1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
5IYDJ 2MSYA 1QRYA 5C4XJ 3L1PA 2E1OA 3A01B 4D5CA 4LOCA 1HX7A 1JJ8C 4A3LJ 3HOUJ 2R7ZJ 3I4MJ 1TWAJ 2XPVA 1U9OA 2O9LA 1T33A 2HI3A 1AHDP 2L9RA 4XK4A 1I6HJ 1F43A 1OFCX 5C35A 3G1LA 4BBRJ 3S15J 3O8HA 1OCPA 3B6CA 1JKOC 2LK2A 5EF6A 3BR0A 2XB5A 4A3GJ 4A3FJ 5C4JJ 2JA7J 3IH3A 1SFOJ 4V2FA 1ETVA 5EGOB 1A5JA 3BT9A 1P7IA 2E19A 1W0UA 3HB9A 1Y1VJ 1PUFA 5IPAA 2JA5J 3ZOBA 4HNVA 1U8BA 4A69C 3HOXJ 1JGGA 3QPLA 3OIOA 3BTCA 1Z77A 2XB0X 5E3NA 1K61A 4M3GA 3G13A 3ZQLA 1YRNA 2DMUA 2NVQJ 2Y30A 5M5WJ 2O8KA 1TWCJ 3BR1A 4IHVA 2Y9YA 2TCTA 1ETOA 4DYCA 1HDDC 1LFUP 1FJLA 2CUFA 5FKKA 2R5ZA 1U78A 3S14J 3RZOJ 1ZKGA 1AKHA 5F27A 4A3KJ 4UUSB 4G12A 5JLWA 1RETA 5J1YA 5E3MA 1W0TA 1AKHB 3ZQFA 5E3OA 3B6AA 3ZQCA 2IAIA 3S2DJ 1IGNA 4A93J 3A03A 5EZHA 3S16J 5K7ZA 5FLVA 4X6AJ 5F1JA 2Y31A 3F0CA 1LE8A 1H88C 2R5YB 4JP0A 3PM1A 1NTCA 5M5XJ 3MN2A 5F0FA 5FLMJ 5DTDA 3Q0VA 3JRGA 3JRBA 3JRHA 3GTKJ 3PO2J 5EZGA 1FEXA 3CMYA 1ETYA 4FCYA 4IHYA 1WH7A 4RDUA 1X58A 3S2HJ 2HYJA 3JRFA 3FK7A 1IV6A 2VKEA 1IUFA 2M2EA 3TEDA 4XRSA 2I10A 4Y52J 1MH4A 3PKZA 4XRMA 1G2HA 4C3JJ 4QTRA 2GBYA 1GUUA 1JJ6C 2GLOA 2QCOA 2GM4A 3E7LA 3HEFA 1VF9A 2HDDA 2XRLA 1S7EA 3MVPA 5M3MJ 1ZR4A 3HKZN 1WI3A 1F36A 2DMNA 2FD5A 3JRCA 2VKVA 3C2BA 3CDLA 1HLVA 2OF7A 3W6VA 5J3LA 3NARA 3BQZA 1JUPA 1HF0A 2JA8J 4W97A 4UUTA 3RKQA 2FX0A 2LLKA 1X2NA 2R5ZB 4FTHA 4JX4A 1ZGWA 5C3EJ 4XIDA 3JRAA 2DMTA 2ECBA 1IC8A 2CRGA 1Z0XA 1B8IA 3LOCA 1MH3A 4Y7NJ 1RKWA 2MHCA 3ZQIA 1IDZA 1IG7A 2EZLA 1ZR2A 4C2MJ 1B8IB 1TWGJ 2LP0A 2EBIA 3CQZJ 1LE8B 1WPKA 2ELKA 2LY9A 1JKQC 1DU6A 1WCMJ 1XC5A 3GUVA 2XGDA 5IYCJ 1VNDA 5JLXA 3FIWA 5FKMA 1XS9A 1JKRC 4JX5A 4A3BJ 3S1QJ 4RBOA 5FJ8J 4B3AA 4AUXA 3GTQJ 2Y2ZA 3HGYA 1ETQA 1JT6A 5IP6A 1P7JA 2DTZA 1TC3C 3RQIA 1OJLA 4XICA 5K7HA 3BR6A 5J1RA 5EYRA 3JRDA 4W1UA 3S1RJ 3UJ3X 3HGGA 3G1MA 3SFIA 3OSFA 3JREA 3HOWJ 4BXXJ 4FE7A 5EEAA 1NK2P 4D7MA 2N8GA 4A3IJ 9ANTA 2IEKA 3PO3J 5F0HA 1FTTA 1MBKA 2ME6A 3OOUA 3Q0WA 3FK6A 4IEJA 2DA6A 4X1EA 5FKOA 2HXOA 2MW8A 1HCRA 1QVUA 1AU7A 2QF7A 1UMQA 4QSHA 1MBEA 1MSEC 1JTYA 2WAQN 2DA4A 1Y1WJ 5GPCA 1WGXA 2FJ1A 2E2IJ 5IOYA 2Y9ZA 4M3FA 4DW6A 4MLOA 3WHBA 3BVPA 4A3EJ 2XPWA 2LKXA 1GV5A 2E2JJ 3IH2A 3BTJA 2R0QC 3TP0A 1T56A 2CJJA 2L7MP 4L5EA 4M3DA 2DMPA 3UKGA 2YU9J 2H8RA 2XSDC 3H0GJ 3HM5A 3VPRA 2B63J 1MBGA 3BG5A 3G1OA 1LFBA 2RSLA 1POGA 2JA6J 2K9SA 2DA1A 4I6ZA 1BW6A 1YRNB 4QIWN 3O8GA 5J1UA 4ABZA 4B1RA 4C3IJ 2AHQA 3OSGA 1O4XA 1HOMA 2MGQA 5FKNA 5HODA 3IV5A 1MBJA 2ME0A 3TP3A 3GTLJ 3HOVJ 3K7AJ 2JN6A 4M3EA 3H3VK 1GT0C 3IH4A 3TW6A 3QQAA 3WHCA 1PUFB 3QPSA 5DS9A 5EGOA 2IBDA 2EZIA 2ID3A 2ZB9A 2NVTJ 4J19A 3MKLA 3M4OJ 4DYRA 5C32A 3D1NI 3LSJA 2PMZN 4AC0A 2XPUA 2EZHA 4I76A 4MIMA 1OCTC 2MG4A 5E3LA 3K2AA 5F0CA 2ECCA 1JT0A 1MNMC 4JYKA 3ZQGA 3BTIA 2E2HJ 1EF4A 4FE4A 1IDYA 2DA3A 4AYBN 5C31A 2VUMJ 4C3HJ 5M3FJ 1IRZA 3A01A 2RAEA 2D5VA 3JR9A 2JMWA 4BQQA 5GPAA 4D5FA 1RR7A 4IHXA 1GV2A 1H8AC 2L0KA 3BG3A 1NK3P 2M8GX 2YS9A 2WV1A 2Y0SN 4UUSA 1JKPC 1MBHA 1BA5A 2CUEA 2HOTA 3GTMJ 1ETXA 1ORKA 2DJNA 2LFBA 2NS7A 1ENHA 4A3JJ 3DCFA 5EG0A 1FTZA 2EQRA 2JJ7A 2X6OA 1ZTRA 1A6IA 5IOZA 5M5YJ 1R9TJ 1WH5A 2R5YA 4CYCB 4FISA 2CQQA 4IHWA 5C34B 4XRSG 1HDPA 2XGEA 1MSFC 2NOGA 3BTLA 2FQ4A 3LHFA 2X9DA 1JTXA 2HOSA 5EDNA 2LTPA 4MFDA 2AO9A 2DN0A 2YUSA 3BR2A 2DA5A 4M6VA 1FIPA 3Q0UA 3CCYA 2O7OA 4DZPA 2CU7A 3GTGJ 5IP7J 1Q1VA 2HXIA 3FISA 2W48A 2VI6A 2JK3A 3ILXA 2NVYJ 2EZKA 2NS8A 5FKLA 2P81A 1TWHJ 1APLC 1ETKA 1I50J 1X2MA 3LSGA 3Q3SA 2WB1N 2LVSA 1IJWC 1E3OC 4MO7A 4A3CJ 2CQXA 2H1KA 1TWFJ 3GTPJ 3ZQHA 1RPWA 1BJZA 2M34A 3HOZJ 4JX6A 5BNGA 1UG2A 1JUSA 1BL0A 2K9NA 5IYBJ 2K40A 1CQTA 2NVXJ 1MBFA 2R92J 5GP9A 2DMQA 1SANA 5F04A 2JWTA 4BBSJ 2GM5A 2HQ5A 4MFEA 4BY7J 2G0EA 4V2GA 5C44J 4B4CA 3DEWA 1VFCA 2ID6A 1ZK8A 3S1MJ 1K83J 1UHSA 4NDLA 3BR3A 2LR8A 3GTJJ 2DA7A 3BQYA 5F08A 2KT0A 3SJMA 1B72A 1XG1A 1FIAA 2XGCA 4A3DJ 2L7ZA 3SDGA 3LSRA 1GDTA 1QPIA 1U9NA 3I4NJ 3HBLA 3BG9A 1RKTA 1RESA 3LSPA 2K9QA 2X48A 3NAUA 1GVDA 2L7FP 2M0CA 1QVTA 1H89C 3S17J 1ETWA 4S0HB 3RZDJ 2LD5A 3BR5A 3JRIA 3TW7A 2OPTA 1B72B 3HDDA 4CYCA 1BW5A 1D5YA 5IP9J 2TRTA 3S1NJ 2DA2A 5K7FA 2COBA 4EEFG 4BKXA 5EG0B 1DU0A 4GFBA 3GTOJ 4BY1J 2R93J 4DYQA 4M3BA 4D7NA 3HOYJ 3LHKA 4A3MJ 1ITYA 1I3QJ 1JUMA 3A02A 2KDZA 2M9HA 2EH3A 4DZJA 2VPRA 1VI0A 1GHTA 3FKIJ 3GBGA 1ZQ3P 3LNQA 2HOAA 3M3YJ
chains in the Genus database with same CATH superfamily
