1ZR5A

Crystal structure of the macro-domain of human core histone variant macroh2a1.2
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
189
structure length
189
Chain Sequence
DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2AFY protein
publication title Splicing regulates NAD metabolite binding to histone macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 59
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1zr5A00
3IJ3A 3GPGA 4KYBA 3EWQA 4ESSA 3EJFA 5FSXA 3GPOA 3GQEA 5CBMA 4J5RA 1ZR5A 3SIHA 3T8WA 1LAMA 2FXKA 4R7MA 4JVVA 2ACFA 4K3NA 4K0CA 1TXZA 5HOLA 5AILA 2EWBA 2DX6A 2FG1A 1TY8A 4IQYA 4R76A 3JZTA 4JGKA 2FAVA 3GPQA 2J9AA 3GQOA 3H8FA 2XD7A 2LGRA 1LAPA 4ZY0A 2EEEA 5FSVA 4JCAA 4ZY2A 5CB3A 4J5SA 1GYTA 3Q6ZA 3EJGA 3ETIA 3V2BA 5HIHA 4ZY1A 4ZI6A 4JLLA 2BFQA 2VRIA 3KZWA 5FSUA 3JRUA 4TU0A 3IIDA 4X2TA 4D86A 3KQZA 4J4ZA 1YD9A 5CB5A 1BLLE 3SIIA 4ZX8A 1LCPA 4GUAA 4UMLA 1ZR3A 3VFQA 1SPVA 2L8RA 4J5QA 4R6TA 2X47A 3EWOA 5CMSA 3H8GA 3IIFA 4KSIA 2AFCA 5D8NA 4GVWA 3SIGA 2BFRA 4ABKA 1BPMA 1NJRA 1VHUA 3Q71A 3KR4A 3EWRA 3SIJA 4ETJA 3KQXA 1LANA 5FSZA 3EWPA 3PEIA 4GVVA 1HJZA 3EKEA 4ABLA 5FSYA 4ETKA 3EW5A 4ZX9A 1BPNA 3KR5A 5DUSA 3V45A 4ZYQA 3H8EA 5E3BA
chains in the Genus database with same CATH superfamily
3IJ3A 3GPGA 4KYBA 3EWQA 4ESSA 3EJFA 5FSXA 3GPOA 3GQEA 5CBMA 4J5RA 1ZR5A 3SIHA 3T8WA 2WCTA 1LAMA 2FXKA 4R7MA 4JVVA 2ACFA 4K3NA 4K0CA 1TXZA 5HOLA 5AILA 2EWBA 2DX6A 2FG1A 1TY8A 2JZFA 4IQYA 4R76A 3JZTA 4JGKA 2FAVA 3GPQA 2J9AA 3GQOA 3H8FA 2XD7A 2LGRA 1LAPA 4ZY0A 2EEEA 5FSVA 4JCAA 4ZY2A 2JZDA 5CB3A 4J5SA 1GYTA 3Q6ZA 3EJGA 3ETIA 3V2BA 5HIHA 4ZY1A 4ZI6A 4JLLA 2BFQA 2VRIA 3KZWA 5FSUA 3JRUA 4TU0A 3IIDA 2RNKA 4X2TA 4D86A 3KQZA 4J4ZA 1YD9A 5CB5A 1BLLE 3SIIA 4ZX8A 1LCPA 4GUAA 4UMLA 1ZR3A 3VFQA 1SPVA 2W2GA 2L8RA 4J5QA 4R6TA 2X47A 3EWOA 5CMSA 3H8GA 3IIFA 4KSIA 2AFCA 5D8NA 4GVWA 3SIGA 2BFRA 4ABKA 1BPMA 1NJRA 1VHUA 3Q71A 3KR4A 3EWRA 3SIJA 4ETJA 3KQXA 1LANA 2JZEA 5FSZA 3EWPA 3PEIA 4GVVA 1HJZA 3EKEA 4ABLA 5FSYA 4ETKA 3EW5A 4ZX9A 1BPNA 3KR5A 5DUSA 3V45A 4ZYQA 2KQVA 3H8EA 5E3BA
chains in the Genus database with same CATH topology
