1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
b'MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
4QTRA 2G0EA 1W0TA 1MNMC 2HOSA 3HOVJ 3G1LA 2LLKA 1AKHA 1JUPA 5FJ8J 1OJLA 3MVPA 2NVTJ 3S2DJ 3TP3A 2EZHA 2HOAA 1YRNB 4MLOA 4G12A 4W1UA 3IV5A 3BTLA 4ABZA 3A03A 5GP9A 4IHVA 3B6CA 2DMTA 5F04A 2L7MP 4BQQA 2LY9A 1ZGWA 3NARA 2EQRA 4A3EJ 1JUSA 5IP6A 3JRGA 3OSFA 4IHWA 1DU6A 1O4XA 3OOUA 2DTZA 4M6VA 3S1RJ 5K7FA 2FX0A 2L7FP 3LSJA 3PM1A 1U9NA 1ETXA 1W0UA 2FJ1A 3M4OJ 5FKKA 1F43A 4XICA 4D7MA 1JKQC 4D5FA 3IH4A 4A3LJ 1X58A 1B8IB 2JWTA 3OIOA 2LK2A 4BXXJ 1JTXA 4V2FA 1T56A 2LD5A 2LVSA 2XPVA 3BQZA 4D5CA 4DW6A 4UUSB 4FTHA 3GTGJ 2I10A 2XSDC 2WV1A 5M3MJ 2MW8A 5JLXA 1U78A 1MBJA 3HOZJ 2LFBA 5C3EJ 4B3AA 3HDDA 1JUMA 5IPAA 5BNGA 2WB1N 3LSRA 3K7AJ 2MHCA 3LSGA 2CU7A 2R5YB 3W6VA 2XGDA 1P7JA 3Q0UA 3UJ3X 3LSPA 4S0HB 3GTJJ 1D5YA 2RAEA 2IEKA 5EG0B 5GPAA 3I4NJ 1JT6A 9ANTA 2X48A 2XPWA 3BTIA 4DYQA 1IG7A 2COBA 3UKGA 2CUEA 1TWGJ 3FKIJ 5JLWA 1R9TJ 3A01B 2VUMJ 4A3JJ 1WGXA 2DA5A 1GT0C 4B4CA 1RKWA 3D1NI 3RQIA 4Y7NJ 4DYRA 2WAQN 1JJ6C 1H8AC 1JGGA 2W48A 3ZQIA 1OCTC 1UHSA 1BL0A 4XIDA 4QIWN 2Y9YA 5C44J 2NVXJ 3S1QJ 4C2MJ 4FCYA 2ID6A 1AU7A 1ETYA 1H88C 4A3CJ 3ZQLA 3ZQGA 2GBYA 2Y31A 4IHYA 3BR2A 1TWAJ 4BBRJ 2HI3A 1VFCA 1IGNA 3S17J 3SJMA 2H8RA 3I4MJ 1I3QJ 1ETKA 4DZPA 5E3NA 2IAIA 3QPLA 4JX4A 3WHCA 1MH3A 3BG3A 1A6IA 4I76A 2CQXA 5FKNA 1IRZA 1X2NA 2E2HJ 2E2JJ 1QVTA 4CYCB 1ZQ3P 1GDTA 2DJNA 3ZQHA 3GUVA 3IH2A 1QPIA 2HYJA 1ZTRA 3FIWA 3RZOJ 2RSLA 5HODA 1LFUP 1RR7A 1SANA 2L9RA 2ZB9A 1YRNA 1TC3C 2DA1A 3K2AA 5K7HA 4AC0A 5IYCJ 3ZQFA 2L7ZA 1APLC 4RDUA 1OFCX 2DMPA 5C4JJ 1JKRC 1QRYA 1E3OC 2B63J 4QSHA 1TWCJ 1RETA 4V2GA 3LOCA 1BW6A 2LR8A 4MFEA 4UUTA 5FLVA 5C35A 1MBEA 3VPRA 1F36A 3RKQA 4XRMA 5EGOB 2ID3A 3S2HJ 3JR9A 2MG4A 2NVQJ 3HEFA 2MGQA 1MBGA 1PUFB 3G13A 1Y1VJ 1XC5A 2OPTA 2CUFA 2Y2ZA 2CJJA 4C3HJ 4XRSG 5EYRA 1IUFA 5FKMA 4D7NA 3JRBA 3GTMJ 1B8IA 4IHXA 2XGEA 2VI6A 2E1OA 4DZJA 3HOYJ 5DS9A 3TW7A 4UUSA 3S1NJ 5FKLA 1B72B 5IP7J 3QPSA 4JX5A 3H0GJ 3TW6A 3Q0WA 2K9QA 5E3LA 1JKOC 2QCOA 2XB5A 5J1UA 4MO7A 5GPCA 2TCTA 2R92J 1BJZA 3DCFA 5IYDJ 1FJLA 4LOCA 1LE8B 3O8GA 4DYCA 5EG0A 3JRDA 1S7EA 3HKZN 4A3DJ 2ECBA 3F0CA 5F08A 2KDZA 4HNVA 1EF4A 1K61A 2E2IJ 1ENHA 5F0FA 2NS8A 2HXIA 3A01A 3FK6A 4GFBA 3BG9A 3HM5A 2EZLA 1UG2A 2M9HA 1UMQA 1T33A 3S16J 4J19A 1FTTA 3SDGA 1Q1VA 4C3JJ 1MH4A 2NVYJ 2JN6A 3TEDA 4A69C 3JRFA 1HDDC 1VNDA 4M3FA 2JA8J 5EZGA 5IOYA 5M3FJ 1JKPC 1JJ8C 3GTKJ 1AHDP 3MN2A 5E3OA 2DA4A 2AO9A 1X2MA 3HGYA 2JA5J 4JX6A 1VI0A 4FE4A 1GV5A 3JRCA 1ZR2A 3E7LA 3WHBA 4FISA 5EF6A 4X6AJ 3HOXJ 5M5WJ 5F0HA 2DA3A 2HXOA 2D5VA 5FLMJ 5IP9J 1ZKGA 2DA6A 5J1YA 4CYCA 2HDDA 2DN0A 2HOTA 2ECCA 2EBIA 2R7ZJ 5C32A 4L5EA 4A3BJ 2IBDA 1MBKA 1DU0A 3JRAA 1LFBA 1HOMA 2XPUA 2KT0A 1FIPA 4BKXA 3S14J 3LHFA 1ORKA 1CQTA 3HOUJ 3JRHA 2DMQA 2LTPA 3BR1A 4M3BA 4A3MJ 2NS7A 1HF0A 4IEJA 2M34A 2H1KA 3A02A 1WPKA 1XS9A 1G2HA 2VKEA 2LKXA 3PO2J 5EGOA 1BA5A 3B6AA 3BR3A 5EZHA 3BVPA 1ETWA 3GTQJ 1RKTA 3Q3SA 4JYKA 3O8HA 1GVDA 1PUFA 2EH3A 1FEXA 1GUUA 2DA7A 4MFDA 1GV2A 4A3GJ 2DMUA 2EZIA 4C3IJ 1ZK8A 4I6ZA 1TWFJ 1MBHA 3M3YJ 1TWHJ 4XRSA 2DMNA 1I50J 2R5ZB 1Z0XA 2P81A 1VF9A 3BT9A 1HDPA 3JREA 3HBLA 3GTOJ 3CMYA 3MKLA 1AKHB 4A3IJ 4AUXA 2X9DA 2YS9A 5IOZA 3JRIA 3BR5A 1B72A 4EEFG 4BY1J 4B1RA 1OCPA 3FISA 2JJ7A 3PO3J 3HB9A 2XRLA 5EDNA 2K40A 3CDLA 3OSGA 1Y1WJ 3ZOBA 3GTPJ 4BBSJ 1IDYA 2VPRA 5C4XJ 5F1JA 2X6OA 4A3FJ 1ETQA 3GTLJ 1ETOA 1WCMJ 2YU9J 4FE7A 2XB0X 1ZR4A 5M5XJ 2VKVA 1LE8A 3GBGA 2Y9ZA 3BR6A 4M3EA 1ITYA 3ILXA 2R5YA 2CRGA 3LNQA 2K9NA 3BG5A 1SFOJ 2K9SA 1U8BA 5F27A 2YUSA 3BTJA 2EZKA 1ETVA 4W97A 1GHTA 3BQYA 1MSEC 3IH3A 2GLOA 3S15J 1NK2P 2JMWA 2O7OA 3HGGA 1A5JA 1HLVA 2O9LA 4AYBN 1HX7A 2M2EA 1HCRA 2ME0A 2Y0SN 3BR0A 2JA6J 1FTZA 4M3GA 5EEAA 3HOWJ 2O8KA 1U9OA 3CCYA 3TP0A 2R93J 3H3VK 4BY7J 3FK7A 2E19A 2CQQA 2M8GX 2FQ4A 2JA7J 5DTDA 4A3KJ 3SFIA 2OF7A 3Q0VA 2ME6A 5E3MA 2R0QC 3RZDJ 1JTYA 2TRTA 1RPWA 5FKOA 4JP0A 3L1PA 5K7ZA 1P7IA 1WI3A 1BW5A 3BTCA 2PMZN 4NDLA 4M3DA 1I6HJ 2MSYA 2Y30A 3G1OA 2FD5A 1NK3P 1FIAA 5IYBJ 1IC8A 1XG1A 3QQAA 3PKZA 1Z77A 2HQ5A 2DA2A 4RBOA 2LP0A 3CQZJ 4X1EA 1JT0A 1IJWC 5M5YJ 2JK3A 2M0CA 1IV6A 2XGCA 1NTCA 4MIMA 1H89C 2N8GA 1QVUA 2ELKA 5J3LA 2AHQA 4XK4A 1IDZA 2QF7A 3LHKA 5C34B 1WH5A 3ZQCA 1MBFA 1WH7A 5F0CA 1POGA 3DEWA 2GM5A 5C31A 4A93J 3NAUA 1MSFC 1RESA 5J1RA 2NOGA 4Y52J 2L0KA 1K83J 3C2BA 3G1MA 2R5ZA 3S1MJ 2GM4A
chains in the Genus database with same CATH superfamily
