1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
2AO9A 1G2HA 5EYRA 4DZPA 4X6AJ 3GTMJ 3S1MJ 1T33A 4X1EA 4JX6A 4S0HB 1K83J 3HOVJ 3UJ3X 1MSFC 2MSYA 2EZLA 5C32A 3Q3SA 5DS9A 2LK2A 4W1UA 3B6AA 1GDTA 1LE8A 3TW6A 2O7OA 1RETA 3A03A 1XG1A 3GTJJ 2MGQA 3S1NJ 5EZHA 2DA6A 5FKNA 2EZIA 3JRGA 4Y7NJ 3OOUA 1LFUP 2YU9J 3TP3A 4A3LJ 2H1KA 3F0CA 4AC0A 3H3VK 2Y31A 3OIOA 2XPWA 3FKIJ 1B8IB 3OSFA 4IHVA 1QVUA 3HGGA 5F0HA 4IHWA 2R92J 3I4NJ 2JN6A 3BR2A 2L7MP 3ZQGA 5IPAA 5C4XJ 1MBFA 4IHYA 2QCOA 2TCTA 4JX5A 1ETQA 3O8GA 5FKOA 2XSDC 4A3JJ 1ZQ3P 3GBGA 1APLC 4GFBA 2LLKA 1RR7A 2EZKA 4M3BA 2I10A 3HBLA 1IJWC 2OF7A 1FEXA 5C35A 4M3DA 1JJ8C 5EGOB 2E2JJ 1P7JA 2XPVA 2EH3A 4UUSA 4M6VA 2NVXJ 1GV5A 1B72A 2P81A 3LHFA 1X2MA 2Y30A 1QPIA 2RSLA 2YUSA 3Q0WA 3HOUJ 2O9LA 2DA5A 4MO7A 4V2FA 1MH4A 1I50J 4M3GA 2XB0X 4C2MJ 1UG2A 5K7HA 1WPKA 2GLOA 5FJ8J 2EBIA 3BG3A 1JKPC 5E3NA 2MG4A 5M5XJ 3GTGJ 1ZK8A 1RKTA 5DTDA 3ZQHA 5JLWA 1EF4A 1X2NA 2R5ZB 3HOZJ 4XRSG 5C44J 1OCTC 2NS8A 2R5YA 1T56A 1UHSA 5J1UA 2LD5A 3A01B 1HDPA 5JLXA 3LSJA 2XGDA 1JUMA 2K40A 3QPLA 1W0TA 3S1RJ 3HOXJ 3W6VA 2EZHA 5C4JJ 3SDGA 1BL0A 2FJ1A 1NK2P 3K2AA 1PUFB 1E3OC 1JT0A 1TWFJ 5M3FJ 3G13A 5FLVA 3S16J 4B3AA 2M0CA 3QQAA 1S7EA 2B63J 2DMTA 5FLMJ 3HKZN 1DU0A 1Y1WJ 5BNGA 1TC3C 1ETKA 5EDNA 3HB9A 3LHKA 2DA7A 3TP0A 2HI3A 2ZB9A 3ILXA 1JTXA 1IG7A 1WI3A 3S1QJ 1Q1VA 4DYCA 2JA8J 4MFEA 1IV6A 5EGOA 1AKHB 4ABZA 4A93J 4A3BJ 2CU7A 3HDDA 3RZDJ 3RQIA 2PMZN 1MBGA 3BT9A 1WGXA 3O8HA 2IEKA 2R93J 1ETWA 4IHXA 4JX4A 2VKVA 3UKGA 1YRNA 2DA4A 2NOGA 3OSGA 5GP9A 2CJJA 1MSEC 3QPSA 1GUUA 2DTZA 4B1RA 2MHCA 4A3DJ 1ZTRA 1JUSA 3BR5A 1GV2A 1MH3A 3BQZA 3JRBA 4I6ZA 2GM5A 1ETYA 1O4XA 1JT6A 3A02A 4HNVA 1U9NA 2XB5A 4M3EA 1JKRC 4FCYA 1OFCX 2DMPA 2R5ZA 1OJLA 3CMYA 2ME6A 3BTCA 5K7FA 4LOCA 3HM5A 1I3QJ 5IP9J 3CDLA 5IP6A 3VPRA 4D7MA 4BY1J 1JUPA 4DYQA 4IEJA 2DMQA 4XIDA 1R9TJ 2VUMJ 1GHTA 4XK4A 2FQ4A 1JKQC 5IP7J 3B6CA 2HXOA 2W48A 1ZR2A 1HCRA 3ZQFA 2ELKA 1BJZA 5E3LA 4MIMA 5M5WJ 4CYCB 4W97A 1GVDA 2JA5J 1XC5A 5IOZA 3GTLJ 1Z77A 3GUVA 4XICA 4BQQA 5F0FA 1IDYA 2R7ZJ 2Y9ZA 3HOWJ 4A3EJ 2DA3A 4A3MJ 4NDLA 1MBHA 2O8KA 1MBKA 1BW6A 1AKHA 1XS9A 5C3EJ 3L1PA 2L7FP 4FTHA 2XRLA 3BG5A 1RKWA 5GPAA 2L7ZA 3IH2A 1LE8B 4V2GA 3TEDA 2DJNA 4DW6A 5FKKA 2Y0SN 4DZJA 4RDUA 3ZOBA 2JK3A 5IOYA 5F27A 2COBA 2N8GA 1ETVA 2MW8A 3FK6A 1JGGA 2CRGA 3S14J 2X9DA 3GTPJ 2XPUA 3BR6A 2NS7A 4UUTA 4G12A 1VFCA 5IYDJ 2VI6A 2LVSA 2WV1A 4DYRA 3S2HJ 3M4OJ 1VI0A 1B8IA 1VNDA 3LSGA 2KDZA 1RPWA 3NAUA 3IH4A 1VF9A 3BTIA 5EG0B 2DA2A 3S15J 1Z0XA 2OPTA 2WAQN 1X58A 3GTKJ 3D1NI 2CUFA 1GT0C 3S2DJ 2HOSA 4MLOA 3SFIA 3I4MJ 4A3IJ 4BBSJ 3JRIA 1FTZA 1HX7A 2GM4A 2LFBA 4MFDA 2DMUA 4UUSB 1IRZA 1WCMJ 3DEWA 2Y9YA 3IH3A 3K7AJ 2JWTA 3BR3A 3WHCA 4A3GJ 1ITYA 4EEFG 3PKZA 3RKQA 3BR1A 3BTJA 2NVQJ 2G0EA 3BG9A 2GBYA 2ID3A 4XRSA 3E7LA 3LSPA 1ETXA 2E2HJ 1A5JA 2FX0A 3NARA 4C3JJ 2X48A 1QRYA 1JKOC 4M3FA 1TWCJ 1A6IA 2E19A 2LY9A 4QIWN 2HXIA 5FKLA 5EF6A 1H89C 2E2IJ 1I6HJ 5C31A 1HF0A 2HOAA 3CQZJ 2VPRA 4A69C 3SJMA 2XGEA 3Q0VA 2R5YB 2ME0A 2ECCA 5F1JA 1TWHJ 2AHQA 3A01A 5E3OA 5FKMA 4A3CJ 2E1OA 3MN2A 4QTRA 3GTQJ 2IAIA 4QSHA 1LFBA 2L9RA 3MKLA 3JRDA 1PUFA 1P7IA 2LP0A 1ENHA 1QVTA 4I76A 5J3LA 1JTYA 2K9QA 3CCYA 3JRFA 2JJ7A 5EEAA 5M3MJ 1IUFA 5HODA 4RBOA 2FD5A 5J1YA 5J1RA 2JMWA 1SFOJ 3BVPA 5EG0A 3BTLA 4BKXA 2QF7A 4C3HJ 4D5CA 3IV5A 1FIAA 2CUEA 1FJLA 2HQ5A 4Y52J 4FISA 1H8AC 2HYJA 5C34B 1HDDC 2NVYJ 4B4CA 3JREA 4JP0A 2YS9A 4BY7J 3HGYA 5M5YJ 5E3MA 1H88C 2ECBA 2R0QC 3DCFA 5IYBJ 2HDDA 1ZGWA 1ZKGA 2K9SA 3ZQIA 4FE4A 2M9HA 3HEFA 2JA6J 5EZGA 1HOMA 4C3IJ 4J19A 3ZQLA 3C2BA 4FE7A 1OCPA 1NTCA 1HLVA 2K9NA 1YRNB 1MBJA 3MVPA 2L0KA 9ANTA 2RAEA 4AUXA 3BQYA 1IGNA 1Y1VJ 4JYKA 3LSRA 3HOYJ 3JRCA 3GTOJ 4L5EA 2DMNA 1K61A 1POGA 3JRHA 3BR0A 1UMQA 2LKXA 1RESA 2M2EA 1BW5A 1CQTA 3ZQCA 1NK3P 1IDZA 1MBEA 2ID6A 3G1LA 1D5YA 1FIPA 1U78A 1TWGJ 1U9OA 2CQXA 2DN0A 3M3YJ 1U8BA 3S17J 1AHDP 5IYCJ 1DU6A 4BBRJ 4BXXJ 3RZOJ 3H0GJ 3JRAA 2HOTA 1BA5A 2NVTJ 4D5FA 2KT0A 4D7NA 3PO3J 1JJ6C 1MNMC 5F0CA 4XRMA 1ZR4A 3JR9A 2EQRA 2Y2ZA 2LR8A 2D5VA 1WH7A 1TWAJ 1ORKA 3TW7A 1SANA 2WB1N 5K7ZA 2JA7J 2M34A 3G1MA 3FIWA 2VKEA 1WH5A 1FTTA 3PM1A 1ETOA 2CQQA 2H8RA 2IBDA 4AYBN 3FISA 5GPCA 1B72B 2M8GX 4A3FJ 3Q0UA 4CYCA 3LOCA 2X6OA 3G1OA 2DA1A 3PO2J 5F08A 4A3KJ 1F43A 3WHBA 2LTPA 2TRTA 1W0UA 1IC8A 1F36A 1AU7A 2XGCA 5F04A 3FK7A 3LNQA
chains in the Genus database with same CATH superfamily
