1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
2NS8A 3LNQA 1TWHJ 2LK2A 2NVTJ 5EZGA 2LD5A 4JX6A 4BY7J 5E3NA 1LFUP 1DU6A 2Y9ZA 4EEFG 1UMQA 4IEJA 1MBGA 4S0HB 2CJJA 1DU0A 2CRGA 2WB1N 5GPCA 5C31A 1Q1VA 2XGDA 1BW5A 5EF6A 2W48A 5M5XJ 1Y1WJ 1YRNB 2E2IJ 3LSRA 4JX5A 4XIDA 5E3OA 1H8AC 1WPKA 5C4JJ 1JKOC 1FIPA 2NS7A 4BY1J 1SFOJ 2M0CA 5JLXA 1OCPA 4A3DJ 1PUFA 1B72A 1JKRC 2JA6J 1EF4A 2R92J 2X48A 3HB9A 1G2HA 1VFCA 2FD5A 1K61A 2EH3A 3HGGA 4C3IJ 5C3EJ 5M3FJ 1F43A 3GTJJ 1IDZA 1D5YA 3DEWA 3OOUA 2COBA 2XPVA 3ILXA 2LVSA 5F27A 2FQ4A 3GTGJ 1U8BA 2VI6A 2TCTA 5FKNA 4DW6A 1JJ8C 2JMWA 3LSJA 3BTIA 5IYDJ 1ETQA 4A93J 3GUVA 3JRGA 2H8RA 2XGCA 2VKVA 1WGXA 5C4XJ 2YUSA 3Q0WA 3IH2A 5FLMJ 3S1MJ 5IYBJ 1B72B 3E7LA 1XS9A 2HDDA 1BW6A 1POGA 3GTOJ 3CDLA 3ZQCA 2VKEA 4FCYA 2DTZA 5F08A 1IRZA 1U78A 2K40A 4A3EJ 2DA2A 2LR8A 2XRLA 2QF7A 5GP9A 3TW7A 3FK7A 3OIOA 4GFBA 4IHYA 1HLVA 1JUSA 3G1OA 5J1UA 2HXOA 4L5EA 3HOVJ 4AUXA 1NK2P 2X9DA 1MBEA 2YS9A 5DS9A 3JREA 2K9SA 3HOUJ 1WCMJ 2L7ZA 1ZTRA 2DA1A 5EEAA 4M6VA 1PUFB 1E3OC 3O8HA 1TWGJ 2M8GX 5DTDA 3HGYA 3BR5A 3IV5A 2DN0A 4A3MJ 4DZJA 5J1YA 3QPSA 3PM1A 2JJ7A 3TP3A 4D5CA 4DYRA 3MN2A 4C3HJ 1WI3A 3FKIJ 4X1EA 3K2AA 2M2EA 3NARA 4IHXA 1MBFA 3A03A 4D7NA 1X2NA 3A02A 4A3KJ 2DJNA 1AHDP 3W6VA 2LTPA 2LP0A 2DA4A 1GDTA 2P81A 4QIWN 1CQTA 1W0TA 2O8KA 2G0EA 3ZQFA 5J1RA 4BBRJ 1JUPA 1H88C 5IP6A 5EG0A 2EQRA 2HYJA 3Q0VA 4M3FA 1U9OA 2E2HJ 1FTTA 1HDDC 5F0CA 2JN6A 3WHCA 3S2DJ 2CQXA 3H0GJ 3LSGA 3FK6A 3ZQIA 4UUTA 1ENHA 2HOAA 2NVXJ 3ZQLA 3MVPA 4MFEA 1FIAA 5IYCJ 2GLOA 1IUFA 3HKZN 3WHBA 2MG4A 3HOYJ 1ZGWA 3FISA 4J19A 1ETXA 1GV2A 4MFDA 2JA8J 2R93J 1NTCA 5FKLA 1RETA 3JRAA 1MBKA 4FE7A 4JYKA 1HX7A 4B4CA 2H1KA 3SJMA 1R9TJ 2LFBA 2ID3A 5M5WJ 1JKQC 3LHKA 1AKHB 2DMQA 3IH3A 2LLKA 2FX0A 5EG0B 3K7AJ 5EGOB 3QQAA 4A3JJ 1UHSA 3RZDJ 2Y9YA 2D5VA 3JRHA 5FJ8J 1QRYA 4I6ZA 4MLOA 1WH5A 1UG2A 1MBJA 2PMZN 4MIMA 3TW6A 5IP7J 4JX4A 2ZB9A 3IH4A 1IG7A 3PO3J 2O7OA 1HCRA 3GBGA 3SFIA 4A3GJ 1JKPC 2DMNA 3TEDA 2E2JJ 2RSLA 3A01A 5C44J 2KDZA 4A3FJ 3RKQA 2OPTA 4RBOA 3DCFA 5IP9J 2JA7J 5GPAA 2Y2ZA 3JRFA 4QTRA 3GTKJ 3BVPA 2R5ZB 2GBYA 3QPLA 4LOCA 1P7IA 4FTHA 2ID6A 4UUSA 4Y52J 4MO7A 4NDLA 3I4MJ 1A5JA 2Y31A 3FIWA 2VPRA 3S16J 1TC3C 2L7MP 4IHWA 1JTYA 1MH4A 1I3QJ 4M3GA 2MSYA 3RZOJ 1RKWA 1RR7A 4QSHA 5IOYA 2HOTA 2HI3A 2WAQN 1WH7A 3GTMJ 3G13A 4A3LJ 1ETWA 1ZR2A 3OSFA 1RPWA 1TWFJ 2L7FP 2XPWA 2M9HA 1A6IA 1GV5A 4RDUA 3I4NJ 1IV6A 1XC5A 5C35A 3BTCA 1ETOA 2YU9J 4HNVA 1MSFC 3BG3A 4BKXA 4V2FA 4ABZA 2M34A 5FKMA 1ETYA 4C2MJ 4C3JJ 3HEFA 2DMUA 4M3EA 2Y0SN 1OJLA 1X2MA 5F0HA 2ECCA 3CQZJ 3HDDA 1JTXA 4IHVA 3BG5A 3HM5A 3Q0UA 2XB5A 3HBLA 2CQQA 2K9NA 3UKGA 1U9NA 1AKHA 3PKZA 1GUUA 4V2GA 1VF9A 3A01B 2EZKA 3C2BA 3JRBA 2JK3A 2EZLA 1JUMA 2B63J 1VI0A 1NK3P 3S1RJ 5C34B 4JP0A 2AHQA 3BQZA 1S7EA 3LSPA 1Y1VJ 4M3DA 2KT0A 1T33A 2R5ZA 2R7ZJ 1SANA 4B3AA 1OCTC 1B8IB 3LOCA 4DZPA 3S14J 2CUFA 5M5YJ 2XPUA 2XSDC 5EZHA 2HXIA 2I10A 4I76A 4A3IJ 1QPIA 2MGQA 5C32A 1GVDA 2JWTA 4X6AJ 4DYQA 5F0FA 4D5FA 1W0UA 3VPRA 2R0QC 3S1QJ 1FJLA 1P7JA 3JRCA 1HF0A 1O4XA 2N8GA 3TP0A 2ECBA 3M3YJ 2LKXA 3OSGA 4W97A 2FJ1A 2DA3A 5J3LA 1ZKGA 5F04A 2QCOA 1ITYA 4A3BJ 3ZQGA 3ZQHA 4UUSB 2IBDA 3BR2A 2VUMJ 1ZQ3P 2MHCA 4Y7NJ 3PO2J 1ORKA 2OF7A 5F1JA 9ANTA 3ZOBA 2Y30A 3GTPJ 1JT6A 3L1PA 5M3MJ 2X6OA 3S15J 4A69C 2EBIA 1XG1A 4AC0A 2NOGA 5E3LA 1TWAJ 1TWCJ 3S1NJ 1X58A 5HODA 2E19A 3BR0A 4BQQA 3BG9A 1MH3A 4XK4A 5FKOA 1I50J 5EYRA 3BT9A 1Z77A 1RESA 1VNDA 3BTLA 3D1NI 4CYCA 1MNMC 4DYCA 1FTZA 3O8GA 2RAEA 4XRSG 1JJ6C 3HOZJ 1HDPA 2WV1A 2L0KA 2L9RA 1GT0C 2HQ5A 4XRSA 3CMYA 4D7MA 1JGGA 2DMTA 3UJ3X 1QVUA 1BJZA 3SDGA 5BNGA 3G1MA 2CUEA 4BXXJ 1ETVA 2EZHA 1MBHA 1ETKA 5K7HA 1LE8A 1IC8A 2IEKA 4M3BA 3S2HJ 1FEXA 3JRIA 2DA5A 2DMPA 2K9QA 2HOSA 4CYCB 2DA7A 2JA5J 3CCYA 1B8IA 3BR6A 3H3VK 4B1RA 1F36A 4FISA 2GM4A 2ELKA 1BA5A 4A3CJ 3M4OJ 4AYBN 3BR1A 2E1OA 2R5YA 4G12A 1BL0A 3NAUA 5EDNA 1H89C 1K83J 2CU7A 3BR3A 3BQYA 3RQIA 1IGNA 1LE8B 1HOMA 5E3MA 1LFBA 3MKLA 2AO9A 1T56A 1IDYA 3GTLJ 3S17J 5EGOA 3Q3SA 2DA6A 3B6CA 1ZK8A 1Z0XA 2EZIA 3F0CA 3HOXJ 2NVYJ 4FE4A 4XRMA 1AU7A 2NVQJ 1JT0A 3JRDA 1YRNA 2LY9A 1QVTA 1OFCX 2XGEA 4W1UA 2ME6A 1APLC 1GHTA 3G1LA 5JLWA 3B6AA 2MW8A 1RKTA 4XICA 3HOWJ 2GM5A 3JR9A 5IPAA 5FLVA 2R5YB 1ZR4A 2O9LA 1I6HJ 2XB0X 2ME0A 3GTQJ 5K7ZA 5IOZA 3LHFA 4BBSJ 2IAIA 1MSEC 5K7FA 2TRTA 3BTJA 5FKKA 1IJWC
chains in the Genus database with same CATH superfamily
