1ZRFA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 64
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrfA01
4O9GA 2EV0A 3RKWA 2M30A 5EFUA 4LJZF 2EV5A 4NVPA 3V8JA 2GH2A 2L4AA 4G8XA 5I0SA 1KGSA 3BJAA 4IRHA 3NL1A 2ZJ2A 1MJ9A 2DK8A 4XFFA 2WV0A 1WWXA 1O7LA 4E2GA 4MH0E 3F3XA 1U78A 3LWCA 4YIIA 1TQPA 3CJXA 2ADUA 2UZKA 3F22A 1RTVA 1YTYA 4IJAA 4O3MA 3NVCA 1L3LA 4E2SA 3OOPA 1ZRCA 2A6EF 2UYBA 1T0FA 1IPJA 2MA3A 1SMTA 4ORFA 5FLJA 2PFBA 4M74A 1XGNA 1QO0D 4LFUA 2IPQX 1QQIA 1H1MA 2IXKA 3M9AA 3QP5A 2LF7A 4JTNA 2V1DA 4AVAA 2O03A 3HRUA 3R61A 2A68F 4KIBA 1JUHA 4R52A 3UKVA 4BNCA 2EAAA 3CUOA 2GIVA 2ISZA 3GO5A 2FA5A 1R22A 1WA4A 4QGLA 4UXNA 3CLOA 3S2WA 1I27A 3TO9A 4A5MA 2EVXA 4A5NA 1LB2A 3HUGA 1GQGA 4WX9A 3F8MA 1WKMA 5KK1A 2R3SA 1J2XA 1SD4A 1QZYA 5CU1A 4Q48A 4YNIA 4ZYGA 4E2QA 3WTTC 2UYAA 3DKWA 4RAZA 3V4GA 3VHRA 4IVNA 2V09A 5LHIA 4MV2A 4P96A 1Z9CA 4IEYA 4M9ZA 1HKSA 3SHRA 4EWEA 1FSHA 2Y75A 4MEYF 5CVJA 5H6RA 1DUXC 3QPHA 4IHSA 1S3JA 3QP6A 5ICCA 5H20A 3ZP5A 3E5XA 3K1PA 3REOA 5JCTA 1REPC 4JBAA 4Q0PA 4G9YA 1QNTA 1DZTA 5KHGA 3IRRA 3MZHA 5JVTA 1IZ1A 4LTAA 3LSTA 4Q29A 2O1QA 4EJWA 3K1NA 4GYGA 1VP6A 3IBMA 5F64A 4I09A 1Y9QA 1CAUA 3TO7A 3H7YA 1XDSA 2EA2A 3KLOA 5FPZA 2DBBA 2UWMA 5A2QZ 3KZYA 3BJOA 2KKOA 3EQLF 2IA0A 3EUHA 4GXOA 1XCBA 3S0MA 1MKMA 2CQKA 3F6VA 3FF5A 3R4KA 3F8CA 1LVAA 3R60A 1ZHFA 3P7NA 5FQ0A 1IF1A 5JR3A 2ESHA 1YFYA 4GYIA 1J7KA 2EWNA 5KHJA 3KP3A 1JHFA 5AVPA 4GULA 4BYYA 2M8EA 1W4MA 1UB9A 4QM9A 3RIRA 4L9VA 2EFOA 2ZMEB 3U11A 3MCZA 3SFZA 1LNWA 2EFWA 5E1XA 4HVRA 3DQVC 3GYDA 4KT5C 2E1CA 2OBPA 1C0WA 3WGHA 1X8EA 2NS0A 2PQ8A 4MNUA 5K8SA 1E17A 1W5TA 1EY2A 3KP2A 2CWEA 3P9IA 5ICFA 4LD5A 4S05A 1O3TA 2Z33A 1ON1A 2V6CA 2XL9A 2LKPA 3E3VA 1LKNA 1NZCA 2QUFA 3S7EA 4O6JA 3RJPA 4RB2C 2HWVA 5D4RA 4ZYDA 2VBXA 1DZRA 3BPXA 3NSTA 1YS6A 3U1DA 2QWWA 3V8KA 3H9AA 2F5CA 2HGCA 4S04A 3T1BA 2WC2A 3EYYA 3ERED 1YW9A 2DPUA 5HLIA 1RGSA 4PIYA 4WF2A 1X8MA 1FSEA 4ZZDA 4HSLA 2FQ3A 2X0LA 3ECHA 2HYGD 4O9EA 4G7ZF 1I1SA 3W6KB 1F1ZA 4IEQA 2XRNA 4UVCA 3VFZA 4P5OA 5DCMA 4XFGA 3WGIA 1LDDA 4I7HA 4RS8A 4MTEA 2F2EA 4EM1A 1BC7C 1NHAA 3B73A 2QYOA 2A3SA 2PFWA 3EQEA 2YX4A 3V8LA 1O5LA 1KQ0A 2HZTA 3KP7A 5BPDA 4I98B 1L0OC 1OD5A 1ZAOA 4BXUA 3FJSA 2Z3YA 2G7UA 2KIUA 3GBFA 1SFNA 3TNPB 1BIAA 1ZRRA 1ZG5A 4U88A 2IA1A 4EGYA 4XFCA 1XD7A 1HSJA 2Y48A 2QCSB 1WSUA 3MFKA 1RIOH 2X4HA 3IWZA 1UIJA 1YIOA 4YIFA 4M9SA 2FBIA 4OIOF 4XF4A 1RUNA 5D6FA 2RDPA 3O14A 1B4AA 3OV8A 5L3BA 4HN1A 4YARA 5LRSA 1LEBA 2EK5A 1Z6TA 1G4DA 5DUKA 4L5JA 1XE7A 1R1VA 2Q8KA 4P55A 1TBXA 4EROA 1FOKA 1BC8C 1VJ2A 1EV7A 6PAXA 3SCFA 3HRTA 1TW3A 3H1WA 3HRSA 2K7LA 2Q0OA 3GFJA 4MQVA 4A12A 1P6RA 3B02A 2IXCA 2LF8A 4A0XA 1T39A 2UXXA 4IESA 4N9HA 2Q0AA 2BBYA 4LLOA 4QX5A 1D8JA 1ZLKA 2GA1A 1T98A 2EFNA 2IRFG 1J3QA 3LWFA 2EFPA 1HW5A 4HQMA 2VC0A 2W84A 1U5TA 2EA4A 2VT2A 5BUVA 1B9NA 1WI9A 4FX4A 1OMIA 2LNBA 4DINB 3DP7A 3KLNA 5D4SA 1ZZ8A 1P4WA 1IUYA 1CX4A 3W6JB 1MD0A 3L2CA 4O5VA 5LEJA 2VOPA 2IP2A 3PNAA 3IKTA 3BCWA 2NRAC 2XLAA 2OAZA 3TOAA 4EJOA 2OD5A 4IEXA 4MGRA 4Y17A 2GQQA 4GGGA 5LHGA 4Q4ZF 1HSTA 3F8FA 1LR5A 3QU6A 2ACJA 3E6BA 1ZZ6A 3F72A 1O3SA 5F6FA 2HJIA 4AXOA 4UVBA 4Q0VA 4HMZA 4HF2A 5DDGA 2XL7A 5FPXA 1XSDA 2OA4A 3UKNA 1MDMA 1KU2A 3Q9SA 4Z07A 3LAGA 1R36A 2M45A 5ICEA 1XMAA 2PYTA 1TLHB 3COAC 1ZRFA 2AS5F 4B09A 1YLLA 3KFWX 4EQQA 4WZCA 3T8TA 3ELNA 1SFXA 3HHHA 2A07F 3DF8A 4HVOA 5HOOA 3R0JA 3T8RA 3F8BA 5FQ0B 2D45A 1TQIA 3J7AO 3RPQA 2XLFA 2P17A 3JAMZ 4IEVA 3MQ0A 4XEZA 3BU7A 3F23A 1L3JA 1R1TA 5BPXA 1OYWA 1IRGA 4HQEA 4L18B 1RUOA 2VBWA 1TNSA 1Z1DA 2D1HA 3BDDA 1I6XA 2P8TA 4KMUX 2L3DA 4AIHA 4ON0A 3EO6A 4RB0A 4ZYHA 4LLNA 4AIKA 4KYWA 