1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
2DTZA 4UUSA 1W0TA 2KDZA 3JRGA 3HOWJ 1BA5A 3TEDA 3GTLJ 2MHCA 3SFIA 4G12A 1S7EA 1ETVA 2Y31A 3D1NI 3M4OJ 2H1KA 1U9NA 2DA1A 2ME0A 2M8GX 4D5CA 2JA5J 4GFBA 3HGGA 1JTYA 3GTGJ 2ID6A 1I3QJ 1NK3P 3S1RJ 3S1MJ 2LY9A 3MN2A 4HNVA 2NVTJ 1WI3A 2EZLA 2GBYA 4B3AA 5IP9J 3BQZA 2L7MP 1ITYA 1JUPA 1TWAJ 1JTXA 2AHQA 4BBSJ 1XC5A 2LD5A 3RZDJ 1MBHA 2VPRA 2FJ1A 4FTHA 2O9LA 4XICA 2R5ZB 3ZQHA 2R92J 3UKGA 4A3EJ 3PM1A 1BJZA 2K9SA 5C3EJ 1B72B 5FJ8J 3G1LA 1IRZA 3ZQLA 2D5VA 1QVTA 2G0EA 4QSHA 1ETQA 1RPWA 2DMTA 5E3OA 2LR8A 3IH3A 5EEAA 1JGGA 2HYJA 3GUVA 2DA4A 1MNMC 3C2BA 3HGYA 1ETYA 2X6OA 4L5EA 2Y2ZA 5K7ZA 1B72A 3E7LA 4XK4A 2GM5A 1QPIA 4W97A 1GDTA 1UHSA 3GTJJ 1FTZA 3BR3A 3HBLA 1VNDA 5E3LA 3IH2A 3TW6A 1AU7A 3S14J 4V2FA 5EG0B 2R0QC 3S1NJ 1O4XA 1IJWC 2WV1A 1IGNA 2HDDA 4Y52J 4A69C 1Z0XA 3IV5A 2CUEA 3PKZA 2XGCA 5DTDA 1RKTA 1Z77A 1CQTA 3Q0UA 4XRSG 1TC3C 2X9DA 3Q0WA 2IBDA 1APLC 3ZQIA 1IDZA 4DYRA 2NVQJ 2K40A 1NTCA 1RESA 5C31A 3SDGA 3HOUJ 1GUUA 3FISA 1SFOJ 2ZB9A 3DCFA 3QPLA 3TW7A 3BG3A 1QVUA 3LNQA 5HODA 3HDDA 5E3MA 3HOXJ 5C34B 5JLWA 2KT0A 2L0KA 3O8HA 3ZQFA 3BTLA 3RQIA 1HOMA 2JN6A 1WGXA 4FISA 4DW6A 1I6HJ 1P7JA 2RSLA 4BXXJ 3S17J 4B4CA 4AYBN 2HOSA 3S16J 3GTPJ 2DN0A 1ETKA 3BG9A 2CQQA 3G1MA 5EZHA 5F04A 3F0CA 2DJNA 3BR6A 2HXIA 1Y1VJ 3ILXA 4JX5A 4M3DA 3ZQCA 1MH3A 4BKXA 1QRYA 1BL0A 3JR9A 5F0FA 3ZOBA 5FKMA 2TRTA 2WB1N 3BTIA 2HOAA 2CQXA 2IAIA 9ANTA 2Y9YA 2NOGA 1AHDP 5GPAA 1X2NA 1FTTA 4BY1J 5FKKA 2FX0A 2IEKA 3JRFA 4BY7J 2YS9A 2HQ5A 5K7HA 5M5WJ 1GVDA 2VUMJ 2MG4A 3PO2J 2JA7J 1JKRC 2HXOA 3JRCA 4A3MJ 2JA6J 1X2MA 1H88C 1YRNB 2DMQA 1ZGWA 3OSFA 3FIWA 1RETA 1JKPC 4A3FJ 3K2AA 1T33A 4JX6A 1ETWA 4XRMA 1GV2A 3JRDA 2LK2A 4A3GJ 3O8GA 5F1JA 2DA3A 1HCRA 1YRNA 4MFDA 1ORKA 4IHVA 4C3HJ 4JYKA 2R5ZA 4A3JJ 2EZIA 3JREA 2CRGA 3CQZJ 1K61A 1F36A 2QF7A 1IV6A 4A3DJ 5IYCJ 1XS9A 4IHXA 5K7FA 1F43A 1U8BA 1EF4A 1IUFA 1HDDC 5IP7J 2K9QA 1MSFC 3H3VK 4M3FA 4A3CJ 5C35A 2RAEA 4V2GA 1GT0C 2N8GA 4CYCB 1WH5A 4J19A 4DYQA 3GTQJ 2EZHA 1ENHA 4ABZA 3GTMJ 1ZKGA 2DA5A 4AUXA 1OCTC 3M3YJ 1ZK8A 2M34A 5M3MJ 3S2DJ 4QIWN 3MKLA 2NS7A 2NS8A 2LLKA 3BQYA 1OJLA 2DA7A 5DS9A 1JKQC 3HB9A 3RZOJ 5J1UA 4CYCA 2LP0A 2E2HJ 1OFCX 2R5YB 2ME6A 3L1PA 4LOCA 5EG0A 1MH4A 1FIAA 1JT0A 2ID3A 5F0HA 2OPTA 2P81A 2JMWA 1IG7A 4EEFG 1OCPA 1JUMA 3HEFA 5GP9A 1IDYA 3K7AJ 3HOVJ 1K83J 3SJMA 1H8AC 2EZKA 2ELKA 1A5JA 5IOZA 4A3KJ 1RR7A 1I50J 2CJJA 5J1YA 1Y1WJ 5IYDJ 4IEJA 2JA8J 5M5YJ 2E2IJ 2MW8A 2XGEA 3QPSA 2EH3A 3CDLA 4BQQA 1ETXA 1HF0A 3FK6A 4C2MJ 2LKXA 3OIOA 2L7ZA 2K9NA 3PO3J 1MBKA 4UUTA 5FKLA 2YU9J 5M3FJ 4MO7A 1HDPA 3B6AA 2PMZN 1MBGA 2M2EA 5FKOA 1LE8B 1LFUP 1ZR4A 3GBGA 4JX4A 5C44J 3BR2A 5F08A 2I10A 3BT9A 2VKVA 1A6IA 1TWFJ 1LFBA 5J1RA 5EF6A 1B8IB 5C32A 2JJ7A 4M3EA 4IHWA 4JP0A 4MFEA 3JRBA 1LE8A 2VI6A 3HM5A 4AC0A 5E3NA 2ECCA 3BTCA 2DA6A 3JRHA 3BVPA 3S2HJ 1Q1VA 2XB5A 2JWTA 3WHCA 1B8IA 1DU0A 2XGDA 1E3OC 2W48A 5EGOB 1R9TJ 2O7OA 1SANA 1JJ6C 5JLXA 3OOUA 1IC8A 4A3LJ 1AKHB 3DEWA 1FEXA 3ZQGA 1MBEA 3BR0A 2DMUA 4C3JJ 2E19A 3I4NJ 4X6AJ 5EZGA 3BR1A 4M3BA 4X1EA 2ECBA 3UJ3X 2R7ZJ 2COBA 5IP6A 5EGOA 3GTKJ 3FKIJ 1ETOA 1RKWA 2CUFA 1AKHA 1BW6A 1H89C 4BBRJ 2QCOA 2JK3A 1HLVA 1GHTA 2TCTA 5F27A 2EBIA 4D7MA 1WCMJ 3W6VA 2MSYA 4FCYA 1MBFA 2XPUA 5FKNA 1UG2A 3G13A 2DMPA 1VI0A 3GTOJ 2E2JJ 4S0HB 2HI3A 2OF7A 1ZR2A 1JUSA 2DMNA 3LSJA 1TWCJ 2FQ4A 5IYBJ 4A3BJ 2HOTA 2GM4A 4XRSA 1MBJA 1XG1A 5IPAA 2AO9A 5BNGA 3TP0A 1JT6A 4DZPA 4MLOA 3CMYA 5F0CA 4I6ZA 2M0CA 1X58A 3JRAA 3LSRA 3A02A 3CCYA 2EQRA 4I76A 5J3LA 3I4MJ 4MIMA 1P7IA 2XPWA 3G1OA 4B1RA 4W1UA 5M5XJ 4IHYA 1JKOC 2MGQA 2FD5A 1VF9A 3LHFA 2XB0X 1U9OA 1ZTRA 4NDLA 1TWHJ 5GPCA 2H8RA 3A01B 5FLMJ 2X48A 3BTJA 2XPVA 2LVSA 1BW5A 1G2HA 1W0UA 2R93J 3OSGA 4RBOA 2LFBA 2R5YA 3HOYJ 3H0GJ 2E1OA 2Y0SN 1TWGJ 3WHBA 2XRLA 3JRIA 1JJ8C 1FJLA 3TP3A 4XIDA 2L9RA 3Q0VA 4FE4A 3NARA 5IOYA 3A01A 2O8KA 1WH7A 4RDUA 1MSEC 4Y7NJ 3BR5A 1T56A 5EYRA 4D7NA 3MVPA 2L7FP 1PUFB 4DYCA 2Y9ZA 5FLVA 3QQAA 4DZJA 2YUSA 3A03A 2WAQN 4QTRA 5EDNA 1D5YA 3LSPA 1U78A 4C3IJ 1PUFA 3IH4A 1NK2P 4M6VA 2M9HA 3FK7A 2CU7A 3S15J 1DU6A 2DA2A 4FE7A 4D5FA 3LOCA 1FIPA 1VFCA 2Y30A 4A93J 3VPRA 1POGA 3LHKA 3LSGA 3BG5A 2B63J 3RKQA 3HKZN 2VKEA 1UMQA 3NAUA 2XSDC 4M3GA 4UUSB 1ZQ3P 1HX7A 2LTPA 5C4XJ 3B6CA 3S1QJ 2GLOA 3HOZJ 2NVXJ 3Q3SA 2NVYJ 4A3IJ 1WPKA 1GV5A 5C4JJ
chains in the Genus database with same CATH superfamily