1ZAOA 1XTBA 3TE7A 3MYRA 4H1HA 4H35A 1XX5A 3M4JA 4X0GA 1F5NA 1O89A 3EF0A 3G2JA 2QAGA 1JKOC 3KUUA 2R7VA 1R8EA 2JJQA 2Z3ZA 2I2AA 2FLWA 2FW1A 3MTBA 4RAYA 2VYFA 4HWGA 4BFLA 3M0AA 1ZRDA 3R7DA 1LJ2A 4BGEA 3B1KA 1U3UA 5J2TA 3JAKA 2OHGA 2YIJA 4H7FA 4GWLA 4E32A 3HB0A 2OFFA 3G13A 5IM4F 4BIMA 4XJTA 4K9SA 1ZP0C 2EQBA 1JJBA 1R0WA 2B69A 3URMA 2EFGA 2X6XA 3WGKA 2Y31A 2HMYB 4Q7JB 5EIEA 5T7BA 4M73A 1A88A 4KT6A 4E09A 3CZ6A 4RV4A 3G9UA 4B82A 3OCCA 3E3AA 4I6EA 1DEOA 1NY5A 3A27A 3BOQA 3V2GA 5IAEA 5J1TB 5IVKA 2HEIA 1X9VA 4MWBA 4LY6A 1XXLA 3OEHD 1A8PA 4LNHA 4E94A 1ML4A 3DHYA 3BWCA 1X1BA 3IV7A 2Y75A 1BE3D 3I4FA 3BB1A 2OR3A 4BJHB 4PSWA 3TLGB 1IDOA 2E42A 3IIKA 4JJ4A 3VPGA 4LXYA 1JHRA 2ROQA 1LNWA 3D8NA 4JX4A 4DMLA 4NBNA 1JCCA 4DNOA 3KOYA 3QYEA 3D6TB 4G8DA 4E12A 5EIXA 3GDGA 2QVLA 3EIHA 4X85A 2WJGA 1N9GA 1O95A 4BVKA 4CMKA 1N36B 3ICEA 2Q3MA 2V9ZA 3BIFA 1BJTA 2LDUA 2JGDA 3ENWA 2EERA 2IU4A 1J9GA 4AUXA 3N4XA 3N8IA 3QQ5A 1FFEA 4BO5A 1V9SA 1RJFA 5HZMA 2ZRCA 2ZT9B 2AB0A 2XQJA 4HG2A 1C3OA 3T8TA 2CLHB 4HB3A 2CYCA 1FYFA 1HZJA 2RMZA 4AVYA 3EJ6A 3EZGA 4FGKA 4EJMA 1FLVA 4OSPA 2AD1A 3VKUA 1FOXA 5K7SA 1VGQA 4WY4D 4WBNA 4OFBA 3M2PA 5TE9A 2A9PA 4KUHA 4HV4A 2G07A 4GDOA 1ODLA 3U7QA 4LF8B 2O5CA 2HU7A 4O4HB 2GFQA 1MGTA 3CCSP 3UATA 4RMIA 4FCWA 4DLPA 1BKYA 4J2HA 4IRXA 1XD9A 2Y9MB 4J49A 3U1BA 2ZBRA 3FPJA 3ZHBA 5JMPA 1IAVA 3WV5A 2NACA 1EVEA 1T8ZA 3MS4A 1XXHE 2WR8A 2Z1MA 1M54A 2DERA 2OO5C 3PR3A 3DXZA 3W06A 3EXG2 4CDRA 4OHRA 2WUWE 4JYKA 3OESA 4KRFA 1BRMA 3RJMA 4QIHA 3A4MA 4X93A 4W6ZA 4JA0A 3K92A 2FZ4A 3WDSA 5KOHA 3BB4A 3Q6MA 1WTCA 2HG5D 2QZ9A 2PKCA 2HTJA 3UCXA 4KNYA 2GR9A 3T5MA 2O57A 4JI7B 1MOSA 3OX1A 2HWYA 1KD1Q 1OAOC 4EI8A 5LYJA 2Z5FA 3KYLA 3LX4A 3HCDA 5G3YA 4M6VA 3M1CA 4G97A 5ELXA 1QHFA 2GAFA 3RL0D 3N6RA 1H0TA 2W48A 2Y27A 1JHDA 4HKZH 2PH3A 3JQBA 5D3ZA 4UM9B 3HHHA 5HKKA 5TVGA 1YOVB 4M1EA 1WW3A 1OYIA 3AB8A 1NQWA 4JELA 5JYDA 5BN5A 2PDAA 2X4IA 3JW4A 4XVCA 2PZLA 3QU7A 2Q1WA 4ZOAA 2PWBA 1EDZA 1S7AA 3DFGA 1NU1E 4CU5A 3GD5A 2FYTA 3RG2A 1MA0A 2CJWB 3PC2A 3F6SA 1GMJA 5KSZA 3CWBD 2CVPA 2LYCA 4N6OA 3U7QB 1YDWA 1QTIA 3O8LA 1V11B 4G01B 2I2FA 5J4KA 2OBFA 3P27A 2LNBA 4F3NA 5JNUA 3P2MA 5AK6A 1F20A 4P33A 1B43A 4FUTA 2XA1A 3RC3A 2FKWB 4JGIA 1JJ8C 5CPBA 4YXFA 1RKBA 4HLQB 2ZZKA 1LBIA 3FUXA 2X77A 2FKNA 3GCGA 4DQLA 4TX1A 3WKDA 3K4BA 2FR8C 2IZ0A 3PJRA 3O4VA 2JDID 1XSEA 1C3EA 2E75D 4ENNA 1XQ6A 2QRJA 2JA5J 1FZAA 3G0BA 3EUAA 4Y13A 1IXSB 3EHDA 4FHEA 4K9KA 4L9AA 2ZRNA 5FKJA 2I29A 2ZWPA 4MVJH 4TPKA 1SXJE 3E18A 5JJKA 1V71A 3V8QA 3TNJA 2NQ2C 2ZUUA 1A31A 4C6HA 1PT6A 2PBIA 4HDSB 1MAUA 3QLVA 3JRGA 3IVCA 2XASA 4I4TF 1ZK1A 3SIXA 2G5TA 2HWUA 1ETYA 3NT2A 5E6RB 1XVVA 1ZI8A 3T35A 3WJ1A 4MP3A 1QOQB 2WWWA 1Q0TA 2GOXB 3C4JA 4DNFA 1ZGGA 1LGYA 4S1PA 1G6NA 3II6A 3CZRA 1NMQA 3GGOA 4ND1A 3OIPA 2V65A 1Z8FA 3OF2A 1QIFA 1NR5A 2WHYA 1ST2A 4G89A 3F6OA 4X1YB 2ZWOA 1Q19A 1WXHA 4G8XA 4FWTA 3H1FA 1RC0A 1U7HA 2ZE5A 4XLNF 1G2CA 4FYHA 4B73A 1MORA 2HR1A 3EDPA 1OVUA 4TYPA 3EF3A 3JWPA 1M56D 5FTWA 5IYCJ 2BSXA 1UAAA 2J58A 1VJ5A 2I71A 3T1OA 2ERXA 4HFNA 1RCTE 1HQKA 4MUFA 1LTIC 1KNQA 5HXAA 2Q2EA 3MERA 4L9TA 1Q2UA 5JC8A 1Q0QA 1MC1A 2PA3A 2P7VB 3A1NA 4BATA 3GUZA 1SFCB 1Y1TA 1O96A 2HMAA 3U48A 5COQA 4B9AA 1MNAA 5AW1A 3THYB 1RBQA 4C14A 4RZ2A 4B2LA 4TKMA 3A4IA 5J8FA 2QRMA 3RS4A 4E0BA 3WHBA 2HTEA 3FETA 2VJ4A 3EDRA 2P9TA 5IDYA 1FZCC 4C0AC 4I8DA 1XVUA 1M1JA 3FOAA 3JTGA 1LK0A 3IAXA 1Z7UA 4KR2A 1EGVB 6PFKA 1NBMD 1XRJA 4DMMA 5IULC 2FZWA 3HYLA 1RYYA 4IEIA 4TZTA 1J33A 3KZ1E 1M1YA 4I19A 3U4MA 5IEJA 4EHIA 3R9XA 1ISIA 1WMEA 3L71D 3GFGA 4GR9A 1E1MA 3G9XA 3PS9A 3CRZA 1MB4A 2X0DA 5L6LB 1WJEA 2JEEA 1JUDA 2MSEB 2VJNA 3WBFA 4EG7A 1G8MA 4IGAA 4BPBA 2FCRA 3WWYA 1GPJA 2NTNA 3NTUA 4A3JJ 2LV8A 1W6RA 3I0MA 3EGEA 4IMRA 1M2OA 4NE9A 5ENZA 2SKEA 1IN6A 1OI3A 3PXUA 4MIYA 3LQRA 2QTVB 5LFAA 1ZH5A 3NEUA 4TXJA 2H0RA 1N3IA 3PU6A 5JT1A 1JQKA 5JYEA 3HV2A 1X0TA 2RREA 2ZJ7A 2HXIA 2RHGB 3NWOA 4LJKA 4NU6A 4AKIA 2O2IA 2HTFA 4PTYA 5H2FH 1SURA 4MW7A 2LH9A 3V7YA 2JNWA 2WAEA 1U11A 3VPHA 2E4YA 4OTZA 4ZJPA 3EW7A 5BVGA 2VDQB 3TOXA 1Y7TA 3P26A 3ZX5A 5DHFA 1P84D 1ERDA 4PHTA 4C2UA 2XD4A 4I1RA 4FEEA 1W49A 5AONA 3HRIA 2N1TA 3USSA 3NDIA 3ZH9B 4FGZA 1I39A 2XRMA 2FWNA 3SOPA 1HA8A 2PWPA 1YJ9P 5JLJA 3IP3A 4KWIA 4S0HB 1AKNA 2E5FA 1NH4A 5M5BA 2IPAB 2JIMA 5T4EA 3GRKA 3HJBA 1E89A 1G3MA 3LK6A 1QBJA 1E2KA 1P5RA 1ZP6A 4KAXA 3FJOA 2L19A 3BBPA 3D7MA 1BU8A 4PCLA 3MWDA 4BNMA 4OGLA 5GPBA 2FFRA 4QEZA 1Z0DA 1FX0A 1WCWA 4EYKA 3GJ7A 2VSYA 3WHKA 3G1LA 4ER0A 2ZUWA 1UZAA 1Z0SA 1XRPA 1R5JA 2QYTA 2M4KA 3U4QB 3MEXA 4XWAA 3HB9A 1S7CA 1FZBA 1SKYB 1PLKA 2QUFA 1VMDA 5L3GA 1P5HA 4Q7EA 2AN9A 1R88A 4X7BA 9ATCA 3QKSA 4ZDLA 2OBYA 4B4WA 4UU0A 1O2DA 5CBPA 1PYOA 4L85A 1QG6A 5IARA 1O6FA 2ZJZA 3KUXA 4GKAA 5AHWA 4L78A 3DEIA 2B0LA 3SZLA 3C5EA 4JP3A 1L8LA 3C41J 3VPXA 1HDOA 1XSXA 1CQZA 3IQZA 3ZDFA 5CXUA 4TMFA 1QNFA 3MF4A 3QPBA 3ZE0B 4LFAB 2Z3WA 3AGQA 5TJJA 5DCWA 3FM9A 3EZ7A 1QA6A 1CUWA 3DWLE 4GODA 1CUXA 2PEZA 5DP2A 2FGJA 1VQ4I 1Q6ZA 2DQ4A 3P9XA 5HLIA 4FQ5A 3AUKA 2HJGA 2AQEA 3EXIB 4KQKA 5HK8A 4QXPA 1ZK2A 2WZCA 4PPQA 4B5KA 2R7XA 1GD1O 1X7XB 4A5SA 4G9EA 4BB6A 4J3NA 2CH0A 2ERCA 4LSWA 1JNYA 2R6JA 2DYSH 4KYWA 5KB3A 3LF2A 2BMWA 1XC5A 1WVGA 1Z5UA 2VOJA 1WP9A 1UJ8A 3H04A 2FP3A 4JCOA 1NSYA 3AU8A 4V38A 3VNQA 3A0HE 3LAJA 1H8AA 4OHFA 3E5MA 2CNDA 1AB6A 3WWPA 3KPEA 4N6GA 1E60A 4Z54A 2XIQA 1JHFA 1IXZA 2V26A 2STTA 3PVZA 3ETJA 1G2OA 4XDHA 3A6PC 4PC6A 4LZAA 1YFHA 3ZG6A 4JT9A 3L2VA 2VA9A 2K2QB 4YUZA 1EC5A 5GTDA 4BWVA 5HDGA 1Y56A 1AKMA 1ZESA 1DG3A 4BNDB 3NJ4A 3AG6A 4BMYA 5KYVA 4GPIB 1UFQA 2X0KA 2AXLA 3C5HA 4QM7A 3GFRA 2PNFA 3AM4A 3WFJA 2DQSA 3H2JA 1J8DA 1O97C 1JKXA 2J59A 2JA6J 2XHEA 1BS9A 3RUCA 5J1UA 3F3YA 