1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
1K83J 1MBGA 2CQQA 4A3JJ 1S7EA 3NARA 3S15J 1IDZA 5IOZA 2XSDC 1U78A 4JP0A 3NAUA 2HOTA 5E3LA 5IOYA 2XRLA 4M3FA 4AYBN 1BJZA 5F08A 3BTLA 4S0HB 1VF9A 5EF6A 2H1KA 2HXOA 2L9RA 3K7AJ 2WB1N 2Y9YA 1FJLA 4XRSA 3IH3A 2JJ7A 3LSGA 4M3BA 4A3BJ 3A01B 1BL0A 3ZQGA 4BBSJ 5F0CA 4B4CA 3GTQJ 3BR6A 3S1QJ 1GUUA 1MH4A 5GPCA 3BG9A 1IRZA 1FEXA 2E2JJ 1IG7A 2X48A 1RKWA 2G0EA 1H88C 2RSLA 5FLVA 1GV5A 4M3DA 2LK2A 2JA7J 1HDPA 3DCFA 2E19A 3QQAA 1ETQA 3BTIA 2JA5J 3OIOA 1JJ6C 1MSFC 1Y1VJ 2D5VA 2XGCA 4AC0A 3TW6A 3MVPA 1ETKA 3CDLA 5M5WJ 4UUSB 3O8GA 4DZPA 2NS8A 3ZQFA 5E3NA 3UKGA 3G13A 1R9TJ 2R93J 3H3VK 5GPAA 4C3HJ 3LHFA 3FIWA 1OJLA 1ORKA 5EGOA 1JKRC 1JUPA 3ILXA 1UHSA 1AKHB 2ZB9A 2XB0X 3HEFA 1QRYA 2DJNA 1WH5A 3PM1A 4QSHA 2HOAA 4MLOA 3BQYA 3GUVA 2LD5A 3TP0A 2XPWA 3Q0VA 3S1MJ 3Q3SA 5J1YA 4JX6A 1MBKA 3SDGA 5IYDJ 2O8KA 2X6OA 1ETYA 1OCPA 4A3DJ 4A3MJ 3FKIJ 1ZGWA 2L0KA 2GM4A 3A01A 1YRNA 5F04A 3S1NJ 3JRFA 4FE4A 2K9QA 1LFUP 5J1RA 2FX0A 2GBYA 4G12A 2Y2ZA 5EG0A 4IHVA 2DN0A 4FCYA 1JKOC 4DZJA 4NDLA 3HBLA 5M5XJ 2NOGA 3RZDJ 1ZTRA 1RPWA 2DA5A 4A3KJ 1DU0A 1JT6A 1ETOA 2L7FP 1RR7A 2XB5A 1WGXA 1GHTA 5F27A 1X2NA 3BG3A 1BW5A 2H8RA 3HM5A 1ENHA 4AUXA 2DMNA 4UUTA 4UUSA 4MO7A 4B3AA 5C35A 1MBEA 1HF0A 3GTKJ 1GV2A 4DYCA 4W1UA 3LOCA 3HDDA 3M4OJ 3TP3A 2LVSA 4M3GA 4A3EJ 3ZOBA 5C44J 2Y30A 1AU7A 2CUEA 2PMZN 1AHDP 3W6VA 4A3IJ 3G1MA 4FTHA 1B72A 4Y7NJ 1G2HA 1VNDA 4XRSG 2K40A 3HOXJ 1VFCA 2L7ZA 1Y1WJ 1AKHA 5EGOB 2YU9J 1F43A 2ME0A 1MSEC 3M3YJ 1TWCJ 4BY1J 1JJ8C 5EZGA 1MH3A 2K9NA 1WI3A 2JA6J 1F36A 3TEDA 3MKLA 1HLVA 2AHQA 1TWAJ 1YRNB 2EZLA 3WHBA 4XK4A 5C4JJ 2EQRA 1QVTA 5FJ8J 3K2AA 1MBJA 5IP6A 1FTZA 1VI0A 5EG0B 4MFEA 3TW7A 2HOSA 4RBOA 2VI6A 1SANA 1MBHA 2EBIA 2DA4A 2GLOA 1UG2A 4IHWA 1ETWA 2LLKA 3DEWA 2R5ZB 1O4XA 2B63J 3E7LA 2FJ1A 3FISA 4MIMA 5EDNA 1HX7A 5K7HA 5M5YJ 3B6AA 1JKQC 1NK3P 1TWHJ 4QIWN 3D1NI 3GBGA 5JLXA 2M9HA 1APLC 2P81A 3MN2A 5EYRA 2TCTA 2DTZA 4BBRJ 2XPUA 1JUSA 2ECCA 4FISA 4A3LJ 2CJJA 3Q0UA 1ZKGA 1JT0A 1B72B 1H8AC 3CCYA 1WCMJ 1U8BA 4L5EA 1T33A 1U9OA 5F1JA 2VUMJ 2IEKA 3HKZN 4IHXA 1E3OC 4BY7J 2IBDA 4A69C 1GDTA 1HDDC 3BT9A 2I10A 3WHCA 3IV5A 3PO2J 1BW6A 4C3JJ 3BTJA 1I3QJ 3A03A 1IUFA 2R92J 4ABZA 1IV6A 2M2EA 4X6AJ 5EEAA 4JX5A 4BQQA 2W48A 5IPAA 1FIPA 1ZR2A 4HNVA 4I76A 1RKTA 2ELKA 2MW8A 1TC3C 3I4NJ 1LFBA 3CMYA 3S14J 1UMQA 1X2MA 5C32A 2NVXJ 2CUFA 5IP7J 3BR0A 2DA3A 3ZQIA 2NS7A 5JLWA 2HI3A 3LNQA 5M3FJ 2O9LA 2EZHA 2ECBA 2E2IJ 2R5ZA 1W0TA 2MG4A 2OF7A 1IC8A 2Y31A 3GTJJ 4X1EA 2DA6A 2R0QC 1CQTA 3JRAA 3RZOJ 2HDDA 4Y52J 1GT0C 2VKVA 4A3CJ 1TWGJ 2WV1A 4IEJA 3PO3J 2HYJA 2Y0SN 1ETXA 5C31A 2TRTA 2DA2A 1XG1A 3GTMJ 1JGGA 2JN6A 3FK6A 1SFOJ 3GTOJ 1IDYA 2EZKA 4V2FA 2RAEA 2DA7A 2LP0A 3C2BA 3VPRA 4D5CA 3SJMA 2M8GX 1B8IA 3OSGA 9ANTA 1K61A 4RDUA 2WAQN 2NVQJ 5F0HA 4XIDA 2VPRA 4DW6A 1PUFA 3SFIA 3OOUA 2R5YA 2N8GA 2IAIA 1JTYA 5K7FA 3JRHA 4B1RA 1W0UA 5IP9J 4C2MJ 3GTGJ 1Q1VA 3BQZA 2MHCA 3ZQCA 3RQIA 3HGGA 2JK3A 2L7MP 3HOVJ 3HOZJ 4M6VA 1ZR4A 2YS9A 4GFBA 5E3OA 3IH4A 2KT0A 1ZQ3P 3BTCA 1NTCA 3S17J 1Z0XA 3G1LA 3GTLJ 2Y9ZA 5FKOA 2LR8A 5DS9A 2COBA 5BNGA 5DTDA 5FKKA 2E1OA 3ZQHA 3GTPJ 1A5JA 3S16J 1NK2P 3H0GJ 2VKEA 3PKZA 1JTXA 4FE7A 1OCTC 4BXXJ 2AO9A 1X58A 1P7JA 3Q0WA 3LSRA 5C34B 2NVYJ 3QPLA 3O8HA 3FK7A 5EZHA 1P7IA 1LE8B 2M0CA 2DMQA 3JRCA 2XGEA 1QPIA 3JR9A 2LFBA 3RKQA 2LKXA 2FQ4A 4V2GA 3LSJA 2EH3A 4XRMA 1XS9A 2QCOA 4DYQA 1XC5A 5C4XJ 4M3EA 5FLMJ 3L1PA 1OFCX 4DYRA 2JA8J 1JUMA 5E3MA 1U9NA 5FKMA 2YUSA 4CYCB 3S2HJ 1H89C 5M3MJ 2OPTA 5K7ZA 3HOUJ 4D5FA 2FD5A 1D5YA 3HOYJ 3S2DJ 3BG5A 1B8IB 1HOMA 2HXIA 3OSFA 3A02A 2EZIA 1JKPC 1MNMC 5J1UA 1T56A 3F0CA 3BR3A 4W97A 5IYCJ 2ID6A 1BA5A 1DU6A 1ZK8A 1POGA 2JMWA 1PUFB 2R5YB 3HOWJ 3I4MJ 2DMPA 2M34A 2X9DA 3BR5A 2HQ5A 1FTTA 3JRGA 4J19A 2XGDA 5GP9A 1ITYA 4A93J 4QTRA 2XPVA 1GVDA 4D7MA 5HODA 3ZQLA 3S1RJ 4A3GJ 4XICA 2GM5A 4IHYA 1TWFJ 4MFDA 3BVPA 2ME6A 1IGNA 1RESA 4JYKA 5J3LA 2NVTJ 2DMTA 2CU7A 3CQZJ 1WPKA 2QF7A 4LOCA 1EF4A 1LE8A 1I50J 2CQXA 5FKNA 3G1OA 1IJWC 2ID3A 2O7OA 5C3EJ 1WH7A 3UJ3X 4A3FJ 2DMUA 4EEFG 2KDZA 5FKLA 1HCRA 3JRBA 3JREA 3BR1A 2LTPA 2MGQA 2JWTA 2R7ZJ 2MSYA 1RETA 4CYCA 3QPSA 3JRIA 2CRGA 1Z77A 5F0FA 3HB9A 1A6IA 3JRDA 3LHKA 3B6CA 4I6ZA 4JX4A 2K9SA 4C3IJ 3HGYA 2LY9A 1FIAA 1MBFA 4D7NA 1ETVA 3BR2A 3IH2A 1I6HJ 5IYBJ 4BKXA 3LSPA 2E2HJ 1QVUA 2DA1A
chains in the Genus database with same CATH superfamily
