1ZR5A

Crystal structure of the macro-domain of human core histone variant macroh2a1.2
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
189
structure length
189
Chain Sequence
DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Splicing regulates NAD metabolite binding to histone macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords H2AFY protein
total genus 59
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1zr5A00
1LCPA 3EWPA 2LGRA 1ZR5A 2EWBA 2X47A 1SPVA 4D86A 3EKEA 1LAPA 4R7MA 3IJ3A 2VRIA 2FAVA 4X2TA 5FSZA 2FXKA 3GPGA 2AFCA 5CMSA 3Q6ZA 4K0CA 4ZX8A 1ZR3A 5DUSA 3IIDA 4ETJA 3VFQA 3KR4A 4R76A 4J5RA 3ETIA 4ZI6A 3H8EA 1HJZA 2BFRA 2L8RA 3EJFA 1TY8A 3SIGA 4ZY0A 1BLLE 2EEEA 3EWOA 4ZYQA 4JGKA 3V45A 4ETKA 5AILA 2FG1A 3EJGA 4JLLA 5FSYA 3KZWA 4GVVA 2ACFA 3EWQA 3Q71A 4GUAA 4ABLA 1TXZA 4UMLA 2XD7A 4J5SA 3GQOA 3H8FA 3SIJA 4IQYA 4ZX9A 2BFQA 3GQEA 4R6TA 3V2BA 4ZY1A 5CB3A 1YD9A 4JCAA 4GVWA 5CB5A 4TU0A 3GPOA 4JVVA 3JZTA 3JRUA 5FSXA 1BPMA 5CBMA 2DX6A 3KQXA 5HIHA 5D8NA 1VHUA 3KQZA 5FSUA 1LANA 4KSIA 5E3BA 4J4ZA 3SIIA 5FSVA 3T8WA 3GPQA 4ZY2A 1GYTA 1LAMA 3PEIA 4KYBA 4ESSA 2J9AA 3H8GA 1NJRA 3IIFA 1BPNA 4ABKA 3SIHA 4K3NA 5HOLA 3KR5A 4J5QA 3EW5A 3EWRA
chains in the Genus database with same CATH superfamily
1LCPA 3EWPA 2LGRA 1ZR5A 2EWBA 2X47A 1SPVA 4D86A 3EKEA 1LAPA 4R7MA 3IJ3A 2VRIA 2FAVA 4X2TA 5FSZA 2FXKA 3GPGA 2AFCA 5CMSA 3Q6ZA 4K0CA 4ZX8A 1ZR3A 5DUSA 3IIDA 4ETJA 3VFQA 3KR4A 4R76A 4J5RA 3ETIA 4ZI6A 3H8EA 1HJZA 2BFRA 2L8RA 3EJFA 1TY8A 3SIGA 4ZY0A 1BLLE 2EEEA 3EWOA 4ZYQA 4JGKA 3V45A 4ETKA 2WCTA 5AILA 2FG1A 3EJGA 4JLLA 5FSYA 3KZWA 4GVVA 2ACFA 3EWQA 3Q71A 4GUAA 4ABLA 1TXZA 2JZFA 4UMLA 2XD7A 4J5SA 3GQOA 3H8FA 3SIJA 4IQYA 4ZX9A 2BFQA 3GQEA 4R6TA 3V2BA 4ZY1A 5CB3A 1YD9A 4JCAA 4GVWA 5CB5A 2RNKA 4TU0A 3GPOA 4JVVA 3JZTA 3JRUA 5FSXA 1BPMA 5CBMA 2DX6A 3KQXA 5HIHA 2W2GA 5D8NA 1VHUA 3KQZA 5FSUA 1LANA 4KSIA 5E3BA 4J4ZA 3SIIA 5FSVA 3T8WA 3GPQA 4ZY2A 1GYTA 1LAMA 3PEIA 4KYBA 2JZEA 4ESSA 2J9AA 3H8GA 1NJRA 3IIFA 2JZDA 1BPNA 4ABKA 3SIHA 4K3NA 5HOLA 3KR5A 4J5QA 3EW5A 3EWRA 2KQVA
chains in the Genus database with same CATH topology