1E4YA 1B8OA 1IY0A 4CCWA 4DMRA 4EB0A 2PX2A 4BO6A 3DVLA 2ZIFA 3M6MD 2CSUA 5DWQA 4YJ3B 4TMTA 4ZOLB 2IYLD 5FPHA 3JVEA 3FZEA 4V0KA 5ALXA 2B0JA 4EVSA 2DA3A 4KVAA 2ZRKA 1RPAA 2IHUA 4IIYA 2KBEA 1SVUA 3TFWA 1QKJA 1L9XA 2XSZA 1DD3A 3SC2B 1AX9A 4JJ8A 1DKLA 5AW0A 3D43A 4XPZA 4LOIA 4B3SB 3W6UA 1QV7A 3KOUA 5IJXA 4P1WA 4PNPA 4NMWA 3MVEA 3R09A 3QBEA 1WH5A 2OO7A 3CNEA 1HE1C 1SCIA 2BEWA 3LLVA 4E2XA 5HRUA 4PYKA 2FPGB 3THXA 3AESB 5CTAA 2RC4A 2O20A 3PNQA 4XL9A 5D6OA 4HMPA 4X45A 4B3CA 3ROKA 3GCMA 3W5BA 4HQNA 2Y0SA 1XX6A 2EZKA 4RH3A 2EP7A 3I8SA 1BVRA 5LXTB 1VE6A 1J39A 3PC8A 3CM0A 5EJ8A 4JC8A 3OMYA 3G0CA 2BHSA 3ABUA 4CU2A 2QRHA 3WTSC 2L82A 4MEBA 2X86A 4R1TA 2KDOA 1CERA 4KXFB 5LXTA 1SB9A 2B5WA 3IL2A 3Q3GE 3LX6A 2OCYC 2UUBB 3IRVA 5JNTA 1N8SA 2YXEA 1AG9A 5E79H 4UCQA 1NF3A 4Z9BA 3FOWA 1UBNA 3L0IB 3ZGNA 2E1CA 3NAUA 1Y4DE 2L7FP 2BBOA 1XPUA 3O6QA 4Q19A 1J75A 1PD0A 4J6FA 3S29A 4ZTUB 1KXJA 1HKHA 4B4DA 4PWZA 5JH7A 2XKBA 1CR4A 2FSGA 1KILB 2GZMA 3W67A 3ROEA 1PL6A 2BV3A 4RSHA 1Y34E 3RIGA 2VF7A 4HLNA 4OFZA 4CN9A 3GEPA 5CH3A 1FXWA 4B48A 3NATA 2YJNA 5JARA 1AOYA 4YRNA 1U5TC 2NAPA 2RDPA 2JLQA 4IWXA 2IF2A 3ZMSA 4DLBA 2PH5A 1I1NA 2EARA 2CHEA 1UPFA 2ENWA 3OZGA 2D5BA 4UFPA 2PKEA 1QU3A 3CXUA 4K40A 1WQ2A 4YWHA 3ON5A 3RFFA 3IJ5A 5I7WA 2GVDC 3HY6A 1X3SA 4NSNA 5EZHA 2HXGA 4UQLA 1NVAA 2XDJA 1QQ6A 2B99A 2HK6A 2RGWA 5C1IA 4LBWA 4S1OA 4AMUA 2HK7A 1DQZA 2C9ZA 1KARA 4ENUA 6GPBA 1PVEA 1KJJA 2DR3A 5EUMA 4HS9A 1YS1X 3OUZA 1DDOA 5CFQA 1AQIA 3HL4A 4GP6A 1JSRA 5IWCA 1QK3A 5IVIA 2IT0A 1MZVA 2FQ1A 1BWQA 1B4DA 1P1FA 3I01A 3IT1A 2W57A 3RFXA 1ZRMA 1U8EA 2NLOA 4RORA 2WJJA 4WCGA 1F8FA 3DDCA 2GLXA 3QI2A 4EG1A 1HF0A 1S96A 2RB4A 3EPLA 3CMMA 1EZ4A 4X3CA 4E4YA 1Z2DA 2E5TA 1WZ2A 1Z0XA 4MV8A 4KE8A 2JEYA 3DKYA 4RF4A 1H2HA 3ZE6A 2X8BA 1I5RA 4LRUA 1FMVA 4KC0A 4FX2A 4XFKA 1WCMJ 4CHGA 2A0FA 2JPBA 1UIRA 2WJYA 2GYYA 2Q21A 2KWIA 1H22A 1YAHA 3R74A 2FZLA 3HCWA 4Y2PA 2FR1A 3AUFA 3L72G 1SHTX 4WI1A 2OFPA 1JJVA 2VODA 1N0UA 1V4VA 1JVSA 3Q0WA 2O5VA 3VHQA 2A06G 4DREA 2LC2A 4INJA 1MBEA 3HYRA 2QN1A 4Y6LA 1BWRA 1QK4A 4A8JA 4ZZ1A 2YMMA 4JVMA 1BN7A 2IJLA 1CRWG 3BTSA 3E9CA 4HNSA 3PNOA 5FHRA 5JMWA 5E1MA 5G2OA 1GFZA 4J1TA 5ARDA 5LBIA 3V9PA 3N6XA 2V0GA 5IASA 2QMYA 4JJ6A 1YRNB 2O2GA 4PSUA 4HGQA 4JB3A 1OLSA 4H1TA 4RK7A 1BHSA 3OZWA 3CCEP 1BS2A 2XUOA 2NVTJ 4PUSA 1TLFA 1EIWA 3QVMA 4IX1A 3VH4A 2Z58A 1Q15A 5HRAA 5LLSA 1MJ9A 4A6XA 1KVUA 2GEUA 4J6EA 2WPDD 2AMYA 3QWIA 2QLBA 2CVHA 4ZK2A 3KQTA 4EJUA 1OB5A 1GGJA 4KOEC 1DRVA 3OPQA 3KYCB 3U40A 2O05A 1TAHA 5NULA 4MEAA 4ZXPA 5APXA 2IYTA 3EEYA 1Q2NA 1N0VC 3O1HB 2DHEA 3LW5H 1KZYC 4CYCB 3K2QA 1QHSA 3TLBA 3V9AA 3IULA 4ETMA 1RJGA 4QOJA 3NOQA 5FP0A 3C6QA 3IMCA 2QZPA 3K2EA 3GRPA 3FMQA 2LDBA 3GRZA 2LF8A 5AVZA 4CF4A 2MH9A 4B34A 1N4AA 1JZQA 2BGKA 1U8XX 4J94A 2C4MA 4NH0A 1FUYB 4F4IA 2NGRA 5A6VA 1NVDA 2Y6UA 3GT0A 3TJZA 2QK4A 4F6RB 4TLCA 1NRIA 2X22A 2EBHX 3H2KA 4X95A 3TPCA 3AHGA 2QSGX 2OXCA 5AIQA 2I2CA 4QOIA 1U2WA 3VUEA 1N7LA 4F6RA 5I7AA 2BEVB 1RQ2A 2R2AA 3IT2A 3UV3A 1I4TD 5DHUA 1CDOA 2HU9A 1A8HA 1MEEA 3EXFB 4IFFA 4AIJA 3GPDG 3RUFA 2IZ6A 3MWYW 1Z88A 3RRFA 3STWA 5JD6A 1CUVA 2O7VA 4KUMA 3GHGA 2AFIA 5HZKA 1YL5A 3ZYZA 2K27A 3AE2C 5A2GA 4KE9A 4Q21A 4XYBA 2BGCA 3WK8A 4ND7A 2EV0A 1STOA 3JTHA 1NHGA 5CCHA 3HCNA 2X8JA 1IEVA 1DRKA 2HCFA 3ZZUA 1C8KA 3FOCA 1ACIA 1E5DA 3PUXA 4Z4FA 5EJGA 3V1YA 2AMLA 3AI2A 5CITA 2GF0A 2JZCA 4KBGA 2B8WA 3V4GA 3AFGA 2QLFA 2GTIA 3SFTA 3DZHA 5CEEA 4QHSA 1A97A 1TO1E 4UB8H 4QNRA 4R5MA 2EA4A 4A0XA 2WSSH 1G4HA 1PUFA 2PHZA 3K31A 5DW0A 3L73E 3AETB 1Z77A 4YECA 4WERA 2G76A 3ZH2A 2W2OA 2GAIA 2NW6A 2W84A 1GL3A 2C92A 1PWZA 4ZYYA 3SQDA 2UZ0A 1C14A 1WLSA 3DV0B 1RT9A 4WY4A 2Y05A 2G63A 3BRQA 5AK3A 1AA0A 2WNHA 3H5LA 1KKUA 1SQ6A 3M9WA 3OTHA 4Y0VA 4P8RA 4ZEWA 1NE2A 1X86B 4J03A 4WNYA 16PKA 2FRHA 2GIZA 2G6TA 4FBGA 3R41A 5GINE 5F51A 2MD5A 2NNLD 4RQBA 3O8NA 2QUAA 5KOHB 1LX7A 3FPCA 1HWTC 5AI6A 4US1R 3THOA 5DHQA 1SPBS 3MOIA 4RFSB 3HR8A 4TKZA 4CSWA 1MAHA 1GA1A 3NJRA 4BX2A 3NM4A 2J6IA 5AVQA 2BGJA 1ZC3A 3QHQA 4XWYA 3Q8MA 3D1LA 3KWMA 1M34B 4UD6A 3FBIB 2HA5A 1MMGA 3T3PB 1IC8A 4WKPA 3ZVMA 4Y7NJ 2XX3A 5EWLA 3GROA 3MRVA 1UQUA 5K5RA 2PKRA 2ZFWA 1A4XA 3HS3A 1GVHA 4YK7A 4DCSA 1H88A 5CJ2A 1K5PA 5KYUA 1L0LJ 2VH1A 4I8XA 2H89C 4IDEA 1KSGA 4QU0A 5HZHA 1W93A 1NJ6A 1WEHA 3PC8C 3S1AA 3CS3A 1PGPA 1JSZA 4J75A 2AFHE 4IHSA 2PUBA 3K0CC 2R47A 3BD6A 4HX2A 2C5SA 4Y99B 3WGMA 3CRMA 1S4QA 3P20A 3MJSA 2NQTA 4M54A 3JR7A 1YKGA 1X7YA 3N7UA 2PUFA 2RGYA 4QYWA 1T9DA 1EXMA 2QVOA 4BU2A 2PT9A 2EA2A 2HXSA 3WKCA 1IN5A 3EA0A 2NXJA 4MLOA 3X44A 2O8CA 2WPVB 5FEMA 3V4SA 3AL0C 1RIOH 2C78A 5SICE 3ENVA 2YWCA 4U7WA 3W9SA 4Y3UA 4C4YA 4KYUA 4ZK6A 3AXSA 2XAHA 3ZS9A 3LPCA 1Q7TA 1W30A 1MMDA 2XV5A 4LLHA 2Q7CA 1SKBA 4YMLA 5BWNA 3OC6A 3VSAA 2KPMA 5KU7A 2D0PB 3WLEA 2AK2A 5G40A 2XAAA 1O4VA 1XELA 3IBTA 2IOFK 3O4RA 3P9KA 2LBFB 1SHUX 1IUNA 1EDEA 1WW8A 4TQAA 4IJVA 4JBIA 1JT0A 3CCFA 3ZQGA 3GX1A 4Y67A 4BRYA 4XVHA 1JNXX 1LQTA 1IDYA 1ZLXA 3CNNA 2X8LA 3BGOS 1PHRA 1BGYJ 3P4XA 1RWKA 4IJKA 4EHFA 2CW7A 1IXKA 4UE2A 4DDKA 