1S8FA 1ISHA 4D3YA 3N5CA 4XA8A 1U78A 2Y93A 2Z09A 1H65A 2C7VA 3V8KA 3M4YA 1FLDA 1Z35A 2O0MA 3HZJA 4H7EA 4J0JA 3JZDA 4OQ4A 3DLBA 3ZU4A 3WK4A 3EUHA 1QTQA 5CX4A 3NM5A 3BTIA 2PRZA 2VPXA 2M0BA 3QX7A 1H0TA 1BKSB 3KTAB 1MDMA 2N46A 2OILA 4RF4A 3T3GA 1YRAA 4Y1FA 1SU7A 2IPXA 4BVHA 2ORYA 4LUCA 2OYCA 2H59A 3FW1A 4IZ6A 4DLLA 1IC6A 2I1QA 3HBNA 1UOQA 5HKKA 3A6JA 2UZ0A 3SZOA 3KYDB 2HH9A 3WLMA 1W1UA 3GYGA 3I45A 4XUGB 4RIIA 1JP7A 2HXYA 3VC2A 1F8GA 1TCBA 3ZDAA 5EUQB 3RHFA 1B8OA 1U8EA 3AKYA 5IJZA 5CXQA 3WTWC 2HNHA 3F8TA 5FORA 3DBHA 1F0YA 3U37A 2JLVA 1FJHA 4H0LD 3AF4A 1SFCB 2HPVA 5FHRA 3DTTA 4XLHA 3KKEA 2HC9A 2HA2A 1CQIB 4PYIA 4WHMA 4E2FA 1Z2NX 4B46A 4Q3EA 1NJ6A 4URXR 1LNQA 1OT3A 2NUPB 2Y92A 2GA1A 3HHHA 2Z58A 3AJ8A 1HNNA 4PBSA 2FF4A 2EILH 1RDFA 3D3EA 2V7EA 1B74A 2PP6A 1TYAE 3ODGA 1QLHA 2HF8A 2DUMA 3ME5A 4YREA 2ID4A 3CKYA 2V7PA 2BZSA 3Q12A 2QD3A 4N01A 3WU1B 2WMNB 4LHSA 4IHWA 4ZT6A 1DINA 5AKYA 3TWOA 4R2WA 2ZRIA 3HCAA 2YKOA 3CD6I 1V8BA 4OP3A 4D9MA 4MR7A 5JAHA 5L51A 3I9NA 3S1SA 4Q24A 5HZHA 1RCFA 4F60A 2DT5A 4AFNA 3NJRA 4DCGA 1FSFA 3LY8A 2CW0F 5GTIE 3PO2J 4Y33A 1HC7A 4JVOA 4H0NA 1PF7E 3UAWA 3CRW1 2OGSA 1OBVA 1FIPA 2YOGA 3BC8A 3E9QA 1DLIA 1IOWA 5DYYA 4HWSA 2PAAA 2C58A 4H7FA 3NTQA 2PBZA 1EJ9A 2X8JA 4XTRA 3E7KA 2BGRA 5CJ0A 1CNEA 4XTCS 1DAPA 1TADA 4J1TC 4V1CA 1L8XA 4ZXFA 2OD5A 1QDEA 3D43A 3UGJA 3JQ7A 2HWKA 4F38A 3ZCVA 2E42A 4HB3A 4KQ6A 4MVJE 4M0KA 4CV2A 2CFIA 4BX3A 5EJ2A 3VPRA 4FYIA 1RCUA 1SC6A 4PFOA 1SQQE 1E32A 3SLRA 4B7UA 2Z5LA 1KZ9A 1NG6A 3RAPR 3EG9A 4PSWA 5IDXA 2VOEA 3RVKA 4IDHA 1A8QA 3CVXA 2YHUA 4M98A 1MG0A 2PUTA 3MB8A 1NVGA 5HS7A 1OLSB 2JGAA 2ILTA 4OGGA 1MC8A 1SQPG 4ALMA 2ZRKA 4BAZA 4KFSA 3AUUA 3TG2A 1T98A 1U98A 3AILA 2IXDA 3P96A 2PRYA 4ETMA 2GVNA 2QCOA 4NFHA 4UUNA 1MP0A 2ODTX 1J20A 2GK7A 3FIJA 1Y82A 2ZM5A 2QRZA 3HFJA 2W2MA 3HB1A 3BF7A 2DGDA 4FFLA 1DU6A 3BTOA 1A2BA 1SVUA 3EHEA 3WJ7A 2ZO4A 2F1RA 5KWEA 4ENMA 1FVXA 2QI9C 1SD4A 5EJAA 2QPTA 1AV7A 4CIYA 2BFWA 4FEAA 1GGKA 4LNUB 2F1KA 1HUCA 3T0FA 3RRYA 1VTNC 1ZRCA 3AX6A 4UD2A 4E0BA 4AZTA 4GXTA 3ZJ5A 3IUQA 2FPUA 3SHWA 2KM1A 5AI4A 3UJ3X 4EZBA 4RLFA 1UC4B 4WK6A 3QXXA 2ECOA 1SBQA 2ZJPF 3OIDA 1UQUA 3HM9A 5F0FA 2BY2A 5T5QA 3RK3C 3Q9VA 3JQAD 4JBLA 4UM7A 1OTXA 3V8LA 1HQKA 2VDNB 2BEVB 3J81A 3IRRA 2O3FA 3ZE0B 2CQNA 2QE7A 4C7RA 3DTKA 3Q3CA 4LKRA 4B31A 3SYNA 3KSAC 3VX3A 3G02A 3CB2A 1FZAA 1DDNA 5C8VA 4WOJA 3KB2A 3AETA 1L4YA 4MKXA 5FNVA 2RI1A 5FPQA 5E2BA 3VC3A 2XUHA 3DU6A 1TU0A 4ZT4A 1WOMA 4TKVA 2HPMA 1FBSA 1HG0A 3DM9B 4F3KA 4OQPA 3PX7A 2WU8A 4PQFA 3ZX4A 1KJIA 2DFHA 2KISA 1MIJA 3LA2A 5IZCC 2A45H 2E82A 1YJCA 5E3NA 3HDVA 2R93J 2HO5A 1G19A 4YRPA 3A3PA 3CLKA 3DNMA 3ITEA 1JJ7A 1U1EA 5EWLB 4EYGA 1BOFA 3WIEA 2X6OA 3EG5A 3LUCA 1YIJI 2HB6A 1XZ8A 2GXSA 5LLSA 3ETGA 4PPQA 2MBFA 3C97A 4ZWNA 4YT8A 2VATA 1PR1A 2D6FA 1LP1A 1O3YA 4WKBA 2OORA 1XQ1A 1WHUA 3O8RA 2RHJA 4DCKA 2XYHA 1COWA 4OGWA 1MJGA 1AQ5A 1TDJA 1OYOA 2XGOA 4UUPA 4EHLA 5CB0A 3PRKE 3PFIA 4RA9B 1T2KC 1KO8A 2B1IA 1MJNA 2LDUA 3FTFA 3G5MA 2ECFA 4XDYA 1XELA 1LSJA 3HKZA 1NHLA 1AHIA 2J59A 2FF7A 1MH9A 3P7KA 1UB9A 2GPAA 1STZA 3TL4X 4NENA 3ND7A 5C4JJ 3VDRA 1T34A 1GKKA 3KLPX 4RENA 3GLIE 1XTVA 3U59A 3U3KA 2FXPA 3DEWA 2B63J 1M6VB 1PX2A 3BB4A 1J6UA 1JXMA 4JC8A 4NDAA 2EWMA 4NZPA 4LIPD 4XX1A 1ISIA 2YYAA 2OYIB 5JXJA 1N2ZA 4GZ6A 3A8TA 2VLIA 1L5KA 4U39A 2B9VA 3AVYA 4P53A 2C4MA 3ITNA 2WPDD 1O96B 3EY9A 1YFLA 4KQJA 2G9NA 4CGYA 3P2YA 3F7MA 5JHGB 4E51A 3FZVA 1CETA 4FKMA 3T5TA 1QU3A 1EHCA 3OYCA 2A88A 3HJCA 2HU7A 1I2AA 1HDRA 5ALEA 1UWCA 3A3YA 4BAUA 4B80A 2H89C 3IT2A 5MFPA 1YXMA 2IVFA 2JDID 1VCHA 2AVDA 3KP7A 1R3DA 3F5DA 4TYWA 1L7QA 1IN8A 3AJRA 4TL8A 3O4HA 5DCMA 3HKEA 2AN5A 5AUNB 2BL4A 2BMFA 3PX2A 2AG6A 1PQWA 4QRDA 1FFSA 1O6BA 1NU1J 3VSAA 2X5JO 3ZKAA 1RWWA 3RFVA 2W98A 3L5KA 2F5VA 3UMRA 1U2RA 5JH7A 4KR2A 1M1NA 2HGCA 3GAAA 4CI0B 2Z5VA 2KLUA 2BM8A 1EH5A 1IUNA 3VU0A 2DMRA 4ECAA 3N8IA 3WK8A 3ED5A 2QLJA 1JR3D 3ZCOA 3L8EA 4W7IA 1BWQA 5EMJA 5AOAA 2C5SA 1TEZA 4JWTA 4BXXJ 1QOPB 3CB4A 4UPVA 3KYLA 4B1FA 4IO0A 4W9NC 3E9MA 3HSEA 1RKUA 4C4RA 4AZVA 4RZ3A 5E3JA 4MR8A 3GRUA 2GTIA 3GVHA 1L5YA 4IL5A 2FW1A 4NK4A 5DM70 3K4PA 4G23A 1JTHA 3E3AA 4NULA 3GJ7A 4AKTA 4RK5A 3JQBC 4Y6QA 3B1WA 1SD6A 4IRHA 1JY2N 4CLOA 2C4TA 3N8GA 2PKQP 2EX1A 1USKA 4EKEA 3QPBA 1MJHA 5C8DA 1LWUB 3I9MA 2VDPB 1R1UA 2B94A 3TTVA 4H7JA 5LGTA 4PQEA 2VJIA 1R9MA 4ZQBA 1R12A 1V25A 1CR4A 1P9RA 4JYBA 4NCJA 1BX1A 5AK4A 3CINA 3L01A 1SD5A 4IMRA 3QKUA 2Z3YA 2XNDA 3SX2A 5LDGA 1K08A 2R7ZJ 3K7EA 1Q11A 4CMGA 2JLXA 1RTKA 1Q6ZA 4IM7A 4TL9A 2JZOA 5FAKA 4GP7A 3LO8A 2K9SA 1IY8A 2P7HA 4NFSA 1UMKA 5JSQA 4JLAA 1MJGM 1Z8HA 5AONA 1ECCA 3FKSA 1I6HJ 1I3CA 4BKXA 3U3RA 4RF5A 5I3CA 1BHJA 1RF0A 3RBZA 3A1FA 3LKZA 4DUYB 1MD0A 1GGEA 4RQBA 3AUYA 2HDNB 2TMKA 2J59M 1IY1A 3VV3A 1TMKA 3L6CA 2SBTA 4E09A 1W8DA 1QYIA 3THOA 4KLRA 3BTSA 5T41A 4LMBA 3A1SA 9LDTA 1B15A 4ZAFA 2XE7A 2H11A 1SQBD 4I7HA 4AQ7A 1E64A 1MH1A 4NYMR 1R5JA 4EFMA 5DHAA 3MZHA 4QAQA 3UEOA 1SFCA 4GGPA 1E9SA 1X7XB 4HDAA 2X1CA 1V9LA 3IUOA 2Q7DA 4R1OA 1CQIA 3N2EA 1EK6A 4UFOA 3VO1A 5HPYB 1IC2A 4H35A 2NUPA 4FFRA 1A96A 1NVXQ 3R5KA 2IH5A 1Q81Q 1G9XA 1QLJA 1SP4A 4BNHA 3CUWA 1VHTA 1WCV1 3DVQX 4BVGA 1YJWP 2LF8A 2QW1A 2P0EA 3CI9A 3WYEA 2AKEA 4ERNA 2LMDA 1EZVI 1TW3A 4BAGA 3URKA 2QLLA 3AECC 4GX2A 3DWIA 4UZEA 4MWZA 3I56P 1L6RA 1X3LA 4FN5A 5DBEX 5B2EA 4Z3OA 5KLIB 4OUKX 2B2CA 4MRMB 2I6SA 3HM5A 4DLRA 4MSUA 3KYIB 4W1UA 1MMFB 3H17A 3HDTA 3D6AA 4LNAA 4RD6A 1RMTA 1RWOA 3NBZC 3U9LA 1E8NA 4II2A 2QD4A 5AXBA 1K05A 4AY3A 2YHIA 3AF1A 3W67A 1U7WA 1FPQA 2DDBA 5JAIA 4B6RA 1FS5A 5C4MA 2VBGA 3AHEA 4RUKA 2VAWA 4IAOA 1DI0A 2M6KA 4B35A 1EJ2A 3Q8MA 1KI3A 4GPZA 5BSMA 3P71T 3QV1A 4AMUA 5DIZA 3VMFA 1M2EA 1Q0RA 1JJIA 