1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
5EZHA 1JUSA 3BR5A 4I76A 3OSFA 1MBKA 1U78A 3ZQCA 4DZJA 1S7EA 5JLWA 1I6HJ 1K61A 1AHDP 2WV1A 2ID3A 1WGXA 1VI0A 1HOMA 3ZQLA 3A01A 2XGDA 3BTLA 1ZTRA 2JA6J 3GTLJ 4XICA 1FIPA 1E3OC 1FJLA 2E2HJ 2K40A 1ENHA 2JA8J 3IH2A 4L5EA 2DA6A 1T56A 1ZK8A 5GP9A 3BTJA 3OIOA 3BG9A 3LSRA 2VKVA 1GDTA 3Q0UA 3CCYA 2Y0SN 3BQYA 3BTCA 1O4XA 3S1MJ 1ETOA 1VNDA 2XSDC 3WHBA 5C44J 2DMUA 5J1UA 5FKOA 1GT0C 3JRGA 3D1NI 3S17J 5E3OA 2Y30A 1G2HA 3G1OA 4B1RA 3O8HA 4MFDA 1QRYA 2HOAA 5EDNA 3RKQA 5FKNA 3LSPA 2OF7A 2KT0A 2FX0A 1DU0A 1GV5A 4A3FJ 2R92J 2L7FP 1IG7A 2W48A 3JRBA 1IDZA 2IAIA 1HCRA 4HNVA 1JGGA 3S16J 2LP0A 2MW8A 2ECCA 5M3MJ 3MN2A 3HOUJ 2K9SA 5IP7J 2JMWA 3Q0VA 2TCTA 2QCOA 1IDYA 1IC8A 3S1QJ 1ETQA 2GM4A 2DA4A 2WAQN 2E2IJ 4JX5A 5J1YA 1H89C 5IYCJ 1QVTA 3FKIJ 2M0CA 4AUXA 1W0TA 2IEKA 2YS9A 5C31A 2DMNA 3TP0A 1B8IA 2EZIA 4QIWN 4UUSA 3GUVA 1MSFC 2ECBA 1JT0A 2HYJA 2M2EA 2O8KA 2FQ4A 4D7NA 3RZOJ 3ZOBA 1MNMC 1EF4A 5GPAA 1IJWC 1GUUA 1FEXA 2NVXJ 4CYCB 1Y1WJ 2HOTA 2ME6A 3L1PA 2JA5J 2LVSA 2LR8A 1PUFB 4X1EA 1CQTA 2NOGA 5FLMJ 2DN0A 4MIMA 2EZKA 1JTYA 3OOUA 3IV5A 3HGGA 4V2GA 4JP0A 2OPTA 5IP6A 1JKQC 1IUFA 1RESA 3BR3A 1QVUA 1OCPA 3LSJA 4AYBN 4S0HB 2LTPA 3A03A 4IHVA 4M3BA 1JKOC 2HDDA 2FD5A 3GTPJ 2DMTA 2DMQA 2FJ1A 4BBSJ 4A3IJ 1ETWA 2JWTA 2I10A 2M34A 2AHQA 5FLVA 2JJ7A 1LFUP 2LK2A 2XGEA 4XIDA 3JRIA 3FK6A 3UJ3X 3H0GJ 5C32A 2R5ZB 3HDDA 2JK3A 2PMZN 2AO9A 2CUFA 2NVQJ 2CQXA 1MBHA 1ZR4A 2XGCA 1MSEC 3RQIA 2QF7A 5FKKA 5IPAA 2VUMJ 2DA1A 3HOWJ 5DS9A 1Q1VA 3G1MA 2H8RA 1SANA 1B8IB 4A3DJ 3MVPA 4C3IJ 1RR7A 4A3BJ 3BQZA 4JYKA 2K9QA 4GFBA 5F0CA 1LFBA 2DA3A 1OFCX 3PO2J 2XPVA 5IYDJ 3S1RJ 4MFEA 5FJ8J 3BG3A 2YU9J 3TEDA 2Y9YA 1RETA 2VI6A 1ETVA 5IOZA 1AKHA 4DYRA 4M3EA 4DYQA 3Q3SA 3LHKA 1B72B 5EYRA 2HXIA 5EF6A 1BW5A 3CQZJ 2X6OA 3JR9A 5EGOA 5EG0B 2X48A 3JREA 1TWHJ 1TWGJ 3F0CA 2MSYA 2ID6A 4NDLA 1XC5A 4W1UA 5IP9J 4RDUA 2L0KA 2R5YA 2LKXA 3JRAA 1W0UA 1JUMA 4FE4A 2NS8A 1ZR2A 3B6CA 4W97A 1HDDC 5EZGA 3BTIA 2HI3A 3A02A 3FISA 2GLOA 3HOVJ 2O7OA 1X58A 2EZHA 2P81A 2E2JJ 2YUSA 1RKWA 5K7FA 1FTTA 4X6AJ 1MBGA 4BY7J 3JRFA 2IBDA 4BQQA 2GBYA 2DA5A 2LY9A 2XPUA 4I6ZA 4RBOA 3BR1A 4Y7NJ 2X9DA 3TW6A 3SDGA 4XRSG 2MGQA 2LD5A 1HLVA 2ELKA 4QSHA 3GTQJ 2GM5A 3BR0A 3QPLA 5F0FA 1MBJA 2CRGA 1MBFA 3GTGJ 3G1LA 3NAUA 5K7ZA 1JJ8C 4IEJA 1WI3A 2E19A 3HB9A 1JTXA 1WCMJ 2DTZA 2L7ZA 1U9OA 1ETKA 1MBEA 1MH3A 5GPCA 3ZQGA 4CYCA 5M5YJ 5IYBJ 5E3NA 4BY1J 4IHWA 2M8GX 1ORKA 3S2HJ 1SFOJ 2R5ZA 2R7ZJ 3S15J 3BR6A 5K7HA 4JX4A 1YRNA 3DEWA 5C35A 3M3YJ 1UHSA 3JRHA 1UG2A 5EGOB 3I4NJ 1BW6A 3GTJJ 1APLC 1BL0A 4IHXA 3K7AJ 4QTRA 2Y31A 2G0EA 5M5XJ 3SJMA 3LNQA 3UKGA 3GTMJ 2HOSA 2DA2A 4M3FA 2JN6A 1FIAA 2EBIA 1Y1VJ 4ABZA 1NK3P 2CU7A 1LE8B 1A6IA 4G12A 2JA7J 9ANTA 1X2NA 1P7IA 1PUFA 2EH3A 4XRSA 3WHCA 4A69C 4EEFG 2VKEA 1BA5A 4M3DA 4V2FA 1XG1A 2DMPA 2LLKA 2HXOA 5EG0A 4BBRJ 5C4JJ 3S1NJ 1WPKA 3O8GA 1D5YA 4DW6A 4M6VA 3H3VK 3RZDJ 3HM5A 1NTCA 4DZPA 2CQQA 5E3LA 4UUSB 3GTKJ 1ZGWA 5F08A 5J3LA 3HOXJ 4AC0A 3JRCA 4UUTA 3OSGA 4IHYA 1RKTA 2MG4A 1NK2P 1Z0XA 4A3MJ 1VFCA 1JKRC 2L7MP 2HQ5A 3BT9A 4BKXA 2EQRA 3PM1A 3HOYJ 2LFBA 3B6AA 5F0HA 4A3JJ 1XS9A 3HEFA 1TWFJ 1UMQA 2CJJA 2WB1N 3A01B 4D7MA 4Y52J 2R5YB 5J1RA 1T33A 3GBGA 2R93J 2Y2ZA 1MH4A 3CDLA 1JKPC 3W6VA 4D5CA 3I4MJ 2TRTA 5F27A 4XRMA 3IH4A 3LOCA 3C2BA 5F04A 1JT6A 2CUEA 2D5VA 5JLXA 3G13A 2DA7A 4FCYA 4LOCA 1AU7A 1HF0A 2NVTJ 1F43A 1QPIA 2RSLA 1GV2A 3S14J 1JJ6C 1TC3C 1P7JA 1H88C 2O9LA 3DCFA 3K2AA 3MKLA 3M4OJ 3PO3J 1FTZA 3HBLA 4A3LJ 1X2MA 5C3EJ 1ETXA 2DJNA 4M3GA 4JX6A 4A3CJ 1A5JA 1R9TJ 2XB0X 1I3QJ 1WH7A 2ZB9A 4XK4A 2XB5A 3VPRA 4FTHA 4A3EJ 3ZQIA 1YRNB 1GHTA 1RPWA 3CMYA 3LHFA 5M3FJ 3ILXA 1WH5A 1ETYA 4A3GJ 2XPWA 3FIWA 3E7LA 1TWAJ 5F1JA 1GVDA 1LE8A 3PKZA 4C2MJ 1K83J 1Z77A 2NS7A 2VPRA 1OCTC 3SFIA 4MO7A 2K9NA 1AKHB 4FISA 5FKLA 3IH3A 3TP3A 1B72A 5FKMA 3HOZJ 2N8GA 3Q0WA 3ZQFA 4B4CA 2NVYJ 1U8BA 3TW7A 1HDPA 3LSGA 4MLOA 4A3KJ 1VF9A 1H8AC 2M9HA 1ZQ3P 2ME0A 2COBA 5E3MA 4BXXJ 3NARA 2EZLA 3FK7A 1ITYA 2Y9ZA 1IGNA 1DU6A 2RAEA 2XRLA 2L9RA 5HODA 1IV6A 5IOYA 5M5WJ 3S2DJ 5DTDA 5C34B 4FE7A 4C3HJ 4D5FA 1I50J 2E1OA 3ZQHA 3HKZN 1BJZA 1U9NA 4B3AA 2B63J 2MHCA 1TWCJ 3HGYA 1JUPA 3JRDA 1HX7A 1POGA 2R0QC 3QPSA 2KDZA 3GTOJ 3BVPA 1ZKGA 1F36A 5BNGA 1OJLA 4DYCA 4C3JJ 1IRZA 4J19A 3QQAA 4A93J 2H1KA 3BG5A 5C4XJ 3BR2A 5EEAA
chains in the Genus database with same CATH superfamily
