1ZR0A

Crystal structure of kunitz domain 1 of tissue factor pathway inhibitor-2 with bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSTSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Crystal structure of Kunitz domain 1 (KD1) of tissue factor pathway inhibitor-2 in complex with trypsin. Implications for KD1 specificity of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zr0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zr0A02
4YLUA 2VH6A 3ATIA 1F0SA 3QN7A 1FPHH 1SGPE 1QJ6B 1DY9A 1MU6B 2GVFA 1A2CH 1QURH 4IN1A 3KIDU 1P0SH 2WYGA 4CRFA 1TPSA 1EJNA 5DP3A 1EZQA 3P8GA 4LK4A 1LHFH 1KLJH 3VPKA 3GY5A 2ZFFH 1C1OA 2PGBB 2ZNKH 3B23B 3QTOH 3UQVA 2BB4A 1HAYB 1VJ9U 2J9NA 1GMCF 4BAHB 1SGRE 2TGTA 1HCGA 3BG4B 1O0DH 3UR9A 4AN7A 1O30A 1C5SA 2Y7XA 3EYDA 1OWEA 1SGFA 5A2MH 3F9HA 3S7HB 1QBOA 1TBQH 3ZZAA 3TGIE 1EB2A 3V7TA 4IGDA 3ZVDA 1GJAB 4FUBA 5A8ZA 4UD9H 4A7IB 4F49A 3S69A 4U2WA 1CHOF 2GD4B 3G01A 4Y8YA 1B0FA 3TH4H 2VIPA 1ZSKA 1FNIA 2P94A 3S9AA 4YT6H 1AGJA 1DOJA 1HPGA 3TGKE 1KXDA 1L4ZA 1W10U 2C8YB 3AAUA 1ZSJA 8ESTE 2TGAA 5C5NA 1FY3A 3C27B 1QQUA 3GY7A 4XOJA 5C1YA 1LCYA 4GCHF 2SGDE 3STIA 4K1EA 2H5DA 3VEQB 4A5TS 2A32A 2UUYA 1P11E 3MH6A 4ABAA 2CHAB 3DFLA 4JZIA 4LZ1H 1MZAA 3RXUA 1GI4A 1YPHE 3I78A 4IS5A 3SQEE 1BZXE 1SB1H 4DURA 5F8XA 1CSOE 4CHAB 2A4OA 1A3EH 3C1KA 3A7TA 4AOQA 4CREA 2BDCA 1Y8TA 2AIPA 3BTTE 3Q77A 1SGEE 2B8OH 1Z6EA 4B75A 2OC7A 1K1IA 1JOUB 1S0RA 2YOLA 3Q3YA 8KME2 3Q3KA 1C2MA 2FODA 4X6MA 3UOPA 3TNSA 1V2TT 1VZQH 3SNEA 3FP6E 5GWZA 8LPRA 1RTLA 5L30H 3RXBA 1BMNH 2BOHB 4R0IA 1BCUH 2ZU5A 2BMGB 1T8OA 3SJOA 1GMDF 3A7ZA 3ATWA 5HM2A 2GCTB 5PTPA 2ZU4A 1OP0A 2V6NA 1YP9A 1A5IA 2EI8A 1GJCB 5A8XA 1IQIA 4XFQA 3QZRA 4FUDA 3K9XB 1ZHMA 1Z8IB 1EAUA 5A8YA 2ZA5A 3ZZ7A 4INLA 1AD8H 2GV7A 3TK5A 1T7CA 1GBFA 2GMTC 1GVKB 2BZAA 2G4UA 1O31A 1CT2E 1HAIH 1BBRK 3BSQA 4NSVA 1YBWA 1BRUP 1ZPBA 3K6ZA 2ZPQA 3A82A 3I29A 3LC5A 3RU4T 1GG6B 1S85A 1AKSA 5EXLA 1S6HA 1NFXA 3A7YA 1CE5A 2C3SA 2EC9H 2FOCA 5DGJA 1O2ZA 2VIOA 2BY6X 3UWIA 4K1SA 1Q2WA 2A0QB 1EP5A 2A31A 1S81A 1SQAA 2NU2E 4A92A 3QTVH 1D4PB 4GAWA 1C5OH 5IYTA 1C9PA 1QB1A 1GBIA 5I25A 1Y5AT 5EOKA 2GDDA 1J14A 1IOEA 2OC0A 2FOFA 4UFEH 1TGCA 1NFWA 4WJG2 5DJ7A 1TAWA 4FUHA 2PR3A 4MLFB 2FO9A 1UTNA 4MQAA 3UQOA 3ATMA 3SGQE 1VR1H 2Z94A 4HI3A 5AVDA 1ZYOA 3TGJE 1LHGH 2Z9JA 1UVSH 4ABDA 1C5PA 3KF2A 3ZVCA 1ESBA 1KXFA 1K2I1 5DP5A 1HJAC 3LOXA 2H2ZA 2G51A 3U8RH 2BVSH 4B1TA 4IN2A 2AGGX 2QV1A 1A46H 2FOMB 2ZDKA 1OSSA 4X1PU 3RC6A 1NC6A 3OY6U 1OX1A 3M7UA 4AGKA 3SNCA 1NFYA 1GJ6A 1BA8B 1KXCA 3L6PA 3SGBE 1EP6A 3QWCH 2QXHA 1EQ9A 1P57B 2Y80A 4UFGH 4OS5A 3SBKA 4FUEA 1RIWB 1CBWB 1PQ7A 4B2AA 4K3JA 2F83A 2OINA 1MTNC 2IJOB 4ZKOU 1O2HA 3P92A 1BJVA 3BN9A 1SPJA 1C2LA 2ZDAH 2WINI 4MNWA 3SZNA 3ZVFA 2ZFTA 4X8TH 5ESTE 1UVTH 3A8AA 4O3TA 3LGYA 1C9TA 1WBGB 2FS9A 2BLVA 3HK3B 3ZZ4A 3UR6A 2ZFSA 2XWAA 2ZCHP 3SV7A 1QQ4A 3TITA 2Z6BD 3M5MA 6GCHG 3UTUH 1PQ5A 3PO1C 1C1MA 3D23A 3M3VA 4MPWA 4D7FA 5T3HA 4RKOB 3GDUA 1NTPA 1YCPH 4OS6A 5J4QA 3RXFA 1O3PB 1MKWH 1CA8B 3W94A 1GI6A 3OTJE 2AH4X 1FY4A 3E91A 1TLDA 3BTEE 2HVXA 1THSH 5GJ4B 2TIOA 1DWBH 2FTMA 2RCEA 4NFFA 4ZKNU 3E90B 1ELCA 2ZTYA 2SFAA 2FOEA 3A83A 5CHAC 2FLRH 4MVNA 5ETXA 1O34A 2SGEE 2ZTZA 1F0UA 4ISLA 1CQQA 3RXTA 4U01A 4GHQA 1TPOA 4BAMB 3I77A 1DUAA 1DWCH 3VB5A 3ZYDA 1PPHE 3TU7H 1INCA 2BM2A 1TGTA 3MNSA 1BMLA 1HFDA 4DIHH 2AERH 1AO5A 5A09A 1GPZA 1GI9B 1W7XH 2FI4E 1BB0B 1O2NA 1ABJH 2BTCE 2WPMS 4LXBH 3MU8A 5L2ZH 1DPOA 4HFPB 1VJAU 1TGNA 2D1JA 1G3EA 1QB9A 1XMNB 1BTZA 2JETC 2R0LA 1TNIA 1E36B 1GBKA 1S5SA 4A6LA 1L2EA 8GCHF 1HYLA 1LHCH 3SNDA 2B0FA 1GBHA 1C2KA 1O39A 3KHVA 4NIXA 1BTHH 4YTAA 2TBSA 1EZSC 3SJ8A 2C8XB 4NSYA 1ETTH 1FPCH 1HDTH 1QTFA 1ELEE 1O5EH 3A80A 2Z7FE 4I8KA 3MU1A 1CT0E 1NU7B 1GHAG 2FPZA 2AMPA 1P02A 1O2VA 1IQHA 2NU3E 1BDAA 2XYAA 2ZGXH 3RXKA 2FYRA 2XNIA 1SR5C 1D3QB 1S84A 2JH0D 1G30B 1EPTA 3GCTG 1NPMA 1OKXA 1PPCE 3D62A 5C3NA 1NY22 1LO6A 1O2UA 1IQEA 3UUZA 1P05A 2GZ7A 1BTPA 3NKKA 3QDZB 1GBJA 2QCYA 3MNCA 3RUOA 5E2OA 4X1QU 1UVOA 3A84A 3RMNH 4B2CA 3BTWE 3BIVH 3F9EA 2WPHS 2FOAA 1SGNE 1JRSA 1ZTKA 1F5RA 2ZFQH 3A85A 3GDVA 1M9UA 4WH8A 2OD3B 1ELGA 1SOTA 1UCYH 3O8BA 4BAKB 4JYVH 1PFXC 1AUJA 4FUFA 3MTYA 1O2IA 3P17H 2G81E 3SV9A 5CMXH 4CH8B 1BITA 1TX8A 1DXWA 3ESTA 1GMHG 5LPRA 1N8OC 1K1OA 4WMDA 2FOBA 1TABE 1NRRH 1RD3B 1P01A 3BEFB 4KTSA 2HNTE 4ISOA 3SHCH 4X0WU 1GL0E 3KGPA 1QRWA 1D3TB 1KDQB 1DWEH 3UPEA 1WCZA 1P10A 1GCDA 1HIAA 4DIIH 1AFEH 3VB4A 1T4VH 2ZIQH 1CGHA 4ISIH 1BBRE 1DE7H 2TRMA 2FXRA 1W0YH 1GHYH 3PTNA 4AGJA 2RDLA 3MYWA 3SNBA 5JBAS 4M7GA 1EAWA 2GTBA 4I8LA 2OBQA 1FAKH 4ASHA 1O3GA 4QT8C 5FCRA 1PQ8A 2C90B 5SGAE 2ZHDA 1A5GH 2OQ5A 1L1JA 1PPEE 1WUNH 1AB9C 2ODQA 2ZECA 2QGRA 2Z9IA 1YKTA 3RXOA 3L3TA 3M3TA 1XVMA 1DS2E 1DXPA 5LH8A 2QXGA 3NK8A 5K0HA 3M5LA 5FCKA 2Y82A 1ZLRA 4GUXA 3CP7A 1NRQH 1ZJKA 2BXTH 1TALA 1CT4E 1PPFE 1V3XA 3TLOA 3P8FA 2ZC9H 1A4WH 4FU9A 2ANYA 4K1TA 2G5NA 3W95A 3BTHE 1XXFA 1QNJA 1QFKH 3MWIU 1HLTH 2PKSC 3M36A 3BTKE 3H7TA 1TMUH 4Y7AA 1O3BA 1UJ1A 2FEQH 3LT3A 4H4FA 2C8ZB 3EGKH 2J94A 1GI7B 3SJKA 2Q6DA 4D9QA 1GI1A 4R8TB 1C1TA 