1VIVA 1W36B 1DQZA 4AG5A 3BVHA 3FSEA 3H42B 3TOSA 2VT2A 4OXNA 2VDMB 1TB4A 4D0SA 1CUCA 3HZZA 5L3RA 3F8SA 3GZ6A 1I32A 4RJLA 1DAFA 1ACJA 5HG0A 1O7FA 4MTEA 3WHCA 5JCJD 4DJGA 1RRCA 3VBEA 2B35A 4WUVA 2P2NA 2WSIA 3VSEA 4DCUA 2ZYSA 2A06D 4BFYA 5FO1A 1T2FA 1C80A 3KS9A 2QM7A 3BCCE 1SEUA 4BZXA 3STHA 5AVTA 5BSGA 5F6FA 1XF1A 1GFWA 1NBWB 5CYPA 1JVSA 4UZSA 5HM8A 4Q21A 3EEOA 2JGKA 4TSFD 4JOMA 4GYYA 3I6YA 2O8EB 3OTHA 1QR2A 4MKZA 2OYHA 1QDUA 3PE3A 5DHFA 3ZW7A 2BR4A 1CU1A 2FEXA 2ZI4A 3LHSA 3WNCA 2HHJA 2IDZA 1IVYA 1LFPA 1XYGA 2VQGA 4FDLA 3EVCA 1X15A 3NJ4A 3QVMA 2E74C 5EQDA 4YX9A 4HAYA 2DWUA 4MYHA 4NV1A 4TXLA 3T5DA 5B7QA 2WAOA 5FKOA 4LNUA 2IBZD 5J4VA 2AW5A 4O8CA 4NNOA 1G5RA 1I0LA 2Z6AA 4LJRA 4YFXF 2AN9A 3EWKA 3O8HA 2P9CA 2N1BA 4AZ3A 1WNTA 1Z06A 3H1LD 1UAYA 3AJDA 5LA6B 1DWOA 5L4NA 1OUMA 1SVSA 2YSRA 1H2FA 5DLQC 1LVAA 1L7RA 1S0UA 1ISPA 2VJ5A 3E7XA 1XCJA 3KKZA 3S2DJ 4UVEA 4YJ3F 2L54A 3SU8A 1UBRS 3Q2OA 1TQMA 3F3XA 4W99A 4Q37A 4FLEA 4X6UA 2RHHA 2E87A 1AGXA 2QL9A 2BEVA 3LFHA 3I52A 5BXQC 3FVTA 3WMM0 5LM3A 3UYLA 2WUGA 4I5GA 4Q1CA 3RIHA 1XZFA 2HF2A 5AW6B 4LYGA 5ICFA 1UBTS 3E0QA 4BQSA 1P80A 8MHTA 4FYYA 1Y48E 7ADHA 2P2GA 3RYHB 3VUEA 1ZRMA 3EGXB 3MOIA 3WHIA 1OASA 4QULA 1TAHA 4C7VA 1XZMA 4H16A 2LTPA 4BACA 1ERDA 1Z08A 2A9JA 1QAOA 3VODA 1U3CA 3NGXA 4GMFA 3Q8KA 3B52X 4KXVA 3EGOA 4PV1B 3LPDA 3BWDD 3PIDA 3MZ0A 1FFXA 2WKRA 4FZVA 3G82C 3JQFA 3HUUA 3B9QA 3DL4A 1OXSC 3ABMH 1NHAA 3NAUA 1OWOA 5EWLA 4JY7A 1EDBA 1ETHA 2VE9A 5D6NA 1NLMA 1WCYA 2HIHA 5CAEB 2WB1N 3R9KA 1SPXA 1IZZA 4RHUA 1KMIZ 1IEWA 9ABPA 3GROA 1W44A 5EHXA 2AX3A 4I50B 3RKRA 3C7JA 3ZWCA 1B6GA 3VOBA 2NP7A 2I6XA 2QZJA 1I9CA 1JLRA 4NYJR 1Q50A 4PLCA 2NVUA 3LW5H 1DG9A 4V0LA 4EDHA 5EJMA 3ABTA 1VB5A 2JGDB 3U4IA 1KEUA 5DSZA 3GCGA 3VC7A 1JUPA 3CZ6A 2O0LA 2YYSA 1ZH5A 3OQHA 4JI5B 4YCDA 1VGRA 5ITVA 2VK2A 3OICA 1JH9A 1HE3A 2K85A 4BRYB 1LFUP 1ZXXA 4IV5A 3V33A 4J7CA 1C9YA 2DQZA 1YDWA 2CFTA 1WJGA 3RZDJ 3E7FA 2L7FP 2WICA 1WGXA 1PWYE 3L73G 4CF7A 2YNMC 2B6HA 5AJVB 3L35A 2OYIA 1UWKA 3ZOBA 3OY2A 3FWPA 2PLAA 3TN7A 3J80K 4WV3A 3CMAP 7ABPA 4WPGA 1VFCA 1VB3A 3A1DA 5FOSA 4H6VA 3INTA 1SS1A 3W2WA 4BQOA 1SQQK 2GNAA 3PEYA 2XOKA 3HXLA 1V1MA 1TJYA 2AFHE 3KFVA 2JJYA 4HDKA 1Y9JA 4OXKA 3RF7A 4XD2A 1Z56A 5APWA 1KKLA 4JFAA 1W2BO 3BMNB 1LEBA 4MQ4A 2M32A 3P0IA 4K3AA 4HO1X 4FHGA 1BEZA 1EKXA 1EFTA 3JWEA 5BOVA 1TUGA 1CX9B 4JT9A 1HDZA 1PZGA 1H0MA 1DCMA 1T36A 3ICOA 5F1JA 2PEYA 3WFZA 2HLDD 3L4FA 2PX0A 1L0LJ 3BT9A 2RGYA 4CM1A 5HILA 3IH5A 4W80A 2MCFA 3U7HB 4F6LA 1CVRA 3BL8A 5KYUB 3OH8A 2CV0A 2IHYA 1S72I 2NM0A 3D0KA 3IDAA 4C6HA 3KB6A 4I4IA 3T35A 2WITA 2E1RA 4IG4A 4U2BA 1E0AA 4S24A 4X91A 4TZ6A 1G64A 4U0VA 1KRWA 4ZOLB 1TWGJ 3IBFA 1KFJB 3LRPA 3EYWA 4C4AA 2EKLA 2XCQA 1FTYA 3Q1KA 5JD6A 4NX2A 1QONA 4YBZA 4IXWA 1AZLA 4PJMA 3FDYA 1D8AA 1LRJA 4WGGA 5LGUA 3HOZJ 3P9XA 1CUEA 3R3YA 3OJAB 2CF6A 3S17J 3EGIA 1I7LA 5EJ7A 3GO4A 3HRNA 3RSHA 1K5GA 2FPKA 2PKWA 3STWA 4IDBA 3S16J 2P6OA 3NXKA 1GG5A 1XCBA 5FTKA 3KL2A 4TS3A 3L3BA 4M0PA 5CU7A 2L7KA 3FRJA 2EDCA 1PJQA 1QJ4A 1SM4A 2A07F 1CRQA 2JASA 4FGLA 3FTEA 1P92A 2CSUA 1URQA 4CR8A 2DPXA 4RETA 3RJMA 4DQXA 4DFDA 1NULA 1KNXA 3QVKA 4ZREA 2VK1A 1FUYB 2NW6A 4C43A 2V8OA 5E2AA 2O05A 1TU3A 3EPKA 3RK0A 1I7SB 2V1DA 2X8AA 3H19A 2L5GB 4YFKF 2DMTA 1SFKA 3UCXA 1VKJA 2E34A 2PU5A 4K0KB 2FPWA 3F4KA 2X2PA 3TW8A 2HAEA 1RZVA 1U5BB 1N25A 4V3CA 2DMUA 2XAHA 4DSAA 1XSEA 1QFJA 2HCFA 3DMFA 3Q9NA 4BGUA 4RIGA 4W8GA 4IEIA 4DMKA 4OHYA 5FWYB 1SXIA 4PLWA 5KSYA 2WC2A 3V5NA 4BWNA 1XWIA 2IX9A 1DUIA 4P82A 5E6SB 3U7RA 4J01A 3ECOA 4RZHA 3GJ0A 3AF2A 4O4LA 1Z73A 4DIOA 3TRIA 2ONJA 2L17A 1UKBA 5FGMA 3V9AA 4LOAA 3VPBA 1SAUA 5TC4A 5KTYA 4HDMA 4HX5A 1BJZA 5KSZA 1ZM3A 1NJFA 5C1PA 3HEBA 5LR6A 5H20A 2WINI 3OIQA 3K32A 4JLPA 3FE2A 1A36A 2EIMH 1IXYA 4MX8A 3PFGA 4NCHA 1C1DA 1YS7A 3DCFA 1P91A 3VKWA 3QG1A 2FOWA 3EH1A 3VFZA 4MRMA 2EW8A 4MOWA 5TMDA 2KKOA 1NFRA 4M3LA 5JCZA 1C3EA 2H4YA 4EK9A 4KQXA 3UK1A 4O3FA 5IT3A 1NBOA 5E3HA 2FQWA 4WAUA 3IOMA 2MDTA 3HE5B 1QX8A 3PCTA 2HYNA 3PQFA 3HCPA 3CX5D 1RABA 4JSRA 4B4UA 1C29B 1R2QA 2C2BA 4QZVA 3H35A 1T38A 1VBNA 1J56A 2DZDA 4JDPA 4A0RA 3BWCA 4UVCA 2HDCA 4YMVA 3PHJA 3G2LA 2GZAA 1H1TA 1CE8B 1EKEA 4YAKA 2OHFA 1USTA 2PKQO 1Z5GA 2GAAA 1CR2A 1OGYA 1BFKA 1W19A 2DBYA 2AG8A 3E1GA 4FYJA 2O8FA 1TM2A 1U2QA 1TAGA 4XIGS 5G3ZA 4U2EA 3OCXA 4F9FA 4B3JA 2FEPA 1KBOA 2ATEA 2M1XA 4R1HA 4BMXA 2IC5A 3KQTA 3TLEA 4GECA 2J9YB 3NHSA 1N5KA 3DLAA 2KYVA 3SQLA 3WLOA 4E12A 3I42A 4KR7A 4FVTA 1FFGA 2WAEA 1WKCA 1AVTA 3L7NA 4IDQA 1C0KA 4MAFA 5FWDA 2AQEA 1NTZJ 2XPUA 1QH8A 4HAMA 2GEUA 1Y39A 5JO0A 3A9VA 3BDVA 1QZEA 3RSOA 4UREA 5JAMA 1K98A 1V5GA 2X1MA 4B6OA 3VZDA 2D1YA 4ASNA 2AV6A 5HR5A 4IMPA 4IFIA 1BU8A 5FYDA 1A1SA 5JNWA 2ENWA 3HXKA 3I9V2 3GXOA 1T35A 4LXUA 1WKMA 4I09A 1X2BA 2QRUA 4OUDA 1US8B 3M9BA 5ESWA 4PY2A 3COZA 2IS6A 4WN3A 2FYUG 2HBYA 3TCKA 3X2SA 3WL4A 2WVAA 4IJUA 1U8CB 3N9IA 4UVGA 4R9UC 4HEA6 2WF6A 3EUKL 3TD9A 2AQHA 1JKXA 4XB2A 1FOSF 5DXJA 3VMXA 1LXCA 4YRVA 2LR0A 5FA5A 2OKCA 5JAQA 3NVKI 2FU4A 5HTOA 2IXTA 4QLCU 1D1CA 4JJIA 