5E2BA 1ZRTD 4REOA 5BORA 1DX9A 3D8UA 1STZA 2XTJA 2OP1A 3PQ3A 3HRHA 5LQKA 2W9XA 5ALGA 1XN1A 3TZHA 1WFXA 3KR9A 5GP9A 3MUDC 2VJQA 3WK6A 3H5RA 1RWNA 2E4VA 4OKIA 9ATCA 3INNA 2C5BA 1IO2A 3U7GA 3HZZA 4HRIA 4IFBA 3C3MA 4OQZA 3EUWA 1USEA 4M6XA 2UZIR 4DLVA 3O83A 4U63A 2QAJA 4CG1A 5U1PA 5IXJA 3AF2A 4B81A 1RAEA 3FLEA 5M3MJ 4LK1F 4N3CA 3ZU6A 3GWGA 2RN0A 2AXLA 3NORA 1B8IA 1FTWA 3DB1A 1WMEA 4P0QB 2C8JA 4IHJF 3EXHC 1YRLA 1BG6A 4PO1A 1GCIA 4WZZA 3R23A 4F46A 4DMRA 2IDZA 3ROPA 1HV8A 1TMGE 4F21A 2C31A 1GPNA 3SLRA 1NBHA 4FZ3A 4AKSA 2IH5A 4TMTA 3K30A 1LB1B 1XD7A 3DBHB 4QQKA 4H4KC 1QZTA 4K81B 1NXPA 4URVR 4F2GA 4EPXA 5DE3A 3VMYA 4ESFA 2PUCA 1EP2B 2UV8A 2HUPA 4EPVA 4FUTA 1SKYE 2VJIA 1YGYA 1Z9CA 4Y6GB 2QENA 1NI4A 2WIKA 3CZAA 2BEJA 3Q7PA 2JF0A 4MR8A 1JQEA 1PEYA 4OGGA 4IJKA 4I50F 4MRMA 1B1CA 3RTEA 4IGFA 4DNOA 5PNTA 4RPCA 1V7CA 1GTMA 4EKNB 3H13A 3AERA 3MTIA 4QOFA 3BD8A 4I66A 1RP7A 1W4BA 2E85A 3BT7A 1UK6A 3G0GA 2FSVC 2LGJA 2A5YB 4D96A 1SXJA 3VDMA 1XC7A 3H1LJ 2L9SA 2K4JA 4QO7A 4Z5XA 2L18A 3QPLA 4CCOA 1MBJA 3WYEA 2W57A 1P2VA 3MIZA 1TXGA 1MO3A 1T15A 3MUOA 1P4GA 2HZBA 4N8SA 3OZDA 1ZBDA 1RXSA 4EFNA 1K89A 4Y3UA 4IUBS 3FSGD 3QTLA 3A0BE 5DU2A 1KARA 4KH0A 3SG0A 1GVJA 1T2FA 3FCCA 1J59A 4PCUA 1E66A 3OFSA 5J4YA 5J43A 1JNYA 3ZMZA 5KNDH 2W42A 3H1JG 2X2EA 4B8WA 3V1KA 3TVDA 4M3DA 2OGWA 3R3ZA 1G7TA 3P9QA 4IKOA 2H2GA 5FUBA 1XZJA 1I51A 1D0XA 1NNUA 3PI7A 3OYBA 2IEGA 5DLQC 2C5LA 1TJYA 1PCXA 2FE4A 2EFPA 2M6SA 3EDMA 1N8RQ 3VHXA 3QELB 1S7GA 2XV4S 2NAZA 1NF2A 5MN5A 2KYVA 4DRXA 1H0TA 2CV0A 3B5NA 4GM4A 1V2HE 4BLSA 2R1VA 4XL9A 3QVMA 3P97A 4BFSA 5K99A 4HDQB 2BMVA 2CUEA 4HEA6 3NT5A 5LMNB 2CSOA 2G77B 1H66A 4QTZA 4M3LA 3I9OA 2DFLA 3GC6A 3FPKA 3CLTD 2FYUE 2BOLA 4CH7A 3VHRA 2FHPA 1U8TA 2XAJA 4RKEA 2D1FA 2E4YA 1Q5PA 1U7JA 3EZLA 3F8FA 4UTRA 3QEJA 2BUAA 4DSOA 3FTFA 2EV6A 3ZHOA 3VR1A 4UVBA 3CX8A 4GP6A 1QLHA 4IY1A 1S72P 4XOIA 2ZUWA 1BE8A 3F71A 3B7WA 1QVGO 2N1TB 3R6GA 4M1SA 1RZUA 3KD3A 1KMNA 1MJFA 4GKGA 2AQFA 4KISA 2CFSA 3JD1A 4L16A 3K6KA 5A62A 3IT2A 2Q0XA 1IC6A 5ALZA 3HKEB 1NR5A 4O02B 4UAGA 1Y98A 3DWGA 4Z9AA 2CL6X 3OYEA 4CDRA 3AX6A 4TVKA 2H6CA 2PH3A 3BXFA 5J4VA 1U11A 2P9GA 4UPDA 3OZGA 1Q95A 1JHXA 3AERB 1BMDA 2LKPA 1YDFA 3K31A 3K9HA 3U4IA 3V3KA 2QR5A 2YKOA 2Q50A 5EZHA 3OLWA 1NTME 5I01A 4IHSA 4EJMA 3IUSA 6GPBA 4BHTA 1ZTRA 4TMFA 2ROQA 4ZQFA 4MICA 4C4YA 1TCUA 2ZXWH 2AG0A 4B6JA 1LJ9A 4BS9A 3PLRA 2A0KA 4G97A 4EJ6A 2MYSA 1CULC 2QUBA 4IDPA 5D87A 1WD5A 1TNTA 4UJ3A 1NG6A 1U8CB 3ZWYA 4A8TA 1HWTC 5ICEA 1ODFA 1QE5A 2MA3A 1I4TD 1YBFA 4Y2TA 3ZJUA 1L4HA 4H13B 4IOMA 1RFGE 3ZLJA 4FSHA 4CSWA 5HKBA 1X0XA 1EH8A 3CCQP 2H7VA 3N0VA 3CWZA 4RD3A 5E4FA 4CKWA 3GT3A 3UK7A 1RYFA 4NQWB 4I02A 4AUXA 3ILSA 5F33A 3R7LA 3DLBA 4X66B 3ZLBA 4NPFX 1AS2A 1UDWA 2UXBB 2FSWA 4GGOA 3L75G 5JDCA 2VAXA 5EJ4A 3K1MA 2C3MA 4OGQB 2O8EB 3R7DA 1I3LA 3VYTB 3GAMA 2BW3A 1NNSA 4N6OA 1UXHA 4GYYA 1GLNA 3RREA 3QU7A 1XA0A 3IBSA 4IX9A 1XRJA 1PNTA 2NACA 1U1IA 3AJAA 5E1OA 3OC0A 2X6QA 4DLPA 3HOWJ 2FXPA 1C0WA 2RGVA 1VF5C 4QYXA 5FUWA 4ESHA 4LYFA 2BHYA 3WYCA 3BX1A 3UWOA 3OHMA 2YHUA 1RKVA 2Q3HA 1YIJI 3R44A 3N39C 2GX6A 4ZJYA 4LG0A 4J0DA 3DE4X 5EP1A 1TM1E 5F2KA 2FJ0A 5DEIA 1NUAA 5IZCA 5CNIA 4B3RB 5JEEA 3F98A 3AY3A 4X65B 2RNGA 1PFUA 4LLNA 4RHFA 4CMIB 1M0TA 3BZKA 3TZLA 4M0MA 3TCNA 3BFVA 5AJYA 2KBEA 3WLHA 3OSUA 4OHOA 1CK4A 4HLUA 4HKTA 2RCYA 5AESA 2OO5A 3BXPA 4YUWA 4M36A 3L9WA 1B15A 1T6SA 4NCHA 3PZBA 1WCMJ 2OO3A 2XTAA 1RPJA 1I4LD 4U7PB 1CIVA 4IXNA 1M9NA 4BV8A 1N25A 4CMJA 1DQYA 4K28A 4G0XA 3CXHD 4G0YA 4REMA 3KYQA 1LBEA 5DTMA 1EXDA 1R88A 3M9WA 3GZ4A 5CFLA 4QDJA 1BCSA 2GO7A 4M0FA 4F4DA 1MMFB 2WW8A 1M1JC 4KMOA 4MVJG 1PUFA 4EYGA 3DMYA 1VJRA 4J0EA 3X2SA 4HDCA 2A78A 2GEKA 1ZMEC 1M73E 2WSSA 4P80A 1S1CA 5LNK6 5LUAA 2NTYC 1LT9C 1JXMA 1UJ5A 4L5IA 5JI2E 1AN0A 1XHEA 5AICA 2WNSA 4I5EA 5G02A 3LT4A 1WMSA 1YI1A 2QORA 2AI3A 4IQGA 3M3DA 2TYSB 2GD1O 1RWWA 1Z5VA 3O7WA 3TEJA 2IS2A 2KZJA 3DDUA 2CJYA 4FMDB 5ALLA 1QHHD 1XNQB 4Q1DA 3OQ6A 3U40A 2YJ6A 1OAKA 3IRUA 3ZQJA 5E6RB 2FZKA 2VDQB 2QLZA 1SMTA 1BCCD 2R6GA 3EMDA 1CC1S 2L5GB 3SDZA 3OHPA 4X20B 2TMDA 4GMKA 3WGZA 1KERA 1F4VA 4ZDOA 3ZC3A 2ADMA 2I65A 3C14C 3S1AB 3TOZA 5ES3A 3G2HA 1V5GA 2ONCA 1J2JA 3DBRA 1H94A 4ATNA 3S2DJ 4BL5A 1NVMB 1MNDA 4IS3A 4KMSA 1H93A 5AW7B 4FFNA 1T2VA 1U94A 1IN4A 1N2CE 2IWRA 2RHTA 4I4IA 1UC8A 5IDXA 4C4PA 3OYAA 1WXGA 1KZ9A 2HU9A 4OBXA 4ZNCA 3OLVA 1G3YA 1VIMA 3CLTC 5JNUA 5CPRB 1ENHA 3UK6A 3ZGKA 2KX7A 3ANTA 3ZGYA 5AIQA 3V4FA 2HDCA 3QKRA 1JI3A 2RGBA 5BMVB 1FDMA 4RVUA 3F21A 2Z04A 2ISQA 2H65A 3A2MA 1XTBA 2ZAOA 2HOAA 4W82A 3PDIB 2AVNA 3MJEA 3BL5A 4D46A 3CCLI 1NTMD 4JBZA 3RTBA 3KS9A 4F55A 3AUUA 2D2VA 4G8BA 1BCCG 4ZGWA 1FCJA 5L3FA 3IB6A 1JFVA 4LTDA 4LIUA 3KWFA 4GM1A 3M6WA 5JD5A 1DAPA 4N0BA 1FZTA 1E3EA 1VG1A 3Q8WA 4U87A 4FLEA 1YVRA 1W0TA 4YWHA 1FUUA 1F3OA 2AXPA 1RXUA 4J0QA 4UVCA 2A0XA 3WMFA 2R65A 5HM8A 2QRGA 2JA5J 3WWOA 2VEOA 2YW2A 3A8TA 3OX4A 4AN0A 2DJ5A 2IXTA 2OSBA 4IOIH 4AYBN 2C9CA 5FQOA 1LNWA 3K10A 3VYUB 3S1AA 1KRWA 4NMWA 1AOXA 2G9UA 3F6RA 4A8JA 2YRXA 2OUMA 4NUBA 3LFUA 1XL1A 2CQXA 3FZVA 5FBHA 3QXCA 2H8RA 1MH9A 4K9OA 1XWWA 3V33A 4YMSA 5B12A 1LPAB 1XHFA 1O0BA 4IJQA 1U3VA 3PGVA 1TOAA 1G0OA 3AFMA 1J2UA 2A86A 1FOKA 1P9LA 2IV3A 3OO1A 2PMWB 4YQEA 2B1RA 4HRYA 4TKVA 1O0CA 4DCOA 1NKZB 3ZU5A 1E2KA 1GXSA 1OYYA 2PJRA 3IDOA 2WMMA 2XB8A 1YDEA 4UCXA 3EDOA 3FPFA 3A05A 3N8NA 1HNZB 1T9DA 1YH3A 1X0TA 3H2HA 4WKOA 4XZ3A 3BJ6A 5APYA 2G67A 3TX2A 3FCAA 3HB7A 4BKRA 3U3KA 1XRSB 3BWBA 4GC5A 1LLCA 2VDKB 1OQYA 4PHTA 4NECA 4EY3A 1G3SA 4CLRA 3G0HA 2FCAA 1DTWA 3JYOA 5KTPA 1WRJA 4RL4A 1OCZH 3E03A 4Z86A 1JPNA 3M33A 3FDZA 1MX3A 2JLYA 2O7RA 4H7IA 1K5PA 1QB7A 1BU5A 4JI5B 3KR1A 1SB8A 3LGSA 4R5MA 4QHSA 2X51A 