1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
5FLMJ 2TCTA 4DYRA 1PUFB 3A02A 1FJLA 1HX7A 5E3NA 1WH7A 1EF4A 3BQZA 2XB5A 3BR6A 2JWTA 5IYBJ 4BXXJ 2VUMJ 2M34A 4C3JJ 1T33A 3GTGJ 1GUUA 3QPSA 3RZOJ 1MBFA 2HDDA 5IOYA 3JRGA 3FISA 4BKXA 4I76A 3FKIJ 2CRGA 4FCYA 2DMQA 4RDUA 1O4XA 1D5YA 1QPIA 3HBLA 1JUSA 4IHXA 4BBSJ 3I4MJ 2JA6J 3BR2A 4MFDA 1QRYA 4QIWN 4EEFG 3JREA 2E2IJ 3IH4A 3BTIA 3WHBA 4Y7NJ 2LLKA 2DA1A 3S1RJ 2NVYJ 1UHSA 1GHTA 3BR3A 1MH3A 3S1MJ 1X2NA 2NVTJ 4XICA 1NTCA 1MSEC 2R7ZJ 1F43A 1BW6A 4A3MJ 4FE4A 1OCPA 1OFCX 2Y2ZA 3UKGA 2P81A 4A69C 5IYCJ 1IV6A 3A03A 1YRNB 2M8GX 4BBRJ 4G12A 1ETQA 4DYQA 2G0EA 1ZKGA 5F08A 4DW6A 2FQ4A 3HOZJ 5JLXA 3NARA 1MBKA 3TW6A 1JTXA 3F0CA 1BA5A 3UJ3X 2EBIA 1IDZA 3GTKJ 2O8KA 3H3VK 3S15J 3LHKA 4QSHA 4CYCB 1JUPA 3G1MA 3BR0A 1LE8B 1B8IB 3G13A 2VI6A 1QVUA 2DMPA 5EZGA 2D5VA 5M3FJ 2Y30A 3ILXA 2I10A 3BG5A 4UUSB 3SJMA 5C35A 3TP3A 3BVPA 2O7OA 3K7AJ 5EG0B 2DMUA 5F27A 5GPCA 2YS9A 1X58A 5IP6A 1ZQ3P 1AKHB 2K9SA 1H8AC 4X6AJ 2LR8A 5EEAA 1JTYA 2WV1A 1RKWA 3GTLJ 2H8RA 3HB9A 3ZOBA 2GLOA 2MG4A 3BR1A 2NVXJ 1IRZA 2DA5A 3BTJA 2M9HA 4JX5A 3OIOA 4S0HB 1HF0A 5C4XJ 4A3IJ 2RAEA 3WHCA 2JMWA 1JT0A 4V2GA 1JKQC 3JRAA 3LSGA 2X48A 1VNDA 1ZK8A 5EZHA 5J1YA 4M3EA 5DS9A 2GBYA 2NVQJ 3CQZJ 1XC5A 4DYCA 3RKQA 2K9NA 3BG9A 1TWCJ 2XPUA 2HYJA 1Y1VJ 1U9NA 1GV2A 1K83J 5GP9A 1VFCA 3JRFA 1UG2A 1PUFA 4MIMA 2KT0A 5M5YJ 4A3JJ 4MLOA 2R5ZA 4NDLA 2AHQA 2XGEA 2YUSA 4JP0A 3LSRA 3HOYJ 4MO7A 3HM5A 3MVPA 1HOMA 2XGDA 2FJ1A 5FKKA 1G2HA 3PO2J 2L7FP 5FKOA 3GUVA 1APLC 4ABZA 1MSFC 4IHVA 3JR9A 2K9QA 3TEDA 2LP0A 2Y31A 4W1UA 5FLVA 3JRBA 2O9LA 5EGOA 2L7ZA 2W48A 2DA4A 2VPRA 1JGGA 3I4NJ 1ETVA 1WPKA 1HLVA 2YU9J 1ZTRA 2XPWA 2R5ZB 4FTHA 2ELKA 3HGYA 3OSGA 1ETYA 1GVDA 1WI3A 1RESA 5F0FA 5C3EJ 4IHWA 4C3HJ 2OPTA 5C44J 4B1RA 3QPLA 1H88C 2XB0X 3C2BA 3Q0VA 3ZQHA 3LHFA 1U9OA 2JA8J 1HDPA 5IYDJ 9ANTA 1ITYA 4B3AA 1U78A 3LNQA 2E1OA 2E19A 2E2JJ 2X6OA 3B6AA 3PO3J 4D5CA 5IPAA 2DTZA 3LSPA 2KDZA 2EZLA 4L5EA 3BTCA 3RZDJ 1TWAJ 3CMYA 2XSDC 4A3KJ 4A3FJ 1B72B 4IHYA 1GT0C 1VF9A 3S1QJ 3L1PA 3GBGA 1FIAA 1DU6A 2Y9YA 1CQTA 2FD5A 3JRIA 4A3GJ 4A3BJ 5F04A 4BQQA 2Y0SN 3FIWA 5C31A 1IDYA 5K7ZA 2JA7J 3JRCA 2MSYA 3FK6A 3A01A 2OF7A 4JYKA 1MBHA 3IV5A 2DMTA 4MFEA 4CYCA 5EYRA 5K7FA 2EH3A 2Y9ZA 2LY9A 1P7JA 1TWGJ 4I6ZA 1ETWA 1H89C 3HEFA 4A93J 5M5WJ 3S2DJ 1IGNA 2PMZN 4UUSA 4HNVA 4M6VA 1LE8A 1B8IA 3TP0A 1P7IA 1MNMC 2QCOA 4B4CA 2NOGA 1MBJA 3S14J 1Y1WJ 2CQXA 5HODA 2DA6A 2WB1N 1AU7A 1AKHA 3PKZA 1ZR2A 1FTTA 2L7MP 1K61A 1X2MA 4BY7J 5C32A 1I50J 2DA2A 1HDDC 2EZHA 4A3EJ 2HOAA 3SDGA 2QF7A 3ZQFA 1U8BA 3HOWJ 3QQAA 4Y52J 5IOZA 2XRLA 2HXOA 1Z77A 2RSLA 2R92J 3ZQLA 3CCYA 3HOUJ 2HI3A 5J1UA 5FKLA 4C2MJ 2B63J 3HOXJ 2H1KA 3HGGA 4FE7A 3K2AA 4XIDA 2DJNA 2EQRA 4M3DA 1WCMJ 1T56A 3E7LA 3O8HA 3D1NI 1HCRA 3W6VA 2DA3A 3CDLA 1BL0A 2ID6A 1OCTC 2MGQA 1NK2P 1FIPA 1JUMA 2LK2A 3MN2A 4V2FA 3Q0WA 3VPRA 1ENHA 1TWHJ 2LD5A 1W0UA 1RPWA 1DU0A 1TWFJ 1BW5A 3ZQIA 2R93J 2ME6A 5EGOB 3ZQCA 2DA7A 3PM1A 1RR7A 3OOUA 3ZQGA 1WH5A 5FKMA 2MW8A 3GTPJ 4D5FA 2NS8A 2R5YA 1S7EA 5C4JJ 2JK3A 1FEXA 1UMQA 1ZGWA 3S17J 3HOVJ 1LFBA 1I3QJ 1POGA 2VKEA 2AO9A 2EZIA 2NS7A 2GM4A 5GPAA 5EF6A 3Q3SA 3BQYA 2IEKA 5E3LA 2LVSA 1SANA 4M3BA 4X1EA 1RKTA 1BJZA 2L0KA 4FISA 3HDDA 4DZPA 5DTDA 2ECBA 5C34B 2JN6A 2N8GA 2CQQA 5EG0A 2LFBA 3H0GJ 2HQ5A 4M3GA 2X9DA 3JRHA 1I6HJ 2IBDA 3TW7A 5IP7J 1IJWC 2GM5A 1YRNA 3GTOJ 2MHCA 1SFOJ 5F1JA 3LOCA 4AYBN 5J1RA 1XS9A 2CJJA 2ZB9A 5EDNA 3M4OJ 2LKXA 5BNGA 3G1LA 5FJ8J 2CUFA 2FX0A 1JKRC 3IH2A 2DMNA 1MBEA 2K40A 4C3IJ 2CUEA 2IAIA 3FK7A 3A01B 2JJ7A 1LFUP 1ETXA 1IC8A 3HKZN 1MBGA 5F0CA 1WGXA 2R0QC 2TRTA 1B72A 2XGCA 3GTQJ 4XRSG 2ECCA 4AUXA 5JLWA 5J3LA 1QVTA 1NK3P 3NAUA 2HOSA 3O8GA 1GDTA 3SFIA 5M3MJ 5FKNA 1IUFA 4DZJA 4J19A 2EZKA 2L9RA 3BTLA 1GV5A 2R5YB 3S2HJ 1JKPC 5E3OA 1W0TA 2XPVA 3OSFA 3LSJA 3IH3A 3RQIA 4XK4A 3BT9A 5M5XJ 3G1OA 1R9TJ 1A6IA 4UUTA 2M2EA 2CU7A 4M3FA 4W97A 4XRMA 3BG3A 4A3LJ 3JRDA 1F36A 4A3DJ 2LTPA 1ZR4A 2HOTA 1ORKA 3BR5A 3MKLA 4RBOA 1ETOA 3DCFA 1TC3C 2VKVA 3GTMJ 1FTZA 2ME0A 4D7MA 4JX4A 1IG7A 2JA5J 2M0CA 1Q1VA 1A5JA 1JJ8C 4D7NA 1JT6A 4JX6A 1AHDP 3M3YJ 4GFBA 2HXIA 1OJLA 4A3CJ 2DN0A 4LOCA 1JKOC 3Q0UA 3S16J 1ETKA 2E2HJ 2ID3A 1Z0XA 5K7HA 5E3MA 1MH4A 5F0HA 3GTJJ 1E3OC 1VI0A 4QTRA 1RETA 2COBA 4AC0A 4XRSA 1JJ6C 4BY1J 2WAQN 5IP9J 3DEWA 1XG1A 3S1NJ 3B6CA 4IEJA
chains in the Genus database with same CATH superfamily