2CNWA 2XGXA 1A3CA 3QF7A 2DQSA 1K3FA 2Q9BA 2JBAA 3U4CA 4GDOA 1Y6GA 3ORSA 4ZQGA 1WULS 3M91A 2H7HA 1YD7A 1LEBA 4KNVA 3ZW7A 2C7QA 1HQKA 3OLVA 5FYQA 5HTOA 1U99A 5COAA 1WVIA 4HNQA 5DSXA 3NAZA 4M86A 3WNBA 3VH3A 2RKWA 4LHXA 4W7HA 3KVOA 4OGGA 1XWWA 1YACA 1ZHFA 1H8HA 5TDHA 1YDEA 2JFFA 4OGQB 2WD7A 4BO5A 2E85A 3BDDA 1SD2A 1RE3A 3GEHA 2XMZA 3NHSA 2X19A 3BWGA 1O9BA 3WUTA 3HU2A 5AVYB 3MFYA 5CJ2A 4L5EA 2WMDA 4JQ0D 5CG1A 2VAXA 4HLNA 4DXDA 3M33A 1NOHA 2OK7A 3HYIA 2GZWA 4EFLA 5E6SA 5M04A 4LB5A 3MHVA 4DYRA 5CCGA 3PUIA 1FEZA 2N75A 3M07A 1WW8A 5FWXB 3ZKWA 2WICA 3JTGA 1N5OX 2QRNA 4NBTA 2P2DA 2F48A 4RMHA 4KO3S 3NBAA 1BX0A 3NWOA 1XMVA 5D7BA 3GBSA 4QTYA 3QU9A 1DGWY 5EZ6B 3ZGNA 3U3ZA 4QDUA 1U2RA 4M8NE 1ETXA 1HYBA 1L1FA 5J2TA 1TKRA 3BICA 3PV0A 5H6QA 3GUYA 2FPUA 3K31A 4XVUA 2FP4B 4DIQA 1BJRE 3L0PA 1AY0A 4FMCB 4W5JA 1KC1A 2UYOA 4G1CA 1V1MB 4X1YA 1MBJA 4F5YA 4F7DA 1M1KQ 1NMXA 1QTNA 3SBEA 2IIPA 5KLVE 3LXXA 1JY2N 4ME6A 2NX2A 3BH0A 5HE9A 4U88A 1TM2A 1AJEA 3TO5A 3BVPA 2M6RA 1TQIA 3M8KA 2GEBA 3D3QA 1Z3XA 3R0ZA 4ZODA 1PNRA 4R7TA 4UNPA 2X0NA 3WLLA 1E64A 1SBCA 3ZPLA 4E2FA 1DFHA 2XV5A 3KQWA 4CFZA 2N47A 4C3UA 1S3JA 4AB1A 1Q0UA 5H2FE 2WF9A 1T35A 3CP2A 2GAUA 1XQ6A 1SN7A 3FMIA 4CCNA 4LUCA 3QU7A 2HHHB 1ZJ5A 1Z4QA 3J81A 3LV8A 1LBSA 3ZE9A 3GX4X 2Z3YA 2FZVA 4JB8A 2R44A 1VB5A 5C34B 4KR6A 1MC5A 4MUIA 2M5WA 4NRDA 1SUEA 4IV0A 2VBXA 3AR8A 4HWSA 4UNQA 4YG2F 1U02A 5EUMA 1XWIA 1G8JA 4YTPC 1XXLA 1RJ9A 1KZ4A 4BJTA 3PFWO 3IX7A 2PFXA 2BMJA 4XZ3A 1N1EA 4DLLA 1R8QA 5JZSA 4GR9A 4JI4B 3PNKA 4ASNA 1HSZA 1AJYA 3HVHA 2R1TB 4ND4A 3BHIA 3BWDD 3DDSA 1UBGA 1H1DA 3HVIA 4TT3A 4QRHA 4P96A 3RIRA 3N2YA 3O4JA 2VOOA 4DYCA 3LMMA 4RQTA 1DDIA 1TQ4A 2B7CA 2HGZA 1TJPB 4UHCA 2DR2A 2WPSA 2HKIA 5LYJB 1O89A 4G0PA 3K0EA 1AIPA 4CL2A 1I13A 3S2HJ 1RNLA 2W6JD 5BPHA 3BCHA 4LIPD 4YP6A 2R7VA 1L6RA 2GR9A 1YU6A 2VNAA 4Q82A 2XZTA 2QBYA 2P4SA 3CCYA 3BR6A 4UHHA 1IZZA 1RWVA 2X0JA 4IQ8A 5CYVA 1T38A 1GGEA 1YRAA 5IC4A 1GV1A 2PZJA 2W93A 2ZXHA 1A9YA 3BR3A 3QW4B 1WIWA 3BQYA 2GBLC 3Q88A 4D02A 4PV1C 1ACMA 5HK8A 1XQ1A 4MUHA 2ZUFA 1PFGA 1M1UA 1PWXA 3H3UA 4ZTZB 1ETHA 3KQHA 4GEGA 3FJOA 3RU3A 2RGGA 4NONA 3DDHA 3X2SA 3TL3A 4HSGA 1KZYC 1ZN5A 1IB0A 1L8OA 1AK1A 3BCUA 2NVTJ 1ZGBA 4KNWA 1CNFA 4WVLA 3KJGA 1CU1A 4MV8A 4LQCA 4Y28J 1R00A 1I2AA 1T9AA 1INLA 1NQXA 2YIVX 4OO3A 5F7ZA 2J3DA 1RZUA 3BMXA 4GE3A 1QR6A 1Y39A 2X5KO 5AM3A 3RK0A 3EXAA 5GTHC 3C5EA 4KQKA 4N12A 1U7MA 3WHIA 3E9MA 5FUXA 2A9QA 4XIJA 4EG6A 5LJIA 2ZBQA 5FPQA 5C9ZA 2QE6A 5EEGA 1CZOA 2IBMA 1Z3IX 3HY4A 1GQYA 1K9SA 3SR0A 3L6BA 2XAAA 2XYVA 3ABRB 4M7WA 2W98A 5I3CA 2QLJA 4CEIA 2H2IA 2BM9A 2A9JA 3VOBA 1LDBA 4UQPA 2OORA 1H0RA 1TMOA 3FI0A 4RKFA 4ND6A 4EIJA 3U3KA 3OYMA 3HOVJ 5J40A 4DQVA 2FZ5A 2PIDA 1DIBA 3SBOA 4LYAA 3OHPA 2CS3A 5L7TA 3A31A 4M1MA 2A9OA 3VPFA 2FXPA 3SMVA 1Z91A 5FTMA 3NKVA 2VWPA 2HMWA 3EZ6A 2II6A 3AETA 2VIXA 1MLDA 3ZCUA 3UF0A 3CWBJ 3ZTWA 3MGNA 1AX9A 2GFIA 4A3KJ 1AHDP 5LZ8A 1P1CA 4B43A 1L2PA 4CUJA 2C7BA 2I7DA 4OVKA 2B99A 4J76A 1LWUA 4OBXA 2OCBA 1O03A 2O0KA 3O95A 2W1OA 4CIVA 3T1HB 3ABOB 1NHGA 3GLFE 1Z2PX 3VHLB 1DWQA 2EW1A 2XJ4A 2XXAB 1G8HA 2WSSA 3GF3A 2CUJA 1MP0A 2Y3IA 2FWNA 1E4EB 2OXEA 4F5EA 5INTA 3VGPA 3WICA 5L3CA 1W48A 4CN9A 1HGZA 1G1MA 4I6ZA 3WRYA 5A6VA 2Q3BA 2JIOA 4Q1CA 1DRVA 3IQGX 3BXHA 4XGQA 2B9BA 2X6TA 4BJ5A 1R8YA 5BPFA 1U6IA 5EJIA 1YRLA 1AGYA 3TF5A 1KFEB 3OPXA 2KIFA 1CUCA 2P6PA 1IJEA 3H1IG 5BSVA 1BEEA 1P5JA 1FE8A 2VZ0A 2Y1EA 3CG0A 4D97A 8MHTA 2JGJA 3HD7B 3Q0IA 4OG2A 4LXGA 1ZMBA 5E8RA 4M0FA 2EF0A 1NU1E 1LRLA 2PT6A 1H9BA 3OM9A 3W9SA 3A6JA 4TLEA 2B5VA 1MMNA 3VYIA 4J3FA 1YC2A 4YUZA 5IRCD 4GX2A 1YZTA 4L5BA 2QHXA 3RO7A 3L7IA 2I78A 3R6TA 2CVOA 2B4TO 2Q3CA 3A6LA 3AR9A 1RZ3A 2GCIA 4MWEA 1GUUA 1VF9A 2W0MA 3Q7IA 5EINA 3FUXA 5CU7A 3VPAA 1SC6A 2H4ZA 2ODPA 3KDPA 2WT4A 3NRVA 4IYJA 2VCHA 3VMFA 2J3QA 3EQZA 1RWNA 4AIHA 4Q7EA 2CNOA 2B8NA 2LXBA 3PE4A 4P92A 3PHBE 3G0DA 2BH9A 4PHTA 4EI7A 3L71E 4DYQA 2YR0A 1BG6A 3LF1A 5DM60 3DFUA 2QN8A 1M90Q 3A0HC 3P0HA 3T8RA 2CBGA 4BHBA 1FMJA 3KV1A 2NUPA 2BFEA 5AIQA 1YFKA 2H8GA 3RYCA 4YPVA 4AC0A 5L3DA 1P1HA 1VL5A 3PHIA 3LQFA 1ULUA 3A10A 2XWQA 2YV4A 3DDWA 3V00A 4GWLA 4JEIA 3ABLH 3D9QX 1MV5A 4OHYA 2WFLB 4OK6A 4WLFA 2A5FA 1LUAA 4TPKA 5DFAA 1DKUA 2VKHA 3ER8A 1RC0A 3MAGA 3LGXA 3HXTA 3D5LA 1BA3A 2JS7A 3E4DA 1ZRCA 1RP7A 1MNQA 1HR0B 3WE7A 2Z4SA 4NCBA 3OX2A 1R37A 4GWGA 1NI5A 2O8VA 3E82A 4R1UA 1YB5A 1Y3HA 3AVUA 3V8MA 3CXHH 1CV2A 1VXOA 4WY2A 4M88A 4ZC3A 4J2TA 4CT0A 1ENYA 3YASA 3H1AA 4ZHQB 5JS8A 4E7LA 1DPFA 5C1PA 3KAKA 4X1KB 1Q21A 1P4AA 3DZ8A 3BERA 4HS9A 4JKIA 3HXKA 1RKTA 2BJWA 5C8YB 1DNPA 3WU2H 1X79B 4QU8A 3N5CA 2A0YA 5LGNA 4MJ3A 3GUZA 2VE9A 2YN4A 1OVVA 4ZRMA 3PRYA 1N5DA 4QA9A 3W8EA 1SMTA 4DJAA 1DXQA 3LTEA 3ROTA 1NQOA 3IT3A 2W7NA 4TKVB 1FDVA 1HE4A 4WEOA 5K0EA 2C6YA 1MAHA 2YHUA 3HI4A 3R3YA 5DX1A 1YULA 3O2PE 5C3EJ 1DXHA 1MD9A 2ZI4A 3OYHA 4QQRA 2ZVNB 4KWHA 5D85A 2HSDA 3MB5A 3ENQA 1WU7A 4O3MA 3WLEA 3PJEA 2KBEA 3SBXA 1PJCA 1IFNA 4BKMA 1XHLA 3NYRA 1SOAA 2ZYIA 1BOOA 4YRTA 4ZI7F 2NU8A 4AYWA 1Y5NA 2IA5A 2FKNA 3V4VB 4BMXA 5AJZA 2FXMA 1SEVA 3JWEA 2JDIA 2CUNA 4K3VA 1BVYF 2RB5A 2XADA 4MW9A 4I5FA 5D5HA 2WTAA 3TM5A 1D2AA 4A3SA 5ALEA 1L1QA 3WMRA 4X84A 3NBKA 3PM1A 4MUXA 5EHIA 2ZYDA 3PIPF 5CLLA 3RM3A 3D8NA 1DIPA 1XAIA 3PFBA 3NARA 5EGSA 2P3SA 5ALDA 3OSUA 4PYRA 4ETWA 1MHPA 4B48A 4X97A 1GR1A 1KFBB 1KBQA 1WXFA 4XM2A 3QWHA 2VAPA 2OTLI 3H9JA 1CUAA 4RF2A 3OQMA 3BPVA 3LSMA 2KSJA 5GJCA 5A4DA 1KORA 1VQLP 2VXCA 3LPAA 4CMKA 3O7MA 1QK5A 5CXQA 1SB8A 3ON5A 6GPBA 1BR2A 4R2KA 2XDJA 2X1VA 2X42A 1PIWA 2D5VA 1DC6A 2CQNA 2W0SA 1NSYA 1K5HA 1NNLA 1P0IA 1ZS9A 2XEXA 1Z7YA 1D1QA 5HZMA 1SU8A 5EESA 4HN9A 3QKWA 3TEDA 1GUBA 1EESA 2LCFA 3KOMA 3L75J 2JD0A 2LF7A 