1LCPA 3EWPA 2LGRA 1ZR5A 2EWBA 2X47A 1SPVA 4D86A 3EKEA 1LAPA 4R7MA 3IJ3A 2VRIA 2FAVA 4X2TA 5FSZA 2FXKA 3GPGA 2AFCA 5CMSA 3Q6ZA 4K0CA 4ZX8A 1ZR3A 5DUSA 3IIDA 4ETJA 3VFQA 3KR4A 4R76A 4J5RA 3ETIA 4ZI6A 3H8EA 1HJZA 2BFRA 2L8RA 3EJFA 1TY8A 3SIGA 4ZY0A 1BLLE 2EEEA 3EWOA 4ZYQA 4JGKA 3V45A 4ETKA 5AILA 2FG1A 3EJGA 4JLLA 5FSYA 3KZWA 4GVVA 2ACFA 3EWQA 3Q71A 4GUAA 4ABLA 1TXZA 4UMLA 2XD7A 4J5SA 3GQOA 3H8FA 3SIJA 4IQYA 4ZX9A 2BFQA 3GQEA 4R6TA 3V2BA 4ZY1A 5CB3A 1YD9A 4JCAA 4GVWA 5CB5A 4TU0A 3GPOA 4JVVA 3JZTA 3JRUA 5FSXA 1BPMA 5CBMA 2DX6A 3KQXA 5HIHA 5D8NA 1VHUA 3KQZA 5FSUA 1LANA 4KSIA 5E3BA 4J4ZA 3SIIA 5FSVA 3T8WA 3GPQA 4ZY2A 1GYTA 1LAMA 3PEIA 4KYBA 4ESSA 2J9AA 3H8GA 1NJRA 3IIFA 1BPNA 4ABKA 3SIHA 4K3NA 5HOLA 3KR5A 4J5QA 3EW5A 3EWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCP A;  3EWP A;  2LGR A;  1ZR5 A;  2EWB A;  2X47 A;  1SPV A;  4D86 A;  3EKE A;  1LAP A;  4R7M A;  3IJ3 A;  2VRI A;  2FAV A;  4X2T A;  5FSZ A;  2FXK A;  3GPG A;  2AFC A;  5CMS A;  3Q6Z A;  4K0C A;  4ZX8 A;  1ZR3 A;  5DUS A;  3IID A;  4ETJ A;  3VFQ A;  3KR4 A;  4R76 A;  4J5R A;  3ETI A;  4ZI6 A;  3H8E A;  1HJZ A;  2BFR A;  2L8R A;  3EJF A;  1TY8 A;  3SIG A;  4ZY0 A;  1BLL E;  2EEE A;  3EWO A;  4ZYQ A;  4JGK A;  3V45 A;  4ETK A;  5AIL A;  2FG1 A;  3EJG A;  4JLL A;  5FSY A;  3KZW A;  4GVV A;  2ACF A;  3EWQ A;  3Q71 A;  4GUA A;  4ABL A;  1TXZ A;  4UML A;  2XD7 A;  4J5S A;  3GQO A;  3H8F A;  3SIJ A;  4IQY A;  4ZX9 A;  2BFQ A;  3GQE A;  4R6T A;  3V2B A;  4ZY1 A;  5CB3 A;  1YD9 A;  4JCA A;  4GVW A;  5CB5 A;  4TU0 A;  3GPO A;  4JVV A;  3JZT A;  3JRU A;  5FSX A;  1BPM A;  5CBM A;  2DX6 A;  3KQX A;  5HIH A;  5D8N A;  1VHU A;  3KQZ A;  5FSU A;  1LAN A;  4KSI A;  5E3B A;  4J4Z A;  3SII A;  5FSV A;  3T8W A;  3GPQ A;  4ZY2 A;  1GYT A;  1LAM A;  3PEI A;  4KYB A;  4ESS A;  2J9A A;  3H8G A;  1NJR A;  3IIF A;  1BPN A;  4ABK A;  3SIH A;  4K3N A;  5HOL A;  3KR5 A;  4J5Q A;  3EW5 A;  3EWR A; 
#chains in the Genus database with same CATH topology