2PA0A 2GIVA 4WLFA 4BRWA 2VTBB 4O4LA 1MPTA 1Z3CA 3E3OA 2HDDA 1VLZA 2N1TC 4UZFA 1GUFA 4ZQGA 3M5WA 3OIUA 2FXIA 1YA8A 1VL1A 5JLAA 2WIKA 4F3KA 5K45A 4K0KB 4AI6A 4LUCA 3GVAA 1AUPA 4UHCA 2XSZA 3A14A 4ZHQF 4YBRA 1HKSA 3WYCA 4YP0A 1SKUA 1XTIA 4KXMA 3O4HA 3INTA 4A2PA 3H1HG 2FZVA 3RYFB 1AZLA 5ENVA 1CQWA 3A4TA 1U6GA 1TQ8A 4W4TA 2PLNA 3BG5A 3N53A 1F4PA 3UA3A 5JATA 5B1DA 1KORA 1X58A 1OPRA 2COKA 2Q8PA 4CL8A 4JLWA 4ZOEA 4A9AA 3ROZA 2WTBA 4LJYA 5CP8A 3KOOA 1OKKD 4S24A 1UKEA 3NAGA 4YHHB 1FTQA 2Z5VA 3OYGA 4BGDA 2K02A 2DR3A 3S8MA 4V2GA 1EDIA 4DRXB 2NG1A 4OI0A 2IRFG 3NT2A 3I01M 2VTVA 5HUQA 2O8CA 1SKQA 3H0KA 4B2LA 4B35A 5GONB 1QG2A 3GRRA 3TD6A 1L4AA 4C76A 2O01N 1M83A 3QNWA 5CD1A 1SQBG 2PZAA 2V7FA 4RNCA 2PGOA 5ARCA 4RTLA 5CJ0A 2BGTA 5A4FS 4S1NA 2W7NA 3CONA 3WYFA 2GBFA 2VOPA 3VODA 3UXMA 5IMBA 4FDMA 3ODPA 3T95A 4LYYA 5J5AA 1KJWA 3FBIB 2IDZA 5BVHA 2KWIA 2WG0A 3IDQA 2KL4A 3V4RA 4PBSA 1UXHA 4MWEA 1GEEA 4KITB 4K5QA 1B3BA 1QIIA 4MJ3A 2HD4A 3KT6A 1R6VA 1FBUA 3BSFA 1MO6A 2WIBA 4OIMA 1XLTC 2PAAA 2H5JA 5LP1A 1EE9A 5CVTA 4KYVA 1NP6A 1Z07A 1VSQA 1G3WA 5HLTA 2EDCA 3WSTA 3B52X 3EODA 1X3WB 5CCHD 3JQ6A 4LXTA 1IPFA 3IFMA 2CQ7A 4YJFA 2JAWA 1RJDA 3HJBA 5K4HA 4YLYA 3VU1A 1MBJA 1UJ4A 5JD5A 5D01A 5K0TA 3Q5GA 5HDQA 2NU7A 5ALIA 5KHAA 3HKCB 1R8JA 5FLXA 1YI2P 2VOEA 4G6ZA 3H1LE 2I8LA 2AI2A 4HUQB 2BHRA 5TIIA 4EGSA 4RL4A 1NTKE 4MR8A 1W9HA 2RH8A 1CEXA 4BS9A 1YTYA 3F4BA 3DKVA 1PFQA 2EX0A 3UXHA 5A03A 3O8HA 3FMSA 3DV8A 1GO2A 1FLVA 3VJRA 1Z56C 2EG9A 1E1CA 1FZCA 1Y9DA 4B0OA 5T57A 1T9HA 3LNCA 3ZC3A 5JSUA 5FKMA 2Z6UA 4NX2A 1R22A 1U7UA 3BXXA 3R0VA 1T15A 1JDPA 3G9TA 3PPIA 5H16A 4ZZ1A 3EVGA 4G9GA 3OMYA 1K6JA 3L04A 4TLBA 1DRUA 4P6VF 1XCMA 1R4NB 1RZRD 3G85A 1DFIA 1E1QA 5A1TA 5BMZA 5DTDA 3MGKA 4L8YA 2Y66A 2OZUA 3GG2A 3L92A 4FM9A 3B5NC 2OBPA 3AR9A 4IV8A 3K6SB 5EJ9A 1JQJC 3GJ3A 1J33A 3GLGE 4HXFB 3URMA 4U3JA 3I58A 1JH8A 4G1VA 4H0CA 4UVCA 4OJKA 2QQEA 2BMDA 2W6CX 2VH5R 1WO8A 3BJIC 3C1TA 4DILA 2VNIA 4EJOA 2HMAA 3NAQA 4HFMA 3CLTC 2MYUA 4OMDA 2ASVA 2MSNA 4WA8A 2G5GX 3OO0A 2BW0A 5IY5H 4MRPA 1G4HA 5DYMA 1DAHA 1X2BA 4X7RA 1K27A 2VDWA 5IJWA 4MWTA 2PWAA 3EBOA 2GNPA 1UPFA 3ZHSA 1GL9B 1XVLA 1LLQA 2F3UA 3OPNA 5EOVA 3A0BE 1AHIA 2ZT7A 4EW3A 3HRHA 3I12A 1UMDB 3VO9A 1BXZA 2XVAA 3RG2A 3HVRA 5EJMA 4IX7A 5BWMA 4PSVA 1JG6A 1P0PA 3V4GA 4JPZB 3EMKA 2IHVA 2WZDA 4AP5A 4XCXA 4OHWA 1HXDA 2RMZA 4L9VA 3KUDA 1OCEA 2XDJA 5KYWB 4Q7KA 1EG2A 1NGSA 2RGDA 2AB0A 4MP8A 4DBLE 4HX9A 2IUTA 3HJEA 4WOPA 1YHQP 1XZJA 2C83A 3ONDA 5CM2Z 4C7MA 1UM9B 2QIOA 2I7DA 5D5QA 1Y9BA 1J22A 2VF5X 2YVKA 1U5TB 4AZ3B 5L95A 3N2KB 5EJ2A 1I1QB 4RH0A 4FDVA 4BX9A 2Q3BA 1L8OA 5H4HA 1HPLA 4U3FE 4NMHA 3AE2C 2GB4A 3RT7A 3K9HA 3RHTA 1FYFA 4ZZ0A 1R5JA 4UEWA 1DPGA 1E5WA 5J63A 4MRSA 3UUGA 1KB9D 1RYYA 3K7AJ 3PIPF 4RETA 2J30A 4QSMA 5DJTB 3NFQA 2QLMA 2FE1A 2BKXA 5B4UA 4AO7A 4HO1X 4UB6E 3T1BA 3M4ZA 1HDYA 1ZOLA 1UG0A 5ILGA 3ERED 3FROA 4XWOA 3UWPA 2KZGA 1RXCA 2QJKC 3AY0A 3LA3A 4N7RA 1VYVA 2PYZA 2GZRA 2CLLB 4Q18A 3O8CA 3OF2A 1SC3A 2QD4A 4Z3DA 1NNLA 2HYFA 2RHOA 3EVFA 3PHJA 2PA3A 3PSHA 2A1IA 1DEKA 3HHEA 4HRYA 3IAM1 1Z35A 4LWQA 2L7FP 3AL0C 1FFCA 4ZPJA 3R20A 3LRXA 4B3DA 2FI1A 1SZCA 1Z4IA 3HNRA 2JFYA 4XKWA 2HFKA 1FSHA 4L8WB 1CUHA 2AXLA 4C4PA 3LYUA 2VSQA 1K8RA 2OGZA 5E6SA 3U3XA 4OK3A 3MP7B 3KYCB 2AQKA 1JY3O 4ASWA 1LK0A 2A1TR 2Q4EA 2NVOA 4LFCB 3ISTA 4N5DA 2E1PA 4H0LD 2G9ZA 5CA1B 5SZJA 4BX3A 1LP1A 1GY8A 1TWAJ 3O31A 3H3UA 3IOMA 1X6VA 1FMVA 1TM5E 4FB4A 1T0IA 4H7HA 5BW8A 4KR6A 3BK1A 3VR4D 5LVAA 5IDQA 2WA0A 3JSVC 4G6QA 1X42A 1EQ2A 3R7AA 2ZYGA 1WAMA 1C8VB 2EU8A 2QIWA 3HO6A 2D2IA 4FDUA 4KN5A 1NA5A 3AB8A 5AYVA 4Z0TA 2J3QA 2XNDH 3VFDA 3B78A 2XOXA 1F06A 1XDGA 3MTGA 3E2PA 2VOOA 4ABTA 5KNCA 3H1IJ 3K9FC 1Z16A 5AONA 4ROTA 4XD7D 1XF9A 4P31A 4E11A 3UM9A 3KQUA 4PYIA 3BASA 3V8PA 1X3UA 2JJLA 3RYTC 1JFFA 4ZVLA 3IP1A 1TC2A 3AG3H 1PR3A 1TT7A 4OQ4A 1WKVA 2R4UA 4CMGA 1OYVA 3K31A 5LD2C 3S1LA 1JUMA 1SUWA 3CTPA 3JD4A 1BMTA 3W6ZA 2WQYC 2W9XA 3RU7A 1JEYA 3PQ4A 3VZQA 1KO7A 4QJ3A 3OYKA 3NQOA 2R5YA 4DF3A 3A04A 2BCCD 2ZKIA 1TF2A 5C5DA 2ONKA 3KPWA 3Q10A 3K4PA 4C0HA 1JALA 3AFHA 1WXHA 5TVGA 3V46A 4IWXA 4QMAA 4I7ZC 3KZYA 3QI2A 3DDZX 5J5VA 1XCVA 3RYRA 4TXJA 4RKWA 2C3OA 1CI6B 2UUPA 2VRCD 3VR1A 4RENA 1GTSA 2O3TA 2ZB9A 4Y2UA 2VATA 2IS2A 1H8AA 3C3YA 1I1HA 3DZFA 4Y6QA 4MVJA 1JHPA 2W25A 2JIZA 1Z7UA 2YWXA 2WT7B 4O33A 3M0DC 2OBLA 1ONNA 3MUFA 5GMOA 1HSTA 3HJFA 3L2WA 4UU0A 4DLBA 3OQIB 3V42A 3IQGX 4J19A 1QNLA 4UUAA 4EQQA 2FOIA 2VQFB 3GZ5A 3SFVA 2JLXA 5FCDA 3SY8A 3B70A 3D0QA 2NXNB 2BVMA 3DCFA 1TO2E 3II6A 1QAMA 3S3MA 2FXAA 3SC3A 1ZU5A 1JT6A 721PA 4UD6A 2JEEA 4DWJA 4GG1A 1YACA 3B8HA 4UATA 3BJOA 1Z4OA 2EFDB 1K3FA 1E3OC 1SUAA 3AR3A 3LDUA 4E5DA 4M0FA 1FFEA 2IDMA 4XQ9A 4GL4A 2YMKA 1LBTA 2G72A 1T6AA 1NVFA 3LT2A 2LH9A 3I4FA 3CUOA 1U99A 1L4HA 2FR8A 1PO7A 5SYMA 3H3FA 4ZHSA 1H5UA 1TJPB 3CRVA 1JQAA 3H1LJ 4MWCA 1PN3A 1L3LA 1COWA 3H8SA 4KIFA 4LYJA 2QR5A 3CLRD 2C5EA 4E94A 4EG6A 2NXJA 3TQHA 3NBAA 1VPEA 2QRVA 3KQQA 3KL4A 1GAJA 4MVJH 2DT7B 1R1TA 2PRKA 2VE9A 4LGWA 4TV9B 3PLAE 1DJOA 1YB1A 2VYQA 5L4SA 5CB4A 4AJLA 1JUPA 5ALLA 1Y4UA 4JT9A 5GV7A 2AVDA 4DIEA 3E6CC 3SE7A 2XKOA 3V6MA 3HRKA 1Y4AE 3GAMA 2E43A 2E82A 2FSSA 4Z6KA 2QQBA 4M1WA 2RNGA 1GFIA 1W2EA 3UB2A 4JEHA 4YAWA 3CX7A 1YA6A 4K2EA 2M7AA 4YYZA 2XUAA 5DNWA 2V1UA 2JR8A 2E35A 1KOLA 4M9XA 2IXAA 2RGUA 4EMSA 2PEXA 2ZXHA 3ZMTA 4EO7A 5T3YA 1D5CA 2WSCH 5DASA 4RDCA 1A3CA 3KTAB 5CIYA 5JFOA 2OR3A 1RLOA 4K9NA 4G3XA 4RVOA 4O5AA 1MKYA 2GAOA 2F8LA 1JFTA 2D8AA 2GVZC 2R86A 5TEVA 5ITZA 5BV1A 1VCHA 2KISA 4OMCA 5E1XA 3H65A 4O4IA 1YB4A 4HNHA 1M0TA 1T6YA 2M30A 2QRJA 4KJXA 3OPMA 1GV0A 1L7DA 1UMBB 2NVBA 1P39A 2BEWB 2B9SA 1VJDA 1AUQA 3OZBA 1L9KA 4NV3A 5K7SA 2VDUE 