4RKWA 4BVFA 5IP9J 1JWAB 4Z51A 4ZCIA 1GTWA 1E3QA 1RE0A 1VHQA 2ID6A 3FBGA 2L42A 1GCOA 4R8LA 2IPOA 2VRBA 3B78A 2PLRA 4CKEB 2V9PA 4MTEA 2G67A 3EMVA 1MIOA 2K3PA 2H09A 2IXSA 2CB9A 1QJ4A 2O7NA 4YUWA 2QY9A 2FLVA 1BI2A 1X1RA 1QE3A 1Z7LA 1RF1C 1YCGA 5I9MA 4I46A 1BGYJ 2ORIA 2K9JA 2AN4A 1JTXA 4OAYA 5E6RB 4ER6A 3MELA 2ZMEB 1XZNA 3SF8A 2JCGA 2ZE7A 4DREA 1TAUA 1K3UB 1XVTA 3HPHA 6LDHA 4CHUA 2Z5HA 3B2QA 3VZRA 4UVDA 3AZOA 4EY5A 3K1MA 3S7TA 2E71A 1FBSA 3T99A 2Q8QA 3UCFA 2QUIA 2QG6A 3WWPA 2P5LC 5JZVA 2DHCA 5HVQC 1AVOA 4KK3A 1N0WA 1HYQA 3BKWA 1WUJS 3P2YA 1ZY2A 1KS9A 3U6BA 1RT9A 3FX2A 3J7TA 1BRTA 1S3GA 3AUKA 5G41A 3CXHD 3P96A 1S9KE 5KC9A 2CPSA 3PS9A 4M6WB 5EJ6A 2XCQA 5D5VB 2CDAA 1HKHA 4PLWA 4Z1MA 3UJ3X 4DADA 5FPKA 1CF9A 4UPEA 4HJGH 2GAIA 3LO5A 1MGPA 3EUHC 3VAYA 4FEYA 2BEVA 4O59O 3UUWA 3STHA 3S44A 5KWSA 1BCCE 3HJGA 4RPKA 2ZRQA 5LBIA 2DSNA 2P7JA 3R9IA 5ALJA 3NXKA 4YPCA 1B0AA 4YREA 5FNVA 1SEPA 4J90A 4FBLA 4JELA 1YI2I 2PFBA 5GTIC 1USUA 2FZCA 4EZEA 1OWMA 4JLOA 4G6TB 3DXXA 3PWKA 4DJDC 3K10A 1GRNA 4GZ6A 3RSHA 4RH3A 1H9GA 3GTLJ 2KBFA 4I3FA 3TBFA 1IUYA 3EMKA 1SKYE 2YMMA 2ZRAA 4BPBA 3AL3A 1XVUA 3BLYA 4FHEA 5K8UA 4QASA 1A5TA 3FPEA 5T4FA 4RV4A 3B6KA 3HUSC 5K7FA 3H4MA 2BFBB 2NS8A 2BR5A 1YQEA 2Z08A 4D8TA 1GNQA 1NGSA 2CXQA 4CM3A 4OYHA 3EIFA 1PL8A 2JRLA 2OYHA 5E9WA 1H8AC 2ZB2A 3EPHA 2O2ZA 3HZZA 1PUFA 2R11A 2OA0A 2IVFA 2PGAA 4EEKA 2HBRA 2PT9A 1W5AA 2B89A 1BCRA 4C1NA 1L0LG 2QT1A 3IKTA 3QBDA 4GVXA 3S3OA 3F5DA 2CVFA 4P58A 2H8WA 1DDGA 1FZCC 2NO7A 5H02A 4G01B 2GPYA 5T57A 5F23A 1QLJA 1NWQA 4N40A 3QENA 2OD2A 1ZINA 3ZC3A 3FK7A 3S8MA 3I2FA 3GT7A 3ZE0B 2P69A 4OL0A 4D4MA 1ZSYA 3DXZA 4XM3A 1DHTA 4M49A 4HWKA 3OEYA 2QIPA 4C14A 4DZJA 1USVA 2VHEA 3CUTA 2REOA 1GAEO 4YASA 1Q7CA 3JAMZ 1H4SA 5U4QA 4KQ1A 1LY1A 1JA9A 2J3LA 5FGMA 1VSVA 3LT2A 2C4TA 4J49A 1PR1A 2BGTA 1QGKB 2ZBDA 4JJ6A 1JUPA 2PR7A 1EWQA 1A8IA 3IPCA 4HRXA 3DPUA 2IE8A 4PYNA 3E7KA 3P9XA 3INYA 3V5BA 1LBQA 1ZOLA 4OGKA 2PO5A 5K8LA 1J7JA 1OWNA 2WM2A 3A6HA 2R6ZA 1ZMXA 3H1EA 4RELA 4QDOA 1W93A 2RCNA 1R9TJ 3SR4A 5KYXB 3DEUA 3Q0EA 2GA2A 1R18A 3ZNOA 2EU8A 2X0IA 2WIFA 1S9DA 4V3CA 1XA0A 4IQGA 3PTZA 3P2JA 2O2GA 1XG5A 4F2GA 2EW8A 3AKEA 1UBLS 4O2RA 5DX8A 2C9BA 1R64A 4F7WA 4EKYA 2CL0X 1QO7A 3WL6A 1OFIA 5ALGA 1NMYA 3BZWA 4EKEA 2C04A 4AICA 1ZJ6A 3KOXA 3I2HA 4FTHA 1DG1G 3QHPA 1W36C 3IQWA 3G73A 4UVIA 4C0QC 3PP8A 4XJXA 5ITWA 1C9EA 5EKSA 3RSSA 3U1TA 4A2WA 4MUEA 3OSFA 4F56A 1RPWA 1USIA 3VPHA 1H1TA 2VP6A 1VMDA 1IW7F 4DA6A 1VG9B 2HPZA 3CDIA 5JSKA 5B6IA 4AJHA 5GINE 3K92A 4EHBA 2WF6A 3A6EA 4FC6A 4BASA 2JUCA 1T5SA 3RIHA 1V3TA 4IUBS 2E36A 1YJWP 1VI0A 3G79A 1RAIA 3EPPA 4NG4A 1F2UA 5H5JA 2QGUA 1JYEA 2R7ZJ 4QTZA 3A1FA 2VK8A 2PUGA 2V6FA 4RWEA 4XPIA 5EZHA 5DGDA 1I6LA 4NY1A 1H6CA 1KH1A 3MTJA 1GU1A 5H59A 4J29A 4L0QA 1MRSA 3SDSA 4RY8A 2W9XA 3ZCSA 2B25A 3OSGA 5SV2A 1KP9A 4UTZA 3VKWA 2HMTA 1ACIA 1RBZA 5HUHA 2O6GE 2IPMA 1EVZA 3DBVO 5LBUA 5K0CA 4L7QA 4OKSA 2WIKA 1Z7WA 1G4UR 5BRJA 5GY7A 1U94A 2FFDA 5G0UA 3AONB 2QY6A 2H8PD 3VC7A 5I7FA 1V8DA 1P4JA 1C2TA 1QVUA 5F21A 2XNSA 1VIDA 3TAXA 1U2GA 2KJQA 1BXRB 3E0XA 4CCOA 3DQVC 3SZPA 1XC7A 1VQLI 1QNFA 4FS3A 1CUZA 1UZNA 2EJTA 4CLOA 4R1PA 3SWYA 4PTLA 4PQGA 2GM4A 3RC9A 2PX2A 4QQ8A 2FPWA 1ZGGA 3ZWPA 2XASA 2Q7OE 2XUIA 4TKUA 2RHTA 3B82A 1PHRA 5A06A 3EJWA 5JASA 1GU7A 4D41A 4FCCA 3TOBA 4CH7A 2OTJI 1HNWB 1I2CA 4QHTA 3JWGA 3HA2A 4KAAA 1QBKC 3ZN2A 1ZK2A 4UMFA 3GFTA 2WJZB 2G83A 1LBHA 2XPCA 1IDN1 3TJZA 1EUDA 2QA5A 3NS7A 4HVAA 1R4NA 1Q5PA 2DUUA 5FUWA 1I01A 4O5VA 4QO7A 3IMCA 4YRNA 4CMHA 1E92A 4ZI7B 2ORVA 1UKVY 1XELA 2RGDA 1Q3HA 3K53A 3NKFA 4FOTA 3OZAA 3DM5A 4DABA 3BCCG 2NQ8A 3K4HA 1JXMA 1KO1A 1C0PA 3WLPA 1M2OB 2QR2A 4FM9A 4NEQA 2IW1A 1OFHA 3DEFA 3KO8A 5ALTA 4GLFA 5FPTA 4TTQA 4OQDA 3R5JA 4ZYXA 1ORRA 3T4PA 1Z0KA 5L4NA 1H42A 5I8PA 2R7UA 4ZZDA 5JXIA 3B7GA 4Z9AA 2JAHA 3K4BA 1QL1A 4DRXA 3WI7A 5AXAA 4G4JA 4QYWA 1WP9A 4W8OA 4WUVA 1N0VC 2GESA 3FTCA 4CV0A 4TTRA 3X43A 4KR3A 3R7WB 1TK2A 2O8NA 4C5BA 3QX8A 2VWGA 2VDLB 1V8ZA 4QODA 2BW3B 1M57D 1KQGA 2Z83A 4PHFA 4KO2S 1X9GA 3D3NA 3CCUP 1QSGA 2QNIA 3GT4A 2NSDA 3D3WA 2KHMA 4CV2A 3KLMX 1RXSA 4ER3A 1FNSA 1UWKA 2WG2A 2ZRNA 5CDYA 1KJIA 3C5CA 2O8KA 3TZ6A 2DOFA 1WF3A 2I80A 4M6YA 3L6EA 3K6SB 5BRNA 4E7PA 1CWUA 2QQ5A 3JQPA 3NEUA 1XOIA 4MCAA 4KXXA 5IN4A 5BSHA 4WFIA 1XR3A 4Y3UA 3STWA 5FJIA 3EHEA 2CXNA 3IH3A 4BHTA 1ZM7A 4XDGA 4FOSA 3V32A 2VBYA 3VR2A 3CZCA 1COZA 4DCNA 2HF7A 3GLHE 1HW1A 5JJCA 1DAMA 4L9VA 3OYEA 2HFKA 1LDMA 5KLVK 3CSDA 2C7PA 2P7CB 2V7GA 2H3HA 3O5AA 4RTLA 3IBFA 5JH7F 4R01A 1VHLA 1VKZA 2HFED 1WJEA 1PJRA 2ZSHA 3R3UA 4GPAA 3ERED 3THYB 2JFUA 3WB1A 2P6SA 3HDQA 3NJ8A 2VTEA 5H83A 2HTFA 4LPSA 3ASOH 2HBZA 3PC3A 3IQEA 2O2CA 2EJUA 3QOWA 4KYWA 2DTRA 1RQNA 4RQUA 2BTEA 1LTIC 3MPOA 2UV8A 2X4HA 4HNTA 1E0SA 3DG9A 4WCFB 4D9BA 3TMAA 2NVWA 3RVOA 1EBUA 3O4IA 3HHHA 4PQFA 4Q24A 2WZ7A 4DLUA 1Q77A 2B35A 4UM5A 3LA6A 1L8QA 4X60A 1Y1RA 1GZLA 5ISMA 3B5IA 1GPKA 1P9NA 4X1YB 4KLNA 1GGMA 5KQSA 1BOFA 2ZRJA 4EYQA 5AQ1A 1NM5C 5BWCA 3NHZA 1QK3A 1TNDA 3E3AA 1O0BA 2XUAA 2OB2A 1ONBA 