2L0XA 3I0MA 3EGCA 3UWMA 1XZNA 5BU8B 3GLGA 1VRWA 4RE6A 2FTKE 1BGYE 5JCOC 1E1KA 5F1KA 2JCSA 4HEA1 4QUJA 3X1JA 4CQJA 1AF4A 4L7VA 3U2QA 5IT9Z 5A4IS 1O8CA 3CC4P 3Q6IA 3PDJA 1PUEE 1XIVA 5FADA 1OW3B 1CVIA 1X7GA 4B71A 1MAUA 5BO5A 3HOXJ 3A1DA 2YJZA 2WFLA 2JVIA 4AMGA 2F6RA 1Z45A 4YRGA 1OKKD 2PFBA 3PYXA 4IDAA 4ZCQA 1PGQA 3MA0A 3L2VA 4N0EA 1YTZI 2PUHA 5B1YA 4CNBA 1G3UA 2Z2XA 5KOIA 1XTPA 5D84A 4HB1A 1P7VA 1UFOA 2XAGA 1DG9A 5BOXA 1FU7A 5JCJD 2ZVJA 3TW0A 3HBFA 4POOA 1E4OA 4JP5A 2WD7B 1OCOH 3HRKA 4Y2VA 5KQGA 1N33B 4DOJA 5B1BH 3GH1A 4KBYA 4V1CB 3UFXB 4LEIA 4LNUB 3ZV6A 2CCJA 3ELUA 4F3RA 1X4OA 4RH0A 1H88A 1U5CA 1XDZA 4AJHA 3INYA 4UVIA 2VT2A 3WNQA 2I80A 3N7TA 4HFNA 4BGUA 4NU8X 3J81Z 1M83A 1GUZA 3KBBA 2NSJA 4WXPA 3VFDA 3MHPA 3G1UA 2J3QA 4BMPB 3R8CA 4HZUB 4OP2A 3OJWA 1MGPA 2FXMA 1T4CA 1WS6A 2J5BA 2QTAA 4W5OA 3ROGA 1Y0NA 2HA7A 2X5NA 5KVCA 2DQSA 1N8TA 4KP7A 1WXHA 4P53A 3L72D 1UBTS 1HX7A 4KW7A 1ZKGA 4TLLB 2CGPA 2XRNA 4LRQA 1JMVA 3A58B 1RJDA 1YHQP 3Q7EA 1LVHA 5HTKA 3FXKA 2AK3A 5CX1A 3SJ7A 1RH5B 1GA6A 3NHKA 2M5WA 3CBQA 3I37X 1E0DA 4KK4A 1MTZA 3RJ5A 3SSUA 1KYXA 1T2NA 4B34A 1RYZA 1HKHA 3TAHA 1CJUC 2RC5A 2DECA 4JVNA 5D3KA 3TOXA 5JDIC 1BH2A 4YYZA 2ZYAA 1Z56A 5HOQA 3OQIB 4RMNA 2PP6A 2HVSA 3RJMA 2DPDA 4TXNA 4AUNA 3CF6R 1M54A 2SCUB 2OBFA 1J5PA 1GUFA 5FPHA 1UBGA 3KE9A 3CX5I 1RAAA 4KACA 3QHPA 3A1WA 1G3RA 1XKXA 4C2AA 1TQIA 4F1KA 3ENZA 4WADA 3JAMZ 3BSSA 5BPFA 5FXMA 1Z5WA 1NMEA 2NSDA 2OPHA 4I50B 4UHDA 4KQMA 3O1LA 1T6YA 2E55A 2XTNA 4ZCLA 1SHZA 2QVXX 3I5UA 1LBHA 2GFHA 4UTZA 4XQ9A 2VPIA 1DIRA 4CF3A 3RC7A 5BQOA 1T1JA 5EJ5A 3ROQA 2OFFA 3GQVA 2DN0A 4DV4B 5AKGA 1NH3A 1VLJA 4MVJI 4C3OB 3AEDC 4RAGA 3W68A 1M33A 4OXNA 2FN9A 3KLBA 4TGLA 2XB9A 3UCFA 1DRVA 2E75D 2IHUA 3IVGA 1X8JA 5BMVF 2OYIA 3HTXA 3SVLA 2XWQA 4OWFA 3IVRA 5E20A 2JK3A 2HFED 2OYSA 2V6CA 3URMA 2WA1A 2DR3A 2QLMA 1I7DA 4G94A 1ZUHA 5BPDA 4F3YA 1ESCA 1F60A 4LBVA 1PS8A 3V8MA 2FB9A 4RSRA 3R20A 1Q74A 1G2OA 1RETA 4KXMA 2E0IA 2HA3A 1JJVA 4RGBA 2J09A 2VAMA 3KD2A 2H2IA 5JQGF 2LC2A 1B0ZA 2OCAA 5L3RA 1QWSA 3L2CA 4DYHA 1NMQA 4A82A 1RF1C 1VE3A 5J40A 2G8LA 1RIOH 3EA4A 5LM3A 2MSKA 3LNTA 1C0LA 5IEJA 3FXJA 3HXMA 1U8XX 1KQPA 1CZRA 2WPNA 2BGWA 4DLTA 2H59A 4W8OA 2B0JA 3U4HA 2C0WA 4WNIA 1WT6A 5H16A 3KXDA 4I5GA 3OE7D 3CCEP 1I2AA 5K7ZA 4L08A 3SHTA 1JTXA 1G21A 1O97C 1I4OA 3P2IA 3LUAA 1MC5A 3UC9A 1DE0A 1JB1A 2LCFA 1GZHB 3BRWA 4CIVA 4XJVA 5KREA 1SY7A 3KKNA 2P6SA 3NXKA 4U2DA 2ZI4A 1DQRA 3ZX4A 3DGFC 1CRZA 3JXEA 3INGA 2IYTA 1U1CA 2OYCA 4XLPF 4C0BA 3SC6A 4UTOA 3ZEAA 3A11A 3FDYA 1Q7TA 1U0TA 3GPIA 4A10A 1Z4OA 1MU0A 2IYUA 4LJ9A 3RPUA 2P0EA 2QTWB 3ZVRA 2X13A 5LA6F 3CMEI 1HKSA 5EWMB 5DNEA 5J3LA 1UJMA 3KP2A 5I7HA 2OAGA 2GK4A 1C8BA 1QYCA 5BQ3A 4HB3A 5LVAA 4PNHA 3AR2A 3RS2A 1YUNA 3EF0A 1JIQA 2RBGA 1JGTA 4J49A 1EFCA 2HBYA 1WVRA 1IK6A 1SQVK 4Q15A 4HPXB 1UWCA 5BMZA 4EG6A 2OBMA 3S14J 2IXBA 1N77A 2Z3ZA 2P9ZA 3MK31 4S04A 1L7DA 4DCGA 1K7SN 4A15A 3DW1X 5G1OA 2ISCA 2FP3A 4ZT3A 2WINI 3HKDA 2X8LA 1LX7A 2VOOA 1SQPK 3GEHA 3HO1A 5CCGD 4B6GA 3RSFA 4MRMB 1V7QA 4HLCA 3OV8A 4ALMA 1GCGA 2XKAA 3F2VA 2BZ1A 4XSGA 2OGTA 4PFOA 3LUGA 5CA1F 4WLEA 2VHYA 3VJMA 4KO4S 1X80A 1MIHA 2W24A 4HDAA 5KX5A 4PPYA 1EXIA 4MN4C 4DRYA 4HTFA 1RQXA 4QBFA 3L79A 3QFTA 2H5IA 5IKOA 4G0VA 3KYDB 1N3IA 2Q5LA 4RKYA 3K4BA 3L7CA 3VDXA 1CRLA 4R8HA 2FOKA 4JNKA 1D8TA 4IJUA 1NWHA 4LXUA 1CLUA 5E2AA 2Q27A 1P31A 3NAGA 4ARZB 1IXRC 5LGTA 4P7FA 2XZTA 2X7XA 3B51X 2X0KA 4HRXA 4ENTA 5FLKA 3EGOA 1OXBB 5G1PA 5JNSA 2ZZNA 3EPZA 1SWWA 1YX3A 1Y3AA 3DA8A 4I6MC 3TLXA 2O0KA 4DS3A 4RPHA 3EETA 3TPCA 3RYTC 2M87A 2WVRA 3EY4A 3OEYA 3ES9A 2NLOA 3TINA 3NTUA 2BGUA 4FT8A 3RKQA 2JCYA 5ELMA 1KI4A 1GV5A 3ICEA 3PKJA 1RWVA 4O4LF 4PLYA 5EHGA 1TUEA 2ZBRA 5FIUA 4G5XA 1I3OA 4PONA 4FIDA 1QVVA 4RTQA 1PHRA 2VJYA 2JZNA 1BXRA 3BGDA 2RHMA 3MWJA 3WISA 1P92A 3UWSA 2O8BA 1NX6A 1Z3IX 1LJ8A 3GOQA 1T2DA 2C94A 3BTOA 3TB4A 1MN6A 2OCBA 3PJEA 4BMCA 2QSIA 4N3BA 3NP7A 1B59A 4JB3A 2EJWA 3OEHD 5I5EA 4Q4AA 4Q3AA 1QR6A 1PK7A 4QX6A 5C8XA 4DC0A 4ND8B 4QOEA 2WTAA 5FLVA 4MQBA 2VQHA 3IQDB 3DE3X 2CNBA 1XD2A 2L7KA 4R81A 1FYLA 3CL3D 3PPYA 2V6FA 4L4YA 2ZYIA 3AM4A 4IDDA 5K09A 4TV7A 2XQJA 2H3HA 1ZSVA 4ZJPA 1QJCA 1WY7A 1GRNA 2CLIB 2CE2X 3HU3A 4YRDA 2CT8A 5EGOA 2PJZA 3G85A 2ID6A 1YITP 1O6BA 2QR3A 3JRXA 2XDJA 3K94A 2XA1A 2G07A 2X19A 1GN8A 2WY8Q 2ZPAA 3O3OB 2CVPA 4D4LA 5ALNA 3FCUB 1BE6A 1U31A 3X2FA 2HM7A 2W6BA 4NONA 3WY9A 2QD4A 3ZWCA 2YFHA 4EVSA 3SQLA 3BR0A 4C4SA 3IWFA 5E8GA 1HEYA 4MDYA 4GSLA 4ZZ1A 4UNIA 2QQ8A 1P1RA 1QNLA 3TNFA 5M5YJ 3KKLA 5EZSA 4Y28J 5ADWA 2JAOA 1Y1SA 1Y1PA 1L5HB 3UB4A 3CURA 3FCSB 1OZHA 4EATA 1JP7A 3NG1A 4H44B 4KDEA 5ILGA 3OJFA 2AUNA 3ZCVA 1H6BA 2PSEA 3F89A 1NHLA 3L7OA 4I5FA 5CVTA 4YASA 4ZYEA 4HXYA 4AO6A 1MW8X 2OLKA 2V7QJ 3NTQA 5AHKA 2ZI6A 4OX9Y 7ADHA 4NG4A 1PGOA 5EWJA 4UHKA 5HKOA 4YUZA 4YCSA 2V7UA 1P39A 4BFYA 3H6PA 821PA 2P6TA 4DR3B 3O4VA 5GTHH 1OQAA 1TUIA 2C1ZA 2OCGA 1IZ7A 3JQ7B 4YUVA 3L4JA 2QEXP 1P91A 1YE3A 3CZ5A 3USES 5BQ5A 2ZRMA 2LCIA 1JTHB 5B58C 4AQRD 1E2HA 1USIA 1U9JA 2O23A 5DLYA 2I8CA 4Y6OA 