4BASA 3D4OA 5HIKA 3PFIA 2OMEA 1U2SA 4C0HA 1R9TJ 3RPEA 5CP8A 1IY9A 3EUHA 1LWNA 5GONB 4RAGA 3G9ZA 1L5KA 5HR5A 2X9DA 4XB2A 4B45A 1ZK3A 3FTNA 4JQOA 2VB6A 3L7NA 4LC1A 3RS8A 5AKZA 5IUJC 4NBVA 3S68A 1PZEA 3ZD7A 1MPXA 2C20A 3SYNA 5D5UB 3FFAA 4B33A 1YQQA 3FGNA 2QAGB 3HXMA 2PBFA 1Q82Q 2P68A 1YLFA 1OVVA 1GCAA 2XWSA 1E0AA 4E5MA 4LK1F 1ISSA 3LKVA 2WBMA 5G0WA 2UZ1A 3O90A 2HWKA 2ZT8A 4NU5A 2OYIB 1QB7A 3FD8A 3TD2A 5LGUA 2RGUA 3G0DA 5T4FA 5TMPA 3WB9A 4YG2F 1YR8A 3DMGA 4CEIB 2X5NA 3PC7A 1YJBA 1M66A 1AMUA 1L7NA 3SICE 1GNSA 5BVHB 3OG9A 4ZVUA 4JYZA 1Y8RA 4UULA 4IL6X 2NZJA 2FUKA 5BR7A 2FR8A 2HHAA 3UXMA 4CI0B 3B2EA 2BF7A 4HS4A 1GU1A 1RYNA 1W5AA 2RH9B 3KEOA 1JY2P 1CKEA 3WRWA 2W6JA 4N9WA 1ZNWA 1YO6A 3GJ3A 3HOUJ 4XSXF 2R7ZJ 3HU1A 1V1MA 3TLAA 5HFJA 4GXRA 1QTNA 2WUEA 4CQMA 4DDWA 4GLBA 1Q14A 2P9CA 5C4JJ 2H59A 3MLEA 2GSWA 4XSZF 1D07A 3EDMA 4R51A 2PSHA 3ZK7A 4JR1A 4JSRA 2BL4A 3FVWA 4P3PA 3VR4A 4N5MA 3IRRA 2HAEA 3D64A 3DZBA 4AJKA 1NTMG 1ZG3A 3W5CA 1Q11A 3DT8A 3MM4A 4R2IA 2FPOA 2WK1A 2DBQA 2EKQA 5I8PA 2LVBA 1PAUA 2NRGA 2IY8A 1LU9A 4P4TA 4DEVA 2A7QA 4MHTA 3U0VA 2YYSA 3R4CA 5EJMA 1W4LA 3DFKA 3RSSA 3S8EA 1IRIA 3MXOA 3BKXA 3T7CA 3QTTA 4FWIB 2MYTA 3LY7A 5LBTA 4RX1A 1E96A 2XH8A 3P9ZA 4BEHA 1NF8A 3S3TA 5D6FA 3VXKA 2VNIA 3KVNA 4R1LA 4DQ0A 1FCJA 3QHPA 3FDYA 1SUAA 1CBUA 4O2BA 4D4GA 1SVIA 4LBYA 4J3FA 2QX6A 2NXWA 2LKMA 3JAMZ 4ZO6A 4AMVA 2P67A 2HM7A 3NHMA 4LJYA 3IIIA 1HL7A 1HRKA 3VN0A 2XYVA 4MNUA 1I6WA 2GZRA 2AR9A 1HFJA 1D6NA 4P3NA 3KZKA 1OXVA 2QRKA 1NBME 1M6EX 1GN9A 1PL5A 3P1JA 1YBKA 1CVRA 3ZVKA 3LWZA 2PZGA 4WBAA 3H32A 5A4JA 1R71A 3HRUA 3G2MA 2P9BA 1IXRC 4RAOA 4JR2A 2HUPA 1QIHA 4H44D 3KSUA 2I7VA 5D8LB 4INAA 2X41A 4FCCA 4R0VA 3LBNA 4BL0B 1KYXA 1YF3A 1O57A 2C5GA 2ZAYA 2PFSA 1N34B 4P5EA 2HVQA 2PT5A 4MQ5A 1ZOYC 5TGTA 4BXOA 3SZUA 5E7IA 4CL0A 2NU8B 3KZIC 2DQKA 2ZYTX 5B58T 5B64A 1YG2A 2BW3A 3BCUA 3QITA 2XF7A 1PR4A 2Z83A 1OVRA 4GX5A 4QGAA 3WIEA 3T61A 1CT9A 2OYOA 5JBQA 1KILC 3CX6A 3FF1A 3BIWA 3MPOA 3FAZA 1P9NA 4FM9A 1ISMA 2G04A 1IL0A 1I0ZA 3GZ5A 2I1JA 4KH1A 1N2CB 4UAUA 2BM0A 3LIPA 3W5DA 4MA4A 1NMSA 4JU8A 3HU3A 1OIPA 1T3HA 3ND7A 3A2MA 1ZN2A 1SULA 1VG8A 3PBKA 3ROPA 2FWMX 3NBMA 4DV4B 1BN6A 5HE8A 4BLVA 1SXQA 3NNDA 1GUZA 4JJGA 5DGHA 1POXA 4H4CA 5LUBA 2PANA 1N0IA 1K5GA 2V7GA 2FXIA 5AW6B 1D4ZA 3FYHA 3GA0A 4CMEA 2VUUA 4JLJA 4YI5A 1MD0A 2H4YA 3W77A 4MJ3A 4IIJB 1A04A 5DBIA 2DPHA 2QUHA 3CLUD 2QN6A 1EM8A 2Q4OA 5HK9A 2XZDA 3WTUC 1L7MA 5FOSA 4HEJA 3SHVA 3E23A 1YQEA 2H2HA 3BJMA 1LS1A 4Z7JA 5I8ZA 1IJWC 1JGSA 3QPCA 1WTAA 2YHAA 2D3TA 2WJPA 3HOZJ 2HJWA 3W1VA 3CURA 4E5DA 2WZ7A 1J1DB 4QU8A 2ZBGA 1YOVA 2YHIB 2RARA 1KYYA 2AKAB 3QY0A 2ZVJA 1ZK8A 1H1LB 2AIRA 3TF5A 1AQNA 1OSNA 4J16A 4ZGGA 4ASUA 1O3TA 4F2PA 4BVJA 4FTWA 4QKQA 4LJAA 2B4QA 3D0QA 2P3OA 2FE1A 1F4KA 1MAVA 3T5GA 5B7PA 3NCHA 4F9TA 4XVUA 2EZUA 3S2GA 4OJYA 4P31A 3WIDA 3L4BA 2XBLA 5FTLA 3BWEA 3NKFA 2XAUA 3KKQA 2Q0XA 3EIUA 2X2EA 1SKQA 1YAJA 3T1YB 1G0NA 4WZBA 1K0FA 1ZGAA 4OYLA 1ZIXA 4OHVA 1BSVA 3IP7A 1N25A 4GKKB 4MXDA 2DULA 1QH8B 3WUUA 1P39A 4NZOA 2R66A 5IHPA 3SFZA 4RF2A 3AH8A 4FFMA 1SQBJ 4MWSA 2GUGA 3K1NA 3R76A 3T34A 2WAMA 2ZG6A 1UIMA 1OI2A 4WKGA 5KWEA 5EGOB 1M2WA 1JWBB 3L0DA 2VNHA 2WV9A 2IPLA 2ISZA 3F6BX 2G5CA 4D79A 4WESA 5ECDA 3OZRA 1TAUA 5FPTA 3V7RA 1YZVA 4GE3A 2AZDA 2VPYA 4GI3A 3O5AA 4QJIA 4IIJA 2C94A 1YX3A 4OUDA 4WZAB 1QHHA 2OD9A 5F1OA 3KCCA 1RE3A 1ZOIA 3HZHA 3PVSA 3TNYA 8ABPA 3EXIA 1X8XA 1GHCA 3DQQA 5JTTA 4N5HX 3GJYA 2M8EA 2EGHA 1S7OA 1NYLA 2FQWA 2RKLA 1ZK4A 4WASA 4OIOF 2I5UA 3AILA 3C3DA 1BSNA 1XC7A 3WWEA 1NI5A 4JL6A 4MV5A 2AW3A 2WJ4A 4X6LA 4AZVA 3IQIX 4EGQA 2PGXA 2JGDB 1ISRA 1J2RA 2ZR8A 5TGZA 2MSNA 3N3AC 4ENQA 3CXHE 2XMRA 1J9EA 5JFGA 3QU4A 1DXYA 5C3EJ 3E22A 2PY6A 4PX5A 4UNRA 2DEUA 4E5UA 3FUCA 4QG3A 4NZPA 1E58A 4LYGA 1K6IA 1GPH1 1KYZA 2EG5A 1WPKA 4EW3A 3PXBA 1EGMB 3R7FA 1Y3BE 2XTAA 1IUOA 2DE0X 1K2VN 3LO5A 2R8YA 3LV8A 4G63A 1FLNA 1P62B 5B36A 2W2KB 1XMOB 2PBZA 1OJ7A 3WBBA 2A8YA 3UJ3X 4LG0A 3QNUA 1RSZA 2VRCD 4PLPA 4QOSA 1O8CA 3F73A 4EHAA 5C1DA 1Q20A 1L4YA 1XZQA 5EJ4A 4LSZA 2JBAB 2ORIA 3LA7A 3MD9A 4R9RA 3I3OA 1EUZA 4TVOA 1DPRA 3GAZA 3WMWA 1QG2A 1HUCA 4CLRB 1IHYA 2R5NA 4N7BA 1U0SY 3FZGA 4JLUA 4K35A 4ZO7A 1GZLA 1XA3A 4RS3A 5T4HA 5AW4A 3GFOA 2H31A 3A28A 3Q11A 3OQPA 2V98A 3V2UA 13PKA 2IBZG 4HF2A 1JAXA 4EHKA 5BQOA 1RAFA 3A4NA 2R1VA 1SU4A 3ZNNA 5JSZA 2G09A 5E18F 4ZVPA 3H0CA 3ZWYA 1L7QA 2P0EA 1R0YA 4A0ZA 1FMFA 2DUUA 4LOHA 3WYBA 2UUAB 2Q3LA 5CFOA 2F8TA 3WJ7A 3WGZA 4OOEA 3EK2A 2NXNB 2JTVA 3IJRA 3ZJVA 5ILOA 1EJ6A 1VPDA 2OXTA 2ZJ5A 3WZ2A 2MH2A 2C8LA 4EDFA 1LBTA 3R3JA 2OKGA 5BPIA 5JS6A 1ULAA 1TNSA 3I32A 5JAZA 1OVGA 3L73J 4IKPA 2QSYA 4RA9B 2HADA 5BV7A 5KPDA 3C3BA 4EB6A 2P2SA 3NHZA 2REQA 4DDTA 1LNQA 4M98A 3HFRA 1B3RA 2JIZA 1PK7A 1MDMA 2BSQA 1U5BA 3K96A 5AJHA 2Z5LA 4BO4A 2NU8A 4I0AA 1QVAA 3PRJA 3I92A 3RUIA 1NUUA 2GB4A 2GO7A 5TT1A 3HSRA 3IUPA 4HUQA 2J33A 1JE0A 3DP7A 2OO5A 1HBJA 1Q1GA 2FI1A 1TVKB 2JLBA 5CXSA 3KPJA 2AZTA 5CHYA 4Y6SA 2FFBA 4H0NA 1TA0A 4I1LA 5BMVF 3AG5A 1BC7C 2N1MA 3GRFA 1JSLA 1RE4A 4KZKA 