2C78A 1IONA 5K03A 1I13A 2PPVA 3SXUA 2V8BA 1XVUA 1I1QB 1AHHA 3RS5A 5IANA 5LKAA 4HQLA 2ZQYA 3BH7A 3GTGJ 4AQRD 4K8RB 4H0NA 5F1RA 3C43A 5I5EA 3P8MC 4IF6A 1UOQA 2YN0A 3W6JB 5CLSA 1QFJA 2R5ZB 3D6YA 1FSSA 1PQYA 2XB8A 1K78A 3NAZA 1IRZA 3P2MA 3UWSA 2RGXA 4Z4GA 2OTLI 2LR8A 3GUVA 4BFZA 4YRMA 3K1PA 4MVXA 5EIEA 2GM5A 1RRFA 2RBKA 4NQWA 1TJ4A 2VJAA 4LZZA 5LP6A 5F7JA 4I01A 3TZ6A 3DXFA 3LT4A 2RNJA 3TN7A 3DA8A 3K6SA 4DUPA 2F5VA 4EO9A 2XB4A 5KJCA 4RMHA 2IYTA 1CEEA 5DM0A 3HN7A 2YRWA 4ZT6A 3MSCA 1VQOP 4FVTA 4XRSG 3VMAA 3ZIAA 4DZZA 2UVPB 2K40A 2IK8A 2R47A 1P77A 4G1EB 1EVYA 4LCBA 5CU7A 3ZHQA 3ND8A 1EZ4A 2GZ3A 2LNDA 5LQRA 3QOEA 4CLHA 2QLLA 2V96A 4DV3B 2CQQA 4OIMA 3IDFA 4ZVOA 3M0DA 1OFVA 2IITA 3M9XA 5TDHA 1L5FA 1XQYA 3FTEA 1HM5A 3BPXA 3B02A 3A36A 1RXYA 2AEEA 4UBMA 4AMBA 3H1AA 4UTXA 3MD2A 1KF0A 1O3QA 1LJLA 1ZD4A 3OIUA 4NZOA 2VBIA 5ALDA 1WSAA 3OIQA 4JVSB 2HR1A 1FZAA 3GRUA 2BXYA 4DRXB 1ZMRA 3H6PA 3RYPA 1P4HA 4CFYA 2ZAIA 4O4LF 4D8TA 2EFOA 1P18A 5F1JA 1DJLA 1KPHA 5JYEA 4Q93A 5KNLA 2W58A 3I83A 4YAEA 1YKFA 3T5AA 4KHPB 3JWGA 1XTKA 5HDQA 1ZGBA 4E5SA 2ZT5A 1Y1TA 3MAGA 4V0QA 4Q9DA 3NHFA 4EZBA 2GZMA 1EM8A 3WYNA 1DX6A 3AERB 5GV8A 1KO8A 5DFAA 1SC3A 5E1WA 1TTPB 2ID3A 2H00A 4G4IA 2GPNA 4MJ3A 1FY7A 1M6HA 3H99A 2D2CD 1QEXA 3PHGA 4CU2A 4BX3A 2ZTMA 2XNJA 1V7PC 1L5SA 4F4CA 3ZGVA 1ZXXA 4LYYA 2CNWD 3MKYB 1E4EA 4UULA 3OIOA 3BZ6A 2Z4TA 1RKUA 3LA3A 4JBLA 3IVCA 3TI7A 5H70A 2PGOA 3JPYA 2F55A 3FGPA 3A3OA 4MA0A 3LUPA 5U9CA 1VPLA 1MIOB 2H52A 2UZ4A 1NTZJ 3E5MA 3DFMA 5GOTA 3KPUA 3GJZA 3NH6A 4GVPA 4RA2A 2G04A 2F1HA 1GSHA 5ALEA 1WO8A 5JCZA 4PU0A 3AO0B 2AOWA 1V4BA 5DOVA 2IUFA 2EP5A 3ZDQA 3U3OA 1JU3A 4ZDIA 4H31A 3NTVA 2IYRA 5FOTA 5JH7F 4CJXA 3IKLA 4J0GA 1ZH5A 2BLNA 4BTLA 2WJAA 3OQ6A 3TL4X 1JFFA 4CDGA 4GKVA 4QUIA 2Z58A 2HXSA 3ZS9A 4UM7A 1E5VA 1L7EA 4H3KB 3O5AA 3CVYA 2XKMA 2FFHA 3TOVA 5JZBA 2XF6A 3D8RA 4FYXA 2KW5A 3UMFA 4Z6YA 1XQVA 1ZI6A 2CLIB 1ECBA 1OYWA 3NT2A 1PS0A 2AFIA 3NATA 4AY6A 1GPAA 4E51A 3K4NA 4JSTA 4DPLA 1XP5A 3RJZA 1H9TA 3AX6A 1SQQD 3OF5A 1NSTA 3QVUA 2PGAA 1S2MA 1P1FA 4AY4A 1EFUA 2REXB 4AO6A 3ECCA 1DXOA 1GRQA 3M2PA 1NGMB 3L75E 2HCJB 4INOA 5A71A 2GLOA 4F2DA 4BRSA 4LRQA 5C4JJ 2RNGA 1K3FA 3HZJA 2HU5A 4YMWA 3BTVA 1CUUA 1W2HA 2K02A 2BZ0A 2NPFA 3CVXA 1EXIA 3DEAA 3KDAA 3L1UA 1EUQA 2ID6A 3WGLA 4F8YA 4ZEMA 4KBYA 3HABA 1MX3A 1NE2A 4WLFA 1CRQA 3ZQHA 4GE3A 4OATA 2GIVA 1CUFA 4AKEA 4L85A 4R2JA 3F2VA 5BXYA 1Y8RB 3MTEA 5ANRB 3AU8A 3D1JA 4EX7A 5KJ6A 2C7VA 2IYXA 5L8RJ 2L7KA 1JNMA 2HJHA 1NYQA 3KXIA 2Y27A 5J4HA 1EH6A 1C30B 4HBZA 1UZLA 3HBLA 3RABA 3DD1A 4MQFA 2RGNC 3GEHA 3S1NJ 3IAFA 3EXG2 3IOYA 2WBLC 3IV5A 1SQ0A 1AZWA 5KPDA 4U7DA 2A4KA 3NHZA 3NORA 1NIJA 5ICFA 2C92A 1E1RD 1LGHB 2VQ3A 3ICVA 3AEXA 5K09A 2KNCA 1W7PB 4FGJA 5ELLA 2X0FA 2DE0X 1WTCA 4PC2A 5K3SA 1U63A 2G88A 2WU0A 2EU8A 3WB0A 2C59A 4H6PA 3M9LA 1NG7A 2PRRA 4ZP1A 4ZHQF 4YIRX 2G4CA 3CBQA 3VYIA 1UBJS 5JRJA 4P9FA 4RGBA 4GNKA 2H27A 2DJNA 4BNVA 2QQ0A 4LY3A 2PQ6A 4QFCA 5LZ9A 3U4QB 1H93A 2NXNB 2AYXA 1RJGA 1LSJA 4DE5A 3U0BA 1MB0A 4LZWA 2GWHA 5AI6A 3CIOA 1U9IC 5B30A 5KTPA 1Z21A 4YEJA 3G7NA 3GH3A 4TS9A 4BRZA 1QX8A 1TKRA 5G02A 2V7BA 3LIPA 1P9RA 5DULA 1EUCB 1VQMP 3ZWAA 1SQXD 4TUYA 3HKDA 3TR6A 5GIOE 4BO1A 1K7YA 5BRNA 1HDDC 2VP3A 3A9WA 2OXRA 3C5HA 3AR6A 2OWDA 5AR1A 1WV1A 5FHQA 1CK4A 3LDFA 5B1IA 2CUTA 3BQYA 2IU4A 2A69F 1PDWA 3HADA 3TECE 4ZK6A 5DDGA 3IURA 1HVVA 4YFVA 3C6KA 3HEFA 3N74A 3W5CA 3NIBA 3E9ZA 3RC3A 4IDBA 3G02A 2CJJA 3CCQI 3VP8A 2ZBFA 3UK6A 3NHMA 4YAFA 3ZBTA 5FWXB 2XMGA 1KO1A 1RWPA 2XUBA 3UV6A 5AJUA 3TK1A 2RHMA 4KH0A 3WRWA 4MQ6A 2X5OA 1XRSB 1OLUA 3TRDA 1KKMA 2ZEJA 2H07A 4FW8A 3LA6A 3CH6A 1L3IA 1ELOA 2LWIA 4ID3A 2PO5A 2J3KA 3JRXA 3HCWA 5JCJD 4J94A 1FY2A 2JNWA 5KJ1A 1I4EB 2Q1WA 2P8SA 3LE8A 5IBCA 1A5BB 5IZCA 3JALB 1PG0A 5LCXA 1A8PA 4A6PA 2FV8A 2PQ0A 4FFDA 4MKGA 3Q3IA 2LMDA 2QTLA 4KJXA 1T1EA 2ZETA 4OY3A 2J3MA 2CVHA 4ALLA 3LW5H 5TQ2B 4LCJA 3TZKA 5BNGA 4MLOA 3PXEA 5F0CA 2P3QA 4CUZA 1YB7A 4RLSA 3LZCA 2OO3A 3M0EA 4GBMA 4BMZA 2O4CA 1T8SA 2YY5A 4M72A 2ATIA 1RJWA 3W9BA 3G71P 4X45A 2HPVA 1TA4A 3L1VA 5I01A 3FCEA 1NXTA 3OT1B 3M1EA 1XRLA 1X8YA 3L49A 4C01A 1N2OA 4KWCA 3HTUA 3UAXA 2I6SA 1MQ8B 3PWTA 3A0UA 3H2KA 1EVKA 5FKJA 4EJOA 2VHTA 3RT7A 1AGNA 4IHJA 4F4IA 3RV3A 5C4XJ 5EP4A 1KOLA 4Y2TA 4RSMA 3O0TA 3CGWA 5E2BA 3RU3A 3OZFA 2W6OA 3KP1A 5EMHA 3RJMA 1YI1A 3OWOA 3PFWO 1CJCA 4KLCA 3AVOA 3CF4A 3HRKA 4DC9A 3RFTA 4EG8A 2OGZA 1LTAC 4OP3A 1Q5PA 3KQPA 3ZNQA 4B45A 4JLWA 3X1WA 1T1GA 2R6ZA 4R9UC 4NC7A 3S9OA 4UBJA 3O2PE 4GZ3A 5MN6A 2V9VA 4H15A 2Z33A 3B1VA 1NVGA 3FCUB 1MNMC 3DKXA 3KLPX 1XCGB 3UJ8A 3MZYA 1LPSA 2FU4A 5IC4A 3HJEA 1N5RA 2PS9A 5ECYA 1RF1B 2EBWA 3PQJA 1CFZA 3X44A 3W3CA 5K0JA 5J8FA 5DEQA 2FYZA 3S29A 2QSGX 3GR6A 1I9GA 2GF2A 2PSEA 3C3XA 3U39A 1H5NA 4BN0A 1P60A 2YFHA 5ILSA 1AFOA 1IXYA 4CDRA 3HOXJ 2JGAA 3HACA 3CC2P 4OL0A 4YJ3F 1Z0AA 1ZJ5A 3OEEA 1TZMA 4TT3D 1ZVKA 1XGNA 4NBWA 2AMYA 4XORA 3AI7A 1ILEA 4ZKDA 4WLEA 2EZ4A 5DCUA 2VDJA 4C6HA 2HMUA 3KTFA 2WFAA 1P3DA 4KKVA 1KK2A 3TOXA 3C6ZA 1PHRA 1NSYA 4X1KA 4OLFA 4RULA 1M0WA 1PN3A 3R7WA 3MLEA 1IN8A 2Q6IA 5KINB 1WCIA 2D5CA 3RYHA 3H35A 1ZOPA 3DLHA 3CS3A 2QRXA 1KAEA 4LNUA 1NVBA 2LP4Y 3AR9A 4YGXB 3H0KA 3TE7A 4F72A 4RE5A 1AKEA 2OSVA 1OKKA 4Z8YA 2OV6A 1F48A 4AD9A 1Q7RA 3ZMDA 2FMFA 1KZHA 5JC1A 2O54A 2GAOA 5PNTA 3MGNA 1SQPJ 4R8VA 5LC1A 2A5LA 2RAEA 4PFSA 2P30A 3HKZA 4CQMA 2JFZA 5JS2A 1G8XA 2R3SA 2QG4A 4HX2A 2AZ4A 2V58A 2WA0A 2ZYUX 1WP9A 3H5IA 3MUDC 3Q9NA 5F9FA 4LOCA 4S04A 1G59A 4LMYA 3LCMA 1MAAA 2B8NA 3IVGA 4NOLA 1G17A 2A1UB 3PT5A 3QMVA 3D8NA 1Y6GA 1YZLA 2ZVDA 4C22A 1GA6A 2WEKA 3ZE9A 3AL0B 1N1GA 2VZ9A 2ACWA 1N5MA 2DOEA 2P1DA 1JDVA 1BKYA 5F73A 4ABYA 4EF5A 1S9HA 3LP5A 2MYPA 2L7ZA 1KI9A 