2PRYA 3U80A 1KO5A 1K75A 2XVZA 3F6SA 1H6AA 2GZAA 2HNKA 1CTQA 3P5BA 2QT9A 5IP5A 1MXFA 4EJSB 2P6RA 1RLUA 4B2LA 4I6JA 3LGSA 5KK1A 1SNYA 3G71I 1TWCJ 4DSAA 4XL9A 1J2TA 1EMDA 4Z1MH 3FPJA 5FKOA 4LIUA 4DFDA 5JSQA 2IHTA 4BLOA 4RVHA 4R8VA 3OPVA 1IL0A 2YO3A 3V1TC 1B2RA 3DTYA 3HEMA 4C6TA 2ES4A 3KPVA 2QZPA 3RPUA 3GNSA 5AW4B 1I32A 1LGHB 5AVTB 1NFFA 3PR1A 2VCEA 4IV5A 3KP7A 4RFSA 3WTTC 1RI5A 2VPYA 2VJCA 1JIIA 2VXBA 1XAJA 2QA4I 2VJBA 3D8HA 4DV3B 5LBQA 3GZNB 1XQWA 1CQXA 5KDLA 5HFJA 1AVYA 1QLED 4ZAFA 5GZ1A 2NZXA 4RJIA 4YELA 4NBQA 1L0LE 4DV0B 3EUWA 2EB7A 4JLJA 3VYWA 3TEFA 3MZ0A 1L7AA 4BL5A 3K72B 2DETA 4KLZA 4DV5B 5CBPA 2QVYX 5AK3A 1GFZA 1FDRA 3PE6A 1Z6TA 3NTQA 3U7IA 5K7ZA 3DZCA 1HPLA 5ECWA 4WLOA 2WRZA 3ZLTA 3JQ7A 1IZ8A 1NXOA 2FSVC 3ZDAA 1JUNA 2BELA 4UUVA 4FJ0A 1VHTA 4BE2A 2F2TA 4QX6A 2XH8A 1NX9A 4QUAA 2IXFA 2Z5GA 1OXZA 3JYLA 1JVNA 4NHOA 2BI7A 3IEIA 4NQWA 1HFEL 1C0WA 2ZSIA 2GO1A 4D9FA 2JASA 3C24A 1RCTE 5ALWA 2FSSA 4AD9A 1FYEA 5CB0A 1NBMA 1I9CA 1SXHA 1LRKA 2AQIA 4BNTA 1T25A 4ZH4F 3FWKA 3BCAA 2Z3WA 4KQXA 2IEYA 4D98A 1QIGA 2IXGA 4R9NA 4DBRA 1KQNA 3ZPXA 2IP4A 3S2IA 3BGWA 5E8IA 3UNGC 5CFRA 5DTEA 2XTZA 5GOZA 3SQNA 1RHUA 4QBTA 3PQ8A 2CE7A 4MRMB 1NUPA 4M9ZA 2YXLA 3IOBA 3DVAA 1JG3A 1GKLA 4G7ZF 2YVQA 1JMYA 2EJBA 3LAPA 3F6YA 2FA5A 2NYAA 1GZSA 2AXNA 4X1OA 3OYJA 2B8EA 1VA4A 4I19A 2OENG 4GOLD 4XUCA 2OILA 3KSZO 4MJ7A 2V54A 1KQSO 3PJGA 4KXYA 4URXR 2L9SA 2WIJA 1S72P 2Q21A 3CCEI 1L5FA 4CDRA 3UMGA 1C9NA 4HAZA 3G1UA 1YTLA 3FFAA 4IXTA 2AC4A 1P45A 3L77A 2HA0A 1VQ9P 1E5DA 5KPJA 3H1BA 1UFRA 5HKKD 4HDRA 3DLLF 4O29A 1CY2A 4TYYA 1CUJA 1ZVJA 2ICAA 2ID3A 4FNOA 3WSVA 4G56A 1R36A 4EY3A 3U2QA 4MA5A 4R0VA 2ZDHA 3GDOA 2WA2A 2J4DA 1QQIA 3JCUE 4HQKA 3I9JA 3L9FA 1WY5A 4NPDA 5GM2A 3ZMTA 2QJKC 4XDHA 4GYIA 3TW8A 5KWJA 2R3SA 1I4WA 5BYBA 3DMHA 3GLSA 5B7PA 4L9JA 1P9OA 2C4MA 1RI1A 2G77B 3M8FA 2P4WA 4FNMA 4YCCA 3TTUA 2KMUA 3CUUA 2OCGA 3L82B 3QI2A 2XE4A 4UXNA 4OHMA 1IJKA 4NK4A 2O8CA 1RKWA 4UPVA 2C97A 4TVSA 3QELA 1VTNC 2DLDA 4WZAB 2EIMH 1SOWA 1NR7A 4RCZA 1N9GA 2XT6A 5FRNA 5I7HA 2KQUA 4P8RA 4XSHA 2IBZG 5FUQA 3IAAA 1KTIA 1NPTO 4QJBA 3SLGA 1T2FA 3Q11A 4I5DA 3QE3A 3TSYA 1Z1DA 1P31A 2J9FA 2YV5A 5P21A 3DOOA 4UARA 5F0HA 1CVIA 3VZPA 4D79A 5FDFA 1IDOA 3H0KA 4NBSA 2WABA 2Z6UA 3RK3E 1CVRA 1ZM4A 1CUSA 1QYXA 1QOPB 1SKMA 3RUCA 3DFZA 1PT7A 2QN6A 2JHGA 3WBFA 4N0PA 1UWCA 4I76A 2JJMA 3ZS8A 1Q12A 4TYPA 5EIBD 1UQTA 3L41A 3WBJA 2QGZA 2P0YA 4N82A 4HAIA 4XWAA 4S3MA 1QQ7A 3FDFA 4UU1A 3TM4A 1E6MA 2EK5A 2VQHA 1T9BA 2EKBA 5EZ5A 5E1DA 3H8SA 3LY8A 2Q0HA 1H3NA 2FNAA 3GTPJ 4D42A 1RI2A 4N0DA 2QD1A 3H1KJ 3UFXA 4UHDA 1JT2A 2PJUA 1LDKB 3M1CA 1ISMA 5G4KA 4GXRA 3MD2A 3K1TA 4XIYA 1W2EA 1HV8A 1I50J 4M9XA 1PFYA 1NP6A 3OLZA 3DFIA 4D9JA 1WXHA 1VG1A 3AOEC 2PUHA 3AEZA 4K81B 4ENJA 4OK3A 3D5QA 4R1QA 5DNAA 5KJEA 3DU5A 3EW7A 2I2WA 3E97A 3V7CA 4HF0A 1UC4B 2NPFA 1DX7A 3F6PA 3B51X 3KYBA 3CCMP 2RE8A 1BMTA 1JPJA 2VOJA 1NRXA 3PQEA 3CR3C 4W99A 1NU6A 2BSQA 1CUYA 5ITZB 5LQMA 2FFAA 4P3PA 5I5EA 5E38A 2OARA 4KI7A 5BSUA 3H32B 3NAUA 1H89C 4WXYB 3A1DA 4HQRA 1IBLB 4ASWA 3PJDA 3KFVA 3O8RA 4GWKA 4FQGA 1L4AA 3I64A 3A0HH 2NVYJ 2UVPA 5D1HA 4NH0A 4KQMA 3OO0A 3GYBA 1HETA 1YJ9I 2B4AA 1KB9E 4EK9A 5BOXA 4QULA 4IGKA 3CZ4A 4DXAA 5C4IA 1PDNC 3Q5RA 3PEYA 3OQVA 2LD5A 4KK4A 2HM7A 4HMPA 4WINA 2AX3A 1XYGA 4F92B 1DEOA 4IDPA 4JJFA 3ER6A 3E6CC 2GBCA 1TZ2A 3RV4A 2DB3A 4MUFA 3LSHA 1LU9A 4WQMA 3DFGA 5DVZA 5AKGA 1AF4A 2EWVA 2OORC 2YBDA 4BXOA 1H4TA 4MS3B 3TLYA 1J5PA 3VPCA 4B6EA 4YFYA 1ZHHA 1V96A 3H25A 4CYMA 4P80A 4YCNA 3H1IJ 2PTHA 3QPHA 4AYXA 3WADA 3WYDA 3AMVA 4OH1A 1AURA 3O7WA 2BFFA 1HFJA 2JFGA 1Z28A 1I30A 1DAHA 1GN8A 2XRYA 1SD7A 2GAJA 5AQEA 4BLSA 3B2EA 1O96A 1RCUA 5LZ5A 3TFWA 2HMYB 3AZQA 4V2UA 2MYPA 1QX8A 3QX7A 4ZTUB 2CVHA 5FA8A 3JREA 1QRTA 1TI7A 1UIIA 1OR8A 3QOPA 2QJOA 2C5BA 1D2GA 3HYTA 3ZWWA 3ZDDA 1OIVA 2VPWA 2FFQA 4F2DA 1V47A 3CRVA 3W5AA 4X1EA 3K2AA 4FFBA 5J9FA 5B37A 3WNDA 5A9TA 4EA6A 3MWJA 3F73A 4HNUA 1QZ3A 1E6CA 3ZHRA 5BQ5A 5KSWB 4Q7LA 2QRLA 1WMEA 3R3SA 4GI7A 3TPFA 1NC3A 5COBA 5ENVA 3RK4A 2I1LA 5DTMA 5JRDS 5E79H 4DM3A 1TAHA 4XLAA 1HDRA 4DSTA 1DJMA 3Q3HA 3PNOA 3LZCA 2J6CA 3CT4A 4ZOLF 3W5HA 4HQOA 1H2ZA 1NGMB 2AXPA 3QVWA 3H5LA 4MI3A 1MPXA 4BH9A 2NPSC 3WL7A 2B94A 1ZLLA 1XJ5A 5MDHA 1HEYA 3USES 2GKGA 4LG0B 4K9SA 1Q7RA 3RLFA 3AJRA 4FYXA 4RLQA 2XU6A 1S5LE 2HTEA 4YY3B 3BE6A 3G8BA 2QX4A 2ZW9A 4QT4A 1K4YA 3IURA 1LDYA 4GI3A 4H7EA 5C81A 1JYSA 2XTNA 2XSJC 4HAMA 2YZKA 1RM3A 5C3MA 1RC9A 5D5QA 5JJ5A 4EI2A 3WMM0 2BW0A 3LCJA 1VJ0A 2A68F 1B26A 1DIOB 4CM1A 1RLMA 1D1SA 3IPRA 4JUDX 1FZAA 2YWDA 3TSWA 2F1HA 2C59A 3GZJA 3L74E 4G5YA 4IZIA 1I7SB 1WXWA 2R6HA 4HWRA 2WTYA 5K3CA 3A2AA 2PPVA 1KA9H 4HOYA 4WNCA 1NXWA 1FAVA 4D9MA 4F4UA 3MJCA 4PFJA 3R9XB 1TL7C 4LZOA 1LKXA 3X2FA 4UUQA 1XNJA 2KRCA 3II6X 3WLKX 5ALKA 4ZPXA 4HRVA 2KW5A 1JG1A 4XB1A 3WL5A 1ON2A 2PSSA 2YS6A 4DG9A 2FXVA 3AUUA 1VQ5I 3BHMA 4NVRA 2V7QA 3EDPA 1GARA 4WECA 4DL9A 3RAJA 3WKDA 2JSCA 3HXMA 2RGVA 3DFMA 3DEYX 4EKDA 4JJ7A 1W4RA 5DI9A 5E18F 1P6QA 3GR6A 1OISA 1PYOA 1XVLA 1TJ5A 4KN9S 4RPLA 