4PFJA 4ZDJA 1FTWA 4CYDA 4K6KA 1X8LA 1GQ2A 4PXAA 3F78A 1NI3A 4PZ0A 4AL4A 3WLEA 2HOAA 1MRSA 4M1ZA 3IV5A 1CETA 3U7QB 2FW1A 4MVJP 3E23A 4CUGA 2J5OA 1W4MA 3NHWA 4PIPA 3KSUA 1QRDA 3NRVA 3PB3A 3W5DA 2YVKA 1YR7A 1A4XA 3OQNA 4S0XA 4ZQBA 3LUDA 4LI3X 1QGUB 5BRJA 3C4VA 4UVAA 1YZUA 4ITRC 5BV1A 1AFOA 3GN2A 2IWRA 4D8WA 1W4BA 1CF7B 4B74A 1JQDA 3MC1A 3F3KA 4BKPA 2YR0A 4ZCLA 2NO9A 3MUFA 3CZ6A 3KR9A 2CUEA 3C43A 4C3UA 3A01B 2F17A 3F23A 4X0EA 4N48A 4JI6B 4UAJA 1V4RA 3O75A 1C50A 3VNQA 3M49A 1QIIA 4NJMA 3K6RA 1WUKS 2Q6KA 2ZJ2A 3AE3C 1USUA 4URHA 1E5LA 3HCAA 3I4MJ 4BS9A 1KQ9A 3AEQA 2CDNA 1I6LA 1QCDA 1G4HA 3O21A 3FWLA 4RZXA 2GT1A 2QKMB 4ZCRA 4KPUA 1ZRNA 2YIDA 1NMZA 1P4SA 2L91A 1HSOA 1TC3C 2DQ4A 2OILA 2PH7A 1E0KA 3TNUB 4DUGA 1FDIA 1GZ3A 2H51A 1U3UA 4DGWB 4KTTE 1PEYA 4YMLA 4XARA 3OS2A 1FZCC 2COEA 3E9CA 1E9AA 1ULHA 1JQ3A 5HSGA 5JBQA 2W24A 5EFZA 3RIYA 3ZCQA 2HXSA 2MMCA 1ZL0A 3QFFA 1GZDA 2NW6A 1MMDA 1SCBA 2W6OA 2GPAA 4RX1A 1IJKA 3GEPA 5DRYA 1GADO 3S1AB 3ZK7A 2Q2EA 4H1TA 1KRHA 1GCIA 1S7EA 1CJCA 4CN8A 2ZPAA 3O9VA 2A06E 2Q2NA 3K5BA 1XPXA 4MJ3A 4OQPA 4DQUA 5M29A 1CUJA 1PZFA 3CF0A 3EOZA 2ZB4A 2XNKA 1B3RA 4LEIA 2FEXA 1Q91A 4F85A 2ZSEA 2IYWA 1Y6FA 3RKRA 1WO8A 1F2TB 2Q3JA 1KP9A 3ESWB 3DV0A 5TPWA 1LJ8A 2LZ0A 4M1YA 5JFTA 3CUEF 1LLCA 4IJKA 5HQ3B 3H9GA 4YASA 3C3DA 5FTJA 1EDLA 1VQLI 1OB5A 1Y33E 3N07A 4DMFA 2R68A 3AM5A 4K7JA 3AE2C 1E8NA 3RHZA 1JN0A 3ZHYA 3A0UA 4OATA 3T3OA 4KIFA 3D0SA 4R3WA 3VR5H 1RBYA 1BX3A 2JWDA 3NCHA 2FOLA 5CVCA 3VR6H 3X1KA 2O3JA 1BA5A 1YOVB 3NAZA 1O5IA 1CF4A 2A86A 2E74C 5U1PA 5B3AA 4KIWA 3M7IA 4U3JB 3V1LA 1RACA 2E21A 2DT7B 3ZZNA 1TOAA 5KAFC 4YI5A 1Q1EA 4ATNA 2BY0A 4DUYB 4PWZA 1GRCA 3CTPA 3B82A 4DIOA 1EH6A 4UEQA 3B53X 1I7SB 3CRZA 1KZ6A 5IS2A 3CPHA 4G4SO 1NX9A 2Q62A 5D3QA 4AP6A 4Z0NA 2CB9A 3HKCA 3ZW7A 4GICA 1F12A 1S3JA 3V6LA 1DC7A 1F0KA 5JS1A 1B8PA 3CNNA 1K8AQ 4EKYA 1KYQA 1EHYA 3N2YA 1BDDA 4DSZA 5AVKA 4RU1A 4OL9A 2M2EA 2JA6J 5K5OA 4J91A 3U4HA 4A5MA 1PJCA 4E30A 3KLBA 3OYFA 4MS1A 2Y67A 4O2BA 3CUQB 2GSDA 4LS3A 1O9HA 4IOKA 5DTDA 4RGYA 2C9LY 1M1NA 5E6RB 2GNPA 2AXQA 3QU7A 1LRKA 4DQDA 1WQ4A 4D74A 2JEOA 3CR8A 4L74A 1U6JA 3HYRA 3OIPA 2FCRA 2GXGA 4JDUA 5B6PA 1BIFA 5CPRB 2GEUA 2VPPA 5LQMA 1R3UA 4R9SA 1R0CA 1TCAA 3K4CA 1IB6A 2HBZA 2A33A 1TEXA 2HA3A 4JJ4A 3Q3GE 1BE0A 4DQ2A 1BDMA 3NHLA 4QOSA 1IWBB 2JT1A 2Z98A 3G1LA 3EFEA 5I8ZA 1HRDA 2K4MA 4JR2A 2JFHA 3ZJ4A 1BXRB 1SXJB 5BN3A 4KO2S 4EPTA 2ORVA 4G7HF 2NN3C 3MZWB 4TWRA 2ANCA 4OHKA 1N0HA 2PYIA 1PDOA 5ED0A 2BEUA 3S2WA 3LD9A 2FEZA 3R0VA 2P0AA 3R24A 4HXFB 2WI8A 4LJYA 4PFSA 4CR8A 1ILEA 4OMYA 4LJSA 5K8JB 2UZ1B 2XSZA 4HDNA 1SJ9A 2WB2A 3P9NA 1VKZA 3EYAA 4JI2B 1UPTA 4DW6A 3L7CA 1TGYA 3OYKA 1WXXA 3PEWA 4L4SA 1BCCD 4Z9XA 1Y0NA 5K0GA 4LTDA 2L82A 4RB2C 3CCVI 4BKQA 5T67A 1P9QC 3CCRP 3LQ1A 4J0QA 5GPAA 4IXWA 1XVVA 2XHEA 3RRFA 3LUGA 3H1CA 1KZYC 2CS3A 2JEEA 1P33A 4DEYA 3ZWWA 4RTSA 1BFUA 4XIDA 1R4NB 3CUYA 3INRA 4LYJA 4PM4A 3H1LD 3FXDA 4PYMA 1PPJD 3W79A 3O92A 1TTYA 1U80A 1NTMG 1EWTA 3LVRE 3CTMA 2VYND 3AEAC 1J22A 5C51B 2DR0A 1STZA 1GQQA 3M0DA 3H11B 3UM9A 3E8XA 2OBBA 2IT0A 1CLUA 3LX8A 5KYWB 4A8JA 2O1XA 1MABB 1ZNXA 3ZQFA 1JMBA 2AG0A 4E31A 4TXNA 1BW6A 3PENA 1FNCA 2PYZA 3DXYA 3L04A 1JR3D 1MH9A 3IMCA 4CN9A 2J7PA 2AX4A 2G6TA 3WYNA 3Q2OA 3PFFA 1F8YA 1JBQA 4DNCA 3L73E 2AG6A 4JI8B 5HTOA 3K0EA 1AQTA 4MW1A 3MELA 2P6UA 4MMYB 1RCUA 2W83C 1JE1A 3E84A 1V43A 1IDOA 1TQIA 2LR0A 2R1TA 3E5MA 1OVGA 1F7UA 1WMSA 2GXBA 2QTMA 4ZQHA 4YT8A 1L7PA 3KKKA 4J9VA 2H1SA 1DZ3A 3MZHA 3TOAA 3C8ZA 3WK5A 4CXMA 1W7PB 2IIQA 2PJUA 2EERA 3S16J 1E1RA 2XITA 2M6LA 4M7WA 4NCKA 4KE7A 1MB2A 4MHTA 4QJIA 5IOYA 2Z1DA 2ZAOA 4RAOA 5E3OA 2VATA 4AJ4A 2ZVNB 1FW8A 3NHKA 2PU5A 5E0KB 2ZW9A 3HOXJ 3R77A 2BY3A 2D5VA 4BQFA 5IP9J 1XEFA 2ONZA 2A3NA 4FEYA 1B8VA 4UVIA 3KC2A 3U4IA 2JVHA 1MBKA 4O3FA 3EPLA 1AK2A 4B44A 4DMGA 5YASA 3S8PA 1I13A 4KYTA 3DF8A 4P83A 3V1UA 4RORA 4BMNA 3U3RA 3NHPA 4J49A 2PS9A 4KXUA 2ACEA 3EZLA 3LRXA 1H1LB 3DAHA 1C7IA 2DMUA 1NVTA 3UTCA 2VPTA 1MIOB 1XZIA 1N75A 2OSBA 2Q3MA 4TL9A 3WLLA 1E77A 2H29A 5JO0A 2EWMA 5D6NA 3Q0IA 4P5PA 1J23A 1C8KA 3T3NA 4QJ3A 4CCNA 1J1UA 2A69F 2HJGA 1W5AA 1A36A 3OF5A 3WYFA 3TLJA 1BC5A 5AH0A 1JY3P 1QVRA 1XMPA 1Z35A 4I2NA 5CXQA 1N4AA 3EDYA 2MC4A 2K9SA 2E87A 4XKVA 1H66A 1G98A 1PDWA 4NYMQ 3BGIA 3BQ9A 4DBQA 4JVSB 1R12A 2O9JA 4JMLA 4NLLA 4UBMA 2I91A 3SHQA 1C7ZA 4BO7A 5FA6A 4G0VA 3P2EA 1Z6QA 1ZJ4A 2VPLA 4PYLA 2OYHC 1W0JD 2X2EA 2NZVG 1NU1K 1LZLA 1G20B 5EXPA 2V26A 2OGUA 1K7EB 1U2EA 1IMJA 2WHYA 4OVNF 4GE0A 4BWVA 2IFNA 4YP6A 3L0IB 3O03A 4RGUA 2WYUA 1MIJA 4KRYA 1FAVA 4ARAA 2ZIEA 1CIJA 4W7HA 2HYFA 1DPUA 1D1BA 4RBOA 3S7TA 5CIWA 3BCHA 1ZMXA 2CNDA 1DAMA 1JFVA 4GC9A 1F8GA 2KRFA 4YIKA 3P9QA 2J3HA 2G1PA 2GRJA 3ADBA 4DR2B 1NU1J 1ONBA 3TWOA 1R0KA 1ECLA 3BXFA 1ZN7A 1HKTA 4ID9A 4FT8A 3UQYS 3E5XA 5AVWA 4JGIA 2MH9A 4V1CB 5AI4A 4RD3A 1N92A 2CGEA 4RA6A 1Q3TA 3TW8B 3BTLA 3WJ7A 3CLTD 2Z2SB 2QVLA 1R5NA 1I0LA 4EMSA 2QI9F 3E6CC 3OL4A 1KMNA 4WW0A 4QD3A 3KQOA 2O8XA 2PWPA 3ZDXB 1Z82A 5JPCA 3HA5A 1YTUA 1VQ9I 1QVFO 1Z62A 5T8KC 4GLLA 1XRSB 1SRQA 4BCCA 5AVTB 2GN2A 2WSEH 4JP1A 1Z7GA 2Z95A 4CQMB 2IDKA 5SYAA 2ZIZA 4I4TF 2WY8Q 3L6CA 4GGMX 3IS3A 4H1WA 2OXRA 4BJ3A 3VPDA 2YWHA 1W5EA 4CKBB 4JMPA 2Y1CA 3DE6X 4JBLA 4JJKA 1RM5A 4G5QA 3ESXA 2FFBA 1NRXA 2XHZA 4RMJA 2XCQA 2OCLA 1SD1A 2H2FA 2BFCB 2VDOB 3E0JB 2IOHA 1F9AA 2C7BA 4QYWA 4HUTA 4YDHB 3FX2A 1ZNZA 4ZVSA 5AJYA 3TRKA 4DZTA 2ZS7A 2WVHA 3IDOA 1RYNA 2EQBA 2Q2QA 3KKPA 1UC9A 2HUNA 4XL9A 5D4RA 4A92A 1A71A 4X24A 3UFXA 3DBLB 2DBYA 4IIJF 1EFAA 3QXSA 1ZMOA 5EWJB 1TC1A 1TQHA 2OSVA 1SK9A 1QO0D 2J7KA 1QV7A 3B38A 3BSFA 4BNHA 2RD2A 2CHFA 5EFWB 1Z6XA 3RPEA 4EKDA 4AG6A 