3TUZC 4FGWA 3CF2A 3U2QA 1FE8A 2ISCA 4E4YA 1D2NA 1BDIA 3DFGA 1D8TA 2PX2A 4N4NB 4EFDA 1NG6A 1W2WB 2VZ8A 4CIWA 3GUUA 1ZAKA 4EVRA 3N0RA 4JOMA 3EGCA 4QGFA 5A3QA 4OKNA 2CW0F 3JRNA 3M9AA 3OOUA 4QASA 2K6GA 2BHSA 2DMUA 3D7LA 4IXMA 3OIGA 3GTKJ 3QENA 4BKUA 5F27A 4H59A 1RAFA 1SU8A 3UA3A 4S0HB 5F9HA 3HKCB 1NFRA 1E4OA 1C0LA 4ZVVA 1GTRA 4UMVA 5DNYB 4P82A 5F77A 3DBRA 3D54D 4DZPA 4GM1A 3VU3A 5ENZA 4RS3A 4XLNF 3T94A 3RC8A 3FCSB 1R6BX 2BBYA 2W82A 2ZSFA 1M8KA 2QTVB 3QEJA 1JMMA 4TN5A 2DTXA 2GCOB 1OCCH 3IL2A 3TTWA 3BE5A 3ME5A 2CCJA 1T9GS 5H7XA 1V25A 4PAQA 4Q3NA 3MCAA 1XSXA 4H77A 3DXZA 1W48A 1NUHA 3QXXA 2CCKA 2DJ5A 4F38A 5EE5B 2BYTA 4OHVA 3SQNA 1QRAA 1D6JA 5AONA 2OGTA 2STTA 2HN9A 5FLVA 4X5OA 1P33A 3M6XA 2VKTA 3NTLA 4ODIA 2JRTA 2KLUA 2AOTA 3G5AA 3U7JA 4FE7A 5KSPA 3KJFA 2QNRA 4RPHA 1DDNA 2FSVC 3CW8X 3I30X 1WUKS 2WLSA 4CIBA 1T3UA 2MSKA 5T8KC 1OH7A 3HFRA 2FN3A 2O03A 3K0AA 4H6XA 3P0JA 4XN3A 5CAEA 3TD2A 4A0RA 3D43A 3CZ4A 2JLRA 3LO5A 5AW5A 4WJLA 1Z45A 5KNBA 1RWXA 4L9SA 4D5CA 5IM4A 2D13A 4TRMA 3IEKA 4EX6A 2PR7A 3FUTA 4YFYA 1QGAA 3OWHA 1QIIA 1ITYA 5LYJF 3NNSA 4G0ZA 1H85A 3AFOA 4BQEA 2A59A 2XBUA 1E3SA 2JAUA 3IAXA 3SR0A 5INTA 2ZU0C 3FA2A 4G4GA 4P3KA 3CJQB 3SIXA 4URFA 4WN3A 2DA4A 3FM5A 1WAMA 5FFMA 2BVMA 2HQOA 4BYGA 1LXCA 2VJNA 4XGIA 3OZVA 2QRLA 2WZQA 3K9CA 3FDFA 2EJCA 1Z0XA 4IOJA 4AJJA 2OFXA 5U4XA 3R6WA 1K7XB 3IT1A 2BHLA 1GAXA 4JLNA 1RDFA 3L0OA 4WINA 1KQLA 4RZUA 3MIWA 2WP0A 3V9PA 1PNQA 1XDDA 4L07A 1ZZGA 3PDIA 1NQVA 1QHFA 4C7MA 3DCFA 2Z6QA 4PFQA 3QEAZ 1HKTA 3MHTA 4J00A 3DFFA 3ETJA 3PGA1 3L72D 4MIEA 4N7RA 1YDHA 4Y6GB 2O3UA 4N9HA 2AXLA 2NLOA 1J70A 5TF4A 1W4ZA 2QJPC 1W0KD 2XSZA 3R0XA 3OIDA 4O4IA 4LE1A 4RJJA 4AM8A 4A2PA 2M3BA 4OG2A 5KEIA 2WWHA 5APWA 1E6KA 1P1BA 3EVGA 4RSHA 4B6RA 3A14A 5JEDA 1QAMA 2BTQB 5KVRA 2NPSC 1GV2A 1O89A 1M74A 3PUWA 4RPKA 3DLCA 4LYJA 2AKYA 3VPFA 3TI9A 4HH2A 2G1AA 2VA9A 3EQLF 1G8JA 2DKFA 1TEXA 1BKDR 1AMNA 4N8SA 4DF3A 3ZDYB 2YHAA 3O26A 1ZK2A 1V7QA 5FJIA 3ABKH 1R6TA 4Y1FA 2Q5JA 3CNHA 4TTTS 3EPRA 4IXAA 4K35A 3AEAC 1T5IA 4Y3OA 2F8LA 4JV5B 3KZKA 1DPRA 3DPTA 4TYMA 5ALJA 2FZEA 3R20A 1J23A 1DQPA 3HDGA 2HXGA 4BJ5A 5HTKA 4W8HA 4EATA 1URPA 3VQTA 4EEFG 3J7AC 2QHXA 2NN3C 1W4AA 2YNYA 4DSOA 3H25A 4RVSA 3Q8MA 3GROA 5AW7B 4ZZDA 5D84A 1MC1A 1VL5A 2X42A 3S7ZA 3OO0A 4PX5A 4YMVA 1MBKA 4Y9TA 1YK0A 1ZRTE 3BHIA 3P8CE 4PYLA 4J0HA 5F5LA 1M34E 1YCHA 2TMDA 3SC6A 3DM5A 4M1WA 2R6FA 5FPPA 4JT8A 3WE2A 2Y8EA 5CMLA 4QU5A 3HGTA 1VPCA 2DETA 2RH0A 3K4JA 4WOCA 4W8GA 2ZUUA 3DEKA 3ESYA 3RYIB 2XYQA 3A26A 4ASNA 5C1PA 1SUEA 2QPAA 4BDYA 3KOOA 2J0UB 5K0ZA 3FTCA 5HLHA 1QP8A 2AJTA 2XTZA 4MVYA 3IMEA 3A10A 2IKSA 4PJNA 1G0OA 3KHKA 2F90A 3RTGA 4XFKA 3ZCVA 3PG5A 1UEXC 3P97A 3MJTA 3GLMA 5CBKA 3BKXA 3JYLA 1R1UA 3EW9A 3A1NA 2ZTUA 5KIAA 1N0WA 3GFPA 1T0JB 5LZ8A 2EQBA 1X58A 1TA9A 4JI3B 2CXQA 3K7EA 3DO5A 1NUTA 2ZIGA 1I3KA 3DC7A 4KR0A 1F4PA 3TLYA 3KL4A 4EW1A 3H1KG 1OW3B 3B1JA 3VSDA 2OZUA 5A7HA 2XWSA 1DGQA 5A2QK 4BB9A 1H8HD 4FEGA 1XJWA 5EIHA 3H32A 1VJGA 3DE0X 2JATA 2OYHB 4WAUA 3X1MA 1IPHA 1W4RA 3P32A 5LN1A 3PE6A 5HKBA 5CT4A 3Q3CA 2MH9A 1OAOA 4FCVA 1SXJA 4TXJA 1TM4E 4CM4A 2VKEA 1UKAA 3AR8A 4TS4A 4NU8X 2BFCA 2F1IA 2H5EA 3S1QJ 2QMUA 2PUAA 4RE6A 2ZR9A 1SVSA 1G98A 3UVEA 2BE9A 1OTYA 5ERGB 4KR7A 3N39C 4B86A 5CT5A 5FR2A 2XKAA 1SQFA 2CFSA 4P35A 4XGRA 5EJIA 2QSJA 4N9IA 1A9RA 2LG4A 4G0UA 3V9AA 3CMEP 4UFNA 3ZDZB 5DX1A 2C84A 1BYIA 2V7XA 3MOSA 3BZKA 1VHQA 2RGCA 3H9QA 3M91A 4L8GA 3U4DA 4LF5B 1V7ZA 2X0LA 1BJAA 3ISJA 1JHYA 2XDAA 1UC8A 2Q8NA 5LQKA 4E5VA 3DG9A 4P84A 1IN7A 3KP5A 5EQJB 2QPOA 1L4UA 4OX9B 4OAZA 1P4AA 3H3ZA 5KAPA 4PYNA 5AVYB 1YDGA 2EFYA 3S44A 4W4TA 2WTYA 5B7PA 2FMIA 2NSYA 4TLAA 3GBSA 3R2PA 2PZ8A 1TVEA 5CIQA 1DINA 2C7PA 2VDLB 2CLHB 4DYRA 1DTWB 1JVNA 4XYGA 1HGZA 2HAEA 2Y1CA 4HF0A 3HN6A 5JLWA 3TW8A 4PCQA 5H9WA 5JAHA 3S5JA 2HOSA 3NHPA 4ZYYA 1Y7LA 2EIHA 1BE3J 3ICOA 1I27A 2K3FA 2Q8PA 4Q37A 2YBEA 1ZINA 1QHGA 2Y76A 2WJYA 2GTIA 4QUJA 3QWAA 3TBIA 3FUVA 3KFLA 4C4RA 3H0DA 3F6SA 2V1XA 4BFUA 1GN9A 5KVSA 3OX1A 3ELYA 4RDXA 2P3SA 1DG1G 2EV0A 2TMYA 4TGLA 3ZV3A 1RUNA 4GOKA 5AMXA 1XDWA 4Z0PA 4PIPA 1O03A 3F6VA 3EZ7A 1ZIYA 5JWRA 2QN1A 3PX3A 1URQC 1IV6A 2BTOA 3MZ0A 1ZUNB 2XT0A 4MWCA 4RZQA 3V4OA 2M6LA 4B6QA 4Q4HA 3JQ9A 2BKVA 1UP6A 4BUZA 2W8BA 4XWAA 4F11A 4FIZA 4C3VA 5FR1A 2NS8A 1VL1A 1P2FA 1G5FA 4LDAA 4MRPA 2IHVA 1EFRD 4CYCA 3OOSA 3ZTYA 4TKVB 4KXMA 3RBVA 2G9RA 3V4FA 5AM1A 2V7VA 3QE0A 2GNOA 4IHTA 1COWA 4PZZA 3TD9A 4R84A 3K2EA 2NPSB 2WT4A 4ZICA 4M60A 1KQGB 2W6JA 2K3PA 1WXGA 2R6AA 4IICA 4JLSA 3RSOA 1CY8A 4ZK2A 1NTMJ 1V3QE 2EKZA 3TQCA 4LSWA 3I72A 3G8DA 1KDZA 3GFVA 3IJEB 3GNLA 3FNGA 4NNJA 4Q3CA 4A36A 4B5LA 3WWDA 4MN4C 2H2GA 1NJ1A 2R8YA 4WBNB 3AE4C 2CYYA 5J1RA 1B8IB 3H1EA 3LQQA 5LZ5A 4B17A 1FJPA 2V26A 2HLHA 2ROQA 4ND2A 2ECCA 4X1OA 3Q87B 4AG6A 1E2FA 1J8QA 3BH0A 1NBMA 4JXZA 4KJZA 4QTUB 3OT4A 1JJ6C 3ZJ4A 1NBEA 3TNFA 1L7AA 1L1RA 4G07A 3NV7A 1UZNA 3LPDA 3CYFA 3N6RA 5IC6A 1LBSA 2IRFG 3DR5A 2H31A 4EG5A 3TDKA 4HZFA 2WC1A 1Q0ZA 3C24A 3OG9A 3EG9A 4QOIA 1I3MA 2C3YA 1EWVA 1MBJA 1Q3TA 