5FR1A 3VDNB 4AVYA 1BI1A 1T33A 2HNBA 4HKZH 4B7CA 4HYTA 4OUDB 3OKAA 4Z4CA 3OYMA 3JQ7A 3O8CA 1AKTA 4C0QC 1HYBA 1JECA 2MGQA 2ZUDA 2K6GA 5HMMA 2VQDA 3L0PA 4U0JA 1KZGB 1OFUX 1FMCA 2QEXI 5EG5A 4RDIA 4JR1A 1NTKD 1SFCB 4LXGA 3EK2A 5BQFA 3HMKA 5KSZA 4TROA 2W6JA 1B00A 3NC4A 2HPHA 3VMMA 4RVGA 1DEHA 2HK9A 3HCAA 2XPVA 5TRDA 4BRUA 5KBYA 1YHZA 1Z4IA 4R01A 2ZTLA 4DA7A 3OO1A 3EODA 4A15A 2VI5A 4FR5A 3RTBA 1T9AA 1DAEA 4QLCU 3D1JA 1KQ8A 1XF1A 3ZBPA 2Q7OE 5JYBA 4WY4D 5JH7F 2WPDD 4B75A 4HDKA 2DWPA 3BBLA 1R8YA 3ZE2B 4HAMA 4G5OA 3ULQB 2VXBA 2FJ1A 1EGAA 5CYOA 4JDUA 3OJXA 1L4HA 1CI6A 4F3YA 2Z5HA 2HEIA 4XGQA 3BWBA 5LKAA 5JCOA 4BFXA 3L2WA 3NWBA 1BQ4A 2G40A 3WDLA 2F1OA 4EEZA 3FPHA 2PRZA 4MARA 3CMCO 4W5QA 1KH3A 3S1QJ 3KEYA 1U2QA 4QG7A 5F6FA 3PQFA 4YDSA 1NR1A 1W2WB 4W8OA 4DG5A 4JC4A 4RANA 3AHCA 2WWFA 2EJWA 1WY7A 4YT4A 4CKYA 5JMOA 2QEXP 1TCBA 4AQYB 2ZITA 1CIJA 2VBFA 3HGMA 1USUA 1YQDA 4JQZA 2PG3A 3RM3A 4C4AA 5BWCA 5APYA 4RQAA 1GGFA 1N2JA 1W36C 3O95A 1IW7F 3UJ6A 1F1JA 4A92A 5BMZA 3T12A 4G4GA 1V1MB 2G8LA 3ZQFA 4C0JA 1T2FA 1QDEA 3GTLJ 4EG6A 4IRHA 4C7RA 2J31A 4LY9A 4QG3A 4M0DA 3OCJA 4L2IB 2VP2A 4H15A 2F48A 2CDRA 2Z95A 3HWSA 5KHLB 2Y0DA 4S1TA 2OXEA 3L05A 4Q3BA 1IM8A 1YG2A 3AH8A 4OSEA 5KSYA 3L01A 3STHA 3J81Z 1DKOA 2EL9A 4F3RA 3EEOA 2IYWA 1IZ7A 4RPGA 1R22A 3ZIUA 1IBSA 1GT0C 1SUFA 3ZIDA 1I4LD 3RANA 4A3IJ 3CF5F 2R6FA 4QE3A 1CZRA 1Z68A 2XGOA 4NZYA 2QIWA 3ROGA 4AJ2A 4JU8A 3B2QA 2PD6A 2EFNA 4MWEA 3ND6A 3PWKA 4W8HA 2ZETA 4IILA 3BC8A 1JDBB 3HU2A 4R98A 3D3JA 3QXCA 3EUAA 1JX6A 4AXBA 2WY7Q 4EFMA 4MUAA 2AIRA 1NOKA 4BMVA 3D3KA 4CCYB 3RHTA 3AUKA 5GQSA 1U02A 2N1TC 2CUKA 2C2KA 3L46A 1J24A 1YBKA 4UHFA 2DERA 1OIPA 2JW5A 1TJPB 1G21B 3G89A 3RFUA 2M3BA 2KJQA 4G7OF 5B53A 3V32A 1AY0A 4DGQA 3ZCRA 5LA6F 1QIHA 4LB5A 3L1VA 4X97A 1YMUA 3I0NA 4LE0A 3FCEA 2ZRDA 4UFNA 1XT6A 4CIVA 2HJWA 3WLLA 4ZD6A 3O8DA 3G2LA 1R4NA 4PV1B 4GS5A 5EPOA 1Z2NX 1E4EB 2GXBA 5LP6B 1XJCA 3I92A 1OXBB 2MSEB 3UT0A 2L7KA 3MS2A 3A1VA 4KRYA 2YCLA 4XLLA 1KYXA 3KQKA 4G6QA 1IWPB 3QE2A 3JQEA 3SQLA 3U16A 4HEA1 4IJ5A 4CM7A 4DLAA 2HF8A 1UK9A 4CMEA 3L72J 3AI2A 4MRVA 2VJAA 2PA0A 1S3JA 3A37A 1E2FA 1RD4A 5BRAA 2AYZA 1A31A 2LY1A 3OIDA 3AECC 1ATZA 1POWA 3RKSA 2W8ZA 1KHTA 3NANA 3DTIA 1F8YA 3R0IA 2X2PA 4Y28J 5BWBA 2NZUG 3LIDA 4CLEA 3BGDA 4I50B 3RT7A 4ZYLA 3EF0A 1VL2A 3WIBA 1NJ6A 4HUQB 1OCOH 4MCAA 1LGYA 1DQRA 1Y4ZA 3GLFA 2GCOA 4R3NA 1BU5A 2K3RA 5EWMA 3IAUA 2QX8A 1QOPB 1WT6A 1FXUA 2YIMA 3WZLA 2ZSAA 3DYIA 2KLUA 3NHYA 1EKEA 1WHUA 3AF3A 2ADMA 1D9ZA 4AYTA 2CLFB 4Q03A 2C8LA 4A3JJ 1NUTA 4GFBA 4P3YA 2E7XA 5KHDA 3HZRA 3FWHA 1ENPA 3AUXA 3SC3A 4QOGA 4DN6A 4XOIA 3GVAA 1LVHA 3H1JE 3TO7A 2X9LA 4MW1A 5FTLA 3VN0A 2Q3HA 3ZQQA 2EV0A 5IH7A 2R8ZA 4ADSG 3RUFA 1BEUB 5J1UA 2XAAA 2OBBA 5I9TA 2XCLA 1E3WB 2ZSHB 1ZRFA 4Z4FA 3KVRA 4OAPA 4AZSA 4K2AA 2QUAA 5IAGA 1IYZA 3E5QA 1Z6YA 2CV2A 2VJMA 5HBGA 2FMHA 1E7RA 2CXHA 3L0CA 3PEVA 3EA0A 2ZSIB 2QTNA 2H2HA 2B1GA 2O6LA 2UUCB 4KMFA 1WETA 3SD7A 3KCNA 4JJKA 1J2YA 1JRLA 1OZGA 3DMDA 2WUWE 3OZRA 4HTFA 3RIGA 1PK7A 2C03A 4FJ0A 1ZJYA 5AKHA 3HSRA 3N2GB 1W5BA 4QEDA 2VN2A 1W1IA 3W6NA 4RX1A 4RESB 2G9WA 1KE1A 4F7WA 3BCUA 3U1VA 1U0HC 1BD4A 1EIWA 3P7KA 5FB3A 3S7ZA 1X42A 5FORA 4CG2A 2RB4A 1L3IA 3VKUA 1UWVA 3RC7A 1XCPA 2HW8A 1F4PA 1S5PA 2Q1SA 3HXKA 4A3EJ 3UAVA 2ZUFA 3ON5A 3S29A 2IZ7A 2YZ7A 5CT9A 4M8NE 2Q4EA 4LV8B 3GFLA 4P5PA 3PR2B 2XYRA 1XTBA 2K9JB 1OU0A 1L4MA 3DFFA 5K5OA 4BEHA 1J25A 3L18A 3Q2KA 4JY7A 5JASA 4H44B 4I1PA 5AXBA 4B81A 4F4IA 5EIXA 3TGLA 5JS7A 3VR0A 5DSXA 5CJJA 1SBIA 1MB3A 3TB4A 1NYRA 3EDQA 5DGCA 3CZ4A 3DMYA 5K1ZA 3V4LA 1AF4A 4L8YA 3EW9A 2YFHA 2QVXX 4CG3A 1QJCA 4I6MC 3L8HA 2R3SA 2NIPA 4KDPA 4YFNF 3CUQA 4U8GA 4Q0MA 1VHTA 2Q5OA 2BC9A 3D8RA 4XSXF 3HA5A 2WG0A 3OE4A 1QRAA 4MWZA 3BCCE 3V7SA 2XKMA 3ZKWB 3OQJA 1FSPA 2X76A 4V0KA 2QKMB 2JFNA 4BCCA 1X15A 1PWXA 4XLHA 3AUTA 3OZVA 2PS9A 1S2IA 4ANFA 1H88C 4UHKA 2IX9A 4US1R 1D8TA 4BKQA 1HE4A 2D1FA 2OG2A 5KUTA 2BY4A 3C2BA 2QTGA 3M82A 3EVBA 2BBWA 1NGSA 3AW8A 2VYQA 3EC2A 4GPAA 4B3HA 1H2YA 3ND8A 2PSSA 4WZBE 3Q2IA 5AI4A 2W5UA 3HA2A 4BXLA 1KYQA 4NARA 3DZDA 3I54A 2BY1A 3PDIB 2J3IA 1R8EA 1A1SA 1ZMBA 1WV1A 1L3CA 5FBLB 4FYYA 2X0JA 2X5JO 2JASA 4B32A 5CT4A 1TAHA 1LNWA 1VRWA 5L3CA 4LIUA 1XKQA 3OLWA 5CJ9A 1YTZI 1Q95A 2IYVA 1W85A 3CRMA 4XGKA 4AL4A 4A9AA 3ZXUB 2MR5A 3S8EA 1VQ5I 1S5LH 4OP3A 1H0KA 4G26A 2YZKA 5T3YA 4YCCA 4NFHA 4EMBA 2BFFA 3P5BA 3Q9SA 2XJ9A 1NATA 3RYHA 2DA6A 4IFDK 2WT4A 5EJ5A 1NQTA 1W4RA 2C2MA 5I9BA 4DLBA 2GQ0A 4ESEA 4F7ZA 3OIOA 3OIPA 3B9RA 5D5XB 4CEIA 3BATA 5F1PA 2R92J 2C4KA 1TPYA 5JDCA 4WDQA 1UBJS 1E2LA 4YGYA 2LKCA 3DD1A 4ZIRB 1J8FA 2Z58A 5C35A 1OI7A 4E88A 2I1JA 2B25A 1EUZA 2NVXJ 1E6LA 2IUFA 1IUNA 4EEKA 1JJFA 1XF9A 3NDIA 2V0CA 5J4KA 4A0FA 3NEYA 2O0HA 4XIGS 1TL7C 3MBIA 3ZE0B 3O74A 4QL3A 3LX8A 5FBQB 5B3SH 1NKNA 1GPUA 1FJHA 1PNVA 2O8DA 1E62A 5HCUA 1I9GA 4D9KA 5EI5A 4YALA 4JJAA 4ENTA 3FJOA 1D1TA 2WD7A 1NTKJ 4UU0A 1TU3F 1Y9JA 2B0CA 2DW4A 1GZSA 3ICPA 3DEIA 4L5AA 4X93A 1QVZA 1VQ5P 3T0YA 2J4CA 1BGYE 2IYXA 3PGA1 1L4YA 4BNUA 1XTQA 3STXA 1FBMA 3WYEA 1R00A 2XTNA 4HLNA 2OLKA 1I7NA 3TBIA 2PP6A 3JWPA 3SS7X 4BXOB 4WZBA 3OWOA 3KVYA 3W8NA 5KNDA 1LPAB 2QRHA 1G17A 4EPXA 2JG3A 3PI7A 3BB1A 3BH7A 4LY3A 5K5GB 5DE3A 4Y2PA 1OW8A 1NE7A 4X8HA 1R3UA 1T8PA 3UK0A 4OXQA 5DBGA 3H6PA 2XA1A 5FL7A 2P1ZA 3WP0A 1UOEA 3W34A 3RREA 3L7DA 3NPAA 3JCUC 3MUDC 1DIOB 3MHPA 3U1BA 2BASA 4MGYR 3OIFA 1SD6A 4Q4ZF 1MA3A 1ZIDA 3QSGA 4YP7A 3IAS6 2XRLA 2W6IA 5EHGA 1G2QA 4J1TA 4TTTS 2CXRA 3Q72A 3H86A 1TRHA 5DM70 1NXVA 3DWFA 4QDTA 3PX7A 5G0WA 1LPNA 4GLBA 1YQUA 5LBQA 1D2GA 2IS2A 1HURA 5FUMA 1JHUA 5IW8A 1RPWA 3UM9A 3RWBA 3OFND 2ZZMA 1BKYA 2Q07A 4U3JB 1AO0A 4U0WA 1MPXA 3EUKL 3THRA 3ITDA 3GLUA 5CFMA 