3PC7A 4EV0A 1FZCB 3GRUA 3M4JA 2P2UA 4MRRA 1JIUA 4BPRA 4HRVA 5HDBB 3GJZA 3T99A 4LK0F 1HG1A 1T8WA 4B9EA 2Z1NA 3UMCA 2VHUA 3VRHA 2W4IA 5I4BA 2YXLA 4ANJA 3MILA 4HH4A 2Q9CA 1H2XA 2P6NA 2LBPA 3DEYX 3Q41A 4F5EA 3JAMZ 4J1TC 4HH3C 4CDNA 2GXQA 2KKOA 4KQIA 3C4QA 1L4NA 3OBBA 2FWBA 5FTLA 2EV6A 2WIGA 2AW3A 4X0GA 1QNLA 3MQ4A 1P9OA 4WACA 2GA2A 1G1MA 1ZAKA 1J07A 2X6RA 2K9JB 2ISYA 5A5GA 4XQ9A 3IEMA 2EJVA 1KILE 1G0OA 3S5JA 1YITP 4V0LA 2O7VA 3ZCRA 5LYJF 3K0LA 3G8AA 1O5TA 3U7FB 4CUZA 2BAGA 5APXA 1N6NA 1A4IA 3WIEA 3M6FA 1VPVA 3FUWA 3ZJVA 2OU2A 2NYRA 1RZ3A 5LQRA 4FFVA 5SYMA 4OI0A 1ZSVA 3K35A 4IDFA 3OQ6A 3B9PA 3ENWA 4KREA 1N8TA 2AXTE 1ZM3A 2FUCA 2XAUA 2E74B 4I4NA 4Q9AA 1XRLA 1J33A 4GKGA 4XI9A 4XCVA 2H08A 3ORSA 3HJTA 2C77A 1ID8A 3HXPA 4DDVA 2IH4A 4EHBA 2LXNA 5AW5B 4D97A 1K8ZB 2FN8A 4LG3A 4LDZA 4H7IA 3F98A 3SX0A 1EFRD 3CRVA 2GKGA 3CCUI 2M6RA 3EMDA 2ZI4A 2OHVA 3FLEA 3OAAD 5H68A 2MJZA 2OZPA 3KYDA 3DDSA 1L3IA 4D02A 3G3ZA 2L01A 3EN0A 1C14A 5BMZA 1HORA 1N5IA 2VHCA 3H2YA 2Y93A 4QE3A 1Q6ZA 4L9SA 5FI0B 4DVJA 5DNCA 4LYAA 2N9BA 5AWFC 3ER8A 3KNZA 4JC5A 4OYHA 1B4DA 1U9OA 1I10A 3IP1A 3LIEA 1RAAA 4QM7A 2PMCA 2V55B 4MCIA 2IGBA 3TO7A 1KARA 4EY3A 2Y77A 1N73C 1EFUA 4JLJA 3KOOA 3GPBA 1DX7A 1NU1E 3PTLA 5HZHA 4X3OA 4X95A 2NYAA 3PNVA 1H2FA 2FXVA 1AUXA 3FXOA 2E36A 2X86A 4F45A 5FL7D 1RTKA 1IQ0A 4UVEA 4B6JA 3TXAA 3PUBA 5IHPA 4H3HB 6ADHA 2VP6A 1M54A 4HQRA 4HXGA 5HF5A 1MSFC 3A11A 3C16C 5THKA 3VC2A 4Y18A 3OJ0A 4LF4B 2LCQA 2GN6A 2VF7A 1Z0UA 1GUDA 3ODPA 3R76A 3OTIA 3H86A 3W2WA 1Z0FA 4ABZA 3MAJA 2NSDA 2EQRA 2GOMA 5DYMA 1S29A 1NJ5A 3DF9A 4OBXA 3A3KA 2G36A 5IYZF 4EAQA 1U4SA 3PJFA 5DEOA 3GLIA 4KXWA 1UAYA 2FPGA 3EAQA 4FU0A 4AWAA 3QE2A 5KOJA 5GJBA 2CWEA 1Y0UA 5DM2A 2X9LA 4TTQA 1KI1A 4G0XA 4X44A 3CWBJ 1VQ4I 2KP6A 2ZXWH 3L7MA 1GZLA 1UFVA 2IUSA 2ZBDA 4N78D 4CMGA 3KZOA 1PUXA 3SQWA 4BL5A 1G8FA 5ICFA 2QW0X 3C7TA 2X48A 3BTIA 1CNFA 4UM5A 2RGWA 2FUKA 2ON6A 2JC3A 3E1GA 3HG9A 3H5AA 5FPPA 1OBCA 2E5NA 1WSBA 3H36A 5B3JA 3N75A 3E15A 4I50F 4R1NA 2PN1A 5EIWA 3BR2A 4LTNA 4ZDWA 1YI2I 3K4JA 4CUJA 2C2KA 2VHQA 4MR7B 3CLTC 4YP1A 5BQTA 1UCRA 3V1TC 4MTEA 2EV0A 3BPVA 4EOGA 4K6GA 2YJGA 1E2QA 1ZTRA 5G1NA 1ZG3A 1ZW0A 4B6SA 2CZGA 1KU3A 2X3UA 2O01N 3W2GA 4DREA 1MBEA 4FMBB 4YFVA 3I9NA 3LC0A 4RY9A 3BEOA 4MMZB 1D5VA 5CDYA 2I7TA 4YJHB 1WFXA 1WTCA 2BT4A 4NK5A 4JSTA 5AK6A 3SEAA 3HJAA 6PAXA 1P8AA 2OTJP 3UIEA 1ONSA 5IAOA 3VO8A 4ZOQI 5GWXA 2KYRA 3PDIA 2K4JA 3QWIA 1G8SA 3M8KA 2XCOA 1F8UA 3CG0A 2DBQA 3HADA 4U2BA 1H2AS 4XXHA 5JAPA 2YVLA 1XMQB 3K2EA 4PRLA 4C6TB 1M0WA 2EJTA 1VQNI 4Q16A 2NVYJ 3MWKA 1U4OA 4K9PA 4HQNA 4U2DA 4N6GA 4IUCS 3HUGB 5IFKA 4AKHA 1E2NA 5DHTA 3UXEA 2Y2UA 2WT4A 3D0KA 3FTQA 4AYBA 2KISA 3T4PA 2FJPA 4YLEA 4LE2A 1JZSA 4DT0A 3PNOA 4PEVA 1QWSA 3U60B 3CCCA 3H18A 3HUTA 3ICCA 4OINF 1NQ5A 1T3UA 1TZCA 1IHYA 4MQVA 2C7VA 3P1JA 2OQIA 3LLUA 2ZRKA 4RGRA 4LHVA 6Q21A 5CBPA 4Z2AA 4GWKA 4RGVA 4NZNA 3D4IA 1L4FA 3GZNA 2WJ3A 3M1IA 2C8LA 1Y5LA 2HB6A 2QMUA 3HN7A 3DVAB 4UTOA 5BV2P 3JTMA 2QVXX 3L0ZA 3BYZA 1V7PC 1EGMB 3BR5A 4U87A 4YACA 2VF5X 4GX5A 1DEAA 2EU8A 4DNXA 5C9ZA 1JMMA 3HB9A 1WIWA 2XRLA 2VJCA 3H0EA 2GN9A 1ZI6A 5B4UA 4H6VA 4OK6A 4K3VA 2HYNA 5F51A 3V1KA 1G8PA 4Z7OB 1WRGA 3B36A 1N2DC 2TMGA 2VYFA 4QPZA 4ZI5A 1EXVA 2X41A 3WFZA 1VIMA 2OYHB 4BHCA 2FE3A 3AIMA 2GZHA 4R1OA 3U3JA 3GLGB 3IQGX 3ZHQA 2ZE8A 2ACKA 4CDRA 4W5WA 1HKUA 4QUBA 1ZP6A 5EKTA 2GA8A 3AFOA 4CO8A 1P8JA 2I7XA 3G8CA 4U7TB 3BIWA 4KO4S 3ROQA 4BQRA 1H5NA 5TT1A 2CSUA 1STOA 3ROXA 3QWLA 2JNWA 4MW5A 4DZRA 2CSXA 1DKNA 1EGAA 2Q5JA 1LJUA 1WQ3A 1B4AA 3REGA 2NZ8A 2M3EA 4DVGA 3T6KA 1JHQA 4WEOA 4FW9A 1K83J 5FLXA 2H4JA 1L3LA 3D6UA 1DFHA 3C3PA 3HOVJ 2R8YA 3PUJA 2RN0A 1H93A 3KLNA 5CW1A 4OU0A 3P0HA 2HG5D 5IMBA 3AUAA 1ESNA 4UUMA 5DCUA 4L1KA 1ZGWA 1AB5A 1QJ4A 1WABA 4LYYA 1GUBA 3CWBE 3CIOA 1NXPA 5L4SA 3FXAA 3DWGA 4PPYA 2OO5C 1FQWA 4DCCA 1NN5A 2CW7A 3HZHA 5ALJA 5AHRA 3GN1A 4CA0A 1PLJA 5E9QA 2IVZA 4XDZA 3TTWA 1L7QA 2EFYA 1RYYA 2NXCA 3OQMA 1TUGA 2BZ0A 2IWHA 3TK1A 2Z09A 3FPGA 2FXIA 2I4OA 3OEYA 3CC2I 2IEKA 4TMVA 2HF8A 2QM3A 4DCUA 3B73A 1GTG1 1UBJS 4DR1B 3W6JB 1XYVA 4ZC3A 5CQEA 1UFRA 2R5NA 4XJVA 2EIXA 1XRMA 1KDZA 1U5CA 1X15A 5FLEX 2PKQP 1H8AC 2ISCA 1DIHA 1T0UA 3F3XA 1FZFA 4NFLA 1B0UA 3V1NA 2IQ5A 3S17J 3ESCA 4CDMA 1NATA 2G3YA 1A6IA 2GJKA 4MI3A 3TECE 4ZXPA 4YRCA 1IRZA 3TSZA 3Q8MA 1PP9G 3I5MA 5KUTA 3ORQA 3DLLF 4ZI7A 4DA9A 5LRRA 1P3JA 4PD4H 3OZBA 1SU8A 1AGNA 4MEYF 4FYKA 1V2HE 1RR7A 3TGPA 5ALHA 5ALOA 2L17A 2FSHA 1X86B 5C4JJ 1VG1A 2NPSD 1CYEA 2HK9A 3LSHA 3T06B 1NH4A 3IV9A 2KM1A 4O9BA 3A7OA 5AUQA 4J29A 2SCUB 1HC7A 2OTCA 4HNRA 1MAAA 3QX9A 4JYAB 2O8VA 2ZIXA 3F7NA 5EYRA 4PC1A 1J8FA 1RXSA 5CEJA 1XPOA 2VI6A 4MSUA 5HRUA 1D07A 4UUSA 2MA3A 2NVBA 1A4RA 3RRXA 1M57D 2Z2KA 4GR5A 1H2RS 3IHTA 5IVPA 2FSVC 5HS4A 3M6IA 1EHIA 4C4OA 1PQ4A 2HXIA 2J6CA 4NMHA 4P7JA 1KAOA 1FTTA 3X2FA 5K3SA 2DERA 2WV7A 1P45A 3G6KA 2HYIC 1OBVA 1TZ2A 3HTKB 2X40A 4BMXA 2AMVA 1LPOA 1NKSA 1UWVA 4QBKA 3Q3IA 4WK2B 4N7JA 3BEDA 3NFRA 3G6EI 3TD2A 5A3JA 3RAPR 4OJMX 1OI2A 3WU2E 3JSOA 2YWEA 4PGGA 3EGOA 1DIPA 