1L7NA 2C2XA 5EJ6A 2PU7A 1SBNE 4FYYA 4B3BA 2D0OB 3UGJA 1HDZA 3BFPA 3HEBA 1J1IA 3L01A 3KDSE 1UOOA 3W3AA 2BGTA 3G6KA 4ZRNA 4IOCF 4FGKA 3L8MA 2O3TA 2XRLA 1YJAA 5AHXA 2D74A 4FJ2A 2RGAA 2RMZA 4K1LA 1EK6A 1ESCA 2Q5CA 1V3FA 4EHJA 3CC4P 4Q4CA 1QIHA 2CEAA 4KMUX 4E4HA 1LT9C 1Z0DA 2H85A 4KVAA 4PLTA 2JH8A 2HVQA 5EUBA 2HLDA 2XSDC 3RK2B 2JFVA 2I3DA 1RRKA 1DBSA 3GT3A 4L0MA 4FSHA 4L9TA 1N73B 1QYWA 3MMYB 4DR4B 1I4WA 3UJBA 2PTHA 3H2HA 4PYKA 4G12A 3AEEC 3E5HA 3KPHA 4MQEA 3I5UA 4M6XA 4GOJA 5E0KB 5K8LA 3H5OA 4MIOA 3R5SA 3ANMA 1IATA 4JQSA 3IOEA 4HDUA 5DKFA 1DPUA 1EFPB 4GR4A 4LX8A 3DJYA 3M6MD 1IBLB 1ZSNA 3ED1A 1W85A 3DVRX 3UKDA 1R4NB 2DDAA 2GWRA 5KQSA 3WBFA 2EJRA 4FN4A 3ONEA 4QJ3A 1RPWA 1YE5A 1RJDA 1JJBA 1X1CA 3CX5I 1H4VB 5DBHX 1C2YA 2A5DA 1WNFA 2XGJA 4GZ5A 4YFNF 3BIFA 2WTAA 4D9HA 4UNRA 3K2ZA 3D0QA 3NKVA 2FPGA 2B9BA 1P0PA 4J01A 1IM5A 1XA4A 1UXHA 1FJXA 3NC1C 1OY1A 1N9GB 2HJWA 3TW7A 4DYDA 2IOFA 1YXMA 1V9SA 2C98A 4GL4A 5K2OA 1XTTA 3HNRA 3WLSA 4AYTA 3AV3A 3PTLA 4LKRA 2KYRA 3CD6P 4N3GA 3NRBA 1QIEA 1XSEA 1YQ4C 3PIPF 1UK7A 4R2MA 3KJQA 3TQIA 2ZRAA 1BL0A 1SVIA 3V2IA 1LT1A 1E2UA 1AHDP 1HF9A 1SFKA 5C7IO 4XYBA 3O3MB 4J1NA 1OI4A 1KILC 1Y3CE 4ZOLB 1ZITA 1HLDA 1WMAA 3V7SA 4XM2A 1SVUA 1Y7PA 5AUPB 2OBFA 1YF3A 3EGDB 3KS9A 4P6VF 5ITVA 3LDAA 4KK3A 1U7HA 1SUIA 3V1NA 2GPBA 4OWFA 3H7AA 2D0IA 3MT8A 2O3FA 2WLTA 1D2HA 1HE5A 3ESQA 3NONA 1RI7A 4EHIA 3GO5A 3T8YA 2VJMB 1V1MB 2X4LA 1GDHA 2IP4A 2Z2IA 4HYEA 1Y89A 5LOVF 2XUGA 1MD9A 4TKZA 3PPXA 2I8DA 5G4KB 3P2OA 1I14A 4GI5A 3OPQA 1RABA 1OFHA 3EN0A 1UBCA 2VUSA 1QZUA 3MCUA 3C97A 1XMSA 3JYQA 5IJ0B 4OAOA 5LNK1 4AY2A 2E2IJ 3D6JA 1G9TA 1JQEA 2P4HX 4HV4A 5AJZA 1R37A 2OQRA 1URQB 2M8EA 3L2OB 2QKYA 2ZRPA 2J5BA 2E6KA 3U9SA 4URYR 1GPYA 5EWMA 1B26A 1L4NA 3VEPA 1CRZA 4H0FA 4RS4A 3DZBA 2CLFB 3GRVA 4LC0A 4HX7A 3ZIUA 4TMFA 1YGYA 1U5BB 3BDDA 1E5WA 3VO8A 3DC2A 3CO7C 4D02A 2ZSDA 4LJLA 2NRAC 2OYIC 5L6MB 3TGPA 1N86A 4NNOA 1F9NA 1T8RA 2R8OA 5FUYA 1AKHB 3DGEC 1OV4A 1PD0A 3FSEA 1QMPA 2WITA 4DUGD 3Q7QA 1ESNA 4N5IX 2UDPA 1RAGA 1X9VA 4ON9A 3MT0A 5TGZA 4TLDA 2A6EF 4DCGA 4U0WA 5EIBD 4BUJA 3MFYA 2ANBA 3VHXB 1QZEA 4TTPA 1P0QA 3OCCA 4DCPA 3GHGA 2FD5A 3ZHZA 3ZKWA 3PGLA 4XKJA 2LNBA 3W6OA 2WV9A 4F3TA 3DHNA 1F6WA 1MIHA 2V4UA 3TQRA 3AE7C 3GCZA 1INLA 3H1ID 3RLFA 3AE1C 2QJTA 4WGGA 2WKQA 5AW8B 3BCSA 8GPBA 4OQFA 3V8LA 3VGPA 3ST7A 4XWTA 4DSUA 2CNDA 5EVCA 3L7KA 1YKSA 1L2PA 4HNRA 2A4MA 2PUVA 3GGDA 3CA8A 1OCRH 2HEOA 2BGIA 2RBGA 4FJ1A 2YJTD 4UUSB 1RP7A 3WLPA 1AA0A 3GYHX 1C3OB 4NQZA 4ZOEA 4ERXA 4RJKA 4DA6A 1BHQ1 3W7BA 2ZPUA 3KQVA 5KVAA 4IKEA 4QBFA 4FUQA 3M4OJ 3VTZA 3I71A 2ZXEA 5IG2A 4PZDA 2EIKH 2WUDA 2EV9A 2NG1A 3V5BA 3MILA 3TAUA 3RUPA 2NVTJ 2GXQA 4ND8B 2VTKA 5LL6P 3EYYA 4P98A 1ZRMA 2FRDC 4B35A 1DQYA 2GEFA 3KAQA 1LT9B 5D6FA 2WINI 1YC2A 4E0BA 5M5BA 4XFDA 3KR9A 3CMAP 5JVTA 1USWA 6PAXA 1VG8A 4NU5A 1AB6A 3IIJA 2ZUEA 1RQXA 4F1KA 5E3OA 5AHOA 4XRGA 4L9NA 4LY0A 4AM3A 2IUEA 3OQIA 1TE2A 2NZXA 4LJ4A 3WQQA 5H20A 1VNDA 2GN4A 3EDOA 5GZ6A 4V2FA 4KWTA 2ZKZA 4QRIA 3OQNA 2HDDA 4RLHA 4FHTA 1LDNA 1DCMA 3FRHA 4POAA 3RT9A 3H6GA 4BHPA 2GAJA 5HGXA 1WF6A 2HSEA 1AA6A 4YJFB 2V6IA 5KYYA 3HZZA 4E5UA 2VJJA 2A45G 2JA2A 4HDKB 4CM1A 1LW6E 4QO8A 5BSKA 3D31A 3GEGA 2RK6A 4PG4A 4YPFA 3GJ0A 5HM6A 5LVAA 4KMMA 1XCBA 3WRYC 1EFTA 3VTFA 2OT3B 2V7QJ 2PKYX 3OSUA 4YELA 4YQFA 1EHYA 1NBOA 3A6ZA 1N34B 5AJVB 2XZTA 1Q0LA 2XAQA 2OQGA 4H0LD 1OGYA 3DVSX 4D82A 3VNSA 1SCKA 2V03A 2DFPA 3ZIDA 4X85A 2NZUG 3VZQA 2YZ7A 5FYDA 3MMPA 2CK3H 4M8LA 4GXOA 1S9KD 2J3HA 3E3NA 2PFXA 5A3SA 2QPLA 4Q7EA 3JTMA 1JAXA 2B3DA 4WFJA 4YRFA 1EZ1A 5AW9B 2XC7A 4X84A 2BJVA 2X0DA 4Q7KA 3R24A 4X93A 1T2KD 3H1LJ 3U81A 1JKJA 3O8GA 1G3TA 3EIFA 4LBZA 4WT7A 1FC2C 3CUEF 3L8ZA 4IRXA 1FFXB 4RAGA 5D4RA 3VC3A 2V9PA 2GJ4A 3MBKA 5KCZA 4LQ4A 2XNKA 5IYZA 4YXWD 2QZSA 4HX5A 1KETA 5HF9A 3W2TA 1CUGA 3OYEA 2VDNB 3L7YA 4FM9A 3EEBA 3UTDA 1E79A 4NU0A 4XOIA 4V0KA 3CCBA 3UMVA 4RVDA 4W82A 3TQTA 7ABPA 3TTSA 3CCMP 3D5RC 3UJPA 1T3GA 4MWDA 2ZFWA 4FS3A 3PQDA 1P5FA 1ZNZA 3P9PA 4M7PA 3KHTA 4KI7A 3G9XA 4X64B 1NW5A 3NHLA 4U7GA 4DR7B 4EA7A 3I5MA 2VYNA 4D8WA 4QLCU 3DXXA 4F9GA 2XMRA 2CD9A 3EZXA 5ERIA 4L16A 2BMDA 5DV5A 4HVTA 3HV2A 4X8LA 5FHRA 3MBOA 2BV3A 4PZPA 4RK1A 3FPEA 1KU9A 1E63A 3R09A 5C32A 4M3EA 3PVCA 2C29D 1NPTO 1R66A 2FEWB 5CB6A 1N6HA 4NEQA 4YRSA 3K5IA 2I5UA 4P5DA 1JSRA 2OA4A 5EKDA 4HLDA 3UEOA 2C0PA 3OA0A 3H4MA 5E9QA 3G9QA 1TK2A 3J81K 1FMVA 2O1XA 1I1SA 4PYJA 3JAKB 1VG0B 1FTQA 2QIWA 2E1PA 2MSYA 1DO0A 1I3OA 1SQVJ 5FUBA 1JUSA 2ZJQF 1XB2A 4BV8A 1R5GA 2W27A 3MEXA 3BJZA 1N0UA 4IOIH 1GNRA 1Z0IA 4Q9NA 1EJ2A 2OYIB 2Z2YA 1NWCA 4RO0A 2XUKA 3QP9A 1FYWA 1UQTA 2ASEA 3L93A 2WSCH 3LNCA 4MVCA 2KE5A 1MXFA 3HOYJ 4PRKA 3DMFA 1U0SY 1FJLA 1BRMA 1VQOI 2HU8A 1DKQA 2HHAA 4FD2A 2IS4A 1GAEO 5A1TA 1SAXA 2I0FA 4IZ6A 4L6IA 4RHCA 1AKQA 5JAIA 4RTMA 1NC3A 4PSXA 3N4MA 2WU8A 2G83A 4RM2A 1EXWA 2IEYA 2HTFA 1T4BA 3O74A 2HDCA 1BC7C 1NTKE 3N2IA 2Q0OA 1DC8A 4E22A 4WL0A 4PX2A 5FBHA 1NMZA 1CR2A 3M2TA 2ZR7A 3DPUA 5AP9A 4DOMA 4A3IJ 3KZCA 3WNVA 1OB2A 4FN5A 3NWOA 2FSUA 5DBEX 1KYXA 