2D93A 2TDXA 1DPUA 2QZ8A 4LG0A 4Q5SF 1K78B 1J58A 3KETA 4LA2A 3IKVA 1ZYRF 3GFMA 4L11A 5K1YA 2CAVA 4HVQA 2MLGA 3FHIB 3OD0A 5C8WA 1PUEE 1BJAA 3V7RA 1JE8A 2XAQA 1MJAA 4ESFA 4EJUA 2WWYA 5DEQA 3N97A 5FCCA 1FYLA 5ILUA 4RGRA 4B29A 1YFUA 3CJNA 2UXNA 3WTWC 1HKQA 3ETQA 1PP8F 5J3UA 2B8MA 4B8XA 3WGGA 2DAOA 4ZH4F 3D82A 3SXYA 3J80Z 3M70A 2NAZA 1UHMA 3RPUA 3ES4A 1HW2A 2CO5A 5LGNA 1ZG1A 1FC3A 1NYWA 5FB2A 5I91A 1SFEA 1WLTA 4IEOA 1P2FA 5FD6A 4TV7A 2M1BA 5E20A 1RNLA 2GU9A 2FE3A 3RTRA 4HX7A 3GX4X 2JZYA 4K8FA 4KFCA 1XE8A 4CGZA 4KWLA 5I0TA 1W5SA 1UD1A 2BGCA 2XHKA 4ASNA 3GEZA 4KWJA 4XF1A 1YUDA 3KEOA 3USSA 2ETEA 2K86A 5D8KB 2QM3A 5KHIA 3V7CA 4META 2K02A 1D8KA 5FO5A 2HDCA 5DV5A 4DNCA 1AWCA 4BIFA 3I0TA 2PAKA 2MHFA 1S7OA 1DGRA 4MX3A 4LMYA 2K0GA 2QNKA 5FLIA 3C3WA 4QGNA 2ISYA 1HQCA 2KIFA 3WW2A 5TJJA 2V79A 3WE3A 3SXWA 3BJ6A 3V7SA 3LAPA 4NHJA 4QMAA 2IW5A 5FFZA 2RGVA 2GC1A 3EBRA 2H27A 2HEOA 2H09A 5BV6A 2ZKZA 5EEHA 3DXJF 5HS8A 3S7IA 2B0LA 3J81Z 4HBNA 4OLLA 3ZQ7A 1P92A 5K5RA 1LDJA 3JTGA 4XF0A 3E5UA 4ZU4A 3BROA 2MNGA 2QBYA 1R7JA 4H7LA 2J5PA 2FRHA 2QLZA 1FLIA 3LQRA 1XGOA 2ELHA 3GW2A 4XSXF 1XGSA 2DK5A 3RYPA 4IEUA 3LA7A 2KJCA 2EA7A 1F5TA 3CF6E 1QZZA 2V1XA 1FP2A 3OCPA 3U0ZA 5HS7A 3WU1B 5FDBA 4EMSA 1QBJA 5L3DA 4J1XA 3BPVA 1DP7P 5D5XB 2NYXA 3EYIA 1EH6A 2G9WA 4P9FA 4LLGF 3IL2A 4E70A 2Z9OA 3DV8A 3ZN1A 3GXOA 3E5QA 5KVRA 5IT9K 2GC3A 3CUQA 1CAXB 4EJTA 5LEKA 2FNPA 2XIGA 4HLYA 3HQXA 5TRDA 3L2HA 1IRFA 5I0RA 2N7GA 4AWXB 1XCVA 4EM2A 1J0RA 4LB5A 1FT9A 1O5UA 1YWKA 5CJ9A 1OI6A 1PDNC 3AAFA 4NB5A 4CO8A 1MDMB 5E8GA 3G73A 2Y0OA 4N0BA 3HTSB 4HV6A 3LA3A 2W57A 4MGZE 1RL3A 1ZLJA 1KU7A 4IEWA 1VR3A 2R7FA 2A6HF 4U0VA 5CVRA 1UCRA 3I59A 1X7NA 2VOOA 1G6NA 1UCXA 2GC2A 5BXXA 1W7PB 1FX7A 2IXIA 3IDBB 1RI7A 2VE8A 2RVCA 3UKTA 4CXFA 2VXZA 1U5TC 4WXDA 4KICA 5AIPA 1J3PA 1IW7F 1U3EM 2DQLA 4A6DA 1U6GA 2H6BA 4HOBA 4KIFA 3K69A 3TO6A 5E16A 2D5FA 3PVBB 3H1MA 4KWKA 5KHKA 3MDPA 4GCVA 2XAJA 3L7WA 2FMYA 2GA2A 2WFPA 4G7HF 3E6CC 4CICA 3HIFA 5CVVA 3PFIA 2A61A 1CAVA 2PTMA 4PCQA 2UY9A 1K79A 3J81K 4YG2F 2STTA 1XSVA 2HYFA 3FZVA 4RD7A 1K78A 2WTEA 3TOBA 3WW3A 5I93A 1UW8A 3BALA 1FYMA 1TW2A 1YFWA 4ZU5A 1DDNA 1S29A 2FQPA 2ZXJA 5FLHA 1USSA 3SMHA 4I01A 1G3SA 2OZJA 1J75A 4BAYA 1W7PD 2DU9A 3ZMSA 1GXPA 1Z6RA 2PHLA 1U2WA 3I7DA 2MBFA 1Z05A 2ZFWA 1TTYA 4UBGA 3TKYA 4KNYA 3RDIA 1XSXA 3HSEA 2Q4SA 4Y15A 3BZ6A 2BYVE 2GXBA 2COMA 3ML6A 1ZZ7A 2OA2A 1FBQA 3J80K 5I0UA 4PZJA 4LGWA 2ZNYA 1ZNPA 4I3PA 3ST7A 4U7BA 1NE4A 4IHTA 3G3ZA 3OF1A 1NXMA 2YX7A 1KYWA 2YU3A 4ESJA 1EPZA 5HDNA 4U0WA 1STZA 3NEUA 5ICGA 5K5QA 3DEUA 1B6AA 2Z2SB 5FLXK 2O61A 4L9JA 4F8AA 1QWRA 4EV0A 4JVAA 2D5HA 3U10A 2ET1A 1WQ2A 4HX8A 4A0YA 3ZMDA 2RNJA 3ZMVA 2IJLA 1Q3EA 2PMUA 4ETSA 3Q9VA 1FWZA 4R8HA 1EYBA 4JK1X 5KHHA 1ZREA 4X6QB 2DTRA 2XVCA 1ZRDA 4Y13A 1GVJA 4RGUA 2D40A 4AVBA 1YS7A 1PMIA 5E1RA 3KEQA 5JI6A 4KU8A 5AONA 3KZZA 1QY4A 2IXJA 2DO7A 1IN4A 2W24A 1ZH5A 3TDUC 1A04A 4AQ6A 3GYHX 2QQBA 3GZ6A 3FHZA 2BNOA 4MGIE 4P9GA 4LULA 3RKXA 1KQ9A 4FHTA 5JHUA 4U0YA 2ESNA 2DW4A 5LLQA 4XFHA 3M1EA 3P9CA 4EJVA 3H50A 2E1NA 3FXUA 3IIAA 1SAXA 2E7XA 1CF7B 3EDPA 3KP5A 5JSOA 2CW0F 1VTNC 2STWA 5DUIA 4ENJA 4PGGA 4I0BA 5D6EA 4QLCU 1Z91A 4G7OF 3HRMA 1QXRA 5JAXA 3IWFA 1FY7A 1T2KA 4NQWA 2A69F 3F8NA 1Y0UA 2P5VA 1CAWA 3EHKA 3KGLA 4A0ZA 1ZGAA 4AIJA 2EJRA 3RYKA 2DCTA 5J8FA 4ZYEA 3D5LA 4PIXA 4U7DA 4MZUA 4KU7A 1PM7A 4L5IA 4A2UA 5LGUA 2K9ZA 3GZ5A 1H9TA 1BIBA 4LEJA 3RNSA 1P4XA 1P4AA 2XUBA 4LG0B 4KN7X 2PHDA 3CO2A 3JTHA 3GFLA 4XF9A 2HS5A 2FSWA 2CFXA 5CADA 1IAWA 1V4RA 4M6YA 1UFMA 2O0YA 1YFHA 1CAVB 2KJBA 4IRGA 1YFXA 5BS6A 2QQAA 1ZZBA 3NKTA 1H9GA 2JPBA 2JSCA 4OIPF 4HW0A 1KQ8A 