4TWBA 4P9NA 3F6VA 1G4UR 3A9TA 3C2BA 3RV3A 1AV7A 3AEKB 3KCQA 4BMDA 5IX8A 3GLUA 3GLVA 2QG9A 1K6IA 3RF7A 1U6KA 4LF4B 3O2NA 1BWQA 4QPOA 2XYHA 4QEDA 3AJ9A 2H4JA 3GF4A 3IQWA 1JGSA 4X7MA 3MERA 4B3TB 2XMSA 1U9YA 1ADFA 3LU1A 1RF0A 4J4HA 2LPMA 2P5KA 3A2LA 1UZLA 3NNNA 2Q5IA 2CFRA 5JANA 4QM6A 2V79A 4K05A 1IWPB 4A3KJ 4UNOA 4P4TA 4E5NA 3MF4A 1HT3A 4RTNA 4J7AA 3MS7A 4ZGGA 1PJ8A 2QI9F 5CX4A 5BV7A 1Q2NA 4N7JA 4ZCIA 2G09A 1OU4A 3BOSA 1XZ8A 1WX1A 2H06A 3D5TA 3RAGA 4DVGA 1LTSC 4L0DA 1AQ6A 4QPNA 1N6HA 3I09A 1GL2C 1NJ2A 2AA3A 2D06A 3MP7B 1VQ5P 1WAMA 3SOPA 3W5VA 3R75A 3GLHA 2CNWA 2XF7A 1E1RD 1NQWA 2IPMA 3PUJA 5LQJA 2NX2A 4NAVA 1GZVA 1VQOP 4M74A 5LSAA 3M0EA 2D5CA 3NMDA 4RAQA 3N59A 2D8MA 5AVQA 1V8DA 5L3DA 3NH6A 1BEUB 4XARA 3OT1B 1HR0B 1I5EA 3R0AA 4KIGA 3FW1A 4L72A 3RYRA 2ZVPX 4MYTA 2GN9A 4JI3B 3UKOA 2YFQA 2NVUA 1KOGA 1TEZA 4EAAA 4PV1D 3TE6A 2QEXI 2FQQA 3COJA 1TM5E 1DSSG 3BHJA 3HE5A 3ZWWA 3FHCB 2RB5A 5HS7A 1Q7BA 3B1FA 3SIRA 1SOMA 2H63A 2Z30A 3NTNA 4ND5A 2ZE8A 1JU3A 2B69A 1EWYA 4QQRA 3REGA 4Q4HA 3OQOA 1WQ1R 2C0XA 2ZK7A 2QJWA 2Q3DA 4IEEA 2YMPA 4Q7MB 1G9XA 1ABBA 1O7FA 3QNWA 1MA3A 3BVHA 2Z16A 1JYSA 2OBYA 3C7JA 3WMXA 1P8AA 1B26A 1L6RA 5TGZA 2JVJA 4OA5A 1OX3A 4F2HA 5ADUS 1JHYA 4RPJA 2VASA 4KGDA 2JWDA 1S3IA 4BEJA 5CNMA 2TMYA 3QU4A 2X42A 4MEAA 1JSZA 5FFXA 3DHYA 2UVPB 1JU9A 4C03A 5ALHA 1NOKA 3QF4B 2O0HA 4DQDA 1BYUA 1CHNA 3EUKL 1ZR4A 3OZVA 2I4TA 3G1MA 4BATA 5KJFA 2Q5EA 3ITEA 3MVPA 1JIJA 4M8LA 2VF2A 5HX7A 1H3FA 5JIBA 4GFBA 3KDPB 3E9NA 4MW9A 5FA8A 3PJRA 3DBLA 3UAXA 3B73A 1RE1A 4BWFB 3GGGA 1ORIA 4ND6A 2RH9B 4RZHA 1EINA 1A88A 1DIHA 4C0HA 3OWXA 4XX0B 4RTSA 3F0CA 1FE6A 4P1ZA 1OVVA 3GNSA 4L0QA 1RPNA 3JRAA 4PSVA 3IMEA 4LXHA 4AY6A 3B1WA 4EPYA 3NRJA 3ZDEA 3WDKA 1LDDA 1JSLA 1RBYA 1R5NA 2BBSA 4IV0A 5BQPA 4JLPA 2VQDA 4KT0J 5JUWA 1LPMA 4PBTA 1FZGA 3OCZA 2GKOA 2Q21A 1CQWA 1GTG1 2Q45A 1CNEA 3WK7A 4CF6A 5GIOE 1IQUA 2XWSA 1S7CA 1X3LA 3BICA 1F51E 1IE3A 1IDOA 1TJPB 1PPJD 1FZCC 4EM6A 2R5FA 2OM2A 1K3UB 3SMVA 1ACMA 1J00A 3MWMA 4BL0B 4TYYA 1IFXA 3MS4A 4J29A 1I1GA 3KT3A 1SVWA 1TLTA 1US8A 4F7ZA 4D8XA 1PG0A 4WWHA 4URYR 1RMTA 1NTZJ 2I0FA 2LG4A 3IDSA 3RT7A 3OOWA 1Y34E 4BX2A 1MHPA 1Z35A 3RVQA 3RZDJ 3E18A 3V9AA 2CQQA 3QKUA 2QN2A 1FDWA 4A5MA 3L70J 4HH3C 3CVWA 5CA1B 5BSMA 4PYMA 4PSWA 3E9DA 4LJ6A 2Q1KA 1GM5A 3JZDA 4TRMA 1O87A 3CWBE 1E79A 2UZ1A 3RRFA 2CLCX 1PJRA 1ZLKA 5TLSA 1KDYA 5KHLB 5HIAA 3O0TA 4N01A 4PWYA 3VYVA 1WBBA 1HF0A 5A2QK 3QBVA 4BGDA 3DVAA 1K0FA 1TLFA 4C0XA 3GZ5A 4ZDPA 4TN1A 1KXJA 4DV2B 1LBSA 1KQ3A 1KY2A 5TX7A 1SB9A 3LE8A 1R5JA 3DZKA 2Z3YA 3MWEA 1Y7HA 1N2DC 3ULQB 4NCXA 3LOPA 3WMRA 5DHTA 2IQ5A 5AVJA 5EKDA 3VDRA 2Y0CA 2B9SA 4CIYA 3ZBTA 5KEIA 2EB7A 3ZUGA 2B3DA 5F7OA 4LGWA 2VO1A 4ZCRA 4EQZA 1NATA 1FP4A 3BK2A 2A6TA 5LOVB 3TD6A 3CCJI 3RK2C 3N8GA 3RGWS 1FLDA 3Q7QA 1IOLA 2VN2A 4D8TA 1O3TA 1TWCJ 2O2IA 2XQVA 5K3OA 1RDFA 1P1CA 3ZU3A 3BDVA 5J47A 2OUIA 2H00A 3K0CA 3U4AA 1NVVR 1SUDA 2P5LC 1C1DB 4KNVA 3PRKE 4R1PA 4A93J 3QRWA 4PLPA 3HPRA 3EIFA 3GEEA 3ZWBA 1VC2A 3E84A 4K1LA 3UCXA 3CLQA 3GMDA 5CDFA 3LL4A 3FTDA 4FZ5A 4W4TA 3IPXA 5I8WA 2E4XA 4LOJA 3E27A 4OVNF 1N5JA 2NRGA 4A5SA 5IYZF 4E22A 1KVQA 4J03A 2HRDA 3QNUA 4YMGA 2R1TA 1NE7A 2ZKZA 3RPEA 1SXGA 2HTEA 4GOOD 5AW0B 1K6JA 4QT4A 4ZTFA 2J46A 3IV9A 1D0YA 3DEFA 3WU1B 3OEEA 2KIKA 2WSMA 3EY9A 2VXYA 1EJBA 2OMKA 1GEGA 5JHGB 5G4LA 5J3JA 1S2IA 2IDJA 3UOGA 4U7GA 3V1TC 1KB9E 2GUSA 1KAMA 5LXTF 2I4IA 1AU9A 3WNVA 4A7PA 2P4UA 1Z8FA 3KJZA 1IN1A 4JYPA 1T0IA 4JP3A 3P2EA 2OAQ1 4Z6KA 3A7OA 4YV1A 1F7UA 3BE8A 3PQDA 3WB9A 2ZS7A 3PE3A 3CDIA 2G17A 3I28A 3GA7A 1LK5A 3CVXA 2VHZA 5GOTA 5EIAA 1YZFA 1FDRA 3ONEA 4CYCB 2EL7A 1HQDA 1PLJA 1PUFB 2NOGA 2OK8A 2HREA 5APXA 2Z0MA 5ILVA 4LTNA 1NRJB 1VPTA 2EZKA 2RHHA 4V2GA 3S3OA 4BEHB 1SCDA 1GU5A 4S0HB 1SVNA 3PNYA 1EK6A 1I30A 2IBZE 3IL2A 2QLNA 3TH5A 4RXTA 2BOVA 3LA8A 4HDNA 2PS1A 3P1JA 4XSZF 1SRRA 3WLOA 4C3UA 4ZO7A 2HTSA 3BMNA 3FM9A 1JDUA 2X1HA 3GU3A 1D8KA 4ZC1A 4TT3D 2I7TA 4TQGA 2YTZA 3VMZA 5A2QA 2QD2A 1PDNC 3U4DA 4N7MA 3KZNA 3PHGA 3QITA 1L4UA 3GEZA 1GKIA 1E3MA 4OAOA 1L5YA 2LY2A 2HR1A 2ISYA 1TWHJ 3MWDA 1U2GA 2NPSD 1VKHA 3CPHA 4RF3A 4FFOA 1SZCA 4L4UA 1E3LA 2IXGA 1ZKMA 1NQOA 2VTDA 2WI8A 2PZJA 3HUSC 3V7WA 4WI1A 4NMLA 1TCCA 1EXMA 3SZRA 3IGFA 1C8VB 4AI6A 5CA0F 4A8PA 2FYNC 4ENMA 3ETCA 3FHLA 1C1DA 4BWNA 4OJMX 4ENRA 2ZWAA 2V8BA 3STTA 1JJ8C 3G6KA 2QSJA 1QHNA 3M9LA 1IZ8A 4WESB 1UC5B 2ZITA 2NU8A 3CH4B 1HSTA 5DM6F 3CEAA 1DAOA 3JD0A 1YZHA 3CNNA 3SF8B 3ROUA 1S6LA 3FI9A 2XRZA 2OYOA 4EY4A 5LLTA 2Z8YA 3F6CA 2V7BA 5JC8A 3DSRA 2SPZA 4JITA 3FOZA 1R1VA 4RUKA 1E1MA 1A6IA 4NJOA 3JQFC 5CDYA 3T9FA 1TQ4A 5INTA 3DFMA 4A0FA 1YIOA 2ZJ6A 4OJQA 3PFWO 1XNJA 2JJ2D 5M29A 1U7DA 1ADGA 4BNYA 2IKQA 4GP7A 3G5MA 4S1PA 3W4KA 3I1YA 4KIJA 1X70A 1T2KA 1G19A 3C87A 1YR6A 1GXQA 2MMGA 1N4DA 3A6EA 2AOTA 3LHSA 4DMHA 3OT5A 2R5YB 2PRJA 5DSXA 2VNIA 2ZT9B 4H13C 2X6TA 5JCOA 3AY0A 5FJJA 4IG4A 1KR2A 3GELA 4AICA 1ENPA 3M89A 2COMA 3BXEA 2DYRH 4NDZA 3KT0A 2VF7A 4NDNE 5GM1A 4MGEA 4PGAA 1FTYA 4PPQA 5C37A 3NCTA 4KYWA 3PFHA 2YIUB 3TTXA 2WQYC 4QU0A 