3CMYA 3AI7A 2M3BA 4WTOA 3CKMA 2BEVB 3RK0A 1Z3IX 4P4NA 3IDFA 4HNAB 1DGRM 2E1MB 2P5UA 2DBQA 2O14A 4E7PA 1AGYA 3B1KA 1H6DA 3BOSA 3DPUA 2LY9A 2RG1A 1SLQA 4EPTA 1DTWA 1U3GA 2ZEJA 1O4WA 1PI3A 1IU9A 1B8IA 2HU5A 1RWBA 1M1JC 1Q6ZA 2EGHA 2WKPA 3L75D 3VGPA 1XMOB 2ZI7A 2NO7A 3QPUA 4Z51A 1MZ9A 3U9GA 4DCMA 1PNOA 2YXPX 1YFKA 3R9KA 1JU4A 4OFBA 4C0LA 5IYZF 2XYRA 3GRPA 3PT9A 4PZ9A 1P5ZB 4HGOA 2A7QA 2RKOA 2WZ7A 3GFGA 3S93A 1Q7TA 5K3EA 2F48A 1SFEA 5FOSA 1HMPA 1DTEA 2DPYA 3SBEA 3DCNA 4JP3A 2BKEA 3WU2C 1G5HA 1RI3A 9LDBA 4IIFA 3Q0WA 3DXYA 1YMQA 3DTVA 5FL7D 2HIHA 4L0CA 4ZV9A 5DGIA 3TJZA 2I2FA 3V1KA 4MVJM 3G5AA 1URPA 2EFJA 2NYXA 2JAHA 5E3LA 5LOVB 4LPKA 3V7FA 1M74A 2G63A 1XTGB 2ECBA 5CCXA 4V24A 3I6IA 1XEFA 2Q2WA 2OC9A 1ODLA 4PYMA 4F8EA 5TV2A 3T9AA 4M1SA 1T5SA 4KAXA 4JK1X 3JQQA 2MINB 1EA3A 2STTA 3PXBA 1NDUA 4I1RA 1A69A 4G5QA 1XCLA 5ECWA 3GEPA 4BQOA 3ZZMA 2Q3FA 1MBEA 4D45A 1MO2A 4KU4A 1Q15A 4C3IJ 2FETA 1W34A 4G26A 3CG4A 4RVGA 2R0QC 3TO6A 1TFUA 3KVOA 3ZUPA 1AMNA 1FA9A 5JPIA 5DCFA 3KOXA 4QGAA 3GQBA 4F12A 1H0SA 2XVXA 3VX3A 5DHFA 4M74A 2B7LA 1BGWA 3WV5A 4Y7CA 4MB6A 4DDHA 1DJNA 2J9RA 1LS6A 2UYQA 4IXAA 4CTKA 1EHIA 2PLYA 4ZEWA 3HY4A 1AHDP 1SRRA 1X8XA 1GADO 4FILA 1AA0A 4TLMB 4J3NA 2QN9A 3KOZA 2ZMEA 2VJYA 4NXMB 1WCV1 3OYBA 3ZE1B 1XTPA 2CDBA 3ZLUA 4QG7A 5A2QA 4PANA 1ZKMA 3E48A 3DBVO 2OY0A 1F8GA 2NGRA 3H05A 4V0RA 3EYAA 2QX4A 4MIKA 1KFCB 2X2PA 4B6SA 5JCOA 5CMZA 1ULZA 2LCQA 5A4KA 3UPUA 3IURA 4KKXB 3M5DA 4C7JA 4DLKA 1E5LA 3U9SA 5F9MA 4CO8A 2QTRA 3G7SA 1IXZA 3VR4A 3ZX5A 5BN1A 1I1SA 4Y0NA 2OCDA 1GHTA 3Q7SA 3P9QA 2O1JA 2LOOA 3L0OA 3WDMA 4CIAA 4P3KA 2ZJ3A 3IAHA 4A69C 5BSWA 2VZEA 3HDHA 5FEUA 3KJHA 1I33A 2D3TA 3A9WA 1E2DA 3CCFA 1BGXT 3ZWVA 1NWCA 3ACDA 3QE9Y 4FCTA 2C5BA 3QXCA 1JU9A 3IQWA 2AL7A 2ZAOA 1LDEA 3C3BA 3E97A 2OCIA 4O4IF 1DWOA 2QW8A 3N8NA 4NJEB 5AVJA 4NDAA 1YQUA 3HB9A 3QKSB 5JSKA 4I99A 3IMCA 1Z36A 5KTYA 4U5QA 3D02A 1LLCA 4AW9A 1A5AB 3GU3A 3WTZA 1NI5A 4BP3A 3OD1A 3A2AA 2A5FA 8ADHA 3G1UA 4DMUB 4JYMA 4OHZA 2A6TA 2NVQJ 2JASA 3ETCA 2R62A 1Z74A 5KWEA 4M60A 2PS1A 4MQUA 2PR7A 3OIDA 2VQ6A 3N4MA 2PD4A 4Z9BA 1ULSA 4BDTA 2X76A 2EKQA 3C5HA 1N3BA 3D2BA 1BR1A 3PNBA 2P6TA 5D85A 2ZZKA 4A5SA 2XUKA 1UFOA 2IFTA 2QMQA 2BCEA 1UWVA 1S02A 3CUWA 5I7EA 2C4HA 2WUVA 3ZJUA 4QGFA 3NUZA 3FTQA 3P0IA 4L2IA 5LQRA 5AW7B 4LOLA 1UBKS 2VUTA 1B00A 3TGUD 1DC6A 3IILA 3EJ6A 4KDCA 3N87A 2VYNA 1JCCA 5CD9A 4V0OA 3BGVA 2ZUFA 4KUGA 4IOIH 2E2JJ 5I9NA 4D5CA 2E7XA 2Z6VA 1C9MA 4M54A 5IZ4A 2PGAA 2PIAA 2DK5A 2YUIA 3G6WA 3UUEA 1H1TA 1DKMA 4E88A 1KQ3A 2ZE7A 1CQIA 3L49A 4GM1A 5JZVA 1GYPA 3OV8A 2BE7A 2PWPA 5I8PA 3EWKA 1EHYA 4NHEA 5T6MA 2R9VA 2IYLD 3AECC 5CYVA 1I7LA 2BSXA 1YL7A 2W82A 2AEEA 1O5IA 2G6BA 4TWBA 4I99C 2NZJA 3L8EA 1YHYA 2AF3C 3NGLA 1OGYA 2G07A 4Y9SA 1B26A 4GYGA 3B6MA 2DA6A 4LSGA 1OXXK 3KEOA 2QSUA 2WM8A 5H83A 1LJ8A 4H0LB 4HPXB 3GO4A 2QD2A 5EMMA 4DZRA 4Q4AB 4YXDC 2KBFA 5FKLA 1DGWY 2BHLA 3AOGA 1WMAA 3T12A 4H35A 2V7BA 3HGGA 1KR5A 3GLIE 4Q1BA 3TL2A 3RTCA 2X6RA 3QZUA 3N7AA 4DNPA 2OWEA 5FYDA 3TB4A 4I6MC 2EYQA 3U0BA 1LI7A 3C0KA 4V2FA 1WABA 1OT3A 3SSOA 3OFSA 3RUIA 4F96A 5EGOB 3IXQA 3WFJA 1PAUA 2XTZA 4MVWA 3SI7A 3ASNH 1QIKA 5DH9A 2V4ZA 1D1PA 5JRDS 2VJBA 2J41A 4WZAA 3ZU2A 2HDCA 3ORRA 1Y9ZA 1N2GA 3W6JB 4ZMDA 3V4VB 1EE1A 4Y7DA 4AS1A 3W8DA 5FTMA 1CC1S 3ZGVA 4IZ6A 4IXWA 1EEXB 4B46A 1N8KA 1IJWC 4BQAA 3EDOA 1S5LH 4JZKA 3G2JA 3WYAA 4HQLA 1YJWI 4RUKA 4B6OA 3H1KE 1JEYB 5EJ6A 1YBVA 1OX4B 3IHLA 2KS1A 3JW8A 2G5TA 3UMJA 1JP7A 3CDIA 5F0CA 1Y33E 5EZYF 3ISPA 5IXJA 5K0LA 2P9FA 3PRHA 4ZOLA 2CL5A 4ZD6A 3IDAA 3N59A 4RD4A 2PQMA 3D5EA 3TSWA 3MTDA 5CDTA 5DBIA 1TZLA 3G1OA 4TS3A 2QSZA 3PWZA 1Y37A 4I0BA 4QWQA 3CC4I 3K4HA 4KH0A 1PZQA 2RHDA 2Y2VA 4ZAXA 1CGPA 4C43A 2XE4A 4IDDA 2QY6A 4JJIA 4PPYA 1TQ2A 3C8HA 4D4HA 1NDHA 3BQZA 1XTVA 5F2OA 3ABSB 4QNMA 4D4KA 5LMZA 3ZD7A 1M0WA 1QU2A 1G1JA 1ZRTD 1AK2A 4UQLA 4MV4A 1KU7A 1EFAA 2H1CA 1BCRA 3T9DA 2IYNA 4LZWA 3UFBA 4L9NA 3F6YA 2ZSHA 3IPCA 1UBSB 2REQB 1K8AQ 1BS2A 3GF2A 3WGIA 4RNDB 4OSPA 5BOXA 1I10A 4RTQA 5K8UA 2QRQA 3ZHTA 4HLUA 4ARSA 2AOVA 2CVHA 5DX1A 3WUUA 1Z82A 2JP3A 1T08B 3O8ZA 3A3OA 4XUEA 2BUBA 3K8ZA 3QUCA 2CJWA 4OOEA 5B7NA 3T3OA 2QL5A 3FNEA 2Z9CA 4KXQA 4KQXA 4IO9F 4PO1A 4ZTZB 2YHAA 3WBBA 3PP5A 1NC3A 2PX2A 3EEIA 4TXLA 2FRDC 5AW5A 1JAYA 3BLYA 4D46A 5B2ZA 1TZJA 2BCGY 1ECLA 4EF6A 3L72D 2IRWA 3F7MA 2HBRA 1A5SB 2BHZA 2AXTE 3N9IA 1FP4A 3TL3A 2NPIA 4DV4B 2BFBB 1I4LD 2QAJA 1USTA 1XZGA 1O03A 2A0KA 2GXSA 2JH3A 3BA1A 8ABPA 2VP2A 4URWR 1QB8A 1QV6A 1CYDA 2Q28A 2B4YA 3FIJA 3VO8A 4EJ2A 2KJCA 4DJTA 2P4UA 3A6DA 3GK3A 3LUGA 1TWCJ 3NT5A 4UM7A 4OHMA 5HW0A 2LUOA 1IY1A 1VFCA 3UT5A 3JRFA 3EISA 2IA1A 3FSJX 4R5HA 2BEVA 3F98A 2NUAB 5GVSA 1U5AA 3SSNA 1LBIA 5EEHA 5CG2A 2HU8A 3NANA 4MA5A 1X1DA 1XMIA 5HTKA 2OO5A 3GUCA 4LSWA 4KTVE 4BX8A 1N5MA 1N2CB 3FUWA 3IAEA 1I0LA 2Z30A 3URKA 3V55A 5KC9A 1WMFA 2ZRCA 4LBWA 3CCMP 2KIMA 4YMLA 2ZBFA 4FOLA 3EIUA 2FW0A 3I09A 3TMOA 2PXHA 4UQPA 2NPSC 2HRRA 4M0UA 1UIRA 2J87A 3PXEA 4P38A 1Q0PA 1ZA2A 2ZT6A 2J0UB 3E4CA 5FRDA 4HRIA 1YZYA 3FZGA 1XVTA 