2OQRA 3NQOA 4LUKA 3CUQB 1S6LA 2RC4A 3T5XA 3RZZA 3KP6A 4DQ2A 2F4PA 2KXLA 2VE9A 4QM8A 4IEZA 3ZMZA 4KUMA 4FX0A 1YHFA 2VONA 5E1ZB 4XRFA 2KIMA 4AD9A 2A5YB 3HOSA 2GC0A 2E7WA 2O3FA 4OMZA 3IHUA 4JV4A 1R1UA 3ZMUA 4ESBA 2ATFA 1O3QA 4Q0SA 3DN7A 3K2ZA 3WODF 2PBIA 3RYRA 3K1MA 3I64A 3HTUA 4XLPF 1Q5OA 3FWEA 4KIGA 4XF3A 3TDZC 3CUQC 5LRRA 4WXCA 1GQHA 4HN0A 1EH7A 5FD5A 3HOTA 2O8QA 2QJVA 2VBYA 3H3ZA 1FBUA 3VEPA 2BE5F 1FP1D 1D3YA 1IN8A 4YRDA 4IXAA 5FLXZ 4LB6B 2HQRA 2IA2A 2PA7A 4RB1A 5DD8A 2H94A 3D0SA 4OIRF 1ZVFA 1LDKB 3I53A 3DFGA 3L09A 2XAFA 2BV6A 1IN5A 1I5ZA 4HYEA 5F1RA 1CAUB 1QXJA 4GO1A 1B59A 1GHCA 4QGMA 4WXHA 2ZNZA 2B9UA 2O6GE 5J7MA 3M7GA 2QQ9A 2F5FA 1OYYA 3HSFA 3BOQA 5AIQA 3RKYA 3GWZA 2V9VA 1SQ4A 2FBHA 3IDCB 4EWAA 4MTDA 2Q1ZB 3WTZA 1XGMA 1G3TA 2HFHA 5E1WA 1CGPA 1U5TB 1HKTA 5BQTA 2HOEA 2PMHA 2VECA 2P5LC 4JTOA 2O8XA 4UV8A 1HBXG 5E17F 1U12A 1DGWA 2H0VA 4PJYA 4YFNF 3G7DA 2FMLA 5HLGA 5BMZA 2IXLA 4ONUA 3LFKA 1R00A 1YQAA 4AVPA 4HDVA 4I2OA 2QBYB 1OKRA 5IT9Z 3WTYC 1T6SA 3JZVA 2K4JA 1ZG3A 2OPKA 4WVZA 4X6RB 1X3UA 5J8CA 4Q0UA 3ABUA 2MD5A 4MHGA 2G7HA 3ES1A 2CV6A 2OZUA 1K6OA 2EV6A 1FZPB 3KSCA 5ILSA 5LGTA 3NW4A 5JSPA 4M9XA 4HF1A 2FNAA 3FFQA 3GVAA 5CVIA 5CYVA 3ACLA 4N9IA 3WU0A 1R23A 2PAEA 3KMHA 4MUVA 1JXSA 1RZ4A 1QPMA 4G6QA 1BBYA 2KRFA 2DFIA 3M8EA 3HHGA 3MWMA 4WBBA 4UXAA 2J5OA 5ERIA 5HS9A 4D0PA 2HR3A 4XETA 1SD6A 2BNNA 1G3WA 1TNTA 2PG4A 2QVOA 3VOEA 2NNNA 4IRIA 4WCGA 2CAUA 2YPRA 2VQAA 5L3GA 2B5HA 3ELKA 5E18F 1ZZ9A 4H0EA 1XMKA 4YFKF 2HKXA 1IN7A 2FXAA 3WE2A 4UNOA 3K0LA 4OOIA 2P7CB 2Z5UA 4KA4A 4WWCA 4FT8A 2P6SA 3SHFA 2RQPA 1XRUA 3OGJA 1W7PA 3FZ3A 1I1GA 3OTFA 4KN4X 1F9NA 2V1UA 4M73A 2P7VB 4BHPA 2VBZA 2PEXA 3R6SA 4XBFA 4QWQA 1LQ1A 1K7AA 2MH2A 3L9FA 3NRVA 1XB4A 4PGHA 3H1YA 2RV8A 4JQFA 1ZN2A 3LZZA 4UBHA 1J3RA 1YO5C 2VODA 2RKHA 4UV9A 2IT0A 1MJBA 4PDKA 4RAYA 4FBFA 3BP8A 2F5EA 1OPCA 2MC3A 3C3VA 2MLKA 1TQMA 2K4BA 2W25A 2CGPA 4AQ2A 5IT3A 4KL1A 1U8RA 2MH9A 5JSRA 4QXKA 5ED4A 5C6CA 1ZZCA 2OU2A 3E6DA 3DPLC 1Y3TA 2D2WA 3WTXC 2VN2A 4L9NA 1FBSA 1DPRA 3GLXA 5D5UB 2DPDA 4OFGA 4LK1F 3HT1A 1X82A 4MEXF 3DL3A 4D7SA 2PJPA 2EFQA 3WTUC 3FX3A 2GZWA 3MPBA 3I58A 1USTA 1TQ5A 1BI0A 3CTAA 4MQ9F 4BHCA 5H6QA 5K5OA 3NJZA 2Z69A 3MYXA 1SMYF 4IF4A 3H8UA 1Q1HA 2XKPA 5HLHA 1V3FA 2I45A 2HKOA 3ISPA 4EM0B 4EWDA 3PQJA 1ODDA 3TQNA 2HTJA 2EB7A 5D1IA 2XGXA 3ZPLA 5EZWA 3CDHA 4ZZLA 4IETA 1YLFA 4TLFA 4YYOA 4XFBA 2CYYA 1S7AA 2LDUA 2Y0MA 4UHTA 1E2XA 3GF2A 5HVQC 4P9UA 1OR7A 2IXHA 3LAJA 3U9GA 4CDGA 1D5VA 2FU4A 3PQKA 3HT2A 1AOYA 3FE5A 1HXDA 3JSOA 1LRHA 3KE2A 3BWGA 2FEZA 3WW4A 5JFRA 2PQQA 3CLPA 4I02A 4OINF 2ETHA 3WTVC 1H0MA 2ET7A 2C6YA 1BOAA 3T0YA 1ZX5A 5T3NA 1G3YA 1JGSA 3M3IA 3HSRA 3JSPA 1JHHA 3SZTA 3RI4A 2BNMA 2OQGA 1OFNA 4XSZF 5BPIA 4LK0F 4CHUA 3LOIA 3ABTA 1J9IA 3O2PE 5A2QK 5HDKA 3O3KA 1GXQA 4Q0QA 1J5YA 4Z2YA 1QGPA 3P9KA 5D5WB 4L0YB 4BQAA 1FNNA 1F4KA 3H3UA 4G6DA 1T38A 2ZMEA 3E97A 4RGSA 5FGMA 4CZZA 5CLSA 1CF7A 1FXZA 3E6MA 1BI1A 3C7JA 4UVAA 1H1IA 1YYVA 4ENNA 2PN6A 4YFXF 4F7ZA 3F21A 1KU9A 1B9MA 4WK8F 1O57A 2R7DA 3R0AA 3U2RA 1EP0A 2Q30A 2PLYA 2E9QA 2XLGA 3ZMTA 2P4WA 3CL1A 1CAWB 2GXGA 3F6OA 2HQNA 1FPQA 5ILVA 4PIZA 3MEXA 2QENA 4UUVA 3K9TA 3WW1A 4M6XA 4XFAA 3FM5A 5L3FA 1R5GA 5BY5A 1O7FA 4HLXA 4HF0A 2AXLA 1J1LA 1YW7A 1IN6A 1R58A 2F5DA 4XFIA 1IXRC 3FMSA 3BPZA 4LUMA 2LSOA 3DPTA 1ON2A 1HW1A 2MPFA 2ZKLA 4OIQF 5LHHA 5L3CA 3QPTA 4ENMA 1MZBA 3M8FA 5HI0A 3FM3A 3CO7C 3MZYA 5DCMB 3FMQA 1O3RA 1LEAA 2L01A 3SZPA 2D1VA 3EETA 3I5UA 1SEFA 2ZCWA 3JAMK 2ZBKA 4RGXA 2W85A 3FXRA 5D8LB 2VC1A 3I59B 1NE6A 5I8YA 3I71A 3C18A 4HBLA 3WG9A 3TNQA 3O6BB 4Q47A 2Z99A 2K27A 2L02A 1BN5A 1R5HA 2FBKA 