1GSHA 2XBUA 3PUWA 3HD7B 2C61A 4DR2B 1SUDA 5B1AH 5D85A 1DAMA 5TVGA 4YBZA 2VF4X 2IEYA 2YOFA 3VZQA 5I7FA 2ONZA 5TY0A 1SK8A 4S0XA 3WHIA 3Q7PA 2DC1A 3KZVA 2PAFA 1JZQA 3CTPA 5BSVA 1OBFO 5K03A 3L8FA 1L5LA 2YJZA 2IV7A 1J5XA 3P94A 1K97A 2QJWA 2WFAA 2HPMA 1TWHJ 5TGZA 5DD8A 4WKPA 3UWSA 4GVLA 4HVCA 4BFSA 3GTQJ 7ABPA 2RGYA 1H9GA 3L7MA 4DDMA 3DQVC 4A6DA 2EILH 1PR2A 4RPJA 4P4SA 3HKDA 3ICVA 4WWIA 3LLUA 2NXEA 3KYBA 4PX3A 5IPFA 4WLOA 1WRGA 3QRFF 2ZYAA 4BACA 3AG4H 4JHXA 3P9NA 2P67A 1IRGA 3H1EA 4H59A 1NVEA 3HEFA 4D26A 3VYSB 5CCGC 1BE3D 1HOXA 1TRKA 4CMHA 2I4TA 1PL0A 1ZLXA 1YJCA 2G76A 1SKMA 2O3QA 4UTRA 1ZN9A 4LJLA 4MCHA 4UAVA 1Z18A 3MFYA 3UWMA 4JI5B 3SQDA 4FLEA 5GONF 3NVMB 3THSA 3PPYA 2PT7A 4EMTA 3QLTA 5IAOA 2DFDA 2IW5A 2IS6A 4UCXA 5FBZA 5REQA 2QMYA 2VN8A 4OJNA 2V8OA 2OM6A 4HEJA 1B42A 4UE2A 2Z2ZA 4BQAA 1I3KA 4KGZA 3H7IA 2ZWAA 5IDYA 5DHUA 2IZ6A 2OAQ1 4KX3A 2J9XB 1KI8A 1ONSA 3UB3A 4RELA 3OHMA 3PO2J 1F43A 2PRIA 1EKXA 3C1TA 2IZZA 4YACA 1C30B 4BX0A 1EA7A 1YTLA 2R7MA 4KRFA 1CZKA 5IT3A 2IZOA 3F5HA 4QOEA 4IGAA 2H51A 3U62A 2H57A 3EEFA 2JUCA 3ZHXA 4QO7A 1HNZB 1ZL2A 3VR4A 3OQBA 1IK7A 4GWGA 4ILEA 4ZJYA 3D0SA 1SB8A 4ZVPA 4DDHA 7GPBA 3F8TA 4RB3C 1YH3A 3DT9A 4E33A 3D4LA 2XB9A 5EEGA 3EYAA 2B34A 3ETGA 1LLDA 1U0SY 1YAJA 5EVJA 1TTPB 1IPHA 2AFIE 1S3IA 2EH3A 4OYRA 2NZYA 5KYGA 3DEFA 3RV3A 4RWZA 5I01A 4NL4H 3E1RA 3CUEF 2MSCB 1ZD3A 2FP3A 3C39A 4PINA 1GAJA 3CLUD 2WF5A 1H89A 1BN6A 2IGOA 1Z06A 5KZMB 4PO3X 4LN1A 4OY3A 2C9MA 1X1TA 5F76A 3VC1A 5MF6A 3KJEA 5JZ9A 1TEVA 5DM7F 4TV9F 3T4UA 3EWKA 4JQSA 1RQPA 4RM2A 4RB1A 1QYCA 4PC6A 1VG8A 3R60A 4OXNA 2VKQA 1TM7E 1RLMA 1EVLA 5GV8A 1XVTA 3DL4A 1NYQA 1T3ZA 2XGSA 3K5IA 4MOWA 4F93B 1DADA 5EYPB 5ALZA 4QYXA 3IN6A 2CZGA 3TW0A 5HUQA 2QBYA 4O4JA 4LBVA 2Z6UA 2P4WA 4FEEA 4HNRA 4U88A 4PZAA 3QFFA 1I0ZA 5DBEX 3K6SA 5BSTA 4LX8A 3OJOA 1M5TA 2BJWA 2HYGD 5AESA 4TTPA 5J2UB 4MKGA 3IRQA 4E6EA 4GDMA 3DO8A 3IAXA 2DQZA 1KORA 5JXJA 1Z7LA 4J7XA 2PLRA 3QITA 2EJTA 1D5WA 1M76A 4FFBA 4OPMA 4JXZA 2MJZA 2PZJA 2IEZA 4FK8A 3FOEC 2PGXA 5DWDA 2DA3A 1OYVA 4UY8I 5IYZA 2IE8A 1BXKA 4ZOLF 3LTEA 3DE4X 4UD2A 2YKGA 2F4IA 3VR6D 4JOSA 1IOVA 4RK7A 1XZNA 2AXTC 3TGUE 4AD8A 3EIFA 1ZUIA 3RK3D 3F74A 3EYYA 1RYHA 1T5IA 2YVAA 2A4KA 4OHUA 2ZIAA 4JJ4A 1FS5A 3IKMB 1JCDA 2AG1A 1ORWA 2WM3A 3E3AA 1GXQA 2ZUBA 1L5OA 2AFIA 5TPWA 4BGIA 4NBLA 2SPZA 3X1JA 3AZOA 1KQ0A 4B17A 5CDUA 3PGVA 3X1YA 3C3KA 1C1DA 3ZWWA 4V1CA 1LVAA 2Z8YM 1A8HA 3LA2A 3FB4A 1KZ7B 1QFJA 1AK9A 1K9SA 4Z0NA 1B3BA 1Z0AA 4B6JA 1LWUA 1V11B 4ECAA 5H9WA 1SHZA 5E1OA 3KX2A 2PQMA 2R8EA 2JO1A 2QG4A 1EVIA 3R9IA 3T9DA 2ISZA 4RPCA 4PTLA 3SIXA 2M5AA 3SLGA 1QVTA 1SQPG 3X1DA 3P9PA 3MVEA 2NP6A 3IP5A 1MJAA 1CJTC 5KNLA 4J1NA 4EJSB 3PC6A 1XTJA 2PXHA 3ELKA 2JDID 1UK6A 3OEED 4B76A 4W1PA 4CEHA 2K9MA 1S7CA 4TZ0A 1YRNB 3B5NA 1WJAA 3OU7A 5E8RA 1ID1A 1RM0A 4RB2C 3MQ2A 1RQRA 3CLRC 3MWLA 1EJ0A 1U7ZA 1KH1A 3H87A 4MGEA 2P77A 3WLSA 1IDOA 2BBOA 1FS0E 5TVKA 3H0GJ 4CEJA 5CVCA 2VC1A 2FRXA 721PA 4G0QA 2X6WA 3VHLB 3EY9A 5DJUB 3R09A 3VKGA 2M1XA 4G0YA 1G20B 1RPTA 2YN0A 2KLVA 5BNZA 5DTMA 4ENUA 4CQMB 1LC0A 3K0SA 3C6KA 4Y6OA 2W6AA 2IPOA 2ZFCA 2VHUA 3INGA 3EG9A 4TRMA 1ABBA 3ESWB 3U4QA 4RTKA 1VLMA 4NU5A 2P6MA 2Q21A 4BU2A 1FAVA 4INZA 1HM5A 3E7WA 2X7XA 1Y8ZA 3OL3A 1I33A 1EJ9A 3TTSA 2V4ZA 3I8XA 4PG5A 3GCMA 4YLEA 4ZZ0A 3A7EA 4R4MA 1PG2A 4GOMD 1SA0B 4CIDA 2BKEA 1OIWA 5IEBA 3HDJA 2A0YA 5KYXA 2XU6A 3TQTA 1JH9A 4XSZF 2PWAA 2BCCE 2DP4E 1XDDA 2O8BB 3LIIA 3WJAA 5ALDA 1VPVA 2H43A 5HK8A 5A0VA 1JTHA 4R81A 4HAZA 2OECA 2E1MB 3BJ6A 3GNTA 3G8AA 1PP9D 2XR1A 3RU3A 1D9XA 4D7AA 1LT9A 5DGXA 5ITWA 1ZXBA 3P26A 1U98A 4E7IA 3ZR4B 1G8PA 4KWCA 4WBNB 5AVSB 1KJ8A 4P81A 1W35A 5J47A 5B1EA 1QK3A 2B7EA 4DIEA 3L2RA 5AVXA 3M6XA 3RYFA 1ZM7A 2WJ3A 3C2QA 4M0CA 2XAJA 1N73B 3EFOA 3E9CA 1ZHOA 3VOTA 5LMZA 4CG1A 2W2TA 4B85A 1N6PA 5JXIA 4AIKA 1BVUA 3JQBA 3L06A 1F0YA 2PZEA 1T8UA 3E97A 3WFZA 1EIZA 3DV2A 1A1VA 3NRVA 1VL0A 1SQSA 3O4VA 2VCEA 5T3UA 3OSGA 4QVKA 4QULA 2XLBA 2QRKA 1AT1A 4RZQA 1NIJA 1XTZA 4FI3F 1JT6A 2BDTA 3BHJA 4L0CA 3TRKA 3CLKA 1U9NA 5ER6A 4CMJA 2VS1A 4RZUA 3GFSA 4M8KA 4NS4A 1KEKA 4CM8B 4TSFD 4GXNA 4RS4A 4Y15A 4CKBA 3KQGA 4CV0A 2MR6A 3L70G 5L3FA 4BBPA 1Q77A 2NVWA 4B5LA 1XD8A 3FWZA 4X9XA 2C31A 2D7JA 1X79B 3EFHA 5CTAA 1P60A 4F6RA 3QYJA 4Q5SF 1U04A 1FFCA 4G65A 4C2BA 3U4CA 1RWWA 5DIZA 4CYMA 2B9VA 4ZKEA 5K0ZA 5BMVF 3ETNA 4AUWA 4H13B 1R6VA 1M8PA 5EQDA 4YCSA 5FQOA 1HW5A 3U0BA 5FOVA 2P6NA 2RCYA 2ECKA 3W90A 4C0WA 4XSHA 3N0VA 1VQ8I 1JFFB 3LGXA 3JRNA 5ADVA 2P4EA 4QUIA 3AEKB 4EM0B 2G1AA 5CTJA 1FU7A 4BV8A 1BH2A 1SKYB 1PKXA 3O0TA 3WGNA 2FEPA 4X3CA 4C5AA 3L71E 3PFHA 1D4AA 4RY8A 5FNVB 4KTTE 4NCJA 2JFYA 1SQQE 3U37A 3H9JA 2TMDA 3ZHUA 2FMLA 3K9QO 1Q5PA 2K85A 3DT6A 3S1LA 1Y6GA 1GQ2A 3A1CA 4R8KA 1RRKA 5IN4A 4L51A 5CLHA 1JG2A 3ZHTA 1RPAA 4DCMA 2ATXA 3ZR8X 2ZTVA 2FEXA 2NPIA 1IIRA 2IL1A 2GJ9A 1EVJA 1RZVA 4FOPA 4KKXB 3GVIA 1LTBC 3GPIA 4DLRA 4P93A 3OOPA 4Z1OA 2PO5A 1YCHA 2H4WA 4O4HA 1JVNA 1U2RA 1H8AC 4JP0A 4Y2RA 3JZFA 1HO3A 4ZOCA 4OOIA 1A5AB 4N8SA 4B6OA 1BU8A 2IXDA 7MHTA 