3RFXA 1IY9A 4GL2A 1FMFA 1OA0A 3B85A 5AVTA 4OQZA 4WY4A 2BFNA 3FTPA 4IJKA 4DCUA 1DOZA 3AI3A 1BSVA 1ZRSA 2HFJA 3WGMA 3U1BA 3IIMA 4UDNA 4YUAA 3DMPA 1SQQG 1CY6A 1TMOA 4BFYA 1AKRA 3S0JA 1HTWA 1HORA 2JGKA 2BY2A 2E1CA 3Q6MA 3NEAA 1VRVA 4Z3OA 1BGYD 3FIUA 4E6EA 1XYVA 3NRJA 3HYTA 1QH9A 4W97A 4YUYA 1V11B 4X92A 5C7OO 3TO9A 5AFSA 5AM4A 1WT6A 4DA0A 3GFOA 1M33A 4FXOA 1GGJA 1RI1A 5TPWB 2AG8A 2VAXA 1USSA 5CM9C 5K4GA 3ZWMA 2VT6A 3I62A 1PGJA 3DLTA 2V7WA 4R05A 1KPGA 1G2OA 4QGGA 1XRMA 2WUVA 3FG9A 5CPRB 2F1RA 3T3OA 1OZ0A 2I2AA 2UXBB 5J2UA 1E2EA 1Y1LA 3OQVA 2DQZA 2J59A 1QLJA 2B82A 5J63A 4FMDB 3RE1A 1A4IA 1HEIA 3VYRB 5HVNA 3LKBA 1X0XA 2ILVA 2Z95A 2EJWA 3VZSA 4CEHA 3BTOA 4XTRA 1NW8A 3E8SA 4CMJA 2M45A 1XTUA 4OQYA 4II7A 1JXAA 2JFYA 2QN7A 4FQ5A 2CDRA 3L6RA 5D5PA 1AJYA 3HVHA 4A3FJ 3DLPX 3VHRA 4OHUA 4N0QA 3N3AC 4CQNA 2GXAA 5AVSB 4LFAB 4Y7CA 4I0WB 4QUEA 2YMYA 4AUMA 3GF4A 5GWXA 2LBFA 3UXHA 1II8A 2PL1A 3ZGOA 2OBPA 5EJ8A 3NHKA 1POWA 3ZWWA 3LS2A 5A3JA 4ZVLA 5C37A 1Z2CA 4WOPA 2E2HJ 4MV5A 2B2CA 1VMKA 1WMKA 1BCSB 2Z6AA 3KBBA 1HLFA 2JBAB 1YL6A 4J75A 3BKWA 3UAOA 2FX5A 3HOVJ 1ISSA 3F74A 2BI4A 3HXPA 3HD7D 3LQ1A 4OGWA 4PICA 3DWIA 2OCPA 1NF3A 3HYSA 2BN4A 3UXMA 3V7RA 4IQGA 1G2CB 4YUXA 4XW2A 3IPAA 3K09A 1DEAA 5ALHA 3FI0A 1YVUA 5E0OA 4XSZF 3AAFA 1NN1A 2C96A 5JTTA 2VS1A 5TGTA 4PO9A 3WBJA 2M2EA 1X3WB 5A02A 5FWNA 1SQXG 2R32A 1SKMA 3EH2A 2BEJA 4XQGA 3NM6B 2Y9MB 3GAZA 4FOPA 3PLNA 4E31A 4ZMRA 4MI9A 2X0EA 3D6VA 4BJ1A 4Q3OA 3TTXA 3S2HJ 6Q21A 2W71A 2WYUA 1U9JA 1E3OC 3I39X 2OQIA 1RACA 1QPBA 5JQGF 1UJNA 4RZSA 5FWYB 3C8HA 3L9XA 1RF1C 5NLLA 3CO6C 3N8NA 2Y05A 1RMTA 1R50A 1TQ6A 4UCXA 2XBMA 1IV8A 2OAZA 3CZ5A 4K9RA 3D6ZA 5KYUA 4PGHA 3FSRA 4XIJA 3QQPA 4UNNA 1QFYA 3FXMA 2VONA 5IYBJ 1Y4AE 2GCPA 2I2WA 4CCKA 3GYBA 4LQCA 3KIOA 2UYCA 3A02A 2MMGA 3CNEA 1GLNA 1TD1A 5B6IA 4I6GA 2ELHA 4UXIA 4FQGA 16PKA 1F4KA 3IQGX 3ZMSA 2ADMA 3O4HA 1JEYB 3F9IA 5BV2P 3L8HA 4HT3B 3ZPLA 1M72A 5A9SB 2L9RA 3DWLE 2QAGC 1CY0A 1B42A 1DUXC 4QYWA 2J6CA 3H4IA 3R8XA 2NUAA 4D7NA 1BWSA 1SG9A 3GZJA 2ZP1A 3A6KA 3COAC 1FB5A 5KO2A 3L4SO 5F1OA 2D1SA 5C5EA 1BM9A 2M9HA 5CLFA 4BBZA 4GWLA 4RTJA 2WIGA 1DHRA 1X1QA 3B6CA 4LC1A 1RXIA 3B8EA 1FMJA 3RJPA 4Q9LA 2D0PB 2JVGA 3EVZA 3F1LA 2E2WA 5FWDA 2ZO4A 5J9FA 1KP9A 2A05A 4O4HA 4WK2B 1BH2A 3C3AA 2DFHA 3AMVA 2VDUE 4TYWA 4OUDB 4RADA 4WKPA 4DA8A 1WI3A 3HGQA 2W4QA 5DNUA 2TYSB 3M4JA 5P21A 1QOZA 1Q11A 4JBHA 4LOIA 1DH3A 4PLVA 4NCNA 2P9EA 3SS9X 5DNEA 3L70D 5JIBA 1R10A 1ULBA 3AL0C 1NRJB 2RN7A 5EERA 4BV9A 3VH2A 2IHZA 5D85A 1PGPA 1CDOA 2CXRA 5JY6A 4OVNF 3OQJA 4LZLA 2NQ8A 5KWIA 4BAGA 3MC1A 2VC0A 1Z6AA 2B9EA 4P81A 1KZ9A 5EG0B 4IFDK 3OCVA 3BHNA 5IC5A 5BR1A 2UWMA 3JWIA 3E0QA 3COZA 2QRVA 5FTNA 5IAOA 3SS8A 4N03A 2DFNA 3GEEA 2QMOA 5ETJA 1S3GA 1Y9AA 4MAAA 1DBVO 3OJWA 3SE7A 5HF6A 1JFRA 3VDMA 1FP1D 3AM4A 2ZB9A 2B5WA 1W5FA 3WLOA 4MR7B 1LLFA 5CX4A 2Z16A 1AQ6A 3IBCA 4ZVTA 1I7LA 4ZFNA 2I1KA 1G3SA 4DV2B 3FYUB 2HUNA 2XX3A 2F17A 4DBQA 2FNAA 4FWTA 3Q72A 2W2OA 2EJVA 2G06A 5C4IA 2DUWA 1L0LK 3KT3A 1DBPA 1PR5A 2ATCA 2JFGA 2JFQA 1FYVA 2BW3B 4KWEA 1OVMA 5GADJ 2WAXA 1TVKB 3AT1A 5ES4B 3ITEA 5FLEX 1R8SA 4JT4A 4XSHA 3HUSA 2HA6A 3LGAA 4ENUA 1ZM2A 5MGNA 2Z9DA 3QJYA 1K7AA 4ACAA 3OLWA 1T2UA 5EZYF 3RVDA 5HOOA 1WBBA 2PPLA 3TLZA 2FPIB 2CRGA 3NTUA 3V7UA 1UHMA 3E7KA 1UP7A 3JASA 4J03A 3PFKA 2P90A 3VYSB 2QL9A 2W70A 3H0EA 1EU1A 4CMEA 2CJFA 1Z3CA 3EZ6A 2DULA 4B2PA 4EARA 1YAJA 3GLVA 1VLVA 4NG4A 3M7IA 4O4JB 3G71I 2VP9A 2QLMA 5B7NA 1RQLA 3JPWA 4RNCA 1TLTA 5BORA 1B0ZA 5K3BA 3SJMA 2AQEA 2PJZA 4Z99A 1NGSA 3ZHXA 2X6RA 2XLCA 2JA8J 1GYRA 4G26A 4JJZA 2Y75A 4ISBA 5LXTB 4A27A 1M2VB 4R16A 1U99A 2PQMA 1YMUA 4WNAA 4IQJA 5C7YA 2D54A 3ABVC 3JRWA 5A4AA 5KDOA 2H8KA 4NXMB 4NHOA 2O8VA 1C9DB 1QHHA 2XRFA 2HKIA 1GL2C 1GNVA 5DYMA 3D1LA 1XA3A 3NYIA 1RMQA 1A8QA 1XRQA 1QVFO 3L0DA 1DU0A 1FQWA 4BIIA 3V97A 1F51E 4FX5A 1L2TA 1WD7A 1HV8A 4YIKA 2GXSA 3ZVRA 5FV4A 3A27A 2FN9A 5EPEA 3U48A 3C3WA 1MG0A 2XMZA 3E6CC 3TEMA 3RKWA 2V59A 4LFUA 1CEXA 3PLRA 2BH2A 2E2JJ 1IBSA 4LJ5A 4ZI7F 2WHPA 1RF0C 4IL5A 4FKMA 5EIFA 1KI6B 3DWEX 2P5KA 4BVLA 2AO9A 4WVFA 2HIMA 1GCIA 2CGPA 3L8EA 3QUQA 3ZYCA 3M5DA 4AWAA 1L8QA 5JDIC 3PNPA 1YU9A 1ENYA 2C3OA 2C1EA 3KYLA 2ZSIA 2VBWA 3BM5A 4OOEA 1M1YA 1JEQB 1QFZA 2C97A 2HW8A 1A5ZA 5E2IA 3HY4A 5H59A 1ECGA 3PI7A 2IPAB 2B0JA 3ABTA 2J4FA 4GZ6A 2JAPA 3BR5A 3H42B 2OC9A 1X74A 3E1GA 3RGUA 2XB9A 1D6NA 4ASWA 3QLVC 2TSYB 5REQB 2VAPA 2F00A 3OE1A 4OGFA 1NWHA 2K37A 2CXTA 3DE6X 1G6KA 1CW5A 1YQTA 2NOAA 5AKYA 2ZZNA 3RIRA 2BVNA 1VQKP 1PO7A 2I8CA 4LG0A 2C9OA 5A7GA 1NPYA 4QPDA 3TW4A 2RH8A 1WQ3A 2VRCA 4YAWA 5BYJA 1IB0A 4NENB 4TSKA 3RD5A 2ZJSE 2R1TB 3CX6A 5HDKA 3GK3A 5E4JA 5DNAA 2QAGB 3HGGA 1WLSA 3LRPA 3HWX1 3C15C 1YE3A 3S6JA 1J21A 4EITA 1LZKA 3M9WA 1GA1A 3QWLA 1VJ0A 1GXSB 3F8WA 1U8TA 3BL6A 1QQ5A 2M32A 3ZC3A 1FNBA 5LBQA 1WKCA 3WP1B 1OWMA 4BZZA 4DXHA 3WTBA 4HUJA 2VTEA 4HC4A 3IQIX 4MMZB 1P4RA 5AH0A 1G2PA 1LDEA 2ZAGA 4G8BA 2A9OA 4N76A 4E7JA 3R0JA 4BNKA 1EBBA 5GAGJ 5CCGA 3O91A 4IJVA 2BGRA 4PVDA 1M5TA 3ORFA 5CNIA 1SH7A 2L9VA 1JJAA 