2QVSB 3VODA 4CYDA 4MGYE 2JPCA 4RB3C 5L3EA 3H7JA 4D7TA 5J6XA 3BB6A 4LLLA 3N4MA 4IEPA 1Z7UA 4HA8A 3CEWA 4G94A 2UY8A 1SD5A 2FOKA 2Q2EA 2VT3A 1O4TA 3QACA 3JW4A 3IRQA 3EJKA 3LQQA 4YSFA 1PP7U 4L0ZB 1RC6A 1BM9A 4KDPA 2JT1A 3SCGA 2GWRA 4K2EA 5D5VB 2OZ6A 4IPAA 3HYIA 1V70A 1KA8A 1YG2A 1SFUA 2P5KA 3ROUA 2XAHA 5E8IA 4HSJA 2DLLA 5HDGA 2PI0A 1B1BA 4ZU7A 2H6CA 4EVIA 4XLNF 5I8TA 3QRFF 4R1HA 1EH8A 1KYZA 3D0JA 3FMRA 3SQNA 2P6TA 4EGZA 4J1WA 4AVCA 5BOXA 2C0ZA 2CG4A 1YW8A 1BI2A 5EEGA 3KGZA 3QAHA 3I54A 2XASA 3BY6A 1OYIA 4L9TA 2HTSA 2L4MA 2XAGA 1J59A 1XN7A 1IPKA 2XROA 2L54A 3L00A 5FFXA 3I4PA 3IC7A 3GFIA 1ULYA 4M71A 2IC1A 4LA3A 2PAMA 3GUDA 1S8NA 5DD4A 5I8SA 2YR2A 5DYMA 5J48A 4OU0A 4HLTA 2RN7A 2VPVA 4IERA 1LJ9A 3ECOA 4HZFA 2JRTA 2ZO4A 4R79A 3CO6C 2DQRA 1UPIA 1KU3A 4FAGA 3TGNA 4HV5A 2OYZA 4HAMA 3VB2A 4ENKA 1ZGJA 1UIKA 3KCCA 2DI3A 4L2NA 1IXCA 2DT5A 2NNYA 1XDUA 2JTVA 2M87A 3FXQA 1IXSB 1Q43A 2GAUA 2M5WA 3ULQB 4Z82A 4A6EA 2YSRA 2QDRA 2CSOA 1FI2A 3H92A 4OMYA 1ZARA 3C1DA 3MAJA 2XKOA 1SD7A 5DCFA 2FF4A 3ZDSA 3SCHA 4MGKE 3WTSC 3PLQA 5KBFA 5CVUA 3Q5FA 4I0AA 2XV4S 3QU3A 4HDUA 2BEOA 1FYKA 1CAXA 1WRJA 5LBQA 4M72A 2IVMA 4BH9A 1WGPA 3QOPA 1ONVA 3LA2A 4HX4A 1MGTA 3ZN0A 4KMFA 1BI3A 1UHWA 3KP4A 4FAHA 4BHBA 5JR7B
chains in the Genus database with same CATH superfamily
2M30A 1M06G 3D6EA 2TUNA 2EV5A 3V8JA 2GH2A 2L4AA 4L5EA 1MS8A 3CCMI 1G86A 3W2AA 3NL1A 1ULCA 2BDRA 1GLHA 5GTHC 1BYHA 1MJ9A 2BGOA 3HWJA 4XFFA 4IV3A 5J1XA 4YG6A 1O7LA 3FK6A 2QKDA 2HH9A 2K9SA 2M7BA 3LWCA 4YIIA 4Y20B 3CJXA 4XACA 1RTVA 1L3LA 3NWSA 4XABA 2VVDA 1XNDA 2HWE2 5FLJA 3ZIXA 2PFBA 3M3OA 2JA6J 2JDPA 4A3BJ 2IPQX 2K2SA 2YHJA 4Y3OA 2LF7A 4JTNA 2V1DA 2O03A 3HRUA 1ULDA 3MKWB 4YM3A 3WNNA 2ZMKA 1JUHA 1H6XA 5J3LA 3ZYPA 2NZ9A 2ME0A 5EJCA 3UKVA 2IUWA 2HXOA 2PMZN 2QQKA 3A4UA 2RHPA 3OOUA 4EN0A 2LC2A 1IGNA 4UXNA 3CLOA 3OYDA 1LB2A 5FP8A 2UUZA 2XPJA 4LBMA 1GDTA 1J2XA 4YNIA 5DN2A 4OMCA 3J8F3 1QQP1 3CP8A 4CSWA 1XS9A 2UYAA 2VTXA 1DDLA 4RAZA 3TW6A 1X1AA 5LHIA 4P96A 1HV1A 5FY9A 1H8TB 4E4HA 1FSHA 2KRCA 4MEYF 2VL4A 1S3JA 5B5EC 1SZBA 3QP6A 2RJKA 3ZQHA 2V4AA 5JCTA 1FMWA 1REPC 4JBAA 4Q0PA 4Y5Z0 2VTXJ 3M3QA 1QNTA 4IKFA 3IRRA 2KQRA 2W5FA 1G9CA 1S0DA 4CEWA 3N9PA 2AO9A 3ZQLA 4LTAA 5C9AA 2O1QA 3SDBA 3TW7A 1VP6A 3U75A 2GN7A 1WLCA 4I09A 4XDOA 2AZ5A 3TO7A 1SDWA 2DUOA 2UURA 1XDSA 4P9WA 2WY7Q 4CZSA 3KLOA 5FPZA 2UWMA 5A2QZ 3VYUB 4LNVA 1HRI1 1QOOA 1RUE1 4DXRA 3BJOA 3JREA 3EQLF 2ID3A 3AL0B 2CHHA 4KGQA 1TWAJ 2YBKA 1RUH1 4UB6C 1XCBA 4CP1A 4IE5A 4LBQA 3AG3H 2LKSA 1AL21 2HPIA 2JJ7A 1LVAA 5CEHA 1ZHFA 1AHDP 3JRDA 5FQ0A 1IF1A 5JR3A 5DDJ2 1J7KA 4ZYAA 1Y8RB 2BOIA 3KP3A 1JHFA 2DDBA 4AVZA 2VMEA 3K4MA 4QXBA 5AVPA 2PELA 4BK4A 3LFUA 3RIRA 4JDMA 5D8AC 2ZMEB 2ZGKA 3BCAA 4HVRA 3JD72 3J26N 4FTHA 3ZYJB 2OBPA 2LTNA 2ZZQA 4RR3A 5LK7B 3WGHA 4FQ4A 1XTAA 4AGRA 4MNUA 5K8SA 5TISC 3E7LA 1W5TA 1GBGA 4BE0A 2CWEA 4LD5A 2ZGNA 4S05A 4XTMA 1BEV2 5FV3A 2Z33A 1Y39A 1D1AA 2AH2A 1REFA 2JDUA 2L7KA 1LKNA 4QPQA 2E51A 2WO1A 1W39A 2HVSA 4K7JA 4ASLA 2VBXA 3NSTA 3U1DA 1OOPA 2PQSA 3V8KA 4RFT0 2OKXA 1BOBA 1I3QJ 2HGCA 4S04A 3ENRA 4A41A 5C3QA 2WC2A 1S7EA 1YW9A 2DPUA 4ABZA 3AXDA 1RXFA 4HSLA 5A6YA 2GLOA 4G7ZF 1R5ID 4IXLA 3SEEA 5T5LA 1LGBA 1V55H 1VIWB 1PZ9A 5F5CA 2F2EA 2XMLA 4EM1A 4AVSA 5L73A 3OYAA 5LA1A 1OQYA 4RA2A 1C8NA 3B73A 1YHQI 2PFWA 1WW5A 3QWLA 1S5LC 2HWE3 5BPDA 5LW9A 4I98B 2KIUA 3RZDJ 1ZBE3 1PO22 5F2SA 2R6QA 3H0GJ 2R5YB 2NP0A 4RYDA 4U88A 2IA1A 5FIXA 1SC7A 4GKXA 5ACA1 5ANNA 5A33A 2Y48A 3MIGA 1YIOA 4QB1A 4AEKA 1W05A 2KZGA 4Z2WA 2VZ3A 4PUSA 4XF4A 4CA0A 4DGWB 3I3QA 5D6FA 4BQQA 3BG7A 4YZ4A 5IATA 5DAPA 1LEBA 2GXAA 3WF2A 1OHFA 4JRAA 1XE7A 3PSIA 