4CODB 1YTZT 3BBLA 5KYTA 3NTXA 4DUYB 4LF7B 4N40A 1DRUA 3OT1A 4QDUA 3TUIC 4L07A 3EFEA 4J7AA 2JJ2D 2WUFA 2ESRA 2OL4A 2N0SA 5JWHA 1T8WA 1CY7A 2LWIA 2Q1SA 1RADA 3Q1LA 3ESDA 2ILTA 3Q10A 2IBTA 2H5IA 3IBFA 2V1UA 1KC1A 5K7FA 4OM8A 4LZJA 2G9RA 1SELA 3PGXA 2YHIA 4A0FA 1V5FA 4G0XA 1HV8A 4ETSA 4AS3A 5SYAA 4IOKA 1B0AA 3SE0A 4JBYA 3IDSA 4EEXA 2FWRA 3KOOA 1GPDG 4JP8A 3WXMA 4ER5A 4D9CA 2O7RA 3D2CA 2ZULA 4DGWB 3O4FA 3LJKA 3HA3A 3RAPR 4DXDA 3O2NA 1AO3A 1NJ1A 3QG1A 4OMDA 3DYIA 1GOTA 5JECA 1VI5A 2VFAA 4FJ0A 5DJ5A 3GQBA 4M7RA 4GGMX 1E20A 3AJDA 1X7XA 3W5JA 4V19K 2NVQJ 1NG7A 3GNQA 4FC6A 2NYXA 4JEIA 4F46A 1JQ3A 2AJCA 2FWIA 3SWKA 1YZHA 2PUCA 4RBNA 2HYGD 2VBFA 4ODIA 3WG7H 3N0WA 1CJCA 4ZJUA 3WYNA 3RNOA 1EINA 3H1JE 2NO7A 1FEXA 1T9GS 2BMEA 4AKSA 5IZCC 1ACMA 4M6XA 3AQ4A 4ZT2A 1NYHA 5CURA 3ZE7A 3SF0A 2Z99A 2R8EA 3UHPA 3HBFA 3U16A 3FHJA 4I50F 1QLJA 4XXHA 1SHZA 1NQXA 2F3QA 4L27A 3FMGA 1QE0A 3Q7SA 4HUJA 4MI6A 3NFQA 4TTAA 4BP9A 5JEDA 1MVLA 1PJBA 1GSOA 1R27A 3UENA 2CUZA 3OTWA 2AE1A 3KZZA 2GA2A 2F48A 3V4RA 1K6EA 2B4TO 2B5VA 2VAXA 3EEFA 2MMGA 4Z2YA 3TOCA 1IHPA 1CP3A 2B87B 4OMFG 1Y8CA 1PYGA 3AF0A 2OB1A 5HPYB 1KRWA 5GOTA 2CHUA 2TS1A 3PQ8A 5BR4A 4Y1FA 4PF1A 4GGGA 2I4TA 2WIBA 3DLIA 2DTZA 1ADGA 3RS3A 4HX8A 2ECFA 2OP1A 5B58C 4LFCB 5EZ6B 2NUPB 2WIDA 2OXIA 9ANTA 1DGWY 1Z73A 5AIAA 1JBQA 3F7TA 2ZRQA 1DEBA 4P7KA 4QQRA 1XNJA 4KJXA 5GPCA 1BG6A 4FMDB 3JV7A 1J06A 3DNMA 2LW7A 4CLDA 2WT4A 2MYPA 1EX7A 3E5HA 3CGWA 1NTKG 3KQOA 3MZHA 5HIJA 2BDUA 5B30A 5IMSA 1OILA 4ZI2A 1TU3A 4B6QA 2IELA 1DX7A 2X2OA 1IQUA 1GAWA 1Z9CA 2WICA 3MAAC 3W04A 4GM0A 1CIPA 1EXNA 1S5PA 3ONEA 3KPUA 4A0YA 3G6EP 1NUAA 4EW6A 4F56A 4PZYA 3MCUA 3RS5A 3FUVA 3LLUA 1J7JA 2VXDA 4ZGBA 4C05A 2YU3A 4CICA 4FOOA 1PSWA 3AEFC 2XUBA 3Q1KA 3P7MA 3V2NA 3F3MA 5HSGA 4H6PA 3GLQA 2KP8A 3RKUA 1E6CA 2FPSA 4F55A 2UVPB 1Q21A 1E2MA 1SC9A 1MBHA 5EIAA 2CHVA 3AP2A 3UMGA 5JFRA 4F71A 2JJ7A 2ODEA 4CH7A 3C1AA 2NT4A 1PSZA 4AS1A 1FMCA 1CRLA 5AVOA 3LHFA 5JYBA 5GADl 1NN0A 1AF7A 4EL0A 3KPVA 4F92B 3KJXA 2HA0A 4I08A 5FQOA 4FX0A 1E3TA 2Z5VA 3ZQHA 5LMCA 1JI3A 4RUKA 2ZI4A 3ZZMA 5AM3A 4PBRA 3K6SA 2CCJA 1QH1B 2H4FA 4YDQA 3GDOA 1IC6A 3H99A 3U31A 1GITA 3ODPA 4P93A 1U28C 1QR6A 2WPSA 5JS8A 5F3DA 4P6VF 3RUDA 5E6SB 4M86A 2RHMA 5U4QA 5CVUA 4HDNA 4OHOA 2Q5LA 3PICA 3SX4A 1P84E 3TBKA 4WDQA 3LCJA 1TPZA 5D1HA 1EI9A 2PG4A 1EQ2A 3MTAA 1SC7A 1Z45A 2W6ZA 4JUFA 1N6OA 5C2JB 3FTDA 1BTOA 1VI6A 4DYQA 1UQTA 2N1BA 1G6Q1 1S29A 5DNEA 3KEQA 1RYFA 2DWQA 1OR7A 1Y4AE 2WABA 2WYOA 2XUFA 2J0QA 5JVDF 2W2LD 3RFCA 3ICOA 2W4QA 2B4YA 1IOZA 3QV2A 5BN3B 2JIBA 3A0UA 3DZIA 3QE3A 2UVQA 4LYFA 2OXRA 1M1KQ 2FSVC 1FC3A 4JJAA 3W6NA 4Z7NB 1NJIQ 5GADJ 1DI0A 1ETVA 2YRWA 1XVIA 4RVFA 1P7CA 4ZHQA 1DQSA 1KQOA 1FYEA 1ON1A 3UWMA 4PG6A 2XB0X 1MMSA 2KI7B 5EFOA 3RJ9A 1PR6A 2IYOA 3SVZA 5FPYA 2QJTA 1Z74A 2ZEJA 1C9DB 1PFQA 4ER7A 3S16J 4BLWA 4FMCF 3UKOA 4CPDA 4CUGA 1SVNA 3RGWS 4WZBE 2IY9A 3K5WA 3ZV3A 3ZNOA 2FUG1 4RJLA 1VP9A 5D87A 5J5VA 4HDRA 3FSGD 3HUTA 1CLUA 1R0LA 1FZFA 2ZYAA 4DILA 4DIKA 3TRKA 3FLBA 2DUWA 2Q5JA 3SMVA 3BTUA 3QMPA 3CUQB 3PL5A 1XQWA 4E70A 2RBEA 3VJLA 4FE3A 5F7XA 1DFHA 3UH0A 1TZCA 2DMTA 1TT7A 5LZ9A 3OEWA 2EVWX 2HT6A 1JXQA 1OR8A 3A1VA 1EXWA 3OOHA 4O0MA 4U63A 4EAQA 3Q0IA 2PX5A 3DC7A 3OPMA 2CLDX 1PL7A 4IZOA 4N4OB 5IX8A 1IBLB 3TRJA 2VLIA 3SIWA 3HSFA 4BZXA 5BY2A 1QL1A 2PJDA 1QZZA 2QLNA 1NQUA 1I30A 1T9AA 4A0SA 3R6TA 3P2OA 3JRDA 3F6YA 2D2CD 5LMUB 2AFHA 4N0PA 4H0LB 3CCQP 1DO0A 4YIRX 5DLEA 4S0XA 3M5CA 4GBMA 1MG5A 1HKSA 4I14A 4Q48A 2N9UA 2Q3IA 3WIBA 2OZKA 1DBRA 4PR0A 4UTVA 1VSTA 2FK7A 4JL5A 3A11A 2F00A 5F98A 3I0ZA 2YKGA 2GZWA 4N48A 1GCOA 2YU9J 2VJYA 2MA3A 4ND8A 2ZIAA 4IVQA 5JFOA 1EK5A 1ADJA 1GZ3A 2X0JA 4Z1OA 4XE5A 5DSTA 3H9JA 4IL6C 4JROA 3R0AA 3R5TA 5ED4A 2PRSA 1MU0A 5KJFA 5AK4A 1N5IA 3HRTA 2HWWA 2QTCA 3OYMA 3WNVA 3O3CA 2NYRA 5LC1A 4CKBA 2OT3B 4JU9A 3R6SA 4IILA 3HJCA 2R7UA 2HDHA 4ZO9A 4M99A 1FDVA 4Z4IA 3OI7A 2NZWA 2HWXA 2W6AA 1GRNA 2W25A 3TR5A 1LWUA 3BF7A 1Z7LA 1BHJA 1V1MB 4RPHA 3QXXA 2RB5A 1U2DC 1YA8A 3GARA 2XUHA 4A6EA 5AW8B 2IODA 2IVMA 1CJBA 1ZPDA 1SVOA 3A2AA 1JNMA 3VU8A 3I5XA 2JHAA 2BV6A 5B7QA 3KQNA 2O0LA 4EKEA 5B6PA 1L8AA 4O5AA 2CD7A 4L3WA 3LC2O 2X9NA 4I3FA 2VOOA 2QGUA 2HFKA 3L79A 3OAAA 4IHWA 5KLIB 3DE5X 4BLRA 4AUKA 1JQ5A 1K6YA 2ZS9A 3U3RA 2H0AA 1E7MA 4ZYLA 5A9RA 3L04A 5KQSA 5TC4A 2V9PA 2AI2A 3NNSA 3LRTA 5CCDA 1UKBA 1RPWA 3JZMA 3KAPA 1R58A 3DVSX 2FX5A 4YRGA 3NS7A 2C2GA 1GPKA 3KP4A 3BRWD 2L3DA 4F96A 3BHJA 2K87A 2PMDA 4XVRA 5ERGB 3TQQA 3M9HA 4C7MA 1M2KA 1CULC 1JHXA 5FI3A 4AG5A 2WQ6A 1QPIA 2GCOB 3A6JA 1D0VA 2BFBA 2G5GX 3W5AA 2AVNA 4ZDOA 2FEAA 3DUWA 4U0VA 4G5OA 4JKOA 4KWTA 1H89C 1SC6A 2PYZA 2Z8ZA 1ETWA 2ZT5A 3NKVA 4UNIA 7MDHA 3UXEA 2FYZA 1N0WA 3D1JA 1LNZA 3A9VA 3CZCA 3H7AA 1XPJA 1L4MA 3RTDA 4PV1B 4DR4B 2KRCA 3GOQA 4EJOA 2DBBA 1K68A 2P40A 2XRZA 4MEXF 2GARA 3AR4A 2XUGA 2HBQA 3PRHA 4WOKA 2QRNA 1MT3A 3BCCG 4PYMA 3UMVA 1FDWA 4B3MB 1XZKA 4Z6YA 1ZARA 3DAOA 1HEUA 2I67A 2IP2A 4RK6A 5LGTA 5FLXZ 1CTQA 5A7GA 2JH8A 2YXBA 4RD1A 5APQA 1DJQA 4XLZA 3H9GA 1VPEA 3M5DA 3U3KA 