GZ9A 5GDSH 1GBFA 1H1BA 1MD7A 3BTGE 1FPHH 1TYNA 3SORA 1O2WA 1F5KU 1KXAA 1ZTJA 3CS0A 3LH3A 1EZQA 3FFGA 5A8YA 3LGTA 2EI8A 1KDQB 1P10A 1Z6JH 2BZ6H 3A87A 3MNXA 2ZDKA 3FVFB 2ZPRA 1ZJDA 2H2ZA 3ODFA 5FCRA 1HDTH 1HCGA 2A7JA 3E0NB 3MH7A 4NWKA 1ARCA 4HI3A 3A82A 1NESE 3M5OA 5K7RA 4XE4A 1KDQA 1O2QA 3OY5U 1S0QA 3A7XA 1AUJA 2JETB 4XBBA 1VGCC 1C2GA 1ELDE 2OUAA 2AYWA 4A92A 2QY0B 1BMLA 2D26C 1QNJA 4NSVA 4X2WA 2BM2A 3URDA 1UVPA 3Q3KA 1TNLA 6CHAC 4ZUHA 3ZYEA 1CE5A 2BDAA 1T8OA 2ZTZA 3EYDA 2JKHA 2QV1A 1D3QB 3SNBA 3M35A 1N6XA 4ABAA 2XCNA 1RD3B 2FTLE 2TIOA 3DT0H 4GUXA 5T6FA 1GI8B 3RXKA 1IQKA 2UUYA 4X6NA 2XBXA 2HALA 1AFQC 2JH0D 2BLOA 1C4U2 1EOJA 2DUCA 3A7TA 3MU5A 1AFQB 3DFLA 1GCTB 4U32A 4DVAU 3M5LA