1KETA 4DL9A 1YO5C 1SUCA 4BNZA 1ACMA 3HFSA 3GJTA 1KOFA 1VQ8P 1CUFA 4UMEA 3SCZA 3VV2A 2XHZA 3MUEA 3P8MC 3K0CC 5CDFE 5ICEA 5FLXZ 2ODEA 1XEWX 4ALNA 3ADBA 3JQ8A 2YZ2A 1WLYA 2O1EA 4NBUA 1FSEA 5EUMA 3ACDA 2GA9A 3R5HA 3DU5A 5D4SA 1YQ3C 2V7WA 3D6TB 4BTLA 4WN9A 3NYQA 1YDGA 2H5EA 3JVUA 3MJ4A 2ZPAA 1N2BA 1UBOS 2GUVA 4K05A 2LCIA 4FYWA 1DX7A 1CWUA 2BW3B 3EVNA 1YZNA 1BE3J 1OZAA 4BMZA 1QQ7A 2A14A 3JD4A 3QVMA 2FK8A 2V9VA 1TTQB 1X80B 4FDUA 2DX7A 3U5ZB 5EZHA 3HDQA 5AVKA 2FFAA 4B3FX 4OAYA 2FUCA 1NAIA 4K8OA 3R7AA 2JPCA 4Z54A 3NTXA 1TIPA 2QLTA 3O3KA 1OOEA 2R85A 4LD5A 4RA2A 1WU8A 2E34A 1IN6A 2OCGA 3HL4A 1SQBE 1PLJA 3ZVMA 3GLKA 3WKDA 2GZHA 4UTNA 2VSYA 5JJLA 3HSFA 3VSDA 3QLEA 4RVUA 5HRAA 5HKAA 5BVGB 1N2EA 1JR3A 4M0LA 2O1SA 3QVTA 1HQCA 2Z6QA 3KQYA 1PEKE 5HF9A 3D6MA 1ZD2P 1KU2A 4YAUA 3A6PC 2PE5A 4EGSA 4W7IA 4UBIA 3MS7A 4QLAA 4UTPA 4K86A 5KWVA 5ALOA 2I2FA 2EX4A 4J3JA 2I65A 1ZP0C 3TG2A 1SBYA 2PZMA 1ETHA 4EA8A 3UXEA 1JT0A 4LXUA 4DZZA 2VUUA 3TNDA 2IS4A 1YZGA 4I66A 4AY5A 4LITA 3GOHA 1PDNC 1MUUA 2E3JA 2GCGA 5J2TB 4AP5A 2OYSA 4PJLA 3LQFA 1XGNA 2AMVA 2HQNA 3MZ8A 2Q2VA 2Y67A 5CYPA 2DHCA 1MU0A 3DLTA 4BQIA 3BE5A 4AMGA 4QDOA 3I4FA 1QLJA 1VL1A 2ZJOA 5AW0B 5K3OA 5CDFA 3OIQA 3V4GA 4JMPA 1W4BA 5ALRA 1I3QJ 4QFCA 3RL0B 3KR1A 4D3XA 5IMBA 3JW4A 2M8RA 2LKMA 4XTRA 3QVUA 3HRSA 1PHRA 2VZ9A 3ETDA 2JLZA 4QODA 4CDNA 3NXKA 4NFLA 1RBYA 3S2FA 3ZV4A 2VK8A 4G5YA 3TS1A 5EC8A 4INAA 3P0RA 3ZWMA 1U28A 5BV7A 1QCYA 5F0FA 1Z2DA 1S2LA 3BN3A 5BRJA 2NYUA 4PNZA 1EUCA 2AOXA 5CX1B 1L4FA 4KBGA 3Q9UA 1I9CA 4KLAA 2HDWA 3K70C 2WICA 4DG9A 4W5WA 1ECLA 1RTTA 4IIXA 2QP3A 3AR7A 2IXSA 4LK2A 2WT8A 2GM9A 1TLTA 3D1NI 4P83A 5HJEA 4DRXA 3VAYA 3MJCA 4OB6A 1C29B 1NJ1A 2V6BA 1R6BX 1ZY2A 1QZ3A 1FLNA 1QBKC 3CRZA 4H1WA 1GEGA 1BWPA 2FPKA 2BOLA 3PHHA 4H0LB 4GI5A 4IR7A 1P81A 3GRZA 4BNTA 2EHDA 4RF4A 1A8SA 3PENA 2C7PA 2C9OA 1A6QA 4U9UA 3WRXA 3KUDA 1JFRA 2VOOA 2Z8YA 2G9RA 4KAFA 1QF9A 1T3GA 4DM3A 2A9QA 4EM6A 1CVLA 4OBEA 3L00A 3HFJA 5FBWB 3DTEA 4EB6B 1XFAA 1NF2A 3L6OO 1XLUA 2W83A 3ZZMA 3L8EA 1BEEA 2ZWOA 5LOVB 3LUCA 3GW2A 4LNAA 2HBZA 4QDJA 3IUSA 3IMEA 4PPGA 1WXWA 2YNMA 1FFXA 4YPCA 1HOMA 4N76A 2G72A 5LN1A 2F8TA 3PQ3A 4BNHA 1E99A 4KE6A 3CCSI 1Q0LA 1H4VB 3U5TA 2L0KA 1BN7A 3A9WA 5AUQA 2RAEA 1Y56A 4K9MA 3CJRB 2HU7A 2P0AA 3ERCA 4NNPA 1WDMA 2P35A 1NXQA 2PKQO 4ZV7A 2Z9OA 3RZOJ 4C4PA 4KQFA 4EGFA 1FJKA 4DBRA 4GPZA 1NT2A 3MZYA 5F1YA 1KKLA 1OAKA 2PV0A 5EQJB 1L1QA 4IQ8A 1P5JA 4OHKA 1L3LA 2PUWA 1E6UA 1DUXC 4E03A 3K5WA 3TDMA 1GAQA 3NDRA 2Y1WA 3IF4A 3OX1A 5AM5A 3JR3A 1ODJA 4QAJA 2DQRA 2ACEA 3L7JA 4QICA 4L08A 9LDBA 1G9XA 3FKSD 2QLFA 1TA4A 2DFEA 5K0EA 4Z0HO 2SECE 1LEBA 3RABA 3OFJA 2H54A 4EYOA 4ASNA 2QMEA 1QDUA 1A27A 1JHMA 2B8EA 1EINA 3Q11A 1XTCC 1HTWA 1PT7A 2ONYA 2J0VA 2R1ZA 4KDFA 5JJCA 5EMKA 1H8HD 3BQNB 1JCCA 2IW1A 1RHMA 5DM2A 4BZZA 3WLHA 2C9BA 5H68A 2OM2A 3TZ6A 1R8XA 3DBLA 5EGOB 3TLEA 4E13A 3K9TA 3BTOA 4WGGA 3VPBA 2ITAA 1AURA 5BQTA 1SCDA 3PUHA 3TSOA 3ESYA 4GZ6A 4X1KB 3EA4A 1Z0SA 2VDQB 5HEKA 3QEMB 1NZJA 4BRZA 1ZK4A 3NG1A 1U3FA 3HJGA 2JLCA 3W2GA 3KT6A 2A5GA 3HOZJ 2QQ0A 4UB8C 2X4GA 3MILA 1M0WA 4JYPA 4KUHA 4DY6A 3RYCA 4C3OB 3VOSA 3GAFA 2BZSA 1BMFA 2R32A 3HHEA 4WCFB 1QQIA 1XAJA 1G3SA 4ALJA 1JMYA 1T8IA 2E76D 3IX7A 4RK0A 5ITZB 4IXTA 3BIWA 2XGMA 3K35A 3FXLA 4K9LA 2P78A 2VF8A 1ACJA 3B5JA 2YWHA 1JY3O 1RZ4A 4HLQB 5FTWA 3LQ4A 4UBJA 4ZV9A 4MKXA 4B6PA 1PP9J 2FPSA 3L1KA 2PGLA 3TZKA 5APWA 1GVHA 3H92A 2CS3A 1ID8A 4D56A 1VL8A 4D0RA 2J09A 4BJ5A 4FYXA 4DSTA 2XB5A 1JMBA 2FW6A 3UUGA 5HKKD 2XQFA 4MWCA 2FN4A 2O8FB 5AW6B 2ANBA 3OPYA 4WXEA 5KVQA 3RK2D 2FETA 1NPDA 4OLFA 3BROA 1C9NA 3PXEA 1HE3A 1HA8A 5LSAA 4LFAB 2DR3A 3ZMTA 1B16A 3B13B 4OHRA 2ZVDA 5FADA 4P34A 5JZVA 3IDZA 4NCNA 1RXVA 2XIJA 1I2DA 3BORA 5I4BA 3SWWA 4ZYHA 5KNBH 5IULC 4IIJA 3O2JA 2J5UA 5CCDA 2H2IA 5K0SA 4QRHA 4EPYA 3TPFA 2RHRA 2AYXA 3NETA 1YT5A 3H1ID 3BZUA 5KTYA 1X1EA 1XKXA 1KYTA 4GXRA 3GAZA 4E7ZA 2YYZA 2C5GA 1VNDA 2QN3A 4QIHA 2EK5A 3V2HA 3L43A 4S24A 1DEEG 4HRYA 4UM7A 2OTLI 5IFLA 2WIDA 1II8B 3OQNA 2ZU6A 2ZT9C 3GR6A 2OP0A 2QRLA 4KMRA 1ML4A 1EDOA 4LDNA 1URQA 2A94A 1YHYA 1VE9A 2FQ3A 3N75A 2C1EA 3RVDA 1MN6A 1RWVA 3C3CA 3OQMA 5FLYA 3KKQA 5CA1A 2PH5A 3PSFA 2EFQA 1A4UA 3A01A 1TM1E 2ZPTX 4CETA 4GMDA 5IS2A 3C18A 1S7OA 3TRJA 1Q81Q 4PWZA 3I6IA 3A4LA 3QU5A 4BO2A 3I58A 4B3IA 1XYGA 3HYIA 4G5HA 4IO9F 1WX1A 1F8UA 4B83A 3AHDA 1AA9A 3ABLH 3UWPA 1HDDC 1GTVA 1Y37A 3MKZA 4IKEA 3WS7A 3C2GA 4ER3A 1JLLB 4V2UA 5KTBA 4Q9KA 1VLZA 4X66B 1WKBA 4W7YA 2WUFA 4KRGA 3BXEA 3CSSA 3ND9A 3OFKA 3EZ2A 2G7ZA 5HLTA 3GTOJ 2H8KA 3PQ6A 3D2CA 5IX8A 3VNVA 4UV9A 2JC3A 3I1FA 1GTSA 3G1LA 2QLMA 4LMBA 1K8AQ 1D8JA 1H2EA 1B0PA 1ZVJA 3TLBA 3S17J 4GLFA 2ET6A 3SOPA 2BXZA 1I2BA 2WJ6A 1DQUA 3ECCA 2OTLP 3RIHA 1Z7GA 1N1EA 3EXAA 5BR8B 3LUBA 5FBVB 1E9FA 3DPUA 2HLDA 2JK0A 1XMIA 4NTZA 3CLTC 4LRWA 3RAFC 1QU2A 3REGA 1ETOA 6CHYA 4I99A 4AYXA 1AXRA 3ORYA 1AQ5A 4CNBA 1CUVA 2X0LA 1V1RB 3OCCA 4YRBA 1NM5A 2J9FB 1Y1LA 1CDEA 4KR0A 3D2AA 1YOBA 3V1LA 1G6NA 1XAHA 4BJ6A 2BFAA 1OSNA 1EX6A 3MJVA 2X1CA 2E5WA 3PUYA 2XEXA 4ESBA 