1PPGE 1BHXB 1WYKA 3E8LA 1GMCG 1Z7KA 1ANBA 4BXSA 1O5BB 1SLWB 5FHTA 2ASUB 1SSXA 4HTCH 4JYUH 3LU9B 4KTCA 1MKXK 2P3TB 2ODYB 4NIYA 3MH5A 2Y5HA 4IC5A 5TCAA 2W5EA 1NU9A 3AW0A 4AFQA 2GMTB 3PLKA 4I32A 2TGPZ 3SU3A 1IQGA 1CHOG 1K22H 4U30A 3UY9A 4ZXYH 1DT2A 4AX9H 1KXAA 3ZZ6A 1K1JA 2HLCA 5FAHA 4ZMAH 3FP8E 2GZ9A 1EKBB 4ZH8A 4LOYH 4RN6A 2YNBA 1C2EA 2VJ1A 1A0JA 3BTQE 1K1PA 1AFQC 3Q3XA 4B76A 1ESAA 3B9FH 4GCHG 3SU4A 3OX7U 1TPAE 2BD8A 1YC0A 2OQUA 3KQBA 4ZROA 5EQSA 1UTJA 1CU1A 1V2LT 1C4Y2 1IQKA 3S9CA 3SUGA 3LGIA 2WYJA 2VINA 3UFAA 3WY8A 2F3CE 1C5MD 1TGSZ 2H1UA 1HJAB 2VWOA 5FPTA 3M35A 2XBXA 2WV5A 2ZZUH 5I46H 1DSUA 1GJ5H 5F8ZA 1FY8E 3GY6A 1GBMA 1BTXA 1ZTJA 1FI8A 4X1RU 3PMHB 4FVDA 1RFNA 1P2QA 2JKHA 3FZDA 2VIVA 3KQDA 3PWCA 1FDPA 1GCTC 1SGFG 1OP8A 3DD2H 2Q1JA 4ZHAA 5EXMA 3AW1A 1TNGA 1MCVA 1E0FD 1KTSB 1GMDG 1GBDA 1QRXA 2AGEX 1MTNB 2BOKA 2R3UA 2UWLA 1H1BA 1V2PT 2XXLA 1ZRBA 1RS0A 4WMFA 4X2WA 1ELFA 3JZ1B 1HJ8A 1Y5UT 2W3KA 2B7DH 4FVBA 6CHAC 1HAVA 3H7OA 2ZP0H 4TY6A 3M5OA 3PO1B 1Z8JB 1QL8A 1VCQA 3LGTA 4YZUA 1YPGH 3U69H 3MNBA 3HK6B 5IDKA 2G5VA 2VWNA 3ZZBA 1W7GH 1ZGIA 1DWDH 1DLEA 3VB3A 2XCFA 3URDA 1LPZB 3ZV8A 1C5LH 4Y71A 1THRH 1VCWA 1JXPA 1PPZA 4ABHA 5AFZH 2QF3A 5CHAB 2EI7A 1ARCA 2A1DB 3KNXA 1TQ0B 2UUKB 2I6QA 1EAXA 3Q00A 2AIQA 3OU0A 2BY7X 2KAIA 2GKVE 3LGVA 2ZCKP 4MNXA 1JRTA 2ANKH 2VVVA 4NCYA 1UHBA 3EDXB 3F68H 3SU1A 1Z71A 1MZDA 1SG8B 1XXDA 2A7CA 5ESBA 5GXPA 1G2MA 4NA7A 1VITH 1TFXA 4GVUA 4JYTA 4KELA 5JDUB 1FUJA 1SVPA 2WPIS 3RU4D 3TIUA 1T8NA 1O2MA 1QJ1B 4FUIA 1C5TA 4CR9A 1CA0C 4DT7B 2JETB 3MU5A 3PM3A 4X8SH 4JMYA 1GBEA 4CR5A 4WH6A 7LPRA 1TWXB 2SGAA 4UFFH 1Y3XA 4E7NA 4I8HA 1SMFE 1ELBA 1C1WH 1GJ9B 1SGCA 3DUXH 1G32B 4BTUB 4GPGA 4HGCA 5GIBA 2NU0E 2Z3DA 3PMBB 4SGAE 1V2VT 3BTME 1NROH 1ELTA 1GDUA 1UVUH 1Z8RA 3URCA 1E35B 5BRRE 2ZGCA 7GCHF 3K6YA 1K1LA 1BTYA 2ZGHA 4UDWH 1UK3A 1PYTC 4E05H 2PLXA 3T28A 2VGCC 3S7KB 5L2YH 1KLIH 1HAOH 4ZKRU 3TJVA 1RGQA 2ZI2H 4XBBA 4Y11E 2GDEH 3NCLA 1S6FA 3R3GB 1G36A 1GHBF 1L1NA 3AVZA 1S0QA 3L33A 4O97A 4Y76A 3PMJA 3T25A 1TNHA 1GBTA 1O3IA 2XC5A 2ANWA 3VB7A 4BXWA 3GCHC 5E2PA 1XUHA 1T8LA 2SNWA 1EPTC 1GBBA 2BD4A 2BVRH 1VITF 1GI0A 3S0NA 4Z6AH 3EA7A 2BLOA 3B8JA 2ESTE 5EG4A 1T31A 4MG3A 5A0CA 4B71A 4HZHA 1ACBE 2CF8H 1P04A 4OS7A 1MH0A 3VXFH 1DX5M 1YPMH 2CMYA 7ESTE 1YPLH 3RMLH 1NT1A 3UNRA 2ZDLA 3GY8A 4Z0KA 1GJBB 3RC4A 1YF4A 3PV4A 2BQ6B 1FZZA 3MMGA 2BDBA 1C5QA 5FBIA 2A4QA 1HAPH 4Y8ZA 1O38A 2BY8X 2IPHA 3IG6B 3A8DA 1N8OB 3TH3H 4NA8A 3GOVB 1G3CA 4D9RA 3SU5A 2UWOA 5DP7A 2G52A 5HGGA 5DPAA 5TCCA 1GBAA 4ABIA 1BOQA 2G55A 3OSYA 4YO9A 1E38B 2QAAA 1AVWA 1MQ6A 1THPB 5E8EH 1HXEH 1HAGE 5DKMA 1W3CA 2XBWA 4TYDA 8GCHG 3LGUA 1C5NH 1K21H 2FZZA 1LMWB 3HPTB 1MTWA 1EOLA 2FIRH 3RXDA 4OGXA 2PUQH 1SI5H 1A61H 5DP6A 3DT0H 4YLQH 2P16A 1SGIB 4CRDA 1P9UA 2G4TA 2O8WA 1GVZA 1TNLA 1XKAC 1BRAA 5EGMA 5GCHF 3S9BA 2UWPA 3SU2A 2IOTA 1TNJA 1O5GH 1XUKA 1K9OE 2BD9A 4WVPE 4K69A 4O03A 3SORA 1Z1IA 1QB6A 1AB9B 2QYIA 4NIWA 5JPMH 4NWLA 5FPYA 1P2MA 2IN2A 4JZFH 1TA2A 1F2SE 1CO7E 1GI3A 1EZXC 1JMOH 1XUGA 1JWTA 3ZZDA 4Y8XA 4AB8A 4Q80A 2BQ7B 2ZCLP 2BD2A 4YOJA 1A0HB 5TJXA 3ODFA 2ODPA 4MPXA 1CGIE 1A0LA 2PKSB 3GY4A 1NFUA 3HATH 1AZ8A 1WOFA 1O2LA 1TB6H 4OS1A 1KY9A 5FX5A 2ZEBA 2EEKA 3FVFB 1ZHRA 2P95A 4O3UA 3SUDA 1NN6A 1W11U 3R0FA 2B9LA 1TRYA 3D49H 2GZ8A 1FXYA 3HGPA 1QCPA 1O36A 1ZMJA 1NESE 1DDJA 2HPPH 3A7VA 6ESTA 1QA7A 5B6OA 1OS8A 3LJOA 1FAXA 1GL1A 4ISNA 1K1MA 2R2MB 3ZZ5A 2XTTB 5HM9A 1TIOA 5F03A 2BY5X 1VCPA 3LH1A 3RXRA 4D7GA 4DY7B 1P3CA 1QR3E 2A4GA 4XDEA 1O3KA 3K65B 5JB9S 1KLTA 1ZSLA 1BRBE 3UREA 1C5UA 1HAZB 5G4BA 3V0XA 1GI8B 1QRZA 2ANMH 5DG6A 1HJ9A 1IQNA 1C4U2 1UMAH 1MCTA 2ZQ1A 3H5CB 1QL7A 4JCNA 1WTHD 1ABIH 1FONA 4FUJA 4UEHH 3F1SB 4AFSA 4ZKSU 1FJSA 1V6DA 4B73A 1AKSB 1P2JA 3FAOA 3U8TH 1PYTD 1AFQB 5C1XA 1C5ZB 3RLWH 3PWBA 1FV9A 1O2WA 5F6MA 1P09A 1GWAA 2R2WU 3SOSA 2GT8A 1UTLM 2O9QA 2WUBA 3M37A 4IMZA 2VWMA 1P2OA 4CH2B 3ZZCA 4FUGA 2FOGA 3F6UH 1OYQA 2PKAA 1HGTH 4X1NU 1V2NT 2A2XH 4BTIB 3TJUA 2NWNA 2RG3A 1J17T 1W12U 2YNAA 2RA0A 1O5DH 2A2QH 3A7WA 3AASA 3VXEH 2JH6D 2G00A 2A5KA 2P8OC 1QY6A 5K7RA 1AWHB 1EB1H 4DW2U 2BLWA 1P2NA 1UCYE 4I33A 1O5FH 1ANCA 4MNYA 1J15A 2FDAA 2ZHQH 1EOJA 2TPIZ 1JBUH 1BJUA 1GCTB 2OUAA 1EASA 5C2ZA 1YPEH 6LPRA 1BIOA 1D3DB 3A7XA 3T26A 1QJ7B 1AUTC 1UK2A 4X6PA 1DANH 1H8DH 3VB6A 1BQYA 2PSYA 2J4IA 1UK4A 3FZZA 1SGQE 4DG4A 1O3LA 3CS7A 1LVYA 1SGDE 1ZTLA 2XC0A 3GICB 1NZQH 3GY2A 1ZZZA 1D6RA 3SU0A 1HRTH 1CGJE 1U6QA 4JZEH 3QK1A 1V2JT 4JZDH 1FQ3A 1C1VH 2SGPE 4JZ1A 1QGFA 3BEUA 2FP7B 2PUXB 6CHAB 2GV6A 5LPEA 1O3OA 1IQMA 1HAXB 2OXSA 2VH0A 3SV6A 4FXGH 1LKBA 2BDYA 3ZVGA 1LVMA 3BTFE 3GY3A 3P95A 2VWLA 2I6SA 2V3OH 4FU7A 4ZUHA 1DICA 4O9VA 2UUJB 1SL3A 3M7TA 4Q7XA 3E0NB 2JH5D 1P8VC 2XBVA 2ZO3H 3KL6A 3SV2H 5FBEA 3ZVEA 3MHWU 1WAYB 3MH7A 2Y5FA 1FN6A 1GVLA 4MDSA 4CBNA 5JBBS 4A1VA 3BV9B 1GGDC 2BDAA 1TOCB 3LH3A 3EE0B 4DOQA 3RXMA 1BBRH 4U32A 1LHDH 2BXUH 2HGTH 1FIZA 3GISB 3KEEA 4WXIA 4YOGA 3RXQA 2P3FH 4K2YA 5FPSA 3TNTA 5C67A 2THFB 4AB9A 1G37A 2ZPRA 3SW2B 2GCHF 3UOUA 3T2NA 3E16B 1CA0B 1LQDB 1C2DA 1WV7H 4NIVA 3SQHE 3NZIA 1PQAA 2AEIH 