4ENUA 5CDFA 5HNFA 3SP1A 5JCZA 2C97A 1GXSA 1UQUA 4U7PB 4I36A 1H4TA 4MAAA 3PV0A 1ETUA 1JMKC 1QONA 3GEIA 3V2HA 4BO0A 1DEOA 2PQ8A 2BAGA 3NWTA 5F1YA 2R7VA 2FNPA 4UUSA 3A4LA 2OEPA 3ZPLA 4YA6A 2UVPB 3U3OA 5CFRA 3C7CB 13PKA 3TBKA 3M06A 3AZOA 1VP9A 4HVTA 1LDJA 2P11A 4NU0A 4Y67A 4HWRA 2VL8A 2HPAA 3D5TA 1E2XA 3LXMA 3PC6A 4KYIB 3H5AA 1V1RA 1W44A 1II0A 1NW7A 1DIOB 3GT4A 3OEED 3HPQA 4ASNA 3MZ0A 5B7PA 4BWFB 1IAVA 1SXJC 5HJ5A 1YTZT 1IQUA 3IXMA 4N82A 4RD2A 3PS9A 1YQWA 4Q05A 1PL8A 1BL0A 5FPSA 3JYNA 1QVGO 3HD7A 1FXWF 4E5UA 2G70A 4PCAA 4JKYA 4P82A 4IJ6A 1B8NA 3KB1A 1LDBA 3NEAA 3Q3EA 2FWNA 1BVYF 1CX9B 4GYKA 4N6JA 2W58A 2QVOA 1IRIA 3CH6A 1WJCA 4KB5A 4CYDA 4XGKA 1E6LA 5DT2A 1RYMA 3W04A 2QMOA 3DEZA 2BOLA 4S1OA 4WFIA 4NMLA 2QKMB 4TQ9A 5HILA 4LY0A 2JLAA 1WJDA 2Z0MA 1C30B 3S68A 1EFCA 1BGYJ 1YD7A 4OYRA 2EJCA 2QK4A 2QN1A 1JHYA 4X00A 3RPQA 2YR2A 4ZTJA 1KJIA 1KEWA 4MGYR 2WUEA 3QXGA 5CG1A 1GGMA 4LIUA 1GG8A 4P7GA 3P2MA 1V35A 5JLWA 1DB3A 2GZ1A 3A7DA 4X44A 4LCEA 1KYOH 3ZJ5A 4F4UA 4IKOA 4MGRA 2EFNA 5E3OA 4G0XA 3AUJB 2QZZA 1BMFD 1A88A 4L8GA 1A6IA 1BG6A 2CU7A 4FFLA 4L0DA 1QTRA 1CF7B 2I0FA 1P5FA 2Y1CA 5LXTB 3LUKA 4DAOA 1OX4A 2R5FA 4BZZA 3AT1A 4KV9A 2HRQA 1VG1A 2ZBDA 4DIOA 3CX8A 2ISYA 3QXHA 1IVSA 4GP9A 4BY1J 1Y1TA 5JAIA 4BVKA 2HCFA 4EAAA 4S2EA 5FFMA 1DUXC 1KMIZ 4KCGA 1QHSA 5BUCA 2BOVA 2AKEA 1JUSA 4L16A 1IK7A 3CIFA 4QUBA 3AI2A 4BFUA 2YFYA 1RY3A 3E35A 2VYFA 2MLGA 2JEYA 5I3CA 3TZ6A 2WF5A 2ZMEB 5SYNA 1XJ0A 4H3VA 3IUBA 2CHEA 2I2BA 3R0IA 2J3HA 4IQJA 2DFTA 2Z2IA 3PX2A 4Z9XA 4MIOA 2NSDA 4DDMA 3E9DA 5LZ2A 4WKBA 1K4SA 1U3CA 5DP2A 4CODB 1E3MA 1JSXA 4F3RA 1FJGB 3LAJA 5AK0A 1W5FA 5A3SA 3BOQA 2KHMA 4ENPA 5E7IA 2X0KA 4HZFA 1KQ9A 2CKMA 1Z4PX 2BFDA 3R3VA 5DEOA 6GPBA 3OWTA 1DQRA 3LU1A 5AKXA 1FXUA 3A6FA 4WZZA 4A0RA 1SQXJ 5AJVB 3BG9A 3NM5A 2FFQA 5IT0A 1WLYA 3L6BA 1VP3A 2R5ZA 4KFCA 1R6XA 1NM5A 1CRQA 2G09A 5ALGA 4BHBA 1LTIC 1V26A 2AFRA 3BAFA 2VXDA 5C4GB 4BNDB 4YCJA 3PDUA 4HQMA 2RJOA 3O4IA 1T3TA 4N4OB 3STWA 4D97A 2LREA 4BKMA 1LDGA 4II3A 2WSCJ 2O2IA 3HFRA 2ID9A 3GG9A 4JYPA 2RHWA 4PLHA 1FFYA 2JA8J 1GSOA 4Z4EA 3O9ZA 1O7FA 4ZJPA 3FSEA 4BNLA 4DYVA 3HABA 4CDGA 1YDFA 3QTTA 1PS9A 3UGTA 4EA8A 1Q0TA 3KC2A 3LE8A 3PSIA 2QDKA 3WLMA 5G02A 2JL1A 1OROA 3CEMA 2ZXIA 4A1FA 5CLIA 4ENKA 2IV3A 3JVEA 4FMCB 5KYWA 3W7BA 3GFQA 1P9LA 1S9KD 1M6VA 3R3WA 5D7BA 3TOAA 1F2DA 2XB6A 3DOFA 3KV1A 3GRCA 3ZXYA 2D00A 3I1FA 3CCRP 1Q12A 5KUTA 4KHPB 1T9DA 2Q8KA 3CG0A 4TVBA 1KV4A 2OQQA 2F6CA 4W9NA 3IKVA 3HD7C 2KPMA 4ZK6A 4ZODA 4MUJA 1LW7A 4OWFA 4N1AA 3OM1A 2FKNA 1FSZA 2QS9A 1DDOA 4ANFA 4CQLB 7ADHA 2P35A 4YT2A 4N5MA 3H5OA 2P8JA 1ZCZA 2EJRA 1QCZA 1UBLS 3GAZA 4UASA 3PXUA 1Q7EA 4XJTA 4BQNA 4UUQA 3JQ8B 4PHFA 3HOUJ 2R1VA 2FE3A 1E94E 4K26A 4G01B 3ZCQA 2A8YA 2AZTA 2H4JA 4AX8A 1J1UA 1ZN5A 3SC4A 3ONEA 4GCVA 1IZNB 4FI3F 2P2LA 4G65A 6YASA 1CTQA 1QQIA 2MH9A 2DA3A 5L3QA 3QTLA 1W0JD 4HK4A 2OCYC 4ZOLF 4R0NA 1EUCB 4O4HF 1QH1A 3DHNA 2IH4A 3AJ9A 5IBPA 3GJ0A 3W90A 1SOMA 4LYAA 2UV1A 3I3OA 4YWJA 2OKGA 1L0NE 5JS7A 4OAQA 3OZRA 3H84A 2O1WA 2Y48A 3V7WA 3QMWA 5J6XA 3NWBA 1L5FA 3JRHA 3TI9A 1RLUA 1IK6A 5JBNA 2FPGB 5IN5A 3H1JD 1V8PA 2VOJA 3GP8A 3TL6A 4D3ZA 3AKDA 5BOSA 4QIHA 4NJOA 5CA0B 1JMMA 1M34B 1OZ0A 2I8AA 3EA0A 1RJGA 1I8TA 2B4KA 2AG8A 2F64A 4BL5A 3I6ZA 2R5YB 1P0QA 4OTZA 4FEEA 2X6YA 4BO6A 2J6BA 3WIOA 1P9WA 1H9AA 1UKVY 3ICEA 3V8EA 3AF4A 5DI9A 2UUOA 5I47A 1T35A 1D0ZA 3KKKA 1S2OA 3OZIA 4P7JA 4M86A 3WGUA 4YMIA 3QYBA 2VJPA 2BFEB 1PK8A 1LPBB 3NTOA 1U9IC 2H59A 1OLTA 3EQZA 4DIUA 4UULA 4YPOA 4X54A 4U7GA 2GDZA 2JHAA 3TRIA 4TKUA 3SKYA 2FJPA 2Y68A 2D1SA 5HDNA 2YC2C 3ZN2A 2QG9A 4MLZA 4CWAA 2WOOA 3N86A 2GMWA 1Z5UA 1XZMA 4AU1A 2XT9A 2ZUCA 3ABOB 2WJWA 3SC2A 1F1JA 1H2BA 3A3NA 4DSTA 4NP6A 1YZTA 1OISA 3PKJA 1MOPA 1JFFB 3GVCA 1YC5A 4NZZA 4MYDA 3HE5B 4WUVA 2A7XA 1U6KA 5CFQA 2PEYA 1ZAOA 2WSIA 3ELYA 4MIEA 3DPIA 2R4TA 3UJ3X 2HH9A 4R1UA 1IDZA 4PBTA 5IDVA 4OINF 4CYCB 3T1NA 1LE8B 3TLCA 3PHIA 3KJZA 4K03A 4LVOA 3M4NA 4IJMA 2MKVA 4PTLA 1JWLA 1XTZA 1PQPA 1FU1A 3MQFA 1QHHD 3IV9A 1REQB 5ANRB 1E3EA 3COYA 3ADKA 3TMKA 3DCIA 2ISCA 4GKJB 1SUPA 5CEEA 3MB8A 3E2MA 2QAGC 1KKLA 2WD8A 1RI5A 2A6PA 2C8KA 4GO1A 1JKQC 2XXBA 2ECOA 1A9OA 4TTRA 4QPDA 4GSKA 2ERXA 3L7DA 4DSZA 4BQFA 4BBJA 4PG5A 2DYKA 3WL3A 2YRFA 3ID6C 3T5MA 5CJ2A 4JA0A 4AQ7A 3DLAA 5JJIA 3T1TA 4G5YA 2P58A 3JR3A 3NM4A 1U0EA 1KK1A 4MULA 1ND6A 3RTRA 5JZBA 4DJJA 5I8WA 1NE7A 2ONCA 1WKMA 1TGVA 4MR7A 2E19A 3DAFA 5GPBA 6Q21A 2H94A 2J3LA 3M6LA 2YWEA 2QQ0A 1W29A 2NUAA 1IM5A 1L7BA 3TMYA 1VF9A 5A5GA 1GPKA 1QO7A 2QPAA 2XQJA 1W88B 3UOGA 4OHCA 1J5PA 3Q8XB 3OJXA 2FX3A 1RF0A 1RS0A 5ER6A 4O5VA 2QSFX 2EBHX 2J5OA 1J5EB 4JUBA 3DEEA 4D82A 3H8JA 3NRVA 2J32A 5AK6A 2BFWA 1TCAA 1P1HA 5BYKA 4HAIA 2KI7B 4ZT7A 5EFOA 2Q07A 4TZTA 1LPSA 2GWRA 4ZT6A 3AILA 3ZN0A 1DHRA 2GOMA 3QJ5A 2UZ3A 4OWRB 2W24A 2J0UA 4QPQA 2Z2ZA 1E1NA 1EFRD 2QAGB 4PCQA 1Q5PA 4RJ2A 3CRW1 1DX4A 1UJ6A 2HR3A 2BFAA 1L5HA 3T7TA 4H7FA 2M2IA 1N7SA 2IPPA 4RBNA 1L4GA 3ZWOA 2YWGA 4GMHA 4BZPA 1AKRA 3ZK8A 1V6SA 1OZGA 1LS1A 3E7LA 1QOZA 4V3CA 2ID6A 1Q0HA 1AKTA 