2PD6A 4M8KA 4QRIA 3C3AA 3VXKA 2DQYA 3EC1A 2WC1A 4WLOA 1RRMA 3ANLA 3V9AA 2LWIA 4AIRA 5D4SA 3L02A 4JYBA 2J58A 2OC9A 3BSWA 4JK1X 1YE8A 2XTMA 4ZCPA 2WILA 1P5RA 5L3CA 3B5IA 1HDPA 2FP4B 1FS5A 5KINB 1E9BA 2JGDA 1XQ1A 2B34A 3B9RA 4ZVPA 1XGSA 4CL3A 2FMTA 3TQQA 2CNOA 4HKTA 2HMVA 1JR4A 4YYEA 2XF5A 1YCGA 4M7RA 5IULC 4JWKA 3HLYA 3PFWO 3S70A 4G4IA 2OXIA 2B7BA 2NVUA 2AJTA 4C46A 3EXIA 1YBAA 3QEAZ 3BTJA 2M32A 3IWFA 1JSCA 3G5MA 4M2LA 1YMUA 2P1RA 2FCAA 3GQBB 3TZQA 5I7WA 3AEFC 3CCJI 2G9ZA 5ES3A 1SG9A 4D79A 1N73B 3DVSX 2E19A 1V7QA 4B45A 1PT8A 3BJIC 4PLHA 3FJOA 1HNNA 4ZZLA 1E61A 2LREA 4KUMA 3BMOB 4MV7A 3OR2C 3RTDA 3D2CA 1PFVA 1AKEA 4P81A 2B5VA 1T5SA 1GL2D 5I7OA 4ESFA 2C7RA 6LDHA 1QOQB 3OE7D 1NUAA 2O8FB 2UUAB 4YAEA 3W3AD 4G01B 3ECSA 2JTVA 1KQ3A 3FHJA 3VAAA 2R4GA 3S8EA 1E4YA 4V3CA 1K66A 1I2MA 1WTAA 4ZVTA 3VC7A 2IYXA 4WPGA 4DDMA 1Y39A 3OAKA 4RKYA 1NR5A 5DK6A 4B4OA 4M55A 4NU6A 2P62A 4BNLA 1R9JA 1IK6A 4IJVA 4ITUA 3AY0A 1OF1A 4X6UA 3DMNA 4R71A 4J00A 4TL8A 4GRIA 1QONA 4JCCA 5L40A 2OZ6A 2IF0A 3OQVA 1LT9C 2OB1A 4GBMA 5ILGA 2YX4A 4O4JA 4ETMA 2FF7A 5LA6A 2WQ6A 2VKQA 5JEEA 2APJA 5H8WA 4US0R 3KPWA 2BBYA 3BHMA 1K8YB 1KDRA 2CE2X 1GQRA 3VTFA 4LBZA 3GO5A 3R4YA 2R5YB 2IE8A 3GW2A 1FP4B 2X8AA 3TGNA 5KX5B 1USVA 4HWKA 1A97A 3D0RA 4FNGA 4GU5A 3I54A 5LP1A 5G0TA 1D2CA 1LFDB 3QYPA 4KAXA 4TTJA 3NG1A 1UFOA 3W8NA 4CEIA 2XUZA 3WL5A 4M3NA 3D6MA 3EMBA 4WCFA 5J4YA 3NETA 2V1XA 4IOLA 3FBIB 3DMTC 3H5RA 1XDGA 3WXMA 4P3NA 1FY2A 2CUNA 1PHPA 1A9XB 1PFWA 3D6AA 3I42A 4KK3A 2COUA 4X8OA 2YS6A 5CCHD 3L4JA 2WKRA 2C3PA 2CYCA 3JPYA 4PO8A 2PG4A 1TBXA 2IYOA 4F6RA 1GQFA 2Q41A 2O3QA 2ZB9A 2O1EA 3IPYA 4TWAA 2HIMA 4RDUA 3BRCA 5DYIA 1D9ZA 2B3DA 2BGNA 4KN9S 4KSYA 4RVDA 1QIKA 5KTOA 2DCEA 2FPOA 3TLAA 5KJ1A 2H1WA 3ZWPA 1HDOA 2XAHA 1I4DD 1XCJA 2AI2A 4RADA 3BK1A 1NOIA 4V0MA 5KVCA 3CB2A 3Q11A 4AURA 3F97A 4MWCA 3RH0A 1TQ4A 1X7XB 4PZZA 5LFAA 1AA6A 5FKLA 5B7QA 1X0TA 2RGRA 1Y6ZA 1IN4A 2LV8A 1S2DA 1DXYA 2H7YA 3FYSA 2AH5A 5DT9A 3T7KA 2XMCA 1RKXA 1K61A 5FBQB 3KV3O 1RHMA 3WQRA 3JATA 3G6WA 2JW5A 1MO6A 1UJMA 2A5DA 3ILYA 3IDFA 1HDDC 3AQIA 3CF4G 2O7RA 4O63O 1YE9A 2AO9A 2OPHA 2R3CA 4RH3A 1FBNA 4A0XA 2HIHA 1KJNA 1FX0B 4YJDA 2NPSC 4OP2A 1DD4A 1T9AA 1WJDA 2I3DA 2WTUA 1M6VB 3HY6A 2RGYA 4X5OA 4L5EA 1LCIA 3G2KA 2OV3A 3D8NA 4YAKA 5TRDA 3D7RA 3ZY2A 1BXGA 5KO2A 2BDUA 3C7JA 4Y6GB 4A0ZA 2O61A 3BR1A 1PGOA 2O01J 5TF4A 3ZQ7A 1FP1D 1BE3J 2XCIA 4PIMA 2DA7A 3O6BB 3L79A 4BMPB 2J5PA 4ZYAA 1ZK8A 1L5VA 1I50J 1W88B 4LISA 1ID1A 5A9SA 2WPRA 3U3MA 2PD3A 5AD1A 3RC2A 1P1JA 4BXOA 5EXXA 4EB6B 4DCPA 2DDAA 2VDPB 4BBJA 2WSBA 2OP1A 3OSGA 2PGIA 3GTPJ 4OKIA 2ILVA 1S3GA 2RH8A 3DZBA 2FAXA 3PEUA 5H70A 1BE6A 3GBGA 3ZIAD 1KMHA 4WLEA 3DF7A 4E22A 1Q3KA 5LMZA 2EX1A 1WLSA 4GKJB 1P4AA 1ZN2A 3WX0A 1QG2A 4AZVA 3GFGA 4CH7A 3FWYA 4AICA 1UWLA 2M8RA 1K5DA 5J23A 4LOAA 1U0RA 4RHXA 1O6GA 5BRAA 1SD7A 5ERIA 5DDGA 4MITA 2WWIA 4AS1A 4U9IS 2CVZA 4JBXA 2XJ4A 2PZGA 2V0CA 1G2OA 5AKKA 4G37A 2J3JA 2O59A 2YNYA 3SM3A 5MDHA 4MKHA 1QQ5A 3DBIA 3GCXA 2AD5A 3RJMA 4FFBB 1IULA 5GJCA 2GTIA 3SHFA 3A0HH 4N6JA 1EVQA 2Z43A 4KXLA 1XCPA 2PKWA 1X7ZB 3MQ0A 3RVRA 2GA9A 4LFBB 1LW6E 1T8RA 1RW4A 5KS2A 5D5PA 4BZXA 4J4BA 4HVTA 5D1NA 1Z47A 2VHJA 1XNQB 3FZQA 1HDGO 1UDXA 5EXSA 5ALNA 5ALYA 1REQB 3E48A 2FN4A 1GSHA 4BN0A 3FTFA 3JRGA 2GEVA 3WKDA 1WSDA 2UVPB 3K15A 4ND4A 2UYOA 5K8UA 3GHGC 1ABFA 1GW3A 4NATA 3W5BA 4YJ2A 3DPLC 2CLLB 2UV8A 5AHXA 2LKSA 4L9NA 3WS7A 3IJPA 4QM6A 4B76A 4UHFA 1VCHA 3NOVA 5M3MJ 3EF1A 4X8MA 4FBGA 4J7UA 2VNHA 4BJ5C 5IPAA 3GK3A 3K9FC 4RY8A 1WHUA 5CD1A 3LSMA 1GL2C 4N3AA 5EZ5A 3PQFA 3C1LA 3C41J 4MDHA 1TQ6A 3NOQA 4ZYVA 4EJSA 1FX1A 5K8VA 1NNEA 5SICE 3GJYA 3LI2A 2GILA 4EA9A 5FPTA 4BP8A 4ZOLA 1LD3A 4L07A 2IBMA 4RB1A 2R6GA 5E4YA 1JDZA 1JQKA 4ZOBA 1FZEA 1QTIA 4HH1A 5DX8A 1WB6A 3UV3A 1B23P 3VV3A 1N9ZA 3C1TA 3L1HA 4BO1A 1GZ7A 5JVGF 4NPDA 4E7LA 3PQ5A 2A5GA 3AJ8A 4EWLA 1PWYE 3R7DA 2C5EA 3B3JA 5HQJA 1N3LA 3AUYA 2ISSD 1IBMB 3VJRA 3D59A 3KK0A 1TL7C 1I0ZA 4Q12A 3O2JA 4ZOAA 1J24A 1NH3A 4IUBS 2EQ5A 2Q1ZB 3GEZA 3H1JD 4PCUA 4YJGB 3FPAA 4LLLA 3CMEP 2G4LA 5EMKA 2ZBRA 2HZTA 4E5VA 1HVVA 1U94A 1KU0A 1SS1A 4IF4A 1U8TA 2HDOA 4G84A 4JITA 1IOLA 3IP7A 3MIWA 5CGQB 1M0EA 2P69A 4RK1A 1KVUA 2JAHA 4A7PA 3R41A 1KDPA 5FLXZ 1RWVA 1ECFA 4EUSA 1PL7A 5EHXA 4IVRA 3OT5A 4UKDA 4JR0A 3P96A 2PBLA 4CMIA 3IR9A 1JG6A 2JL1A 5KNCD 4IH9A 4XZ3A 1P2SA 1CQWA 4F8YA 2WF7A 3T8RA 1DG9A 3HJUA 3MGAA 2LKDA 1BOBA 4UQPA 2IY9A 3ER6A 1S8FA 5M3FJ 5LZ2A 3LCJA 1ML4A 1MMSA 4PLWA 2AXTH 1XZKA 4QPOA 2CV1A 5TMEA 1KIAA 1BE3E 3GAZA 1UJ8A 4JU9A 3WLFA 1Q0LA 4MQUA 1N8NA 1RKVA 3SSOA 3VGJA 1HW1A 3O4HA 2ZXFA 1MNQA 2ID4A 2H11A 3QIVA 2X6QA 5FBVB 1NM5C 2FPRA 3TPZA 2P7VB 3JYLA 2QUHA 1XS9A 3HYCA 3RU2A 4YIIA 4YP9A 1U2ZA 3DDNA 2X5KO 4L5AA 4B7UA 3RROA 2HT1A 3QEBZ 1PS0A 1TTTA 3FB4A 3EXFB 4HLUA 1H69A 3PNMA 1CG6A 2PR2A 3M9WA 3VX4A 1OCPA 2Z8XA 4AO8A 2BEVA 2OVBA 5DN6D 2WHPB 1JR2A 1J8DA 3ERED 4DMKA 3UT0A 4FS3A 1MA3A 3ONNA 4MGKR 4RS8A 4XFDA 3EDCA 1IF1A 2UAGA 1NVOA 3QVKA 1R6DA 2RGUA 4G65A 1Z0DA 5LQJA 2FR8C 1D7MA 2EV5A 2GTPA 3BICA 3IMFA 