2WBLC 2DHDA 3I30X 3LLUA 4R3WA 1FSSA 3U31A 1E4VA 1J1UA 3HPGA 3UTDA 3QWHA 5IMSA 1DKLA 1JL3A 2J9RA 1Z7GA 1MTZA 1YZKA 3UKOA 1UUFA 1QP4A 1QGED 2CBZA 4Z4EA 1IHDA 3G7UA 3PUHA 3KSDO 2J6BA 4B2YA 2W57A 1J2TA 4RSRA 3PQ6A 1B43A 3QSYA 5EWMB 4Y9DA 1XPRA 2JD2A 4CV3A 3T7RA 2K2WA 3AWIA 5E3MA 1QGZA 1W6UA 3E84A 4YMTA 2CYAA 2NXNA 3VJLA 3R4CA 2JMWA 2ZVDA 2FU5C 3GRKA 1SUEA 2ETXA 3AUJB 1OJ7A 1YK0A 1GVDA 3KVRA 2QD2A 2ZRJA 4MRNA 1ZIXA 7GPBA 4DADA 5TXGA 3BXOA 1QC5B 1PPJD 4O0MA 2PI0A 3S27A 2KP6A 5LZ7A 2Y48A 4OVNF 3AQ4A 4D1QA 1Z39A 1CY8A 4I50A 4GLLA 1X4PA 1JX6A 3OYIA 5K3SA 3P1JA 4KQKA 4QGSA 4I3HA 2WSYB 5HMMA 1T6AA 2K9MA 2VKQA 2GAJA 4C2TA 1EE1A 1ETVA 4LK3A 3BDDA 3WTUC 3FJOA 4F21A 1ECPA 2JGDA 3I9JA 1NTKD 4L27A 3KJFA 2H6BA 1JXQA 2DKNA 2VS1A 2UZAA 4H4EA 1JS1X 1ZU4A 4IOCF 3DKKA 1JE0A 2NPSD 1MRZA 3F6OA 2XSZD 4YS6A 4FHCA 2QMUA 4GGMX 1JIIA 4WLVA 4XOTA 4ZTJA 2P40A 4E30A 3RJ5A 1H69A 1JQDA 2LK2A 3NKVA 3ZVMA 2JVHA 4UUOA 2O8XA 3EIFA 2O9JA 2RIRA 5CEEA 5DDIP 2DUWA 3PICA 3OYNA 2AOVA 3AEQB 3WYCA 4A73A 4NV3A 1V26A 1E94E 5GAHJ 2QRVA 1QPGA 1SULA 1T9DA 3AKCA 5C8XA 3QPAA 5AR1A 4K05A 3LHFA 4CDGA 1ORKA 4NEGA 5DP1A 2ZB9A 1TLHB 4HZGA 3SEFA 3ECSA 2XMSA 2X4DA 3RCOA 4WESA 1M90Q 1L1EA 3DMRA 2CSOA 2YKGA 1JDTA 4G9EA 1NF9A 4INOA 2Q62A 3U7JA 3SLGA 3LQRA 2OU2A 1SG9A 1FYMA 4BQNA 1NA5A 2QDKA 4HNAB 3A0HC 1RPWA 2IX7C 1DU4A 1JT6A 2OHXA 4EPXA 3HP4A 3TIVA 3GF7A 1I3LA 4LB6B 4IIYA 1ZUWA 4PR3A 3T5AA 3BCBA 2Q4RA 4XJXA 2NZUG 4K88A 2FR8C 2WWVD 1T6YA 2K5UA 4MR7B 1G2HA 2XW6A 1AOYA 3OF3A 4D0RA 1Y7TA 5FIUA 2YZMA 3IP7A 3GNSA 4JV5B 4PCQA 5KYUA 4X3CA 3FFWA 4LF8B 3WHKA 5HNHA 3PWZA 3JQ6A 1YZYA 3ECCA 4IIFA 4IDPA 4XJTA 3O1LA 1RMYA 3HWSA 4HB1A 3I56I 2Z98A 2X8JB 3E7LA 1WU7A 2ELJA 3WS7A 5IAAA 1QVRA 3E9ZA 4V1CB 2N9YB 4ZOLA 2IL1A 1LH0A 3G2JA 2F00A 4IQ4A 4UV9A 3I4CA 1W5CC 4IRUB 4OXXA 1GTZA 1ZKGA 3KQHA 4MEXF 3AOEA 2Y0SA 3K0AB 5FROA 4OFWA 4QE3A 4GOEA 4FONA 1SXQA 1GDTA 1QP7A 2YC2C 1P33A 4ZODA 5IWCA 5FBRB 1CC1S 3ACDA 1W73A 3KQVA 1JZQA 1FZCC 4LZPA 1J4AA 2WSEH 2MYPA 3U6BA 1FSGA 5C5CA 1SC7A 4OTZA 3HMKA 2XE8A 1C8VB 5K6AA 5HVQC 5K5RA 1D1QA 5MGNA 1U4SA 2YJZA 1KL7A 3FK6A 3K0LA 2Q2QA 4UASA 1GRNA 3KVVA 2XA1A 3G2BA 1DH3A 4D45A 4K1XA 2REBA 3E3NA 1JTYA 3Q98A 2WG1A 5F7JA 1SVWA 2FB9A 1XRLA 2Y8EA 1CF4A 4M6VA 1ZR4A 3QPCA 2FWMX 1B4AA 4OINF 1TC2A 1XCGB 2BLNA 5FFFA 5CJJA 2D1VA 4DMRA 4L50A 3QVOA 2JZCA 1WB5A 2Y1KA 1LDNA 3VVBA 1P5RA 3RAGA 1MX3A 2WV0A 1TAQA 2LPMA 4X5OA 4WXPA 5AP9A 3QIAA 4BGEA 1NM5A 2PUAA 2ICAA 3JYNA 3UK2A 2PR7A 1SIWA 3MQ0A 1I4LD 2N3ZA 4HVCA 2XUOA 1VMIA 5F21A 4LMRA 2FD5A 2HTJA 1DRUA 1V43A 5CDUA 3ESAA 2H31A 3FSGA 1VJGA 4IHKA 1H9GA 5TE9A 1L1FA 2CWDA 3F9RA 2PH3A 1TJ3A 2V5AA 5U9CA 2D3WA 4U6SA 2XX3A 4DCOA 3AW8A 4GKBA 4F4FA 3HJUA 1IBRA 1R0LA 3W79A 5KVRA 3LKVA 2XYQA 2XLCA 3EZNA 1D0XA 2YFHA 3QLUC 1HCRA 2PWBA 5FD6A 4W63A 3HN6A 2XGXA 5I7AA 5BNTA 3MTAA 1P72A 2XDQB 2EFGA 3UAVA 1FIAA 3L74E 2CLMB 2IHKA 3KOXA 2XKKA 4EJSC 4LB5A 2VRCD 3ABIA 4YRLA 4HDUA 3BUSA 2AB0A 1CY1A 2QJRA 3GGCA 5H59A 2YWDA 2HG5D 5K3OA 3LW7A 3MF4A 5LBUA 4N0EA 1U0GA 4KH0A 1XZBA 4AO6A 2ZB4A 3VJRA 3AVXA 3HE5A 2PCLA 1S7AA 4UMEA 2CXPA 1E3MA 1BC5A 5CCGC 1Q2UA 1JLMA 2B4TO 1P1HA 4TSKA 2UZ3A 4BNYA 2X3UA 5BWMA 4F7WA 1LP1B 3LKDA 1U65A 4E3ZA 3M9WA 4GI1A 1V48A 4S05A 3RANA 2IEIA 1IZYA 1Z4IA 4F97A 3S2FA 1JBEA 3P4XA 3BMCA 1E0DA 1IXCA 3DXXA 4R84A 3AY0A 3HH8A 5J1YA 4A3DJ 2ZSBA 1O8CA 4IJWA 3SEZA 1K7AA 2BTEA 3B53X 4U3FD 3PHHA 3GJ4A 2NT3A 3MUNA 4BE4A 4JT8A 3BXXA 1IN7A 4N0QA 1UDXA 1NAIA 3A70A 3NR2A 2GN9A 4EQZA 1Z82A 4EUEA 2I9KA 1VE6A 1L4KA 3OYDA 3OESA 4QNRA 3ZCUA 4DBQA 4GWKA 2Q5JA 2A4MA 1DBPA 1QR6A 4II7A 4B83A 3MW8A 2ONYA 2KIQA 2PMZN 4YAOA 3HL0A 3NHPA 2QTLA 2WF5A 1NI4B 4KSCA 1SCNE 5FOQA 1ZQ9A 2Y2VA 1XSDA 3ZHOA 4AXXA 3B5NC 1ZSNA 3SJ7A 4JEUA 1RWPA 1TMYA 3TEDA 4QEZA 2VCYA 2V9PA 3WIVA 3EDMA 1G2PA 2D2FA 1CEEA 2OO5C 2ZTMA 4LX0A 2ZAOA 1B8NA 1RAGA 3OZUA 4BXOB 2IOHA 2EBIA 2BFFA 5KNBA 1CJUC 2GOMA 2VXCA 1AQIA 1US8A 3OBBA 3ZV5A 1UBHS 5K7HA 4R83A 2O1WA 4IHJF 3MKWB 3WI7A 4ISBA 3H0KA 4TVOA 3O91A 3RV3A 1VPEA 4MIEA 3WB1A 4DBZA 3HY3A 5A3JA 3COAC 2AFIE 1EZZA 3PPIA 3UH1A 4OKNA 1F3LA 4IJMA 5CYGA 1GZVA 4M60A 5JS6A 3OU6A 4KWIA 5JH7B 4E6PA 1M1NB 1M0WA 2CKMA 4MQLA 2DWCA 2D0DA 5C80A 4TV9F 4RAOA 2K4BA 5TR9A 4HQRA 5IAOA 3R0AA 1S8NA 4COOA 3BR0A 3S2EA 3TX6A 1DD4A 2P1JA 1U6IA 3BZBA 3ENNA 1C1HA 4X1EA 4B17A 2JR8A 3VR4H 5KQPA 1XN7A 5EWMA 1D1PA 3SEQA 2JI6A 3HXTA 4OI1A 4MR8B 3RGUA 4ZP1A 2TRTA 2ZULA 2OD7A 1HW5A 2XUKA 3E5XA 1HF3A 2MKVA 2EZTA 1K61A 3OX4A 1VF5B 1GLNA 2HEGA 4KMOA 4CLOB 1Z6YA 2WFMA 5JT1A 1PJAA 5A4AA 4Z2AA 1UPAA 5HJ2A 1WV1A 1Z16A 2JJ1A 2FI1A 5J2UB 1SKQA 3DE7X 4FMDB 1YI8A 3WLIA 1QC5A 2IZ5A 1RJGA 2ATXA 1LPSA 1P7JA 1HOXA 4P5OA 4DDTA 3A04A 1WRGA 3GQBB 1RXCA 2W85A 5EXDA 1JPVA 1M56D 2KB7P 5A4DA 1Z29A 3GZ5A 1EA3A 1WUYA 1YNOA 2VYNA 2W6ID 1IM5A 2VDOB 2VJLA 3EZ2A 1RRKA 1KPGA 3IR7A 2EOAA 4TTPA 4XDHA 4EABA 4CF3A 1G3WA 1VOTA 4UBLA 3X3HA 2C92A 1T9ZA 2AE2A 4LGVA 2ORVA 3BVPA 5BWCA 3EUAA 4GGGA 1MZBA 4AYBA 1NW4A 5KAMA 1EWRA 1Z4PX 4GXNA 1D4OA 1ZA2A 3HY6A 4JDUA 3S0JA 3ZOKA 4W9RA 