1E1DA 1JB1A 3MD0A 1B8UA 2A86A 1SVUA 4CEHB 3P8ZA 5ELLA 3N8IA 1FYLA 3ANMA 4BRYB 2VNSA 3RJMA 3O8BA 1ZGWA 3L82B 2H54A 2WHPB 4BKOA 1VKHA 3ELDA 1G1IA 1BVUA 1Q17A 1FC3A 3NRBA 3DULA 2H8GA 4FISA 3DEYX 2GBCA 3BQNB 5J8FA 2AZMA 5I5EA 4B71A 1TL8A 3UIAA 1NI4B 3T3DA 3PR3A 1VTNC 3D6MA 2XGJA 2NXCA 1OX3A 1RQRA 3W2AA 1UPTA 2OYIB 2WILA 3F49S 3KD3A 1QVAA 1U7OA 5B3LA 4M71A 3JU3A 1O87A 2NPSD 3VX4A 1DS6A 4JQZA 5JAMA 3S2UA 5K4AA 3BRWA 5JSZA 2BBSA 5MDHA 1CZHA 3S8EA 3NAUA 5TX7A 4JYCA 2PL9A 4XTCS 3R5JA 2JRTA 2JLVA 4L95C 2BEUA 5AKLA 1FEZA 2OVFA 5GJBA 3HJCA 4FHCA 2I1QA 3AM5A 1J1DC 4P32A 5L4NA 1ORKA 1KYXA 3MKLA 3MZHA 3EG9A 5IPFA 5TQ2A 3SJUA 4AIKA 1VE6A 1M2GA 1OX5A 3NYQA 3IC7A 2OZVA 3C3DA 1UUFA 1YZGA 2DN0A 4EY7A 3IO5A 2CQNA 4M9UA 1NJIQ 4GEKA 3TLGA 2COBA 5DMXA 2BLLA 4NH0A 2GUVA 3SF0A 3EPKA 4HVLA 5JO0A 3F90A 5K8TA 5LDDC 1CP3A 3HSYA 1JXAA 1QQBA 2ODEA 3BG7A 3FISA 1GNPA 4DIBA 5A04A 3SZOA 4H6VA 5F1RA 5BU5A 2DLDA 3GXOA 3BR2A 4EFNA 1MU0A 1VJGA 3D31A 1COWD 1QO9A 1Z8DA 4IL6X 1F7VA 1KFNA 4HTAA 1B9NA 2ZNZA 1DPFA 3ETGA 1FZPB 1QHIA 1IUNA 1KAMA 3MLAA 1BQEA 3SEAA 1CR2A 1GRRA 2GYYA 5ALUA 4ZWNA 5K6TA 3LDGA 1E1RD 4HQFA 5D5WB 2X8WA 2HXYA 4MGKR 1HEIA 5JBQA 4EJSC 2OYRA 4U2GA 4AKHA 1QX3A 2HIMA 1F9NA 5M3FJ 4B4WA 5SZKB 4MYCA 1S6YA 3ZZ0A 2XV4S 2AJCA 4PYRA 5JVTA 2RH9B 2HZTA 3OA0A 5JC1A 2HLDD 2CLHB 4Q37A 1MV5A 3M6VA 3R7WB 5JVDF 3T7SA 3SR4A 4Y30A 4GQIA 3USES 3THYA 2PCJA 4JP8A 2ZUEA 2Z8ZA 5SY9A 4JJ4A 4ZVRA 5IU6A 3A0RB 1Y7IA 1VJ1A 2QG6A 1AUOA 1Y1VJ 1WBBA 1IHYA 2X7JA 1KOJA 1RCTE 4YELA 2IPMA 2IOYA 4L28A 5EG5A 2DETA 2W6NA 4DLSA 4BNKA 2YY7A 4MVJI 1S2NA 5K4GA 4P53A 4GL2A 5KHDA 1DZIA 2EAUA 2WY8Q 1J9ZA 1KEEB 1P29A 1JIKA 1QGED 4HDKA 1WPKA 2R8PA 1SU7A 1QO0D 4OBXA 1G6HA 2HUNA 2OM6A 5EVJA 4D4IA 2X6OA 1LNWA 5BW6B 1XTKA 3LSPA 1B8VA 3N75A 1V7ZA 1AY0A 1JY2O 3EG5A 2CFTA 5DK6A 1RIOH 2CSOA 3L1PA 1TAUA 1A02J 3RIYA 3LSHA 5EJ5A 4IOMA 4EG3A 1I80A 3TTWA 2P6RA 1E9RA 3HKEB 2HFED 1WNFA 1KK0A 2BFCB 3JRNA 4LNUB 1G17A 1NU1G 4GWLA 1N0IA 3HGMA 2KXPB 1CUSA 4TVSA 3VOBA 1A27A 1JJAA 1YOBA 2Y9ZA 1A4UA 1UHWA 3E15A 4RY9A 3KJXA 3ZCXA 4IGEA 1Z4LA 1E7YA 2DY0A 3W5VA 4U87A 3IKTA 3CMCO 1VJRA 4CIXA 3OVMA 4CTJA 4N7BA 4Y8VA 1GVJA 1BGYG 1RPNA 1EJBA 1ZD5A 3B60A 1RWWA 1R49A 1NPYA 1WULS 4RK4A 2EBFX 3EMDA 4CG3A 2VLIA 1RM5A 3LIDA 4ME6A 3KZIC 5E6UB 1ZKDA 1ACJA 1N7SC 2V7WA 2VSXA 2HLPA 1PR6A 3UOWA 3EVDA 2IYVA 1Z9CA 3ZJTA 3RSNA 1XU9A 1M2NA 1CERA 4J76A 4P4SB 4Q00A 1RD4A 1MH9A 1KB9H 3E9YA 1ZMOA 1CLEA 4X1IA 3K0AB 5JI2E 3FUCA 4U9IS 3FTFA 4D8YA 2GCGA 2P5SA 2CXQA 4YV2A 2JPCA 2OTLP 3P0FA 1UDRA 5JE8A 4RZ2A 3BE5A 2RD2A 5GADl 3JWGA 5AXCA 5F7JA 2WY7Q 1C0PA 2CL0X 1RAGA 4RTNA 4AG5A 3U2QA 5HIMA 3VOTA 1G5PA 1FS0E 4MDHA 1SQXE 1Y1PA 2ZI6A 5FJ8J 2FGJA 3DMYA 2XVCA 1N2SA 1TP4A 2EHJA 4RZHA 4LF9B 3OT4A 2FMIA 4QG3A 2J85A 2XWPA 2G28A 1TK3A 1ZISA 3O8GA 2Q5HA 4YYEA 3PD7A 4HCJA 1XTJA 1QIEA 2GM3A 1IQ0A 4YRNA 3Q5FA 4NEGA 1C1XA 2OYIA 1ZR4A 1NBAA 4HX7A 3QE2A 3TTSA 4N40A 1KR2A 2HF8A 3KBOA 4FX5A 2E76D 2C54A 4KX3A 4B8WA 4RAZA 3TEMA 4MHSA 2R7MA 1DUVG 5L3RA 4CM7A 2WAQN 3F3XA 1WUJS 4W1QA 4I7HA 3LSKA 1ZHOA 3EYWA 4B74A 3GHHA 3KFLA 2LDBA 2Y6UA 4FIDA 2Q3JA 3DNMA 1MW7A 5KMGB 4EABA 2REBA 1U6JA 3FOBA 3WWEA 2B35A 3GLMA 4J0QA 1USWA 2IPQX 4GR5A 3G6KA 3IR6A 5JAOA 4KGZA 4BKXA 1H4QA 2DHEA 3JSPA 2KYVA 2JLBA 1Z5PA 4KO2S 3MNFA 1MJ9A 1PWYE 3EZ7A 5DV5A 1W1UA 4MI9A 3RJTA 2OO3A 4XIJA 3GH1A 4HQNA 2BFEA 2ZIWB 1AXGA 2ZULA 1DQZA 5LMCA 2G8LA 4FYJA 2P10A 3DH0A 3C41J 3W7AA 2ZZMA 4BFXA 4L74A 3KTAA 3EWAA 2XYVA 3L7IA 1Z17A 3F73A 5ER9A 4EI8A 2AKAB 1H2RS 2VAMA 3UIEA 1L0OC 1IUKA 1ZG5A 4ARVA 4US1R 2IITA 4Y2YA 4XR4A 4MZXA 1NVVQ 1FVOA 3SJMA 1G3MA 2CHQA 4W9RA 1S01A 3CCEP 4XGNA 2H2IA 3P96A 4CIWA 1J2RA 4XLHA 2B8EA 2PX8A 2IC5A 2CW7A 1UOEA 4M9QA 4UVDA 4R0VA 3BCCE 1ZESA 1JNMA 1KU9A 3L70G 3DE2X 1ZK8A 2B61A 4YT4A 3QK7A 2D2CD 1DJPA 1B41A 2NM0A 7GPBA 1NLUA 3AHDA 1KILE 2P7HA 2ZJ5A 3M70A 4HMOA 5EFWB 4DQDA 4UB8C 1T5IA 1ZNQO 4MX8A 1ZYRF 4FFNA 5ELMA 4QBTA 3OX1A 1REQA 1X22A 4WX9A 3M6AA 2W6QA 1E4VA 2QB5A 5AW5B 1APLC 3SGLA 2EP7A 2Z4EA 3E7XA 5F7OA 2LV8A 4GEGA 5CT6A 2VBYA 9MHTA 1VMAA 1GCUA 2FR8C 1FWZA 5TE9A 4IO1A 3BRWD 4BDZA 2IBZD 1LDDA 3TNUA 4HXEB 4JELA 4HJGH 2WRZA 2Q1TA 3FMQA 1GUAA 2WUWE 4RESB 1URQD 1XN1A 3FHOA 1PT5A 2B6HA 3MMYB 3V7SA 1XZHA 3ZDXB 3BIOA 4JXKA 5B1IA 2I91A 5FAXA 2WM2A 4XM1A 3RKSA 5C5CA 1W87A 2FYNB 1GZVA 3FX2A 2EQAA 1D4ZA 3L6DA 2BFFA 3VYWA 2EH3A 1XPUA 5JAZA 2HY7A 4Q7QA 2PS9A 3HWSA 4I1PA 3HYRA 3P8CD 1BWSA 2BT4A 1AU7A 2IGBA 4V1CI 4F11A 1HDDC 3C8VA 1A8QA 2HEIA 2Z2JA 3CDHA 2M8RA 3MJRA 2YXLA 4BQEA 2IQ5A 4IIJF 3IP3A 2ZJ6A 4E2WA 5JNLA 3IP9A 1ZK3A 2AC2A 4ZYYA 3S27A 1RI2A 2CDNA 2ODQA 4MZDA 5C8ZA 1FVFA 1T1JA 4KAAA 4Q66C 4O2LA 4RSRA 4YRCA 3MCTA 1E1MA 2QZ8A 2EG5A 3KEMA 3NO4A 4DV6B 3DWFA 2TRSB 2PBFA 3PQ5A 621PA 4DIQA 1BW5A 5FUYA 1XGNA 3QYFA 1GGEA 3QPCA 3IQIX 1RRKA 1WU7A 3NIBA 3OCJA 3FSGD 5DYGA 1D4FA 5FH9A 3EEOA 1YAHA 5EHQA 1HLGA 1YTLA 1Z5ZA 4M3BA 4NBLA 1RKTA 5ALZA 2VBGA 1R66A 1UBCA 5CAEA 1ODSA 1JG3A 2KYRA 1SCKA 3DV0B 4BNCA 2AXTH 1DLIA 4M87A 4HC4A 1H3EA 1K63A 1KI4A 4RK6A 