5E0JA 1YPHC 2FYQA 2DE8A 2H9HA 4KTUA 3M5NA 3P70B 2AMQA 1J16A 3EA8A 2STBE 2Q6FA 4YESB 1P2IA 1QBVH 4BTTB 3MO6A 1V2ST 1UTOA 2A4RA 3ZZ9A 3SJIA 3BEIB 3GDSA 1XUFA 1UVPA 1B5GH 2R0KA 3SI4H 2BX3A 4VGCC 3P6ZB 1W0ZU 1EUFA 2AYWA 4OS4A 2QA9E 3UNQA 1C1QA 1ZOMA 1ZR0A 9ESTA 2VGCB 4A1TA 1HUTH 4INKA 1J8AA 1JIRA 1GBCA 1Y3WA 3D65E 2Y6TA 5EQRA 4ESTE 1C1PA 1V2OT 4NFEA 4X2VA 5FXLA 4JK5A 3GCHB 1OXGA 1A5HA 3SJ9A 2H5CA 1EPTB 2XCNA 2PV9B 3ZZ3A 4X2XA 1DITH 1RJXB 1V2RT 1WU1A 4XBCA 2F9NA 3QO6A 1YGCH 2ZU2A 4CRGA 2V0BA 1EJAA 2GT7A 3ZZ8A 3FP7E 4X2YA 1LHEH 1O3FA 3IWMA 3SI3H 1RXPA 2C4FH 2BDIA 1ZGVA 1P9SA 2ILNA 4YM9A 1ZHPA 1P2KA 4TWWA 5HMAA 2OC1A 1C2FA 1LVOA 1YCPK 1YLCA 1DSTA 2J34A 2H9EH 1O3JA 3KQCA 1Y59T 1MKWK 1F0RA 5CE1A 1UTKA 2WPKS 1AMHA 2A45B 1H8IH 4AFZA 2J95A 2BZ6H 1NS3A 4TPYA 3FFGA 1ANDA 1O33A 1TA6A 1HNEE 1X7AC 3RXCA 3TK6A 3K2UA 1FLEE 3T27A 2HRVA 3Q76A 3F9GA 1GHXH 2ZKSA 1V2WT 1AN1E 3STJA 1BMAA 2BLQA 3EA9A 2PFEA 3M61U 4SGBE 5J4SA 1TBZH 4X8UH 1AVGH 2PTNA 4ABJA 1ORFA 4NZQA 3SUEA 2VB0A 2VIQA 3ZVAA 4J2YB 4I8GA 1VGCC 1W13U 5HXFA 2LPRA 3P8OA 1K1NA 4THNH 3MU0A 1SOZA 1HIAB 2ZGJA 1XM1A 1T8MA 2P59A 1XX9A 7GCHG 1O2XA 5EQQA 1C1NA 1Y3VA 2QXJA 4XE4A 1GHZA 4GHTA 1KXEA 2A7JA 1P03A 1MD8A 2ZDNA 1F7ZA 1C2IA 3MH4A 4B2BA 2PGQB 1C2HA 4X6NA 3NPSA 3PMAB 1GHBG 3RP2A 4ABBA 3SV8A 1J9CH 1FY1A 2VVCA 3ATLA 5C5OA 2Y81A 1OPHB 1A3BH 5AFYH 3PTBA 1F0TA 3UWJH 2DE9A 2CGAA 1C2JA 1GJDB 1RTKA 3VGCC 3BTDE 1AE5A 4IBLH 4K5ZA 1VITG 1LPGB 3AAVA 3RXAA 1O3EA 4NGAH 4AG2A 1C5RA 3MO3A 3BIUH 1C1SA 1RRKA 4AYYB 2W7UA 1SC8U 1AZZA 4UE7H 1H9LB 1O3AA 1TONA 5GDSH 4D76A 3A8BA 2OLGA 1QIXB 3JZ2B 2PSXA 1C5XB 2PTCE 1SBWA 3RXSA 2F9VA 1MTUA 1YPKH 1K28D 1EATA 1Y3YA 7KMEH 1OWJA 1AI8H 3RU4E 4GLYA 3V13A 1Q31A 1AE8H 3KQEA 3A81A 3N7OA 1AQ7A 4JK6A 5DK1A 3SN8A 3U1IB 2C8WB 1UCYK 1OYTH 1C5WB 1GHWH 1V2KT 2A5AA 4KP0A 3RMMH 1YLDA 1EAIA 1FY5A 3SGAE 3PROA 1OWKA 3O8DA 4IMQA 3QGJA 1KSNA 1TBRH 3ATKA 1EXFA 1SHYA 1BMMH 2AFQB 4BAQB 5JBTA 3QGNB 1AHTH 3RXPA 4MNVA 3NWUA 5GCHG 1QL9A 2AS9A 2XWBI 3CENA 3TPIZ 1TX6A 2ZHWH 1QBNA 1O5AB 4ZXXH 5C20A 3KCGH 2HALA 2BDGA 1ARBA 1LKAA 1E34B 4OGYA 5EXNA 2HWLB 4I7YH 5T6DA 1RTFB 1WSSH 2P93A 4D8NA 2ZDMA 1ZJDA 1W14U 1SQOA 1ZMNA 1N6YA 1SGYE 3E6PH 3ENSB 2VNTA 4CRAA 2BQWB 2BDHA 2ZFRH 4OS2A 2PW8H 3A86A 1HAHH 2VIDA 2O8TA 2XRCA 2P8OB 1OWDA 5EODA 1A7SA 1V2QT 2ZTXA 3A8CA 3ODDA 2XBYA 1O3HA 3U98H 1UTPA 1W2KH 1WTGH 1O2RA 1IQFA 5EPYA 1ZMLA 1H4WA 2LNCA 5T6FA 5BPEA 3TK9A 2CXVA 4CRBA 4X1SU 2FOHA 4H42U 1GJ8B 4GSOA 3A88A 4KKDA 3MU4A 5JYIA 2QY0B 5DP9A 3KN2A 4PROA 1O2GH 1UTMA 1O32A 3BTGE 3A87A 3E1XB 2D8WA 2ALPA 2ZU3A 3ZYEA 1O3CA 1XKBC 3HKIB 2AMDA 3PLPA 3EQ0H 3TJNA 3LKWA 4AORA 2BY9X 4BAOB 1C5VA 3PYHA 1JIMA 2V35A 4Q7ZA 1PJPA 2A5IA 4DJZB 1HAVB 2OBOA 2OC8A 2R9PA 2H9TH 1ELAA 1NM6A 4DVAU 3O8CA 1TNKA 3V3MA 1GI5A 1ETSH 4Y0ZE 3T29A 2BVXH 2CN0H 1FN8A 1ZRKA 1G3DA 3T5FH 1MKXH 2AGIX 2BYAX 1O2PA 2Z3CA 4AFUA 2HNTC 2WPLS 2HOBA 5LPFA 5A0BA 2CV3A 2UUFB 2C93B 1T4UH 5AHGH 2FTLE 3EAJA 1BT7A 1Z1JA 1GGDB 3UIRA 1O2TA 2ZGBH 1ESTA 4AG1A 1TYNA 3BG4C 3O8RA 5DP8A 1EZUC 1DLKB 1HBTH 4NWKA 1O35A 2GX4A 2XC4A 1KDQA 4Q7YA 1C1UH 5ABWA 5T6GA 4BNRA 3M3SA 1AWFH 1SLUB 2KAIB 1LDTT 3DA9B 1UHBB 3SHAH 5HYOA 1YYY1 1NRSH 1OWIA 1T32A 4RKJB 1TRNA 1UTQA 1E37B 3IITA 4TY7A 1G9IE 1MBQA 3U9AH 3V12A 1G2LA 4DGJA 1SGTA 3ELAH 3SNAA 1B7XB 1LQEA 1IAUA 3TJOA 1GDQA 1TRMA 2W7SA 3TVJB 3QUMP 1SHHB 3P8NA 4FU8A 1HB0B 1O3MA 2PHBA 2F9PA 4KGAA 4VGCB 1BRCE 1WQVH 1BTUA 4BOHA 4H6SB 4X8VH 2CHAC 3RDZA 3E3TA 3F9FA 1BUIA 4ABEA 3LPRA 3ITIA 1OP2A 1EJMA 4TPIZ 3RXIA 1ETRH 2TGDA 2B5TB 3GYMA 5LGOA 4IC6A 9LPRA 1AU8A 1MBMA 5L6NH 2Z9LA 4K8YA 3RXJA 3T62A 2F9UA 4CHAC 1AY6H 4FUCA 3HKJB 2CJIA 1KXBA 2BD3A 2ULLA 1D9IA 1EX3A 1IHSH 1O2QA 2ZWLH 2QF0A 4ABGA 1L0ZA 1OWHA 2EI6A 1TE0A 1F5KU 1UO6A 4Y6DA 2J2UA 1MMJN 1SLXB 2ZHFH 2O8LA 2EA3A 1N1LA 2O8UA 2WUCA 2SNVA 1FIWA 1F5LA 3LDXH 1NRPH 1MD7A 3BG8A 5AF9H 1IHTH 1OOKB 3A89A 4WF8A 2GCTC 2F91A 1GJ7B 2V3HH 1YM0A 2Q6GA 2K1QA 2FLBH 4ZHLU 5EW1H 2OTVA 3QLPH 2W3IA 4MTBA 1SQTA 5DO4H 1TX7A 3RXGA 1XUJA 1QHRB 2OP9A 3SUFA 1GBLA 6GCHF 4BANB 1O3NA 2GCHG 1CVWH 2BHGA 3RLYH 2VIWA 1DFPA 4INHA 1IQJA 1AVXA 1MAXA 2VU8E 2ZF0H 2ZQ2A 1GG6C 2D26C 1GI2A 3U1JB 4NG9H 2WPJS 4MPVA 1L1GA 1A1RA 1MAYA 2BD7A 1GDNA 3QZQA 2STAE 5JBCS 3SU6A 1KTTB 1VGCB 3PLBA 4ZHMU 5E0HA 4WXVA 2BX4A 1NRNH 3ZV9A 3VFEA 1P12E 1G3BA 1XVOA 3NUMA 4MPUA 3RC5A 4Y7BA 1NO9H 3RXLA 4K8BA 1F92A 1FMGA 2FWWA 5C1UA 2Z9GA 1BHXF 1HXFH 5EPNA 1ZPZA 4ZAEA 2FM2A 3LONA 1L4DA 4YOIA 2Z3EA 1LPKB 3LIWA 3TH2H 4I8JA 3M7QA 3E0PB 4UFDH 3VGCB 2SGFE 1C4V2 4ISHH 1TMBH 1TOMH 4WY3A 1Y5BT 2J38A 1TPPA 1D6WA 3HGNA 1ID5H 2QIQA 4F4OC 2SGQE 1P06A 2FI5E 3DFJA 3NXPA 1O3DA 4E06H 4NZLA 3GYLB 4XBDA 2ZFPH 1N6XA 1TGBA 2W26A 2FMJA 2PWXA 5JB8S 4TWYA 3U8OH 1IQLA 1RIWC 1CBWC 1ELVA 2BD5A 3QX5H 1C5YB 1GHAF 1W8BH 3MFJA 2G8TA 5EW2H 4K60A 4LZ4B 3MI4A 2XW9A 2WV4A 4J1YA 2J92A 3LJJA 1V2MT 1P3EA 2Z9KA 3RM0H 1S83A 3GCTF 3RMOH 4RSPA 4WMEA 1TQ7B 3GCNA 2NU1E 1H9IE 1V2UT 4CBOA 2FX4A 3RXEA 2O8MA 3SO3A 1H9HE 1AIXH 1Z8GA 1TMTH 2CF9H 3ZVBA 5DP4A 1MU8B 5F8TA 1XUIA 2R3YA 4ABFA 5H4IB 2Y5GA 3LGWA 1B0EA 1DY8A 3RXHA 4A1XA 1KYNA 1ZPCA 1S82A 5A0AE 4IW4E 1O2KA 1YPJH 2F9OA 2HNTF 4DCDA 3CS0A 1DM4B 1CHGA 2NU4E 1DUEA 1GJ4H 2ALVA 1BTWA 1PPBH 3OY5U 3MNXA 4E7RG 2A7HA 3RM2H 5E0GA 4Y0YE 4B74A 4Q2KA 2D2DA 3LC3A 1LVBA 1GMHF 4WWYA 2QN5T 2HPQH 1DVAH 1C1RA 4Y10E 4X6OA 1D3PB 3RXVA 2M5TA 1MQ5A 1O2JA 1C2GA 2P3UB 1SFIA 1KIGH 1ELDE 1Y3UA 2Y7ZA 1SFQB 5GPIB 3FANA 3OYPA 1MTSA 1O5CB 4NA9H 4H6TA 2PKAB 2F9BH 1SLVB 2VVUA 2ZU1A 3BF6H 1GHVH 2FX6A 4UONA 1O2OA 2FS8A 1O2SA 2RA3A 5FX6A 2H6MA 2QC2A 2ZPSA 4CRCA 2GP9B 1HV7A 1Z6JH 3UNSA 1LTOA 1WQSA 3DHKH 4XSKU 1YCPM 3MO9A 2ZDVH 1O37A 2OCVB 3GCOA 3PB1E 2ZG0H 1Q3XA 4I31A 2DUCA 4Y79A 4AZ2B 2FESH 1ANEA 4YT7H 2QXIA 4AYVB 1MUEB 2GGVB 1MTVA 1QA0A 1O2YA 5EU8A 2FI3E 2ZHEH 3MOCA