4CEIA 3ZIAD 4BUZA 3AL2A 3WG9A 1N34B 2H18A 4I6ZA 3AEQA 4LJ4A 5EIHA 1NBIA 4R6XA 2OWDA 1U7UA 4IHSA 3ZHRA 2IYPA 2OBYA 3OQJA 1V2HE 4TMFA 1FMTA 3RYTC 3QTLA 2OT3B 1ZNZA 1P9QC 2I55A 4AO7A 3W04A 2O20A 2IXBA 1HLGA 5KWJA 1LGYA 1NTMG 3LWZA 3KDAA 1CJKC 1Z4OA 3OA2A 3BK7A 1BMTA 5ILVA 3FOFC 1NYRA 1TZ2A 1MH4A 1N36B 3ITDA 4HNAA 3QKTA 4BU2A 4CZCA 1TM3E 4C0HA 4DUGA 4HPWA 2BBSA 1H4QA 1DARA 1J5YA 4Z9YA 3JTEA 1E79H 1RZUA 4PO8A 4BE7B 2RHLA 3CP8A 1R10A 2PZEA 2B4RO 4JLKA 3T7AA 3KEMA 5T57A 3IQHX 3FKQA 4QODA 3KKNA 1P17A 2A3NA 1EH6A 2BYVE 5JFTA 3CURA 1QGPA 2CLKB 3EDRA 4Y3OA 2ZR0A 1GZLA 2C07A 3H6GA 1CUYA 3HRHA 2YHIB 1P3DA 4OU0A 4PRLA 2VTKA 3EGWA 3FXRA 1NT2A 2R84A 3ESRA 1U7HA 2DWOA 3W9YA 2KFDA 3GMTA 3ZCRA 3SICE 3RSNA 3E5UA 3FTDA 2QDXA 1NRXA 2R8EA 4J2OA 3HUSA 1T8RA 2B34A 4O4HB 4U0JA 2EJWA 1U2GC 3OJXA 1H8AA 4B2LA 3QUBA 1ODIA 1AU7A 2X77A 3RVBA 5BXYA 3KD2A 2YDYA 3K0AA 4FOOA 3HV0A 3FCCA 1QKIA 2WY2D 4R68A 1NXXA 2J9FA 1OXBB 1M2HA 2GYYA 2KRFA 1N7SD 2P2CA 2YXNA 3K6JA 3K1NA 3S8YA 1R74A 3N2GA 1QIIA 1A9QA 4HQLA 4R79A 1MGPA 4LJKA 1UFVA 2MU1A 2WSFJ 1A0OA 2XB6A 4EHBA 5AVTB 3B1XA 3GCDA 3M6MD 1ODSA 1HX7A 1GW3A 5EXTA 1YCHA 4Y2UA 5GTIC 2FX5A 2R7FA 2VVTA 2FN9A 5J9FA 1KI6A 3U49A 4XB6B 2OYHB 5AW3B 3RAJA 5KTTA 5LLDA 1ZK1A 3KIOA 3D71A 3W5IA 2AA3A 2ZJOA 1SQVJ 1U7PA 3PUBA 5CT5A 1LRKA 2VQDA 3VH2A 4KW7A 4N54A 3TGPA 4I76A 2IELA 3B6MA 2P7JA 5JNRA 3DLHA 3L71E 4D79A 2JBAA 2NVWA 1AV6A 1LF5A 2OUIA 1UFOA 4AZ3B 2WNIA 4LY6A 1NF2A 2C7RA 4L5CA 2B82A 4YAEA 5AKXA 5F77A 1UKZA 1G7CA 4DYVA 3KT6A 2BEUB 1OC4A 3W6JB 3NWSA 1Q1AA 9ANTA 2W1OA 2CNDA 2Z4SA 4EDFA 3H4MA 4FFDA 1JILA 1RACA 1QPMA 5LN1A 4D3XA 1QBKC 1FSEA 1ZM4A 5E3OA 2JLYA 1OLXB 2QQGA 3JCZA 5BMVB 4I1RA 1QFXA 3TGUG 5CBKA 4RS3A 2NU7B 2CZGA 3NBUA 2C9DA 4RGQA 1WMDA 4IOKA 2IOFK 3FDIA 2JLAA 3FK7A 4IFEA 4C6SA 1FP6A 4AF8A 2X85A 4ZJUA 5FLMJ 2B9SA 1GG8A 2JA8J 3AM3A 1L5GB 1A5TA 4N76A 4ZZLA 1K6MA 5BV8A 3HOYJ 1FLVA 2XDQA 4WZZA 4UHDA 1DO0A 4KMUX 1Z6RA 4KWEA 1S6LA 1WDKA 2Q4TA 3DOFA 2IEZA 4LVUA 3OTQA 3GAZA 1OAAA 1FFXB 5E9WA 3NEPX 3O03A 4Y98A 2QX4A 3P32A 4JXXA 4HLYA 1J5EB 3RQ4A 3K70C 4RULA 2Q50A 3CZCA 1DRWA 3BYZA 3KOOA 2M6RA 4IDCA 1EF4A 5CLQA 2BUBA 5LB4A 4W7HA 3VGPA 1J2YA 1HKQA 3FCEA 5I7FA 2KDZA 2ONZA 1LZLA 2PXXA 1SVMA 1GAJA 2H0QA 5KJ7A 4A26A 2A45G 5T8KC 2JI9A 1I24A 1E6MA 1QIFA 1QUEA 4HNSA 4W5QA 2OXCA 2NVUB 3WBBA 3MTGA 4OBWA 3Q15C 3E61A 4G4JA 2FF5A 4JJ8A 5EKXA 4OAQA 3O9ZA 2X1VA 4A2CA 1QB7A 1VG8A 1M0EA 2NV2B 4XSZF 3PRHA 2XUAA 3Q7IA 4PD4H 5CX1B 2BDUA 3N3AC 4E13A 1KMNA 3IAHA 1ZJ5A 4RHFA 1TZCA 2RGWA 1X8XA 2H1RA 5C0OE 4EG8A 4RB1A 2QL6A 4X45A 2PBFA 3JWPA 3FXQA 3RHZA 1HE4A 4AKIA 4B8WA 2C97A 4NTZA 1FZQA 1YS6A 3UQYS 2LF7A 1SFRA 5C7YA 2NS8A 1YR3A 1O7LA 1NI4A 1QYCA 3BGSA 2GF9A 3COSA 3SMQA 3DP9A 3VNVA 1V1MB 2WG0A 1S01A 4WBNF 2B8TA 2E18A 3U4GA 4HDKB 1ZG1A 1ON1A 3C3KA 1QH1A 1KP9A 1XTJA 1J1DC 3ANSA 4RKEA 2I7VA 1LPPA 2ATIA 4BXOA 3HO8A 1VQNI 3MMPA 1PP9E 4HLUA 1E2GA 1G18A 2EBHX 3NHUA 2VJ4A 5AVKA 4FT8A 2XMCA 1YBAA 1JKJA 3NTNA 1EX7A 1X14A 1AHDP 5EGNA 4JGIA 2QWWA 5J2TA 1XMXA 5KYNA 3AF6A 1T36B 3R3UA 2IWRA 4EJFA 1PJZA 6CHYA 5JI6A 3PDUA 2WPVB 2YZKA 5I9LA 1MNEA 1CS0A 3VU9B 3SWKA 3REGA 2FBWC 4B76A 2YV4A 4JLVA 1F20A 1ZKDA 3DZKA 5DTJA 3ULQB 1VSTA 2PX3A 3EVGA 4MCHA 2XF5A 3BXGA 3FVVA 3V8JA 3RR2A 1JIJA 3S1AB 4FDTA 1GTG1 1N5JA 1V9CA 5E1MA 5J4YA 3W9UA 4G0NA 1XVTA 5FTWA 1M1XB 4KQIA 4BTVA 4G7ZF 1SK8A 1IV6A 3W68A 3ND5A 5J2UA 4LF5B 2A3SA 4S04A 1WI9A 3ROGA 4L2IB 4OU5A 3ZQJA 4ZEWA 3HHGA 5L6MB 3KZCA 3TYYA 1QE5A 4E4TA 3RJZA 3ZBQA 4R16A 1NF3A 3FOZA 7MHTA 1H88A 1Y6FA 5CT6A 4GOMD 3AR4A 3GQBA 4RVSA 1O95A 4XGNA 4ESOA 2DETA 3BULA 4ZC8A 4L9TA 4V0SA 1E3QA 1HETA 1DDGA 2IU6A 1NAFA 2O0KA 1PL8A 4GZMA 5L7YA 1URQB 2JD1A 4L9AA 3FCYA 5H4HA 1YT5A 3FB4A 5G3YA 5DISB 2XH8A 3GTGJ 4KKVA 3M4ZA 3T7TA 5AVYB 4D4GA 2KT0A 1IQPA 3EF3A 2C9ZA 5EKTA 2VZ0A 3L2WA 4MV0A 2R6R1 2QJWA 3L70E 3SQDA 3BERA 2AVNA 2XTMA 3CY6A 4LHZA 5CB6A 4U7HA 3LSRA 1KFMA 3I3LA 3TFOA 3VPSA 2V74B 1VA5A 3TW8B 3ESCA 4K8OA 4NL4H 1YG2A 1M34E 3O9MA 5CFLA 2MIIA 5EP3A 4D6TG 2V55B 4UW9A 3JQAA 1T0IA 1J23A 4XW2A 2HXIA 3PB3A 5GGYA 2FDCA 4IUYA 3LSYA 1YFHA 4Y6RA 3IP4B 1MIOB 1CLEA 4QBIA 3CIOA 3HYRA 2VJNA 4O4LB 3RUEA 5IABA 5K3EA 2BY4A 5P8WA 1JG2A 1CEQA 1GQSA 2QIWA 3F8MA 2BGWA 2VWPA 2FMYA 2WU1A 2ZSFA 3IBTA 4BO4A 4MHTA 1YQAA 4HDMB 4V38A 2GYUA 2GM5A 3GEPA 2I9PA 4PYNA 3AE6C 1LBTA 4KPEC 3H32B 1N6IA 3QBEA 1BEEA 3CCQI 1NATA 1D9ZA 2C98A 4J43A 2WOOA 1DG1G 4C0SA 4TLCA 2E75B 1G41A 1C1DB 3I5XA 3ONVA 5DOVA 2C7OA 3AG2H 3QITA 2RAPA 1D4FA 4KC0A 4DQDA 4HI0E 1Q84A 1ZWKA 1FFWA 3A2NA 2Y1CA 1FZPB 3CMEI 3I2JA 4O25A 1IBCA 1GZUA 3U1TA 3KQOA 1QS0B 1WU8A 1WJCA 3IALA 1EVQA 1HYEA 5DCLA 2UVDA 3ZP5A 4L0YB 3LQQA 1NJ8A 3S5UA 2JKYA 2GHIA 1EHYA 2RKOA 3A4VA 3WIUA 3SCZA 5L3CA 3ELYA 1DQYA 4O4HA 4HSTA 4DNXA 4TYPA 4F04A 2I91A 2BKLA 4CCOA 3ES9A 4U3JB 2ZWPA 1R4ZA 1FRZA 3F8FA 2B78A 4MVJH 3PHIA 2LE0A 4I2OA 3V7RA 1ZGBA 1U5TA 1X7ZA 3BAZA 5ALSA 3IMKA 4W5JA 3QH9A 4AYXA 3DG9A 4LV8B 3CPWO 1H94A 3PBKA 3CCCA 3V4OA 3KLNA 4DG5A 1GU7A 2O8FB 2GM9A 4H44B 1L5SA 3WRYA 