4LOJA 1AHNA 1IZNB 2QMZA 2V0GA 2CVQA 4UTZA 3FRIA 4RWZA 4V39A 4IRIA 4BEBA 3HDDA 3GNQA 1U0GA 5DI3B 3FWNA 3H2YA 1W35A 3R6SA 1RWOA 3BHJA 3N7UA 3E0XA 4XR4A 3G8CA 1VHWA 3BDVA 1MJ9A 2UVQA 3SF8A 1EDLA 3N53A 2CJWB 5TR9A 3ZCXA 1N7SD 1V39A 4CLRB 4E12A 2J3EA 2P5VA 3M9BA 4R4LA 1VJ5A 2A8YA 2OOKA 1PTKA 1UJ8A 3JQFC 1NOIA 3LHIA 3KT6A 1A82A 3L7NA 2N9YB 1EUYA 2X3YA 5AW1A 2HWXA 3WFZA 3PO2J 1UIRA 2HXOA 2AT1A 1NYRA 5BVGB 4H4EA 3N5CA 1TRKA 5B3SH 1VPTA 5D3MA 1ZI8A 2ZJPF 3T0YA 4WNYA 2OYHC 4X0EA 3FOAA 4CM9D 5HRCA 3ENNA 3FMOB 1UC9A 3QXHA 1LV7A 3ZHSA 4N3CA 1Z5GA 5D2CA 4BB5A 2WSSH 1RWMA 4ZN6A 3KEFA 1UBHS 4KOAA 3PNTA 3L72G 3GRZA 3DM9B 5FLXA 1QKKA 1NBIA 2RHHA 2NSDA 4HEA2 3RG8A 1M2OB 1NUUA 3E5QA 1L0LG 3MBIA 2JHFA 3ABZA 6LDHA 2GZSA 2AWOA 1IWBB 1A97A 4RCZA 4EQ6A 2JKYA 4JELA 1B14A 4YP7A 3PA8A 1KFBB 3B6IA 3VOEA 4B44A 1YB6A 3M3HA 1SFCD 3EH1A 2ZJ5A 1V4VA 3RWBA 3RC2A 3V8JA 4O63O 3V8EA 1EH8A 2ORWA 4XQEA 5EZ6B 1Z15A 3K92A 1OLTA 2EKQA 4O29A 1OT3A 2I5PO 2ZOSA 3GDHA 4EKYA 4FHEA 4AZ0B 3OQPA 4OJQA 3P19A 3N8GA 1NQ5A 1A36A 3RIMA 4RK7A 5CJ0A 1IXKA 1BD4A 3ETDA 3I01A 1EG2A 2IFNA 1MC8A 4L8WB 4I5EA 2QEXP 4A3LJ 2QQ8A 3TYXA 3B1XA 1PR9A 2EOAA 2FTKE 2K85A 3GJ6A 5B36A 2B2XA 3I9FA 4ZA2A 4ON0A 1UZUA 3VZCA 1KFJB 4BDTA 2RGVA 1PDNC 2HIHA 3VWBA 5LQNA 1S01A 2EBIA 3VO9A 3GFLA 5C5DA 1HNZB 5AVUA 4KREA 5ESXA 2JFOA 3JWPA 4R0NA 1GL2B 3CMYA 3JRAA 4AJ4A 4I76A 3ZW7A 3V55A 5DHSA 4CN9A 4RH1A 2ORED 3FJYA 5C81A 1TQPA 2YXDA 4WHMA 4P4TA 1SMTA 1T5BA 3BDAA 4H0CA 3K5PA 4CF5A 3ZGNA 1Z5VA 1LQUA 2F43B 2ZAOA 4KIFA 1JSCA 1XWWA 1AUOA 3Q3DA 4GPZA 3ZHRA 4RDUA 2FDCA 1PJCA 3PEFA 1E1QD 1IJEA 2G5PA 5FDFA 1CB7A 3RBZA 5JI6A 3P9YA 3H5LA 2GD6A 4IFFA 1FX0B 2UV1A 3STHA 1P75A 4CW7A 1YR3A 4HQRA 2V3CC 3HRSA 4LF9B 4J76A 1JUDA 4URUR 4UVCA 2M1XA 2VYVA 2WMOB 2Q41A 4N5MA 1HX7A 5LNK6 3U80A 3HOZJ 1GU5A 3U1AA 4IDPA 3UUFA 3LY8A 1L0LD 2DPHA 3VR2A 3JQAA 4KDRA 1J8MF 1SQBJ 3HIFA 3RQ4A 1OBCA 6REQA 4PE5B 2NO4A 1Z1DA 3O9ZA 4KQMA 4PPQA 4FMCB 4GX2A 4ZNCA 4J0EA 3BZBA 2AJLI 4YP6A 3IJRA 2OO5C 1F2TB 2ES4A 3EHEA 1RI2A 2HG5D 3BPSA 2VPRA 1NU6A 1L7QA 3CVWA 3TB4A 4HAYA 4P32A 1WLYA 3V2RA 1RVV1 4UVEA 2BH9A 1JQLB 4NX2A 4C78A 4AU7A 3I2JA 1OIVA 2NNNA 1SHKA 3WLQA 3BWCA 2C7RA 1KU7A 4KE8A 5G1PA 2JLCA 2CSUA 2R00A 2J3JA 4PPFA 2NTNA 4HQKA 1LA2A 1IUPA 3QA3E 2WV1A 4NFLA 2B6HA 1KXZA 2JW5A 1J99A 1ZA1A 3DAHA 4MUXA 2F5DA 3EVTA 1SUFA 3KJIA 2BCCE 3N0WA 4IKOA 3WXBA 1HFWA 2ORYA 1YQ3C 4GP7A 2BKUA 5DM2A 3R4KA 3CCJP 4KH1A 4F7ZA 1EK5A 1OKRA 2G9NA 1C3VA 2IZ6A 2QN6A 4GQIA 3DEJA 4WBAA 5JXJA 4L57A 2BJHA 1ISRA 3EXIB 4QRHA 4UOEA 1MABA 2DN0A 3DS8A 4IGEA 3TQQA 4FCWA 2I8AA 3G2BA 2EFEB 3M6AA 2IV2X 1QRYA 2P0YA 2MYSA 4G6QA 1TGVA 2TRTA 1AKYA 4JGIA 3EGVA 2FFDA 3N28A 1UIMA 5J8CA 4A2QA 1P7ZA 1BEEA 5FKKA 1OXXK 4Y2UA 2WVRA 5CFZA 4EYGA 4Z1MA 1MW8X 5IXJA 2TECE 4NDAA 2VBGA 2HPIA 3FXUA 2XMBA 4EI7A 1K05A 1USEA 2YIJA 4CL2A 5J2TF 4LG1A 1IO2A 1EGQA 3LRTA 5BNTA 4UMEA 5IYCJ 5EFWB 5FXMA 1X7YA 4I1UA 3SC3A 2ET6A 5BSRA 1OVRA 3AEUB 1DQNA 3ZWQA 3RK2C 1U2EA 1PFQA 4LY6A 4H0EA 4GPEA 2H2IA 3BORA 1P4WA 1DARA 1LUAA 2EJBA 2GK6A 4BKQA 1GTG1 4MW2A 4Q19A 3A9SA 5MDHA 4B73A 3IOMA 121PA 4CZZA 3CCRP 1XTVA 2KX7A 1N73C 2OQ2A 3WNBA 2PN6A 3K1AB 4BO5A 3TOCA 2L69A 3DL7A 4A3KJ 4ARUA 1O87A 2JC3A 3CIFA 4EMTA 1KKUA 3JVEA 4BDSA 4O1HA 1EFCA 2IA5A 2NU6A 3ZDEA 2Z5FA 4C0SA 3GW6A 4GP9A 4G8CA 3IDSA 1T3LA 5EMKA 1AHPA 2ZUCA 3GBGA 2WU4A 3L1IA 3SJBA 4UDYX 4Q16A 3KQHA 3RYFB 5GONB 2N3ZA 1CIVA 2C9LY 3KB8A 1HJ0A 1UAAA 1XDUA 1OLXB 2C9CA 5EMJA 4GYKA 4XWKA 2MINB 1T8IA 4PDKA 5I8PA 3DGFC 3CMEI 2YWBA 3UR3C 1AA9A 2OWEA 1QS0B 4QULA 1PK9A 4D98A 3DXJF 4A5MA 3B53X 1SQ6A 1XXHB 3I2KA 1GZHB 1HKUA 2G3YA 2ZXIA 4UHKA 4BQOA 4FBMA 1L0OC 3V1KA 2O3SA 4Z9FA 3M82A 2L01A 5F64A 1HA8A 2VT7A 2Q2EB 5SY6A 3CE9A 5DHAA 3F8BA 3P0IA 2ETVA 1ZK3A 3ZY4A 2YL2A 2VN2A 4U88A 2G0NA 1XEXB 2F5EA 4JLUA 2A9PA 4D9KA 3SS7X 5HLTA 1M1NB 3ZLJA 1QAOA 3DHVA 2XUIA 3VU9B 1GHCA 5FL7D 3QNUA 4CKYA 3NVKI 1U7XA 3C18A 3Q8LA 1V41E 2Y0PA 5ALNA 2PIAA 3OTGA 4AWBA 2PR2A 1QYIA 4PSUA 4BX0A 4CPDA 1O95A 2VP2A 4IPTA 5JZ9A 4P22A 1GV0A 2AQFA 1UBNA 2AG1A 3K0CC 3LSGA 1I7DA 4RELA 1K2VN 1UMQA 5TQ0A 5C8YF 1ZX1A 4OFXA 4JI0B 4HX4A 5L7WA 3PFNA 1C81A 3SYRA 2K7FA 3Q3SA 3P5JA 4UHFA 3ZEAA 2DGDA 4X7RA 4PBSA 2E76D 1DXHA 2ZRMA 4MUNA 4PM4A 4E5NA 3Q2IA 1S4XA 4X20B 3BGIA 4PO1A 2DMRA 2DA1A 4OIRF 2VLAA 4CG2A 4DJFC 2GPSA 5KSZA 1IG0A 3P9CA 3T5DA 2R84A 4P7JA 2D62A 4WKOA 1J2RA 2FR1A 3QYEA 4HDRB 1KDYA 4UXHA 4LE2A 2CLOB 1Z39A 1OWPA 1ZGCA 5EYPA 4D43A 4WWHA 1Q1AA 1O6CA 1ZISA 4Y2GA 3V1TC 1OE0A 4WK6A 4CQLB 1MDMA 1N6IA 3ESXA 3H65A 4FWIB 4RKEA 4BWFB 1KAMA 3R9XA 1VQ9I 4E1BA 5CQEA 4UM9D 2PMZA 4QQRA 1DQUA 1FXWA 1O8CA 1D0YA 2V9KA 4K3AA 2AYZA 1TPZA 1W46A 4ZH4F 4NYJR 3DEFA 3UMBA 3SJAA 3CC8A 3WNCA 4XR6A 1CQXA 2CN1A 4JOCA 1QLWA 1HT1E 2YY7A 4V0SA 5G40A 3MSXA 3ZV4A 4KE6A 1ZARA 1QJ4A 5LQMA 3B60A 1TD9A 1OCOH 4LA4A 1J2UA 1XKXA 2BMJA 4BUCA 4PJLA 4S1WA 1Z0KA 3W8NA 1DP7P 3QYFA 1HR0B 3ESDA 1BBYA 5EZHA 4KX5A 3WOHA 1S0UA 1EB8A 1XMOB 4EGCB 5JXGA 1XNQB 2WHRA 4EL0A 1GPDG 1RRPA 5FOWA 4D9CA 4UTNA 4EZIA 1QR2A 1KJNA 