chains in the Genus database with same CATH superfamily
4YLUA 2VH6A 3ATIA 1F0SA 3F0PA 3FN8A 3QN7A 1FPHH 1SGPE 1QJ6B 1DY9A 1MU6B 2GVFA 1A2CH 1QURH 4IN1A 3KIDU 1P0SH 2WYGA 4CRFA 1TPSA 1EJNA 3FO8D 1MABB 5DP3A 1EZQA 2XOKD 3P8GA 4LK4A 4RT1A 2K0QA 1LHFH 1KLJH 3VPKA 3GY5A 2ZFFH 1C1OA 2PGBB 2ZNKH 3B23B 3QTOH 3UQVA 2BB4A 1HAYB 1VJ9U 2J9NA 1GMCF 4BAHB 1SGRE 2TGTA 1HCGA 3BG4B 1O0DH 3UR9A 4AN7A 1O30A 1C5SA 2Y7XA 3EYDA 1OWEA 1SGFA 5A2MH 3F9HA 3S7HB 1QBOA 1TBQH 3ZZAA 3TGIE 1EB2A 2L6OA 3V7TA 4IGDA 3ZVDA 1GJAB 4FUBA 5A8ZA 4UD9H 4A7IB 4F49A 3S69A 4U2WA 1CHOF 2GD4B 3G01A 4Y8YA 1B0FA 3TH4H 2VIPA 1ZSKA 1FNIA 2P94A 3S9AA 4YT6H 1AGJA 1DOJA 1HPGA 3DSOA 1KXDA 1L4ZA 3TGKE 3OFND 1W10U 2C8YB 1YLNA 3AAUA 1ZSJA 8ESTE 2TGAA 4XRNA 5C5NA 1FY3A 3C27B 1QQUA 3GY7A 4XOJA 5C1YA 1LCYA 4GCHF 2SGDE 3STIA 4K1EA 2H5DA 3VEQB 4A5TS 2A32A 2UUYA 1P11E 3MH6A 4ABAA 2CHAB 3DFLA 4JZIA 4LZ1H 1MZAA 3RXUA 1GI4A 1YPHE 3I78A 4IS5A 3SQEE 1BZXE 1SB1H 4DT4A 4DURA 5F8XA 1CSOE 4CHAB 2A4OA 1A3EH 3C1KA 3A7TA 4AOQA 4CREA 2BDCA 1Y8TA 2AIPA 3BTTE 3Q77A 1SGEE 2B8OH 1Z6EA 4B75A 2OC7A 1K1IA 1JOUB 1S0RA 2YOLA 3Q3YA 8KME2 3Q3KA 1C2MA 2FODA 4X6MA 3UOPA 3TNSA 1V2TT 1VZQH 3SNEA 3FP6E 5GWZA 8LPRA 1RTLA 5L30H 3RXBA 1BMNH 2BOHB 4R0IA 1BCUH 2ZU5A 2BMGB 1T8OA 3SJOA 1GMDF 3A7ZA 3ATWA 5HM2A 2GCTB 5PTPA 2ZU4A 1OP0A 2V6NA 1YP9A 1A5IA 2EI8A 1GJCB 5A8XA 1IQIA 4XFQA 3QZRA 4FUDA 3K9XB 1ZHMA 1Z8IB 1EAUA 5A8YA 2ZA5A 3ZZ7A 4INLA 1AD8H 2GV7A 3TK5A 1T7CA 1GBFA 2GMTC 1GVKB 2BZAA 2G4UA 1O31A 1CT2E 1HAIH 1BBRK 3BSQA 4NSVA 1YBWA 1BRUP 1ZPBA 3K6ZA 2ZPQA 3A82A 3I29A 3LC5A 3RU4T 1GG6B 1S85A 1AKSA 5EXLA 1S6HA 1NFXA 3A7YA 1CE5A 2C3SA 2EC9H 2FOCA 5DGJA 1O2ZA 2VIOA 2BY6X 3UWIA 4K1SA 1Q2WA 2A0QB 1EP5A 2A31A 1S81A 1SQAA 2NU2E 4A92A 3QTVH 1D4PB 4GAWA 1C5OH 5IYTA 1C9PA 1QB1A 1GBIA 5I25A 1Y5AT 5EOKA 2GDDA 1J14A 1IOEA 2OC0A 2FOFA 4UFEH 1TGCA 1NFWA 4WJG2 5DJ7A 1TAWA 4FUHA 2PR3A 4MLFB 2FO9A 1UTNA 4MQAA 3UQOA 3ATMA 3SGQE 1VR1H 2Z94A 4HI3A 5AVDA 1ZYOA 4B6FA 1WXRA 3TGJE 1LHGH 2Z9JA 1UVSH 4ABDA 1C5PA 3KF2A 3ZVCA 1ESBA 1KXFA 1K2I1 5DP5A 1HJAC 3LOXA 2H2ZA 2G51A 3U8RH 2BVSH 4B1TA 4IN2A 2AGGX 2QV1A 1A46H 2FOMB 2ZDKA 1OSSA 3PRBA 4X1PU 3RC6A 1NC6A 3OY6U 1OX1A 3M7UA 4AGKA 3SNCA 1NFYA 1GJ6A 1BA8B 1KXCA 3L6PA 3SGBE 1EP6A 3QWCH 2QXHA 1EQ9A 1P57B 2Y80A 4UFGH 4OS5A 3SBKA 4FUEA 1RIWB 1CBWB 1YWUA 1PQ7A 4B2AA 4K3JA 2F83A 2OINA 1MTNC 2IJOB 5EJZA 4ZKOU 1O2HA 3P92A 1BJVA 3BN9A 1SPJA 1C2LA 2ZDAH 2WINI 4MNWA 3SZNA 3ZVFA 2ZFTA 4X8TH 5ESTE 1UVTH 3A8AA 4O3TA 3LGYA 1C9TA 1WBGB 2FS9A 2BLVA 3HK3B 3ZZ4A 3UR6A 2ZFSA 2XWAA 2ZCHP 3SV7A 1QQ4A 3TITA 2Z6BD 3M5MA 6GCHG 3UTUH 1PQ5A 3PO1C 1C1MA 3D23A 3M3VA 4MPWA 4D7FA 5T3HA 4RKOB 3H09A 3GDUA 1NTPA 1YCPH 1WDIA 4OS6A 5J4QA 3RXFA 1O3PB 1MKWH 1CA8B 3N7DA 3W94A 1GI6A 3OTJE 2AH4X 1FY4A 3E91A 1TLDA 3BTEE 2HVXA 1THSH 5GJ4B 2TIOA 1DWBH 2FTMA 2RCEA 4NFFA 4ZKNU 3E90B 1ELCA 2ZTYA 2SFAA 2FOEA 3A83A 5CHAC 2FLRH 4MVNA 5ETXA 1O34A 2SGEE 2ZTZA 1F0UA 4ISLA 1CQQA 3RXTA 4U01A 4GHQA 1TPOA 4BAMB 3I77A 1DUAA 1DWCH 3VB5A 3ZYDA 1PPHE 3TU7H 1INCA 2BM2A 1TGTA 3MNSA 1BMLA 1HFDA 4DIHH 2AERH 1AO5A 5A09A 1GPZA 1GI9B 1W7XH 2FI4E 2WHXA 1BB0B 1O2NA 1ABJH 2BTCE 2WPMS 4LXBH 3MU8A 5L2ZH 1DPOA 4HFPB 1VJAU 1TGNA 2D1JA 1G3EA 1QB9A 1XMNB 1BTZA 2JETC 2R0LA 1TNIA 4P02A 1E36B 1GBKA 1S5SA 4A6LA 1L2EA 8GCHF 1HYLA 1LHCH 3SNDA 2B0FA 1GBHA 1C2KA 1O39A 3KHVA 4NIXA 2W6JD 1BTHH 4YTAA 2TBSA 1EZSC 3SJ8A 2C8XB 4NSYA 1ETTH 1FPCH 1HDTH 2KZ4A 1QTFA 1ELEE 1O5EH 3A80A 2Z7FE 4I8KA 3MU1A 4F55A 1CT0E 1NU7B 1GHAG 2FPZA 2RFKC 2AMPA 1FX0B 1P02A 1O2VA 1IQHA 2NU3E 1BDAA 2XYAA 2ZGXH 3RXKA 2FYRA 2XNIA 4Q63A 1SR5C 1D3QB 1S84A 2JH0D 1G30B 1EPTA 1QZ8A 3GCTG 1NPMA 1OKXA 1PPCE 3D62A 5C3NA 1NY22 1SKYE 1LO6A 1O2UA 1IQEA 3UUZA 1P05A 2GZ7A 1BTPA 3NKKA 3QDZB 1GBJA 2QCYA 3MNCA 3RUOA 5E2OA 4X1QU 1UVOA 3A84A 3RMNH 4B2CA 3BTWE 3BIVH 3F9EA 2WPHS 2FOAA 1SGNE 1JRSA 1OHHD 1ZTKA 1F5RA 2ZFQH 3A85A 3GDVA 1M9UA 4WH8A 2OD3B 1ELGA 1SOTA 1UCYH 3O8BA 4BAKB 4JYVH 3UB0A 1PFXC 1AUJA 4FUFA 3MTYA 1O2IA 3P17H 2G81E 3SV9A 5CMXH 4CH8B 1BITA 1TX8A 3KQ5A 1DXWA 3ESTA 1GMHG 5LPRA 1N8OC 1K1OA 4WMDA 2FOBA 1TABE 1NRRH 1RD3B 1P01A 3BEFB 4KTSA 2HNTE 4ISOA 3SHCH 4X0WU 1GL0E 5IK2D 3KGPA 1QRWA 1D3TB 1KDQB 1DWEH 3UPEA 1WCZA 1P10A 1GCDA 1HIAA 4DIIH 1AFEH 3VB4A 1T4VH 2ZIQH 1CGHA 4ISIH 1BBRE 2F43B 1DE7H 2TRMA 2FXRA 1W0YH 1GHYH 3PTNA 4AGJA 2RDLA 3MYWA 3SNBA 