3OOEA 2C00A 1P0MA 4XEUA 1SXGA 2G5TA 4WKBA 2C04A 4L73A 4U5QA 4TGLA 5AKLA 1XROA 1DKMA 5BQXA 3NEJA 5HJEA 5CNIA 1UUFA 3V4OA 1NAHA 3S99A 3WU1B 3GL9A 4E14A 3BCAA 3BHNA 1IV6A 5CA0F 2B87A 5E4FA 2ZB2A 3HG7A 3HXKA 1DT3A 2ZULA 3FFXA 5BW8A 1PIWA 1FTYA 3J81A 2Q6LA 4YRKA 5TGTA 2WA2A 5JC8A 4DLNA 4CM9A 3FSGD 5JQGB 3B2QA 3FRJA 3CLOA 1Q7CA 1O3YA 2C4HA 1CVRA 4O3MA 4F9EA 4P4TA 5CP8A 3UF0A 1M1JC 3RKXA 1LT9B 2R65A 1RNLA 4G5XA 2N3ZA 1RE3A 1VMAA 1PYDA 3QPUA 1NBMA 4WBXC 2LR2A 2VDKB 3PF8A 1RC1A 4NOKA 1XCOA 5T41A 2EZ9A 4UOQA 4HYQA 3GQVA 5AOBA 3VPAA 4AAYA 4W9NC 3NFYA 3J7AC 1JIVA 5L7WA 4DY6A 2C9CA 2DETA 1D2GA 4ZVLA 2HZDA 3U1KA 3L73J 3Q98A 3VR3D 1RQXA 4QTUB 2M8EA 1Q95A 3I2JA 1RJEA 4AP5A 5C4GB 3AUUA 2XAJA 4F60A 3JW8A 4IFMA 5ALPA 2C9OA 1SULA 1S2OA 3NIBA 4KMOA 1F3OA 5KYUB 4PZJA 1TVEA 2CV0A 3KEYA 4FHEA 1NU8A 5THXA 2X85A 2INGX 2N1BA 4YBRA 1J8QA 3GEMA 1U1IA 5PNTA 5AJHA 2VJ4A 5KJ7D 1EA5A 1EIWA 4PZDA 2G9VA 5ITVA 1Y8QA 1FSEA 4JT2A 2YV1A 5ISMA 3JQDA 4IS2A 2XUAA 4DNPA 1VB5A 4EDHA 4FILA 5HLGA 3HXMA 2HADA 1U98A 3PGJA 1YAJA 2HPVA 1G1IA 4LOHA 5TR9A 5BSVA 2VZ9A 2R7LA 4IMPA 1H1TA 4CLRB 4ZTZB 2GERA 3Q7SA 4RKQA 3HCFA 3V2GA 3SPXA 4I55B 4FFMA 5HS8A 3EA0A 4ER6A 2YSRA 2GCIA 3ES9A 4D81A 1FU4A 3N8DA 1PR3A 1XK7A 3FNIA 2PG3A 1L4UA 4HF2A 3IF4A 4HFJA 3AG4H 3ASYA 1DTWA 1PWHA 4AWBA 3DL0A 2NPSB 3GRPA 4LGDE 3GFOA 5MN6A 4F9FA 2RONA 2HXOA 2OYCA 5HHTA 5EMNA 1Y80A 4OU5A 3IXMA 2WPNA 3EJ6A 1MZ9A 1TIPA 1F1JA 1PU2A 1ZLKA 3NKLA 5JXIA 2XRMA 2G8LA 1SOUA 4G1BA 3HPQA 5C8VA 1U3EM 3EBPA 5T57A 3DW1X 2DT5A 5K05A 4M9CA 5DO9A 1W9MA 1AO3A 2R66A 5FNVA 3R7FA 4LJKA 2FB9A 3UGKA 4EJTA 2BF4A 3I3OA 1FMLA 4ND7A 3CH4B 2VXZA 1C8LA 1PI3A 3CMYA 1CYDA 4RWZA 2IW3A 3LRTA 2AFRA 1ODIA 3GX4X 2M5AA 2LF8A 2ZT7A 4LZWA 3RWBA 1VSTA 1VMKA 3QJYA 2DYSH 1N78A 1LE8A 1QLED 1DDOA 1N1GA 2H1RA 5JI3E 2V9ZA 1HDEA 3BX1A 2ZBPA 4J3JA 3FKSD 3WTSC 4NG4A 2NXNA 5REQA 5G1PA 2Z8ZA 3LF1A 4KOAA 3RU7A 2CXXA 1Y3FE 1JX6A 4DUGD 4HQMA 1X1QA 1DRVA 5HJ7A 1USKA 4RS3A 4CWAA 1SC4A 5F21A 3U21A 5CDTA 1QRTA 1I7QB 1F7VA 2FQ4A 1VPWA 1WMAA 3SFIA 1M2VA 3GF3A 2GHIA 2OCYC 4RIEA 2XXBA 3GVPA 2FGKA 2CCKA 4GYJA 1L8QA 4BBPA 1PX2A 1Y6GA 1Q0ZA 1X1EA 4XIJA 1XCMA 4JXKA 4DBLC 5AJUA 4K6OA 1PYOA 4PSWA 4NMLA 1EZZA 4KI0A 1LP1A 4AJHA 1VPLA 4PAQA 4LRYA 2F9FA 4MX8A 2G04A 4EAAA 5BW4A 3ECHA 2JI7A 5JATA 3T4UA 1JB0J 4FZ5A 4RPCA 3CO7C 3HDHA 4FS8A 4R0VA 4FYHA 2UYHA 1YRAA 3GHGB 1QHSA 2NUTB 4LBWA 3NBMA 2FJ1A 5J3JA 3DVRX 3C7CB 1GZHB 1KH3A 4JAVC 3OCJA 3DT6A 5JYBA 1EDOA 3DO8A 1ZLJA 3ZCSA 3GPLA 4JA0A 3WTUC 1UAAA 3KYBA 2PJPA 2NU8B 3PXXA 3AEEC 5JNTA 721PA 1GL2B 3JVEA 4JUFA 3S2IA 1C7RA 4KC0A 3B5JA 4WF2A 3OF2A 4XKBA 2EOAA 3KHSA 1OLUA 3W6VA 4CF3A 2IUTA 2L5QA 3CUTA 4EGQA 2JFUA 1QC5B 2WFAA 1SA0A 4EX7A 1RXWA 4HDKA 1WGXA 2PTGA 1RKWA 1UHWA 4RPHA 3KCCA 3E53A 3F9RA 3MCAA 1PTKA 3MRXA 3WLMA 4LVCA 3ZN1A 4WY8A 2MH2A 1JTVA 1OLXB 4QHYA 1N7GA 2H6EA 3H1ID 4YXWH 4E3WA 1EDBA 3L2RA 3E6DA 1JJAA 1Z7EA 1RP1A 1Q0PA 2WBLC 4IMRA 3GUVA 3C5EA 3MLAA 3ZWCA 3BCCD 3G2IA 1SXIA 4N0MA 4TKMA 5C8ZA 3NUQA 1XDZA 1K04A 2QUIA 4RVCA 1UZAA 3EXHA 4OB7A 4R2KA 4Q37A 3DPIA 4GMDA 4BVJA 2F1HA 5BSKA 4LAFA 2Q5CA 3UOGA 2XADA 3FN4A 4FC6A 1KEEB 4U0KA 5F52A 2A5WA 2W0SA 5FJJA 5CT4A 3NWBA 4JLMA 1C3LA 4NCAA 4KDEA 3UPUA 3GNLA 3G8YA 4GMXA 3ZLTA 2E5YA 2HSZA 2PUBA 1E79A 1JMYA 5IM4F 2G8YA 4KQMA 2ZTSA 1NGSA 1RQRA 4PLZA 4LG0A 1V48A 2WM2A 2ZVJA 5G0VA 1VHTA 5IYDJ 2ZANA 4A8TA 4XLLA 3HKZN 2B6HA 3ENVA 5KSZA 4P53A 1DJQA 3M2PA 1O3QA 2RKOA 3R75A 5APUA 4NESA 3II6A 1J1DC 3TVYA 3WU2H 2Z5HA 1QH8A 3BP8A 4WAUA 3GJ5A 4PCAA 1P1IA 4HFMA 1GFIA 5KJ7C 3CNEA 1SCJA 5HA5A 2ERXA 4S1NA 2X2OA 3PFNA 1RYHA 4M98A 3AI7A 1XBTA 3L8FA 3UXYA 5K4GA 4D3XA 2QLNA 4C6RA 3LQ4A 3CCQI 4EA7A 2XSZD 2CLCX 4LOKA 4PSKA 2CF6A 1HH4A 1RJFA 2V8OA 3QLUA 1JFFA 3OVMA 1QDLB 2LTPA 5I7FA 1TJ5A 2QR2A 1T0FC 3ZWBA 1KAGA 3CTAA 2BN4A 5EGOA 1MNAA 2W1OA 4QTXA 3O8HA 3OBIA 2I8AA 1NTZG 3GJQA 5LU9A 1GV2A 2G70A 4I9HA 1JPNA 1C3EA 2D0DA 1D6SA 5B7GA 4A6DA 4QOHA 3F6RA 2C96A 4QDKA 2VRSA 3FDYA 5IUJC 2PMEA 4TXHA 1UK8A 3O3CA 4YMTA 2Z5LA 3I05A 3OYEA 5DOZA 4JENA 1P17A 2DHRA 3OY9A 2ZQ5A 5IH3A 4RCVA 1YBVA 4YJFA 3AR2A 4DRXA 3MB5A 2XEDA 3K4QA 1Y1QA 1ONPA 3ZV3A 2F43A 2AXLA 1T0BA 3QFCA 2OTLP 1YE5A 4BNYA 2TMDA 4Z1MA 1DDNA 1WQ2A 2ET6A 4ENUA 2CD9A 1QL2A 1OX3A 3OT1B 1QFZA 4IOJA 4Q9HA 1XTPA 4I9UA 4AI6A 3ZZ1A 3TBIA 1FMWA 4UV8A 1M1XB 4ENNA 1S3IA 4DJ5X 1TK2A 2JAUA 2AGVA 5ALWA 2C2MA 2XA2A 2XEXA 1H0MA 3CMAP 4EY7A 3R7LA 1I7LA 2J7PD 2FXPA 5K8LA 1T25A 4KXYA 4R68A 3S2YA 4EELA 2FEPA 2X5JO 4IJMA 5BSEA 1YQ3C 1ZHFA 1YA8A 3U09A 1KGDA 3DUFA 1U7XA 1ZRTE 4Y0VA 5H81A 3P0IA 4M6WB 4KR6A 1IZZA 4FWBA 4O1HA 4XRRA 3L84A 1MKYA 2OV6A 1CZOA 2YFHA 4BTLA 2I8DA 4GXOA 2JDIA 1GN8A 4MGHA 1MBFA 1SCAA 2WWYA 2Z4SA 3RYTC 1G6KA 1Q84A 1R0RE 4WBNB 1E1RD 2UYYA 3MVPA 4LK3A 4QU9A 4MLOA 1X7WA 3SQOA 4G12A 1A1SA 1O58A 3KEOA 4G0ZA 1YIJI 1M1JB 1GWNA 4AVYA 2II6A 2Z5IA 2REQA 1MRZA 1Z5ZA 3J80K 1O4XA 3ETJA 1VI2A 1JHMA 5AUPB 3VPXA 4K88A 1NVMB 4JVLA 4CM1A 2ATCA 4ACAA 4AWXA 2CVFA 3O38A 5I9NA 2QNRA 2LD5A 3HYTA 4CEJA 2F8LA 2FI1A 1IWOA 2QORA 1KRXA 5ILQA 