5HQ3A 2ACKA 2QX7A 4JB8A 2BLLA 5JJ5A 4EY5A 2V74B 4A5OA 3O90A 4BY7J 4PJMA 3WR5A 3F98A 1JL3A 1GITA 3VOSA 4EA9A 1U3EM 2YQ4A 4M8NE 3N2GB 1AN9A 2PI0A 2E75D 3KQWA 5CVJA 1WXWA 2E5WA 1AK9A 1F7VA 5HNKA 1Z91A 4YTEA 3F5DA 5DTQA 3RVJA 3NHUA 4N6OA 2GCIA 3JREA 5BUCA 2XVAA 4E07A 3QVOA 3RPUD 1L1FA 3Q7IA 3LNTA 4FYMA 1VIDA 4YRTA 3RR2A 4YLYA 1FWZA 1QLED 3PYLA 1D2MA 2J33A 1D9ZA 2IXTA 4NK4A 4NICA 2HF2A 5JXHA 4M1QA 3FNRA 3TZQA 1C8VB 1EZVD 3L2QA 1YQXA 4NJEB 2O01N 3EEQA 4EFLA 5LGUA 3O0DA 3JQGB 1F6DA 4G1VA 2RB5A 4EG6A 3FTDA 3NTRA 2EZKA 3X2QH 2ZJZA 2ZTLA 3ZXUB 2F9MA 3GLHB 2G1UA 3SHFA 1O7LA 1N8RQ 4ND3A 1IWPB 4NOKA 4LJSA 3CC4I 2F5FA 1J90A 1Z0FA 4QXOA 3UNGC 3DHWC 2C5LA 5E6SB 4EFKA 4G5FA 4IP0A 5B3AA 1DBRA 1U2ZA 5TV2A 4KO1S 3WK9A 5AW4B 4B4VA 2COEA 3FOZA 1IOVA 1A2OA 3IYLW 4PLPA 3PFHA 4ZZ3A 4N78E 1DAMA 4DPKA 5JNTA 4RORA 3HHHA 2FW1A 5I8ZA 4RTNA 2Z5HA 2X13A 3JR7A 2QN2A 3HRUA 3NJ8A 1Z3XA 4PSVA 4EB0A 1T6SA 3GXBA 1EKXA 1ORWA 3ZQGA 1MBEA 2E19A 4PCAA 2O7RA 1W1WA 3EUHA 2X4IA 2AR9A 1MPXA 2QDKA 5H6QA 3HBMA 3RKRA 4WXHA 5FCDA 4KODA 4CA0A 5LA6F 1QG6A 1BA2A 5J58A 1PW5A 4IV0A 3C3JA 2BHNA 1D6MA 3EFOA 4GOMD 5E79H 1FMTA 3FAKA 1UMCA 4IXWA 4NBUA 2A06G 4DJEC 1XK7A 1U8RA 2Q9AA 2A33A 4C7OA 3AF1A 5DV9A 3ICQB 2SKDA 1TWHJ 3QW2A 1BVYF 3K8QA 3ERCA 4UBKA 3P27A 1B4DA 2NAZA 1CIPA 1TU0A 2CDAA 4IDAA 3QY0A 4L4ZA 3EAQA 3JARA 1PVDA 1GD2E 5IFLA 2WIBA 2XAHA 4PG6A 4ZVSA 3DTVA 2GASA 4DR2B 3JQ7A 3E5XA 1Z67A 4CV3A 3TAHA 3HPHA 5B4VA 1WCV1 1Z4JA 1WE2A 5DDIP 3T15A 5E4YA 1VFCA 3VPRA 1EAMA 5B2ZA 5JSUA 3SEZA 1BS9A 3VA7A 4WPGA 2BEUA 1P9OA 2JD0A 3CD6I 5DRTA 1SBHA 2Q6TA 4D99A 4FDLA 3BE8A 2M9MA 3IO3A 1KSJA 1Y7TA 2KZIA 3RVKA 1EM6A 3WUVA 2Q9UA 4B83A 2L4MA 3BB3A 2FMXA 5FEMA 1BOBA 5IX8A 4AF7A 5IU6A 1YCGA 3OPYB 5IVDA 1Y9DA 1GOTA 1U9NA 1SIUA 4KPUB 1ODTC 3WYEA 3TDMA 4Q4AB 3H1IG 2Y2UA 1L7MA 4UNOA 3J7TA 3RTBA 1GUZA 4GOLD 2A0KA 1LPPA 1OPRA 4EY4A 4H7DA 3QOFA 2Z2SB 1U7PA 5F1KA 4KRXA 3VDQA 1VLZA 1MMGA 4UBIA 4ZT4A 3NWBA 4Y6RA 5DHTA 4CCNA 1GNSA 3I2YX 2MMCA 1U28C 5KC9A 3BZWA 3IUNA 4FEYA 2CW7A 4NABA 4DG5A 5EMLA 3KEMA 1XRPA 4M53A 2D1HA 2JS7A 3BMOA 3H1KJ 1NUAA 4OKSA 5AJTA 3WNQA 1AMUA 1L5MA 1CUAA 1R1VA 1FZGA 4P58A 3RRFA 1FFWA 4A0GA 2KS6A 1QIMA 2WIAA 5L3BA 3P2YA 2OHOA 2OBBA 3PF8A 3T9FA 2QTNA 1WMSA 1P0FA 1LF5A 3MT7A 3SX2A 2EKBA 2WI8A 4PLGA 4Z7NB 2Q3FA 5AIQA 5E3MA 1J09A 4C21A 4FYPA 1N8NA 2V7PA 5DNCA 1CQWA 2JPDA 4DIEA 3DVQX 3O8RA 3OESA 1OD6A 2R6HA 3GJ7A 3DYVA 3M1AA 2A06D 2P2ZA 2OM6A 4ROSA 2Z8YA 3P2EA 4WA7A 5I7EA 1L7XA 2PMEA 2O8DB 3A5TA 1XJQA 3G0OA 2AVNA 1R15A 2Z8ZA 1OBHA 3EMVA 2O2SA 3U17A 2XZPA 4ARZB 1CUIA 2PM8A 4QMAA 1W75A 1O54A 2ESHA 3RVQA 3L79A 1IVYA 3TINA 5TC4A 3GRRA 1YQGA 2LK2A 1J2XA 2XQFA 5FBLB 4EJVA 3W2GA 1W8IA 2QR5A 1U0EA 1YS9A 1W6UA 4OXQA 5I48A 5FPQA 1P9NA 3PCXA 4EK9A 3LCRA 1H9GA 1U65A 4A3CJ 3DZJA 2EYQA 1T0IA 1YR2A 5M3MJ 1U2QA 1IFDA 3HRIA 3CP8A 3HB9A 1Q1EA 2I03A 1JP7A 4ZKEA 4K7JA 1OX3A 4C6TB 1W6RA 1TIPA 3SF0A 5FI5A 1EWQA 4X90A 4FB4A 1W25A 4KXXA 5TJHA 5BYAA 4OIOF 1JY2N 3DV8A 4NH0A 1UXKA 3OOHA 4QXAA 1H8AC 4JQCA 4QBKA 2M4GA 1DX7A 4YCDA 4C89A 1GKYA 2XIGA 4I50F 5T41A 3UJCA 1CC1S 2WYOA 3RWOA 3COVA 5I9NA 2L9SA 4GSYA 4QC2A 1BGWA 5H5JA 3TVTA 4B2LA 5J4VA 2NGRA 3PUJA 5B2EA 1KA8A 2WW8A 4BOYA 4XVQA 2KWIA 2DA6A 4KXFB 1KYYA 1U2DA 2HA4A 5EGOB 2P4EA 1UQUA 2OEPA 5EWLB 3ML6A 4WGFA 1MJBA 3LD9A 1JNYA 4I3HA 3W6KB 3I2HA 1F1JA 2XDYA 4YHBA 1RI5A 3IULA 2XU6A 3UM9A 3BYZA 4R2KA 3NT4A 2QJWA 1EX7A 1V5GA 1A3CA 4HB4A 4TWRA 3CMAI 4HGNA 2HOTA 3A37A 2O2JA 2AFVA 3BREA 1PUEE 3ADOA 4R83A 2BFBA 3D3QA 4F4FA 1Z2EA 5JVGF 2IF0A 4IR7A 4LTMA 1H2FA 3FNBA 3THSA 2FEAA 3T1TA 2XF8A 3B1WA 4JKOA 1I4TD 2X3UA 2UZAA 2Q3BA 3EWNA 3PPIA 3MCTA 1VJ1A 3F90A 1UC5B 2JPBA 3K9TA 1W19A 4RK0A 3HTKA 3VZRA 3FMSA 2ODEA 5L40A 2H0AA 1NWQA 3G7SA 4B3MB 4ARIA 5T57A 3EXFB 2YV4A 3TZHA 4HNAA 3I12A 2HA5A 3H2ZA 4QJIA 3IMGA 3LFKA 2AW3A 3ZN0A 3DW3X 3SOZA 2EZTA 3FWHA 1KYZA 4HJRA 2Q0SA 2BWJA 3QBDA 4PV1B 4IY1A 2B20A 1K92A 2WJJA 3GBPA 4GECA 1GKLA 4G0PA 2ODBA 5JFGA 5HJ5A 2BBSA 3C87A 3OE7D 3DHYA 1U6KA 4Y1GA 4C2UA 4CXFA 4ZTUB 4NUBA 5I47A 1TVMA 4NE9A 2VE8A 3B82A 1K7SN 4H9GA 3T3MB 5JTUA 1BYUA 1D5WA 1LBIA 3JW4A 3C3BA 1AKWA 1I3QJ 3S1RJ 3WYFA 3M0AA 3AFGA 3SZRA 2YV3A 3EPLA 3JSXA 1CRPA 5SYMA 1I3AA 4IKPA 5HZHA 3E6BA 3RZDJ 1XZDA 3NWJA 2W57A 1IJFA 4R71A 1FYEA 4CEJB 1X80B 2VWQA 1PI3A 1U0JA 1MNDA 1HE1C 3WL8A 5FLYA 1PGNA 5L9AA 3DB1A 1NDHA 2Y2ZA 2F62A 3WTCA 2X14A 3GA7A 3CCMI 4ZV4A 4GLOA 4OXKA 1BCRA 3RSZA 3RAGA 4MULA 1UR5A 2STWA 2JGIA 1Q20A 1ZMBA 4MUJA 1MFTA 4PRZA 3Q88A 4CQJA 1ZH0A 1WJEA 4PCLA 1FSPA 2DI3A 2BEOA 1ONBA 1RHQA 2NRGA 4BXLA 1AQIA 1PP9D 4F3NA 4B8YA 1WSDA 2FSIA 1E7QA 4DBRA 4WX9A 1NQXA 4EVIA 2JVKA 5BRJA 1GTVA 4XWYA 4IIJB 1BGYG 1H2WA 2CQXA 2YW9A 4KC0A 3PGMA 1X2NA 2F1JA 3V4ZA 5A6SB 1RYMA 1SD2A 5K7HA 2FMUA 1JQDA 3SR3A 2JEOA 5AICA 5KX5A 4ZC8A 3C7KA 2HPZA 2Q6LA 5C0OE 1II0A 4LHVA 3GMSA 3W2FA 1NZJA 4KNVA 1OT5A 2PBIA 1G7SA 3GVHA 4BRYA 3LQ4A 3SSAA 4TV9B 4BUPA 3CI9A 2W2NA 3HYRA 3BCCE 4EYOA 2XAAA 3R0VA 1N2CE 2NAFA 1JGSA 1L5HA 4YCMA 2CL6X 3EA0A 3AYZB 4F9FA 3W6UA 