5JBAS 4M7GA 1EAWA 2GTBA 4I8LA 2OBQA 1FAKH 4ASHA 1O3GA 4B6EA 4QT8C 5FCRA 1PQ8A 2C90B 1E1RD 5SGAE 2ZHDA 1A5GH 2OQ5A 1L1JA 1PPEE 1WUNH 1AB9C 2ODQA 2ZECA 2QGRA 2Z9IA 1YKTA 3RXOA 3L3TA 3M3TA 1XVMA 1DS2E 1DXPA 5LH8A 2QXGA 3NK8A 5K0HA 5KEDA 3M5LA 5FCKA 2Y82A 4ACBA 1ZLRA 4GUXA 3CP7A 1NRQH 1ZJKA 2BXTH 1TALA 1CT4E 1PPFE 1V3XA 3TLOA 3P8FA 2ZC9H 1A4WH 4FU9A 2ANYA 4K1TA 2G5NA 3W95A 3BTHE 1XXFA 1QNJA 1QFKH 3MWIU 1HLTH 2PKSC 3M36A 3BTKE 3H7TA 1TMUH 4Y7AA 1O3BA 1UJ1A 2FEQH 3LT3A 4H4FA 2C8ZB 3EGKH 2J94A 1GI7B 3SJKA 2Q6DA 4D9QA 1GI1A 4R8TB 1C1TA 1PPGE 1BHXB 1WYKA 3E8LA 1GMCG 1Z7KA 1ANBA 4BXSA 1O5BB 1SLWB 3DCLA 5FHTA 2ASUB 1SSXA 4HTCH 4JYUH 3LU9B 4KTCA 1MKXK 2P3TB 2ODYB 4NIYA 3MH5A 2Y5HA 4IC5A 5TCAA 2W5EA 1NU9A 3AW0A 4AFQA 2GMTB 3PLKA 2WZQA 2TGPZ 4I32A 3SU3A 1IQGA 1CHOG 1K22H 4U30A 3UY9A 4ZXYH 1DT2A 1K0HA 4AX9H 1KXAA 3ZZ6A 1K1JA 2HLCA 5FAHA 4ZMAH 3FP8E 3GS9A 2GZ9A 1EKBB 4ZH8A 4LOYH 4RN6A 2YNBA 1C2EA 2VJ1A 1A0JA 2J98B 3BTQE 1K1PA 4OM9A 1AFQC 3Q3XA 4F48B 4B76A 1ESAA 3B9FH 4GCHG 3SU4A 3OX7U 1TPAE 2BD8A 1H8ED 1YC0A 2OQUA 3KQBA 4ZROA 2KCYA 5EQSA 1UTJA 4FETA 1CU1A 1V2LT 1C4Y2 1E1QD 1IQKA 3S9CA 3SUGA 3LGIA 2WYJA 2VINA 3UFAA 2GJGA 3WY8A 2F3CE 1C5MD 1TGSZ 2H1UA 1HJAB 2VWOA 5FPTA 3CNRA 3M35A 2XBXA 2WV5A 2ZZUH 5I46H 1DSUA 1GJ5H 5F8ZA 1FY8E 3GY6A 1GBMA 1BTXA 2JJ1D 1ZTJA 1FI8A 3OTPA 4X1RU 3PMHB 4FVDA 1RFNA 1P2QA 2JKHA 3FZDA 2VIVA 3KQDA 3PWCA 1FDPA 1GCTC 1SGFG 1OP8A 3DD2H 2Q1JA 4ZHAA 5EXMA 3AW1A 1TNGA 2YMSC 1MCVA 1E0FD 1KTSB 1GMDG 1GBDA 1QRXA 2AGEX 1MTNB 2BOKA 2R3UA 2UWLA 1H1BA 1V2PT 2XXLA 1ZRBA 3N99A 2OK5A 5HKKD 1RS0A 1EFRD 4WMFA 4X2WA 1ELFA 3JZ1B 1HJ8A 1Y5UT 2IJD1 2W3KA 2B7DH 4FVBA 6CHAC 1HAVA 3H7OA 3PRDA 2ZP0H 4TY6A 3M5OA 3FKSD 1Z8JB 3PO1B 1QL8A 1VCQA 3LGTA 4YZUA 4ASUD 1YPGH 3U69H 3MNBA 3HK6B 5IDKA 2G5VA 2VWNA 3ZZBA 1W7GH 1ZGIA 2EQNA 1DWDH 1DLEA 3VB3A 5KECA 2XCFA 3URDA 1LPZB 3ZV8A 1C5LH 4Y71A 1THRH 1VCWA 1JXPA 1PPZA 4ABHA 3W1EA 5AFZH 2QF3A 5CHAB 2EI7A 1ARCA 2A1DB 3KNXA 1TQ0B 2UUKB 2I6QA 1EAXA 3Q00A 2AIQA 3OU0A 2BY7X 2KAIA 2GKVE 3LGVA 2ZCKP 4MNXA 1JRTA 2ANKH 2VVVA 4NCYA 1UHBA 3EDXB 3F68H 3SU1A 1Z71A 1MZDA 1SG8B 1XXDA 2A7CA 5ESBA 5GXPA 1G2MA 4NA7A 4TSFD 1VITH 1TFXA 4GVUA 4JYTA 4KELA 5JDUB 1FUJA 1SVPA 2WPIS 3RU4D 3TIUA 1T8NA 1O2MA 1QJ1B 4FUIA 1C5TA 4CR9A 1CA0C 4DT7B 2JETB 3MU5A 3PM3A 4X8SH 4JMYA 1GBEA 4CR5A 4WH6A 7LPRA 1TWXB 2SGAA 4UFFH 1Y3XA 4E7NA 4I8HA 1SMFE 1ELBA 1C1WH 1GJ9B 1SGCA 2JJ2D 3DUXH 1G32B 1W0JD 4BTUB 4GPGA 4HGCA 5GIBA 2NU0E 2Z3DA 1COWD 3PMBB 4SGAE 1V2VT 3BTME 3KYGA 1NROH 1ELTA 1GDUA 1UVUH 1Z8RA 3URCA 1E35B 5BRRE 2ZGCA 7GCHF 3K6YA 1K1LA 1BTYA 2ZGHA 4UDWH 1UK3A 1PYTC 4E05H 2PLXA 3T28A 2VGCC 3S7KB 5L2YH 1KLIH 1HAOH 4ZKRU 3TJVA 1RGQA 2ZI2H 4XBBA 4Y11E 2GDEH 3NCLA 1S6FA 3R3GB 1G36A 1GHBF 1L1NA 3AVZA 1S0QA 3L33A 4O97A 4Y76A 5KGOA 3PMJA 3T25A 1TNHA 1GBTA 1O3IA 2VBCA 2XC5A 2ANWA 2KCAA 3VB7A 4BXWA 3GCHC 5E2PA 1XUHA 1T8LA 2SNWA 3NRLA 1EPTC 1GBBA 2BD4A 2BVRH 1VITF 1GI0A 3S0NA 4Z6AH 3EA7A 2BLOA 3B8JA 2ESTE 5EG4A 1T31A 4MG3A 5A0CA 2LELA 3F2GA 4HZHA 1ACBE 2CF8H 1P04A 4B71A 4OS7A 1MH0A 3VXFH 1DX5M 1YPMH 2CMYA 7ESTE 1YPLH 2WSSD 3RMLH 1NT1A 3UNRA 3F2HA 2ZDLA 3GY8A 4Z0KA 1GJBB 3RC4A 1YF4A 3PV4A 2BQ6B 1FZZA 3MMGA 2BDBA 1C5QA 5FBIA 3MQKC 2A4QA 1HAPH 4Y8ZA 1O38A 2BY8X 2IPHA 3IG6B 3A8DA 1N8OB 3TH3H 4NA8A 5FL7D 3GOVB 1G3CA 4D9RA 3SU5A 2UWOA 5DP7A 2G52A 5HGGA 5DPAA 5TCCA 1GBAA 3U28C 4ABIA 1BOQA 2G55A 3OSYA 4YO9A 1E38B 2QAAA 1AVWA 1MQ6A 1THPB 5E8EH 1HXEH 1HAGE 5DKMA 1W3CA 2XBWA 4TYDA 8GCHG 3LGUA 1C5NH 1K21H 2FZZA 1LMWB 3HPTB 1MTWA 1EOLA 2FIRH 2QE7D 3RXDA 4OGXA 2PUQH 1SI5H 1A61H 2YMSD 5DP6A 3DT0H 3SYJA 4YLQH 2P16A 1SGIB 4CRDA 1P9UA 2G4TA 2KR7A 1GVZA 2O8WA 1TNLA 1XKAC 1BRAA 5EGMA 5GCHF 3S9BA 4M9FA 4FOUC 2UWPA 3SU2A 2IOTA 1TNJA 3WW7A 1O5GH 1XUKA 1K9OE 2BD9A 4WVPE 4K69A 4O03A 3SORA 1Z1IA 1QB6A 1AB9B 2QYIA 4NIWA 5JPMH 4NWLA 5FPYA 1P2MA 2IN2A 4JZFH 1TA2A 1F2SE 1CO7E 1GI3A 1EZXC 1JMOH 1XUGA 1JWTA 3ZZDA 4Y8XA 4AB8A 4Q80A 2CK3D 2BQ7B 2ZCLP 2BD2A 4YOJA 1A0HB 5TJXA 3ODFA 2ODPA 4MPXA 1CGIE 1A0LA 2PKSB 3GY4A 1NFUA 3HATH 1AZ8A 1WOFA 1O2LA 3EE7A 1TB6H 4OS1A 1KY9A 5FX5A 2ZEBA 2EEKA 3PV2A 2IPQX 1NBMD 2LP6A 3FVFB 1ZHRA 2P95A 4AC9A 4O3UA 3SUDA 1NN6A 1W11U 3R0FA 2B9LA 1TRYA 3D49H 2GZ8A 1FXYA 3HGPA 1QCPA 1O36A 1ZMJA 5CDFE 1NESE 1DDJA 2HPPH 3A7VA 6ESTA 1QA7A 5B6OA 1OS8A 3LJOA 1FAXA 1GL1A 5F53A 4ISNA 1K1MA 2R2MB 3ZZ5A 2XTTB 5HM9A 1TIOA 5F03A 2BY5X 1VCPA 3LH1A 3RXRA 4D7GA 4DY7B 1P3CA 1QR3E 2A4GA 4XDEA 1O3KA 3K65B 5JB9S 1KLTA 1ZSLA 1BRBE 3UREA 1C5UA 1HAZB 5G4BA 3V0XA 5HIYA 1GI8B 1QRZA 2ANMH 5DG6A 1HJ9A 1IQNA 1C4U2 1UMAH 1MCTA 2ZQ1A 3H5CB 1QL7A 4JCNA 1WTHD 1ABIH 1FONA 4FUJA 4UEHH 3F1SB 4AFSA 4ZKSU 1FJSA 1V6DA 4B73A 1AKSB 1P2JA 3FAOA 3U8TH 1PYTD 1AFQB 5C1XA 1C5ZB 3RLWH 3F2FA 3PWBA 1FV9A 1O2WA 5C0UA 5F6MA 1P09A 1GWAA 2R2WU 2J97A 3SOSA 2EY4C 2GT8A 1UTLM 2O9QA 2WUBA 3M37A 4IMZA 1S6LA 2VWMA 1P2OA 4CH2B 3ZZCA 4FUGA 2FOGA 3F6UH 1OYQA 2PKAA 1HGTH 4X1NU 1V2NT 2A2XH 4BTIB 3TJUA 2NWNA 2RG3A 1J17T 1W12U 2YNAA 2RA0A 1O5DH 2A2QH 3A7WA 3AASA 3VXEH 2JH6D 2G00A 2A5KA 2P8OC 1QY6A 5K7RA 1AWHB 1EB1H 4DW2U 2BLWA 