1JVBA 1R0XA 3FFAA 3DKYA 3GW6A 3H1HD 5J8CA 2YKOA 1GG5A 4X6LA 3L4KA 4JBLA 1EFVA 3QWIA 4MB2A 1H6AA 1G8GA 3KZOA 1PR5A 2YBDA 1KRXA 2DLCX 4L4RA 5E7QA 4H31A 5KQLA 4B5KA 2ZPAA 1JHVA 1IUFA 4PG7A 2AJTA 1J00A 5M5XJ 3FY4A 1DIGA 3O8QA 1XZQA 1YIJP 3C7JA 4EPWA 1N2DC 3B6EA 2QX7A 3VYSB 3HRIA 1FT9A 2PO5A 3L2QA 1JMYA 2HNKA 1CJSA 2BM9A 3I6QA 1R4MB 3ZE2B 3GTJJ 5C7IO 1U8FO 2F9MA 4ZO4A 3NTLA 2Q1XA 1U3FA 1CZLA 4P5OA 2ZXXA 1WUTA 3MUEA 4JKIA 3B2NA 2NTNA 3W7VA 2RB5A 4AY2A 1H0MA 1U2ZA 3RG8A 2C96A 3GF4A 4WY4A 1MBFA 4UB8H 5JD6A 2P62A 1XGKA 1SFCB 4DFDA 1GGHA 1TM7E 3GLVA 3I4MJ 4MR9B 3WHBA 4MPPA 4X60A 4JI7B 2A0UA 3MJCA 3AE3C 1GZHB 3E9EA 1S96A 4D3SA 2IPNA 4B4VA 4ALKA 1T34A 5HS4A 4PPQA 5BVGA 2FZKA 3T7EA 5TISC 4S0ZA 3TW6A 1NLYA 4EG5A 2C7VA 3PDIA 4MWDA 1Z7GA 4JH0A 3KYQA 4D8XA 2C2YA 4RFVA 4E7KA 4F52A 5DBOA 2IGTA 3I04M 1NZDA 4DJ5X 4AP6A 2DY1A 1W35A 2POQX 3IOEA 5A0VA 3BMQB 2TS1A 2VTKA 4YXWD 2VHQA 4IRMA 4WNCA 1A9XA 1O8BA 5FRNA 1AQIA 4M83A 3U13A 5KWVA 3ZVMA 1I5OA 2JMWA 2CZQA 2NZ8A 5EMLA 3G0IA 3A4NA 3AC0A 1H69A 3QENA 5KOYA 4D5EA 3DZGA 3O83A 4G1MB 1OT5A 4EO9A 2QN6A 3W3ZB 4DNFA 1CVIA 1EK0A 3CC2I 4D9IA 5IMSA 1E2IA 2HYJA 4LXUA 1RJ9B 1ZLKA 2R6CA 4MO7A 5GTIH 2QVLA 3ELBA 1W5BA 4QPZA 4R3NA 1ORTA 3O0DA 1WEHA 1YR6A 3PQ6A 1I51A 3PO2J 4AULA 3OQBA 3HL0A 1CSEE 1VQ6I 2OBBA 1ZOOA 2W83A 3R7WA 3S44A 1TK2A 2VQGA 3TX2A 5KTBA 1VE1A 2PX4A 4G0WA 4RM2A 4LF8B 3HH8A 1O97D 2ZJAA 4JV5B 4ZRDA 2I9KA 4KHZA 2H09A 5K8CA 4CQMA 4J01A 4AS2A 2QQ9A 4GI3A 4RY0A 2Z9DA 2CXTA 3EZ2A 4G9BA 3EYIA 3E1KA 4DLRA 2AFVA 3NONA 2CE7A 3R6TA 3AG1H 5DUKA 2QRVB 4WK8F 2IHBA 5BUZA 4K9PA 5E79E 2ST1A 3QOFA 2MSYA 1B14A 3MWEB 3PFBA 4ZKEA 4MQEA 2OHOA 1K9SA 1P1KA 1ZM9A 2VUIB 3FGAD 2B7EA 4ZVNA 4H44D 1P7IA 1JJ7A 4HF2A 5IT9A 3SDZA 3MELA 3C8UA 1KKUA 2DUNA 1DKQA 1AKEA 4G56A 1DCFA 4LDZA 1Z47A 2QTNA 5D3ZA 5CXUA 1L3IA 3DC2A 4MH0R 4HWPA 4U2BA 1PJTA 2UXCB 2HU7A 5LU8A 1T6SA 3R7BA 5KX5F 521PA 6ABPA 4FWTA 3PNLA 5E0OA 1PE0A 3AK4A 1KKMA 3B5NB 1QGUA 1UJNA 4OXRA 2Z6AA 1MEEA 3AKZA 1L0NJ 1VF5D 4BFCA 1ZRHA 1CRWG 1ENOA 1TWHJ 3FH0A 1I3AA 3PM1A 2LVBA 1XWIA 4BO8A 1QPMA 2E5ZA 2A3RA 2HDOA 2H00A 3VDRA 3BL6A 3JARB 1ZL0A 3N8DA 4PRKA 1P0FA 3HJAA 3AEXA 3G2PA 2LVSA 4KN7X 3PGVA 5E9QA 3BIWA 3K4KA 5A9RA 1T6NA 5E8GA 2ZB4A 2W70A 3TW8A 4YWHA 2JHGA 2GERA 4R3WA 5EDNA 1B1CA 3QOYA 4ZT3A 3WMXA 2Q8QA 2A5LA 1E62A 1AKUA 4XRSG 3V5NA 3GARA 2GHRA 2GRAA 4BQPA 3RPUD 5KMGA 3V34A 2R7DA 2FR1A 4H77A 1JECA 1FSFA 5EMJA 2PGNA 1EH8A 5AW8A 1GQRA 4P3PA 1GYQA 4CJXA 1H9TA 1UP4A 1NV9A 2PG3A 5DXJA 3SJ7A 2OHJA 3ONFA 4E08A 1T9BA 2JIOA 1ZU4A 1SQQJ 4DCNA 1QFZA 1NKSA 4BJ5A 2DTDA 2OZKA 5ENDA 3L35A 1N1MA 4BV9A 3F67A 1A4RA 4XRSA 2HEOA 1J5XA 1JFRA 4YO8A 2VP3A 3E5HA 2K27A 1XCOA 2I55A 2IP1A 1KMMA 2EV5A 4DMFA 2QMYA 1O3YA 5CB6A 1N75A 1HDZA 4L9WA 1DEBA 3SF8B 2DT5A 4Y0AA 3DVAA 3QVXA 1JR2A 5ESWA 1W7PA 5HNKA 1Q2NA 1M7BA 2CDCA 3OA2A 3PGA1 3LT1A 3ES9A 4M72A 1UFQA 1ADYA 1F1BA 4X62B 4YMGA 4BXOB 5BPHA 2OFXA 3ENZA 5CBKA 1U0HC 5C80A 8AT1A 5J2TF 5LBTA 4JF7A 1YRNB 2PN6A 3QH4A 4QGHA 5LOVA 2OYHA 1ZKGA 1KAHA 1S7GA 4J0FA 2YHIA 4GDFA 4HS9A 2QUJA 3E9RA 5APSA 3NARA 2LMDA 1D4OA 1DJLA 4DA4A 4LK0F 4KQEA 1D1QA 1IFJA 1XZLA 4LJAA 3EF1A 1E2FA 2IF0A 3LLCA 2NOJB 4ND6A 3UB4A 4UQOA 3QMVA 1AO0A 3AETA 3HZRA 1VPTA 3Q15C 1UIXA 4GI7A 3E5NA 5IAGA 1APBA 2P9EA 2WP8J 1YDWA 4X64B 5KJEA 2K7LA 3LSMA 2OJED 4WE3A 3F5HA 1QIFA 1P74A 5JRJA 3ORFA 3KPHA 3CNQS 4FYMA 4UOEA 2F59A 1Z29A 3GFOA 4LVCA 1WCIB 2H0QA 4BJ5C 1U65A 1W8DA 3PFCA 2I8DA 5DCMB 1ES9A 3U4QB 4E4TA 3T5DA 3D8NA 2OAP1 2GAUA 1QJ4A 2KQUA 4WJZA 1FOKA 3HOYJ 3JQDA 3NYRA 4F9FA 1EP1B 3VR2D 1S29A 4N54A 2IBZG 5CU7A 2K9QA 4OHFA 1UQRA 2R5ZB 4IQGA 1G8JA 5AVXA 3ZNQA 4GUDA 2H43A 1A50B 4BWYA 3F89A 5AUOB 5L7YA 1TVCA 2QORA 4IO0A 2I2XB 5E1OA 1TQPA 2PUVA 3TSCA 2MWMA 3H19A 1R9MA 4OHVA 4Q1AA 4CW7A 3K1AA 2CK3D 4WQMA 2Q45A 2H4ZA 2RDMA 1B72B 1S7OA 1Y6RA 3ZYCA 2YYZA 2B1IA 2C4TA 2PZKA 5FLYA 4NG5A 1NYQA 3ZDYB 3D8UA 3L8CA 1YDHA 4KVZA 4KSYA 2JJQA 3ZZNA 2X5KO 1Q92A 2H2HA 3X1YA 4O4HA 2L9NA 1TMYA 3P8CE 2Z56A 1A96A 5GTIE 5JR3A 2R65A 4MI3A 2ZIVB 1D2RA 3H83A 3GLUA 1WTCA 2Y92A 3M9BA 4IIGA 3I52A 1OA1A 1P7VA 2GI4A 4IIJA 4NU5A 4BAUA 5D3MB 4BXLA 1YUNA 1X7GA 3ADBA 1DP3A 1UAYA 2C1XA 1CNFA 2O8BB 3PXAA 4LDQA 2UXDB 2Y0EA 3RO7A 1OFHA 3OTHA 5IKMA 5LP6B 5C8YF 3JCUE 1MJNA 1MMGA 4O2AF 3HE4A 5ICCA 3Q7EA 3G8DA 2PJPA 4BIMA 4ILEA 4O1MA 2AR0A 3SXJA 2FQQA 2IE8A 2HLNA 1QL1A 3KKLA 4CUZA 1NU1K 2HNBA 3EEQA 3WBFA 4LLHA 1DKNA 3B5EA 4BE4A 1Q3KA 3U7JA 4V02A 1RYBA 2AC4A 2A9RA 3EVTA 1SVLA 1B1AA 5APQA 3F7NA 3H5LA 3R4KA 3OC6A 1X8KA 3M1LA 4QX6A 4TLAA 1XBTA 3CEJA 5DRTA 2ZIXB 4JVMA 4XI9A 1ADGA 3D6TB 1H42A 3GDHA 4M6YA 5CDGA 3DE5X 3WMM0 5CQGA 3ECOA 2G5CA 1VQ5P 1XK7A 1RHRA 5HZGA 1M0SA 2OYCA 1GRQA 5C2JB 1FLDA 2HHJA 4W6QA 3B3FA 1Z4QA 4IOLA 1WJAA 2Q5UA 2DG2A 2P1ZA 1WSUA 1PP8F 4BX2A 1GPH1 3T1YB 3RYIA 4KUEA 2G9WA 1YJ9I 1OV6A 4D9MA 3I2HA 1JPVA 3HMKA 1P60A 5K5RA 2ZJSE 2X22A 2DQSA 3GJ5A 3LKBA 4D7NA 1NI4A 3CN9A 2FYNC 5DGHA 2W2KA 3PVCA 2BIFA 2PRSA 1P7PA 4EM2A 3AIMA 4D4JA 2HUPA 5FEMA 4DG5A 1G16A 2OYOA 2HTEA 5KSPA 