5KTOA 3N2EA 3WQHA 3L46A 4HXEB 2OO3A 2V79A 4GS5A 4DLKA 3JTEA 3AY0A 2RBKA 2XZRA 1R0SA 4AZ3B 1ISGA 3V2PA 4QXMA 2RHMA 3E9DA 2R5NA 3JQ6A 1VP9A 3WYFA 1Q90D 1JKFA 5GV8A 2DA5A 1IHUA 3KBBA 2QG4A 3DTTA 3ILVA 1IK4A 4JLBA 1YLFA 4DT1B 1SCUB 3I1JA 1RIOH 1YITI 2QTZA 2UUPA 2QLBA 2M9MA 2PL5A 4HGPA 1XKXA 3F7TA 1JDPA 2HSGA 4GPTA 3BCBA 1FFWA 4R7ZA 5AW7A 4TRMA 2GF0A 1GV0A 2OKCA 4C06A 1PW5A 1N7SC 1XJ0A 4CIYA 2QLZA 1MVLA 3SN6A 1C7QA 3MT8A 1KD1Q 1UXIA 4JDUA 3KZKA 3CCLP 3DTKA 1QO9A 1KO4A 2BRUC 1YL7A 3B1ZA 2ZR8A 2B5WA 3RLIA 2OQGA 1E9EA 1KKLA 5JRJA 4F8EA 1SAYA 2J33A 1UFVA 1KZGB 2H00A 2HW8A 4Q4HB 1BOBA 4ZDOA 5F2EA 4M0MA 1SMYF 1E2DA 4J2HA 2P2CA 2ACEA 2CLCX 3HR7A 2WUDA 1QWSA 3O1HB 5FLEX 4UUNA 3VAZA 2VI6A 4IX1A 3V2UA 1PP9E 3UJCA 4D92A 1BDCA 4WLEA 2FN8A 3FXKA 2IWHA 2HLHA 4WN9A 2Y2VA 3E53A 1FTQA 1BW6A 3SEFA 2FRVA 1QOZA 3W6PA 4NZZA 7REQA 4PCLA 2FWJA 4KISA 4ZO7A 3I6BA 3LIEA 3G8YA 5A7HA 4JLUA 4YCSA 2IX7C 2WPVB 4EBFA 2HKXA 2E4WA 3RK3D 4C7XA 1J97A 2YIJA 3VSCA 4KFCA 4JFAA 3ACBA 5HBGA 1H8EA 3COSA 4GC9A 3D3KA 1WBJB 1JB1A 2V7BA 3QLUC 3W2TA 2DN0A 3BMOA 3MILA 1Z2NX 4PW0A 4W8GA 1MN6A 1AQNA 3JYPA 3PDIA 3TNUA 3WTSC 2FPPB 2FMXA 2AD1A 3IOEA 4HDAA 2BHLA 3M9HA 3KELA 2FK8A 2GEDA 4FGUA 3QVOA 5EWJA 2J8ZA 4AL4A 4N4OB 1EVKA 2VNHA 1EK5A 1KOLA 1I4EB 2D2VA 2M32A 2IW3A 2PKXA 1KDOA 4IO0A 1U1FA 4QPJC 2NTYC 4H1TA 4WK2B 1ZZGA 3N28A 4KTVE 3LVQE 5B4UA 2MG4A 1MT3A 2IUFA 3HWX1 3KZMA 4TS4A 1F14A 3NFQA 2EWWA 3MOIA 4MW2A 3SJMA 4GMXA 4AG3A 3GRCA 4P5DA 3EYYA 1E58A 3MHPA 1II0A 5IARA 1TU3F 2YJTD 3OE7D 4WZBE 2W2KA 1B0ZA 2V7UA 2GS9A 4RTKA 1G3MA 2HHCA 3DL0A 1FFAA 4O08A 4RORA 4QWQA 1YT5A 3T9AA 4RHTA 2LZ0A 2K2WA 1NG6A 2J7PD 3V8RA 1KA8A 3K5IA 4MS4B 1RRJA 4XB2A 1SJ9A 3RC1A 1VCNA 3WIOA 1XMJA 3F8FA 4D8VA 3VZBA 1R0ZA 1SRRA 2CNLA 3ZLBA 4CIBA 1MEJA 2YC2C 3EBLA 5AW1B 3TCXB 2C84A 4MROA 3SYNA 2WNSA 1E7SA 1G291 4WCFC 3W1EA 4HDNA 5CD1A 4YXDC 5FD5A 3LW5J 4W1PA 4EM0B 1ZR2A 2BONA 4CMJA 3EDRA 1TU4A 5B66H 3K0FA 4Q01A 3TFQA 1JG2A 2D2XA 4JC0A 1XZGA 5HIJA 1SQSA 1U7DA 3DONA 4RHXA 3ADCA 1SH7A 2FA9A 1UBTS 1TA9A 3NBXX 5DOZA 4FFSA 1QV9A 4D9NA 4B3AA 1NW5A 3SM3A 2PS1A 3HB1A 4Q00A 1T91A 1B1BA 2DP4E 3KRTA 4RIEA 4L3WA 4OQFA 3KQUA 1P62B 5E4TA 4LRQA 4MUYA 4Z7NB 2OV3A 1PKXA 1G42A 1EYZA 1EQ2A 2ZXFA 1J2RA 3FR7A 1B4AA 1MW7A 4KPUB 4ZEWA 4DLYA 4YT2A 2BBTA 5IK2D 1ZWKA 4FJ1A 4P83A 4BP1A 4MAAA 1E20A 3DZHA 3L7MA 1NKVA 1RP1A 2PZKA 4OHBA 3MN1A 4LNHA 1F6BA 3GK3A 4CQLB 2MLKA 2OBLA 4KPFC 2QN3A 1MH3A 2GZSA 3BS4A 2WILA 2JLBA 3FXUA 1WEKA 1A9PA 2GLTA 2X8JB 1S5LC 1KILC 2A1TR 2LW7A 1GRVA 2Q41A 4XI9A 2JIBA 2YWJA 4F9FA 5ECGC 1N2OA 1ISJA 2HADA 1V8OA 2O8DA 1NN5A 4OGLA 2IEKA 2FCAA 1FQKA 3DLIA 2O8EB 1KH3A 1OFTA 5LL6P 3R5FA 1EM8A 5TQJA 4PLPA 5TSDA 1EPUA 3H1KG 3PQKA 2V7XA 3QIVA 4IUCS 4KWIA 2JPDA 5IT3A 3C3EA 4U63A 2V9CA 4LY9A 5MFZA 5BYJA 1W5EA 3KSUA 4UB8C 1PEYA 2M98A 4ZZLA 3TZBA 3L8HA 1RRPA 4UATA 3U17A 2Q50A 2H2AA 4IL6C 4ACAA 5DSTA 4LDJA 1U80A 2QVGA 1HWTC 3I9NA 4GMDA 1K4SA 1IZ7A 3LC1O 4GGGA 2ANCA 2X6WA 3IKJA 1G2PA 5EZGA 4RL4A 2Q3EA 1GILA 1DU0A 1DP7P 1UJ5A 1R5OA 5CHXA 3L73J 4HSEA 2NGRA 1YC5A 2X8LA 2FTKE 3O26A 4DNQA 5ELLA 1AOYA 3ZLUA 1F60A 2FYUJ 4UD2A 3JSAA 4B74A 4FR0A 4P7FA 3ZKAA 2PFSA 4B4KA 6CHYA 2OWEA 5CA1F 3QV1A 1PG0A 4NC8A 1GTRA 2P41A 1MJGM 1FRNA 3VHXA 5T3YA 5LU9A 3AERB 1YB4A 5J4HA 4H13B 1KO7A 4UUOA 2FG5A 1AGRA 4R79A 4NUBA 4OGFA 5BN5A 1RDFA 1OWLA 3E27A 5A5DA 1GSIA 4JX9A 1NI3A 1F6WA 2ZJBA 1DFIA 2V6CA 4UKDA 3TL6A 2IRWA 1LTAC 2AQHA 3T1TA 1U5BA 2RQPA 1WLYA 3M9LA 3IIMA 4OQEA 4DE5A 2IX3A 3QTTA 4RTPA 1GXSA 1LTJA 1CZUA 3NUGA 3FTPA 3WL4A 2WIDA 2QA4P 3R6GA 2G6TA 4NQRA 5GP1A 4CCYB 1EX7A 7MDHA 2H5LA 4JYAB 2QX8A 2FMUA 4WOKA 2Q6IA 3PWZA 3F90A 1VE3A 2FAXA 4FSXA 4N3GA 2PV7A 4S1WA 4AUEA 5CFNA 1WSWA 1JG7A 3L79A 4R41A 2HOAA 1IEXA 2HDCA 1J21A 2CYYA 1W7PD 4E2XA 1A0OA 4KPGA 1KYXA 4KMOA 3CEHA 1NTZE 2DM6A 4HZGA 4UNIA 2KS1A 3F5FA 2XTAA 5BQ3A 1UXGA 2B4QA 4AIRA 3Q7RA 1QHIA 1YV9A 2W90A 2WAAA 1CYEA 3HBFA 2ONZA 1X3ZB 1L7QA 1USEA 2VJAA 5D84A 1KI6B 1II8A 5IM4A 3FOBA 4KE7A 2OVFA 2RN0A 1SHLA 2E5NA 3M8EA 3EPJA 5HQJA 1ZUIA 4KAXA 3T5GA 4M53A 2DPDA 5M7EA 4R98A 3RKQA 3AFGA 1Y1TA 2BCCE 2JVGA 2AXTH 1X15A 1SQBE 5I7OA 1W75A 1Z45A 3KOOA 2XB2A 2FYTA 1JS1X 3CC8A 4RF3A 3RANA 1PZNA 2C4NA 1W0KA 5D5UB 4CRWB 2GZMA 1KMHA 3PDUA 5ILSA 3GDWA 3LCMA 2HJWA 3QP5A 2WTXA 5TRTA 2GCEA 1IY0A 1CERA 2F9MA 2Z9OA 1U31A 2F7SA 3Q2OA 5KVVA 4BO0A 5KCZA 3VWBA 4UM8B 5ERYA 3VOPA 1P91A 2AD5A 2DUNA 1IPEA 4XX1A 1ZW6A 3GD7A 4Q4CA 3GXBA 4CGYA 4PZCA 1XRMA 4RB1A 3RAPR 4KX5A 1T5BA 5C8DA 3VQTA 1JMBA 5M5YJ 4M89A 4E5KA 3V8LA 2ZJ6A 4LQLA 1L7PA 4DUZB 3L36A 1K6OA 4CODB 1VYHA 4G0MA 3U4HA 4DLNA 4UQOA 3M0DC 2N8GA 4NCNA 2LKXA 3RWMB 2G7HA 2WIBA 3BREA 3RJZA 1QGUA 3GLGA 5EWLA 2EINH 5DBGA 1BGYD 4PO3X 1EEHA 3HMKA 3NC0C 3F22A 3HHEA 2DC1A 3KKEA 2N1TA 2OGTA 3HSRA 4MKZA 1Z35A 3ZD7A 4U2KA 4EA7A 4MRAA 3U3XA 2XSZA 3GRFA 2GOXB 3STTA 1NBAA 2QQGA 2IYRA 4MHOA 2XSZD 2O1KA 1HZJA 1T1JA 2HQ5A 2YYYA 1Y9BA 1JSRA 5H4HA 1C5KA 1URQC 4ZRDA 3MZHA 3VVBA 1UIMA 1OA1A 3BIFA 1QVVA 3P97A 3KAQA 1MX3A 2BGNA 1VGRA 3VKUA 1P8JA 