1P2NA 2JIZD 1UCYE 4I33A 1O5FH 1ANCA 4MNYA 1J15A 2FDAA 2ZHQH 1EOJA 2TPIZ 1JBUH 1BJUA 1GCTB 2OUAA 1EASA 5C2ZA 1YPEH 2YMSB 1BIOA 1D3DB 3A7XA 6LPRA 3T26A 1QJ7B 1AUTC 1UK2A 4X6PA 5C94A 1DANH 1H8DH 3VB6A 1BQYA 2PSYA 2J4IA 1UK4A 3FZZA 1SGQE 4DG4A 1O3LA 3CS7A 1LVYA 1SGDE 1ZTLA 2XC0A 3GICB 1NZQH 3GY2A 1ZZZA 1D6RA 3SU0A 1HRTH 1CGJE 1U6QA 4JZEH 3QK1A 1V2JT 4JZDH 1FQ3A 2HLDD 3VG8A 1C1VH 2SGPE 4JZ1A 1QGFA 3BEUA 2FP7B 2PUXB 6CHAB 2GV6A 2KX4A 5T1VA 5LPEA 1O3OA 2W6ID 1IQMA 1HAXB 2OXSA 2VH0A 3SV6A 4FXGH 1LKBA 2BDYA 3ZVGA 1LVMA 3BTFE 3GY3A 3P95A 2VWLA 2I6SA 2V3OH 4FU7A 4ZUHA 1DICA 4O9VA 2UUJB 1SL3A 3M7TA 5GNDA 4Q7XA 3E0NB 2JH5D 1P8VC 2XBVA 2ZO3H 3KL6A 3SV2H 5FBEA 3ZVEA 3MHWU 1WAYB 3MH7A 2Y5FA 5C0TA 1FN6A 1GVLA 4MDSA 4CBNA 4YXWD 5JBBS 4A1VA 3BV9B 1GGDC 2BDAA 1TOCB 3LH3A 3EE0B 4DOQA 3RXMA 1BBRH 4U32A 1LHDH 2BXUH 2HGTH 1FIZA 2M2AA 3GISB 3DSGA 3KEEA 4WXIA 4YOGA 3RXQA 2P3FH 4K2YA 5FPSA 3TNTA 5C67A 2THFB 4AB9A 1G37A 2ZPRA 3SW2B 2GCHF 3UOUA 3T2NA 3E16B 1CA0B 1LQDB 1C2DA 1WV7H 4NIVA 3SQHE 3NZIA 1PQAA 4HG6A 2AEIH 5E0JA 1YPHC 2FYQA 2DE8A 2H9HA 4KTUA 3M5NA 3P70B 2AMQA 1J16A 3EA8A 2STBE 2Q6FA 4YESB 1P2IA 1QBVH 4BTTB 3MO6A 1V2ST 1UTOA 2A4RA 3ZZ9A 3SJIA 3BEIB 3GDSA 1XUFA 1UVPA 1B5GH 2R0KA 3SI4H 2PP6A 2BX3A 4VGCC 3P6ZB 1W0ZU 1EUFA 2AYWA 4OS4A 2QA9E 3UNQA 1C1QA 1ZOMA 1ZR0A 9ESTA 2VGCB 4A1TA 1HUTH 4INKA 1J8AA 1JIRA 1GBCA 1Y3WA 3D65E 2Y6TA 5EQRA 4ESTE 2QF5A 1KMHB 1C1PA 1V2OT 4NFEA 4X2VA 5FXLA 1H8HD 4JK5A 3GCHB 1OXGA 1A5HA 3SJ9A 2H5CA 1EPTB 2XCNA 2PV9B 3ZZ3A 4X2XA 1DITH 1RJXB 1V2RT 1WU1A 4XBCA 2F9NA 3QO6A 1YGCH 2V7QD 2ZU2A 4CRGA 2V0BA 1EJAA 2GT7A 3ZZ8A 3FP7E 4X2YA 1LHEH 1O3FA 3IWMA 2WPDD 3SI3H 1RXPA 2C4FH 2BDIA 1ZGVA 1P9SA 2ILNA 4YM9A 1ZHPA 1P2KA 4TWWA 5HMAA 2OC1A 1C2FA 1LVOA 1YCPK 1YLCA 1DSTA 2J34A 2H9EH 1O3JA 3KQCA 1Y59T 1MKWK 1F0RA 3F3BA 5CE1A 1SQRA 1UTKA 2WPKS 1AMHA 2A45B 4ZCNA 1H8IH 4AFZA 2J95A 2WV9A 2BZ6H 1NS3A 4RI0A 4TPYA 3FFGA 1ANDA 1O33A 1TA6A 1HNEE 1X7AC 3RXCA 3TK6A 5DSFA 3K2UA 1FLEE 3T27A 4XD7D 2HRVA 3Q76A 3F9GA 3WWBA 1GHXH 2ZKSA 5DN6D 1V2WT 1AN1E 3STJA 1BMAA 2BLQA 3EA9A 2PFEA 3M61U 3UAIC 4SGBE 5J4SA 1TBZH 4X8UH 1AVGH 3FOAA 2PTNA 4ABJA 1ORFA 4NZQA 3SUEA 2VB0A 3OEHD 2VIQA 3ZVAA 4J2YB 4I8GA 4P00A 1VGCC 1W13U 5HXFA 2LPRA 3P8OA 1K1NA 3WWFA 4THNH 3MU0A 1SOZA 1HIAB 2ZGJA 1XM1A 1T8MA 2P59A 1XX9A 7GCHG 1O2XA 5EQQA 1C1NA 1Y3VA 2QXJA 4XE4A 1GHZA 4GHTA 1KXEA 2A7JA 1P03A 1MD8A 2ZDNA 1F7ZA 1C2IA 3MH4A 4B2BA 2PGQB 1C2HA 4X6NA 3NPSA 3PMAB 1GHBG 3RP2A 4ABBA 3SV8A 1J9CH 1FY1A 2VVCA 4Q4LA 3ATLA 5C5OA 2Y81A 1OPHB 1A3BH 5AFYH 3PTBA 1F0TA 3UWJH 2DE9A 2CGAA 1C2JA 3DSPA 1GJDB 1RTKA 3VGCC 3BTDE 1AE5A 4IBLH 4K5ZA 1VITG 1LPGB 3AAVA 3RXAA 1O3EA 4NGAH 4AG2A 1C5RA 3MO3A 3BIUH 1C1SA 1RRKA 4AYYB 2W7UA 1SC8U 1AZZA 4UE7H 1H9LB 1O3AA 1TONA 5GDSH 4D76A 3A8BA 2OLGA 1QIXB 3JZ2B 2PSXA 1C5XB 2PTCE 1SBWA 1BMFD 3AK5A 3RXSA 2F9VA 1MTUA 1YPKH 1K28D 1EATA 1Y3YA 7KMEH 1OWJA 1AI8H 5EJ1A 3RU4E 4GLYA 3V13A 1Q31A 1AE8H 3KQEA 3A81A 3N7OA 1AQ7A 4JK6A 5DK1A 3SN8A 3U1IB 2C8WB 1UCYK 1OYTH 1C5WB 1GHWH 1V2KT 2A5AA 4KP0A 3RMMH 1YLDA 1EAIA 1FY5A 3SGAE 3PROA 1OWKA 3O8DA 4IMQA 3QGJA 1KSNA 1TBRH 3ATKA 1EXFA 1SHYA 1BMMH 2AFQB 4BAQB 5JBTA 3QGNB 3OE7D 1AHTH 3RXPA 4MNVA 3NWUA 5GCHG 1QL9A 2AS9A 2XWBI 3CENA 3TPIZ 1TX6A 2ZHWH 1QBNA 1O5AB 4ZXXH 5C20A 3KCGH 2HALA 2BDGA 1ARBA 4I86A 1LKAA 3PV5A 1E34B 4OGYA 5EXNA 2HWLB 4I7YH 5T6DA 1RTFB 1WSSH 2P93A 4D8NA 2ZDMA 3ZIAD 1ZJDA 1W14U 1SQOA 1ZMNA 1N6YA 1SGYE 3E6PH 3ENSB 2F4LA 2VNTA 4CRAA 2BQWB 2BDHA 2ZFRH 4OS2A 2PW8H 3A86A 1HAHH 2VIDA 2O8TA 2XRCA 2P8OB 1OWDA 5EODA 1A7SA 1V2QT 2ZTXA 3A8CA 3ODDA 2XBYA 1O3HA 3U98H 5B6LA 1UTPA 1W2KH 1WTGH 1O2RA 1IQFA 5EPYA 1ZMLA 1H4WA 2LNCA 5T6FA 5BPEA 3TK9A 2CXVA 4CRBA 4X1SU 2FOHA 4H42U 1GJ8B 4GSOA 3A88A 4KKDA 3MU4A 5JYIA 2QY0B 5DP9A 3KN2A 4PROA 1O2GH 1UTMA 1O32A 3BTGE 3A87A 2L74A 3E1XB 2D8WA 2ALPA 2ZU3A 3ZYEA 1O3CA 3SZEA 1W0KD 1XKBC 3HKIB 2AMDA 3PLPA 3EQ0H 3TJNA 3LKWA 4AORA 2BY9X 4BAOB 1C5VA 3PYHA 1JIMA 2V35A 4Q7ZA 5EIYA 2V3MA 1PJPA 2A5IA 4DJZB 1HAVB 2OBOA 2OC8A 2R9PA 2H9TH 1ELAA 1NM6A 4DVAU 3O8CA 1TNKA 3V3MA 1GI5A 1ETSH 4Y0ZE 3T29A 2BVXH 2CN0H 1FN8A 1ZRKA 1G3DA 3T5FH 1MKXH 2AGIX 2BYAX 1O2PA 2Z3CA 4AFUA 2HNTC 2WPLS 2HOBA 5LPFA 5A0BA 2CV3A 2UUFB 2C93B 1T4UH 5AHGH 2FTLE 3EAJA 1BT7A 1Z1JA 1GGDB 3UIRA 1O2TA 2ZGBH 1ESTA 4AG1A 1TYNA 3BG4C 3O8RA 5DP8A 1EZUC 1DLKB 1HBTH 4NWKA 1O35A 2GX4A 2XC4A 1KDQA 4Q7YA 1C1UH 5ABWA 5T6GA 4BNRA 3M3SA 1AWFH 1SLUB 2KAIB 1LDTT 3DA9B 1UHBB 3SHAH 5HYOA 1YYY1 1NRSH 1OWIA 1T32A 4RKJB 1TRNA 1UTQA 1E37B 1NBME 3IITA 4TY7A 1G9IE 1MBQA 2RDEA 3U9AH 3V12A 1G2LA 4DGJA 1SGTA 3ELAH 3OAAD 3SNAA 2XNDD 1B7XB 1LQEA 1IAUA 3TJOA 1GDQA 1TRMA 2W7SA 3TVJB 3QUMP 1SHHB 3P8NA 4FU8A 1HB0B 1O3MA 2PHBA 2F9PA 3OEED 4KGAA 4VGCB 1BRCE 1WQVH 1BTUA 4BOHA 4H6SB 4X8VH 2CHAC 3RDZA 3E3TA 3F9FA 1BUIA 4ABEA 3LPRA 3ITIA 1OP2A 1EJMA 4TPIZ 3RXIA 1ETRH 2TGDA 2B5TB 3GYMA 5LGOA 4IC6A 9LPRA 1AU8A 1MBMA 3F0OA 5L6NH 2Z9LA 4K8YA 3RXJA 3T62A 2F9UA 4CHAC 1AY6H 4FUCA 3HKJB 2CJIA 2KCOA 1KXBA 2BD3A 2ULLA 1D9IA 4RT0A 1EX3A 1IHSH 1O2QA 2ZWLH 2QF0A 4ABGA 1L0ZA 1OWHA 2EI6A 