2QT1A 5AKYA 4HFRA 3WLFA 2IHNA 2W6NA 5B1AH 2MR6A 3OOPA 5F5XA 3GLLA 2XDAA 3SBEA 1EWKA 2I8DA 4YIFA 1NTRA 3SZOA 1YDGA 1C3JA 3EHEA 5FA6A 2JEZA 1ZM2A 4X64B 4DQKA 1HLPA 1JMBA 2ZUSA 1ZCBA 2JFOA 5DM0A 2WU8A 2J5BA 2FA9A 5FH9A 2MD0A 3UQZA 1RJEA 5EXXA 2ZRMA 4NQZA 3RYCA 4JGBA 2YY6A 1HBWA 5KJ7C 3TGWA 3K20A 5AW9B 1EEXB 2XGMA 5K0ZA 3U17A 3IHKA 5FUMA 1W4BA 5ILSA 3MPUA 3HVRA 1NI4A 4F6LA 3E9ZA 4DYHA 1JP7A 4LIVA 4WL0A 1GRVA 3LFHA 2PJRB 1UXIA 2ZJ8A 2H8GA 4D9GA 4MMZB 2DBZA 1KI3A 3H1KG 1P0FA 2DI3A 3HKDB 4AZTA 2K5CA 3FXMA 3K9LA 1EB8A 4IF4A 3C8UA 4OYHA 2V9KA 2CS3A 1TWGJ 2A9VA 1Y1KE 1YZFA 1G9XA 3REOA 3QPVA 4IIHA 1X13A 3DPLC 2NYUA 2B1QA 3TMYA 3M5PA 3ABOB 3ZZTA 3MMPA 2J5RA 3QVGB 1UBKS 5BW4A 2BM1A 5C7LO 3WZMA 3P0IA 1PZHA 1N5RA 2QTHA 1KA8A 2XVZA 3F6PA 2COMA 1BXRA 1OBOA 5MFZA 5DT9A 3L73G 1OLSB 1T5OA 1XB4A 2P6SA 3PWZA 4FK8A 1VRWA 3W3ZB 4DVJA 2C4TA 2R9VA 2FDXA 3EYWA 3HUGB 5DM4A 1DOHA 1M5RA 2AN1A 2JASA 4J1SA 4KSCA 3BREA 3G6WA 1G3WA 1BW6A 1GU0A 4PM4A 4GVPA 2JHGA 1NVEA 2JN6A 1DD4A 2QL5A 3LW8A 4QAJA 3SWFA 4QT0A 4QDJA 2IF0A 1COWA 2LOOA 4BYMA 3U1KA 1LP1A 2P77A 4Z9YA 1EK1A 1MABA 2BSAA 1XTVA 2WAFA 4Y2JA 5EZYB 1WXGA 4UDYX 3AHIA 1L2TA 1ZVKA 2J5KA 3ZDEA 3EGIA 4KACA 4XLCA 2B78A 1KI9A 1BCCJ 4Q5IA 4A92A 3E7KA 1XD7A 2PUWA 3W4KA 2GPSA 2A5YB 2Z2YA 3AI7A 2Y99A 4EARA 3QELB 4LBVA 4QBIA 2CXXA 2HYIC 3OX2A 1XDSA 5H9VA 1T6YA 4CIVA 3TW8A 1I3OA 3TLKA 1LLDA 4L22A 4R8RA 4C4TA 1ZRTE 8OHMA 1U5CA 2ELHA 4BUPA 3QEMB 2CV2A 3DM5A 2Q27A 2XUPA 3CIFA 2C9DA 4P32A 5EHQA 5ALWA 4Z3KA 1RI2A 3TDZC 2PGOA 4MQBA 2WSEH 2O3UA 4WH0A 3ZKWA 5BMVA 5DHRA 1Z56A 2G9WA 1F8GA 3M4XA 4B71A 3OCVA 1ORIA 3P94A 2DU8A 2Z8YM 1X3WB 2G9NA 1Y5LA 3A1DA 3KKOA 4UUPA 1JDPA 1QHEA 3R4VA 3IAOA 4UBOA 2Q9CA 5JS7A 4FNMA 4AQDA 3BGIA 1Y9BA 2QY6A 4R7ZA 2QEXP 5AD1A 2H8PD 1E99A 4HBZA 2Q9AA 3O8OB 3OLVA 3ZP5A 1J5YA 2IGNA 3B38A 1E6WA 4B1FA 2VJMB 3KFWX 3JRIA 1NBMA 1FFYA 4KNVA 1BR1A 2X1CA 3GRRA 3F49S 4GR4A 2QX7A 4KPGA 1E79A 3GTOJ 2RGDA 1NE7A 1E62A 3GIDA 5HM8A 3HLKA 4C4AA 1ZVMA 3FVRA 2UUZA 1ZX1A 4UB8E 4UE3S 1TWAJ 4DIFA 1AN0A 5E79E 4OKSA 1DPUA 2GBLC 4BP8A 1DWPA 1QFYA 1N73B 2BEQD 3H9UA 1CQPA 2G7MC 1EBFA 1MX5A 4FFOA 1VQ9I 1PGQA 2VJ5A 2ODPA 4TVKA 1A8IA 3SF8B 1BU5A 5IBCA 3DMFA 3RVSA 1VDMA 3ABTA 3PXEA 4F3KA 3I56P 1K7EB 3R0IA 2HPVA 3OWXA 3UK1A 5CK4A 5KAFC 1U1EA 3TMKA 1IIRA 3GQVA 1GEGA 3MHVA 2VWGA 1PQYA 1OC2A 1MB3A 2QYOA 5M5XJ 4B3DA 1WG8A 3SVLA 3CSSA 2JAQA 5E8JA 1LC0A 1EHCA 2VK1A 5EGNA 3NG1A 4D80A 5CEFA 1YJ9I 4OWFA 3LNTA 5DXAA 1RRCA 2V4HA 3JRFA 4GEKA 4C29A 1SD7A 1HDZA 3OYGA 1UK6A 4C7JA 2O2XA 3HJTA 2EINH 4BQOA 3I59B 4WA7A 4A8PA 5E4JA 2HDDA 2NZXA 4TWZA 3ZI4A 4R4JA 1YIJI 2CLOB 3C2HA 2GZ1A 3WGOA 3KZIE 3JRCA 2AC4A 3IUOA 3E2MA 1RYMA 2FBIA 3T41A 1S2GA 4TKLA 3I9V1 2JA8J 1U4NA 2C8JA 3UY4A 4BXOB 4Y6QA 2WPDA 4J0JA 2D0DA 1FIUA 2AOTB 4DC9A 3SU8A 4U3FE 4IZ6A 3RBAA 1QTQA 2DT6A 4CR8A 3DLHA 3AF2A 4KT0J 2OXEA 4I1YA 3L0SA 4RD4A 3PF8A 3TIFA 2JJLA 4ALIA 3N74A 3SJ7A 1O58A 5SY6A 3PD1A 2ZS7A 2OV8A 4QA9A 1YJ5A 4CL3A 4K26A 4G1MB 1SEUA 1G3UA 1R8YA 4FXOA 4XJVA 4QDTA 2DW4A 1R4MB 3VOSA 1ADYA 1GZDA 3T0YA 3TQHA 1AZTA 1XZBA 5CDUA 5AW9A 2ME6A 1JZTA 3B73A 3V8RA 1SFKA 2YSRA 2HQNA 2G3YA 4K7JA 2W82A 5IBQA 3HXQA 4P38A 1CDDA 4ASUD 2NT3A 3JSVC 3COYA 1F1BA 2GUVA 2OZVA 1UHMA 3PHCA 3GHHA 1EUQA 4LWQA 4RW0A 3R3YA 1G16A 3E0QA 4N0DA 4UCXA 4LDRA 4TQUS 1IZ0A 3OICA 3PGLA 5F64A 1EIZA 2VC0A 2GWRA 1YR7A 2BKUA 3F74A 1RXWA 1A5TA 6Q21A 1JLKA 3TINA 1XZEA 2R1TA 1YI1A 1XEXB 4MV3A 2N3ZA 1GJRA 4A4DA 5PNTA 2YO3A 2PGAA 4H60A 3KLPX 5C31A 4HZFA 1OXXK 1OFIA 3M8JA 2Y68A 5DMXA 3H5WA 3QOFA 4KWCA 3S2EA 2WYIA 1G9TA 4UNOA 2BZSA 3V2PA 2ZUBA 2D59A 3CUVA 5FUXA 2WHEA 5KYXB 3UM9A 4WN9A 2AZXA 2Q1TA 4WJZA 2PMFA 5FDFA 1VTKA 1KTIA 3T4PA 3LA8A 4QPZA 1X1EA 2FWAA 4G4SP 4DZPA 1GTG1 4BNKA 1XK6A 2QA4P 5KJEA 1LH0A 4HQEA 2A45I 3RL0B 3GGCA 2E6UX 3A05A 2VLAA 4UBNA 2Z5UA 3RWOA 3HJGA 1IAWA 1R4NB 3LSGA 4C9YA 1MMAA 4UBLA 2DWUA 2A06D 2RH5A 3Q3IA 4EMUA 2XF6A 2F4OB 1J1UA 2ZU0C 3S1MJ 3RK2D 4LNAA 3K9GA 2P8JA 3RHZA 1Y8RB 1ECBA 3KR0A 3FLAA 3HCEA 4MR8B 5AHRA 2WA1A 2R4UA 3ITDA 3TBHA 3LDGA 4A9AA 2IYYA 4QXRA 4B76A 2DFEA 4TSRA 4FILA 2JQ7A 2JRCA 4YUWA 1IZ8A 3JARA 1G59A 3TZLA 5CM8B 3PQFA 3AR6A 3ZS8A 1I8TA 4QDKA 1RH5B 5IT4A 1KOGA 3L84A 3FFTA 1PWHA 2ID9A 5B2ZA 4TM8A 5BSEA 4LOAA 4F5DA 3DO8A 3UB4A 1TAQA 3QXGA 4Y15A 3ABRB 5I7SA 2FF4A 3EA5A 3GV0A 1FJGB 1QIJA 2ORVA 4QTTB 5DCMA 2P2NA 2QN7A 1Y3DE 3IC5A 1O7LA 3EVTA 3EZFA 1UM8A 3DU5A 1BXZA 2YWHA 4CVNA 2B4KA 3MILA 1YDMA 4N4AA 5BV1A 1FS5A 4KN8A 3WK7A 3UPUA 5HUJA 2F55A 1YRNA 3ONVA 3I1IA 3N5KA 3J7YJ 4OFXA 1UBFA 4KQEA 2FPLA 4NMHA 4L4UA 4UUSB 3UUEA 4OX9Y 3VV3A 4RNCA 1ETHA 4M0LA 1QGZA 3W9BA 1PPJE 3R5SA 1L7XA 5L3EA 5K8CA 4LRQA 3MW8A 3M9LA 3CHYA 3M81A 2VQCA 2F64A 3VPSA 3AEZA 3G49A 3WLNA 3UICA 4P35A 3KB8A 3GRUA 1G18A 4EYSA 1PR0A 3G9TA 1KRHA 2X19A 1A8QA 5AMXA 2W4IA 1JMYA 5CFZA 4MV1A 4HTFA 1E4EA 2JF0A 1THGA 4KREA 3ZV7A 4LRYA 2OFXA 5A9SB 3A36A 4KPUB 2QT0A 4PRYA 1IB6A 3VR4D 3W5IA 3JWIA 3JRAA 1YJWI 4E14A 3COWA 1T2KA 4GZMA 2WAAA 3O9VA 4TZKA 4ARIA 1FOYA 1K4TA 2CXRA 3IKTA 