4QPIA 2QSGX 4NROA 2ZZJA 1RUI3 1MVQA 2QQIA 2ILMA 2K9QA 1ZGWA 3LIHA 1G7YA 3WHTA 4UFLA 3SCFA 1OT5A 2WKKA 1W0NA 1APLC 3H1WA 2N8GA 1V5FA 3GMEA 2KZVA 3GJAA 2EXKA 4A0XA 3ZIWA 1DYPA 2D6MA 1AX1A 2Y64A 3NKGA 2D5VA 2BBYA 2SLIA 3KPHA 5LK5A 1H89C 1BK0A 2IRFG 1T98A 1VAVA 2WT0A 4D3WA 3LWFA 1F5JA 2LK2A 3H8RA 1VBE1 1ULEA 1WJDA 2CJJA 1UMIA 2WZR3 3OY8B 4JQRA 1NLSA 2EA4A 2CUFA 4FX4A 4DNYA 2V9KA 1RUD2 1JZ2A 2P0WA 3KLNA 3HMYA 1ZZ8A 2XJSA 4YIRX 2VOPA 4BLJA 4A93J 2DCKA 4OYUA 1LEDA 2OAZA 2WQ4A 4J25A 1OD3A 4M6VA 1ULGA 2WBMA 3D5RC 2LRPA 4Y5SA 5ANQA 5GLZA 1WMXA 2DA6A 2ZGSA 4FP2A 2P2KA 2ZAHA 3R4DB 3QODA 2WL1A 3AKRA 1VI0A 2IVIB 2ACJA 2RMU2 2B63J 5FXWA 1OF3A 2AR6A 3VDDC 4FFGA 2E1MC 5GAGJ 2HPMA 3GHNA 1E3HA 2JIJA 3FBMA 2XL7A 2B46X 2YFZA 4MGTA 2GNTA 1VQOI 5FZDA 1LGNA 5ICEA 1LHWA 3AMMA 1VB2A 1TLHB 5L9BA 1Y1VJ 3RVHA 1ZRFA 1XYPA 2QBXA 4BQ2A 1YLLA 5C7GA 1W2OA 4Y26A 4WZCA 3FUQA 3ELNA 5FOBB 5GP9A 4XN0A 2A07F 3DF8A 4HVOA 4EJRA 3R0JA 3T8RA 2ZJQF 5D2AA 1IGOA 4CDWB 3J7AO 2PHTA 3L1PA 1RUH2 4IEVA 4YVWC 1LODA 3PTRB 3NAUA 3MQ0A 5GZGA 3F23A 4NPMA 1L3JA 3ZFGC 1PK6B 5BPXA 3MIEA 2LH9A 4CU9A 3AKTA 1POV1 3KCYA 2LP0A 1Z1DA 5T5JA 1MBFA 1PGL2 4E7ZA 4GWNA 2L3DA 1OKOA 3ZVXA 2WAAA 4QB6A 3EO6A 4ZYHA 3H9QA 1W8TA 2XQXA 3I4NJ 4AIKA 2TDXA 2Y0SA 4MLOA 1LULA 1OA3A 2WNVC 3IKVA 4AYBN 1O6UA 3K4ZA 2ZX0A 2MLGA 5HNHA 1EA3A 1IV8A 1HDKA 3PJQA 2EXHA 4ESFA 4EJUA 4LKDA 2WWYA 3WINE 3AB0A 3UJOA 2DDUA 5T5PA 3VBOA 3BTXA 4JGYB 3N97A 1W8ZA 2DA3A 4AFBA 1FYLA 2QSHX 1ZA4A 4E4SA 4B29A 1GKBA 5GZFA 1YFUA 5IVEA 5FOJB 2O5RA 1YI2I 1PP8F 5J3UA 5DAVA 4DFSA 1WVRA 1OUXA 1OH3A 5B66C 2XR4A 3VBHC 2QSFX 2VJIA 4ZH4F 2RM23 3IP4B 2JG9C 3CCEI 5KC5A 1BR1A 1UHMA 3I2GA 4CEWB 1W9YA 1U5XA 1WLTA 4IEOA 4UW6A 2DYSH 2M1BA 1POQA 5JVVA 1AR91 2PHUA 2NMOA 4XVHA 4CGZA 2CDPA 3EB7A 1UD1A 1NK2P 2FHRA 2JDHA 2XHKA 5FR3A 2ZOEB 1UOGA 3J7LA 1UZZA 1YUDA 4FPYA 1Z3XA 4QQPA 2R49A 4BL0B 2XB0X 2K86A 2E33A 5FY7A 4LBQB 5KHIA 1YIFA 2HDCA 1NG0A 1R091 5DV5A 3IDEA 1S7OA 1JZ8A 3USUA 2QNKA 5FYZA 3TEYA 3C3WA 2ISYA 4LKSA 1HQCA 1LCLA 2WY8Q 5F3IA 3AG2H 1NUKA 2R7SA 4ISQA 3FLPA 1MEC3 2IW5A 2WYFA 1AZDA 2VQHA 2Y38A 3BR6A 2HEOA 2P6CA 3AP4A 2NS7A 5BV6A 2ZKZA 5HS8A 5EIYB 1F4HA 4HBNA 4A3KJ 4IGPA 4OLLA 1P92A 4QPYA 2KT0A 2XVKA 4W8JA 1LDJA 4D94A 3CC7I 5A1FA 3FKIJ 2DVAA 2MNGA 5CISA 4ISRA 2QBYA 4H7LA 2FRHA 4BQYA 2ERFA 3GW2A 2P34A 3JUUA 5F5QA 2RJ2A 1K3IA 2DK5A 2KJCA 1F5TA 1FP2A 3H0DA 2V7FA 4GMP0 1WCKA 3GTMJ 4EMSA 1YRNB 4J1XA 3S3MA 1DP7P 1RUC3 2E7TA 3EYIA 1WJEA 1EH6A 3H5NA 1W5CC 3IT8A 3IL2A 5BNNA 4IOAF 2RR13 2Z9OA 3KT1A 3LSRA 4CP2A 1E5HA 3SDGA 4FPOB 4LHSA 4EJTA 4GXLA 3Q0UA 5LEKA 1OKQA 5IJRA 5L9VA 2IFRA 4N7IA 4AWXB 3JXSA 5CFDB 1JBCA 4YELA 1YWKA 3OL4A 4QSHA 3VPRA 5E8GA 2E1OA 2VXJA 3HTSB 3O7OA 3KZIC 4FOVA 2WN2A 3VB9A 2AEZA 4D7NA 1VR3A 4DUVA 1A5JA 1NT0A 2JVGA 1AXKA 1GZ9A 2VOOA 1G6NA 2RDRA 3M3YJ 4TYSA 4INDA 5KC6A 2IXIA 1RI7A 2VE8A 1YQ2A 2ZGRA 4D7MA 1J3PA 1W90A 2FDFA 1IW7F 1U3EM 4YM0A 1QOSA 2DN0A 2V5YA 1MEC2 1JTYA 2ZEXA 1HQLA 1PO12 4XN3A 4KWKA 4QPIB 2XAJA 4E6KG 1Y1WJ 3ZYBA 2B45X 2WFPA 4A3LJ 2BWAA 3HIFA 3VBHB 1QU0A 1PO23 1JS9A 5GPAA 1XSVA 2HYFA 1MMNA 2WTEA 1AJOA 5FY1A 5I93A 1UW8A 3BALA 1TW2A 3UV9A 1MH4A 2FCVA 3M8LA 3RJRA 3KIOA 1YFWA 2ADDA 4AHZA 1MS3A 1TT0A 2OZJA 3A1YA 2PHLA 2MBFA 5B2GB 4ZTFA 4UBGA 4KNYA 3BUCA 3VBOB 2EIBA 2GXBA 3O5SA 2I10A 3VHNA 5CFCC 4IV1C 1ZNPA 3DU5A 3OF1A 2YS9A 1EPZA 5HDNA 4U0WA 4H4KC 1AR83 3NEUA 4XJ8A 5K5QA 2DWRA 1XE0A 1PVXA 2BZTA 2Z2SB 3MEPA 3RQ0A 4L9JA 4EZ4A 3KLSA 4EV0A 1WJBA 2WADA 1WQ2A 3PU8A 2RNJA 3G1OA 4MXWB 2OTLI 1Q3EA 3PMEA 2DMQA 4IEJA 3OYBA 4XPVA 2DTYA 3Q9VA 4BXSV 4CDXB 1FWZA 5KHHA 1BK1A 3SQOA 3S57A 3CLQA 3OBZA 