4IJQA 1DKLA 1QGPA 2JR8A 3A8TA 4LWQA 1NI4B 1HGXA 2IPLA 5E8GA 4AMYA 1AZSC 5C8YF 2VSQA 3FKIJ 2PQMA 4LXIA 3R7BA 1E5DA 4CL0A 1KTMA 2UZ3A 3EB9A 1HT0A 3PI7A 5LXTA 3AI1A 1RS0A 3NOXA 3G2OA 1O7JA 1GD2E 5LQUA 3OSZA 4IIYA 3WGNA 1SAYA 1S9HA 4BIMA 4MUJA 3EZNA 4UMEA 1OTXA 3ZZUA 4MR9A 4HYTB 5D8LB 3RUFA 3ABLH 4DTCA 3O90A 2VDWB 4W5NA 2JEZA 1IM5A 5B3SH 3LMKA 3X1ZA 4N3NA 1FU1A 3LDGA 1SVFA 2GJ9A 2PGXA 2ECFA 2W2MA 5AT1A 1I27A 1YB4A 3M4NA 1Q7YQ 5FHQA 5CFZA 2MGQA 4RSRA 4U6QA 4BE4A 1ACLA 4NS4A 2ZJPF 4RO0A 1DBQA 1KYXA 2QVGA 4Y8VA 1FEZA 5FORA 3TIVA 5CCEA 3NV9A 5ITSA 2FWRA 5FH9A 3FFAA 5JNUA 1HI9A 2GYUA 3K30A 3A2LA 4IRHA 4CMKA 4UM7A 5AVXB 3TLZA 2O0JA 2HU5A 3F6EX 2ZT9D 3TFWA 2R92J 3DE0X 2ADFA 2IU0A 3UQZA 5KTMA 2X51A 2IOFA 3FAKA 4JKIA 2CBXA 1QHHA 5BW6B 4EDFA 1U65A 1JHVA 9LDTA 1C81A 3IVMA 2NSJA 3DKPA 1EK1A 4QQ8A 4FLMA 5EFOA 3WBBA 3Q3DA 1TGVA 1XSXA 1SMKA 1NN1A 3AWDA 2VZ8A 1H3FA 1VLZA 1GTJ1 1P18A 1U0LA 2MIIA 3N70A 5GP1A 4F9TA 3DAGA 4DA0A 2Q3CA 3WL7A 1XELA 1HFKA 3TG2A 3N0XA 4DWVA 3ICVA 4OV6B 2FP3A 2V6CA 4JUAA 5J58A 1OISA 2G9QA 4NOMA 1XK6A 4AZSA 3ZJYA 3IE2A 3HOUJ 4AYWA 3OY7A 3A3OA 2VRWA 2WKSA 3A02A 4QOJA 5JIBA 3CKYA 2W6JA 3BR3A 3MGKA 4DCJA 2O03A 2PL5A 4KLNA 4QXMA 4BXLA 3PGXA 2JGNA 4IH4A 2WIBA 4NMXB 3X1MA 4FYJA 1JCCA 5T4EA 2A1TS 4GL2A 4NZZA 1WXQA 3DXXA 4D4HA 2X9DA 3VR4A 2ZTLA 4HUQB 2O06A 3O2SB 2Q5EA 2R7WA 1WZEA 4GYWA 2J1LA 1F4LA 2JFOA 2ZSAA 2F00A 4Z6YA 1Y5NA 1KOJA 2YZKA 4U4AA 1RQLA 4HEA2 1MTZA 1NMQA 1AKTA 4HGRA 4CCKA 1S5LX 1ZOOA 2QT9A 2ZRAA 1YCHA 2QQFA 3THXB 2QOEA 3AUJB 3LPNA 3FH0A 3BL8A 4FGKA 1XDSA 2WWFA 1USSA 1CQIA 2RC6A 3ZJUA 3RGWS 1DKOA 2REBA 3NWTA 2A1UB 1EDKA 3RFVA 2KJQA 5C4MA 1UBMS 3QI7A 4BC0A 1TJYA 3T97B 3D71A 2YY6A 2EFDB 5MGBA 3KT3A 2KOGA 4E6EA 1C3XA 5E3MA 4CT0A 3LT0A 4P0TA 1P1KA 3GJ8A 4MUXA 2NV6A 4HDMA 4U0YA 1XGOA 1TJ4A 4R6XA 2ORED 4DIKA 4MB6A 3HCEA 3ME5A 1K6YA 1T10A 4X1EA 1VC2A 2X76A 4BMDA 2ZBUA 2HCFA 1S7GA 3PX2A 1ZNYA 1T08B 4N7RA 2J85A 3U39A 1UXKA 4D4KA 3WMWA 5JBIA 2CL7X 5EP4A 1J75A 3T7JA 2XAQA 3UATA 3ROGA 4OQNA 4K8OA 3M0DC 4Q9NA 5GZ3A 1IUKA 4W1UA 2L2OA 1T0PA 5C52B 3V34A 5IP6A 1SQVD 3EYYA 4V19K 4TWJA 3MWDA 1Y8RA 3FBTA 3DNFA 1T3JA 5KKCA 3QFTA 1PJAA 4ISBA 1M5RA 5E79C 4ALKA 3W6UA 4LY6A 1WHSA 2PV0A 1ZYUA 5FROA 2ONCA 2AOTA 2F8MA 1KH1A 3W05A 1NVFA 3T5GA 3I01M 2ZCVA 1LLDA 2C5SA 4F92B 2CUKA 3CZ4A 3O5AA 1PUJA 3MN1A 5GVSA 4IL6C 1N77A 3VKGA 9ANTA 1IG7A 2COBA 1PFYA 3JAKB 4FFDA 5ALQA 3QFSA 4YC7A 3R3WA 2JUGA 3BK7A 2XUOA 3UJNA 1WXWA 4PIVA 2NVXJ 1IRGA 4YP0A 2MTBA 3FIJA 1TAUA 4XPIA 4B3BA 1RC9A 4A82A 4HF1A 3VKFA 3AIIA 2PKRA 3AHDA 4M9QA 1R0WA 3I6BA 5A0FA 2CVHA 1UZLA 1GVJA 1SHKA 5L7YA 4MGEA 3KZ1E 3ONWA 3IH2A 4RAZA 4B4KA 4XR6A 2FWPA 1FNSA 1P77A 2G9UA 2I5PO 5F2NA 1WBDA 1YZQA 5AW6A 3BULA 2C7GA 4UTRA 5HFNA 2O8NA 4HWPA 3TMKA 3KEGA 4QDTA 3DAOA 2HFED 4ENPA 3E9DA 1PV1A 3THSA 2C92A 5D00A 3B1FA 2XE8A 1L4EA 3OJLA 4I2LC 5DGIA 1JDUA 3CUKA 1YQGA 1FFXB 2BMJA 3T8YA 2VHTA 3IUBA 1S02A 1XKXA 2P9FA 3D1JA 4DSOA 5E1OA 2B0JA 2BI7A 4TTIA 3F6SA 5DNEA 2MFZA 1RI1A 3AL3A 2A58A 2DYKA 2JJ2A 5ENDA 2XNHA 5KHDA 2OD2A 4J0HA 5L3QB 2V1NA 2PL1A 4C3OB 1XMVA 1Y4AE 1J1DB 2O01H 4GSLA 1JTHA 2ZR9A 1GG5A 4LJLA 3UENA 3PL5A 3N0RA 5KNBH 4CEHB 1DZIA 2X8JB 2CNLA 2PZEA 2FW0A 2LOOA 5T7BA 3L35A 4P1ZA 3SLGA 2ZXJA 4GAEA 2HJHA 2XZOA 5H9VA 1HWYA 2MR5A 4ACBA 1DBRA 2G3AA 2ZLBA 3WLPA 2RDPA 3MINB 2W2PA 1AK1A 3GLHE 1Y1TA 5LR6A 2BCCD 2WTBA 2F3QA 2GX6A 5H3HA 1ORKA 1POWA 5EXEA 1V9LA 3O4GA 4ALMA 4U0WA 2ZSHB 2P1DA 4EOTA 2QDXA 4NP6A 4Z7QB 2VNKA 2E48A 3KUKA 5TQ0A 1X4OA 3FZVA 1ETWA 2Y48A 1XN4A 3OWHA 4C7XA 3T35A 3HJBA 1GT91 1ZARA 1LUJB 2WF8A 4KQ1A 2ZT9C 3WUUA 5KKZC 2AQHA 5JROA 2I4LA 2BWJA 3PDUA 3TJMA 4CQLA 1I8TA 1EUZA 2ZJSE 2POQX 4HXEB 1Y48E 2PCLA 8LDHA 3WNVA 2C07A 5DM70 5KVAA 4FNMA 4E5NA 4IO9F 4DOJA 3FCAA 2HJWA 2YUSA 5CHEA 2XV4S 3GDGA 3MBKA 4MV6A 1D1TA 3DE2X 2QTFA 3KZIC 3QLJA 3HA7A 1EDJA 2C5AA 2B4AA 4BNFA 1ACJA 2VZ0A 3EFBA 3IBTA 3HCOA 4DJTA 3CQ9A 3OX1A 1PVEA 3H3VK 3PG5A 3S27A 3L72D 2LSOA 2AB0A 4C06A 3W2EA 3PXBA 2VJJA 2IT1A 4MLCA 1GOTA 1TNTA 1V8DA 2JSCA 3GRVA 2WJVA 4JH0A 3MCTA 3EODA 1PNRA 1FJPA 2G1KA 3USSA 3GR6A 1QIMA 1IC8A 2QE6A 1U3WA 3PTAA 3HACA 4OSPA 5E38A 4BQSA 2XGCA 2OY0A 5HKLA 5C1OA 1VHJA 3FRHA 5JS6A 2OXFA 3MTBA 1NJFA 2Q28A 3TRIA 1IN6A 5HZKA 3AEQB 5J1RA 4KO8A 2PIDA 4G8DA 3LPCA 1YS7A 5DW0A 2WSSA 4KPUB 2QX4A 2FWJA 2OXCA 1V9SA 1W0KA 2ATXA 5BSTA 3EEIA 5BOSA 3NLLA 2CHVA 2OWDA 1UC4B 2HGZA 4CZZA 4UTZA 3N2GA 2QLBA 1EWKA 3U7JA 2V6EA 1NTKK 3L18A 5FYDA 5BURA 3IPLA 4WEQA 2HMUA 5I9LA 1GKUB 1GL6A 3ZXIA 5B7PA 3NRJA 1OXUA 5KQLA 1N6OA 2PSJA 3WR5A 1A2QA 3IKLA 4CFZA 1F0YA 1GXQA 1FS4A 1U78A 2FZKA 3EGWA 2O3SA 4URYR 1G2CA 5IVIA 1I3KA 2CB0A 1P1FA 2Q2EB 1UPFA 1S1CA 1NTKJ 1CY4A 1VSUA 3JD0A 5CVEA 1JQJC 3UG6A 5DHRA 1I80A 4U2KA 2WAQN 4QOFA 3TQSA 2UWMA 1JQ5A 2OLKA 1VJRA 4H3VA 4C87A 3A6DA 5GIOE 2PD4A 3EDMA 2PMKA 2OHOA 1SBTA 1HQKA 1L5MA 5F35A 4XDHA 2KLVA 2PMDA 1NZJA 3IJEB 5TPWB 3DV0B 5CBOA 4JQFA 3I8OA 4L0CA 1V1RA 1L6RA 1VL6A 1XXHA 2DTRA 3L05A 1FSSA 3QW4B 4AYXA 4IXAA 2BKEA 3RIXA 5DGXA 5AXCA 1S9KD 2P0EA 