2HK8A 1CFZA 4F6CA 3LCCA 4X3OA 3EWIA 3H4MA 3MJVA 4PZLA 3SIWA 1UEXC 4NFYA 4BUCA 5CBNA 2XMDA 3U48A 4JXXA 5APTA 2NVWA 3PGJA 3HOZJ 2HPAA 2R6AA 3IAS6 3UJDA 4YJFA 1K2VN 1G6Q1 1MNQA 2RC4A 2I71A 2EIKH 2FXIA 3F1LA 5CLLA 5LD2B 3GJ4A 2MINA 2MFZA 1L5ZA 2XRLA 1T25A 1I3KA 1W36D 1U1EA 2UUAB 5C34B 3N87A 1U9NA 2IKSA 2JHGA 3F8BA 4RF2A 4EA7A 5IARA 4L3VA 2BEZF 5EWMA 2YV2A 1J42A 1SC7A 2ZSBA 1O97D 2QRXA 3D2AA 2Q6QA 4ITVA 3MGBA 1BQEA 3PG5A 2FWAA 1VBFA 1U78A 5BNIA 4XYLA 1QFSA 2EJUA 4XA8A 4DLXA 5LA6A 4MI1A 4A16A 2QA5A 5L9AA 3BCAA 2KIUA 4IRHA 3BZ6A 4ONEA 2PA0A 4GVLA 1QKKA 1ZESA 3AE3C 1XK6A 1H2BA 2O06A 3AE7C 3DTVD 4FCTA 4P5DA 4NJEB 2QJFA 4XJSA 3WHBA 1HDGO 5J1UA 2EX1A 3PHIA 1UL1X 4F3QA 1ZRDA 1PT8A 4MVXA 3Q8KA 1UFRA 2KB0A 3A4TA 4MKHA 4OQMA 4V3BA 3GJ0A 4ZQEA 3L09A 1AXGA 3P2YA 3CRRA 3CTAA 4XWYA 4Q4JB 2GM4A 3ETNA 2GBIA 4MITA 5C5EA 3GRVA 1UB9A 1GL9B 1BA2A 2RKWA 2IU6A 3QGMA 1PQYA 2HV9A 3HYLA 4C7RA 3IJPA 5CFPA 1CUBA 5JAQA 2Y1XA 1LWUB 3F6PA 1FL9A 2OP0A 4GECA 4IO0A 2YXQB 1ZD3A 3HSSA 1QGPA 2G6BA 2IITA 2D1YA 4MMYB 1AD2A 4AU1A 1ZRSA 2JWTA 1A31A 3ZCSA 4H44C 1LS1A 2V4UA 2JUGA 4A03A 1LDNA 3KP5A 1A9TA 1K63A 1H1LB 3VU9B 4IDFA 3RLIA 1V54H 1L0LG 2OHIA 3R0JA 1L7VC 2X1DA 2J4CA 1K98A 3I6MA 3VO2A 3SF0A 5APQA 1LVGA 2X8AA 4IKEA 4X00A 3P0FA 5KPDA 2FFJA 5AVZA 2CNLA 3ENQA 1BW5A 6PAXA 4AIDA 2E5NA 4CM6A 4EHLA 5T3YA 4XM3A 2I8AA 4XXHA 4DV0B 1IG3A 4HCJA 3GK3A 4HWSA 1T5BA 1TAUA 2J31A 4MXDA 1C7RA 3ONVA 4QBIA 3IPCA 5DMHA 3AI3A 3ZJVA 5EZYB 3TEFA 2IX7C 2YU3A 3CN7A 3HNRA 5IAJA 4RBOA 2EARA 1PVOA 1ESEA 1YZQA 2IHTA 2WF9A 3OKPA 4MEXF 4RB1A 5A2GA 1MOSA 2IPQX 1RC1A 3CX6A 1VG0B 3NC4A 5BV1A 3R24A 3BBPA 4PCQA 2VONA 3FROA 1FXSA 1UP7A 3W8EA 4WERA 1C7QA 4L95C 2XW6A 4L73A 1DQNA 5EXDA 4DJGA 1SOAA 5C39A 3K0AB 2DCMA 3A9SA 4ZAZA 2QTGA 3BF8A 4R9RA 2PA3A 4YRNA 5HM6A 3T41A 5MDHA 1ND5A 1NVKA 5AW3B 4W7HA 3JQ8A 1EDIA 1M6HA 4C7NA 3LHDA 4EO9A 2FUCA 3QPCA 1O94A 3OZ7A 4YAWA 4B9AA 1YDHA 2WSSH 4UUTA 1T1EA 3BDAA 4LSMA 1T0PA 4IIHA 3IOBA 3M9BA 3K9FC 2VQSA 5FNVB 2GCPA 1KJQA 2X6XA 4JT8A 1JKPC 3M7IA 2GBGA 1D6SA 1V47A 1KJIA 4PRLA 1XMQB 3D7LA 1GTL1 1K7YA 2NSYA 2PQ0A 3G1TA 5I8ZA 3AV0B 3CM0A 5HIIA 2HDOA 3JD2A 1E2PA 4A27A 1L4AB 3VR4A 3W0LB 1CT9A 4OQQA 4RHTA 3DKRA 3EFHA 2GZ2A 2I7VA 3NIDB 4LOKA 2JJ8A 3SFTA 1WF3A 4RW0A 3UG6A 2PGOA 5K1ZA 1QBGA 4QOSA 3USCS 1H3NA 1NUUA 4IGEA 4CE6A 5L40A 4OIOF 2BGKA 3JQDA 2AG5A 1P6XA 2HX1A 1ZU5A 1JKJA 3MGNA 5K45A 5H68A 1GL2D 4PC6A 4O2RA 1SIWA 1YHNA 5KX5F 3D71A 3M4YA 7MDHA 2CWWA 5DCMA 3C3XA 4WXRA 4REQA 1TYZA 2IX9A 1NXVA 2G71A 1MEJA 2A9RA 4RV9A 4ZJZA 3LP8A 4PDKA 4WX9A 2Q6KA 2FCRA 1GFSA 1IBCA 5A0FA 3B6EA 1GTSA 3EXIB 4J16A 4TQ9A 2JD0A 3FWZA 5KSOA 1JQKA 4AAYA 3ZD9A 3WXMA 2UUZA 1JR3D 1XE3A 4PCLA 1T95A 5F7XA 4ZVVA 1BHO1 4TV8A 3DKYA 4B2YA 2WVJA 2XEXA 2PKEA 3G1WA 4MYUA 3KPWA 3PNTA 3RFXA 4LTMA 4PD4D 3L72J 4Y99C 1KQNA 4I1IA 4Q47A 2JIPA 2FFAA 2JFPA 3P9NA 4NVRA 2KMUA 4U1RA 3D7MA 2LWIA 3GAFA 5GGXA 4MFDA 3FCEA 1Y63A 3F8MA 3DOIA 1Z75A 1VJ5A 3NTOA 3AE9C 3Q1LA 2ZIGA 2OAP1 1A04A 3T1TA 1MPTA 3VHXB 4BNZA 4KE9A 2JCXA 2R97A 3LWBA 5IP7J 2BP7A 4Y7DA 2GN8A 3PVSA 4H6VA 1V71A 2FOIA 3DNMA 3F9KA 2BFBB 1OXVA 4QYMA 4URZR 1DOHA 2AH5A 2ZYVX 3W5IA 4WB4A 3H9BA 1QE0A 2C2WA 3ICPA 1HDEA 4TSRA 4QUKA 4JX9A 4E5VA 3VC1A 3LECA 4L3OA 3S29A 2RGCA 1U8UA 3LC0A 2P9TA 4CF7A 4PLCA 2KQRA 4C7XA 4IHVA 2HDDA 1BDMA 3BGWA 1GT91 1KA8A 1BS1A 2RK6A 3L7BA 1G42A 2QTNA 1QJ4A 1VP9A 3FK6A 5DVZA 3EF3A 2JFYA 1P7WA 2VR1A 2R5ZB 2MYUA 2R5DA 4HGRA 2H1LA 3P9RA 2WJZB 3EVDA 4OOEA 3FOEC 2YHAA 3PNOA 4TYWA 3EDCA 2O61A 1KK3A 4B43A 3SQWA 5I7UA 3AHDA 4IIFA 3EFOA 5FWDA 3U60B 3V4WA 1VCIA 1ZARA 2QX8A 4M99A 5BOVA 4HLYA 2J9FB 4KPGA 1R22A 2VPPA 1EZ1A 4MO9A 4R9VA 1RACA 3BJRA 3F74A 2VKHA 3O0DA 1SD4A 2A2ZA 1C3OB 1V41E 1G5TA 5DNWA 2B1JA 2O7NA 3DOEA 3T3OA 1FU4A 2PQ6A 3O26A 1AWCA 3NEYA 5DYYA 1Q7EA 3S27A 2X9LA 2WSYB 4D2IA 1NPTO 1MBEA 1OPCA 4PO9A 4KR7A 3ENKA 1XCMA 2F1KA 3PUZA 1ZGGA 3BR6A 3FMQA 4B75A 2JI9A 3IQEA 8OHMA 2BBOA 4PSCA 4XRFA 2CN1A 4PXSA 3LCRA 3AJDA 1GKLA 1HZZA 3SAJA 2KNCA 1ZM4A 3V2RA 1Q1GA 2A30A 4QOIA 5LGNA 4BLVA 2AE1A 3NOXA 2M0MA 1BZYA 1ZPDA 3TNJA 1YB7A 4G8CA 4Z53A 2FPRA 5LEJA 1P9QC 3RVNA 1FZCB 4LHZA 1VMIA 2VPWA 2BBTA 4OI2A 2MOKA 3TSAA 2J6IA 3K5PA 4OH7A 2PVSA 1DOZA 2HNAA 4FGSA 2RI0A 1KVTA 1RKTA 1WRBA 3DGEC 1FW8A 3F4BA 3D6HA 5K51A 5CBPA 4J76A 4XIJA 1Z83A 2UVPA 5T4BA 2PPLA 4W5HA 1JM0A 4P2GA 3AI1A 3H1IJ 2FPIA 1T8IA 3VTAA 3K2AA 4K6GA 2HSWA 1V55H 1MMDA 2FOXA 2IF0A 2DHQA 2PFSA 1L7AA 2GNOA 2GT1A 2V5VA 2JEZA 4V19K 1E2MA 4GPIB 1UF9A 2ZI5A 1NU1J 5FKLA 2B36A 4MQLA 2NXJA 4D74A 2OZVA 2NVYJ 3QYBA 5AR1A 2EZ4A 4QYWA 3NWEA 5JS2A 3NXSA 1LLDA 3V6IA 1ON1A 2GZ1A 2YZNA 2JDID 2VTKA 2CWDA 2RAEA 1P0FA 2O4UX 5E8RA 3PJFA 3W8DA 3DEEA 4K3UA 2H16A 5BSGA 1TVMA 3BTVA 5GGYA 2ZR7A 3KVNA 2DYSH 1NTRA 4B80A 4PD4I 3F23A 4U3JA 4HSGA 3AI7A 3BC8A 1RZRD 4M7RA 3TMKA 4YRJA 4DWWA 2W8BA 1IXCA 2WWXA 3VC7A 4BQRA 4BTLA 4DR2B 2FRXA 5JQGA 5B3SH 4XWOA 5FBRB 2YNMA 3VR5A 2JHPA 3KQSA 4IQ8A 4EEZA 1M5RA 1S3JA 2AT1A 1I7LA 2E2HJ 1T2AA 3KZIE 2FA9A 2B37A 1VSVA 2R7FA 1ZLYA 4D9EA 1RE3A 