3IJ3A 3GPGA 4KYBA 3EWQA 4ESSA 3EJFA 5FSXA 3GPOA 3GQEA 5CBMA 4J5RA 1ZR5A 3SIHA 3T8WA 1LAMA 2FXKA 4R7MA 4JVVA 2ACFA 4K3NA 4K0CA 1TXZA 5HOLA 5AILA 2EWBA 2DX6A 2FG1A 1TY8A 4IQYA 4R76A 3JZTA 4JGKA 2FAVA 3GPQA 2J9AA 3GQOA 3H8FA 2XD7A 2LGRA 1LAPA 4ZY0A 2EEEA 5FSVA 4JCAA 4ZY2A 5CB3A 4J5SA 1GYTA 3Q6ZA 3EJGA 3ETIA 3V2BA 5HIHA 4ZY1A 4ZI6A 4JLLA 2BFQA 2VRIA 3KZWA 5FSUA 3JRUA 4TU0A 3IIDA 4X2TA 4D86A 3KQZA 4J4ZA 1YD9A 5CB5A 1BLLE 3SIIA 4ZX8A 1LCPA 4GUAA 4UMLA 1ZR3A 3VFQA 1SPVA 2L8RA 4J5QA 4R6TA 2X47A 3EWOA 5CMSA 3H8GA 3IIFA 4KSIA 2AFCA 5D8NA 4GVWA 3SIGA 2BFRA 4ABKA 1BPMA 1NJRA 1VHUA 3Q71A 3KR4A 3EWRA 3SIJA 4ETJA 3KQXA 1LANA 5FSZA 3EWPA 3PEIA 4GVVA 1HJZA 3EKEA 4ABLA 5FSYA 4ETKA 3EW5A 4ZX9A 1BPNA 3KR5A 5DUSA 3V45A 4ZYQA 3H8EA 5E3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ3 A;  3GPG A;  4KYB A;  3EWQ A;  4ESS A;  3EJF A;  5FSX A;  3GPO A;  3GQE A;  5CBM A;  4J5R A;  1ZR5 A;  3SIH A;  3T8W A;  1LAM A;  2FXK A;  4R7M A;  4JVV A;  2ACF A;  4K3N A;  4K0C A;  1TXZ A;  5HOL A;  5AIL A;  2EWB A;  2DX6 A;  2FG1 A;  1TY8 A;  4IQY A;  4R76 A;  3JZT A;  4JGK A;  2FAV A;  3GPQ A;  2J9A A;  3GQO A;  3H8F A;  2XD7 A;  2LGR A;  1LAP A;  4ZY0 A;  2EEE A;  5FSV A;  4JCA A;  4ZY2 A;  5CB3 A;  4J5S A;  1GYT A;  3Q6Z A;  3EJG A;  3ETI A;  3V2B A;  5HIH A;  4ZY1 A;  4ZI6 A;  4JLL A;  2BFQ A;  2VRI A;  3KZW A;  5FSU A;  3JRU A;  4TU0 A;  3IID A;  4X2T A;  4D86 A;  3KQZ A;  4J4Z A;  1YD9 A;  5CB5 A;  1BLL E;  3SII A;  4ZX8 A;  1LCP A;  4GUA A;  4UML A;  1ZR3 A;  3VFQ A;  1SPV A;  2L8R A;  4J5Q A;  4R6T A;  2X47 A;  3EWO A;  5CMS A;  3H8G A;  3IIF A;  4KSI A;  2AFC A;  5D8N A;  4GVW A;  3SIG A;  2BFR A;  4ABK A;  1BPM A;  1NJR A;  1VHU A;  3Q71 A;  3KR4 A;  3EWR A;  3SIJ A;  4ETJ A;  3KQX A;  1LAN A;  5FSZ A;  3EWP A;  3PEI A;  4GVV A;  1HJZ A;  3EKE A;  4ABL A;  5FSY A;  4ETK A;  3EW5 A;  4ZX9 A;  1BPN A;  3KR5 A;  5DUS A;  3V45 A;  4ZYQ A;  3H8E A;  5E3B A; 
#chains in the Genus database with same CATH topology