1ARZA 1L4AC 1R7RA 1RWBA 4OOFA 3RYIA 2C78A 2X86A 3E1IA 1CUSA 1M34B 4OKSA 1VSQA 2Y1GA 3OY9A 2HFED 1GTZA 3PWZA 4XWTA 1VHDA 3GELA 5AKZA 2JAQA 1KI7A 2Z2SB 3MQ4A 2VASA 3Q7SA 3BK1A 3GY0A 4PHCA 4TVOA 3L7YA 4TV8F 5EMLA 5EE0A 1YRWA 1XMQB 4NE7A 4Z86A 1F8FA 2H1CA 5AOAA 3A9CA 3VR5H 1M72A 3ZZTA 2VJQA 1BXGB 1FTGA 1YE8A 2FQYA 1WCIA 1T56A 4BQEA 3ABIA 4LDAA 4R8SA 5JCJD 4DMMA 1IG3A 3T1HB 3GLFE 2VFAA 2H7XA 1IO2A 4B4OA 1EDIA 5AJVB 3H5AA 4IV8A 1VMAA 4LK3A 1Z33A 4FLMA 4Y98A 2AQHA 4LQDA 2JFPA 3K4KA 2BGIA 3OF3A 5IZ4A 4P3OA 1DB3A 1H2HA 1QPZA 4TS3A 2G08A 2DTEA 3DT8A 4EQZA 1PR0A 1V4NA 2WJJA 2MFZA 1QANA 2HY7A 4CIAA 1UKYA 4HGYA 3RK1A 1C3JA 1JXAA 4DLWA 3BIOA 3LUDA 2VKHA 5AW7B 2FWMX 1QKJA 2KB7P 1BM9A 1VLJA 4QGGA 3DM9B 2O3JA 2QD4A 4BV2A 2XUDA 1OYWA 2ERXA 5EQTA 1CYDA 3RSFA 4OGWA 2WWHA 1PUEE 3BTCA 1O6BA 2WKQA 3UMGA 5FHRA 3D8BA 4DYQA 5HM6A 3W9BA 1ZRCA 1PQ4A 3AMVA 4JP3A 1JE1A 4BN4A 3DZ8A 5IWCA 1J5YA 5B5EC 5T4FA 3DXFA 1UCFA 1GCGA 4YMSA 3E9EA 4FONA 1BX0A 3WWYA 5LUAA 4MW7A 1G8XA 2HCBA 4DW8A 4LPSA 4ZRMA 1NBHA 2H4JA 1FQWA 4YH1A 2QMZA 2COUA 2B8JA 4Y2VA 1F0PA 3LMKA 2Y6VA 2PUDA 2QUHA 1PVDA 1ATIA 1O5OA 2VDMB 3VOPA 2Y92A 2NO4A 1GL9B 5KI6A 4KHPB 4P7JA 1MRSA 1FVOA 2FPGA 4MVJH 3THXB 4M83A 2JGMA 3UV6A 2WR8A 3NTLA 4X1IA 1QH8A 3MWDA 4LZJA 2AI2A 4ZALA 1YC5A 4GIBA 2I2WA 1SD2A 4X20A 5LR6A 4Q16A 5BR4A 3ZC3A 1A9ZA 1B9MA 3JQRA 4IXMA 4IX9A 1ONBA 3OTIA 2A06E 3LL7A 1C1YA 2XCIA 4MW2A 2PL3A 3ZWPA 3WTWC 1W4AA 5ESDA 3ZH2A 2YSRA 1AMOA 4E7LA 1J7JA 1WDWB 4BLUA 2AR7A 5DBIA 2CHFA 2QORA 2H6CA 4G23A 2W4SA 2ZS7A 2ZYUX 1PGNA 3I04A 2CK3D 2YIJA 3ROMA 1QSGA 3JAKA 2D5IA 3R8XA 5IU6A 2VATA 1OPCA 2BHSA 1D1CA 3ZQKA 3U7GA 3KETA 1ECPA 3NTQA 2DFVA 4BNYA 5D5UB 1RWQA 2XH8A 2JAXA 4QFBA 2D0PB 3H11B 4GZ3A 4L57A 1RJGA 5D3KA 2VOJA 2E74B 4BLQA 4ZEMA 1Y1VJ 5BOSA 4EKYA 1J8VA 2A9RA 4AIJA 1FQOA 1BW5A 1KILE 3RVBA 4FMBB 3RIXA 1XZFA 2VAPA 2VPIA 3GFOA 4RFSB 2N1BA 3BFXA 2J5PA 3SMVA 3WC4A 3OQVA 4Z5XA 5CNJA 1NDUA 3MUNA 4RD4A 3LPAA 2JJ2A 1XNHA 3DTYA 1T15A 1ZGHA 3FM9A 4OMUA 1VPLA 3EBLA 3EGDB 3R5FA 2DOAA 1UJCA 5EUBA 4NS1A 2FAXA 3R9XB 4NJEB 1RI3A 5IKXA 3K9CA 3WKBA 2AL7A 3GLGB 4HZUA 1CY4A 3NYIA 5A4DA 4RDXA 2Z6VA 4DB4A 1A36A 2OY0A 3O5AA 2XKOA 5M5BA 2C00A 5ENVA 3A7OA 5AW2A 2F4MB 2AEEA 5SY6A 2K37A 2X8JA 3UK2A 4XD7A 3ZQ4A 3I59A 3PT9A 4N48A 4IHSA 4JI3B 1CQJB 1NSFA 1YI1A 2PMBA 1LBHA 3WBFA 1N5JA 3RGUA 1OLSA 1AQJA 4GLLA 4UOZA 4E3ZA 3OZUA 4JJIA 1ELOA 3MEXA 3GJ3A 3B6KA 2M7AA 4I9UA 4RZHA 1O94A 2GKGA 1IB0A 2QTCA 3WLMA 5LLTA 3C3DA 4MGKR 3SC6A 4C0HA 2NPSD 2ZYHA 1UG2A 1UBUS 4UUNA 4RVFA 4BFLA 2OAGA 4WV3A 5E3NA 1J90A 1VM6A 1OCTC 1U94A 2LD5A 2FA9A 4OQFA 3GZNA 1QGYA 1RZUA 1FUKA 2EP8A 3FYUC 2MSLA 4DLNA 3K0FA 4O4JF 2OCAA 4FBMA 1BQ3A 4XKJA 3TYYA 2QAJA 2WWIA 3U3OA 1ZH2A 4RV9A 1YITI 5JWOA 4H6VA 2M0CA 4NOKA 4QPNA 4NYMR 3I5XA 1B6GA 1AN9A 1LV7A 1UT6A 2CLCX 4TKUB 2YS7A 2V45A 5JRJA 1YBMA 5C0OE 1KB9I 3BMOA 1IK6A 3IV6A 3BE4A 4BP8A 3X3HA 3X1KA 5GJCA 2HDOA 2YWDA 1KILA 2WYUA 5K6AA 2N42A 4Y33A 1RHRA 3E61A 1AA6A 4XMYA 1JNMA 1XBTA 4LHEA 5IYZF 2GBCA 1X74A 4LRSB 2YVLA 4WQMA 1RF1C 4D7MA 4GMXA 4OKNA 3VKFA 5T64A 1QC5B 4UTXA 1D09A 4L5JA 1QVFO 1KMIY 1G7TA 4PX9A 1XG5A 1NRIA 1XGKA 4G1BA 5E18F 3DPIA 3BREA 4MR7B 3AOEC 3TL3A 5GZ6A 2O06A 3NLLA 2FUG2 5JNUA 2IVMA 3C3MA 4J9VA 1IQ0A 1OQYA 1YK0A 4HXGA 3RU9A 2J67A 1UDRA 2HA6A 1POXA 1R27A 4RL6A 4K26A 2Z8ZA 3P0FA 3E6DA 2LKSA 1N3BA 4A0RA 3S14J 1YITP 1RXYA 2OYIA 4BC0A 2I9PA 3CWBE 2RGGA 4U7DA 1UDAA 1E9BA 5DYIA 3RUPA 2YXEA 4XB1A 3QIAA 1W8DA 1S7GA 1YTZT 2XTJA 5G40A 1Q7GA 3KSDO 4LDQA 4IG4A 4N3AA 1L5ZA 5IC5A 5T6MA 1WZEA 1ZK1A 2R00C 3ITEA 1F6BA 4DIUA 3M33A 1NJIQ 1XEXB 3SSAA 1ZM3A 1I4EB 3CLSD 4HQ6A 4N18A 3WIEA 4DS3A 5AK4A 5E3JA 5DLQC 2Q3EA 4LGWA 2ZMEC 5CNMA 4YJ2B 2NSYA 4DIBA 2A7QA 3OTOB 1X92A 3OYEA 3M81A 1E7QA 4DLVA 5EP1A 4KQJA 1QFSA 3BRTB 1YFKA 2QMQA 2QRUA 1OFIA 3CQZJ 3JY6A 3K1AB 3H1IJ 2AJ8A 2DBZA 1BOFA 3A14A 3MIZA 5A05A 4DA9A 3FG9A 4KNVA 2OGSA 3K1ZA 5KMGB 4BMYA 3HDYA 3E0JB 4J6EA 4ALLA 4UDNA 3HQ4O 1VKOA 5J1YA 4C6RA 1FIAA 1QB8A 4M6WB 1OVMA 4XJSA 3H16A 2WA0A 5JI3E 1ZLLA 1ICEA 4W5OA 3P5SA 1XXHB 4TT3H 3F8NA 4CCKA 3IEIA 4E30A 4MLDA 5TJ9A 4P9FA 1NAHA 5AVWA 4ZYXA 2X19A 1N7SA 2BE5F 1O97D 5B1DA 3WBKA 3TNUB 1AGXA 4F21A 2WDZA 2GB4A 3PIRA 4IDCA 2M5WA 1ZESA 2D4AA 3FIJA 3R3HA 2QRPA 5CEJA 2ID6A 4LSWA 4GXQA 5ALIA 3QX9A 4XYBA 1YASA 2EGGA 3HUGA 2NVUA 4ZK2A 2XRZA 4UCWA 5GZ1A 1N6NA 2QY6A 5LBTA 1QUEA 1CGPA 4ZT2A 1NUQA 2HB6A 4MLCA 4YRZA 1WV0A 3TRDA 1H8EA 4K46A 2WYHA 1YC2A 5CLJA 5DLEA 1B4DA 5F2NA 4FX2A 1UH5A 3CZ6A 1KC1A 3ROUA 2XGCA 3VAAA 2AO9A 2CNNA 3HJNA 3DE6X 5DYYA 1TVKA 3QVJA 2F6CA 4HAWA 5EJ2A 1MP0A 4UPEA 3WBBA 2EZUA 1J0EA 3B2NA 1S2MA 2HA0A 1JQBA 1TO1E 3QHPA 4D1YA 4MRPA 1QL1A 5B66E 4PZYA 3DE0X 1SMKA 1TO6A 4B34A 3DMFA 2D2FA 4QBFA 3SYRA 3LCMA 3QP6A 3NGMA 1T4GA 1X7ZA 4D44A 1Y8RB 5FPQA 5E9WA 3OT1B 4IFTA 4QX6A 4YMTA 1L0LG 4DPKA 5FX2A 1KU9A 4KN7X 3I55I 1VA4A 1GU4A 3OUTA 1YB2A 1M7LA 1VIYA 2GQQA 2F3RA 3THWA 1PL6A 3T9AA 3U39A 3QX3A 1WVMA 1HEUA 3WLKX 4BTVA 5BN4A 4NENB 1VMKA 5KTNA 2EFHB 4QFDA 2QR3A 3OZGA 5CH5A 