4WWCA 2ZR8A 1CY0A 4TT3H 5DX0A 4G5FA 1M1YE 4M21A 2AUMA 5KJCA 4IICA 4JB8A 1U7OA 1AA6A 5BV8A 3OZTA 3ZDFA 3KM0A 2GJ8A 2R92J 4B79A 5ICGA 2J58A 3ZNPA 1N5OX 4JX8A 4CIDA 3AZOA 3VKUA 2ISSD 4MQFB 2OQGA 2KXPB 2QU7A 1KFEB 3K2ZA 3BWMA 1TTTA 3DKWA 1F4PA 4LI0A 4KR9A 3PU6A 4XIIA 4HZGA 3RK2B 2XUBA 5BMOA 2YN2A 1N32B 3MJTA 3NUQA 5TRDA 1SC4A 5JCJA 2VS1A 2GXBA 3VTKA 3BL6A 4RH1A 5JD4A 2FQXA 3HB4X 3ID6C 3P9KA 1JR3A 5E6UB 4B3JA 4DLWA 2EVWX 2N1TC 3RRBA 2XF2A 2VHEA 3T4PA 2ZTVA 1AKYA 2NVQJ 4L1KA 1E2IA 4R1OA 1E1RA 3HV0A 4MKFA 1IATA 2HKXA 1F5TA 4Y99B 3ODPA 4GBMA 2PNFA 4PICA 3LYUA 4BEVA 4GOKA 2KPOA 3DXYA 1Y9AA 1FSZA 1M6NA 2XZRA 1M7GA 4UVGA 2IT0A 4IWYA 3EHDA 1KDVA 3PQ2A 4UZSA 1ISJA 6REQA 1T8ZA 1GDHA 4Q34A 3OI7A 2XXAA 2Q46A 3IWZA 3QFSA 1I24A 3PUHA 2IT1A 4BY7J 4BX8A 2EKPA 4FGUA 1A4XA 2O2GA 3R41A 4R84A 1CFJA 2BYVE 4Z7JA 3AEUA 1KJNA 2HVRA 2VJPA 4YP7A 4KNYA 1B43A 2MSEB 3ZZNA 1LSUA 1T2KC 4DYDA 1PVDA 1OZ0A 2HKOA 2RHOA 3AF6A 2DTZA 1J2YA 3ZQGA 3SYLA 4JU8A 1NAYA 3F6BX 1UEJA 4M1QA 1X87A 2BY2A 2WB1A 4MPTA 2VXCA 1V9LA 2C83A 3DFZA 4RGXA 4HY3A 1PLLA 4HZUA 4OAZA 3KJGA 3KUDA 4D6YA 1WL8A 4WK4B 2WSCJ 1D2HA 2MC3A 3KSDO 4FMDF 3BMXA 2YBDA 2CKDA 4RQBA 5KKAA 4F5YA 1JNMA 3HHGA 4CCWA 2FK8A 3SWWA 2V54A 5ICSA 2MYTA 4INAA 3SXUA 3UFXA 1Z22A 3QKWA 1XYYA 5F08A 1NC3A 1G8KA 3PXEA 4PJ0E 1FOSE 1VFPA 3SX4A 1VFCA 1JXAA 2HQ5A 3B71A 2K7FA 1H8AA 2Q7DA 2EG9A 4ZVTA 1IJBA 1KKMA 1R58A 2YX7A 2A59A 2PGJA 1T3TA 4LJAA 4ND8A 5LHIA 1EM8B 4TOIA 3AP1A 2R87A 3PO3J 2YNMD 1KJWA 1K0UA 1XGNA 2Q3CA 3AP2A 3B6JA 2E5YA 2Y0EA 1J75A 5I48A 3M83A 2OZLA 4I99A 2ZMEB 1DLIA 2BI8A 4I1PA 2VDPB 4FOLA 1DEHA 4I4NA 3IURA 3UUEA 1UUFA 4YA6A 1VE1A 2HK9A 1U3TA 3GIDA 3AQIA 3C41J 3FFBA 2B4AA 1EB8A 1YC2A 2VTBA 1W46A 3WKEA 1E3PA 2IHKA 4CLRB 4XGNA 2E1OA 1ZKDA 3OQHA 2MLGA 2NTNA 3AVVA 3HJBA 1DPRA 1FW6A 3LCMA 2VC1A 2V96A 2HPMA 4BZQA 5DYNA 1RRCA 5KIAA 3FPGA 1C41A 4C0LA 5LKRA 3IQFA 2H52A 2A5GA 4AZSA 1LW7A 4XB2A 4GXNA 1IG0A 2D74A 5AKEA 1Z6TA 3C9IA 1VBNA 3DMRA 5CHXA 4K40A 1GRQA 4I3GA 4P08A 2O7VA 3UXMA 4L9VA 1SXJD 3SXYA 4MIYA 5LZ7A 1KILB 3MG9A 2O54A 3ZJ5A 3OMYA 1DAEA 3MELA 3PQ5A 1U8FO 1PT6A 4PSXA 5JE8A 1JIUA 1FNCA 3TW8A 2BKVA 2I99A 3ZE8A 4OMFG 2LNDA 4HNHA 4XN0A 1IQRA 2UWMA 2GVZC 4DG5A 1IG7A 4FK8A 2NU9A 1N7HA 2PKCA 1VDFA 2BEWA 4JENA 4HEJA 5EYPB 4UNSA 2K9SA 3AOEA 4B2LA 2B87B 5MHTA 1JDZA 1L8LA 2OBBA 3OQ1A 2FEMA 5JTTA 1GPKA 1JSRA 1N36B 3R74A 1T8RA 4PC7A 2Z6AA 4WXDA 5TJ9A 1ORTA 3BFJA 1VYVA 3V2GA 4KVFA 4FC7A 3LF2A 4EK9A 1FZAA 4WY4C 5L3VA 3UG7A 2OHFA 2HOTA 3TLAA 4N8DA 1EWVA 2XITA 4J01A 5D5QA 3HGMA 2JRLA 1LU9A 1S3GA 1SUSA 4I1OA 3SF8A 1GFWA 5A5VA 1P1KA 2ZIXB 4DA4A 1NY6A 1OC4A 1CE8A 1ZGHA 2HMAA 2ZJ0A 4HEQA 1A97A 2REQB 3ZWAA 5EUMA 3HJEA 4D98A 1U2DA 4US2R 2WAQA 4RA9B 4MVJF 4KVGA 4A3BJ 3I9KA 1QF9A 1DBIA 3K0SA 3PDIA 1JR6A 3BERA 1ACJA 2AMYA 4CETA 3FYCA 5GQSA 1EGMB 3TW8B 4HN4B 5JAUA 1NVVQ 2YWRA 1KY3A 2UKDA 3CTPA 3T5PA 1CUIA 2B6HA 1WMKA 2Q0OA 4Y9SA 3Q87B 4IKFA 1CB0A 4EUNA 1T9CA 1IHXA 1BIFA 3IAHA 5FTNA 2DQYA 3FYDA 5DM4A 2WDPA 1C0KA 1YKFA 5HG0A 1XMAA 2JIMA 1MA0A 1MABB 3WLTA 3FFAA 3F5DA 3UJPA 1W4ZA 5AKJA 3CLVA 1VKNA 3FHNA 2KDOA 2A7QA 1GA1A 3S7ZA 3THXB 2FPGA 4JIMA 4R8VA 1NW5A 4LBZA 1DEXA 2L9NA 4P4NA 1FUYB 5HGXA 1J7JA 4CHTA 4OHCA 4GKBA 1X38A 4BCDA 4H31A 4YI5A 4R9SA 1IB0A 1JTHA 4BMVA 4RYDA 4R8RA 5IDWA 2FPWA 3NYIA 1VQOI 3WAKA 3AZQA 1T2KD 2HXSA 3ABLH 5FR1A 3OM0A 1U28C 5BW5A 1DFGA 1VE5A 4DLZA 3E6CC 5DTEA 4CIXA 3KCCA 2QJPB 3RFUA 2GOYA 4FOPA 4RA6A 4LY6A 2DMPA 4UTXA 2GHIA 1W9MA 2YJNA 2JT1A 4G26A 4BFUA 2XCRB 2HZ7A 4GIBA 1KMHB 2N1BA 2V0CA 4XGKA 1QG0A 1BMQA 3BJAA 1EXWA 5A3QA 2IA0A 2R8YA 2HU2A 4GGPA 1HTBA 1TT7A 4NOMA 4OHPA 1M2JA 1HSZA 3D70A 3JZFA 1L5OA 2FNAA 1E9AA 3A1FA 3Q3EA 5BY2A 2AYYA 2OFOA 1I7NA 3L7IA 3HB5X 3N7UA 5FFFA 2GPTA 1SEVA 4OGLA 2ZWOA 1X77A 4E3WA 3PSFA 1D0ZA 1M3SA 5DTRA 5KJ1A 1RXVA 4GOFA 2GTHA 1DVRA 3IHKA 1ZNZA 4WKBA 2FMTA 3NHLA 1U2ZA 3RUAA 3EMVA 3FPJA 4HYEA 5GJWC 2HL6A 3TN7A 2QX7A 2ZBQA 1M1YA 1ZGAA 4W7YA 2RBKA 2R6FA 2UUOA 3OIGA 4XRRA 3U9TA 3ZDYB 1FX0B 2OAEA 1BDBA 2J48A 1XLUA 2NZVG 1CIJA 3UYLA 4KMMA 3G5AA 4P7GA 3H1AA 3K4QA 2WE7A 4BC0A 4Z49A 1KMIZ 1JMKC 2OQRA 4KK3A 1Y9ZA 4D26A 3K9WA 3ONQA 3NVKI 2QD1A 4ZD6A 4TT3A 2EFYA 3FVVA 4G6ZA 2BY4A 3IP5A 1WJCA 2DQLA 3GHGC 1JBQA 4ZU6X 2ZTMA 3WGYA 2L82A 1D3YA 1JHRA 1Z39A 4XM1A 4XJTA 4PRZA 2DCUA 4YAEA 2EZTA 3LV8A 2QBYB 3ZHXA 2HJWA 2VOPA 3ZE6A 2XYQA 3OUUA 3Q85A 3ZXYA 3DLPX 4HZIA 5JROA 3OA7A 2DOEA 2O52A 4G8DA 1QO9A 2XOKA 5ADVA 2I8DA 1X7WA 1PTJA 2FEWB 5IAGA 2W6CX 5E38A 4CUZA 1TBXA 4FLFA 3C6YA 2ZFCA 1EAYA 2FKAA 2SNIE 1K88A 5FKOA 5GVRA 2Y30A 3R5HA 3ZPXA 2LD4A 1MW7A 1M34A 3AHEA 3PK0A 3HP4A 4KE8A 3R9IA 4HH1A 4W1RA 2JZCA 3WX0A 3OYIA 1YJAA 1X0VA 3FYUA 4AKHA 4M60A 2BMEA 2KSQA 2N47A 3SYRA 3V2PA 1V5IA 2C61A 1SELA 1U7HA 3QPAA 2PLWA 5AW2A 1XTQA 1JYFA 5D5WB 3RM3A 3WJAA 1BHJA 2GF0A 4XN3A 3LUBA 3VOSA 1ZW0A 2FQ4A 1R27A 3RZOJ 3Q1MA 1QC5A 2NU6B 2LVSA 4BYMA 2GZWA 1K86A 3H1HD 3PUWA 3EIOA 3U9SA 3C2HA 5JSZB 4I36A 1N2EA 3N70A 4CI9A 2ASEA 5A04A 3AETB 4J1QA 1RRKA 4XCXA 2F5DA 3IEKA 4H1VA 1H69A 