3ELDA 1CVLA 1CBUA 4G5GA 2A5JA 4B0PA 5LYYA 3DVLA 4LBWA 4URYR 3WTYC 1E32A 4TX1A 7YASA 4PXAA 1Q0HA 4KJMA 4ZYEA 2QAIA 3U16A 1I2DA 1DT5A 4FLFA 2CVQA 3PXXA 1XGOA 2XQGA 2RKOA 2GEFA 4M0EA 3U7EB 3E8XA 2MSNA 4ZOCA 4H18A 2WWXA 1W8IA 3ETNA 1QYDA 2JAQA 1E98A 1U0OC 2NZVG 2RGAA 1NTZG 3FDJA 3LK6A 3AIIA 3SNHA 5FTNA 1G0OA 3TINA 1OLXB 1J70A 4J0HA 4MR8A 3H5VA 4XRFA 1IY8A 2CMFA 1X92A 1WPKA 5C4JJ 2I3BA 2JA6J 1O08A 5ALUA 5GPBA 3KQYA 3AM5A 4LJRA 2RGEA 2ZXUA 5DV5A 1YIAA 1SUIA 2RHHA 1OVGA 4IMJB 3E1SA 2A84A 3AEQB 1DU4A 3TDMA 3ZGYA 1F4PA 2RGCA 3S4RA 5CIWA 2B5OA 2O3UA 3U19A 3PGXA 2BHZA 5JAZA 2R32A 3PL5A 3UJBA 2DA2A 1PK7A 3GVPA 4W7ZA 3TW7A 1NAFA 2JAXA 5TF0A 1XLTA 5REQB 5AVZA 5I6DA 2R66A 3VU8A 3DF9A 2X2PA 4PX2A 3O3CA 5CVTA 1MA3A 4A6PA 2P67A 4FYMA 4J4BA 4YMUA 2JQ7A 3DDOA 4N1AA 2F4IA 3ETDA 1NG1A 4OXXA 2W57A 5IK2A 3QAHA 4RDHA 1SBQA 4PGAA 3U9LA 3A6PC 1JT9A 1KMMA 3EXG2 2HA5A 3DKRA 5CYOA 3FXEA 3E4CA 4UXIA 1NVOA 5B30A 2ZSIB 2WSFH 2NADA 3EBPA 3SJZA 3KJIA 3U3DA 3H2GA 3K8YA 2CL5A 2JKZA 4D6TE 1Z2AA 3T3PB 1W4CA 3TSIA 3WHBA 1J2UA 4F96A 4J43A 2SCUA 1MC1A 5LA6A 4TRJA 4MP8A 1JKQC 3TZEA 3ZLVA 3C7KA 1WNFA 1H22A 5HKAA 4KI0A 3KDAA 1T5OA 2SKDA 2QAJA 1GUYA 1SQVG 4J0JA 4E4YA 1VFPA 1AXEA 4ILKA 3MJVA 1AKVA 5BVHB 3BMNA 1NKZB 1FLAA 5CLQA 3U61B 1Q11A 2Y2ZA 5GAEJ 2ZI9A 4FTWA 1E6KA 4EL0A 2GT1A 4F06A 4MWDA 2ZU6A 5AW9A 1MDMA 4WBSA 3OJXA 1X1BA 1SQVD 4UB8H 4FFMA 4WDRA 2HA4A 3RTAA 1VKRA 3GTMJ 2VP0A 1SFEA 4EFNA 4KWEA 1D4OA 4DDUA 3H2JA 3CEPB 1ESZA 2W4SA 1I24A 2MTBA 4DDKA 1M74A 3ZNQA 4MEYF 2QIOA 1NYQA 1QKJA 1T9HA 3RHFA 1VKOA 3NUQA 4V03A 1G9SA 1USWA 2IW5A 2SBTA 4JT4A 2ZBKA 3QH9A 1BVRA 4EF6A 3WGHA 1TA0A 5KVRA 4Z99A 4RE6A 4ZMBA 3TBHA 3BQZA 3T7IA 5F77A 4LTMA 3HXPA 2Y1FA 4TLDA 2A9KA 1Y82A 1FLNA 4TQUS 1OXSC 4DHEA 3EOZA 1QVWA 4S1PA 1S5LH 3N0VA 3CMEI 1D8AA 5TQ2A 3VM6A 1AA7A 2ONKA 4LTNA 1NA5A 3HRKA 5IJZA 3BMQA 2DO7A 3TTVA 2Y30A 5JAUA 4CF7A 2XIQA 4A5MA 3CZAA 1WWKA 3UMYA 2GN6A 3JWPA 4BB9A 3AHJA 5CCGD 1H88A 3QYBA 2VHYA 1RYBA 2VHCA 1Z4OA 1UK8A 2CD7A 3RYIA 5BNGA 1VRWA 3UGTA 2D45A 3CGWA 1ZISA 3H1CA 4OIOF 3DEIA 3DO5A 4YUAA 3I3OA 3NCHA 3MKZA 4U9UA 4ARIA 5GTHE 4RB0A 3OFVA 1H6BA 4QGGA 3VYTB 3H84A 2R5YA 4LNUA 2P6NA 2BGKA 4ALIA 1V3QE 3LQQA 3EK2A 5B66C 4K9LA 4GFDA 1HDZA 2HJVA 3OMWA 2GA8A 5LA6F 2ZTSA 4E2YA 4A0HA 2MH9A 3SG0A 3KAPA 2DLCX 3LUHA 3ND6A 3AR7A 4EA8A 2F6RA 3ETLA 3IVAA 5I7EA 4R3UC 1YTYA 1SQPJ 1LDGA 1TTHA 3TTXA 1Z34A 2HX1A 5I7WA 5K0FA 2Q3HA 3UMVA 4WK6A 1ECLA 1KSHA 3UZUA 5TXGA 3T1QA 3O84A 2MSCB 3AF2A 4V39A 5IT9A 3HRMA 3C3WA 4HQFA 3TB4A 5BOSB 2WB1N 4QNMA 1SQPK 4WKPA 4ENVA 2F6CA 2VQEB 1R2QA 3DZIA 3MZWB 5KKZC 3QYFA 5JLXA 1XN1A 3H2ZA 3SC2A 3H8JA 3Q3IA 2IV7A 2QG9A 4WBXC 4N9HA 3VI3B 1QONA 4DCJA 3W2HA 2J9XB 1F12A 1NV8A 3GUVA 2YWXA 2E75B 1JFFA 3L72E 1YTUA 2LXNA 2YWFA 3GPLA 3VU0A 1YO6A 1HURA 2IOQA 1SC3A 3A6KA 2OCYC 4A8JC 3HXOA 4YMWA 5L8VA 2QJWA 5KHDA 3SQWA 1MIJA 3L75E 3F78A 4ZICA 3A14A 1OPCA 4B3DA 4C1BA 1FPQA 5IZ4A 3HYRA 2Q46A 4RD4A 3S2EA 1BO6A 1O2DA 3QXXA 2ZEJA 4D9KA 3G4SI 1BFUA 2X3YA 3M9QA 1YU9A 1HEIA 2IFTA 2MJZA 1G1IA 2D1HA 4AQ7A 4M36A 3K1PA 2OHJA 2GARA 4J91A 1X87A 4XMYA 4JP1A 4DMLA 2P0EA 1KJZA 4KQJA 1N2BA 3KPYA 1N2CE 5IBQA 2GLOA 4N01A 1OWPA 5JI3E 1DH3A 3OYCA 3QE9Y 2FVXA 1Y6RA 3HD7A 2AN5A 2NG1A 1EE2A 3JARB 3RYHA 4B4DA 1F1BA 4KR7A 2ALJA 5A0FA 4NMHA 2FX0A 1MGTA 1RM4A 4YIHA 4H08A 4HZIA 3A9WA 4KMUX 4G07A 1U8XX 3DO6A 1KFKB 4OQMA 3T94A 5BSWA 1YI2P 2VC2B 2VPLA 1AUOA 4DBLC 3LE8A 5ERXA 3K70D 2FRDA 2IH2A 2KDZA 1AB6A 4YBZA 4A8TA 4G5XA 5LYJF 4KE9A 3DL7A 1IN8A 1QWOA 3NPMA 2IH5A 2KE5A 4CMIA 1V11A 1SKBA 4QJ3A 3ZHVA 1MG0A 2O07A 5KO2A 1CW2B 4RBNA 2R65A 3FAZA 2MYNA 4RQBA 2QENA 3ZDEA 3KP4A 2VUUA 2H1SA 4Q21A 1FP6A 2BFEB 2EDCA 2Q6VA 4G0OA 3CURA 3OPMA 3WB9A 4QPZA 1JKIA 4BXLA 3C6YA 3EX7C 2ZQ5A 1W5CE 1QZYA 3H16A 3K1AB 1BKYA 3Q4GA 1U65A 2ZE6A 4ZVMA 4LWQA 3T7KA 2OXFA 4G8XA 4IKFA 1YAJA 4FYYA 4JQSA 2IUUA 1IFXA 3GOQA 5CCEA 3OEWA 1YE8A 2ZB4A 3W5BA 1HUQA 3AW9A 1I51A 1OH6A 1Z68A 4CJXA 5JHHB 1YHQI 3L73G 4CIWA 3JC22 4MV1A 4Q4AA 4KR0A 1NI4B 3A0UA 1L5LA 5HOEA 3A3NA 1H1LB 4YMIA 3L1PA 3ML1A 2QUJA 1MOPA 1S7GA 4J7AA 3RYRA 2RH8A 1S8NA 1H2BA 2OHOA 4BMVA 3IUNA 1XK7A 5FNVB 4XWGA 1XZKA 4UTNA 1X1EA 1TECE 1K6EA 2NZ2A 5C8YA 1XSEA 2Z2SB 1OKKA 1IXCA 2RDMA 5IS2A 5JALA 5JMWA 3CPWO 4KDEA 4PS1A 2HRZA 2RMKA 1S2OA 2JCYA 4NFYA 3WO0A 3HZOA 3M8JA 3ICOA 4IHJF 5TT0A 3E35A 3EVCA 2NV2B 3UAVA 1YS9A 3TNYA 5AI0A 1C4KA 1QQBA 3MLBA 4YDSA 5HIIA 1DUIA 1JTHB 2KOGA 3A1YA 4C87A 2HRBA 3QVTA 2G17A 2QE7D 2A06G 4FKZA 3ZH9B 5BN3B 2GPSA 4WFJA 4MWGA 2D7DA 2EKQA 2JAUA 3HABA 5BW8A 4M38A 2D1SA 3KHSA 5WRFA 2O01N 2DOEA 3A4IA 1TWHJ 1QBGA 4D9CA 5K1ZA 1GYRA 4NDAA 2GF2A 2QJKB 4RAQA 3H3FA 4PRYA 3IHWA 5LCXA 1FOSF 2AWOA 5B55A 5AKEA 3WFIA 1IY2A 1LKZA 4AQDA 1B76A 4EB6B 3LY7A 2I67A 2ZJAA 4P0TA 3NNDA 2AIRA 4MUAA 4B3IA 3H17A 3FWLA 4FUTA 4KBFA 4QJ5A 1XKLA 1GMJA 2CJWA 1U8BA 1Q1AA 4OHFA 1KV4A 3FZEA 4OWRB 1QP8A 3OFSA 5AVQA 2FW8A 1JA1A 3H5NA 2HAEA 1G3RA 2P7IA 5BVGA 5E7IA 5K8JB 2YFHA 2RHWA 2H7YA 1TZMA 3BGOS 4JBZA 2YHIB 1P2UA 2LR8A 5CVUA 1LBEA 4FWTA 