 1LCP A;  3EWP A;  2LGR A;  1ZR5 A;  2EWB A;  2X47 A;  1SPV A;  4D86 A;  3EKE A;  1LAP A;  4R7M A;  3IJ3 A;  2VRI A;  2FAV A;  4X2T A;  5FSZ A;  2FXK A;  3GPG A;  2AFC A;  5CMS A;  3Q6Z A;  4K0C A;  4ZX8 A;  1ZR3 A;  5DUS A;  3IID A;  4ETJ A;  3VFQ A;  3KR4 A;  4R76 A;  4J5R A;  3ETI A;  4ZI6 A;  3H8E A;  1HJZ A;  2BFR A;  2L8R A;  3EJF A;  1TY8 A;  3SIG A;  4ZY0 A;  1BLL E;  2EEE A;  3EWO A;  4ZYQ A;  4JGK A;  3V45 A;  4ETK A;  2WCT A;  5AIL A;  2FG1 A;  3EJG A;  4JLL A;  5FSY A;  3KZW A;  4GVV A;  2ACF A;  3EWQ A;  3Q71 A;  4GUA A;  4ABL A;  1TXZ A;  2JZF A;  4UML A;  2XD7 A;  4J5S A;  3GQO A;  3H8F A;  3SIJ A;  4IQY A;  4ZX9 A;  2BFQ A;  3GQE A;  4R6T A;  3V2B A;  4ZY1 A;  5CB3 A;  1YD9 A;  4JCA A;  4GVW A;  5CB5 A;  2RNK A;  4TU0 A;  3GPO A;  4JVV A;  3JZT A;  3JRU A;  5FSX A;  1BPM A;  5CBM A;  2DX6 A;  3KQX A;  5HIH A;  2W2G A;  5D8N A;  1VHU A;  3KQZ A;  5FSU A;  1LAN A;  4KSI A;  5E3B A;  4J4Z A;  3SII A;  5FSV A;  3T8W A;  3GPQ A;  4ZY2 A;  1GYT A;  1LAM A;  3PEI A;  4KYB A;  2JZE A;  4ESS A;  2J9A A;  3H8G A;  1NJR A;  3IIF A;  2JZD A;  1BPN A;  4ABK A;  3SIH A;  4K3N A;  5HOL A;  3KR5 A;  4J5Q A;  3EW5 A;  3EWR A;  2KQV A; 
#chains in the Genus database with same CATH homology
 1LCP A;  3EWP A;  2LGR A;  1ZR5 A;  2EWB A;  2X47 A;  1SPV A;  4D86 A;  3EKE A;  1LAP A;  4R7M A;  3IJ3 A;  2VRI A;  2FAV A;  4X2T A;  5FSZ A;  2FXK A;  3GPG A;  2AFC A;  5CMS A;  3Q6Z A;  4K0C A;  4ZX8 A;  1ZR3 A;  5DUS A;  3IID A;  4ETJ A;  3VFQ A;  3KR4 A;  4R76 A;  4J5R A;  3ETI A;  4ZI6 A;  3H8E A;  1HJZ A;  2BFR A;  2L8R A;  3EJF A;  1TY8 A;  3SIG A;  4ZY0 A;  1BLL E;  2EEE A;  3EWO A;  4ZYQ A;  4JGK A;  3V45 A;  4ETK A;  5AIL A;  2FG1 A;  3EJG A;  4JLL A;  5FSY A;  3KZW A;  4GVV A;  2ACF A;  3EWQ A;  3Q71 A;  4GUA A;  4ABL A;  1TXZ A;  4UML A;  2XD7 A;  4J5S A;  3GQO A;  3H8F A;  3SIJ A;  4IQY A;  4ZX9 A;  2BFQ A;  3GQE A;  4R6T A;  3V2B A;  4ZY1 A;  5CB3 A;  1YD9 A;  4JCA A;  4GVW A;  5CB5 A;  4TU0 A;  3GPO A;  4JVV A;  3JZT A;  3JRU A;  5FSX A;  1BPM A;  5CBM A;  2DX6 A;  3KQX A;  5HIH A;  5D8N A;  1VHU A;  3KQZ A;  5FSU A;  1LAN A;  4KSI A;  5E3B A;  4J4Z A;  3SII A;  5FSV A;  3T8W A;  3GPQ A;  4ZY2 A;  1GYT A;  1LAM A;  3PEI A;  4KYB A;  4ESS A;  2J9A A;  3H8G A;  1NJR A;  3IIF A;  1BPN A;  4ABK A;  3SIH A;  4K3N A;  5HOL A;  3KR5 A;  4J5Q A;  3EW5 A;  3EWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...