2DMTA 4DIEA 2DMQA 1UXOA 3MM4A 4YMVA 1JDPA 3DXFA 4NJMB 2IYEA 2SECE 1K66A 2LMDA 3W2EA 2OTCA 3VISA 2ID9A 4H7FA 2A5JA 3VO8A 4O1MA 2M32A 1BDHA 1MB4A 4XRGA 4CM7A 5KAIE 1H1LA 2P2LA 2RREA 1CF2O 2C9ZA 5U4XA 2QRVA 4QMAA 3HQ4O 1NTZE 2YWDA 1A5BB 3HLKA 3MGKA 4MS1B 3QYAA 1VHQA 1IUYA 2VAVA 2W2MA 3O8ZA 2JDIA 4WNAB 5BSVA 2OCCH 4DT1B 3E5XA 1KC8Q 2CW5A 3DT9A 3Q3CA 3AVWA 1J5EB 3ZZTA 4ZFNA 3SNHA 2ZM5A 5IJ9B 4II2A 4LY0A 1DKUA 1JEKA 1HE1C 4RVSA 3I4CA 3JWIA 1KQFA 1PW5A 1PZGA 3BRQA 1KJJA 1C7ZA 3VZQA 3GTGJ 3HL4A 3JQCA 1PT7A 5CCHD 2W7NA 1M2FA 3UPDA 4XLLA 1UFKA 4B45A 1Q77A 1W2WB 4KVAA 1QV9A 3ABIA 1OILA 4LOAA 3VN0A 4CUKA 4DBLE 1XXLA 3RQSA 2WUDA 1EPUA 1KB9I 2WSCH 3QVTA 4JOBA 1N1GA 1RRMA 3MT7A 2CU7A 1JIXA 1OX5A 3RT1A 2AWNA 4N0PA 3QKSA 1SHLA 4Q4DA 2Q9CA 4UPEA 2BMAA 1GAXA 2JA2A 1W48A 3KEGA 3OY7A 3Q9VA 1HJBA 1EP3B 3G79A 1D7AA 2KS1A 3O8GA 4AVPA 1NPYA 1Z0ZA 2G4LA 3C3WA 2F5CA 1Y9BA 1H5QA 1Z63A 1VOTA 3G5LA 2D13A 5H6QA 3TUZC 2IW1A 3KETA 4PTLA 1B42A 5DHPA 3WZMA 2AFHA 1UP6A 1DFIA 3DTVA 3T9AA 2Z5UA 4XRMA 2PV0A 5D5VB 3KJXA 4YREA 4HPJB 1N2ZA 4IF4A 3PEUA 3Q41A 5JPCA 1TA4A 4JH0A 4PLHA 4ENUA 3C3EA 4YY3B 1X13A 2WWGA 3HYRA 1G5PA 2F00A 3H6KA 1WH7A 4DIKA 3TIXB 5AHOA 3NHWA 2F5VA 2BI4A 1J8QA 4DMCA 4B4UA 4FZVA 5C4MA 1ZJJA 5EIFA 1NQTA 4LRTB 1Q2XA 3GGDA 3E0JB 1T1GA 3FTQA 3OZBA 2F62A 4FWBA 5T6BA 3WLKX 4X62B 1YZVA 2QAGC 4J91A 3TO7A 1NSYA 5BNFA 2IHZA 4LG3A 3F6YA 2JBAB 2ME0A 1XXHB 4KQ1A 1XRQA 1E2JA 2XVCA 5CR9A 2OV2A 5AKIA 1E1YA 5C46F 2AXTH 1Y7IA 2IEZA 2PWZA 4WBXC 2OWEA 2WYIA 2G0TA 2OZ6A 1QM5A 1POGA 2FUG1 4PAOA 1IK7A 1W5TA 2H2FA 4IVNA 1AO0A 1T39A 4XKWA 2IW5A 2AXQA 1V6AA 3AJRA 4G63A 5C4XJ 2AW3A 4LVOA 1I6HJ 4MB6A 2DQZA 3FYTA 3X1DA 1M6VA 4PYRA 2XGJA 1ADJA 3SQOA 3DZ8A 1SFUA 3VH4A 4XWWA 4E33A 5IHXA 2DT5A 1EFRA 1FFAA 1GNVA 1N9ZA 3C0KA 4LGMA 4OCZA 4CIAA 3D6FA 3K53A 3RKYA 5AHWA 2HYDA 1T8TA 4UTPA 4JGGA 2XJ4A 2UYCA 2KSJA 3RYCA 1P4JA 5HS9A 4EIJA 1Z3CA 5KYWA 3KZYA 5KJEA 3VA7A 1IZZA 1GL7A 2FR1A 1SCUB 1DDGA 5HZGA 1FVHA 4YRZA 4KN9S 2VODA 4HNVA 3U3OA 1X1QA 3FGPA 3KEMA 1WCWA 1XPJA 1CZOA 1IC8A 3WK4A 2DLNA 5HZHA 1C80A 3PEVA 1GVHA 1RAIA 4XQCA 4E32A 1CV2A 2NZWA 3C2GA 3B9QA 1FK8A 1NTOA 3L0OA 4QU8A 1B1AA 1J1DB 3VNBA 3DFUA 2NXEA 5IP6A 1L4YA 2DTDA 2R7KA 2UUCB 2AD5A 2W6JH 3A03A 3WYGA 4EVRA 1EWKA 2G7MC 4A3IJ 1RZ3A 2AMVA 1G6KA 1IFDA 1NBWB 3NAQA 1FBTA 5CA0B 2WPDA 2N9BA 5IVDA 4PC1A 4WJZA 3VMXA 2VXBA 4FFSA 3KG2A 1H5UA 3GVIA 2I6SA 3THWA 4JYKA 3PIRA 1T4CB 2YIVX 1IU9A 3WU2C 3A2NA 3IVXA 1YBKA 3ONNA 1MC4A 1VKRA 4I08A 1VKOA 2PKQP 5CFZA 2ZBEA 3DAGA 4BB6A 1ZNYA 4GCVA 5TF0A 2P65A 3WYDA 4JYBA 1QH8A 1ZVQA 4RY2A 2ODQA 3FJ1A 4IR7A 4ETMA 1ECPA 2MC4A 5KBYA 4Q3OA 1KFJB 2OENG 1B6GA 3S3NA 4NL4H 1LI4A 4DNFA 2J41A 4YAFA 2E2JJ 1K8AQ 4HGZA 4MJ3A 5C5DA 5B4UA 2C5SA 2PANA 3DEHA 2HWVA 4LQDA 2GESA 3N2GB 1IK9A 4RC9A 3KUXA 1GKYA 4MZXA 3ROXA 3R3XA 1GV1A 2G7UA 2HQOA 3QU2A 3J7AO 1RI4A 4KVZA 1FC3A 1YIAA 3H4VA 5H4HA 4QXQA 3JQFA 1NWQA 4HATA 3QFRA 1JFFA 4IX1A 4U2EA 1WB4A 2JHCA 1EJ9A 2ZB7A 2JASA 4YRSA 5IKPA 4CN8A 1QTRA 2B34A 3ABOB 4NAUA 1OPXA 2L3DA 4F2WA 3G71I 3DO5A 1HQYE 2BEQD 1SBYA 1RE4A 3TJZA 4RPLA 1HDIA 3EPKA 3HPHA 3ZD7A 3FWLA 4KUEA 4BE1A 3MJRA 4B86A 4L75A 1ZN7A 4F4CA 5HCUA 3PXCX 5L3QA 1U57A 1FSGA 4XYEA 1U3FA 1XU9A 3NR2A 1E4VA 3WUTA 4YAKA 4L85A 4XPZA 2WD8A 3WNCA 1KE1A 5IUNC 4DV7B 1KFCB 2Y99A 3KKQA 2OYHA 4WVLA 4CKEA 3I4MJ 3B89A 1KWGA 1UMBA 4ZQBA 3CP8A 1EG2A 1HG1A 1Q91A 3EN0A 2C0QA 2F9FA 1K7EB 5DV5A 3VNQA 5C4GB 2WBLC 3GR6A 7MHTA 3H84A 2XMQA 1YUBA 2EX0A 3A14A 1SU4A 3HBLA 3LI2A 5TV2A 2WILA 3CLRD 4ROTA 2G6TA 3D43A 1NUTA 1WH5A 2RDMA 5JJKA 4DTIA 4ER5A 5ED0A 4OV6B 1YOVA 2LXNA 4HL6A 4RFSA 1ZIDA 5CCGC 5TEWA 2CLKB 3UJHA 2VF5X 1QYWA 5DX8A 2NUTB 3WGKA 1KQ8A 3W2AA 2Y4NA 4BBZA 2AEJA 4BJ3A 4KRFA 2C4UA 2PAAA 3HGTA 4ANJA 1NF3A 1J9EA 1YZ3A 3ZZ1A 1K7XB 1KI9A 1WJEA 5AJTA 1TAGA 4Q3KA 2XNHA 2GARA 3QVGB 3MRTA 4Q7EA 3RIRA 1EFHA 4UD2A 1OA1A 2FWPA 4JVSB 2V26A 1F36A 4NCAA 2IYQA 1PVEA 2RHGB 2I7CA 4C3JJ 1R5SA 4MS3A 2QNIA 3QEMA 3ICQB 3HZHA 3TD2A 1J20A 3X0DA 5FTKA 5LQCA 2VIIA 3M3PA 3A01A 5JLAA 3F97A 3ASUA 4QGHA 4L5EA 1CSEE 1JAHA 3L06A 4RGUA 4F4UA 1DBVO 1HLGA 1UZNA 4FW8A 3NVDA 2IOFK 2WWTA 4LDJA 4DJ5X 3I71A 3NDPA 3D6AA 3D6VA 4WZBA 2VYCA 2WYHA 3HUSA 1D2NA 1G38A 1FT9A 4JWKA 3E0QA 3LKZA 4YBRA 2ZJ4A 3WOHA 3H9QA 3ZP5A 3WQBA 4POAA 2NYAA 3DTEA 2BI7A 2IZOA 3TQFA 2FFBA 3I39X 5E17F 3KQLA 2DA4A 4MVYA 4O4HA 5AW8B 5LBQA 2FFHA 1HTWA 1ZW6A 3Q9NA 4HWPA 3SM9A 1KMHA 2Z99A 4AO7A 3RNLA 3JR7A 4JYCA 2QLLA 4F3TA 1PYGA 2PD4A 2O3SA 1KMQA 1KSFX 1EFVB 2VF4X 2RH4A 2C04A 3W2GA 4V0OA 4NPAA 5JG7A 1QANA 2XCLA 3QPVA 1KILD 2VZLA 3GGCA 1MLDA 1NU1E 4B7AA 1LFUP 3X1XA 2XGEA 4XIDA 3JRIA 2Q7CA 5F23A 2HAEA 3FR8A 2BLNA 3PUVA 2EKBA 4R3NA 1AY0A 4KLRA 4RQAA 1DJNA 2MT9A 4CL8A 1J97A 2QTCA 2QL6A 4RAOA 3GLKA 4Q9IA 3NVMB 1PHPA 4F1WA 3O4GA 5JAHA 2HCJB 3M4ZA 5DW0A 1ZCFA 2XLBA 3CUQA 3UT5A 1A8QA 3SBOA 3EVGA 3BJOA 1QS0B 3UT6A 4FE4A 4G5GA 5EZGA 2A58A 2V1NA 4A2PA 4UTNA 3WV5A 3HOVJ 4OQYA 1SC1A 1EUQA 2J85A 3CGGA 3OF2A 2OHOA 2XUQA 5AM5A 4NFSA 1CUHA 1L7EA 3M34A 3VVBA 1U0NA 1COWA 