2VK1A 1J07A 1VYTA 2R4UA 2FEOA 3SVZA 3STYA 3KJXA 1CUUA 5K09A 3LJKA 3E5QA 1YS1X 5G53C 3SJCA 4UAGA 3P94A 1EFPB 4CF4A 4DBQA 1DEEG 2VJMB 1V5GA 4YRIA 3ENZA 4CEJB 1E7MA 4S24A 1NU8A 3SSUA 1ULBA 1QLWA 1U3TA 2XDYA 2XWJI 4HX4A 1BHSA 2DBBA 2H11A 1LNQA 1KDTA 1Z08A 4PSXA 2P81A 4FONA 2XDQB 1P39A 4DMMA 4O33A 1TYCA 2PEZA 2JN6A 3U4AA 2AQKA 3EPRA 3W5IA 4DCGA 2O7VA 1E18A 5CDFE 4EGJA 1IV8A 4DR7B 1QGAA 2ZXEB 1OX4A 4MFDA 5KREA 1KJYA 1GRRA 1X9HA 4BEHA 4IIXA 5F1YA 1SVMA 4Y2UA 1E3WA 4Q1DA 2ZLBA 2RREA 3TNLA 3FKJA 3EE6A 4PFSA 4K05A 1LTHR 4XQ0A 4HPQA 4C4TA 4YH1A 1P9WA 2CNKA 1VLVA 3G8CA 4Q3EA 4YJKA 5EE5B 4Y8VA 3ZDMA 1GZ5A 4M9RA 2ZMEA 3D4LA 3GU3A 3VYRB 4ZT4A 2E1NA 1ZLXA 3AEEC 2A5GA 2QSYA 1TT0A 1LVHA 1OC2A 3LLVA 2JA7J 2W6IA 1Y3BE 2C9YA 3QPLA 4WBNF 5BS6A 3JU3A 1N6KA 3CCBA 1YZ3A 4C0XA 4OHRA 3MQ2A 3TUIC 1SAUA 3I0ZA 4URHA 1GL2A 1BFDA 2WSFJ 1BGWA 5FOSA 4HDQB 4C4SA 3IF4A 3KZIE 3CJRB 2O1EA 4IICA 2RMZA 2I4NA 3ZDQA 1RAFA 3EVZA 4ABYA 1KKUA 1PWZA 1RW4A 4BVAA 2R6R1 1PT8A 1ORDA 2A59A 2O5EA 3UMCA 3BXZA 1M34E 3EYIA 4E0BA 4DIOA 2I8AA 4GZLA 1R0RE 4BCCA 3IHKA 3HBLA 2J5XA 4I7EA 2BKAA 2WWRA 3VJMA 4M1TA 3ND8A 4M6WA 2KSQA 2WSSH 3ZVKA 3A06A 4M87A 1ZJZA 4PD4D 3T0FA 1S8AA 5C8ZA 3GGOA 3HO6A 5P8WA 3CW8X 1RRCA 3NHPA 2OFOA 4ZVVA 2F55A 4K8OA 3VPRA 3JX9A 1U8AA 3P8ZA 3JVDA 1ZW0A 5HOOA 3CR7A 2YWBA 3I9FA 1CI6B 4Z5XA 1XJWA 1XTKA 1FBTA 3V2NA 1WZIA 1NVAA 2GA9A 3ICVA 2X77A 1NZJA 1SQPG 1TIPA 3LOPA 3BT9A 3GHGB 4NSNA 3TPCA 3FF5A 5AM0A 4ZOLA 1JSCA 4PRKA 3RS7A 3NIWA 4IKEA 1WV1A 2OAGA 2KMLA 4TV7A 3UG6A 4IHSA 1DGRM 1ETVA 5JH7B 5SYAA 5JNUA 2PGXA 3HCEA 3E9ZA 4WMLA 1VZ2A 1Y3FE 1RWXA 5HS8A 2J9ZB 3V4ZA 3HBAA 5EPEA 3RHTA 3ZH2A 2ZJSE 3H5OA 1RF1A 2EX0A 2ZRCA 3Q6NA 4URVR 2UZAA 4IIYA 3J80K 3HCAA 2FUNB 1I0ZA 3PD7A 4R2HA 1O6GA 2HS5A 3BATA 5HEKA 5DLDA 5TVKA 1SFCD 1CJTC 1VQPI 3N87A 2L01A 5EOVA 4BWGA 2GM5A 3G2JA 4ZA2A 2QM0A 4BU0A 2JHFA 4HXYA 5DD8A 2Q3DA 2QL6A 4B71A 4MOWA 3GPIA 2I22A 3TD6A 1TLHB 2ZYRA 1A5BB 2WTUA 4RSMA 1IU9A 1NBIA 1FDSA 4PC3A 2GHIA 1KO8A 4O4HB 1Z06A 4XEHA 4F2WA 1P84H 2OQIA 3RC2A 3OTIA 2QW1A 4GYYA 4WZBA 3PSHA 1EZ4A 2M0CA 4MAFA 2CC2A 1SUSA 3GLXA 2X48A 2LY2A 1DJPA 1HZZC 4G0WA 2NU8B 3MZ8A 4K9OA 5K3OA 3L1IA 4LRWA 4LE0A 4L0CA 3TTWA 3WXBA 3DOUA 3T3HA 5HCUA 3PGLA 3H2HA 4OQPA 5BV7A 1HJ0A 2X4GA 4DS3A 1QB7A 4BECA 3ZDFA 2VTDA 3KHTA 4YAUA 1NTRA 3AEUB 5SZHB 1T6XA 2FWAA 3QLTA 5BR1A 4XR6A 2PX5A 4ARZA 4UU0A 1TJNA 3DKVA 1JE0A 3KEFA 3MMXA 2I4MA 3T9FA 5F3WB 3D4OA 2XX3A 2NXNA 4B9EA 4JBAA 5A62A 2I2DA 4C01A 1H8HD 1TEXA 2RFLA 4UJ5A 3UPTA 4DB4A 1TC1A 4UZSA 3EEQA 4S0XA 2C1XA 4WXCA 2F43B 4D6YA 3ILHA 4U6SA 1E17A 2BLLA 4L16A 1E2UA 1EFAA 5HGXA 5EP3A 3KBOA 1K6XA 3JQAB 5M1BA 3G71P 1CUVA 3C8UA 3RJ9A 2STWA 2WFZA 3DW1X 3GHGC 3HB4X 5IKEA 2PJRA 4GMHA 3ETEA 1N6HA 2Q8NA 2ISQA 1X8KA 4EF5A 4QXRA 4Y6LA 1GTSA 4BO8A 1WCIA 1Z4IA 2W85A 2HXYA 3ZIDA 2WF7A 1P1JA 3DULA 2ZYUX 3O6QB 1HX7A 4I55A 1VLQA 5ICGA 5IT9Z 3MFQA 1KSFX 3N2KA 4NB5A 1Z62A 4O4JA 2XUQA 4IZZA 3EASA 3CCJP 1E60A 2LPMA 3FKSD 4BRZA 2Y76A 3F1LA 2A1UA 3HWSA 1VE1A 4JR0A 1XMAA 4WSOA 1PV1A 4DWWA 3K35A 1U7XA 2R2AA 1L4UA 3AH8A 2WP0A 2ZRDA 3LBFA 5AJYA 2WJ6A 2AKAB 4LOCA 2RK3A 4UUSA 4QZVA 4ENNA 3I4MJ 3FYSA 1DAIA 3IV6A 3Q2KA 1RR7A 5FBRB 3BCCJ 2ZT5A 1NM5A 5KDDA 2Y0DA 2JHCA 3FX0A 1ADGA 1C1DA 3UQZA 2RNJA 1QU2A 3UQYS 2VDJA 3AHFA 2L2QA 4RVCA 1CK4A 1KILB 4JYZA 3SOPA 2CB0A 4DSUA 2I3GA 1CPYA 1K8RA 3AE2C 3Q5SA 3V46A 4DLZA 4K9RA 3H13A 1KI6A 3FOFC 4DV4B 3ZGZA 3Q9NA 1Y1VJ 1KIFA 3GGCA 3OHSX 4OTZA 1MRNA 3UT0A 4BHPA 1X8LA 1XEXB 5JMTA 4GL4A 3Q7PA 4OV6B 3AT1A 4RAOA 3WGQA 4P5OA 2H0QA 3C4QA 5FNVF 4AX4A 2J59M 2XUGA 2WWWA 3SY8A 3V4FA 5DX0A 4UZEA 4DMKA 1U9JA 5LQRA 2A78A 1U2QA 3PDJA 2VUMJ 4IL6E 3ZBUA 5KMGB 3PUYA 1AM4D 3AETB 4QDXA 2IGTA 3G02A 2WB1A 3HJCA 5GGYA 3UK1A 1MIOB 4WK0B 4IRMA 2VODA 2CT8A 1S5LX 2W6CX 4N8DA 4U39A 2WU1A 3ADOA 1G7CA 2QVCA 4IJWA 3UH0A 3L0CA 1ACJA 5EZYA 1NRIA 2ELJA 1Q1EA 3LPLA 2NU6B 3GCGA 2VK4A 5K7HA 3RV3A 2PMBA 2REXB 4PONA 4QHSA 4DUGD 4KJZA 2PXCA 1Z6RA 4GYGA 2DMPA 3DKPA 4Y2GA 2YXEA 1SB9A 2P65A 2P9FA 3M6LA 4US0R 3DC7A 4KN4X 1O3QA 1UBHS 3GEIA 4CZ2A 5KOHA 2O7SA 3THSA 5L95A 1PJTA 3L8ZA 3QJ5A 1MDBA 5AI5A 2XMCA 1O3SA 1UAAA 1RVDA 4XOTA 3FBWA 3HQ4O 4HNAB 4PR0A 1KU0A 3NHBA 3M5PA 4B83A 1LA2A 2H1RA 2M0BA 4I1RA 2P79A 3PGMA 1J39A 4ND7A 5T64A 2G36A 5BW4A 5E1OA 3HYLA 3JQ8B 3T9BA 2QSGX 3L2QA 4LYGA 4ZI3A 3WFZA 4TXLA 3QPTA 3RSQA 2ZZKA 1CFZA 4HQ0A 2I29A 1JXAA 1ULZA 5E3NA 2VATA 1WXQA 2ZR7A 2G9UA 4BO1A 5FIUA 2K7FA 3UFBA 2BE5F 2DFVA 2ZITA 1LNSA 5E3OA 5BQPA 3MWDB 1DTEA 3C5VA 4Y6SA 3MT7A 4F1KA 1RRGA 4Q4LA 2D13A 5H2FC 1G2HA 2CSUA 5LUBA 2J3EA 3LQ1A 1YQGA 3GNTA 3KUKA 3D4BA 4ZO4A 4PG6A 5CQEA 3H0EA 3LFTA 2YYSA 3LPCA 2CL7X 3CRMA 2STTA 2UUOA 1GGJA 5IVPA 3CEMA 1ZAKA 3UXHA 3T1YB 4JU8A 5GP9A 1YE9A 4KIGA 2R2GA 4Q0MA 1TA4A 5L4SA 3LQ4A 2FW0A 3KKKA 2Z2ZA 4P4TA 2W37A 2ISCA 4BBJA 4B4WA 2IZ5A 3RYCB 1T9GS 4BU2A 1B00A 2C9NY 1BH6A 1QZEA 3UHJA 5CH3A 2YFKA 3L73D 4MDEA 1VL0A 5AVRB 4RFLA 1ATIA 2E37A 1L7XA 5HG0A 4EPWA 3LNCA 3K8ZA 1TIBA 5KVQA 4MIKA 2AXCA 1W9HA 4JJ8A 3KLNA 1JHHA 1O6CA 1OR7C 