4R41A 1WD7A 2V54A 1SQPK 1E17A 2JCSA 1NJGA 2CFRA 2C57A 4TTAA 4KQGA 3DHNA 1X86B 4ZCLA 3E23A 3K0EA 4XRSG 3UJCA 1X70A 1L7AA 1P7CA 5K8JB 2CPBA 2JJQA 4WNIA 1C9MA 3DVQX 5EFOA 5LXTB 2X5XA 5FLVA 3RHFA 3IUOA 2HDNB 1WXIA 4XFDA 1RZRA 4UM9D 1ZVMA 1DKNA 4XX0B 2NMVA 3N70A 1MZ9A 2EIXA 2GAJA 4DARA 5GV7A 4ABZA 4PCVA 1CV2A 3ENWA 2PKXA 3QBVA 1CUGA 2WWXA 3V4WA 4CCOA 5D1HA 1L5HB 4QWMA 5KOHB 1GUUA 2EFCB 1PS8A 3MT9A 3Q8WA 1ZBQA 2PJPA 4ZZ3A 3TINA 1F4LA 3I55P 3L75G 3CMYA 2HR1A 1W36B 4G84A 3MAJA 2ZR8A 3AG2H 3X1XA 3FHTA 1MD9A 3W6ZA 2W4QA 1ZOYC 4RGSA 3DQZA 1Z25A 1MNEA 4LVOA 3TTTA 3DZFA 4CGYA 1I39A 1NXXA 1E2HA 2GN2A 3LDGA 5JZBA 1MDMB 1LTKA 4CRWB 3RT9A 1CQWA 1L8QA 1E3HA 4W97A 1Z6AA 5L7WA 5ECWA 1MEOA 3KFWX 3GUVA 1C50A 5T7BA 4AG3A 1Q0RA 2FWIA 5G1NA 4I55B 1OLXB 4TS4A 2VDJA 4Q4HA 3KIPA 1BG6A 5B2FA 4UVCA 7MDHA 4PZCA 3MZWB 1UADA 2NO7A 4DC9A 5F27A 1EA3A 4GW3A 2WM2A 4NAVA 2WHEA 4FB5A 5HIAA 4DNPA 1NTMD 1NVTA 3CCLI 3S2HJ 3W5HA 4IWXA 3FY4A 3UAYA 3DMTA 1A50B 2ZVJA 2AUMA 1ZCZA 3S2DJ 1Q1BA 3MINB 3UK7A 1UT8A 1QRDA 3C7KA 1D5VA 2IHTA 5KDOA 4PVDA 2CQKA 1WXEA 1UM9B 3EUWA 3A3OA 1E5QA 1E0SA 4CI9A 3RKQA 1TTTA 6REQA 1UWLA 3M07A 1OI4A 4PZEA 1XSEA 2EJBA 3DEJA 1W94A 3LNTA 5HIJA 5KQPA 2PEXA 2P1DA 3SZ3A 3W9SA 3C1AA 4O4HF 5AW8A 5F9FA 3B8EB 1K7AA 1GPMA 3TUIC 1QAMA 4X0GA 3T4XA 3W06A 3KXDA 1Y1RA 4CM4B 4DDWA 5TQ0A 2HGZA 2N1TB 1J39A 5GP1A 1PNQA 2CMHA 4D98A 1QZEA 1N5IA 5KYYA 1ORTA 4A3CJ 2YV1A 1QHYA 3NGXA 3O82A 1QF6A 1ST3A 2WSMA 3RHSA 1E3LA 1I6KA 2CGPA 2WD9A 2BMDA 1RAFA 1JUDA 4W9MC 2NSJA 3VNAA 3AIIA 1D1AA 3TI9A 4OXYA 1W87A 1XRPA 4HH0A 3BTLA 2G25A 4BKXA 3CW8X 3BC1A 4V38A 4EHBA 4L0ZB 3WMWA 3H1PA 4BN0A 2VE8A 2QAGC 3W3AH 1OREA 1L8LA 4YRCA 3MVPA 3KL4A 3RVJA 2VAVA 3TQFA 3RE1A 3CCLP 2QT9A 4EF6A 1DTEA 2UXXA 1PYOA 5KAFC 3FD8A 1LDDA 1IAWA 4CT0A 1JEQB 4D9FA 2Y2UA 5TV2A 5AXCA 3VHXA 1JEYB 1AZWA 4D4LA 3OU6A 1CEYA 3N2EA 4EKEA 2WIKA 4Y3OA 3RIYA 3N2KB 3QEJA 1O96A 2GNAA 2XGJA 2QJPC 3P9QA 2ASVA 5C8VA 3ZDCA 4XQEA 2A4MA 1LS1A 2Z2JA 2O5CA 1VBMA 1AU7A 3CINA 3BMQA 1EXNA 3AINA 3FUXA 2OO7A 3HTXA 3W7BA 5J1SB 4UB6H 1CF7B 1TZJA 1Y4AE 1SGWA 2AXNA 3KKNA 3E3NA 1UMCB 1V55H 3NZEA 4PRYA 2HTJA 3FPEA 1GZ4A 2RAUA 3L73E 2ZJ6A 4YRNA 4YAFA 1C4WA 1IY2A 2PYDA 1R5HA 3TXAA 5LDDC 1NJ5A 4PSXA 3FETA 4L8FA 3VHRA 1FFHA 4RHUA 3PFWO 2OVBA 2H1OA 3TK1A 3VYTB 4XQGA 1JEAA 4LXHA 3KNZA 1NPYA 1LKXA 3PD1A 3MC1A 3PLAE 1VIVA 1KC8Q 1M1JC 3CKYA 1L5MA 3K6JA 4F38A 3EY4A 4KICA 3CUKA 5CT5A 4PVCA 1ESEA 2P81A 3LHFA 3NYWA 3OPXA 2EA4A 2KPOA 5G3ZA 4YXWA 4PNHA 2BAGA 4Q6WA 3VYVA 1I1GA 1EQUA 2CFOA 3G9RA 4RHXA 3V9AA 2KIFA 4R40A 1GNVA 3ZWOA 2JKVA 5DXFA 5JNTA 5CCBA 2YMKA 1YNSA 4KT5C 4ZVVA 3JASB 4I7ZC 2CEKA 3TIXB 1B43A 1TWFJ 4N78D 3I5CA 5H82A 2RHHA 1UHMA 2PBZA 3Q12A 4JB8A 2WILA 4RQBA 5E7JA 3ABMH 4KR6A 3ER8A 2RQPA 2PLWA 4KFRA 5CM8B 3WIVA 5FL3A 4HDAA 4LYGA 3DTKA 3NHZA 4EAQA 221PA 2IP4A 3HDDA 4DQ2A 3KQLA 3X1MA 2GPAA 2VBIA 5GP9A 1EJ2A 5EMNA 2FBIA 1MSEC 2FXOA 4D74A 3RCOA 1X7WB 3IPLA 4A3DJ 3ILHA 3WBJA 1N2OA 1ODDA 1ETYA 5KQRA 4RKYA 1KYOH 1OFCX 5DEQA 2A1UA 3URMA 2VHXA 1GUFA 4D0LB 4Q21A 1M2OA 4EKDA 3T4PA 2RJ3A 3ZWAA 4E7JA 1ZUNB 5G4KB 2Q9UA 4C20A 2RI0A 4R1TA 5L7YA 2H9YA 2WAOA 2QTHA 1GPKA 3WODF 4J91A 4U2BA 1IJEA 4XL9A 2WIBA 3EIQA 1BE1A 1P5HA 3MZ0A 4RULA 1V5IA 4AUNA 1UXHA 3TZCA 1HNNA 2PJRB 3PF9A 3RDPA 3NJRA 3A2MA 1O8CA 3O83A 1KYZA 3G7SA 2IYTA 1JA1A 5CLFA 4OI2A 3DTVD 4H77A 1Q0PA 1ZH5A 1GXSB 3C1UA 5FKKA 1D0ZA 4WVZA 1QH1B 4MEAA 1PEDA 1ZC3A 4IJVA 1FJGB 2QNIA 2F1KA 4ZI3A 1JGTA 1EU1A 3GCDA 1DIPA 1KTVA 3NCTA 1N7IA 1VFCA 1GQRA 1PD0A 4ZI5A 1LBQA 2GMWA 4ZOQI 1GPWB 4MV9A 2CWDA 3WNCA 1IRXA 2F1RA 4L9TA 4MRNA 1LSJA 4BAUA 2QD3A 4MGIR 2GM4A 1DX9A 1H69A 1UBCA 1Q0TA 3TAHA 1EX9A 4FCCA 2GXSA 2CPSA 3H4VA 3AJDA 4AQRD 4MEBA 2F3SA 1KXZA 3P9ZA 5T8KA 3VXKA 1HMPA 4EI2A 1GYRA 3LSPA 1XU4A 4HLCA 1E5LA 5KJ7C 3RNOA 1P9NA 5DDGA 2UZ1A 3W8EA 1N2CB 5EF6A 3DD5A 2X4HA 1Q17A 1O2DA 3FNHA 3AERB 4OHXA 4R8RA 1KI4A 1ZO8A 4DMUB 2XMZA 3E7XA 2Q3MA 3NGLA 2R6R1 3M7IA 3MMZA 4IY1A 4XKBA 1PFYA 4BUPA 4HYEA 5CBOA 4JL8A 4CVNA 4KLNA 3PI6A 1I94B 2JJ8A 3JWEA 3K69A 3QE4A 4MB6A 1RJEA 5EE1A 1ORRA 3FXJA 4BE4A 4CG0A 3N8IA 1N6HA 3F3MA 2VQFB 5SYMA 2LCQA 4YMLA 4MX8A 4AN0A 4IRMA 5KAIE 3IJ5A 1IMOA 2D5LA 3KQUA 3S2YA 2BONA 4OGQC 4G8XA 3A0HC 2CNWA 1JNYA 4NG4A 5AKJA 4KE8A 2JI4A 4XVQA 3VPGA 3LK7A 2HPCA 4WK6A 3HTKA 4RMHA 2XNHA 2BGWA 4HJGH 2WW8A 2WLTA 1ZVVA 1QRUA 3RLFA 1QHNA 1FSFA 3ESBA 2H1FA 2R6AA 3F7OA 3OLZA 4MRAA 1PGQA 2DH6A 3L82B 2IUSA 4X1OA 5EERA 1N2HA 1L7BA 4ND1A 3BKXA 4HDNB 3W5AA 4IMJB 2TRTA 4MHSA 4CFZA 3GLXA 3FNBA 1H6AA 2TMKA 2V7QD 3ROPA 4EJFA 1SUIA 2ZWMA 3BP8A 2RONA 1MGTA 4UOQA 3FMSA 1GDTA 5AI0A 4CCLA 4ESJA 3ZQ7A 5I9LA 4W5HA 3I6ZA 3ZEIA 1WOMA 2IDZA 1NWCA 3G7NA 1EE2A 2VYVD 5K0LA 1DBVO 4FDVA 4G24A 2A33A 1MH9A 2H63A 2I29A 3N1UA 1YBVA 3VSAA 4N5HX 3LT2A 3TQQA 1Y1QA 5JAMA 4J0QA 4XORA 5IKPA 2YWRA 3WNBA 3TPCA 5JADA 4EG4A 5ERIA 5FIUA 2G6BA 3INNA 3RQ4A 1JPVA 6ADHA 4LXYA 5J3JA 2LC2A 4Q1DA 2I3DA 3QAHA 4MO7A 1RVDA 4BNKA 1CDDA 3IALA 1ZG1A 5HF6A 3V4ZA 4C06A 3DMGA 3QPHA 3GJYA 4R54A 2GZAA 5LZ8A 3M3DA 