 3IJ3 A;  3GPG A;  4KYB A;  3EWQ A;  4ESS A;  3EJF A;  5FSX A;  3GPO A;  3GQE A;  5CBM A;  4J5R A;  1ZR5 A;  3SIH A;  3T8W A;  2WCT A;  1LAM A;  2FXK A;  4R7M A;  4JVV A;  2ACF A;  4K3N A;  4K0C A;  1TXZ A;  5HOL A;  5AIL A;  2EWB A;  2DX6 A;  2FG1 A;  1TY8 A;  2JZF A;  4IQY A;  4R76 A;  3JZT A;  4JGK A;  2FAV A;  3GPQ A;  2J9A A;  3GQO A;  3H8F A;  2XD7 A;  2LGR A;  1LAP A;  4ZY0 A;  2EEE A;  5FSV A;  4JCA A;  4ZY2 A;  2JZD A;  5CB3 A;  4J5S A;  1GYT A;  3Q6Z A;  3EJG A;  3ETI A;  3V2B A;  5HIH A;  4ZY1 A;  4ZI6 A;  4JLL A;  2BFQ A;  2VRI A;  3KZW A;  5FSU A;  3JRU A;  4TU0 A;  3IID A;  2RNK A;  4X2T A;  4D86 A;  3KQZ A;  4J4Z A;  1YD9 A;  5CB5 A;  1BLL E;  3SII A;  4ZX8 A;  1LCP A;  4GUA A;  4UML A;  1ZR3 A;  3VFQ A;  1SPV A;  2W2G A;  2L8R A;  4J5Q A;  4R6T A;  2X47 A;  3EWO A;  5CMS A;  3H8G A;  3IIF A;  4KSI A;  2AFC A;  5D8N A;  4GVW A;  3SIG A;  2BFR A;  4ABK A;  1BPM A;  1NJR A;  1VHU A;  3Q71 A;  3KR4 A;  3EWR A;  3SIJ A;  4ETJ A;  3KQX A;  1LAN A;  2JZE A;  5FSZ A;  3EWP A;  3PEI A;  4GVV A;  1HJZ A;  3EKE A;  4ABL A;  5FSY A;  4ETK A;  3EW5 A;  4ZX9 A;  1BPN A;  3KR5 A;  5DUS A;  3V45 A;  4ZYQ A;  2KQV A;  3H8E A;  5E3B A; 
#chains in the Genus database with same CATH homology
 3IJ3 A;  3GPG A;  4KYB A;  3EWQ A;  4ESS A;  3EJF A;  5FSX A;  3GPO A;  3GQE A;  5CBM A;  4J5R A;  1ZR5 A;  3SIH A;  3T8W A;  1LAM A;  2FXK A;  4R7M A;  4JVV A;  2ACF A;  4K3N A;  4K0C A;  1TXZ A;  5HOL A;  5AIL A;  2EWB A;  2DX6 A;  2FG1 A;  1TY8 A;  4IQY A;  4R76 A;  3JZT A;  4JGK A;  2FAV A;  3GPQ A;  2J9A A;  3GQO A;  3H8F A;  2XD7 A;  2LGR A;  1LAP A;  4ZY0 A;  2EEE A;  5FSV A;  4JCA A;  4ZY2 A;  5CB3 A;  4J5S A;  1GYT A;  3Q6Z A;  3EJG A;  3ETI A;  3V2B A;  5HIH A;  4ZY1 A;  4ZI6 A;  4JLL A;  2BFQ A;  2VRI A;  3KZW A;  5FSU A;  3JRU A;  4TU0 A;  3IID A;  4X2T A;  4D86 A;  3KQZ A;  4J4Z A;  1YD9 A;  5CB5 A;  1BLL E;  3SII A;  4ZX8 A;  1LCP A;  4GUA A;  4UML A;  1ZR3 A;  3VFQ A;  1SPV A;  2L8R A;  4J5Q A;  4R6T A;  2X47 A;  3EWO A;  5CMS A;  3H8G A;  3IIF A;  4KSI A;  2AFC A;  5D8N A;  4GVW A;  3SIG A;  2BFR A;  4ABK A;  1BPM A;  1NJR A;  1VHU A;  3Q71 A;  3KR4 A;  3EWR A;  3SIJ A;  4ETJ A;  3KQX A;  1LAN A;  5FSZ A;  3EWP A;  3PEI A;  4GVV A;  1HJZ A;  3EKE A;  4ABL A;  5FSY A;  4ETK A;  3EW5 A;  4ZX9 A;  1BPN A;  3KR5 A;  5DUS A;  3V45 A;  4ZYQ A;  3H8E A;  5E3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...