3TSIA 1T10A 4NDLA 1KRXA 4KQWA 1AN9A 1OILA 4Q3LA 1KI1A 3GRRA 1NI3A 1V55H 1FS0E 5ICGA 1DIHA 3H1HE 2J3MA 2YJNA 1RRFA 4URYR 3G8DA 1M2NA 3H1FA 4G5RA 1KTIA 2RGAA 3GTKJ 2GBFA 3LGXA 5JPIA 1LTJB 4RA2A 2NZVG 4MQVA 4R9RA 5AW3A 1QH8B 4X54A 4OBXA 2F59A 4B6JA 1QP0A 1Q1QA 2WPDA 3Q7PA 3FYHA 3T5PA 5CLHA 1L4AC 2ZXIA 3V46A 3SN6A 1H0RA 2VDVE 4AUKA 4L4YA 1DXOA 1H4VB 3MEQA 4EA7A 3RSCA 3K9HA 3BL6A 4KU4A 2ZC2A 1K78A 1XT6A 2OHHA 5JR3A 1M0SA 3FCSB 2H8PD 4KBGA 3ROUA 4LI3X 2JDIA 3L7WA 3GFGA 2ZYRA 4DJJA 1FQKA 1Q92A 4OUDB 5HCIA 3FCXA 4L1KA 3SKYA 1KKMA 2ZRNA 3UG7A 4RFSB 5GINE 1Y3CE 3P27A 5BSUA 3S3MA 1G0OA 2BEUA 1WS6A 2QBYA 3FX3A 2IEKA 5FD8A 5BPFA 2F48A 4UNNA 4UB8E 2FMXA 3QEMA 1RADA 1ICIA 4HRXA 3RD5A 1U28A 3TPFA 4RVFA 1OLXA 3G7SA 1U0SY 1SRQA 5BMVA 3CCBA 4P0TA 3D2CA 4QX6A 1VP3A 3VSDA 1JR3A 1PCXA 1FOXA 2IGKA 4NEQA 2NU7A 4I1SA 3KM0A 4WI1A 1G8SA 4HGNA 2EFOA 3COYA 1AT1A 1SOUA 3PLNA 1U3UA 3GGOA 1JR2A 4NNPA 5K05A 3TOCA 3W90A 4BCBA 1NJSA 4WL0A 2F9LA 5LQKA 1W0KD 1RQ2A 5C1OA 1SFOJ 5CR9A 4IDNA 3ROPA 5BN5B 3M5WA 4HGQA 5JYBA 1M54A 3GEGA 1Z75A 3OY7A 4B2PA 3A2KA 3B78A 2QOEA 2NXNB 3QU7A 2B2XA 6ABPA 1H9AA 4N1AA 4NK5A 4MWTA 3A7EA 1K89A 2BELA 3N74A 1P7PA 3ACCA 3MCTA 2RNJA 5CT4A 4AB1A 2F5EA 1JECA 1WABA 3CLOA 1TYDE 1LTHR 2YS7A 3QIVA 2ZJ8A 3NYRA 5GM1A 5L9AA 1KQGB 4BKUA 1YC5A 3RWOA 4YQEA 4LV6A 2LD4A 4BV2A 1KB9I 2P5KA 4YCJA 1C5KA 2J5QA 3I55I 3MLBA 3UWMA 1DWQA 1Z68A 4DSUA 1XS9A 1EEXB 3ESZA 2O3UA 4HTFB 4JLDA 1XZNA 1KWKA 1TCAA 3P7MA 3WY9A 1QKJA 1Z3IX 3A28A 2HFKA 1UK6A 2HR3A 1IJFA 3CX4A 5DGHA 1WSWA 1SCQA 1Z8NA 3SE7A 5H16A 1QSGA 1I4EB 4MYSA 1B6AA 1KS9A 5IUKC 4TL7A 4JN6B 5B6PA 2JVGA 2ZS7A 3L9FA 4DHEA 4F2PA 3EXFB 5E1WA 2B8NA 3VRHA 1DAKA 1FNMA 1OSNA 3H2KA 4KK4A 2PR2A 4MQ5A 3BROA 3LGSA 5CX1A 3Q7EA 3OMYA 3F46A 2F4OB 4HMOA 1AY0A 1NN1A 1AKNA 3W5CA 1HZZA 2VNKA 3UF0A 1WH7A 4OYLA 3EIQA 2WT4A 3R75A 2I1VB 1KO5A 5C51B 3PNYA 4DPKA 1DGRM 4KR3A 5CYVA 1YU9A 3CWBE 2Z6UA 1QIDA 3L49A 2V4ZA 3HGTA 3UCEA 1CZOA 2QRVB 3PEWA 5B1IA 2QVAA 5HIMA 1E77A 3ZMTA 1S9DA 4ACBA 1YJXA 1J99A 2CXUA 3PP8A 3PC8C 2EKDA 2TMGA 4JH0A 1UIRA 4BNJA 4ENTA 1ZVQA 2A67A 1DTEA 4LFAB 4WESB 2HSDA 1SQFA 5TJHA 4MUNA 1ZUHA 4YV2A 3GD5A 4ICIA 2DFDA 4DF3A 2UYGA 4S12A 2NTNA 1K8YB 1IRZA 3BG9A 1FEXA 5CA1F 1X94A 2IU0A 1FW6A 2RBEA 4JXZA 4F9TA 1FTGA 1GU1A 2VP0A 4FS3A 1NVTA 3O8GA 3N0WA 4Z0NA 1G291 1U7DA 1MB2A 4L8YA 3M89A 1U1IA 4L28A 1R9TJ 1E2NA 1N6HA 3SYKA 4BHTA 3E3MA 3CLTD 2OBMA 4LKOA 1QRYA 3K5HA 1BRTA 1YVUA 3PF8A 3WIDA 3TD2A 4ER5A 4A0XA 4A3MJ 3HRMA 1OD6A 4MROA 1XJCA 5FUWA 3VU9A 3CESA 1L8QA 4HNRA 2FX0A 1P19A 3GOQA 3SQMA 2UV1A 3GHHA 2HOQA 1FUEA 4IX9A 4OHBA 1EDDA 3B7PA 2HV8A 3PNVA 3BE8A 3TCXB 1KIMA 1F7VA 2BGTA 1Q77A 1YR8A 4WA8A 3L0PA 2EPFA 4GX1A 1HDXA 4YIRX 4XSGA 3SIPA 2WEKA 3E8SA 3S1AA 1UXGA 4OSOA 3T1VA 3B73A 1E7YA 1VLHA 4ER3A 1AKHA 2QN2A 1EZVE 5KDLA 2CLEB 4YRJA 5JCJA 3VMZA 2J5UA 4YXWH 2G8YA 4HAIA 2QR2A 2GILA 4TWBA 1JHAA 4HFJA 1KPHA 4QGAA 4BLQA 2AXLA 3F6CA 4YI5A 3ZE6A 1LT1A 5K0CA 1Z5PA 6LDHA 1TWAJ 3SQXA 1SD7A 1AM4D 4L2IA 2CT8A 2FK7A 1X8KA 4KQ9A 2LLKA 1GZ3A 5B58T 3UMCA 1WWKA 3FXDA 2J5RA 2O0JA 4QPCA 1E3SA 1Z0UA 2FSIA 2C9MA 4CEHB 1APLC 2N1MA 3AZOA 1SKMA 5IM5A 5AW4A 5KB3A 3LPNA 5F52A 4XMYA 3W8DA 1YRHA 2E2WA 4XN0A 2JFZA 4EG6A 1THMA 1K7EB 4CU2A 4AZSA 3ET4A 4LE0A 2AN1A 4X6AJ 5AK3A 5AVYA 3ETJA 1P6RA 1SUDA 2NYVA 1T6NA 2MW8A 3FBNB 4IHAA 4UBKA 1KI4A 3KSRA 2DOFA 2ZUWA 4EY5A 3PJRA 4JJFA 1RUOA 1UWVA 2MG4A 3ZCPA 1HQDA 2H9AA 1M7BA 4BX9A 2JD0A 2B1RA 4OI2A 2G5GX 3QQPA 2XBUA 2PGJA 4CFYA 4EA8A 3R2JA 4H7PA 3D4IA 2RONA 2DJIA 2FXVA 4RE5A 5CFNA 4NSNA 5JSFA 3A7DA 1IUYA 3IP8A 2DAOA 1TJNA 3K2IA 1J0CA 2QLBA 2ZJYA 1HDIA 1SQXJ 1MIOA 3H1JJ 1P61B 5HZMA 3BIJA 4BN5A 3GRFA 2QPLA 3HOVJ 3KUCA 3JAMK 2GUGA 2P5LC 3BTCA 1T8IA 1W47A 3DBLB 4FI3C 4G65A 5TS2A 1GL7A 3NOQA 4M6XA 3GYBA 2KYRA 1YBVA 4JNCA 3H32A 4L6AA 3GLRA 3D3JA 5ICCA 1NC3A 2O8NA 3EWAA 3RKQA 5ALLA 1JU4A 4FS8A 3BK1A 4EM6A 5NULA 2B1QA 2PUHA 5JC8A 1EDEA 3FUWA 4LBWA 2YUSA 3GHGA 3WMRA 1QF7A 3MLAA 5DBFA 1DO8A 3FMRA 3TI7A 4I3GA 4PWYA 1IEXA 1TCVA 1ZITA 2B7BA 4B3BA 4DHWA 1XCOA 3MOSA 5JSYA 5IZ4A 1UCFA 3JYLA 3K71B 5IF3A 3KV3O 1WW2A 1RT9A 1QS0A 2MSLA 2V6CA 2RGVA 1QIHA 4DCPA 1KZ4A 2FQ3A 5ICEA 1CY4A 1O4VA 4HX9A 4BXLA 5JNTA 2PJDA 1YZ3A 2V7QD 2HZDA 4I8IA 3KXKA 2XMDA 1OZAA 5F73A 3OPNA 2X22A 3JXEA 1E99A 2FUNB 4KXNA 1FF9A 3MSCA 3IB3A 2KBFA 1EVJA 2OXTA 1AUXA 3BQMB 4U3JA 1DCFA 4OWRB 2LY9A 4R2JA 2GHTA 1BN5A 3BR2A 1XMPA 5IYBJ 3QW2A 2DU9A 3EE6A 4PX5A 3BMCB 4C4PA 1XDWA 3AC0A 4LA4A 3WZMA 1JKMA 3PUXA 1N0HA 3GK3A 5BN4B 1KYOI 2FQQA 1BCCJ 2O1SA 3Q6MA 3IAS2 1PYOA 1QVAA 2NQTA 4NB5A 4LQDA 1II0A 4LSMA 1XNQB 1YB4A 3KQNA 4RD1A 2FEMA 3RL0B 1P45A 3HWWA 2ZJ1A 3QOWA 4ZVTA 4PZ0A 5CCHD 2ZR8A 1NVWQ 4LDJA 3PPYA 3P8ZA 1R88A 4BLRA 3GDHA 4AUNA 5AJUA 4IVRA 2FWIA 3R0ZA 1LTJA 4BX2A 3SDBA 4XSVA 2AF3C 4I1PA 3SBXA 3DWFA 1XQ9A 1KB9E 3FIWA 4K35A 2E37A 1UJ5A 3GPLA 3SSOA 4JHLA 4BAYA 4G9GA 1E5VA 2WYWA 3LVRE 3AP3A 2I71A 4HAZA 2AK3A 1YE9A 3R7AA 3A9RA 1Q3TA 3CZ4A 2B7LA 4IP0A 2X0RA 4WEOA 1S2LA 1TLLA 1M6HA 2GEJA 2CNNA 1HNWB 2BFFB 4DLAA 