3K4LA 4DY3A 1RB8G 1SVOA 1WGXA 2B7YA 3KEQA 5JI6A 4KU8A 4D6SA 5AONA 1QY4A 2XRLA 3G4SI 3C8XA 1IN4A 1JUIA 3OEAA 2ZGPA 3WP6A 3TDUC 4RLQA 4COVA 3ZMOA 1SVLA 3ZYIB 1X1DA 1OOPC 5CG8A 4QPOA 4DPNA 4P9GA 3AMQA 3OSGA 1BJQA 3FXUA 3IIAA 2E7XA 1SEUA 2CW0F 2STWA 5DUIA 4I0BA 1NZIA 2WAEA 4XE9A 2VQGA 4QLCU 1Z91A 4FTEA 2I07B 3W59A 3HRMA 4H3WA 4QHOA 4XL9A 1A31A 4QAWA 4YW7A 4NQWA 1HIXA 2VAUA 1D5YA 4AIJA 2X1CA 3AMNA 5E89A 3VV1A 2ZC2A 5GPCA 3WNPA 4YGBA 3KM5A 5EF6A 1A78A 3WHUA 4A2UA 1W36C 1I3AA 2XJQA 4LG0B 4AYBA 2PHDA 1VQ4I 1Z7S2 2HS5A 3N9MA 2O0OA 4LO6B 1V4RA 1UFMA 2O0YA 4IRGA 2L0KA 1OQDA 3CJQB 4XJZA 1N1SA 4XHBA 2X29A 4GAZA 4E7JA 4QPGC 4PJJA 2LR8A 4I30A 1FPN3 5ACA2 3CUQB 4Z2AA 1FEXA 4DQ2A 1LE8B 3N9NA 4AAPA 4QM8A 3DTIA 3K4NA 4KUMA 3HPGA 3TN92 3ETPA 3PVOA 4AD9A 5IYDJ 4UY8I 2A5YB 4FI9A 3ABLH 3QCWA 4ESBA 4C0BA 3FN9A 3DN7A 4XIOA 2VBDA 3F2ZA 2P5BA 3I64A 1NOVA 3VD7A 4XLPF 1ODNA 3AFGA 4PQQA 4LK7A 4XF3A 3ZX7A 3CUQC 2VQ0A 4A3JJ 1LGCA 4HN0A 5EYYA 1EH7A 1VBD1 5FD5A 2O8QA 1TME1 2QJVA 2DCJA 3GLLA 1FP1D 1KJLA 1IN8A 4YRDA 2DOEA 4IXAA 4XHXA 1R9TJ 1PK6C 2H94A 2GSYA 1ZVFA 2CGOA 2OF7A 1LDKB 4PI2A 3AX4A 3EYPA 4PDWA 3L09A 4Q4Y1 3SZGA 2XAFA 1I5ZA 1CAUB 1GHCA 1IG3A 5IP9J 4OHWA 3LEMA 2DFHA 2WBKA 5J7MA 3M7GA 1W3XA 2QQ9A 2IEKA 2HOTA 1HB1A 3RKYA 2K5CA 2V9VA 3LEGA 3IDCB 4AI2A 3IH3A 2QQOA 5T50A 2Q1ZB 1E3PA 3WTZA 4JKLA 4W65A 2BVLA 3PO3J 4YZ2A 1CGPA 4KG8A 2HOEA 1S0CA 1OQ1A 3LEKA 2VECA 3PUQA 3GBWA 2BZDA 4TXWA 1UZ0A 1PIV3 4UV8A 2E35A 1HBXG 5E17F 1DGWA 3MKYB 1W9WA 4YFNF 5HLGA 5A7QA 1ZQ3P 1YQAA 2KIQA 2A6VA 4I2OA 5DPNA 2QBYB 4BQ1A 1FOD2 3JZVA 2C4XA 4AQSA 2OPKA 4XTPA 1IDYA 4QIWN 5JXIA 2RMU3 2VU9A 2G7HA 4PHZA 2CV6A 4F83A 3OR2C 2B39A 1W2NA 5T52A 2OZUA 3OS1A 1K6OA 1FZPB 2F48A 4M9XA 4Q26A 5JOZA 2VZUA 2FNAA 1SFKA 5CYVA 3ACLA 4N9IA 4AOCA 5F04A 5E79C 3KMHA 1RZ4A 4E7HA 2KRFA 1HQNA 2GIZA 3FLRA 3M8EA 3IDAA 4CCJA 4QQOA 3P3PA 1REEA 5GADJ 1O4YA 4ZDPA 1OISA 1MNEA 1OA4A 2HR3A 1SD6A 1ASJ2 4CDXA 1UU5A 3K77A 3ILNA 5DTDA 3HOWJ 2ARXA 3LDBA 1QJU2 2B5HA 5FKLA 2OCEA 4I3GA 5J47A 3U78A 4H0EA 1XMKA 4XUTA 1NTCA 2FXAA 3WE2A 4YG0A 3JU9A 4BQ5A 3BKZA 1NH3A 1EV13 1K6YA 3KVAA 5FMOL 4I99C 1YJWI 1QKQA 2Z5UA 4LQRA 1UNBA 1N1VA 3SHFA 1POV3 1HRI3 1CPMA 1TC3C 2DCEA 4NC8A 2YXSA 3NAPB 3R6SA 5C3RA 4XBFA 4RQPB 2V1NA 1DQ4A 2IS6A 1LQ1A 2LG4A 1K7AA 1JZ5A 1XB4A 3LOCA 2CSGA 3FC0A 1OH4A 4JQFA 1YO5C 2VODA 2WS92 1FPN2 2ECBA 4LOSA 3KD4A 2DXIA 2JMWA 3BP8A 3O12A 4WVMB 2MLKA 3KV9A 4O65A 2CGPA 4AQ2A 5IT3A 2NM1A 5JSRA 3VZOA 4BQNA 5ED4A 5C6CA 3E6DA 1HXS2 3QYEA 2P3JA 3AZYA 5GTIC 3CNAA 4FFIA 1MVEA 3C2BA 3GLXA 1R092 3TL4X 1F36A 4UUSA 1WJ5A 3E0JB 2HQAA 3HG9A 1MMAA 5CBLA 1MMSA 4D7SA 3ZFEB 1DGWY 3OSFA 3O1UA 3JCUC 4LO4B 2VE1A 5E3LA 5CG9A 2J1UA 5K5OA 1NX9A 4IF4A 1IQAA 5E3NA 4CCEA 4HKWA 1SMVA 4BGDA 4EWDA 1Z67A 4FP3A 3PQJA 5IYCJ 2IFWA 3ALQA 2ZHNA 4FETA 1X9TA 5EZWA 5EPAA 1LFUP 1WWYA 3ZKUA 1ASJ3 5DG2A 4Z92B 2CYYA 3VL8A 2JG9A 3LCPA 1AR82 2IXHA 3S32A 2ZA9A 2Q2EB 1C57A 3PQKA 4YWAA 1HRI2 5F08A 3Q0VA 3JSOA 3MGUA 4ZZ8A 3AKPA 3L9JT 5JFRA 4TTGA 3FFZA 4I02A 1PGW2 2ET7A 4Q4W1 2YC4A 1BOAA 4I76A 4HNTA 1TMF2 2QKLB 5EG0A 3M3IA 4JOMA 3THDA 3GALA 2QQ8A 1JHHA 1J84A 1VBB3 2VZVA 3I2KA 1RPWA 2BNMA 2EZHA 3WEZA 4GH4B 4X8NA 3JD71 3TEXA 2R062 3KEYA 3O2PE 5HDKA 2ZGOA 3O3KA 4E8CA 1G8WA 1GXQA 4Q0QA 4AAXA 4JC1A 3LMMA 1AR81 3CIHA 4A45A 3E97A 4RGSA 4CZZA 1LOBA 1KZHA 1XNTA 1FXZA 3E6MA 3VWBA 4UVAA 4RHV1 3VBRA 4ENNA 4FPCA 2BVVA 4YFXF 4K9SA 5FXXA 2AHQA 5BNGA 4HKLA 3TRSB 1B9MA 4C91A 2E9QA 3ZMTA 3S16J 3CL1A 1CAWB 2HOAA 2E36A 2OJED 4AU7A 2AREA 4UUVA 3FK7A 2K46A 3K9TA 3WW1A 2J1SA 1J09A 4M6XA 4HPKB 2A6TA 1GVDA 2R92J 5BY5A 1ZTRA 2NS8A 5DZEA 5IK4A 