1ZR5A

Crystal structure of the macro-domain of human core histone variant macroh2a1.2
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
189
structure length
189
Chain Sequence
DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Splicing regulates NAD metabolite binding to histone macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords H2AFY protein
total genus 59
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1zr5A00
1YD9A 3GPGA 4ZYQA 3KQZA 5FSVA 1BPNA 4ZX9A 5FSZA 4KSIA 5DUSA 3T8WA 4ESSA 4GUAA 1BLLE 3EJFA 1TY8A 3IIDA 4ETJA 3KR4A 5CB3A 3V45A 2LGRA 1VHUA 1GYTA 4ETKA 2AFCA 4R7MA 3KR5A 4ZY2A 2J9AA 5HOLA 2FG1A 4TU0A 5AILA 1LAMA 4R6TA 3V2BA 4K3NA 3IJ3A 3PEIA 1LCPA 3Q6ZA 3SIJA 4ZY0A 3JZTA 2XD7A 4J5QA 3SIIA 2BFRA 1HJZA 5CB5A 3EWOA 3SIHA 4JGKA 2DX6A 4K0CA 3EWQA 2EEEA 5HIHA 4ZY1A 2VRIA 4ZX8A 4ZI6A 1ZR5A 3GPOA 2BFQA 4GVWA 3KQXA 3KZWA 4IQYA 3JRUA 4GVVA 3EW5A 1NJRA 5E3BA 3SIGA 4ABKA 4J4ZA 4R76A 2EWBA 4J5SA 4ABLA 5FSXA 4J5RA 1LANA 4JLLA 1SPVA 3VFQA 1ZR3A 2X47A 5CBMA 1LAPA 3GQOA 5CMSA 5FSYA 3EWPA 3H8GA 4JCAA 1BPMA 2ACFA 3Q71A 4JVVA 4X2TA 3EWRA 4D86A 3GQEA 2FAVA 3GPQA 3H8FA 2FXKA 1TXZA 4UMLA 3H8EA 3ETIA 5D8NA 3EJGA 5FSUA 4KYBA 3EKEA 3IIFA 2L8RA
chains in the Genus database with same CATH superfamily
1YD9A 3GPGA 4ZYQA 3KQZA 5FSVA 1BPNA 4ZX9A 5FSZA 4KSIA 5DUSA 3T8WA 4ESSA 4GUAA 2RNKA 1BLLE 3EJFA 1TY8A 3IIDA 4ETJA 3KR4A 5CB3A 3V45A 2LGRA 1VHUA 1GYTA 4ETKA 2AFCA 4R7MA 3KR5A 4ZY2A 2JZEA 2J9AA 5HOLA 2FG1A 4TU0A 5AILA 1LAMA 4R6TA 3V2BA 4K3NA 3IJ3A 3PEIA 2W2GA 1LCPA 3Q6ZA 3SIJA 4ZY0A 3JZTA 2XD7A 4J5QA 3SIIA 2BFRA 1HJZA 5CB5A 3EWOA 3SIHA 4JGKA 2JZFA 2DX6A 4K0CA 3EWQA 2WCTA 2EEEA 5HIHA 4ZY1A 2VRIA 4ZX8A 4ZI6A 1ZR5A 3GPOA 2BFQA 4GVWA 3KQXA 3KZWA 4IQYA 3JRUA 4GVVA 3EW5A 1NJRA 5E3BA 3SIGA 4ABKA 4J4ZA 4R76A 2EWBA 4J5SA 4ABLA 5FSXA 4J5RA 1LANA 4JLLA 1SPVA 3VFQA 1ZR3A 2X47A 5CBMA 1LAPA 3GQOA 5CMSA 5FSYA 3EWPA 3H8GA 4JCAA 1BPMA 2JZDA 2ACFA 3Q71A 4JVVA 4X2TA 3EWRA 4D86A 3GQEA 2FAVA 3GPQA 3H8FA 2FXKA 1TXZA 4UMLA 2KQVA 3ETIA 3H8EA 5D8NA 3EJGA 5FSUA 4KYBA 3EKEA 3IIFA 2L8RA
chains in the Genus database with same CATH topology