3PG5A 4IIBA 2EA2A 5ENZA 4PNPA 3OO1A 5LLTA 1SZJG 3Q7TA 4LF4B 2M6KA 1TJ5A 4I46A 1LLDA 3DYBA 1OCZH 1I39A 3NBMA 3JYOA 3RSFA 4ILKA 2YZ7A 4G8JA 3IH4A 3BSYA 2G8NA 3AHEA 3L36A 3RJZA 4U3FG 3DZHA 3JAMA 2PQ6A 2ADFA 3PPXA 5MFZA 3HKDA 5FFZA 1I6KA 4PXAA 3NUQA 1YV9A 2BGGA 4IL6H 1SXJE 2WYHA 4L27A 1KQ0A 3QWOC 1HT3A 4JNKA 2DX7A 4L6CA 3WQRA 2QN2A 1DARA 5CFZA 2R60A 2NPOA 4YAJA 5L7TA 3IIKA 3MWMA 2DPMA 2VR1A 2WFLB 2J9FB 1G7CA 3K70B 4WN3A 3QP9A 2XU6A 3HYIA 3H1HE 3N3AC 1W4ZA 1GEGA 4KAFA 4PLWA 3NWSA 1PT8A 3ZQQA 3GMSA 3OTQA 2B8WA 1TUBB 1UDBA 3O2QB 2ZJ4A 5LYJA 3EASA 2NO1A 3EH2A 5I3ZA 5D3KA 2H3EA 4LMRA 2I6GA 1JE0A 2GBGA 4D6TJ 4AURA 4QXPA 1NTRA 4RKRA 1I3CA 3N0RA 2GZAA 2PUFA 4IDOA 1BXGB 4P34A 3AZQA 1JKJB 4G1BA 1TYDE 4NF2A 2EXXA 4WY2A 2I67A 3FMVA 4ZI7B 2BISA 2QN7A 1G9XA 1P0CA 2P3OA 4BNMA 5KLVE 2R5WA 2WBLC 2L7ZA 4ZV4A 3AE7C 2C94A 2ZOSA 4KIJA 2GKSA 3TIVA 3WGHA 3I9MA 3DDOA 1EPUA 4NPDA 1BCSA 1SH7A 5DJ5A 1Z0IA 2FYTA 1OI2A 3KHUA 2OHXA 2YCBA 1LCIA 1TC1A 5DYYA 3UMMA 1RCFA 4X41A 2RKHA 4YLGA 3RZDJ 2QSGX 3BJZA 2FPKA 1YR8A 5HEKA 3G49A 2V3VA 3HDVA 1N92A 5EJEA 1CUDA 5B6PA 4GYYA 1LXCA 4IEIA 3VQTA 4MV7A 1JT9A 4TUYB 1U94A 1PFGA 2JK0A 3OJWA 3SK0A 1E1RA 2HMYB 5KLIC 1ARZA 1O2DA 3LT0A 3KUCA 5DNDA 3K6RA 3D7RA 1NTME 1LFAA 4GBJA 4C21A 3L9FA 1L4UA 1U81A 3GRVA 1SXJB 3ZDBA 4ZQIA 3KOYA 3LLVA 1U57A 3A9UA 3A3PA 4RQAA 4PM4A 4A0ZA 4V0MA 3RFVA 4LECA 1O3TA 4HDMA 1F20A 3F9CA 4TMVA 3HKEA 2BFCA 4LNUA 4AN0A 3RVPA 3Q6MA 3DBHB 3SSAA 1KHTA 3ZD6A 1D6MA 3JAKA 1K66A 3DLPX 1FIPA 2QROA 1GG2A 3VPRA 2QVXX 1JIXA 1KFKB 1G9TA 1E7WA 2BPOA 3N6VA 5FWAA 1D7OA 4PSUA 4IUDS 1J0EA 2ZM6B 5DHTA 1IYZA 3KQNA 3I55P 3OOPA 2CNDA 4B3SB 1M7GA 3Q1KA 2EZUA 2A5GA 1NJ8A 1G19A 1SANA 3QF7A 1Z6XA 5FBWB 3TEFA 5HNHA 2JSPA 1SXQA 4EPXA 3BPXA 2XIQA 4BDSA 4LTDA 1PG0A 1MGTA 2B8JA 4C0AC 3GIWA 4L8FA 2K37A 4BNNA 4DJFC 3FNHA 2K40A 1GKYA 2GF9A 1DPUA 2D7DA 4JC4A 1EE2A 1WGXA 1Q0SA 2TRTA 5E9JA 1CUWA 5C7OO 3OHMA 4XXHA 3EDRA 2QJRA 4AY6A 4CVNA 5F35A 2WVAA 4IQFA 2Q3EA 2ONYA 4ZCQA 4YTEA 4EW2A 4CGZA 3E5QA 2ZANA 2K4JA 1K7FB 3HVKA 2NRGA 2NU8A 1RM3A 3IOCA 3R7FA 3I39X 2GLXA 3VPDA 4R68A 2P69A 2D0DA 1WQ1R 1Y6JA 4Y2SA 4TT3A 4WWHA 1MMAA 3RK3C 4KQ6A 3Q0UA 2V26A 2IYPA 4DJDC 4PG6A 1RETA 4I4LA 4F4FA 4B3XA 4C3UA 3FUTA 3WQSB 4IEJA 3ZY5A 3UKDA 4ZYTA 5JASA 3JQFC 1SBIA 3AEKB 1WZIA 3TGPA 5F1KA 3UXYA 2HNAA 3KUXA 4UTRA 2G8YA 3UUWA 3JAMZ 3TQSA 1R5OA 3PXGA 2ARKA 3QKTA 4FCYA 2YIMA 2V9VA 3NNSA 2E2IJ 4ENVA 2O8DA 1UCFA 2DA1A 3QXJA 1WXEA 3O9VA 3ZV7A 4MO2A 3VMXA 2JJYA 1Q2XA 1K89A 4EYQA 3GLFE 1N7JA 3KHTA 1RFLA 3Q9LA 2JFBA 2M8GX 1ZMTA 5I45A 3SYRA 1WHUA 5AI6A 5KJ6A 4QDUA 4D9CA 3E1GA 3B9PA 4OP3A 1QAQA 5DCMA 3K0AA 1WUIS 3LBFA 4OHKA 1QK4A 4BGVA 3SG0A 1O3RA 4BTEA 3QOEA 2Y0BA 4B2PA 4KRGA 2IT1A 3PJSK 3II6X 3EXG1 4NFYA 1QFJA 1IUYA 4UHFA 1SFRA 5C1OA 4MGEA 1YIOA 3V7UA 1LY1A 3ED1A 2V7QH 5FPHA 4ZYAA 3CLOA 1IO2A 1MT3A 3MWYW 3BR1A 2GBLA 2R7UA 4PGFA 3O82A 1RYFA 4Q19A 3P4YA 4IIUA 2B92A 3CCVI 3QFSA 1P1BA 2WF7A 2ZYVX 5AP9A 4C4SA 1D0IA 3NHMA 3DDUA 4BE0A 3E3MA 1FUIA 1BFUA 2XUBA 4JC8A 4UEOA 4B0PA 3OCZA 2CLIB 3FZNA 1Z6PA 4LG0A 3H1IE 3JALA 2PXAA 4X95A 2C0WA 2XAAA 1E0SA 2E42A 1SCJA 3DDSA 1WJFA 3DONA 1LT1A 5ITWA 1KS2A 3JRXA 1PJ8A 3GNQA 4F97A 4RZIA 2C0QA 4ZYLA 2JIPA 5K09A 5DNCA 1YQAA 1YCFA 4ZCSA 4JCOA 2KSJA 4ZOQI 4HEJA 1NWQA 5HRUA 1T2KD 3PO3J 1KZ4A 2LBFB 3CF0A 3THXA 2ZR0A 3FMGA 4WJLA 4NZYA 1E66A 1N7HA 2F4IA 1BIBA 4HN2A 1SAXA 2F43B 4AQYB 1ZICA 1GQYA 3DHEA 4LDRA 2CCKA 1XA3A 1T4GA 4PW0A 5JMPA 5E2IA 2AOUB 4BLTA 5G3YA 2YSRA 2KBEA 4IYJA 3CRRA 1T24A 3FB1A 4LRWA 3U4AA 3EXHB 2R79A 4I6ZA 2R6FA 5IBCA 5DTRA 3R3XA 2QRHA 2W6JH 2W2XA 5HODA 2C2XA 2W71A 1E8DA 1E61A 5K3DA 3I6BA 3SDGA 4HVCA 5AVUA 2HODA 1A97A 2X8LA 2F62A 4E5NA 1RP1A 4MKXA 4Q47A 1DRVA 4OK5A 3BXFA 3QLJA 2YJTD 1YITI 5KREA 5BV8A 1OLXB 5JTTA 1RF1B 2R84A 3NIDB 2VJ4A 1ZNYA 3EVAA 3H1PA 3SLGA 3HQ4O 3ZBPA 1MX3A 3WLJA 3VJLA 1NU1J 4XDYA 1XCPA 1E8NA 5A9SB 1ZCAA 4L02A 3MKZA 1GRCA 3N2EA 1L6RA 1BJZA 4BKQA 1E20A 1XKQA 2O2YA 2P2GA 2VDVE 2YQ4A 3HYCA 4Y9UA 4FT8A 3CSUA 1XRRA 1GPUA 5F3WB 5AT1A 1EBUA 1HBJA 1I3NA 2XYQA 2LKXA 5BNGA 4IL6C 3GCXA 4TWAA 5HWSA 4P36A 3HY3A 2R6HA 3B8EA 4LE1A 1M76A 1DL5A 1LFUP 2XNKA 3ENVA 3PA6A 4LGYA 3G88A 4DNXA 4ZO6A 3NORA 3IQFA 4XYBA 1Q91A 1QHFA 4EGCB 1IJDB 4LMYA 1Q0QA 4AUWA 3BRVB 4LLLA 4NHOA 1NBHA 1JLLB 2EX1A 1R9TJ 4V2IA 3RUFA 3NV9A 1LTTC 1DLJA 1ZI9A 1C3LA 1V41E 3L6UA 4HXGA 4DGSA 1EXNA 4LB5A 1TC3C 4WXMA 4WADA 1MXFA 4UVBA 4CV2A 4DL9A 1ECBA 3ZR4B 2EGGA 2LE0A 3EQ6A 3NDRA 1ANKA 4DNQA 1FYEA 4OU0A 3LTEA 4ISCA 3I6YA 1U2EA 4FYKA 5E95A 2PQ0A 3WRYA 1ZQ9A 4F7DA 3JPYA 4EHNA 3SQOA 1EF4A 3K0EA 4EJFA 3UJHA 4CYMA 3EFFK 1TIBA 3QY0A 1PS8A 1J97A 5BSRA 1TTQB 3TH5A 5JROA 2XE7A 5EJ8A 2IZZA 4FN5A 4AP9A 4YTPC 1R1DA 2F5CA 1VQOP 4E07A 1MB3A 1S8AA 3QIVA 1FYWA 4US2R 4PNHA 2IX7C 3FR7A 4YBZA 1IBMB 3EY4A 4TMTA 3C48A 4NB5A 1BOAA 1XRQA 3PUYA 2CCJA 4ZVUA 2Z95A 4LJSA 1G6OA 1SQ6A 3G2KA 3H1ID 3LPNA 2E1NA 1FFWA 4B6EA 2IDJA 3KD2A 4FD2A 2XF6A 1G60A 2ZWPA 3H3VK 3DFIA 4PFQA 5G3ZA 4H60A 3PCXA 2LY1A 5IARA 2K9MA 3W8FA 3IO3A 5AM5A 4TOIA 