1J1LA 1P8JA 2F5DA 3ZN4A 4XFIA 2XGEA 2ORXA 2W92A 3BPZA 4LUMA 3WR0A 1TZLA 2ZKLA 4NIHA 1JYTA 5L3CA 2HBTA 2VUCA 1HV0A 4HONA 4HSTA 1MZBA 3INAA 1H30A 3SISA 1D4VB 3CO7C 5DCMB 1R093 3WF1A 4LE3A 2R5ZA 2L01A 5GLWA 1ETVA 3LGRA 2E32A 3T09A 2D1VA 3WX5A 3POSA 4F91B 3AYEA 4OAZA 3FXJA 3FXRA 5L7OB 1VBC1 1GYKA 4UWDA 1NE6A 3I71A 3C18A 3WG9A 5FRMA 4XBQA 5J98B 5FJ8J 2PXJA 1G59A 2Z99A 4BY1J 4FPKA 2K27A 1DIWA 5CKNA 1BN5A 1VBB1 1JHJA 2QVSB 3ZFFC 4CYDA 1X1CA 3BC8A 4YW3A 2R5YA 2VGDA 5L3EA 3H7JA 3PJRA 3N4MA 5A33B 2JG9B 4HA8A 1KDMA 2UY8A 1RUG1 2XF6A 2Q2EA 1MQTA 1QHDA 2XJRA 2JQ7A 3KQRA 1D4M1 1PVC1 2Q8DA 5JPMB 3AP5A 2OZ6A 2VQLA 5C3OA 4IPAA 1V70A 4N4NB 4LBLA 4EN6B 5A7WB 2DLLA 3RFRA 2PI0A 3CCYA 1B1BA 2NXNB 2VUDA 3BTYA 5LA2A 2H6CA 4EVIA 3VBUB 4XLNF 3QRFF 5FPBA 4S2HA 3KYCB 2OPWA 3FMRA 2P6TA 5BOXA 4F52A 4M3BA 1YW8A 1MZ5A 1PJRA 2XASA 3BY6A 2BHYA 2IS4A 1Z78A 3VSLA 5M5WJ 1GNZA 2XAGA 1EAH1 1J59A 2L54A 5FFXA 3I4PA 3IC7A 3OIPA 4M71A 3VHPA 2PAMA 2X6OA 5DD4A 3SKJE 5I8SA 5J36A 4OU0A 3KX2A 1LJ9A 3OBTA 3A02A 2QDNA 4UFJA 2QKMB 4TWTA 2P3IA 1SAUA 4RBOA 1V54H 4V2WA 1VBD2 1ORKA 3LSHA 1G9BA 4ZY9A 1J1TA 3LDKA 1GT0C 3NV3A 1JW6A 3S17J 2ZPXA 2W2IA 4LLFA 2JA2A 3ESWB 2DV9A 3ZO0B 2P3YA 3BG3A 3AG4H 2DMUA 3ON7A 1FMD3 1XDUA 2JTVA 4AYUA 3HB9A 3FXQA 4NMIA 3ULQB 4Z82A 2JDAA 2GALA 1A6IA 1FI2A 3HAGA 3H92A 2LKXA 4OMYA 4XK4A 1W2UA 5DCFA 4N53B 3ZDSA 5CVUA 3QU3A 2QQVA 1AR73 3WD5A 1FYKA 1CPNA 1WD4A 4Q4W3 3T0AA 2FDIA 2IVMA 1WGPA 1TP4A 3QOPA 1U8BA 2VUAA 3MKZA 4JP0A 1VRBA 2RREA 3KP4A 5JR7B 3LPGA 4RR3C 4M3CF 3RKWA 2KA3A 4XBLA 3NWTA 1RUJ1 2MC4A 3W6VA 4EE2A 2ZX1A 5D8AA 4B3NA 3NJVA 1JMUB 3ZFEC 2BBVA 1WWXA 2EH3A 3WG1A 1XNBA 2RG4A 4E2GA 1U5ZA 4GALA 4MH0E 4QX0A 2EIEA 1TQPA 4NNJA 4M3DA 4B3XA 1YTYA 3DGTA 4O3MA 1PVC2 3OOPA 2BU9A 1T0FA 1XC5A 1RUJ3 1ND2A 3I2IA 3OPWA 3HKZA 3HEFA 5E3MA 4XM3A 4M74A 1QO0D 1QQIA 2FMDA 2WAOA 3QP5A 4MOAA 5ISLA 3LFMA 4QDSA 3WDXA 2VZQA 2DBNA 3RWNA 2C9AA 2LTPA 1I50J 1AR63 4MIMA 3PUAA 3FXLA 4HPKA 1XYOA 2QQUA 3D4KA 4LKEA 1ZA7A 1AX0A 4AVVA 3ZFFB 2OUHA 4N4OB 1YQ8A 2GIVA 2ISZA 2FA5A 2L9RA 3ZR6A 1YYNA 4YW4A 4C9YA 1WA4A 5K7PA 1R1A3 4BQOA 3UGGA 2BW3B 3B01A 4A5NA 5JWPA 1C4RA 3LB9A 3F8MA 1SD4A 1QZYA 5CU1A 4Q48A 1ETWA 2L9LA 3TEDA 5EQUA 2IVJA 2PMZA 3FXOA 4E2QA 3BTCA 1DGWX 3POGA 3DKWA 5FZCA 3V4GA 1KGYA 3MLLA 4FPLA 4MV2A 2RVAA 4WVVA 3T1MA 4IEYA 3BIWE 2MG4A 2Y75A 5CVJA 1DUXC 1NCQC 2XBO1 3CDZB 5ICCA 2DYRH 3K1PA 2WA3A 4Q4Y2 1OLTA 1COV1 2ID4A 2RS12 3MICA 4CXYA 1E3OC 3MZHA 4XOTA 3ZXKA 1CX1A 1IZ1A 3LSTA 1KS4A 4Q29A 4EJWA 3K1NA 4GYGA 4PFPA 4P9XA 4FTSA 4KBZA 2Y30A 1Y9QA 2G9FA 3E1F1 3H7YA 3RZOJ 2JDZA 4DOZA 5JI7A 3KZYA 3A21A 1JOPA 1JTZX 4YRVA 1UU6A 1ZBE2 2IA0A 3S0MA 1PMHX 2Y9ZA 4LOTA 3FF5A 3R4KA 3UL2A 1VZ0A 2A73B 3O1OA 2R7WA 1ZR2A 4BB3A 1TMF1 3AMPA 2QEXI 2LY1A 5A7WA 4OULA 4GULA 3AC0A 4NIDA 2FQ4A 1SBDA 3U11A 1LNSA 3DQVC 3K4JA 3WVJA 3GYDA 4KT5C 3H3LA 2E1CA 5LFAA 4LK6A 1PM4A 1RUI2 3P6BA 4AIDA 4Y33A 3VBUC 4QQHA 5FREA 1MZ6A 4H2AA 3I2JA 2WV1A 3LSMA 2DFCA 4GZ9A 2XL9A 3ZXEA 2LKPA 4BBSJ 3E3VA 3S7EA 2PJRA 4RB2C 5D4RA 1AYM1 1XNAA 1MBEA 5EV7A 3BPXA 1YS6A 2QWWA 4NQWB 1RUF3 3AL0C 3DPRA 1US3A 2XUEA 3EYYA 2LS6A 3ERED 2XVGA 5HLIA 2DMTA 3RRDA 3P5JA 4G6TB 1RGSA 2VC9A 1FSEA 2X0LA 2XWJB 4FFFA 4O9EA 3DWLE 1F9KA 2G9GA 4BEHB 5FYBA 4UVCA 5DCMA 1ZELA 3CMEI 3W2VA 1RUI1 4DUXA 1LDDA 4I7HA 4M3GA 4RS5C 2F4LA 1V6OA 1W8OA 3OBAA 5AC91 4Q8LA 2WAQN 2QYOA 3JR9A 2WNEA 1TNRA 3EQEA 3V8LA 1DLCA 1AR71 1O5LA 2FDKA 1KQ0A 2HZTA 3BPSA 1S0JA 4ZU4A 1OD5A 3GBFA 3J8F2 4BXUA 3RI8A 2NOJB 5JZGB 2EZIA 2P1BA 3QPLA 2HQ5A 1XPWA 1ZRRA 1ZG5A 4YW2A 3N9QA 4RN5A 1LOFC 4NBQA 4WM7B 1HSJA 4Q4Y3 3ZXJA 1PO11 2L9SA 2IGMA 4RLFA 