1TE0A 1F5KU 1UO6A 4Z1MD 4Y6DA 2J2UA 1MMJN 1SLXB 2ZHFH 2O8LA 2EA3A 1N1LA 2O8UA 2WUCA 2SNVA 1FIWA 1F5LA 3N7EA 4TT3D 3LDXH 1NRPH 1MD7A 3BG8A 5AF9H 1IHTH 1OOKB 3A89A 4WF8A 5CHBA 2GCTC 2F91A 1GJ7B 2V3HH 1YM0A 2Q6GA 2K1QA 2FLBH 4ZHLU 5EW1H 2OTVA 3QLPH 2W3IA 4MTBA 1SQTA 5DO4H 1TX7A 3RXGA 1XUJA 2JDID 2J5UA 1QHRB 2OP9A 3SUFA 1GBLA 6GCHF 4BANB 1O3NA 2GCHG 1CVWH 2BHGA 3RLYH 2VIWA 1DFPA 4INHA 1IQJA 1AVXA 1MAXA 2VU8E 2ZF0H 2ZQ2A 1GG6C 2J98A 2D26C 1GI2A 3U1JB 4NG9H 2WPJS 4MPVA 1L1GA 1A1RA 1MAYA 2BD7A 1GDNA 3QZQA 2STAE 5JBCS 3SU6A 1KTTB 1VGCB 3PLBA 1E79D 4ZHMU 5E0HA 4WXVA 2BX4A 1NRNH 2KM0A 3ZV9A 1VKYA 3VFEA 1P12E 1G3BA 1XVOA 3NUMA 4MPUA 3RC5A 4Y7BA 1NO9H 3RXLA 4K8BA 1F92A 1FMGA 1UW7A 2FWWA 5C1UA 2Z9GA 1BHXF 1HXFH 5EPNA 1ZPZA 4ZAEA 2FM2A 3LONA 1L4DA 4YOIA 2Z3EA 1LPKB 3LIWA 3TH2H 4I8JA 3M7QA 3E0PB 4UFDH 3VGCB 2SGFE 1C4V2 4ISHH 1TMBH 1TOMH 4WY3A 1Y5BT 2J38A 1TPPA 1D6WA 3HGNA 1ID5H 2QIQA 4F4OC 5C17A 5HIZA 2SGQE 1P06A 2FI5E 3DFJA 3NXPA 1O3DA 4E06H 4NZLA 3GYLB 4XBDA 2ZFPH 5EJLA 1N6XA 1TGBA 2W26A 2FMJA 2PWXA 5JB8S 4TWYA 3U8OH 1IQLA 1RIWC 1CBWC 1ELVA 2BD5A 2QF4A 1C5YB 1GHAF 3QX5H 1W8BH 3MFJA 2G8TA 2KFWA 5EW2H 4K60A 4LZ4B 3MI4A 2XW9A 2WV4A 4J1YA 2J92A 3LJJA 1V2MT 1P3EA 2Z9KA 3RM0H 1S83A 3GCTF 3RMOH 4RSPA 4WMEA 1TQ7B 3GCNA 2NU1E 1H9IE 1V2UT 4CBOA 2FX4A 3RXEA 2K8IA 2O8MA 3SO3A 1H9HE 1AIXH 1Z8GA 1TMTH 2CF9H 3ZVBA 5DP4A 1MU8B 5F8TA 1XUIA 2R3YA 4ABFA 5H4IB 2Y5GA 3LGWA 1B0EA 1DY8A 3RXHA 2KCPA 4A1XA 1KYNA 1ZPCA 4ACAA 1S82A 5A0AE 4IW4E 1O2KA 1YPJH 2F9OA 2HNTF 4DCDA 3CS0A 1DM4B 1CHGA 2NU4E 1DUEA 1GJ4H 2ALVA 1BTWA 1PPBH 2AHME 3OY5U 3MNXA 4E7RG 2A7HA 3RM2H 5E0GA 4Y0YE 4B74A 4Q2KA 2D2DA 3KYFA 3LC3A 1LVBA 1GMHF 4WWYA 2QN5T 2HPQH 1DVAH 1C1RA 4Y10E 4X6OA 1D3PB 3RXVA 2M5TA 1MQ5A 1O2JA 1C2GA 2P3UB 1SFIA 1KIGH 1ELDE 1Y3UA 2Y7ZA 1SFQB 5GPIB 3FANA 3OYPA 1MTSA 1O5CB 4NA9H 4H6TA 2PKAB 2F9BH 1SLVB 2VVUA 2ZU1A 3BF6H 1GHVH 2FX6A 4UONA 1O2OA 2FS8A 1O2SA 2RA3A 5FX6A 2H6MA 2QC2A 2ZPSA 4CRCA 2GP9B 1HV7A 1Z6JH 3UNSA 1LTOA 1WQSA 3DHKH 4XSKU 1YCPM 3MO9A 2ZDVH 1O37A 2OCVB 3GCOA 3PB1E 2ZG0H 1Q3XA 4I31A 2DUCA 4Y79A 4AZ2B 1YY3A 2FESH 1ANEA 4YT7H 2HVYB 2QXIA 4AYVB 1MUEB 2GGVB 1MTVA 1QA0A 1O2YA 5EU8A 2FI3E 2ZHEH 3MOCA
chains in the Genus database with same CATH topology
4YLUA 2VH6A 3ATIA 1F0SA 3QN7A 1FPHH 1SGPE 1QJ6B 1DY9A 1MU6B 2GVFA 1A2CH 1QURH 4IN1A 3KIDU 1P0SH 2WYGA 4CRFA 1TPSA 1EJNA 5DP3A 1EZQA 3P8GA 4LK4A 1LHFH 1KLJH 3VPKA 3GY5A 2ZFFH 1C1OA 2PGBB 2ZNKH 3B23B 3QTOH 3UQVA 2BB4A 1HAYB 1VJ9U 2J9NA 1GMCF 4BAHB 1SGRE 2TGTA 1HCGA 3BG4B 1O0DH 3UR9A 4AN7A 1O30A 1C5SA 2Y7XA 3EYDA 1OWEA 1SGFA 5A2MH 3F9HA 3S7HB 1QBOA 1TBQH 3ZZAA 3TGIE 1EB2A 3V7TA 4IGDA 3ZVDA 1GJAB 4FUBA 5A8ZA 4UD9H 4A7IB 4F49A 3S69A 4U2WA 1CHOF 2GD4B 3G01A 4Y8YA 1B0FA 3TH4H 2VIPA 1ZSKA 1FNIA 2P94A 3S9AA 4YT6H 1AGJA 1DOJA 1HPGA 3TGKE 1KXDA 1L4ZA 1W10U 2C8YB 3AAUA 1ZSJA 8ESTE 2TGAA 5C5NA 1FY3A 3C27B 1QQUA 3GY7A 4XOJA 5C1YA 1LCYA 4GCHF 2SGDE 3STIA 4K1EA 2H5DA 3VEQB 4A5TS 2A32A 2UUYA 1P11E 3MH6A 4ABAA 2CHAB 3DFLA 4JZIA 4LZ1H 1MZAA 3RXUA 1GI4A 1YPHE 3I78A 4IS5A 3SQEE 1BZXE 1SB1H 4DURA 5F8XA 1CSOE 4CHAB 2A4OA 1A3EH 3C1KA 3A7TA 4AOQA 4CREA 2BDCA 1Y8TA 2AIPA 3BTTE 3Q77A 1SGEE 2B8OH 1Z6EA 4B75A 2OC7A 1K1IA 1JOUB 1S0RA 2YOLA 3Q3YA 8KME2 3Q3KA 1C2MA 2FODA 4X6MA 3UOPA 3TNSA 1V2TT 1VZQH 3SNEA 3FP6E 5GWZA 8LPRA 1RTLA 5L30H 3RXBA 1BMNH 2BOHB 4R0IA 1BCUH 2ZU5A 2BMGB 1T8OA 3SJOA 1GMDF 3A7ZA 3ATWA 5HM2A 2GCTB 5PTPA 2ZU4A 1OP0A 2V6NA 1YP9A 1A5IA 2EI8A 1GJCB 5A8XA 1IQIA 4XFQA 3QZRA 4FUDA 3K9XB 1ZHMA 1Z8IB 1EAUA 5A8YA 2ZA5A 3ZZ7A 4INLA 1AD8H 2GV7A 3TK5A 1T7CA 1GBFA 2GMTC 1GVKB 2BZAA 2G4UA 1O31A 1CT2E 1HAIH 1BBRK 3BSQA 4NSVA 1YBWA 1BRUP 1ZPBA 3K6ZA 2ZPQA 3A82A 3I29A 3LC5A 3RU4T 1GG6B 1S85A 1AKSA 5EXLA 1S6HA 1NFXA 3A7YA 1CE5A 2C3SA 2EC9H 2FOCA 5DGJA 1O2ZA 2VIOA 2BY6X 3UWIA 4K1SA 1Q2WA 2A0QB 1EP5A 2A31A 1S81A 1SQAA 2NU2E 4A92A 3QTVH 1D4PB 4GAWA 1C5OH 5IYTA 1C9PA 1QB1A 1GBIA 5I25A 1Y5AT 5EOKA 2GDDA 1J14A 1IOEA 2OC0A 2FOFA 4UFEH 1TGCA 1NFWA 4WJG2 5DJ7A 1TAWA 4FUHA 2PR3A 4MLFB 2FO9A 1UTNA 4MQAA 3UQOA 3ATMA 3SGQE 1VR1H 2Z94A 4HI3A 5AVDA 1ZYOA 3TGJE 1LHGH 2Z9JA 1UVSH 4ABDA 1C5PA 3KF2A 3ZVCA 1ESBA 1KXFA 1K2I1 5DP5A 1HJAC 3LOXA 2H2ZA 2G51A 3U8RH 2BVSH 4B1TA 4IN2A 2AGGX 2QV1A 1A46H 2FOMB 2ZDKA 1OSSA 4X1PU 3RC6A 1NC6A 3OY6U 1OX1A 3M7UA 4AGKA 3SNCA 1NFYA 1GJ6A 1BA8B 1KXCA 3L6PA 3SGBE 1EP6A 3QWCH 2QXHA 1EQ9A 1P57B 2Y80A 4UFGH 4OS5A 3SBKA 4FUEA 1RIWB 1CBWB 1PQ7A 4B2AA 4K3JA 2F83A 2OINA 1MTNC 2IJOB 4ZKOU 1O2HA 3P92A 1BJVA 3BN9A 1SPJA 1C2LA 2ZDAH 2WINI 4MNWA 3SZNA 3ZVFA 2ZFTA 4X8TH 5ESTE 1UVTH 3A8AA 4O3TA 3LGYA 1C9TA 1WBGB 2FS9A 2BLVA 3HK3B 3ZZ4A 3UR6A 2ZFSA 2XWAA 2ZCHP 3SV7A 1QQ4A 3TITA 2Z6BD 3M5MA 6GCHG 3UTUH 1PQ5A 3PO1C 1C1MA 3D23A 3M3VA 4MPWA 4D7FA 5T3HA 4RKOB 3GDUA 1NTPA 1YCPH 4OS6A 5J4QA 3RXFA 1O3PB 1MKWH 1CA8B 3W94A 1GI6A 3OTJE 2AH4X 1FY4A 3E91A 1TLDA 3BTEE 2HVXA 1THSH 5GJ4B 2TIOA 1DWBH 2FTMA 2RCEA 4NFFA 4ZKNU 3E90B 1ELCA 2ZTYA 2SFAA 2FOEA 3A83A 5CHAC 2FLRH 4MVNA 5ETXA 1O34A 2SGEE 2ZTZA 1F0UA 4ISLA 1CQQA 3RXTA 4U01A 4GHQA 1TPOA 4BAMB 3I77A 1DUAA 1DWCH 