4R0NA 2KLUA 3UCXA 1FMTA 4BV2A 3U1CA 2IHNA 2SECE 2PKQO 1R36A 3A1NA 1VCMA 3HWX1 5EEHA 5CPFA 1BCCG 1K5PA 1M73E 4BO3A 5A7GA 2NVQJ 4KKXB 4DIMA 5AOAA 4DJDC 5KYYA 3PPXA 1FLVA 5DCYA 5HUJA 4Z9AA 4D3YA 2XV5A 1IEVA 2EFQA 3BMCA 1W25A 1KN7A 5DS9A 3DO6A 3ISVA 4D0NA 5DCMA 2JBHA 3H1LG 4RTKA 4EP1A 1NOHA 1PPJG 2VC1A 2ZYWX 2CDCA 1DKPA 4OQDA 3QHQA 4JOQA 3DSRA 1NXXA 1AQIA 1VZ2A 2IH2A 3VSCA 3HKCB 4ZVNA 1K7CA 4UB6E 1EZVE 5IC4A 2A67A 1OA0A 2QZJA 1DS6A 3CN7A 1WMEA 5I8WA 3TQIA 5K6RA 4CIBA 4RL4A 4NL4H 2LMDA 3ZD6A 3PKIA 1M76A 1QYDA 1VQKI 4K3AA 2FMKA 2IEIA 1KEWA 2DP4E 2XE7A 3NC0C 3I30X 2BY1A 3PNPA 1XL0A 4MS1B 3B5EA 4O2BB 1A7AA 4KXNA 3K1NA 1XT6A 4TL6A 1LEHA 5K0LA 2DJ5A 2DN0A 4MH0R 1M1YA 1MENA 4BP1A 2XGJA 2ZUVA 3BWGA 1KF0A 2H5JA 2FPPA 3W6NA 3G71I 2CFTA 1PT6A 1S72P 1XCBA 2B92A 2C3UA 3F3MA 2XF6A 3GEBA 3TB6A 5CEFA 2PSSA 3AEDC 5WRFA 3ET4A 1FEXA 1GUUA 5AVUA 2OUKA 4NDZA 3LXMA 4HL6A 3PX7A 3B5NA 1HNXB 4WNCA 1PQYA 3NVDA 3F8WA 4JOBA 3ZXUB 5BN3B 5BO5A 3CDLA 2Q4BA 5TQVA 2BFPA 3M1LA 2WFLA 1IBSA 1U3DA 2I9PA 1NTOA 5JZOA 4R83A 3BIXA 5ARCA 2A0XA 2BEUB 3KDPA 1HEUA 2ZI7A 1N7JA 3QPDA 2XAAA 2WG0A 3FUCA 3OOJA 1NQOA 1TKAA 5AW2B 4TTAA 3CWCA 3GUCA 1XMSA 3KQTA 4L51A 2K9YA 4HDNB 2JO1A 3DTTA 2RNGA 1DTEA 4N47A 1M7LA 3OLWA 2CVOA 4G97A 1R88A 1Y81A 1UINA 3FK7A 4LKOA 2BEJA 2IPMA 3IUJA 2F8TA 3GMEA 4MRNA 1I5OA 1ULBA 2VPZA 3I1JA 1BX0A 1GG9A 2WQZA 3RC9A 1QRUA 4AUMA 1LJ2A 1R0BA 1ISJA 4RY2A 4JT9A 1RWOA 2AQIA 3DYBA 1JIIA 4OAQA 2FETA 3D3WA 2WWWA 4UCWA 5B3JC 4B4VA 3HKBA 3WV5A 3KP2A 4IDDA 4OSOA 1ZBDA 3G1MA 2ZCWA 3LDAA 1K2WA 4LZAA 1SUFA 3DC2A 1BH2A 2D1HA 4URFA 4PLGA 4A8JB 1U2TA 3LIDA 1L5ZA 2IDZA 1MP0A 1AUQA 4G24A 5FUWA 6ABPA 4HEHA 3JALA 3O93A 3RUAA 1S9DA 3LYLA 2A6EF 2JFGA 2JI6A 1E2PA 2DFFA 2D2EA 1NTKE 1LVAA 3QP5A 3C3CA 1ZRCA 3GLXA 3I56I 2GMWA 3CP8A 2D59A 4PQYA 5LQNA 4O8CA 2Y1WA 4TSKA 1HBXG 1P1CA 2R1TB 3DBOB 4X93A 4ZRNA 1V8BA 4UXJA 3CEMA 1D8TA 2RGVA 2YYZA 2P7JA 3H9CA 1NONA 1WVGA 5A4DA 3SZOA 1YZLA 2YH2A 3VYSB 4C14A 1O0BA 3QY0A 4DKJA 3QPBA 2VDVE 3MRTA 4DMLA 1FBMA 1L3CA 1Y6IA 1VFCA 2BTQA 4NDAA 1BIAA 2HQSA 3KSAC 1JS1X 4UNQA 4ZT6A 2P9JA 2WMMA 4LBYA 2A4MA 3AKDA 4CHGA 1Z0IA 3NALA 4C2UA 3C4JA 4NYJQ 2M6KA 3UWMA 3C5VA 4B8XA 1P62B 3MD0A 4BO4A 1XRJA 4H0FA 1SQPK 2KXPB 5C18A 2Q1XA 2F3TA 4X3PA 5EHQA 4QDZA 2C31A 3U1VA 3CCVP 5ECGC 5GTIE 3OZTA 1QGOA 1FRQA 1BOAA 2HK8A 3JX9A 1OFGA 3TR5A 4B8WA 3GHYA 3VMFA 5LEKA 4ZTFA 4Z4FA 1WNTA 1DEHA 3CZ9A 1A8UA 1E4EA 4BNUA 1VMDA 3NJRA 4ZEWA 1U0NA 3WWPA 3ROFA 2Q1SA 4OAPA 1L1RA 5DGTA 3MSXA 3KSMA 1VHWA 1LGYA 1YB6A 1ZH6A 1SQPJ 4EHFA 2ZROA 5JTUA 4MAFA 4I1SA 3PT5A 5FI5A 1VCIA 3FX0A 2R87A 2QVAA 3KT8A 4MCJA 5KTKA 1LU9A 2B37A 4UHDA 2OFOA 2YCBA 3INGA 3BE5A 4A2CA 2JPBA 2FX2A 4P3YA 3A9VA 1NC1A 3TD9A 4JELA 4F4FA 4NCXA 3ZOKA 1UPCA 2GBLA 2XQKA 5AP9A 3A14A 1WHTA 1AG9A 1OT3A 3KEFA 5D5QA 4OCZA 1ULUA 3D3EA 3EBLA 3NIDB 3OOHA 3RYFA 1KEKA 1ZR2A 1G21A 2VFAA 3QLTA 3W5SA 4XASA 3DOUA 2PUGA 3ZBQA 3I9V2 3AU9A 1RLIA 1D1PA 3D81A 1LS1A 4PG7A 2P0YA 5BW5A 4D98A 4TZTA 4JLAA 2PL9A 4IDOA 4BCDA 2D7DA 1UKZA 1KEPA 1S5LE 1QBJA 2V6IA 1Q20A 2ZT9B 1GVDA 5KKZB 3WHPA 4XTCS 3G89A 4HB0A 1HDYA 2G5PA 1CQZA 2XGMA 3ZLBA 3JRXA 3SKYA 3BTVA 3DV2A 5AHKA 4JSRA 4N5HX 5JMWA 5AVWB 1BCRA 4M4SA 4IS3A 1OTHA 1X8YA 4H18A 2BFEB 1RPAA 3L06A 4RA6B 1QRAA 2VT6A 2QMYA 2JJ7A 5JISA 1GY8A 2IYYA 4C7MA 3A4NA 3PSHA 2EKLA 2ZRPA 1YBKA 2W00A 3K0AB 1WUHS 5IF9A 3R20A 3QKUA 1T5TA 1RJ9A 3AETA 4A0QA 1G5HA 2QQ5A 1JHPA 3CZMA 5APTA 3UJ8A 2FNPA 3RJ9A 3TF5A 2V96A 4L9RA 1F6WA 2JI4A 2UYQA 1XQVA 3OCXA 4FDAA 2QLLA 4IQ4A 1QZUA 1MZPA 1HF3A 3JW4A 2GAUA 2B7LA 2BUAA 3H1HJ 4ZTUB 2W8BA 3DEIA 4YT2A 2OFWA 3AV0B 3OYMA 2D5AA 4X85A 3AYXB 2AFHE 4J03A 2HCBA 4UW9A 5KYNA 4RKFA 3AEZA 4E2WA 2I1WA 3EXEA 1CUBA 3EUWA 3UFXB 1SO8A 2QF7A 2NPFA 2E4AA 5AW1A 1JA9A 1RVV1 4M0FA 4FSXA 2CHUA 4N9WA 3ZE6A 4Q3KA 3KYQA 1OXXK 4YUVA 1SQXD 3OSUA 3N6RA 3Q10A 2IYSA 5L53A 2VBIA 2CBZA 1VKNA 4Z2YA 3TJRA 1EX6A 3SQNA 2ZPTX 5EP1A 3QKRA 4A4DA 1YHZA 4NY1A 3FUVA 3S1RJ 1EZ4A 4RZIA 1U9NA 4Z4QA 4DCMA 3RT9A 4INZA 1JSRA 1FUIA 4GX1A 3GJXC 4DCNA 4D7MA 3BCUA 4Q47A 4LZZA 3Q1MA 1ICEA 2IFTA 5CM8B 4CPDA 2W2LA 1MMAA 3D6HA 1I3OA 4A15A 4AZ3A 4RWEA 1NWHA 4IV8A 1SKBA 5CLIA 1AC5A 1BQ3A 4FB5A 4K9OA 3H1GA 2QEQA 2CHGA 4EKNB 4JP3A 5D8KB 1QZEA 3GAMA 1ML3A 4C9BA 4PYKA 3H2BA 1YDHA 1OFUX 1BL0A 4QPDA 5D84A 2IZ1A 4FCYA 2OZVA 1V1MA 2EA2A 1AKUA 3V80A 1Z5NA 4BFLA 3C6YA 3OX4A 1Z4KA 1YR8A 4KGDA 3AZPA 4D0SA 3LX5A 4I4IA 4KGVA 1VQ9P 3Q72A 4Q18A 3WIUA 1AF7A 1UT6A 1EZVI 4H7KA 2AI1A 3KD2A 1SQGA 4EZBA 3BZBA 1XAIA 3CGGA 1WOYA 4HWOA 4YWJA 4HO1X 1HFEL 4WVLA 3E7DA 4WNYA 1Y9ZA 1E3OC 5LNK6 1MKMA 4NQWA 4ZZ2A 3RI4A 4MFEA 3KAKA 1NF2A 1SQPE 2JATA 1EFKA 2YU3A 4ZYLA 1ZAYA 4ER7A 2BZ1A 2Y2ZA 4B35A 2ECPA 4DHEA 4H9GA 2ADOA 3V4QA 5KSOA 3DTKA 3VAYA 2DHDA 3L5OA 4MW4A 3D0QA 3HR7A 5D01A 5B66E 4URZR 2Z9CA 5H9WA 4MS3A 5JXWA 2FZ4A 3C97A 1H22A 2DLCX 3NRBA 4QUEA 1IEWA 3FXQA 3VHXA 3AG5A 3ZCVA 3MHVA 2GI4A 4CCJA 3T5AA 1FJLA 4LOCA 4Z6KA 4ND3A 1GNVA 2RHDA 1IVYA 2VHVA 2VBGA 5DDIP 3VISA 3VZDA 3BTOA 4Z86A 5J43A 1ZITA 4XRGA 4ZMBA 2XRFA 2JN6A 