5F21A 5BS6A 3I2FA 1K8YB 1N2CB 4UM8B 4XKWA 1JKQC 2HODA 1ZIXA 1LI5A 2HRBA 2XCOA 5ADVA 1K8XB 2WD8A 3WNDA 1Q16A 2XOEA 3IDZA 3DCJA 4CMIB 2X2FA 5AK5A 1K9MQ 2DUNA 2BONA 3SK0A 3WMGA 4J43A 3U3KA 4HBGA 4R1TA 2PLYA 5CRIA 3K15A 2ZRGA 1SELA 3SMQA 4CR7A 1JHZA 1WDWB 1NVVR 2GFHA 5A5DA 2FE3A 2ZIAA 1RPJA 2HXYA 4GRIA 1TVCA 1AH2A 2AK2A 4KP7A 1MDFA 1KU0A 1U7ZA 3HCCA 2J4DA 4C29A 4N1AA 3WWEA 6YASA 1F0PA 2FR8C 1IHDA 4ILKA 2WSIA 1TQ2A 3O4JA 3FFXA 1VL2A 5DP2A 5CNMA 3F5HA 3DP7A 4QARA 2CVFA 4S05A 2ZJ3A 1FW8A 4FDAA 3VTKA 1WMEA 3L6OO 1JHUA 1H65A 3R7AA 1ULAA 3VYTB 4AS2A 2TMGA 4B8ZA 1T9CA 1TGYA 2ASVA 4CNQA 5E2AA 4MYSA 1M73E 2GBGA 2WILA 4JWKA 4DIQA 5LHGA 2H48A 2VP4A 3OYLA 1UWCA 5CVDA 3FZVA 1GZVA 7ADHA 1T4CA 1MMDA 2PGDA 3FYUC 2ZFUA 1FYMA 1PVVA 3A6FA 3LPNA 2M6SA 2JK0A 4OHPA 2V7QA 5KYXB 2G7MC 3GQBA 2G1PA 1F6BA 1GQSA 4BKMA 2LREA 4N01A 3O8LA 2C4TA 2GETA 1GRNA 2BF7A 1ZG5A 3CJRB 1M66A 4EUHA 5ES3A 4WN9B 3KK0A 3MVPA 3TSOA 3S2FA 2AQKA 4BQPA 3S55A 3GGOA 1M10A 3C16C 9LDTA 4HYYA 2NUPB 4P4UA 1DU6A 4H7HA 2R60A 4XLZA 4YV7A 2XH8A 3N5KA 1Q1BA 2VJQA 3GVXA 4FFVA 3CC7P 2I4RA 2EFWA 3BRSA 1FOYA 2POQX 2WJHA 3DMHA 1QYCA 4M99A 2JAQA 4IW3B 2BDTA 4MV3A 1ZFNA 3WLTA 3FXRA 1JXMA 4L7QA 1R1DA 4XIYA 2VC1A 1Y8CA 3T0IA 4XLFA 2JLSA 3SI7A 3P2IA 3HPGA 2IW3A 2YWGA 2EBFX 3F2IA 3WOVA 2UUZA 1PT6A 1LTJA 2R5WA 4AVPA 4KU4A 2J7PD 4HNVA 4XNFA 1Y6JA 1T8ZA 4LGYA 4GZLA 2O0JA 3W8DA 3P4XA 4Y9RA 2HGSA 4AUNA 3MJVA 3CW2A 1QH1A 2R92J 5E7IA 1GTJ1 2RG1A 3WGNA 3KU4A 2FFRA 1UPFA 1JGGA 1BN6A 4EM2A 3WUTA 2JUCA 4P4LA 3WYCA 5DHRA 2NTEA 3VR3D 1Q14A 3TLMA 2HZBA 5CJ4A 2XUHA 2VYFA 3UHFA 3ZHVA 3FWKA 5F7OA 1X4OA 2VPPA 1H1LB 5LDGA 3H17A 4M1SA 4IFBA 4Q66C 2QMHA 4C6SA 3SIPA 4OMFG 5DM70 3U0VA 3PUXA 3RKUA 4GKGA 2J30A 3DKRA 5DK4A 1PR2A 3R7FA 4JSYA 4YDRA 3GRAA 3USSA 1XWIA 2C77A 1IZ9A 3S8EA 2J32A 3W5DA 2GD2A 1I2DA 3GVIA 3R3XA 1NAHA 4HGZA 3L70G 3C41J 4EVSA 5JZSA 2KIQA 1T3JA 1WPRA 2N0SA 3VSBA 1GZSA 5E9AA 3LH5A 5IKXA 5KYVA 4PGGA 2DWOA 1GSAA 2WB1N 3FOWA 2NVUB 4U4AA 4MCIA 2DEUA 5AVOA 4L08A 5A2QZ 1MB4A 3RB8A 2JA6J 4YCJA 3VR5A 4MV8A 4NPEA 4TL9A 4XM1A 5K6TA 3U9TA 4DMUB 1YNSA 3MWDB 1RZ3A 4HB0A 2FQ1A 4LGDE 5EQFA 2AV6A 4FHZA 4PANA 3HNPA 2Q1UA 4DCTA 5FTKA 3TRIA 1MUUA 1SVMA 4OO3A 4F12A 1I51A 4RKYA 4K8OA 2WSLA 4PFOA 2N9BA 3AEKB 4KXUA 1FSGA 2IFTA 1P19A 2H51A 4RGQA 2GIZA 3CR7A 3IAS1 1LPQA 5IDQA 1RHUA 3RRNA 2KSQA 1OJLA 2DA7A 3HRNA 3HJRA 4P2BA 4DT1B 5AXAA 4W5HA 3HJTA 2FRXA 4RDCA 4L5AA 2YRFA 5IVPA 1E0SA 1RD4A 5M34A 3ZHUA 2JDID 3RC7A 2FGKA 1SBCA 1H8EA 4JJ8A 4S35A 1VIVA 1JBQA 3BCAA 1KA9H 1TMYA 1YFHA 2VT2A 2DJIA 3R3VA 3HHGA 1F2DA 4KI0A 2LRDA 1KN7A 1HDYA 2QTGA 3BD9A 3LPAA 4E5MA 1ZLJA 3EZYA 2O1SA 4X66B 3A9VA 3QWIA 3BPVA 2AOUB 3DW1X 4WCFA 1U1FA 1OZHA 4BBAA 4N8DA 4HYQA 4OBBA 4MR9A 1RHMA 1JA1A 3ABRB 1X1EA 1GUYA 1UINA 3LL7A 4ZVNA 3CKLA 4MGIR 2OU2A 5CDUA 3TOAA 3GFRA 2O6GE 2UVDA 3ZE0B 5LDDC 4ALNA 4EZEA 2XTAA 3DEWA 5H82A 1V8DA 4NARA 3I42A 1JLLB 4XVCA 4HXEB 5ALVA 1Z6RA 4C3OB 1DOAA 3NNNA 1JHFA 3RLIA 1RKWA 4JOSA 2ECKA 2PBLA 3ZCOA 4BBRJ 2YWEA 4LJ9A 5BT9A 1YE8A 2JIZA 3WZLA 2V6CA 3BIOA 1X9GA 1GDDA 2HPCB 5DASA 2QXUA 3IHWA 4FNGA 3VRHA 3VMXA 1IG3A 4V2IA 3SBOA 1VQMI 4M83A 5LRRA 1ZD8A 1GZ5A 2EFGA 4B6SA 5CFNA 2DPGA 3ZK9A 3Q3GE 3T5GA 3ZWPA 3GEPA 2XE4A 1XTIA 4YJDA 4JN6B 1KOGA 4D4GA 1DO8A 1SPXA 1HFJA 2OYOA 2EPFA 2GUSA 2FE4A 3F6YA 3NDRA 2E4WA 3KOZA 3D64A 1W73A 1A50B 2HZ7A 1RWKA 2XVYA 1X9IA 1KDVA 4XIDA 2ZRFA 5G0TA 4BP1A 2DLNA 4DA9A 3SIWA 1T56A 2QQ5A 1XZQA 2ZJFA 5CDHA 1YVEI 5ALGA 2H1FA 4UY8I 2P7JA 2LY2A 2ZBVA 4FT2A 2HRZA 4M73A 3GUYA 4TWBA 2WUFA 4KIJA 4MS4A 1VZ3A 1JG2A 2Y66A 1GQFA 2B63J 3PS9A 1H0TB 2WIFA 1C9JA 1RCUA 2GZWA 2WPDA 3T4PA 3JQPA 3QKRB 2ZIFA 3MERA 1XUOA 4XJTA 4BNMA 4Q48A 1W36B 4XEUA 1XHFA 5BR4A 4DNPA 4UB6H 3KFVA 3SZUA 3K94A 1NMEA 2WQYC 5IY5H 5E8JA 1YRBA 2HU7A 2VDVE 5DCYA 2AKEA 1SEVA 3RU7A 1QF9A 3UFXB 1IEXA 3VMFA 2FJ1A 4C14A 3O1IC 1NJGA 5A04A 2YXPX 1OW6A 3VKVA 1I10A 4QPJC 1OASA 1U04A 2H11A 1U57A 5C3EJ 4HW0A 1NH3A 2R6JA 4JXXA 1N3BA 4OLBA 5K7ZA 3UFBA 4EH1A 1KPIA 4D3ZA 3I54A 4ENTA 1N2GA 3D8UA 4C20A 1WKBA 4PG5A 3SX0A 3S14J 3Q7PA 3TIIA 8AT1A 1QMGA 1GTSA 2DYKA 4G65A 3A06A 5HRUA 3LIEA 3V6MA 1UBSB 4KQCA 3E23A 4P0QB 3T97A 2YUIA 3X1DA 2JH9A 2AXCA 1QRSA 5GOZA 1QFXA 1ZRTD 2BP7A 1UBOS 2WDZA 5SICE 3LNQA 2A3SA 2APJA 2ZWVA 4L9JA 4HAVA 2ZVJA 3R8CA 1FQOA 4Z1OA 4UB6E 4UBNA 4OLAA 2AC2A 2BC9A 4I6JA 1VFPA 3WKAA 1U9ZA 5J5CA 3X1XA 2AGVA 4CCWA 3BXZA 3BLYA 1M75A 1MH3A 4JZYA 4MW0A 4DDTA 3BVHA 2JGLA 2FSWA 4LF8B 3WLLA 1F1BA 2IYQA 2YZNA 4E2ZA 4HWTA 2OXIA 4N0BA 1Z6XA 3IP7A 3PL5A 2NUBA 2X1CA 2BV6A 1OHHD 2ATXA 3BWGA 4EI8A 4WQMA 1HE4A 2BGMA 1YQEA 3RHTA 4GXRA 3PE4A 1E2PA 4R7TA 3B73A 2J48A 2V5AA 1T26A 4DIKA 2JG3A 4RESB 1SQQJ 3RM3A 2WD7A 4TROA 4QU0A 1UJMA 5F4ZA 5HILA 3K6KA 3PUYA 3I59A 1W88B 2IEIA 1T2CA 4YXDC 1ZKGA 5KTNA 2MR5A 1MA0A 2PV0A 5KREA 2H65A 2JANA 1IK7A 1AXGA 5HIIA 2QE7D 3RKYA 2OFWA 3L5OA 1OGJA 3ZRGA 5CB4A 4BDZA 4OK3A 3RK4A 3PRHA 5AVRB 1CHDA 4CMBA 4BAUA 1QDUA 1KEVA 3GU3A 1FMCA 1HWYA 2M5AB 5JG7A 4UATA 3ND6A 4JLPA 4B7UA 2MW8A 1DU4A 2HY7A 2QG9A