4PYQA 4NXNB 5KNCH 1Z15A 3EZXA 3HVKA 3ETCA 1Q57A 4FNOA 1W88A 1WQ2A 1IFPA 3HO8A 1RYFA 3COSA 4ME6A 2NUTA 4RTNA 2JIBA 1THTA 1OU4A 4Q4AB 4B7XA 2KNCA 3JQAA 4I46A 1Q1VA 2G0NA 4NDAA 1QWSA 3KE9A 4Y4RA 4CXMA 4BNWA 2EW2A 2HDHA 2QE7D 3EUEA 3M7GA 3KKKA 5CBPB 4XZ3A 4Z2YA 4N40A 3G3ZA 3BB4A 2HIGA 3BT7A 8GPBA 1QONA 2XDJA 1JR3E 4KKVA 4FDAA 4BVGA 2BFDA 4G1VA 2JZYA 2QX4A 2IX7C 2VTEA 5AI9A 4G5SA 4BEBA 4GAEA 3HDGA 5ELMA 4OTZA 3L84A 3FDYA 4ACAA 2XVCA 4DWWA 4EPWA 5DP1A 3MHTA 4NU6A 3WQBA 1VLVA 3GLTA 5CLIA 4OXKA 5ALMA 4IIJF 1A8IA 4LGVA 4EUFA 1QK4A 1E77A 4LYJA 4AKHA 2JSPA 4RTRA 1EV7A 3IUQA 4LKRA 3J7YJ 2P7HA 3DDCA 1FPQA 4B33A 2GD0A 4RK1A 4X8OA 3PQKA 1RAGA 5JSUA 3BOSA 2OC9A 1RC1A 3E5UA 4PZJA 2W84A 2WG1A 4D99A 1WTCA 2QDKA 5ERGB 4N5LA 4PHGA 5FJJA 1E5WA 3BWGA 2NSHA 1F14A 1YR3A 3UJHA 6ABPA 4DR1B 2AC2A 1N2SA 2RGCA 2WSSH 3QV1A 4MR9B 1ZGZA 3ETJA 1IL0A 1K2WA 3LBIA 3WSVA 2VRNA 4C3VA 2QQ5A 1RF0C 4MS3A 3JPWA 3AWDA 3WJ7A 3MWEB 2KPMA 2B2XA 2X1VA 4E2FA 4YXDC 3T94A 3UXMA 1B0UA 4DVGA 3V3TA 4GYKA 2ESHA 1VYVA 3D6VA 4H1UA 5AONA 4EYGA 3FZGA 3G49A 3L6BA 4O2BA 1KQ3A 1LU9A 2EFYA 2YQ4A 3MQ0A 4NMLA 3PFKA 1SQVD 3UFXB 4UMFA 5H59A 1DS6A 1OR7C 3GNQA 5E3OA 2X9GA 1NTMJ 1FOSE 3FKJA 1YW7A 1KJYA 4CLDA 3KRTA 4ZZDA 1QQ5A 5ELXA 1WQ3A 1SVOA 1P1KA 3T4EA 2CBZA 4Y1RA 4KTVE 2OYOA 2VJPA 3B3QA 3NBQA 3UJPA 4MRMB 3TTUA 1GYPA 4FC6A 3WGHA 1RACA 3T99A 3ZQIA 2P2GA 2VSQA 3E9NA 4CCWA 5C4MA 1OCPA 4PLGA 1N78A 2W93A 1AIPA 1IGNA 2P3LA 2E89A 2NU9B 4F2HA 3VM6A 3U48A 3V9PA 4UKDA 4UV8A 2EZ4A 1FZCC 1ZM4A 3GHGC 4IZHA 1TNDA 2WQ6A 2VYFA 1Z7WA 3OPVA 5KYUB 1YI0A 4NRDA 4WKOA 2EIKH 5SYAA 2G70A 4OI0A 3AM3A 4RVSA 3VFDA 2ZR7A 4D43A 2BP7A 3PPXA 1NXOA 1PTJA 3GI1A 2BM8A 1UPBA 3WK9A 1VIAA 3U4GA 5LZ2A 4DNOA 1PZNA 1IC8A 3IPXA 1XFDA 2W6JD 3W6OA 4AIIA 2DUJA 4XUGB 3N76A 3S1MJ 1IWOA 2IQ5A 1RIIA 1Z6QA 2MYUA 2RD2A 5EUCA 3AYZB 3GA0A 2H59A 4OA5A 3INRA 1OC4A 4EI8A 4OP2A 1FZFA 2VF7A 5COQA 2EZIA 2VZ0A 2GTHA 4KQ1A 2H1KA 4D81A 4OMFG 1Y3AA 2E42A 3K3PA 3TL2A 3B2EA 2AFVA 1KJNA 3HHGA 3OX2A 1IE3A 2ZAEB 3A6JA 2W43A 4KHXA 1GPH1 4R79A 2CYBA 2AW5A 1WMKA 2Q3IA 2IWRA 4A4DA 4H4CA 3WGGA 3D6NB 1YDMA 4QHYA 3R2PA 1NBAA 4RS8A 4GQIA 5CG1A 3DLLF 4IHJB 3T7EA 3FMIA 4EYSA 2VXZA 1AHIA 3UKJA 1NFFA 2IYFA 4MQEA 1QHHA 1O5TA 2PR7A 2FR8A 1DARA 1LDEA 2B9BA 5AIAA 1AB6A 4MKFA 2AN4A 1X9HA 3HEAA 3N9IA 1HGZA 1UP6A 4IXDA 2BM1A 3CJNA 3LSYA 2X4LA 2PZAA 1BC8C 1EK5A 1PN3A 1SXJC 2EEZA 3AAFA 3FX3A 2HRBA 4CR7A 2ZROA 4DCPA 3R3ZA 3WOVA 3DAFA 4CM9D 3BMNB 2X1HA 2FFDA 3F46A 1QF7A 1WHTA 3P4YA 5JYEA 4IHXA 1OFGA 4JJ7A 1SD7A 3RC3A 2EWMA 2IXFA 5DNAA 5CDYA 4I6ZA 3MAGA 2VC0A 3GDHA 4NQZA 2O8EB 2I87A 4BWGA 1M67A 1VG1A 3FXUA 5TB5A 4FEGA 5IP6A 3K6RA 3VH2A 1FMJA 1ADBA 1XIVA 5ADWA 4U2EA 1Y3IA 1HE2A 5BXQC 2ODWA 5JECA 1TT0A 3ZTWA 5BQ5A 4BNFA 2G9ZA 2PX2A 5J4YA 1I5OA 3LLCA 3CIFA 1QVWA 2FE3A 3P5JA 3N2IA 1G41A 2EKPA 3QVLA 5E79H 4BOYA 3VUEA 2YOHA 1B59A 4EDHA 3ZK9A 4M37A 2J5KA 3DQQA 1BRTA 1SRRA 4MWGA 3DB2A 4WZ6A 4LWQA 2GYUA 2XWBF 3CO0S 3MOGA 1ZU5A 2FP4B 4AJHA 1LRKA 3IXMA 4R2KA 2LH9A 5E4FA 2RK6A 5GGXA 2COBA 4S05A 2PD3A 3L9FA 3FPKA 2JPDA 4UMDA 2KRHA 1SC9A 4EVQA 1KR2A 2D5CA 2Q3FA 1DJMA 1PGPA 3P0IA 1NFRA 1ZN2A 1VECA 4U7TB 3TQSA 4M3LA 1ZJJA 1A7JA 5EG0B 5BQXA 3OFSA 2WAQN 3VVBA 2A9KA 3ABQB 2QTBA 1T26A 2DTXA 1RLUA 3L74G 3EJWA 1X3ZB 2JJYA 4TKLA 5FO5A 5D6EA 1MIHA 3NTRA 2BBYA 1MR3F 1CP2A 1FOYA 2GAAA 2GYYA 4QKQA 5HS6A 3FGAD 2UYQA 3DKVA 3N74A 4Q6BA 4BVBA 4U2KA 3BSSA 2VP0A 1FFGA 3HE4B 2DT6A 1HYEA 1NUAA 4EQ6A 3DBHA 3WGIA 4N5NA 5LRSA 3VSLA 3MN2A 1P5ZB 3R7NA 4Q1FA 1AKVA 4P35A 4TWJA 2QUKA 2BBTA 1O6FA 3D4PA 2OC6A 1DXQA 3TGNA 1NKZB 2K9QA 2JFGA 5EEAA 5JEDA 4E2WA 4CM1A 1PVEA 1I0LA 4XQFA 4D5CA 1V8DA 1XCJA 4NY1A 2AWNA 4YJHB 5ICCA 4ZQBA 5JNLA 2VNJA 3DB1A 2LBFA 4RGQA 4DR4B 3OMXA 5IF9A 4BY7J 4XOUA 4P4GA 1YF3A 1FFDA 5DKFA 2FMYA 2WSEJ 2IHZA 3EIOA 3QFCA 4M8IA 3STYA 1NTCA 1Z13A 3KWLA 5IANA 4AUXA 2PPVA 3U3RA 4JYKA 4DMRA 3ASVA 1V2HE 2JZCA 4V0LA 2LKXA 3DFUA 1A71A 4LF9B 1TWGJ 3AUJB 1HY3A 2DE0X 3BGVA 5L3ZA 1BA5A 1M2JA 3JAMA 5DMHA 1W9MA 4GBGA 4QTTB 2DSTA 4IEFB 4RFLA 4E22A 1G6KA 1WH5A 2HREA 1LTJA 4RYLA 1IN8A 3SQXA 5GPCA 3QELA 5TDHA 3C1LA 2M8GX 3NIBA 3TR6A 3ZWXA 3H1TA 2EJUA 4F06A 3KTFA 1MZVA 5JSZB 3EC7A 4YIHA 2BGMA 2BZTA 1YS1X 1SQ5A 2P3SA 4DV3B 3FHJA 3TIIA 2GI4A 5AK5A 3PNBA 3HYSA 4JASB 2K7LA 3OMYA 3QU9A 2Y31A 1B6TA 1N25A 4QBKA 2JR8A 1UEXC 1PJ4A 3B5IA 4S2EA 1IHUA 3UATA 2B7BA 3EMBA 4LG0A 3IODA 1LNZA 2R68A 2ZT8A 1K04A 1ZIOA 4UU1A 3QU2A 2V7QJ 2KWIA 3AK4A 1VCHA 1F20A 3RS4A 1RQ2A 4JJ8A 1M1NB 3JC22 1OMIA 1VJDA 3AEGC 1XTIA 3WA7A 3RSSA 1GQSA 1FQKA 5KLVG 2ZTHA 3ZE9A 1CDOA 2CNOA 3BQ9A 4FSXA 2P75A 3TLXA 3DPTA 3QBJA 2MLKA 4Y6LA 1D8AA 1YJAA 3A04A 1JLSA 4JJ6A 1RI4A 3RVQA 2N0SA 3OIWA 1W5TA 4WXPA 2NWQA 1J1IA 3VJMA 1BWRA 4ZEVA 1GNQA 3U3JA 3ILXA 4D57A 3F6SA 1S1CA 1U3UA 2JA8J 3MOIA 4DQDA 1EX7A 2BTQA 2IIVA 2GNPA 4EL5A 3O03A 3RUAA 2HAEA 5DYGA 4DV0B 1M0SA 5ARDA 2FVXA 2DDAA 3QPSA 2NAZA 1B6SA 2NYAA 1W76A 2FGKA 2WSLA 3L0SA 4IDBA 4MMZB 2DMPA 4X84A 3H04A 3SJ7A 4MPPA 3EPZA 2GR9A 2B6HA 5E6SB 4NPCA 4DJEC 1A8PA 