3R2PA 2EBFX 3JRFA 3OECA 3OLVA 3L70D 5C7LO 2XLBA 2HFHA 4C4TA 2XWJI 2O50A 3OJCA 3MCVA 1RRJA 3UAOA 1U57A 2WF5A 4BXFA 1C8VB 3KKEA 5CNJA 2R47A 1DSSG 4G2NA 5ESXA 3IMKA 2X2PA 1K79A 4I5GA 3RVPA 3EVZA 4A3BJ 4BWFB 3MJCA 4HVLA 4RTLA 2JCVA 2O0HA 5D5HA 3QUAA 2XPUA 4IFBA 4F2DA 2C03A 1EAMA 2C7OA 2EDAA 4OOFA 4PSXA 5JMPA 3HBAA 5I9IA 1BVRA 2QN6A 3B6AA 4BKRA 3CNOA 5J4VA 1JG2A 1TQDA 4OA5A 1H6DA 2RIPA 1HEIA 2A61A 3V46A 5EJEA 1W7AA 1M7GA 4J01A 1M0TA 4JP2A 1YL7A 4AQRD 3A32A 1JYEA 1MQSA 4CT5A 1R0XA 4IEIA 4C78A 1ANKA 3TFQA 1WCWA 3DFMA 4XLAA 1E1MA 5J2TA 2R44A 1HOXA 1HGZA 9LDBA 1C2YA 4JJIA 2DH5A 2VIXA 3VJLA 3GLIB 5CMLA 3SWFA 2WIFA 5FUXA 1KWKA 3SHOA 2FPGB 3KQSA 2QTBA 1RH5B 4KE6A 3RKYA 3H1HE 3LU1A 1UOEA 5KOJB 3HO1A 3OU2A 3KZMA 1IK9A 3L7DA 3B1WA 3R7NA 4AQ7A 3F6OA 4RVFA 4RVHA 4CE6A 4PG4A 5JQWA 3RK3E 3DFZA 4PPFA 5FD5A 4MWZA 2HKIA 2W6ID 3M4YA 4OJTA 1DI0A 1OXBB 3TDNA 2NVOA 3W9YA 4Z54A 4ZHSA 4LC9A 5BVGA 5I7HA 3QK7A 5L51A 4IR7A 1K6OA 3ZKWA 3WJAA 1FJGB 1ODJA 1C9KA 4KYIB 1IK7A 2D2CD 2XT6A 1N2IA 4K6CA 3CCUP 4QTTB 5CM2Z 5I4CA 4ZYWA 3FCEA 5GONF 2JK3A 4BO6A 4LCEA 2FMIA 2D45A 3AP2A 3V97A 3LHKA 5J3LA 4WCFC 1YFZA 4PTZA 4CIDA 1LWNA 3ESQA 1ULYA 4EFNA 1YW9A 5T3YA 3PDJA 1Z39A 3STWA 2BTOA 1JSZA 2P5SA 3IE0A 3IB3A 1IFNA 3RCOA 2A9KA 5AUNB 5EJIA 3OYAA 1CT9A 3QRWA 5D2CA 2I2BA 2YASA 1ZH0A 2FMXA 4URXR 4UTPA 4GEGA 1ISGA 1YRBA 3IHUA 5DT2A 3RSQA 3TW0A 4NPFX 1TZJA 2XUJA 1NIJA 3C0KA 4C76A 2G76A 1UC5B 2FWAA 4LY3A 3N2ZB 1ZRFA 3IOMA 2WSMA 1M5TA 5DASA 1BW9A 5HS9A 5KBYA 1CJMA 3GV0A 3PUWA 4K9KA 1PJ3A 3U40A 3HO6A 4AUWA 3Q7TA 3UYLA 2XVZA 4KMRA 5IC6A 1SBQA 2XSDC 1ORDA 1XL1A 4E13A 3PDIB 2B1RA 3BA6A 2VNJA 2VJMA 2GPSA 2PX9A 4M1KA 4G6QA 4ME6A 3I4NJ 3HHEA 4GO1A 2NO7A 2BLNA 3V5BA 3SXPA 4EFMA 3OU6A 4TWZA 3F4LA 4XLCA 2JAQA 5DXAA 4PANA 1Z6GA 3A9WA 5ADVA 2K7FA 3FI0A 5E7JA 2VXCA 3EXG2 4LXUA 1SD6A 1TPZA 4WJLA 4IG4A 1I33A 3RJPA 3ZY3A 4BB0A 3CPJB 2EPFA 4NBQA 3ZQHA 4G2TA 4KR9A 3NYIA 1X1PA 4IHTA 2X1MA 4OQLA 2BBWA 4EFKA 1VQ4P 3DBHA 4PINA 4QATA 3KV1A 1I2ZA 3KOXA 4HN4B 3LS2A 4YWHA 3LOCA 4C7KA 3IV6A 4W5RA 2GCNA 2PJRA 3JYPA 5CBPB 1T3LA 1M66A 1DX4A 1PZHA 3PWZA 3VO2A 1DOHA 1IIRA 5G0SA 1J25A 4WESA 3GZNB 3OT4A 2D4AA 2MDTA 13PKA 5KVRA 2P2LA 4C4AA 2CLDX 3G17A 2DLLA 1ZKDA 5LQSA 2GZRA 2R00C 1AMUA 2B9EA 2AJCA 1T5DX 3SMVA 4F96A 2IOQA 4HLQB 2FXMA 3RFFA 3S3OA 3G1TA 3TEMA 1TZKA 5CXSA 3GT7A 1U1CA 2SKCA 4I9FA 3D6JA 3D1VA 4PNZA 2F6CA 1SXHA 3L4BA 3CX5D 3IOCA 2ZJ1A 3LPAA 4MCHA 4CM9D 3RK0A 2ZMEC 4DOMA 1DJMA 1DV2A 3I6QA 4J43A 4ZRDA 3K09C 1YL5A 3KS9A 4N54A 4FPXA 1ZY2A 2P7HA 4YTEA 2MU1A 5CDFA 3WUTA 3FSRA 3CCMI 4J7CA 4JL8A 4LE1A 1JTFA 3FY4A 1C9DB 4KAFA 4LRTB 2HVQA 4MVJA 1NW8A 3W7VA 3EGEA 1W36D 3VZRA 1KFJB 2O2EA 5C32A 5JJLA 2ZJZA 5BWCA 2BEZF 2QTLA 4WL0A 4JF7A 1GSIA 3RU3A 3CPWO 2NYXA 5DLQC 5COBA 1QE0A 3IJRA 3SBDA 4KDFA 1N5DA 3E5RA 5K5GB 3G1UA 4INJA 4C0BA 3RB8A 1VQNP 3GWZA 2Y0DA 5K01A 1MZBA 1SPBS 2EAUA 2IKSA 1W2GA 4BE1A 4EBBA 4FJ2A 1U7UA 1KQNA 1U5BA 1QPBA 3OQOA 5JECA 3PRJA 4F2GA 1XVUA 5DBGA 1FZBA 2DFPA 2C9BA 3M0AA 3SC2A 5JHUA 1I14A 5CB4F 1ND6A 3O3KA 3EDOA 1D4OA 4PAMA 4WN3A 3SAJA 3GT4A 4ZKUA 1VJ0A 4GHWA 1WMBA 3Q87B 1G8HA 1J2RA 2CF5A 1ZVKA 3BR0A 4PSAA 2EJBA 1FZQA 5I7EA 1LKXA 4DANA 3MUNA 2F48A 3QV2A 4TQGA 5U4XA 3RF6A 3L0CA 3FLBA 5HK8A 2KSQA 5I47A 4FQ5A 3B51X 3WDSA 1YA4A 2XCTB 2F2EA 4NBVA 4IZIA 4IJWA 1RRKA 2BMEA 2R6R1 3S7ZA 1NZDA 4RK7A 1D04A 3MGNA 2W6ZA 3B1JA 2ELKA 3SLKA 1O87A 3ICQB 2RKBA 3M1YA 2EWVA 5M04A 3UT5A 3GFJA 2WSLA 1R8SA 1JEAA 1WETA 1WXGA 3GMSA 3U4CA 4ZI7B 1HBWA 4BYYA 5KX5F 2C8KA 2XWPA 4XUEA 4RKUJ 3ZCPA 3NV7A 2JFZA 3N0VA 3H8WA 2HLOA 3QEOA 1EK0A 1UBEA 4BQQA 4ZV9A 2VC0A 1CR6A 3GEHA 3WDLA 1QZZA 4HLCA 3HP7A 1JI0A 2ZIXB 3L75J 3IP6A 4WY4A 4LRUA 4N1AA 1GU4A 3M81A 1X58A 2JKZA 3L4KA 1LLUA 4D0LB 4BE7B 3E1RA 3HLKA 4D9HA 4UUSB 2Y1KA 1N3BA 4AMGA 1C9EA 1VSBA 3OM1A 1I32A 1IHUA 1V3VA 2Q3IA 2MSLA 2D2CC 1KYYA 2BY2A 2QQEA 4ZZ0A 2FGJA 2RAEA 1K88A 2GK4A 5TS2A 5AW4A 4GEKA 1Q0QA 3RQIA 2IYTA 1IE3A 3LK6A 3AIOA 3R40A 4JLNA 2ATIA 2YHAA 4EB0A 1ODKA 3T7SA 2WWHA 4K46A 5BNFA 1T9KA 3ENZA 5I5GA 2X6WA 1KRWA 4XMYA 3H5WA 3RARA 5AIQA 4TVSA 4OL0A 1KEVA 1DRJA 2DHQA 3HMKA 2XGXA 3ZLJA 3GGSA 4PRZA 2G1AA 4QSHA 3PE3A 1MDMB 3GUHA 1J6UA 5T6BA 3VTPC 3Q8KA 4REOA 1W19A 3CC2P 1UH5A 1E3LA 5A5FA 5ARBA 3UWPA 4E51A 2PWZA 4CF5A 4TMFA 2BUCA 2VLBA 3I5UA 1Y4DE 3Q6MA 1OILA 2BZGA 2JVKA 3U3XA 4UB6H 5JDCA 4ZC8A 2JGDB 5IAAA 1OVUA 1N5KA 4HLUC 5G2OA 5HKBA 2XMDA 3AVOA 2HXGA 4FB4A 1Q2NA 4M0KA 4QKQA 4HPWA 2QCOA 2VH5R 2OHJA 4LV8B 5HZGA 3G82C 1TDJA 4J9UE 4ZOEA 2XECA 2B82A 3AUXA 3B7GA 3O4RA 8ATCA 2PPVA 3EXIB 1VKJA 3SJ7A 2EGUA 1MO2A 2VWPA 1BVYF 3TBKA 2D5LA 2K9LA 4OYRA 1X1SA 3LW5J 2QL6A 4Y1FA 2IBZE 5LBQA 3VSAA 3LQQA 4G7OF 1F1BA 2MSKA 1VI0A 1JY3O 3WDKA 4B0OA 5D6EA 3L3BA 4FQ7A 2BYVE 3HBNA 2JIZA 4G7ZF 1XX6A 1VYUA 1KMMA 1C4OA 3ISTA 1VB3A 5EPEA 3GG2A 4Q7LA 1GUYA 1UL1X 3T15A 5IJWA 2Y1LA 1ON1A 2CKMA 4LFUA 1SEVA 2QL9A 4E70A 4FFSA 1KAQA 5J2UF 3HRSA 1C30A 4FN5A 3RJTA 1OGYA 1X7HA 4MA5A 1E3WB 2CFIA 5FFXA 4BRWA 1N0WA 4RK5A 1YOBA 2CXHA 1RZRA 2I7VA 2ZIGA 1U8RA 3L74D