1YD9A 3GPGA 4ZYQA 3KQZA 5FSVA 1BPNA 4ZX9A 5FSZA 4KSIA 5DUSA 3T8WA 4ESSA 4GUAA 1BLLE 3EJFA 1TY8A 3IIDA 4ETJA 3KR4A 5CB3A 3V45A 2LGRA 1VHUA 1GYTA 4ETKA 2AFCA 4R7MA 3KR5A 4ZY2A 2J9AA 5HOLA 2FG1A 4TU0A 5AILA 1LAMA 4R6TA 3V2BA 4K3NA 3IJ3A 3PEIA 1LCPA 3Q6ZA 3SIJA 4ZY0A 3JZTA 2XD7A 4J5QA 3SIIA 2BFRA 1HJZA 5CB5A 3EWOA 3SIHA 4JGKA 2DX6A 4K0CA 3EWQA 2EEEA 5HIHA 4ZY1A 2VRIA 4ZX8A 4ZI6A 1ZR5A 3GPOA 2BFQA 4GVWA 3KQXA 3KZWA 4IQYA 3JRUA 4GVVA 3EW5A 1NJRA 5E3BA 3SIGA 4ABKA 4J4ZA 4R76A 2EWBA 4J5SA 4ABLA 5FSXA 4J5RA 1LANA 4JLLA 1SPVA 3VFQA 1ZR3A 2X47A 5CBMA 1LAPA 3GQOA 5CMSA 5FSYA 3EWPA 3H8GA 4JCAA 1BPMA 2ACFA 3Q71A 4JVVA 4X2TA 3EWRA 4D86A 3GQEA 2FAVA 3GPQA 3H8FA 2FXKA 1TXZA 4UMLA 3H8EA 3ETIA 5D8NA 3EJGA 5FSUA 4KYBA 3EKEA 3IIFA 2L8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YD9 A;  3GPG A;  4ZYQ A;  3KQZ A;  5FSV A;  1BPN A;  4ZX9 A;  5FSZ A;  4KSI A;  5DUS A;  3T8W A;  4ESS A;  4GUA A;  1BLL E;  3EJF A;  1TY8 A;  3IID A;  4ETJ A;  3KR4 A;  5CB3 A;  3V45 A;  2LGR A;  1VHU A;  1GYT A;  4ETK A;  2AFC A;  4R7M A;  3KR5 A;  4ZY2 A;  2J9A A;  5HOL A;  2FG1 A;  4TU0 A;  5AIL A;  1LAM A;  4R6T A;  3V2B A;  4K3N A;  3IJ3 A;  3PEI A;  1LCP A;  3Q6Z A;  3SIJ A;  4ZY0 A;  3JZT A;  2XD7 A;  4J5Q A;  3SII A;  2BFR A;  1HJZ A;  5CB5 A;  3EWO A;  3SIH A;  4JGK A;  2DX6 A;  4K0C A;  3EWQ A;  2EEE A;  5HIH A;  4ZY1 A;  2VRI A;  4ZX8 A;  4ZI6 A;  1ZR5 A;  3GPO A;  2BFQ A;  4GVW A;  3KQX A;  3KZW A;  4IQY A;  3JRU A;  4GVV A;  3EW5 A;  1NJR A;  5E3B A;  3SIG A;  4ABK A;  4J4Z A;  4R76 A;  2EWB A;  4J5S A;  4ABL A;  5FSX A;  4J5R A;  1LAN A;  4JLL A;  1SPV A;  3VFQ A;  1ZR3 A;  2X47 A;  5CBM A;  1LAP A;  3GQO A;  5CMS A;  5FSY A;  3EWP A;  3H8G A;  4JCA A;  1BPM A;  2ACF A;  3Q71 A;  4JVV A;  4X2T A;  3EWR A;  4D86 A;  3GQE A;  2FAV A;  3GPQ A;  3H8F A;  2FXK A;  1TXZ A;  4UML A;  3H8E A;  3ETI A;  5D8N A;  3EJG A;  5FSU A;  4KYB A;  3EKE A;  3IIF A;  2L8R A; 
#chains in the Genus database with same CATH topology