3HE3A 1EP1B 3VU0A 3NBYC 1SQXG 1XGSA 2GJ9A 4FHFA 2UZKA 3IQZA 4D3XA 4GKVA 3M6IA 3WHIA 2M4GA 1RBQA 3QVLA 2WWHA 3B5NC 4G5RA 1Z5NA 3DV2A 5D6EA 1KI1A 4UY8I 3CT6A 1QP4A 3NAZA 4MV1A 4WFKA 2Q1YA 4BXFA 4N3YB 1BWSA 1TTQB 1PJQA 4ZT2A 3PUXA 4MQ4A 3DVLA 3L7YA 4A69C 4ENJA 2ZAMA 2UZAA 5KYYA 5AJVB 4ZAYA 2QM7A 4KFCA 4U7DA 4FKZA 4G4GA 4MS3B 1PE0A 3NEPX 2QT9A 4JT9A 2NTJA 3OEWA 3T3EA 4DLLA 1N6RA 3BT9A 3GX4X 3U4QB 3II6X 1ZELA 2XDQA 3OPNA 1VQ4I 3ZV7A 3TLMA 1J5YA 4D9MA 4AQ7A 1X7DA 2O0LA 3HYSA 4JIGA 1TEVA 2V7GA 4FCYA 4BV9A 1QPIA 3MTQA 5HTOA 1ZOYC 5AW6A 4MPJA 5LDGA 3D1LA 5DIZA 2FP4A 1GP2A 3T35A 1I7PA 5EE1A 2XB0X 1FS5A 4PEVA 4KQKA 4TRNA 1YQGA 1KILA 3L8GA 1YOVB 3KFLA 3LXXA 2J6BA 4IYRA 1OH5A 1XX6A 3L71E 2FI1A 1QC5B 3WLIA 2BY0A 2BAGA 2J45A 4B6QA 1KWKA 3UAYA 4W5NA 2PUWA 2QRNA 4XVQA 2IIVA 1BVUA 2HV8A 2ZQ5A 4PXAA 4CICA 3FN4A 4GLLA 4CMIA 4ZU1X 1XVVA 1E5XA 2Z5IA 5TY0A 5EJMA 4ETIA 4K35A 2B1GA 2ESRA 2RH5A 2XNDH 2OA0A 1U3CA 1JE0A 4D92A 4DR7B 3GRZA 4RXUA 1VJ1A 1NTZG 3TRFA 4BMOB 3L2UA 2YWXA 2H1VA 4GOND 1M2VA 3E58A 3LC2O 4UBKA 3UTDA 3T5DA 2YOHA 3WZLA 3B4SA 1H4VB 5HQJA 1NO4A 5CAEB 2XLCA 3QOYA 1JHPA 4MHOA 1I5RA 4TKMA 2H94A 2CDBA 1U2TA 3UHFA 5TC4A 4XBFA 3D8TA 1RJEA 3H2IA 5EWJB 3VSAA 1AV1A 3LDFA 1NOJA 2Z2SB 1IQ0A 1P8JA 4CTOA 2PZBA 5KMGB 3JCUC 1W36B 1GTWA 4A5OA 4J0KA 3TTUA 2Y0SN 3RUEA 1SQPG 3VR2D 3NNSA 5KLVD 4TWZA 1YFJA 4ZH4F 1NLYA 2Y9PB 4RZ2A 3U21A 2CXNA 3RL0g 2CKMA 4I55B 4V03A 2C07A 2OF7A 4IOCF 4FFPA 1RE4C 3B78A 1OZFA 4AN1A 3WYAA 4K9PA 2H92A 4BQEA 5FCDA 1Z67A 2YWJA 4TVSA 1PWEA 5A7GA 1OFGA 2ECCA 4BNVA 5DEQA 4AIHA 5CFMA 1WIWA 2ZXUA 1I0LA 3QVWA 2D7CA 4GSKA 2FX2A 2ZMEC 5LEKA 1GAEO 2I67A 1G8PA 3LZCA 4F8EA 1L3LA 3N53A 1A8UA 1MAVA 1U65A 5TISC 3LSTA 1OAAA 5THXA 4RV4A 3O2JA 4C7OB 3ZH9B 2WTBA 1TK3A 2EKZA 4K7JA 3N4XA 3PX2A 1JDBC 1ZHFA 4MP6A 3DEIA 1XZQA 3IJEB 2AV6A 2G4VA 1TDJA 3O75A 3C6MA 2FF5A 4HV5A 3IC5A 4UNQA 2BZSA 3SQMA 1MOPA 2OHJA 4XWTA 2HFHA 4E5YA 4LMYA 4PNPA 2PG3A 1YQ9A 3V4OA 3OTWA 1BXGA 4ZT6A 1N73B 3PUYA 4R83A 1GPBA 3O92A 2Y9YA 3G89A 3PNQA 3D4OA 2J6CA 3NQ41 3C5WP 3G9TA 1RLOA 4FFDA 4P31A 2X48A 1Q7GA 3KKEA 1L5KA 3I9FA 3T7AA 1ISMA 1KYZA 3LC1O 5I51A 2NS8A 1UAAA 4JR0A 1EFRD 3U61B 3AB3A 2O8CB 1PVVA 1N5LA 2RE8A 1HDRA 2G08A 8ATCA 3Q2IA 3FX0A 4U7JA 1KO1A 3IJ5A 4FR0A 2VJAA 4ZOEA 2KIMA 4DA0A 4GYGA 1W1WE 3I2HA 3PQ7A 4H18A 1Z2NX 4CDNA 3W1WA 3E3OA 1JHFA 1NR7A 2XNCA 3ZBQA 2R11A 3TSIA 3RBVA 3CC7I 4ZICA 1NP7A 1XF9A 1N0HA 1EQ2A 1CP3A 2VQGA 5JYEA 1EDOA 4HLXA 2GK6A 2OV1A 2I6QA 5AVWA 1G8HA 5FTWA 4GLOA 4ILKA 4JL6A 5EINA 4KPEC 1PJ4A 2B8NA 5JNVA 2PXAA 1X3UA 1U8EA 3AW8A 3NDRA 1LJUA 4PG4A 5LQNA 4KGXA 3MMNA 4RX1A 1HY3A 1X4PA 4Y33A 2BM9A 1GGFA 1OTXA 3SQNA 1XZMA 1YRYE 2OO5C 4BJTA 4ZI7F 1K7AA 4UVEA 3AUKA 2WTMA 3HACA 1HFJA 5IDQA 4AVZA 4XLNF 4OLAA 1VCOA 3FUWA 2F1JA 2ONZA 4B74A 4EHDA 5A4AA 1BEEA 4F1JA 5JPIA 3UK0A 5KNBD 5KTYA 1H9AA 3I12A 1SZJG 4RAFA 3ENVA 3HGQA 1YBHA 1Z05A 1Y6RA 2XU6A 4RGRA 4IHJA 5GONF 1JIKA 1BS9A 1ZCJA 1M67A 5KHOC 3RK3E 3AG2H 1PEDA 5AKKA 1VZ3A 4EJWA 3IBGA 3MFQA 2CQ7A 2IVFA 3EE6A 4QGSA 1F8XA 4IJ6A 1E94E 2YYAA 3HLYA 3M6UA 3SFDC 4J0JA 2A69F 3ZGXA 1MKMA 5G4KA 4MCIA 2COBA 1KYOH 5MGNA 5GADJ 4PFJA 1OB2A 1K8XB 3ETDA 4E6PA 2VYQA 1YA4A 4EMTA 3KQOA 1YL7A 2G06A 2NU9B 3OZWA 4U2GA 3CY6A 4FE7A 1CEYA 3GRUA 1WU8A 5FV4A 4G0UA 1B0PA 3BKWA 2XVAA 3H1IG 3BZUA 2PGIA 4G56A 1BW9B 1Z4PX 2AL7A 3ILVA 1PJ3A 4OGFA 3S2GA 5AK6A 3TRKA 4QJIA 2WUFA 1DRUA 4Q66C 1E5LA 4IINA 4UU0A 2OYHC 4MGHA 3RH0A 3SC4A 3IH2A 4AJ9A 2V6GA 2QXTA 2J3KA 1ZH0A 3QLTA 2Y66A 4IVQA 4EKDA 2VSXA 4E15A 3S1MJ 5A1JA 1N7SC 2HQSA 3LPMA 1G17A 4Y67A 3B12A 2HGCA 4ZAFA 3AG6A 4YRRA 2WSBA 4NZ9A 5CU7A 5H3LA 3IQIX 2ZCUA 3VU8A 2R6R1 1RQNA 1BGXT 4KIUA 3GVCA 2J87A 4LFUA 3LP5A 3LCUA 4HNGA 5I45A 3DNFA 3VPCA 3IEMA 3MN2A 1X2EA 5IT5A 3PICA 5SYMA 5CDGA 4MWZA 4BNJA 1HE5A 3WIOA 3H1JE 3AEKA 1N2GA 3OHSX 1RQUA 5AI6A 2M7BA 1A2QA 1YZYA 4XLFA 5AJXA 2EKDA 1KV4A 4JLJA 4UUQA 3QU3A 2Z8ZA 5FLMJ 3MUDA 2Y8EA 3CVVA 2FDCA 4CPDA 1AK1A 1A2KC 5B3AA 5JT1A 2W25A 2PFKA 1HL3A 2BSAA 3ANYB 4Y2SA 1RBZA 1MJNA 3L75D 4HH4A 4HYTA 4ERXA 3SHOA 3H87A 4N39A 1BXKA 3UM9A 4FYVA 3COAC 4LI3X 2PO7A 1M90Q 4Z9XA 3SI7A 3PFIA 5KSPA 4LBWA 3FOFC 1LP1B 5CQGA 3E97A 2CUJA 3VP8A 1TQ6A 5SY9A 1D1SA 3VBEA 1ECFA 3ZOKA 2ETVA 3G9RA 1L5HA 2CVHA 3OE1A 5K0FA 5EF6A 2RN7A 3GBSA 3QYEA 3K16A 3WGTA 3T1HB 5ECWA 4NBRA 4TWRA 5DBEX 3J7AY 4WCVA 2OTJP 3WSVA 4Z4CA 5DN6D 3K69A 3KPVA 4PBSA 1VYUA 4ZYTA 3TOAA 1ULTA 3AFOA 4DSNA 4QXMA 4TX1A 5L6LB 2WIBA 5BURA 3MS2A 1MVNA 3W5AA 1XVAA 1C1HA 1DGRM 4LRSB 3JZIA 3W2FA 1WI3A 5D8LB 1YQ3C 1MO5A 3E82A 1QU2A 2FR8A 4HBLA 1R4MB 2OO7A 1FRFS 4TV9B 3RDIA 1L7NA 2SCUA 3V8LA 1ZLJA 2O8EA 2WTEA 3UKGA 2X0LA 2X5XA 2OECA 1U9IC 4QG3A 3WFJA 2MWMA 1OY1A 1FMTA 1SQQK 3U1VA 2C2KA 1U7ZA 2OV6A 1P7IA 4KI7A 3UB2A 4EF4A 3CIOA 2FBKA 3GWZA 3I2KA 4RETA 1TZMA 2FJPA 1XJ0A 3KEOA 4FGZA 3DAHA 4Y2QA 1UM9A 4KXFB 4MWTA 5GZ6A 3CZRA 4LV8B 2GEBA 1UMKA 3S2SA 2XVXA 1E3SA 3L8DA 5C1OA 1YJNP 1SFXA 2L4MA 4G1UC 2ZE7A 3S2YA 3A9UA 5C52B 5FWXB 3KXPA 5AW5A 1EP9A 3UA3A 2N9UA 3M7GA 5CYGA 4Z0NA 1MZP