1PYDA 3NCTA 4ZMBA 4NMXB 3T1NA 1EUYA 2C9OA 4NAVA 3BZ6A 3CTPA 1V6SA 3W2IA 4OOFA 2GWHA 3WSWA 5TNXA 1TLLA 3X1XA 3JZDA 4UTRA 3V1TC 4BXXJ 1XAJA 4FUQA 1SQBG 4A3IJ 4LFBB 4WLUA 4DABA 4G0YA 4QUJA 5D6EA 2P7CB 5GMOA 5BOXA 3WZLA 1G4AE 4Z4QA 4KXLA 5DHPA 1QLHA 1N4DA 3T1BA 1VQNP 2X6QA 2R6R1 2DPGA 1ZG5A 3OECA 1T38A 3BD9A 4I36A 4NC9A 3SX0A 2JFXA 2WWIA 3QKSB 3ZOKA 4R9VA 2ZSIA 4I4TB 4GKVA 3VODA 4Z7QB 4RABA 2J1LA 5HIAA 1ADCA 1WB5A 1FFSA 3LDAA 2OUKA 5CNMA 1X9HA 5HOEA 3U7HB 3GJQA 2GFIA 1E3JA 2BFBB 3ZLTA 2UYHA 1OW7A 3HFJA 3RRXA 2M0MA 3O3NB 3K8YA 1KDPA 2VSOA 4M0DA 4US2R 1FP4A 2IE0A 4B75A 4FE4A 3IB6A 2ZDQA 1YI2I 1HQCA 2EQ5A 3MGGA 2FMTA 1U3VA 1XLTA 2Z8YA 3BMXA 4O3MA 2LBFA 3LM8A 4FN4A 4LNUA 3LXMA 5HDQA 3K70B 3IVXA 5BPFA 2WYHA 1FUEA 4E1BA 3IHLA 2BR4A 3UFXA 4UDOA 5LB4A 2VQGA 3CCSI 4KV7A 4J9UE 1UG0A 1UOPA 4X7RA 1RJWA 2Q6OA 1CV2A 2DFVA 5CXQA 3IHTA 5E95A 2DFIA 1QPBA 1VLVA 4Q4DA 4QGSA 1YMQA 3RV4A 5JAOA 2A5GA 4GOFA 4C7RA 3QXSA 4RV9A 5EY5B 2AG0A 2EF0A 2UXDB 4G0NA 1EH7A 1Q0HA 1N2OA 4LXGA 4RVCA 1X1RA 4PWYA 1XEWX 4V0RA 2XYGA 1KU3A 3ZK8A 4AN4A 3B70A 4GPAA 3ENKA 2JGLA 4JOCA 1M8KA 4DT1B 1KHTA 1FRZA 1M67A 1KFCB 5FUVA 2ZVPX 1JIQA 2H0QA 2R62A 4WNAA 3LQQA 5BW8A 5JCOC 5CEJA 2P9EA 4NYIQ 4HWTA 2GKSA 2X9VA 2JCGA 4HNAB 1E5QA 1K5HA 3EYIA 1OPXA 3RU9A 2IFNA 1N2CE 5B57C 2VAMA 1XB2A 5LP6B 3U3ZA 1DXQA 4RADA 2E4ZA 5I4KA 1BW9B 2RAPA 4X8OA 1H93A 2A78A 3SN6A 1ZBDA 3K9QO 4LMAA 1RJ9B 1SUSA 1URQC 5IKXA 4RQTA 1OCRH 5KLVK 2I3AA 1JYSA 4E1VA 1U6GA 4JP5A 2YXQB 2LIVA 4JVSB 3E6DA 3RREA 4MDEA 3BT9A 5LYJB 4LY0A 3T0FA 4HNVA 1U7TA 2XUAA 3A2NA 5BWOA 2E55A 1YW9A 3ASOH 1C2YA 4LKOA 5JHGB 5K0FA 1DIRA 1L5LA 2WF8A 1N5OX 3T3NA 5LJLA 3PDUA 5E3OA 3JVVA 1VCHA 5JJ5A 5EZSA 3EQLF 1FLDA 3FB1A 4NR0A 3JRBA 3M9XA 1KE2A 3S6JA 1ILWA 4JDPA 2JRLA 4QBHA 5EZGA 2VHVA 5HQ3A 3BJIC 1S9KE 4HR7A 3LL4A 2IUFA 4M0MA 5FNVA 4RJIA 3LUAA 3QWHA 3DL0A 3EVDA 1X4OA 1L5HB 3TRDA 1L5QA 2H9AA 2OA4A 1JF8A 4BNGA 3VO8A 3H75A 5CCHD 4R9SA 4IDQA 2DFFA 2H11A 2WVRA 3F5SA 3E2PA 3PGKA 3P9PA 3UWPA 1I9CA 3EDQA 5BQPA 3PYXA 1G5HA 2JRTA 3UUFA 2A06E 4TRNA 2B4RO 3D0KA 2ZSKA 3ZXUB 1V16B 1W7PA 1GTRA 4HZUB 5JBNA 1X0VA 5EJIA 3O47A 3WYGA 2H52A 1AT1A 2C2MA 1W44A 2ZO4A 2X5XA 3R2PA 1YB1A 2DOKA 1DCMA 2X7XA 4PXSA 1P9RA 4EABA 4D0GA 2A6HF 3ZW9A 4Y17A 1UC5B 1E4EB 4U2KA 4I02A 3M0EA 3WGUA 4ZRNA 1NKZB 3FPHA 2BEVA 2JFNA 4W8OA 2HMUA 1OOEA 3QIVA 1UCFA 5M7EA 1II8B 3NMUF 1K4SA 3KSBC 1KS2A 1U6IA 5F0HA 3D8RA 4W7IA 3V3TA 2RNJA 1XT6A 1XHEA 4JBAA 1V8BA 1JU9A 4XYEA 3FH0A 2H18A 3A26A 4BDTA 3A7EA 5H3HA 1BDMA 1K5DA 2Q29A 3GL9A 1Y6ZA 1INLA 3IH5A 2Q50A 3EPPA 1P80A 5B66H 1EFDN 1RXCA 1T2NA 1JY3O 1L2PA 1JAIA 1R50A 2GKGA 2E37A 3DEAA 3SIPA 2Q49A 4TQGA 3MAJA 1N5LA 1ODSA 1HOTA 1PL0A 3FKSA 1US8B 4AMBA 3H3VK 1W8IA 2PWYA 4M0KA 5EP2A 1P4WA 4YMVA 3IAHA 3AFMA 4TYWA 1S1CA 2ADOA 3P8CE 2K4BA 2J5UA 2RC6A 4UUMA 2OSBA 2ICAA 3EAQA 4AC0A 2O0MA 2E89A 2QJPB 5A9TA 3MZ0A 1CIJA 2VC1A 2R87A 2HI0A 4AZ3A 3KAKA 3FHTA 1LF5A 4D9MA 3GVAA 1K75A 1FFXA 2RGEA 4Q3CA 4PSCA 5TR9A 2OESA 1C80A 2JIQA 4QTYA 1DBQA 1ZRHA 3K05A 3AKEA 1SOVA 2AC2A 1AKUA 5KJ7A 1CXZA 1ZQ9A 1C9EA 3TVDA 1A6IA 4I6GA 4XEHA 2ZJ1A 3BWGA 1KGSA 4TT3A 2AMJA 1IN7A 2X40A 4DRXB 3DLLF 2I4NA 5CVVA 3UMCA 1IBMB 1MKYA 4LXIA 2DA5A 3KDAA 4L16A 2HMSA 4BZZA 1WZCA 1BI2A 3UGQA 4LXQA 4F4HA 3CH4B 5C80A 3U1AA 1OBHA 3WIVA 4MYUA 4X1OA 3HG7A 3W2WA 5FRDA 3MGAA 5CX1B 4OV6B 1RF0A 1SXPA 4CMGA 3F3SA 3ND9A 5GP9A 3IDFA 3CZMA 1UODA 5HF5A 3ADBA 1QYCA 1IY8A 2JIRA 5J4HA 1T0IA 2MT9A 1IK9A 3H1IG 1R1UA 4P4SB 1PT7A 4KUGA 2H1OA 1CPYA 5DM60 3OZCA 4PYJA 3DV9A 5CCBA 2HQAA 3WTYC 3RSQA 1ON2A 4AP6A 1NW7A 4H4KC 5HE9A 2X48A 1E3WA 1I80A 2Y66A 3CZQA 4XRFA 2JGAA 4M9ZA 3U62A 1UFMA 5CFLA 3W2FA 3RVNA 2ETHA 1U98A 4WT7A 4IIFA 3DKRA 2XE4A 3SHQA 4Q39A 1HEIA 3IEXA 4MVJE 4E7ZA 3SK0A 1LUAA 1OFTA 3IBCA 1IATA 2C7PA 5F76A 4U9UA 1Q1BA 3C39A 4NOKA 1VZ3A 3IURA 2JH3A 2R6ZA 3DDNA 1YITI 2FSSA 2DLCX 3LC7O 4L5JA 3HOTA 1GQ2A 2DK5A 1NNEA 1AA9A 4YCMA 4PYOA 1RI3A 4XDYA 1GPAA 1XCLA 4D6PA 3NTNA 3G82C 3S4YA 3SEAA 1QIIA 1J8MF 3I2FA 3PWKA 3S1AB 2XCIA 1PNRA 5GY7A 4WN9B 4EVRA 3OFVA 1CE8A 4K1LA 5HKOA 1GNTA 3IKVA 1A27A 5FRMA 1BOFA 1S9KD 2IEAA 1QIMA 4OBWA 3WVNA 1A9XB 2QD2A 1JLSA 4IXMA 5FBHA 1EXVA 5IFKA 4LQCA 4LXXA 4DR3B 1EHIA 4JENA 3IAS2 1I2MA 5BV0A 3KEYA 4TV9A 3BKWA 3LIEA 4RDCA 2NNWB 2EJUA 5IJZA 4GMDA 5MHTA 2ZI7A 4DE5A 4C03A 5EKUA 4ZAGA 2IIVA 5F3WB 2VP0A 1G2HA 3RKSA 2A0KA 3NHWA 4BFWA 3WTBA 3WKEA 2XKPA 5JZBA 1VYTA 1CNFA 3A4CA 4ZCMA 4HHEA 1E8NA 1IRGA 2B92A 4DBRA 3ECSA 1D03A 5FNVB 1U9ZA 3RKQA 3BPSA 3WP0A 1WU8A 3U26A 4UM8B 3LOCA 3NTOA 4IL6H 1EWQA 4AY4A 3E9EA 4BKMA 1CWUA 1SCAA 1XTIA 1JKQC 3D7NA 2ZPTX 2OECA 5ELMA 5HKBA 2ZBUA 1RQRA 4AFNA 4RIFA 4YUYA 3LC0A 2J9ZB 2ZIXB 3KD2A 4UUAA 3LXRA 4IMPA 5FBVB 4PLYA 4JAVC 5CPFA 5FWXB 1WDMA 3RF7A 1FU7A 2EFPA 2FOLA 1SIOA 3OSFA 4ZKPA 1YQXA 1UUFA 4FFDA 4YFVA 1V7ZA 4AF6A 3ZE9A 2GS9A 1P7YA 4KX3A 3DWFA 4K6GA 4O5OA 4YJHB 4EZBA 2P2YA 1ONOA 3BASA 3BMQA 4N3GA 3WGGA 3THWB 5AKKA 4KFTA 2H16A 2EWMA 5EZ5A 2VJLA 2DCEA 1GV5A 2XY4A 1AOXA 1HQDA 4JI4B 5HJEA 2EFNA 5AKGA 4UFOA 