 1YD9 A;  3GPG A;  4ZYQ A;  3KQZ A;  5FSV A;  1BPN A;  4ZX9 A;  5FSZ A;  4KSI A;  5DUS A;  3T8W A;  4ESS A;  4GUA A;  2RNK A;  1BLL E;  3EJF A;  1TY8 A;  3IID A;  4ETJ A;  3KR4 A;  5CB3 A;  3V45 A;  2LGR A;  1VHU A;  1GYT A;  4ETK A;  2AFC A;  4R7M A;  3KR5 A;  4ZY2 A;  2JZE A;  2J9A A;  5HOL A;  2FG1 A;  4TU0 A;  5AIL A;  1LAM A;  4R6T A;  3V2B A;  4K3N A;  3IJ3 A;  3PEI A;  2W2G A;  1LCP A;  3Q6Z A;  3SIJ A;  4ZY0 A;  3JZT A;  2XD7 A;  4J5Q A;  3SII A;  2BFR A;  1HJZ A;  5CB5 A;  3EWO A;  3SIH A;  4JGK A;  2JZF A;  2DX6 A;  4K0C A;  3EWQ A;  2WCT A;  2EEE A;  5HIH A;  4ZY1 A;  2VRI A;  4ZX8 A;  4ZI6 A;  1ZR5 A;  3GPO A;  2BFQ A;  4GVW A;  3KQX A;  3KZW A;  4IQY A;  3JRU A;  4GVV A;  3EW5 A;  1NJR A;  5E3B A;  3SIG A;  4ABK A;  4J4Z A;  4R76 A;  2EWB A;  4J5S A;  4ABL A;  5FSX A;  4J5R A;  1LAN A;  4JLL A;  1SPV A;  3VFQ A;  1ZR3 A;  2X47 A;  5CBM A;  1LAP A;  3GQO A;  5CMS A;  5FSY A;  3EWP A;  3H8G A;  4JCA A;  1BPM A;  2JZD A;  2ACF A;  3Q71 A;  4JVV A;  4X2T A;  3EWR A;  4D86 A;  3GQE A;  2FAV A;  3GPQ A;  3H8F A;  2FXK A;  1TXZ A;  4UML A;  2KQV A;  3ETI A;  3H8E A;  5D8N A;  3EJG A;  5FSU A;  4KYB A;  3EKE A;  3IIF A;  2L8R A; 
#chains in the Genus database with same CATH homology
 1YD9 A;  3GPG A;  4ZYQ A;  3KQZ A;  5FSV A;  1BPN A;  4ZX9 A;  5FSZ A;  4KSI A;  5DUS A;  3T8W A;  4ESS A;  4GUA A;  1BLL E;  3EJF A;  1TY8 A;  3IID A;  4ETJ A;  3KR4 A;  5CB3 A;  3V45 A;  2LGR A;  1VHU A;  1GYT A;  4ETK A;  2AFC A;  4R7M A;  3KR5 A;  4ZY2 A;  2J9A A;  5HOL A;  2FG1 A;  4TU0 A;  5AIL A;  1LAM A;  4R6T A;  3V2B A;  4K3N A;  3IJ3 A;  3PEI A;  1LCP A;  3Q6Z A;  3SIJ A;  4ZY0 A;  3JZT A;  2XD7 A;  4J5Q A;  3SII A;  2BFR A;  1HJZ A;  5CB5 A;  3EWO A;  3SIH A;  4JGK A;  2DX6 A;  4K0C A;  3EWQ A;  2EEE A;  5HIH A;  4ZY1 A;  2VRI A;  4ZX8 A;  4ZI6 A;  1ZR5 A;  3GPO A;  2BFQ A;  4GVW A;  3KQX A;  3KZW A;  4IQY A;  3JRU A;  4GVV A;  3EW5 A;  1NJR A;  5E3B A;  3SIG A;  4ABK A;  4J4Z A;  4R76 A;  2EWB A;  4J5S A;  4ABL A;  5FSX A;  4J5R A;  1LAN A;  4JLL A;  1SPV A;  3VFQ A;  1ZR3 A;  2X47 A;  5CBM A;  1LAP A;  3GQO A;  5CMS A;  5FSY A;  3EWP A;  3H8G A;  4JCA A;  1BPM A;  2ACF A;  3Q71 A;  4JVV A;  4X2T A;  3EWR A;  4D86 A;  3GQE A;  2FAV A;  3GPQ A;  3H8F A;  2FXK A;  1TXZ A;  4UML A;  3H8E A;  3ETI A;  5D8N A;  3EJG A;  5FSU A;  4KYB A;  3EKE A;  3IIF A;  2L8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...