3HB0A 4ZCMA 5EIEA 2NUTB 3OT1A 4JUIA 1R0CA 1VHJA 2Q62A 2FEMA 3WDLA 5D6EA 1T8TA 5CJPA 1L4GA 1CG6A 3JYOA 4EB8A 2O4CA 1XTUA 4IRHA 2R00C 1DAFA 3TE6A 4XCVA 2AV6A 3NBQA 4CDMA 5CCHA 1IQUA 1SQXJ 2G7MC 3ZUPA 5LDHA 3VO8A 4NYIR 3ZIAA 4UC0A 2XUFA 1C8KA 5C1DA 1I27A 1KQGB 4CHGA 3IFMA 2GO7A 1V25A 3L71G 2P0AA 4P7BA 5TY0A 1LFPA 3OKAA 3SQOA 1QCZA 2ZKIA 1DD4A 3FPKA 5ERIA 1DXYA 2B2XA 5ALLA 5CCHC 3TIVA 3PEEA 4HGRA 3HU1A 1VPEA 3UV6A 4L22A 3D43A 5FTKA 3P7NA 3DZFA 3GPDG 2BMDA 3WU2E 3S16J 3A2MA 4H35A 2PQMA 3OQJA 5E7MA 1RXYA 4YJ2A 5KAFE 1SO8A 1ULHA 3KQNA 3HRTA 4HDMB 4GT1A 1B73A 4YONB 3H5WA 4LE1A 1MB3A 4NV3A 3VR5A 4PLFA 1P84E 1EVQA 4DY6A 1EZZA 4Y2HA 3GO5A 4U3FE 4YQYA 2F3RA 3FWYA 3A1CA 2DMUA 3JAWB 2ZR9A 3BFXA 1ZEMA 1UC8A 4HY3A 4HYQA 4X92A 1WKCA 2H7CA 3TVYA 3BZUA 1FS6A 2QVZX 3A36A 2B63J 1QDLB 3ZD9A 2QL9A 4XWYA 3LSPA 5IHXA 1GGFA 1FFBA 3PIIA 3S14J 3AQIA 2LIVA 4EG3A 5DM7F 3KB6A 1GKYA 4KXNA 4HNGA 5BT8A 1YA8A 5F1RA 5JVGF 1JAXA 3RVSA 3SJUA 3TGUG 3SVTA 4X5OA 4P35A 5H20A 1YYCA 2CKMA 4JJZA 4WY4B 2JGAA 5F9FA 1TT5A 1FZGA 4Z86A 4H2DA 3QK7A 1UBKS 1HTLC 1K8YB 4Y17A 1UM9B 1KZ6A 3IQDB 3RROA 3K7EA 1RF1B 2XUBA 4BIIA 2VHWA 1WKVA 3G1MA 1P75A 1SCNE 5EWJB 4AWBA 5KJ7A 3E22A 2ECFA 4YP1A 2DE0X 3LY5A 3KTFA 3ZCPA 1W36D 5AVOA 2M8EA 4JI0B 1K1EA 1RI3A 3OE7A 1NC1A 1W47A 3GA5A 5JARA 1YS4A 3S29A 1R7RA 4RLFA 1GCAA 3CEAA 3KJEA 1AKEA 3U4MA 1X7WA 1Z0ZA 3X1KA 5TQ2B 3L6CA 4W63A 2JLAA 5FPSA 3Q8XB 3GBVA 1XZAA 3AJAA 1RF0A 3C7AA 1D2CA 2EGGA 4JCCA 1JHOA 1G5RA 4TLMB 2LBPA 1MAUA 4DUYB 1ODCA 1PR5A 1E1CB 2VBZA 3QPVA 3KQGA 2JVIA 1ZXLA 5TQ0B 2C7RA 2CYCA 4MS4A 3HKCA 3VO9A 4PAGA 2F00A 4BE0A 2HWYA 1ZRTE 3GRUA 3JYHA 3F89A 1C1HA 2DPMA 4NZMA 5BNTA 4LMYA 4BJ6C 1T0FC 3UHFA 3V1YA 1O6ZA 2QQAA 2XAFA 4I14A 1OLOA 4M74A 2UZ3A 2MR6A 2I6GA 1TK3A 3SYMA 2FPRA 2NM0A 2W48A 2PO7A 3LSRA 1VPTA 4EI9A 5G02A 3VJRA 1T2KC 1NAYA 3K1ZA 1A98A 4NHJA 2RC4A 3CVOA 2JH3A 2RONA 1W2GA 3HJRA 3SKVA 4PAMA 1EFRA 1W0JA 2I34A 2OHHA 1HUCA 3F97A 5FKNA 3GGJA 5CBPB 4BMSA 1U3WA 3ISTA 4TLBA 1QGOA 3KQLA 1C3LA 1F48A 2FWMX 4UZFA 4LBYA 2H9YA 2DQKA 3RSLA 2HO5A 4K28A 3I5YA 4Q9KA 4FCYA 4PGGA 3SAJA 1FXWA 5BWMA 4MVYA 2YINC 4FSHA 2X4DA 1VCOA 4P84A 2IEAA 1ZGHA 3N6RA 1RKQA 5BNFA 3CXHE 2DA1A 3ZVLA 3A0HE 3GAMA 3EZ7A 1XX6A 1T0BA 3SFVA 1FDWA 4NATA 3B8EA 2XE8A 4G1BA 4DJTA 1CZHA 4JLWA 4X63A 1UKEA 5JNVA 3AEKB 4IGIA 2DA4A 4AKEA 1VIMA 1J0RA 4AS2A 4H4KC 5EG0A 4GOJA 2QKYA 1EX9A 4BWFB 2FUCA 3GFJA 3S2DJ 2NU9A 3FNIA 5DHFA 4RXTA 3ZWYA 2QKMB 2VQLA 1BTOA 4X64B 4P98A 4JV5B 5FPYA 1RH5B 1B4DA 2V4ZA 3F6OA 1JJIA 4LXUA 4EW3A 4KMRA 4D3YA 5ELXA 5EE3A 1NLUA 2HODA 1FDOA 4CT4B 2POQX 2BYVE 5DM70 3I2YX 3OZEA 1XAGA 1JILA 2B87B 4MITA 4H1HA 3WGYA 1RWKA 2RB4A 1IG7A 1UP7A 4CNBA 4DQ2A 4ILEA 4IXDA 5L6LB 4XLHA 3KUUA 2WHEA 1ENPA 5AIAA 2JEOA 4IY1A 8ABPA 1X4OA 2B1RA 1HT1E 2DECA 1UG0A 4TSRA 1T1RA 1E1YA 3WGMA 4KMFA 4RTNA 3EFGA 4RZHA 3ZY4A 5AVXA 1T5LA 2FEWB 3GLIE 4Q9JA 2L7MP 1P18A 5EIAA 2BP7A 2A2ZA 4AP5A 2AOUB 1GV5A 5D00A 1J9GA 4R84A 1TF2A 5EZQA 1HDEA 5J59A 4L9TA 2RHJA 3BEDA 3CLQA 4RPJA 5K0SA 1GPBA 3I54A 3X1DA 4ZZ2A 2C31A 3NVAA 3WGLA 1G38A 4BFUA 2ZJZA 3UC9A 4AJKA 2RHRA 4XIIA 2CQQA 2CDCA 2DEUA 2IODA 4YFXF 3K4CA 2EBHX 3ZK8A 4K1LA 4F5DA 5FWYB 1ML3A 2DAPA 3B1JA 4X8HA 4TMKA 4X71A 2FYUD 1E7YA 4QTUB 3RL0g 2AKEA 3DHVA 2FHSA 1QPIA 1N4DA 5ESWA 5DU2A 5JJBA 1U6JA 5B3JA 1WUHS 5H6RA 3CG4A 2O61A 3GMDA 2N46A 1NVFA 2Z8YM 1U0LA 2E0IA 1GFSA 4OP3A 3P2OA 3CO6C 2IGNA 5EYPB 4FDUA 1T1SA 3OCYA 3O9MA 4J1TC 5KOYA 3HFSA 3HSFA 1OD6A 3ZCTA 4BE7B 3WLQA 4ZU6X 5BV1A 4ZI5A 3TR6A 1IVSA 5JDIA 4XGKA 1PGNA 4ZVPA 3VC1A 3VNAA 4WCGA 1HE8B 1LSUA 2L0KA 2E76C 1M0WA 5IH3A 1OSNA 2CWWA 3IEPA 4UBLA 2VYND 4E12A 1XZMA 1MH1A 2DULA 2XVAA 3R75A 3FM9A 4G5OA 2W2TA 4BL0B 5AW5A 4DCPA 1NSFA 1VI2A 5TMPA 3HUEA 5BUCA 4OP2A 4LD5A 2ELKA 1YIOA 1D8TA 2IOHA 3C43A 3OJFA 4K2AA 4LWPA 1MEOA 1H94A 1DI0A 3CPHA 3A27A 3SFDC 1X7GA 5IHPA 2O05A 4AKGA 3R5SA 5PNTA 4O1MA 1W6RA 3N3BC 3MT9A 5CEJA 4JX8A 4GOKA 1FZCB 4F4DA 3RODA 5ESRA 1ABBA 2H1FA 1DCTA 1Y98A 1JSXA 5EJ7A 4O8ZA 4AJ1A 4ALKA 1R0XA 2IX9A 4DKJA 5D3MA 3L1VA 1JBKA 4MW6A 1FTWA 1PR4A 1DU6A 5J4YA 4XJTA 3IQFA 4WHMA 4EEFG 2Z2YA 1DRKA 4TMTA 4PV1D 5GADl 4CUZA 2ZWOA 2HYIC 4EBBA 1JKRC 1HF9A 4CQMD 3WU1B 3ZCOA 3T7DA 4PWYA 1TTYA 1EDLA 3GTJJ 1D5YA 1IBSA 3PQCA 4H60A 4B34A 4MWCA 1M2KA 3VR0A 2ZXIA 1C0LA 1T3GA 2QEXP 2O8FB 1P7WA 1P92A 3OU6A 4NJEA 3H2KA 3PITA 4YMGA 2IVZA 1JLRA 2X9QA 4D7AA 3PVCA 2BUAA 4B1FA 1R5ID 5B1EA 5I9IA 4PPQA 3AB3A 4C6HA 3X3HA 1QVZA 4QQNA 4D8YA 3ZDCA 3GEZA 2ZAOA 1OCCH 4Y0AA 3A3KA 4A0GA 1DMSA 3EGIA 5EWLB 1NLFA 3TJMA 5IF3A 3ICWA 5T6MA 4OFXA 1XCVA 3QPSA 3OBIA 4GPBA 3OMLA 3JZAA 4KBYA 3T3OA 1ID8A 1XJCA 1EA7A 1M0TA 3A03A 4HDSA 2IU0A 4ZOAA 2PMHA 1QS0B 4R51A 3M3PA 4GGMX 1UK6A 1NQAO 3LZDA 1G3TA 2YXRB 1YJNI 4AXXA 5F0CA 3WHCA 2DWPA 1J8QA 2ZQZA 4RADA 1NU1J 3U59A 2CMHA 3JSXA 1M0EA 1KBZA 2DFNA 4F7ZA 2EATA 3E23A 3ZD8A 3ZX5A 2O3QA 1ZN8A 2XD9A 4KQ9A 4BLTA 1J1ZA 1DC7A 1QM5A 1OYVA 4ZJYA 4OATA 2QGFA 5M5BA 4X44A 4X6XA 4AQYB 4Y7DA 5BW5A 4OY3A 1C41A 2M5AA 2BEUB 4RJ2A 4O1HA 3CISA 4PZEA 4YRP