1L5RA 1DG1G 1BDCA 4BWGA 4YTPC 5TMEA 4KB5A 5J5AA 2YHSA 2BD0A 3SP1A 4C3IJ 4MLPA 4BZPA 1WHUA 4BNUA 5CB4A 1H2RS 1X15A 4ZYTA 4A27A 2VXZA 2RGGA 2Z43A 2CVOA 1ZSNA 1XTAA 1SNYA 1HNWB 3E6BA 3QQPA 3Q8KA 1S2MA 3OU7A 4AX8A 1YJXA 4NLLA 1FUUA 3TSIA 5DRYA 2MG4A 3OS2A 4JXXA 5HCUA 3BTIA 2VZ8A 3RRBA 2O1EA 5D5QA 2A4KA 2ACWA 2ZP1A 3ZLVA 1ORHA 2O7QA 2W43A 1I2DA 4ZI7B 1RRGA 3PHIA 1AUQA 3KP7A 3IV9A 3F9CA 4WZAA 3DD1A 2P0WA 4RTQA 2XKKA 5DYGA 5B1DA 2H8KA 1PFIA 2HOSA 2VP3A 1Z5ZA 4IVNA 1QUFA 2JBWA 1KI6A 2J0EA 2AD5A 4OB6A 3NYWA 2O2JA 1NVOA 2IDMA 1DPFA 2REQB 1EJ2A 1F0NA 3CR7A 1S2LA 2WB1N 4EJTA 3VZRA 3CX5H 3PKJA 1OWNA 1NIPA 1IRFA 3CEMA 4Y6RA 5LEJA 2JB9A 4O63O 1IJDB 4MR9A 2Z33A 1NF9A 2HQ5A 3QOYA 5I8WA 4JZYA 3FE2A 1E0DA 3DZCA 3JD0A 5CLHA 1U8ZA 4JY7A 4ZQGA 3CWQA 4D0NA 1XZHA 3PFBA 1NMEA 1QZYA 1U9NA 2E3JA 4UUVA 4DDVA 3WG9A 2BUAA 1IM5A 1D3YA 5IPFA 3O74A 2QG4A 3MQ4A 3H42B 1YQ4C 5EPEA 2HBRA 2DODA 4CFZA 2N1TB 4PNHA 2J45A 2O1XA 3NDRA 3AW9A 2VBYA 3JYHA 2VZ0A 3HPRA 3M4YA 2W8ZA 2HYDA 3DOHA 3MYYA 1NXXA 2PD4A 4QC2A 4IDHA 1PR3A 1JA9A 5BSUA 5C9ZA 1EG2A 4LOCA 3KAQA 4RPIA 1EYZA 2D1HA 2BRUC 5EGSA 3DNFA 3RTBA 1HYBA 4WUTA 4XLTA 4A3SA 3IIMA 3TIIA 4MCAA 2W85A 1K8YB 2VDPB 4O59O 4ZZ2A 1LKXA 1C7FA 1O08A 2VP2A 1TCVA 2HQSA 2QQ8A 4LYJA 5AUNB 4F8EA 3RVMA 3DAGA 3N70A 3L92A 2WKQA 4V2UA 3DR5A 4HQOA 5IMBA 4C0XA 1ZH4A 5B6IA 2PAJA 3H0DA 5L95A 3C6XA 4MWOA 3K8OE 4BEVA 4D82A 1I10A 4OIRF 4RA6A 4YHHB 4UXJA 2M7AA 3N2KB 3E05A 3AE6C 1MDMB 2WNSA 3L4JA 3ZWKA 3GZNB 4JHLA 4WBNB 4RULA 3ZHQA 3L8HA 3BTVA 3WTCA 1DAKA 3O94A 3ZK9A 4PIMA 1FWZA 3H5AA 5TX7A 4R6XA 1WJBA 1COWD 2G9QA 1N2CA 2ZJBA 3RV3A 1ABFA 1VJTA 4R6WA 2DFDA 5JNWA 4C3JJ 3OR1C 4H13D 4XIFA 1J0AA 4GBGA 1NQAO 3CWZA 3AEGC 5C8VA 1RLJA 2PRKA 3WMM0 3IEVA 1A2KC 1RQXA 1XU7A 1XRNA 2H1VA 4ZV4A 3G7UA 2WJ3A 3VHXA 2CRGA 4LWZA 2JZNA 1O95C 2J32A 3W2HA 1ULZA 5EJAA 5I5GA 3HP7A 1U2ZA 2I65A 4FZRA 9LDBA 1B8IB 3CQZJ 5FBLB 1C7IA 3H1KD 2QZSA 1NFFA 4FGLA 2X0NA 2A5FA 3OJCA 2PTHA 1J2EA 4ZYZA 2VZEA 1P2SA 5KVRA 3UMRA 3T3HA 2ZWAA 4XLHA 4YELA 4HAVA 5CAEA 5HQTA 3BD7A 2PX4A 1KFKB 1A9YA 4L0MA 1K92A 1R5NA 4JB8A 1ORRA 3TQIA 3ZWXA 1ONPA 1FP1D 2OILA 3LLMA 3NTRA 2AEEA 4Q4JA 3OQJA 4RHEA 1KQNA 4PIVA 1ONNA 4UUBA 5CCGD 2TYSB 4Z9FA 1UADA 2WTXA 3ROFA 1N78A 4NPFX 2W8BA 5EI5A 1NU1J 2XSDC 1Y82A 3EVZA 5KO2A 2CQNA 3EZXA 1IWBB 2K9SA 2EW2A 4K88A 4XGQA 1ZI9A 2XE6A 1KIMA 2ME0A 3MJFA 3F8MA 5JWOA 1E8DA 5GTIH 1Q91A 3KT3A 2P1JA 1Y3HA 2VZ9A 1CZNA 5IXJA 3TTVA 2ID3A 3G4SI 2PLWA 3ZTTA 5F7OA 3CLSD 3Q9VA 5E6RA 4CCNA 3O38A 5CHXA 1Y9JA 3UQYS 3L75G 5FV4A 2W2KA 1F7VA 1KYOI 4F38A 3IPAA 1KDTA 3PQ6A 4P7BA 2A3NA 1JU4A 1C50A 2Y1KA 4YJGB 4TWAA 2FRVA 4JP1A 4FD2A 1AHNA 1RE1A 1X42A 2DPUA 2NZVG 4D0RA 5ECYA 4JS0A 1Q7GA 2PGIA 4H3SA 4N12A 3ISVA 3HCRA 2D1VA 1JLMA 4QPNA 1SCUA 3IP6A 3PC6A 1IUKA 5FLKA 3S70A 1T2EA 4M76B 2FW0A 4ES6A 1BE0A 4M9UA 1P74A 5E3HA 1KSHA 2EOAA 1GR0A 3SQWA 3FJ1A 2A1TS 2CW8A 3AF4A 1CQTA 5KMGB 1DARA 5CNKA 2E1PA 3O4IA 4DLKA 4TYMA 3UPTA 1ITZA 4ZCRA 3G0HA 2X6TA 2HKXA 3R8XA 4J0DA 4ZHSA 2J3DA 3L07A 4P34A 2JD0A 1H85A 3NEJA 4E5PA 2ZVNB 1RKVA 2YNMD 2XEDA 3RL0C 1BNCA 3Q3HA 4K6HA 1WEKA 1L4AC 5AKIA 3QYAA 4D9KA 3ABMH 3P8ZA 2HPCA 1A5BB 2WJHA 4GUAA 1G291 4ZAWA 4OH1A 2ATXA 1M1JB 4KQFA 4PIPA 4JMLA 4Q9NA 1XHFA 5CBOA 3VAAA 4IHJF 4MOWA 1GZVA 4FZ3A 2JLCA 1B26A 1FRVA 2AJTA 3WS7A 3X1YA 3FZYA 4YT5A 2F4NA 2JT1A 4PZEA 3EXHC 4E7SA 4QVIA 4AD9A 4I9FA 2D2EA 2FW7A 3QLJA 4ZI5A 1JG4A 4R0MA 5B66C 4XCXA 2LR2A 2IZZA 4FJ2A 3COSA 4CT5A 2Y4OA 1AQYA 3FCYA 4LIUA 1U7XA 1V5EA 3IVAA 3TGPA 5EZYF 3KXLA 1MW8X 2ZJAA 3LAWA 3CY6A 3FIJA 2EKBA 3F3KA 1G4DA 2KS1A 1GLGA 2D5IA 1OMIA 2NVUA 4UJ3A 4FYXA 2BTQB 1BVUA 3BCHA 1SUBA 1UOQA 2BFFA 1LTHR 1ZN9A 3EPRA 1X92A 4U5XA 2NSYA 4B3BA 2OZLA 1NF2A 4MRNA 4O0LA 1YE9A 1G8SA 3EIWA 4ZMRA 2PVSA 2VJKA 1CS4C 4XFDA 1I7SB 2GT1A 2YIVX 1LDEA 3O8BA 4WX2B 3I8XA 4CQMB 1L5FA 4GSKA 3T8RA 1JMVA 2O3QA 1D7OA 4K9NA 3HBMA 4RK5A 1DUSA 2YV5A 3C2BA 4DA4A 4FYPA 3TQRA 1UJNA 1T1GA 3BQZA 3IF4A 1M7HA 1BS1A 1NR1A 4M1WA 1UWLA 1OHHA 4PGFA 2GNPA 3E35A 1ZJ6A 2O8FA 5FQNA 4AYWA 3BXXA 1QQ5A 3EVEA 3L7DA 4NBQA 3ESRA 4OHYA 5LDHA 1E0KA 4WVLA 1G8XA 3QMVA 5CIQA 1M34A 1VNDA 3Q6NA 4FHGA 4KODA 3VZDA 3UA3A 4QU5A 4P3OA 3ESWB 2AXCA 2NOAA 1CC1S 3WLKX 2GBFA 1G8FA 3BR6A 1OBFO 1R9GA 2NSDA 2FOKA 5LQAA 5F5LA 1X6VA 4GLJA 3U4QA 1R6TA 4YIKA 2FWPA 1M6NA 3Q1MA 4NCBA 5FKOA 1C3OB 4GPTA 5KTNA 1MSEC 4L02A 4EJ2A 1V45E 2DKOA 1QLED 1KNXA 1WXIA 1SQVJ 5BV8A 4OJQA 5AVKA 1E6MA 4B0PA 1P0MA 2OBXA 3PPWA 1GQSA 3KQUA 1CU1A 4IUYA 3EH1A 4AJPA 4B8YA 1BGYD 3Q85A 1LTGC 1GG9A 4J00A 3R4KA 4A0RA 2PNJA 1SAUA 3NMDA 1TXGA 2EAUA 4Q3AA 2ACEA 3S2ZA 1RQLA 3DC2A 4BNJA 3MLAA 1LZLA 2G28A 4OXIA 4HDRB 4H44C 4KMMA 1JKMA 3OCUA 1DKPA 4PJ0C 3VPFA 3D3JA 4BMVA 1VCIA 5LWQA 4W5RA 2GN6A 1OLUA 3U4CA 2RI6A 4E30A 4NC6A 1ZZEA 2HDNB 3WU2H 5KX5B 4R68A 1JV2B 2HGZA 3RBVA 2XBMA 3G89A 1QYRA 4CM8A 2JKZA 4BAZA 4LDPA 4ZYAA 3BZCA 4GI7A 1BYIA 3TGUD 3E8SA 4Q66C 1FFBA 4MUHA 1UT8A 2H4WA 4NHOA 4FFRA 5DYMA 1KU0A 2XF5A 3HJAA 1HDRA 3PKIA 1JLLB 3W2EA 1S01A 1EFPB 1OFUX 1M8FA 3H5RA 4DBZA 4WSO