4I09A 3W67A 1V48A 2BKUA 4XQGA 2AMFA 3IT2A 1JAHA 1H8AC 1UFKA 1ONSA 3QLTA 3WOVA 4YMSA 1UXGA 4K6KA 1VKZA 1XWWA 2XTNA 4LBZA 4JQYA 1R8YA 3CUQC 3NJ4A 4EMBA 4P7FA 4IMJB 5F73A 3LQQA 1MB4A 5LWQA 1TMOA 3QRFF 1TW2A 3J81K 3CO6C 1N2XA 1KZYC 4J90A 2L02A 3O92A 4DKXA 3AOEA 4PZ0A 4C9YA 2HB6A 2QVYX 1QRUA 2WWGA 2EINH 3ML6A 3TINA 3LIPA 4Z0NA 3SMVA 3KNZA 4NFHA 2RMKA 1FOXA 4KQGA 3QMMA 1RPJA 3BPVA 4TT8A 3V4OA 3SVZA 3U1DA 4HZUA 2OT3B 3PIIA 4OATA 4BTLA 1LBEA 3L1KA 4M9ZA 3E84A 1NWHA 3OLYA 1IBSA 5J4YA 4B84A 5EP3A 1ZIYA 2PMDA 1ODDA 2WIAA 4HYEA 4PXYA 1HDIA 4JBNA 5AFSA 3R2PA 4O4LB 2YVQA 4QRIA 2WA2A 5IPAA 4R1HA 3ORQA 4QYMA 2IL1A 1M6WA 1FDIA 1A9SA 4URXR 3SXYA 4JX9A 4ZAWA 4Y2RA 2Q2OA 1TQ4A 1L4EA 4WKOA 4ZI7A 1O6CA 2HSJA 2ATIA 5LU9A 4TXNA 1E3QA 4A03A 4MA4A 1SBHA 2IA0A 1ZRDA 4H17A 4L5AA 7REQB 2FSVA 3WYGA 1KOFA 1NG1A 2OFOA 3K7EA 3PFHA 2OTJP 1ZITA 2PYIA 1ZEJA 5CXXA 3WHKA 3TTXA 4XRGA 1P4SA 4QXAA 4RGUA 1RLTA 1JLHA 2A92A 3SBOA 3H1LD 1M57D 2BY2A 3CLTD 2C59A 4WL0A 1L1EA 3JTEA 2ZM5A 3V8KA 1E9BA 1RQPA 1BFKA 3NKFA 4DM7A 3SZ3A 3WMEA 1DTWB 2IOFA 4LVNA 2DQ4A 2OA0A 3X43A 2CGPA 3IPRA 4PZYA 2W22A 1QE0A 1R0BA 1AGPA 2C20A 1I3LA 1FU8A 5ED4A 4ESEA 4ZVSA 3KG2A 4B7ZA 4ND1A 1DC7A 1PJSA 1GQSA 4RAQA 4X24A 2I7VA 1IN8A 2IYFA 2VXZA 1SKYE 3NTQA 1T4CB 1VDZA 3QLUC 2K5CA 1XSEA 3A1FA 1VRVA 3K73O 3L70J 8MHTA 2H6BA 4WB4A 2W43A 3MT7A 4J7UA 4B47A 1B6TA 1H2XA 1INLA 4U2CA 1ORHA 3RBVA 4QQKA 2DHCA 2J3IA 1S2DA 4DNOA 1FFHA 1QRDA 1IXRC 1K6OA 1P8JA 1P84I 2OZPA 1MXHA 1SBYA 5CLJA 1KYOI 5EJAA 1DRWA 4R98A 2UKDA 2P78A 3REOA 1LI5A 1RXYA 4QREA 4BNFA 3A27A 3I54A 3CRNA 5B57C 2H17A 1FJHA 3OY2A 4ZKPA 3ZQKA 1Z4KA 3FYTA 2CHUA 4YJ2B 4J4BA 1V3VA 5D6OA 3M3YJ 3HBAA 1NG9A 1L4AC 5BPIA 4E2FA 3A58B 3WWDA 1Y42X 4Y13A 5D3MA 2HZDA 1ZXLA 3B6CA 5HXAA 4HH0A 1VG9B 5CLGA 2Y8EA 2QI9F 2ZXEA 3T1QA 1MZPA 3O91A 2TYSB 3ZCRA 3D1VA 5IP5A 3CZ6A 3USCS 3KYCA 4D80A 2FU4A 2UZKA 1UP7A 3ESDA 4WWIA 3MCVA 5JDIC 3AH8A 1UHSA 1NJSA 3BR3A 2HWXA 3VH3A 2X4DA 1HY3A 3Q6IA 3U60B 3CX6A 3CF6R 2QN8A 2DWUA 2P81A 2X5XA 1O97C 4HY3A 3WTVC 3FWPA 2ZSDA 4BBRJ 1I1GA 2OXEA 2XB8A 3MMNA 2WYOA 1RQGA 4KE7A 1L0ND 2BYVE 2Z2YA 1IXSB 2CUKA 1DKLA 2W5UA 2ETHA 3QLVA 3BTVA 2O7OA 4LKRA 4MV0A 2ZVQX 4ZOLB 4DSUA 2BTEA 3HNPA 3KLNA 3FUXA 1G2CB 4YQYA 3VYUB 1MD0A 4QEZA 3AU8A 3EWSA 3J80Z 1TMKA 2A05A 1EDJA 3RWMB 1FBQA 1CQXA 1NNEA 2C7OA 3KSMA 3L79A 2E87A 4MDFA 3T8RA 1Z2CA 2I6TA 5I7RA 4WSOA 5AIPA 1G3QA 3A25A 5DS9A 2FUG2 1NRJB 4QEKA 1R9NA 3RJ5A 1HGXA 2ZXFA 1PR4A 1QWOA 4NBQA 4IIDA 3WMWA 1FFGA 3RH0A 3VC3A 3S7ZA 2BUAA 4CMIA 1XMSA 5ICSA 4IJ5A 5LB2A 5BV0A 4M1TA 5I4IA 1YOVA 1JY2N 3X1JA 1MDBA 3G5TA 2PKXA 3T7JA 4PX2A 2V3WA 2YU9J 2IYWA 2XNDA 2XPWA 3NT4A 1WI3A 2A9VA 3D0OA 4ACBA 3HCCA 2DBBA 1JJVA 1JBKA 4CLRA 1V9CA 4KQ9A 5D8KB 1UKYA 3P9CA 1PR2A 2XCSB 3AQ4A 3LBIA 4HH1A 4B81A 4F4HA 2LG4A 2NZWA 4EGFA 2B30A 2JJ2A 3JD1A 4F6RB 1KO1A 1LBQA 4XIGS 1SURA 1YCDA 1A0OA 3GNLA 3LRTA 3J80K 3AKEA 3FXLA 1G4UR 4HAZA 2FPPA 1SB9A 1T8SA 3PRKE 1NBMA 3KWJA 3JRIA 4LZNA 1KO4A 1RZRA 2C3PA 2BHNA 1VRCA 1PJZA 2ZO4A 1AE1A 4L75A 3DMTC 4AY4A 3L73E 1E9FA 2OGSA 1NPTO 1N78A 2XT6A 1ZJYA 3GMAA 1OHHA 2PMZN 2Y0CA 3ZHZA 1N2OA 1P9OA 1XMJA 2QCOA 3WSVA 1JF8A 3UQYS 5CW2A 2D13A 1BCCE 4B31A 3LX4A 4XDHA 4FXOA 3RS4A 1J1ZA 4GXNA 2Y77A 4YCLA 2EILH 4MARA 2JGKA 1YO6A 2OXRA 1K4YA 3U7QA 4WA7A 1VQMP 1I4WA 1VFNA 4AICA 4EM1A 1G21A 1H5NA 2Q4DA 1PJBA 3GOHA 2REXB 3L0SA 3K0CA 3DLCA 1ECGA 3BCAA 1KQNA 1UZCA 5L7WA 1EGMB 4JDPA 4NY1A 2OZLA 1GDDA 1QQ5A 2KP8A 1MD9A 3BWMA 5JPDA 1OCTC 4NS1A 1SU6A 1ZJ6A 2F1IA 1R27A 4XLNF 3CXHE 4MQFB 1D0VA 3O8QB 3VOSA 2BC9A 1DWPA 1T3ZA 4JLAA 3IVRA 2H1WA 3RANA 1R6DA 1XTBA 4DZPA 4R8HA 4TS9A 4BO4A 3LUHA 4WCVA 1M0EA 3SNKA 1E2EA 3KTOA 1LV8A 3CLRC 1X0TA 2J48A 1XT6A 4IZIA 2XZRA 4B09A 4HGRA 1XQ6A 4MQ4A 2VQHA 2PMEA 3GUHA 4PGHA 4HDCA 3LWZA 4N3CA 1O6BA 3IODA 3PC8C 2A3NA 4C7OA 2VJ5A 3LHSA 4AKSA 3S2FA 2DU9A 3UICA 5E4JA 1YFLA 2EW1A 3WXMA 1QOQB 1TA9A 4R1NA 1L4FA 4BMVA 1KZ9A 3B1FA 3B73A 1NC1A 3HB7A 4R81A 1XPJA 1NX9A 2IKQA 4A3CJ 3AESB 1HDCA 1J2UA 1LQ1A 2A5WA 1EZ4A 5HKAA 3ZVRA 3AJAA 3EDPA 2FQ3A 3J7YJ 1E7MA 1DAKA 3VU3A 1WH7A 3JYQA 2A9KA 2VQ3A 5EFZA 3KPVA 4TT3D 3AVOA 1IQRA 2ZYTX 1T0HB 1HGZA 4UNOA 2ZS8A 3AL3A 1R00A 2ZWOA 4LPSA 1I2ZA 2JI4A 2CV1A 1CWUA 4UTPA 4KQFA 1WQ4A 2II6A 2NO9A 3GAFA 4XICA 5FPQA 1MZBA 1JNYA 2LPMA 4F91B 4HF7A 3TZBA 5JC8A 1X1SA 4MKIA 4QQFA 2GXAA 3KUUA 2UV8A 3CVUA 1BD3A 4JI5B 1VL2A 4MVCA 3U16A 2Y2UA 3VVBA 1VSTA 3HYTA 4TWZA 4X3PA 2ID4A 2QZPA 2IIBA 2P4EA 4JT8A 1IM2A 1W4RA 5I7UA 2A9FA 3PNSA 2EFGA 5JNRA 1VOTA 1R36A 5EKTA 3A3YA 2IUSA 5CM8B 3TEJA 3H1TA 4L5BA 2VA9A 1A72A 2WD7B 3NOQA 1CDZA 1UOQA 1NF9A 4D0NA 2OU2A 1EH7A 1J90A 1CZRA 1Z62A 1JQDA 4P7KA 4Z9YA 1DXYA 4G37A 3NHUA 3HPHA 3CCJI 4IUYA 1PFIA 3EW9A 1Z8FA 1CE8A 2GTIA 2PVPA 2HJGA 1Z8HA 5COBA 4PQEA 3NVAA 4DZOA 2FMFA 3F96A 2BZSA 1NAFA 3VAZA 2HPHA 2QRMA 1UODA 4CM8B 3EVCA 3FAZA 3GNTA 4TWRA 1XEWY 4PR3A 1VMKA 3IEXA 5LCXA 1M2VA 4RTPA 5A5EA 2AJDA 2R96A 5DHRA 4YCMA 1WMBA 4B1RA 4ASVA 2EHDA 4HNTA 5IVIA 1L4YA 2BUCA 1H2ZA 1AGNA 3PWTA 3DL7A 1B16A 1B8OA 5K0B