1S4XA 2C2ZA 1N2GA 5ITWA 4D4HA 2NO1A 1ONOA 3K8QA 4RFSA 3L84A 5LEKA 3LX6A 2YMQA 3TLXA 4GPD1 1T5IA 2HLDA 5K01A 1IQRA 4GMHA 2UVPA 2RIPA 3R5JA 3PQ5A 5FT9A 4HPQA 1QDLB 4WDQA 4JC0A 4V02A 2XODA 5DEIA 4ZMBA 5FJ8J 2PBLA 2ZRDA 1GA1A 3DTIA 4GGOA 4D74A 5E7MA 3CC4P 1P2SA 5B1EA 3GRPA 2VOOA 4FC6A 5ICMA 3E0XA 3RTGA 4XORA 3ZZ1A 4JB2A 1IG3A 4MUEA 3AEXA 1RXIA 1Q82Q 1UCRA 1Q0QA 3LDAA 3ZXYA 2R87A 2VSFA 3PGJA 1F51E 3ZPLA 5BN5A 4AJKA 2GJ8A 2W83A 5LVAA 5DM60 2D06A 3KSMA 3LOUA 4DLNA 1E3OC 5CFMA 2MD5A 3PUZA 5AO9A 2MMCA 5JSZB 4C0JA 1TRHA 1U6KA 2EWVA 3A03A 3DONA 1BI2A 1GL3A 1IPHA 2WM3A 4GCVA 2YKQA 1I3KA 2HYFA 3VZSA 2O0YA 2SPZA 2R5FA 1KQGA 3IV6A 1YB7A 1N8SA 1LTGC 2J5XA 1Z4JA 4YXDC 3PHCA 1DNPA 2Z3WA 1VJRA 3DQPA 4O2BF 4YELA 4CL3A 4ME6A 5AM4A 2VYFA 4GVXA 1JUNA 1VLVA 4HTFA 4CKXA 2R7UA 4NZ9A 1SQPD 4FGKA 3ZVNA 5HDGA 3LBYA 3VPCA 4N5MA 4I3FA 3C4VA 3REOA 3WTSC 3NO4A 4L4SA 4JROA 4EB3A 2R1UA 1CIVA 3T0YA 3QEOA 3EXFA 1HE1C 3SR4A 3L8MA 3QVUA 4LJ9A 2D1HA 4OGKA 3WWDA 2WIFA 4IG9A 3GTPJ 1B1AA 2R11A 2JCXA 5JASA 5A3RA 3EDPA 3OPYB 4EI7A 2C04A 4QMAA 4YDHB 3X1MA 4FT2A 3QFFA 3B2NA 1KS2A 5GVSA 2OR3A 2YICA 4NECA 3T1QA 3L75G 4CEIB 4DC1A 3AG4H 1JNXX 2OPTA 2CJFA 2F7SA 1B3BA 1FE8A 1IWOA 4IQJA 3HJFA 3A02A 4F2GA 5FFNA 4RHEA 3PPVA 4WGFA 2H0RA 1RAAA 2W11A 3RC3A 3HOWJ 1ISJA 1AS3A 3J81Z 2YMLA 4J19A 4Y6PA 4CT4B 1E66A 5AI6A 3DOUA 1G3IA 4DOZA 1S02A 2KX7A 5K0LA 3COWA 3V4WA 4LLHA 3IUBA 3R7FA 2LC2A 2IZ0A 1QP8A 1ZA1A 4M88A 1T6SA 2WIKA 4WOPA 2X7XA 1G60A 1MGOA 5H70A 4CODB 3D0RA 1NY5A 3OR2C 2XXJA 4EEFG 2J1LA 4R1NA 1P0FA 4HMQA 1QGOA 2DY0A 2JPDA 4JKIA 3ROXA 3ZDXB 4CXFA 1U0TA 1WUJS 1I80A 5TGTA 3KXPA 1QCZA 1GPBA 4PICA 4EG3A 2ROQA 4WNAA 4BJ6C 1CUGA 3O4IA 2P7VB 1NW5A 5JRJA 3OFSA 4E07A 2K7FA 1JHFA 3U1VA 4AW9A 4KNWA 5I5GA 5IOYA 1W0CA 2ANBA 4ESBA 3DFZA 4E5DA 4LITA 1YJWI 1WBDA 1ZINA 5DW3A 4YACA 5J4HA 3Q5GA 1DFGA 2VSXA 4TV8A 3LVBA 2Q2OA 1ODTC 2X1HA 2PFSA 3BD8A 3PUIA 1WNFA 4RFLA 4C6TB 5FBHA 3WJ2A 3P2MA 3TSWA 2NIPA 3HUSB 3WWPA 3FBIB 2JFBA 1N57A 1QWSA 5DLEA 2Q4EA 1L0BA 4QOGA 1X7WB 5AUPB 1H3NA 1RM4A 2DJ5A 5F12A 3CNBA 2G9UA 4O0LA 1U04A 1W4CA 4WVLA 1KE1A 5LHIA 2J9FB 2O1XA 3PITA 5L7TA 1E7SA 3O6BB 3BCHA 2ZAEB 3SJBA 4LG1A 3RKSA 2C1XA 4YVFA 2P62A 2QZ4A 3N2GB 3C14C 4A82A 4DG9A 4X8OA 5TY0A 4KYWA 1X1CA 3TEJA 1ZOOA 1M1YB 2Y0MA 3TQOA 1BGYG 3AEKA 3G3ZA 1BXGA 2BCCE 1P1RA 4IUBS 2QN9A 5JJCA 5LNK6 4CEHA 1T5HX 2K4MA 3WL7A 2M7AA 1ZONA 4LW8A 2MYTA 1TTPB 1KI6B 1H4SA 3HVJA 3FRHA 4F8JA 3TM5A 1OB5A 2DUUA 3ZMDA 1LBIA 1PGQA 2FV8A 3Q8WA 1QQ6A 5APXA 3NP7A 4G97A 2QVYX 4G9BA 3AJAA 3JYOA 2EZLA 1GPH1 5TRDA 1PJSA 2P5YA 4E08A 4BNGA 5LOVA 1H8HA 1DRVA 1RC9A 3DHNA 2HOSA 3LAPA 1K9SA 2Q2VA 5HNKA 1LTQA 1YS2X 1XTBA 1YKFA 2YOHA 1CK4A 1NXTA 2KSQA 2JBAB 3FISA 4IOIH 2ZUBA 2ZXXA 3CV3A 3PUVA 3QPDA 3NT4A 3RC2A 4FEEA 3IEKA 1VMAA 1T0PA 3KUXA 2Z8ZA 3SR0A 4QBFA 1VJ0A 5F1OA 1VYHA 1JU3A 2AS5F 1UBCA 2H5EA 5K3CA 2W42A 5AXDA 5JG7A 1X9GA 3C5WP 2EFWA 1KJ8A 3JTGA 2A9OA 4ABZA 4QFMA 2GIVA 2V7BA 4RAGA 2ELKA 2LV8A 3OCZA 3DBLA 3KQLA 1Z4LA 2F3PA 3RK4A 5IAKA 2EJVA 3A58B 2Y9PB 4BHBA 1EDOA 2F3TA 1L1RA 2VQLA 2ZSIB 4MUBA 2R0QC 1ECGA 1E9BA 2IUTA 4AJEA 2HFHA 1XVIA 4NH0A 4HZUB 3WJAA 1NH3A 3FPBA 1KK2A 1UXIA 1UMCA 1JAZA 3ZGZA 3LNCA 2IA2A 1ZN7A 1I2MA 4RDIA 1U9IA 1Q1VA 2IUFA 4QECA 1XD9A 1DDIA 2CUZA 1HO3A 3QLVA 1XFDA 3B51X 1ZNQO 3K1JA 4GXQA 3WICA 5H9VA 3H2JA 2YXEA 1AX9A 4G7HF 1YVDA 5ELLA 4DNPA 3OJCA 4E5MA 3M70A 4ENWA 5DCWA 3L4BC 2Q9BA 3PYXA 5IK2D 2C7QA 1GNQA 3ZW8A 4E22A 5MHTA 1EXVA 3QXJA 2G0AA 1YJ9P 4AJ2A 1T4BA 4LOJA 4GZLA 5E0OA 3ZE2B 3ZHQA 2HWUA 3K35A 4OATA 4H7IA 3BC1A 3M8FA 2W9XA 5BN4A 5J23A 2XSZA 2GD2A 1RESA 1BDCA 4CI9A 3V2IA 1DOAA 4MS3B 4OLJA 2OAGA 4YRRA 3W5BA 3E5MA 2A1IA 3BXEA 2IODA 3V2NA 2MGQA 2DPLA 1GD2E 4H0LB 2W37A 2BVNA 2Q9CA 4OJKA 3NM4A 1ULHA 3IHTA 3T52A 1LC0A 1OLOA 3AG3H 3LP5A 1ZD2P 5ERGB 4NBTA 4AL4A 4G89A 4ZT7A 2X4GA 4DLYA 3DLTA 4HJXA 3IVXA 1AKUA 1N8TA 4L9SA 3E4CA 2O23A 3EZGA 1UBJS 3RBAA 3KZKA 5BUCA 4K9SA 4V0NA 1WLSA 3HL2A 2CS3A 1RXWA 3WNDA 5K6TA 2BM9A 4RK6A 5EXPA 3PQKA 1H22A 2E4WA 1BE3J 5B4VA 3I2IA 4NG5A 4JLMA 2PT7A 4FFVA 4ZOBA 3DDCA 1QH1B 2JFOA 5M34A 4UHJA 4U7TB 5D6OA 1EQAA 4PU0A 3CMMA 2VYVA 3DMTC 3DPUA 3AV0B 2QN3A 5JDCA 3PGKA 1X19A 3DGFC 3VNAA 1P4AA 4KV9A 5CVTA 2BXYA 1ZD4A 5M5WJ 1HOTA 1JKJB 5EHGA 3KEOA 2Y1WA 5ANRB 4CDNA 4OLBA 1ZYRF 2HREA 5MN6A 1ESDA 2DECA 4L5BA 3CMAI 3VV2A 5J2TB 1KI2A 3I6IA 4WRRA 1DBSA 3I12A 4XDZA 2PX8A 4MLOA 2LUOA 1E2EA 3RYPA 2VF5X 2B9BA 1MVOA 5LJIA 3NETA 3TNLA 3KVYA 4EEXA 4B3IA 2XGMA 2B37A 2ZGVA 1CS0B 3I73A 4NP6A 4BFWA 3FZEA 3QFRA 1GNSA 1ZN8A 4RPKA 5BO5A 4DZJA 3TMYA 2YIUB 3NIBA 5D8DA 4UTZA 1EFRD 4DDWA 2IZ1A 4Z1MH 2GUVA 4FXPA 1KDVA 5JPDA 1TQ4A 1GJRA 2OHOA 3H1IG 3PI6A 1XAJA 3EZ9A 1XR3A 3EJWA 2YU9J 2BUCA 4UNSA 2G83A 2EFEB 1UT6A 1JEYB 5JSZA 2O2YA 2FNAA 4JBYA 2XRNA 2JEEA 1C8LA 5LLQA 2M1BA 3T1BA 2JVIA 4URWR 5FPYA 2X8BA 3K05A 1FTZA 2FKAA 2ZW9A 5AJZA 5IP5A 1P9LA 4I8DA 1SANA 4IH4A 3LSKA 1CNFA 2AUTA 1ETWA 2G7ZA 4QDJA 2G80A 3MGGA 2O8DA 3RC1A 3RK2D 4B3TB 5ER9A 4Q34A 1XJ5A 1K4SA 3WG7H 3S8EA 3WFIA 2D0PB 