3VB5A 3ZYDA 1PPHE 3TU7H 1INCA 2BM2A 1TGTA 3MNSA 1BMLA 1HFDA 4DIHH 2AERH 1AO5A 5A09A 1GPZA 1GI9B 1W7XH 2FI4E 1BB0B 1O2NA 1ABJH 2BTCE 2WPMS 4LXBH 3MU8A 5L2ZH 1DPOA 4HFPB 1VJAU 1TGNA 2D1JA 1G3EA 1QB9A 1XMNB 1BTZA 2JETC 2R0LA 1TNIA 1E36B 1GBKA 1S5SA 4A6LA 1L2EA 8GCHF 1HYLA 1LHCH 3SNDA 2B0FA 1GBHA 1C2KA 1O39A 3KHVA 4NIXA 1BTHH 4YTAA 2TBSA 1EZSC 3SJ8A 2C8XB 4NSYA 1ETTH 1FPCH 1HDTH 1QTFA 1ELEE 1O5EH 3A80A 2Z7FE 4I8KA 3MU1A 1CT0E 1NU7B 1GHAG 2FPZA 2AMPA 1P02A 1O2VA 1IQHA 2NU3E 1BDAA 2XYAA 2ZGXH 3RXKA 2FYRA 2XNIA 1SR5C 1D3QB 1S84A 2JH0D 1G30B 1EPTA 3GCTG 1NPMA 1OKXA 1PPCE 3D62A 5C3NA 1NY22 1LO6A 1O2UA 1IQEA 3UUZA 1P05A 2GZ7A 1BTPA 3NKKA 3QDZB 1GBJA 2QCYA 3MNCA 3RUOA 5E2OA 4X1QU 1UVOA 3A84A 3RMNH 4B2CA 3BTWE 3BIVH 3F9EA 2WPHS 2FOAA 1SGNE 1JRSA 1ZTKA 1F5RA 2ZFQH 3A85A 3GDVA 1M9UA 4WH8A 2OD3B 1ELGA 1SOTA 1UCYH 3O8BA 4BAKB 4JYVH 1PFXC 1AUJA 4FUFA 3MTYA 1O2IA 3P17H 2G81E 3SV9A 5CMXH 4CH8B 1BITA 1TX8A 1DXWA 3ESTA 1GMHG 5LPRA 1N8OC 1K1OA 4WMDA 2FOBA 1TABE 1NRRH 1RD3B 1P01A 3BEFB 4KTSA 2HNTE 4ISOA 3SHCH 4X0WU 1GL0E 3KGPA 1QRWA 1D3TB 1KDQB 1DWEH 3UPEA 1WCZA 1P10A 1GCDA 1HIAA 4DIIH 1AFEH 3VB4A 1T4VH 2ZIQH 1CGHA 4ISIH 1BBRE 1DE7H 2TRMA 2FXRA 1W0YH 1GHYH 3PTNA 4AGJA 2RDLA 3MYWA 3SNBA 5JBAS 4M7GA 1EAWA 2GTBA 4I8LA 2OBQA 1FAKH 4ASHA 1O3GA 4QT8C 5FCRA 1PQ8A 2C90B 5SGAE 2ZHDA 1A5GH 2OQ5A 1L1JA 1PPEE 1WUNH 1AB9C 2ODQA 2ZECA 2QGRA 2Z9IA 1YKTA 3RXOA 3L3TA 3M3TA 1XVMA 1DS2E 1DXPA 5LH8A 2QXGA 3NK8A 5K0HA 3M5LA 5FCKA 2Y82A 1ZLRA 4GUXA 3CP7A 1NRQH 1ZJKA 2BXTH 1TALA 1CT4E 1PPFE 1V3XA 3TLOA 3P8FA 2ZC9H 1A4WH 4FU9A 2ANYA 4K1TA 2G5NA 3W95A 3BTHE 1XXFA 1QNJA 1QFKH 3MWIU 1HLTH 2PKSC 3M36A 3BTKE 3H7TA 1TMUH 4Y7AA 1O3BA 1UJ1A 2FEQH 3LT3A 4H4FA 2C8ZB 3EGKH 2J94A 1GI7B 3SJKA 2Q6DA 4D9QA 1GI1A 4R8TB 1C1TA 1PPGE 1BHXB 1WYKA 3E8LA 1GMCG 1Z7KA 1ANBA 4BXSA 1O5BB 1SLWB 5FHTA 2ASUB 1SSXA 4HTCH 4JYUH 3LU9B 4KTCA 1MKXK 2P3TB 2ODYB 4NIYA 3MH5A 2Y5HA 4IC5A 5TCAA 2W5EA 1NU9A 3AW0A 4AFQA 2GMTB 3PLKA 4I32A 2TGPZ 3SU3A 1IQGA 1CHOG 1K22H 4U30A 3UY9A 4ZXYH 1DT2A 4AX9H 1KXAA 3ZZ6A 1K1JA 2HLCA 5FAHA 4ZMAH 3FP8E 2GZ9A 1EKBB 4ZH8A 4LOYH 4RN6A 2YNBA 1C2EA 2VJ1A 1A0JA 3BTQE 1K1PA 1AFQC 3Q3XA 4B76A 1ESAA 3B9FH 4GCHG 3SU4A 3OX7U 1TPAE 2BD8A 1YC0A 2OQUA 3KQBA 4ZROA 5EQSA 1UTJA 1CU1A 1V2LT 1C4Y2 1IQKA 3S9CA 3SUGA 3LGIA 2WYJA 2VINA 3UFAA 3WY8A 2F3CE 1C5MD 1TGSZ 2H1UA 1HJAB 2VWOA 5FPTA 3M35A 2XBXA 2WV5A 2ZZUH 5I46H 1DSUA 1GJ5H 5F8ZA 1FY8E 3GY6A 1GBMA 1BTXA 1ZTJA 1FI8A 4X1RU 3PMHB 4FVDA 1RFNA 1P2QA 2JKHA 3FZDA 2VIVA 3KQDA 3PWCA 1FDPA 1GCTC 1SGFG 1OP8A 3DD2H 2Q1JA 4ZHAA 5EXMA 3AW1A 1TNGA 1MCVA 1E0FD 1KTSB 1GMDG 1GBDA 1QRXA 2AGEX 1MTNB 2BOKA 2R3UA 2UWLA 1H1BA 1V2PT 2XXLA 1ZRBA 1RS0A 4WMFA 4X2WA 1ELFA 3JZ1B 1HJ8A 1Y5UT 2W3KA 2B7DH 4FVBA 6CHAC 1HAVA 3H7OA 2ZP0H 4TY6A 3M5OA 3PO1B 1Z8JB 1QL8A 1VCQA 3LGTA 4YZUA 1YPGH 3U69H 3MNBA 3HK6B 5IDKA 2G5VA 2VWNA 3ZZBA 1W7GH 1ZGIA 1DWDH 1DLEA 3VB3A 2XCFA 3URDA 1LPZB 3ZV8A 1C5LH 4Y71A 1THRH 1VCWA 1JXPA 1PPZA 4ABHA 5AFZH 2QF3A 5CHAB 2EI7A 1ARCA 2A1DB 3KNXA 1TQ0B 2UUKB 2I6QA 1EAXA 3Q00A 2AIQA 3OU0A 2BY7X 2KAIA 2GKVE 3LGVA 2ZCKP 4MNXA 1JRTA 2ANKH 2VVVA 4NCYA 1UHBA 3EDXB 3F68H 3SU1A 1Z71A 1MZDA 1SG8B 1XXDA 2A7CA 5ESBA 5GXPA 1G2MA 4NA7A 1VITH 1TFXA 4GVUA 4JYTA 4KELA 5JDUB 1FUJA 1SVPA 2WPIS 3RU4D 3TIUA 1T8NA 1O2MA 1QJ1B 4FUIA 1C5TA 4CR9A 1CA0C 4DT7B 2JETB 3MU5A 3PM3A 4X8SH 4JMYA 1GBEA 4CR5A 4WH6A 7LPRA 1TWXB 2SGAA 4UFFH 1Y3XA 4E7NA 4I8HA 1SMFE 1ELBA 1C1WH 1GJ9B 1SGCA 3DUXH 1G32B 4BTUB 4GPGA 4HGCA 5GIBA 2NU0E 2Z3DA 3PMBB 4SGAE 1V2VT 3BTME 1NROH 1ELTA 1GDUA 1UVUH 1Z8RA 3URCA 1E35B 5BRRE 2ZGCA 7GCHF 3K6YA 1K1LA 1BTYA 2ZGHA 4UDWH 1UK3A 1PYTC 4E05H 2PLXA 3T28A 2VGCC 3S7KB 5L2YH 1KLIH 1HAOH 4ZKRU 3TJVA 1RGQA 2ZI2H 4XBBA 4Y11E 2GDEH 3NCLA 1S6FA 3R3GB 1G36A 1GHBF 1L1NA 3AVZA 1S0QA 3L33A 4O97A 4Y76A 3PMJA 3T25A 1TNHA 1GBTA 1O3IA 2XC5A 2ANWA 3VB7A 4BXWA 3GCHC 5E2PA 1XUHA 1T8LA 2SNWA 1EPTC 1GBBA 2BD4A 2BVRH 1VITF 1GI0A 3S0NA 4Z6AH 3EA7A 2BLOA 3B8JA 2ESTE 5EG4A 1T31A 4MG3A 5A0CA 4B71A 4HZHA 1ACBE 2CF8H 1P04A 4OS7A 1MH0A 3VXFH 1DX5M 1YPMH 2CMYA 7ESTE 1YPLH 3RMLH 1NT1A 3UNRA 2ZDLA 3GY8A 4Z0KA 1GJBB 3RC4A 1YF4A 3PV4A 2BQ6B 1FZZA 3MMGA 2BDBA 1C5QA 5FBIA 2A4QA 1HAPH 4Y8ZA 1O38A 2BY8X 2IPHA 3IG6B 3A8DA 1N8OB 3TH3H 4NA8A 3GOVB 1G3CA 4D9RA 3SU5A 2UWOA 5DP7A 2G52A 5HGGA 5DPAA 5TCCA 1GBAA 4ABIA 1BOQA 2G55A 3OSYA 4YO9A 1E38B 2QAAA 1AVWA 1MQ6A 1THPB 5E8EH 1HXEH 1HAGE 5DKMA 1W3CA 2XBWA 4TYDA 8GCHG 3LGUA 1C5NH 1K21H 2FZZA 1LMWB 3HPTB 1MTWA 1EOLA 2FIRH 3RXDA 4OGXA 2PUQH 1SI5H 1A61H 5DP6A 3DT0H 4YLQH 2P16A 1SGIB 4CRDA 1P9UA 2G4TA 2O8WA 1GVZA 1TNLA 1XKAC 1BRAA 5EGMA 5GCHF 3S9BA 2UWPA 3SU2A 2IOTA 1TNJA 1O5GH 1XUKA 1K9OE 2BD9A 4WVPE 4K69A 4O03A 3SORA 1Z1IA 1QB6A 1AB9B 2QYIA 4NIWA 5JPMH 4NWLA 5FPYA 1P2MA 2IN2A 4JZFH 1TA2A 1F2SE 1CO7E 1GI3A 1EZXC 1JMOH 1XUGA 1JWTA 3ZZDA 4Y8XA 4AB8A 4Q80A 2BQ7B 2ZCLP 2BD2A 4YOJA 1A0HB 5TJXA 3ODFA 2ODPA 4MPXA 1CGIE 1A0LA 2PKSB 3GY4A 1NFUA 3HATH 1AZ8A 1WOFA 1O2LA 1TB6H 4OS1A 1KY9A 5FX5A 2ZEBA 2EEKA 3FVFB 1ZHRA 2P95A 4O3UA 3SUDA 1NN6A 1W11U 3R0FA 2B9LA 1TRYA 3D49H