2CJWA 3T7RA 1AS3A 1KAHA 4KE7A 2XBMA 2J3EA 1YL5A 2VKTA 1WB9A 4TQ9A 2O1JA 3K72B 3AVXA 1M7BA 3A9SA 4JT8A 5DP2A 3HUSA 2KSQA 1QS0A 1KFBB 3D8SA 1BQEA 4HJXA 2VNHA 3A70A 3JVEA 5GOTA 5L7TA 1UBMS 1SC6A 4D0SA 2O2ZA 3IV9A 4BCBA 4NDLA 2CB0A 1IXSB 2ZJ5A 2A3NA 3OESA 5ILQA 3JQGB 2O3SA 3L1PA 1AV6A 3H1JD 3OX3A 1Y80A 2MMGA 1N9GB 2IWHA 3CZAA 3AY6A 4E21A 1SZDA 4JUDX 2NS7A 3STUA 1C0KA 4K9OA 3SDSA 3L04A 5DJ5A 1QO0D 3A36A 4M9QA 4JI1B 2R6HA 3FYSA 1N7JA 4HLYA 3HG9A 1I6LA 3SFIA 4NVRA 1MLDA 3W1EA 2GSDA 5A7HA 1VPEA 1QFXA 1P75A 9GPBA 4RK6A 2BHYA 2HIMA 4KIUA 2IH2A 3NPMA 4GO1A 3LC2O 2YJNA 4XRSA 4QOFA 2M4GA 2ZRJA 2C5AA 2HCJB 3AZPA 4MA0A 3CDHA 2DB3A 2Q2OA 4K88A 1W7PD 1ZNYA 1BRMA 3HGTA 1XU7A 4AO8A 3WGUA 1ZD8A 3HYTA 3X1ZA 2CMGA 5ULLA 4EA9A 2V7BA 1W8IA 3AXTA 1Z3CA 3IAS1 4KXFB 2Q1ZB 2LUOA 3RS0A 4TX1A 1XHFA 3PXXA 3IV5A 5B1SA 4BZXA 4BYYA 5H2FH 3H3XA 1E6MA 1I24A 4IDEA 4MPDA 1FNCA 1FX0A 4N6GA 3EZGA 2QSGX 4RS3A 4Y6QA 4MLPA 4LYHA 1ZREA 1P18A 1SK9A 3C5VA 5KCMA 3DYVA 2AUTA 3D5SC 2ARKA 2VH1A 1Q1GA 5HDBB 3N28A 3BA1A 3K0AA 1ULAA 1MABB 1T4BA 1SQVJ 1KMQA 5KX5A 2D1YA 4KR7A 3KQTA 3UHPA 3JAMK 4P5EA 4IVNA 4BXXJ 5FD5A 4JXJA 1G7RA 5SY4A 5HRCA 3EARA 2H8PD 4GOXA 3AJAA 3R6GA 2H65A 1XQYA 1NQWA 1JY2P 3OE7A 5FTKA 2DQ4A 2EFGA 3T8RA 1QFMA 4MTDA 1F6DA 4JENA 4KQ2A 1EEHA 4CWAA 3P2MA 2B36A 3QFRA 1R74A 2BHZA 3UHOA 2VP5A 3E6CC 1DLIA 1GRNA 3BCSA 3GG9A 5CJPA 1T2KA 2RGVA 3E2MA 4NR0A 2PEYA 1MOQA 3MCUA 2PA3A 4PYLA 1OGJA 3V2NA 2XMDA 4HJRA 4RGRA 3AIKA 1DWOA 1JFSA 4LJYA 1EGMB 1UBHS 5CLSA 1RQLA 4J9UE 4CCNA 2W0SA 2VZ8A 3SR0A 1Z8FA 3I4NJ 4WZAB 3BCCD 4ENMA 3V1MA 4TL9A 2ESNA 1I14A 1BVYF 1MIOA 1U65A 3NASA 3SZGA 4M60A 1L4UA 3MJFA 1RYNA 2H4XA 2HBQA 2OBLA 3MJRA 1NRWA 1OKKD 1X2MA 5DHAA 1N5LA 4G63A 4HRAA 3MWJA 2J48A 3B20A 1SPXA 4D6TG 3EH1A 5D3MA 5EAIA 3L2QA 3IE1A 2P0WA 2E5NA 3ZGXA 2AHOA 1X9GA 3GTGJ 2R5ZB 3ZV7A 2PANA 4IRXA 3UMRA 1VHLA 1KNQA 1Z4NA 2P3OA 3O4GA 1NZDA 1KS9A 5AVUA 3HR7A 3HKCB 4A2QA 2QL7A 1CY1A 2FWNA 5KNDD 3L0BA 4JP5A 1UZUA 1VL6A 2V7UA 1B8PA 4UFPA 3UUEA 1MJ5A 1OTYA 3PEYA 3ZGLA 3BD8A 5D51S 2WWWA 5HFNA 4UHEA 1YJXA 1IN4A 5GM1A 5AHKA 4UBMA 3KUUA 4DLPA 3U31A 2KRFA 1H3EA 4DQLA 4YIRX 3L7LA 4U1RA 4EUSA 1SC7A 4HDSB 3TIVA 2XQVA 1PX0A 1XCOA 3GFPA 3DOOA 3CV3A 4KDEA 2CJJA 2WMMA 3MKWB 5CHEA 1LVGA 2ZSJA 1ZTRA 3FMPB 3IQGX 5M3BA 1ZWKA 1JQLB 1ISFA 1E79H 4OLJA 2CMDA 2EV5A 1XRLA 2W6ID 3PUJA 7AT1A 2F2EA 1SQPE 4GSLA 3VU9B 3G5MA 3S2WA 5TJHA 1PGOA 4WL0A 3GGSA 1HBWA 1F1BA 3GRVA 4C07A 5JNVA 3E3LA 3HZHA 4LGDE 4UUBA 5A5VA 3Q9VA 4M76B 5CVJA 3K1YA 2W6PA 1PFUA 1QP7A 2G7MC 4W9NC 1ZNZA 3AE1C 1OVUA 1US8B 1XD9A 4XPIA 3PRYA 2H7VA 3IT3A 1PDWA 4ZI7B 2VNAA 3IWFA 4A0GA 1YDHA 4AB1A 1X6VA 4P5OA 2J0EA 3FVVA 3K70B 1ENZA 2DWQA 3GO5A 5HQJA 3FVQA 3ET4A 5DGDA 2WWGA 1KQGA 4UM8B 5LGTA 2BLNA 1J8QA 4ARIA 1GSIA 1RRCA 4TN1A 1XGMA 1SURA 3LC0A 1I1HA 3NOVA 3DE2X 4IHQA 4JGBA 4H17A 4BUJA 3VRHA 5ECYA 1NR5A 1FOKA 4UBLA 4MYDA 1E4VA 6PAXA 4RMNA 4JNCA 5KTSA 1BGYD 2ECPA 5CPRB 2GOMA 2YQZA 4XR4A 3GLHA 2DUMA 4D96A 4C0SA 3PZRA 3R75A 2P10A 2B37A 3DZCA 1RJ9A 4ENJA 5IZCC 2R5YB 5BSWA 4ZDLA 4MHOA 4PSKA 5F98A 4LYYA 2P9TA 4D8TA 1NU8A 3FYHA 5FKMA 4I5DA 4PRZA 4JA2A 5WRFA 4MUXA 1R2QA 4P3KA 3CCYA 1GFWA 4FZRA 2A5JA 1GILA 4C3HJ 4LE2A 4BAYA 5B6PA 3ADKA 2PS0A 3CI9A 3ZX5A 3UOWA 1RPJA 1DEOA 2R7LA 3QWIA 4Z7JA 4FE4A 2J7KA 1HGXA 3DKIA 1FYWA 3QXJA 4P0PB 3CLVA 3LA3A 4BFYA 2O5RA 4HH4A 2R1TA 5AJTA 2OMKA 4BJ1A 5AJYA 1AV7A 1KRXA 2RC5A 1V8BA 2HTEA 5FKJA 3UICA 3LK6A 3AGPA 5CYVA 1DKUA 5AVQA 2NS0A 5B4TA 1A88A 1ZLJA 3TB6A 3P52A 2IY9A 1J2JA 4YMVA 3VR4D 3FIWA 2GBLC 3TLGB 4MVJG 3FISA 1B23P 1ZW6A 5FOSA 2L54A 1DRKA 1U8RA 2RV8A 4EJOA 3WICA 4LGMA 3EDYA 4TXHA 3DXJF 4KH1A 2BFCB 1UC8A 1RMTA 3MIIA 4ND8A 4NBKA 4XLZA 1G3UA 3IEUA 5DCLA 2R751 2XYGA 1M1KQ 3TIGA 1CUZA 4B48A 2FR0A 1SZJG 4EG3A 2ZRGA 1E2MA 3H6GA 1FYLA 2X41A 5AW9B 1BJTA 4D79A 3GJZA 1FLIA 2FTKE 1VJCA 1X7HA 1B8IB 2AI3A 1XD2A 4A36A 1VYHA 4EFDA 2VQEB 3Q10A 3QX8A 4B80A 4S1NA 4RK4A 2YN2A 1PL7A 1FVXA 2VCHA 3I5AA 1RRPA 4R05A 2IA0A 1IIBA 1JNXX 4WX2B 4NZZA 5BV0A 1NAFA 2EPFA 3MMPA 4JJGA 1KBQA 3WVNA 1IFJA 3UY4A 2Q3BA 2HUNA 4JF7A 3W5DA 4BMPB 2QD2A 1JIUA 2XV1A 1YZKA 3PICA 2BPOA 4O4LA 3WU1B 2YWGA 2C2ZA 3MWKA 5LP1A 2XB2A 1W7AA 2QL5A 1IH8A 4LG3A 1KI3A 3T1YB 2OCPA 4QQNA 4GGGA 4IIDA 2C4MA 4B4UA 1Y1WJ 3BHIA 5JDIC 4ASWA 1A9SA 4RNDB 1NLFA 1OJ7A 1DGRM 1WI3A 3CISA 1FBQA 4EELA 1ODTC 3BRWA 4O2LA 5IT9A 1WZIA 3SHQA 1EFVA 1VKHA 3VOBA 3O8HA 1J2EA 2QJYC 4Q4DA 2VWPA 2L5GB 3P32A 2DA4A 1V0JA 1YU9A 3FGZA 1ULYA 2O2SA 2QZPA 4FFOA 3TLJA 5AVVA 1KP2A 2IYYA 2GBPA 3HRUA 1QHEA 2JQ7A 1JUPA 2BR4A 1YXMA 4UEQA 2AMYA 2VUMJ 3QEAZ 3UEOA 3TAUA 1E2JA 1AUXA 4MW9A 5K0GA 1BI0A 5H70A 2NSDA 3CO5A 3P97A 3B1WA 2WC2A 2QM3A 3TO9A 5EJFA 2OV1A 1KI6A 1MVLA 3WR5A 5CG2A 2E1CA 2FSIA 3I3SR 3MJDA 1BFUA 4JB3A 4U39A 5K0TA 4DRZA 1MX9A 3P9XA 2IRWA 4N0DA 3TFQA 1L0OC 3EFGA 5FUYA 3ZWBA 1ZK2A 4NCAA 4Z9FA 4DC0A 4N01A 2APJA 2Q7XA 2M4KA 4B3GA 4ZTZB 4MWDA 3SP1A 3P27A 1U31A 2ATEA 4D3SA 2I6XA 1A97A 3QUCA 1Z56A 5A2QZ 1C9YA 4Q9LA 4DCVA 5LHGA 4Q5IA 1E96A 2ZT9B 1RKXA 2ZBRA 4CQJA