5K7SA 1PYDA 2QIOA 3CVOA 4PN3A 4H3VA 2Y1EA 5DX1A 3PENA 4G5XA 2JFHA 4YV7A 3I71A 4HQFA 4TTIA 1JMKC 2BE9A 1XLTA 3A0HH 2J8ZA 1QNLA 2AZ4A 4POOA 5M1BA 1NT4A 1OFHA 1W88A 4EQQA 1Q0HA 4DMCA 1XSXA 1B2RA 1VPWA 2C77A 1X2MA 5DTMA 4PIPA 1BVUA 4YRDA 4ARCA 4DWOA 1X1EA 4MB6A 2INGX 4KRYA 3FWEA 1XHFA 1B00A 4FXOA 5JMOA 2CV1A 3OPYA 4R4MA 3NPMA 3OCVA 2DA6A 5JCPA 2ZFCA 2NO9A 4GH5A 2HBZA 3JYQA 2R6CA 3FF1A 3VPFA 2PZKA 3WWZA 4D3FA 4J3NA 3CRMA 3WLFA 3CIFA 4I5EA 3AEAC 1TMGE 5T4BA 1W76A 3JQAB 3TNYA 5GV8A 5AKJA 2RGUA 3CT4A 1Z2CA 5GM2A 5K3FB 3RQIA 4Z7JA 3RU9A 3HTKA 5JVTA 2ZJSE 4R1PA 4A12A 1QGAA 3SQWA 5GADJ 3GP8A 1J9EA 5HJEA 3IILA 3E5QA 1QV6A 4YV0A 4IGIA 2CJPA 1DEXA 1HR0B 2W70A 1TYEB 3H2YA 4RPJA 3VOPA 3BA1A 4XYEA 2IA5A 2JLWA 4E5UA 3BWXA 3S93A 1ZUNB 1KERA 1YR9A 4RLQA 2ZTSA 3BH0A 2FPIB 2QN7A 4BDTA 2W2LD 4RDHA 5I4BA 2ZS9A 2OQIA 4BN0A 2WIGA 1JR4A 4QJ3A 3OCJA 1RRVA 5DMHA 3L36A 5ALIA 4N78E 3R4KA 5HF5A 2IZOA 2X15A 1XA0A 4CICA 2WWTA 1CZRA 1SBCA 1NTOA 1CFZA 1A2KC 4E7PA 1ZI9A 5IUJC 3WNVA 4BFTA 4HPXB 2O2EA 1V7ZA 5I9BA 3A27A 4PIVA 2QNIA 2ZRBA 4GX5A 3KWFA 2F55A 4A91A 1Q7CA 1V16A 1L5FA 2E55A 4S1WA 2IQIA 5DZSA 4C6TA 4D92A 1R5NA 2VO1A 3FG9A 3DAHA 3IBCA 3OF5A 1DEHA 2X9GA 4AULA 3UGKA 3FXJA 4UCFA 3KT0A 3DFMA 4OKSA 4D7NA 1X7WA 4C4TA 2A0KA 2CSXA 2RH8A 1RMQA 1RFLA 3RVPA 4L8FA 2YJ5A 4Y3UA 1EAYA 5IDQA 2FKNA 2GDZA 2GZMA 4AKGA 5DT2A 1U5TB 3NDIA 1X7ZB 3NMDA 1YCDA 4UHFA 2HOTA 1V6SA 1EVEA 5DLPA 1S2DA 1HJBA 4FLFA 1P60A 5A03A 4AP9A 3D7NA 2NZ2A 3RVNA 1ZKMA 2O03A 2IU4A 3ZN2A 3ID6C 3Q3IA 4E4RA 1GV5A 1M1YA 2WADA 3L7BA 5H5JA 4BFZA 1GGNA 1IL0A 5ENZA 2F5FA 2WUDA 2ZMEA 1TUIA 4BLTA 3TKLA 3TRKA 4RNCA 2QA5A 4GPIB 1AU9A 1R9NA 2YX7A 2BOLA 2A7QA 5APVA 3WP0A 2XT6A 5ALQA 3QMPA 3L73D 3G8CA 2WA2A 4I7ZC 4M2LA 1PFQA 2KZVA 4QJBA 16PKA 4IYRA 5CQGA 2R1TA 2L0KA 5EE0A 3H0DA 1O58A 2C2WA 1K78B 3KP3A 1VQ5P 2ZZNA 4LXGA 3RDPA 2SICE 3K4HA 2BW3A 3QFHA 1GPUA 5IKPA 3GLVA 2BDEA 1C3XA 1P7ZA 1SC9A 4UFPA 2QQFA 3KZOA 3D9QX 3NCTA 4MQMA 3W5HA 4ESJA 3AL0C 3D6TB 4GPTA 3PUKA 3A6EA 4OJNA 4N7JA 5C52B 4YRIA 1LK5A 4AMGA 5CRIA 2CFXA 3GLHE 4MUFA 2X23A 1IPEA 4JJKA 2JGEA 3I2YX 1D4ZA 2FUG6 1Y1WJ 2QBYB 2GD1O 3M3YJ 4PRYA 3OE7A 3RIRA 1NBMD 5IF9A 1C7IA 3OHPA 4R1SA 3QEMB 1ISFA 4AY5A 4KV7A 2VRWA 4YPCA 2ZT9D 1JHDA 1QVTA 3CX7A 1L7NA 1JEKA 3L6EA 4OHUA 3DE0X 3U2RA 2JAPA 2ZSIA 2QAGC 1U80A 1AQ6A 2ILVA 3MCWA 4ZA2A 4EMBA 3GW8A 1G8XA 3I23A 4QDXA 3CCEP 1BI3A 4EL0A 4RADA 1PVVA 1WY5A 2C2XA 4HZUA 4PVDA 1FNBA 3PFHA 2JCVA 1NRJB 1OYYA 5D3QA 3I3SR 2WJHA 1AKRA 2G7HA 1O54A 1OWAA 2VNHA 5E6UB 3OKFA 3BWBA 3PXDA 4I1YA 5ILUA 5G1PA 2L2QA 2B21A 2P9GA 5CFPA 1D9XA 5ESXA 3UW3A 1L0LK 2WE8A 3CDHA 2YVKA 3O9VA 1PQYA 1R00A 4H17A 1W46A 4G1FA 4D5EA 4KLZA 1TO6A 1JA1A 2QUIA 4A0FA 1A35A 5JATA 1GZ5A 4I0BA 5CLJA 5GV7A 4GQBA 3AXSA 4LHWA 2P8JA 2DKFA 4HAOA 2O1EA 4Q9IA 3N8DA 4O2RA 3AHHA 3PR1A 1X1SA 3M9XA 4UUBA 2YZ7A 3AHCA 3N2LA 1XEAA 3DB2A 3RYFA 4DIDA 3G9QA 2IGNA 3OKPA 4KYVA 4LHVA 2A57A 5A2GA 1FZTA 4GMDA 4AY6A 1GV1A 4TGLA 4E2YA 4HF1A 4E5NA 3Q1MA 4MCAA 1YZUA 3M0DC 3BWEA 2R7KA 5DE3A 1T9GS 5ILQA 3B60A 3A36A 5A7FA 1N2SA 2BR5A 2F8SA 2D8AA 4MS3A 2WIAA 1FX7A 4DM7A 5CHYA 4I2NA 1FSHA 4DLBA 4C87A 2ZTUA 3JR9A 1V71A 1NR7A 2QQEA 2XXAB 1CDZA 1E1MA 5G0WA 5TVGA 5JNVA 1UJ8A 1P0MA 4TWIA 5HUJA 1ZUIA 4EW1A 1SVOA 3GLFE 1QNFA 2NYRA 3BDIA 3HB0A 4C89A 2ZUEA 4UU8A 1XZPA 2NADA 2WW8A 1YTUA 2XR1A 1ZHFA 2X9DA 2YS6A 2P2YA 5IFLA 2ZIGA 3ELDA 4QQ8A 4K9NA 2P2SA 3TLCA 5TMEA 3SM3A 5HODA 2X51A 4IUDS 4MUGA 3F22A 1ZC3A 3E18A 2JHFA 1M74A 3LA6A 4O33A 3WGQA 1YA8A 1OZHA 5B3SH 4X85A 2G88A 1FC2C 4IICA 2BHLA 4AJOA 5LP6C 4ZARA 1A04A 3GJRA 3TD6A 4LEIA 4EY7A 2MSDB 1S2NA 1CHDA 4JYPA 1IVNA 2ZNZA 3NQ41 3D7RA 3LOPA 1Y1PA 1YB5A 2O59A 2DP4E 3KE9A 4YJFB 4HNGA 4OL0A 4JI0B 1OPXA 4UCWA 3LUBA 3HO6A 1Q1ZA 4JYCA 4AJHA 1NL3A 1G3QA 1SHJA 3H1KJ 3L0OA 4V2IA 1EM8B 2GARA 3TIFA 1XTPA 3IE1A 5L3FA 4X6XA 1PJ2A 3GBVA 3EYIA 1Y1QA 2QW0X 1VPCA 1WWXA 2FWPA 5HKLA 3L4KA 1GXSB 4BEWA 1LRLA 1UMDA 3UB4A 2P67A 2JA5J 4L22A 1Y1VJ 3UOWA 4J91A 1ADCA 2Q3MA 1UPCA 3ZGLA 4IIJF 1OZ0A 1EFVA 4O1IA 4J3JA 5LZ5A 1AKHB 1OH6A 2NOAA 3SK0A 5CG1A 3R09A 3NIGB 3BT7A 3U0VA 2ORED 2AZDA 1N7SA 1JEYA 4RVHA 3TR0A 3C3WA 1ACIA 4IFFA 1IFXA 1XLUA 1IHOA 2VDRB 1D07A 3BGIA 1Z26A 5DCYA 4OIRF 1PW5A 2BIFA 4RY2A 1G55A 1PN3A 3DZDA 1MPTA 4HXFB 1KXZA 3RARA 1JQ3A 3AYXB 4QPJC 1G8KA 2COMA 1JB0J 5JCOC 1GQFA 3FNQA 3PC4A 3X1DA 3TRFA 1EP1B 5AW4B 5ETJA 2A0YA 3HUDA 2R8PA 2DT6A 3MGBA 1A7JA 1C0WA 1BE6A 4FASD 3NTLA 5JROA 5AJTA 4QTTB 1EUQA 2A86A 4RQTA 1L0NJ 4NPEA 2XBLA 2PGXA 3O74A 3PUFA 3W1VA 1IY2A 4NCNA 3DF9A 5JE8A 3SC4A 3F73A 1WMSA 3KXDA 3TW7A 1PT5A 3Q7QA 1U0NA 1ZJ4A 1ZN9A 2BI4A 1ZLJA 2XQFA 4QIHA 1DX4A 3W3AD 1JXSA 3BGVA 3DU5A 3LG2A 4ENNA 3K20A 5DEOA 4F46A 4FISA 4BE0A 3Q0UA 1Y1LA 3WLLA 5IPFA 5CXSA 4IO9F 4G24A 3RRBA 3EOBI 2VAXA 2J87A 2CQKA 4IHXA 4RIFA 2FYUD 4FQ5A 5F5NA 4QM7A 2C1ZA 2ZBPA 3ZWPA 5FHQA 5K3FA 4Q16A 3TFQA 2VBFA 3FGPA 2J85A 2XDYA 1NN5A 2BVMA 2IH2A 1XGKA 1F3OA 3QHAA 3NHBA 4AQDA 2E76D 5SYAA 3BJZA 5FJIA 5CTJA 1W1WE 4RCVA 3GTJJ 3TGWA 4BGVA 3D0OA 5KJCA 5J3JA