1WSUA 1WCUA 5A3LA 4D69A 3IWZA 4M9SA 3TN91 2VPLA 2QTWB 5FWJA 1GZWA 4A3ZA 3V0AB 2IXSA 1B4AA 4BPZA 3OV8A 5L3BA 4HN1A 1YIJI 4CEYB 3L2YA 1P7IA 2ENRA 4PF1A 3CCUI 4CH7A 1R1VA 1RUG2 2NVYJ 4P55A 3LDRA 1TBXA 4EROA 5FPAA 5DXDA 1VJ2A 3BOPA 6PAXA 4NC6A 2QQNA 1KRIA 3GZAA 3ZFEA 3HRSA 4RMNA 2VCCA 2IXCA 1MACA 2LF8A 4BCUA 3OYKA 1EAH3 2Q0AA 3VBRC 4QX5A 2YPDA 1AHSA 2HEVF 3X2QH 2VZ1A 2WJSA 2VOTA 1W3VA 2VCMA 1CJDA 1N75A 2M4KA 4HQMA 3CZUA 5SV8A 4RHV2 3RQ4A 1WZXA 2GMPA 2W84A 2DT7B 3W58A 2VMIA 2VT2A 1B9NA 1WI9A 2LNBA 3OYFA 2F4MB 2AYHA 2XXZA 4C0HA 3QYBA 1GNHA 2F4OB 2X1EA 1MD0A 3CCSI 4O5VA 5A6XA 4V2FA 3VDXA 3PNAA 4MVTA 5L7OC 2R071 4BJTA 2NRAC 1LEMA 1UWWA 3IB3A 4CDQC 3TOAA 4IQJA 2K3FA 4EJOA 5IP6A 2OD5A 4CXXA 3SJMA 2GQQA 3FBIB 2BVMA 4Q4ZF 2CV1A 3F8FA 4AI1A 1XQNA 1RUF2 3CU7A 3PNYA 3F72A 3PIPF 1O3SA 5F6FA 2HJIA 1G2HA 2YMZA 3ZKYA 4AXOA 3O1MA 4Q0VA 4HMZA 3WLUA 3TB0A 4HF2A 1ACCA 1LVKA 4EEFG 1U5IA 2OA4A 3UKNA 3WQ7A 5L36A 2KD7A 1EUUA 3Q9SA 1JKQC 4UF0A 3BR1A 3ILFA 4M3FA 3HQUA 3U07A 5CFCB 1XMAA 2CTVA 1AR72 4X1EA 1D2QA 1GWKA 3ZYGA 4B09A 5IFTA 2KISA 3T8TA 4CDUB 2K3PA 3DKQA 5HOOA 1UYZA 4H14A 3F8BA 5FQ0B 1COV3 1Y56A 3LSGA 4S2DA 5F0CA 3RPQA 2Q8OA 2L2OA 5FZOB 3ZLIA 1RETA 1C8M1 3BN6A 2VL8A 3BU7A 3WQ0A 1R1TA 1Z7S3 3ZM8A 5IVYA 2CQNA 1OYWA 2DTZA 1NKGA 1UL9A 3FL7A 1AL0G 4QT6A 2AQFA 2V9PA 1TNSA 1URXA 1V9U3 1W6QA 3BDDA 3IH4A 1I6XA 5C70A 1MS0A 2P8TA 5F3CA 4KMUX 2EF6A 4ON0A 2IS2A 4A3EJ 2Z79A 4LLNA 3WHCA 3AVRA 3R0RA 4M3CE 1DPUA 2QZ8A 4LG0A 1IKQA 1IV6A 3OS0A 4IE6A 1ZYRF 3GFMA 4Q4V1 4HVQA 4V2GA 3ZFFA 1HKDA 1CWPA 1Y4WA 3WV6A 4X0GA 4DYQA 2R041 3K46A 4XURA 1UPSA 1PUEE 4BQ3A 4E7IA 5A6ZA 3V7RA 1JE8A 2VZOA 4FOWA 2XAQA 4XICA 1UMZA 4BKXA 1JI6A 4AI9A 2VQUA 1QU3A 1UZCA 1MBJA 4YLZA 5HCBA 5LA0A 2J1TA 2XC7A 4GWIA 4B1MA 2WO7A 4UW3A 4A3MJ 4CCDA 4B48A 3ETQA 3DKYA 3CJIA 4B8XA 2D3PA 2DAOA 1C5IA 5C4WB 4BMBA 2NAZA 3AVSA 5B4XA 1C5HA 4OHYA 3ES4A 5A7OA 1HW2A 2CO5A 2D6LX 3QYFA 5I91A 1SFEA 4IV1B 2CUZA 1WI3A 2GU9A 3RTRA 4J00A 1DQ0A 1XB9A 2JZYA 5FYYA 3PHMA 1JUMA 4K8FA 1XE8A 1W5SA 3I4MJ 2JX9A 4ASNA 2WS93 3ZCOA 3KEOA 2D98A 1JYCA 2ETEA 1OA2A 5D8KB 3V7CA 3BG6A 1RVF2 2GP3A 4JHTA 1U0JA 4DNCA 1AWCA 1B8IB 2RS32 1DQ6A 2MHFA 4Z1VA 1DGRA 1CQ9A 3V56A 4LMYA 4QGNA 1US2A 2KIFA 3WW2A 3DYMA 2DDAA 1MNMC 1RMU3 3SXWA 3V7SA 3TWIA 4NHJA 3O1TA 4DY5A 1Y9MA 5M5YJ 3WOGA 2P81A 5FFZA 3OWTA 2DJNA 1OCOH 3EBRA 1GOGA 5EEHA 3DXJF 5LBCA 4FXGB 2B0LA 5GM0A 1VALA 1KEXA 3JTGA 3E5UA 1T6BX 1H9WA 1W8NA 3VBRB 1VQLI 1W6OB 1W6PB 2J5PA 5KXBA 4UFMA 4U36A 3LQRA 1XGOA 2WQ8A 4XSXF 1XGSA 3RYPA 3LA7A 1H2KA 3CF6E 1GUUA 3ITQA 2V1XA 1JUSA 3OCPA 5JOWA 5FDBA 1QBJA 2ZBJA 3BPVA 1QZEA 3WHBA 2YGLA 4JX6A 2G9WA 2V4JC 4AL9A 4IV3C 4LLGF 2Z4FA 4YZ3A 2I8DA 3E5QA 3MUZ1 5IT9K 3CUQA 1CAXB 5LATA 2W46A 3M2MA 3H5AA 2NVUB 3L2HA 4FVVA 2L9VA 3V0BA 2FUG2 2N7GA 1TEIA 4XJWA 1J0RA 2HDWA 1O5UA 4Q8KA 3OYMA 1S0FA 4NB5A 1JT6A 4TSVA 1MDMB 4DUWA 3G73A 2GP5A 4LPLA 4N0BA 4ZC3A 1M1EB 1HCRA 1Y6IA 5FJHA 1ENSA 3CKHA 3TBIA 5JZGC 4K1ZA 1ZLJA 1KU7A 1PNGA 2XF7A 2B42B 4QPGB 5CVRA 4RAGA 2EIGA 1M4WA 1ZBE1 1B72A 2GC2A 1H6YA 2QQWA 5CFDC 3JBG2 2EINH 3UKTA 4Y22A 3F9KA 3FHNA 2RM21 1ASJ1 4NO4A 1RJ7A 5K9YA 2QQMA 1U6GA 4BOWA 4XONA 3HBZA 3L2WA 3MV01 3ZQGA 5A3UA 3RMYA 5KHKA 2QCOA 2X8KA 2F6CA 4GCVA 3L7WA 2HWC3 2PHWA 2RDNA 4PLMA 3E6CC 5CQGA 4BISA 3PFIA 1CAVA 3PDQA 4PCQA 3CBNA 5HXVA 1JN2P 2FJ1A 5FYHA 3J81K 3H42B 2WN3A 2CU5A 3FZVA 4RD7A 1B8IA 1K78A 4IE4A 1NG6A 2QA4I 5FY0A 2VNVA 3TOBA 3WW3A 4BIOA 2BXYA 1KDKA 4ZU5A 3AP9A 2UWCA 3G1MA 2FQPA 2ZXJA 5M0TA 1G3SA 2XG3A 5IVVA 1W7PD 1JUPA 1GXPA 1U2WA 3NNGA 4RQPC 1Z05A 1JKPC 2ZFWA 1TTYA 5JLWA 1JYVA 4D8MA 1XSXA 3HSEA 3BZ6A 2Y2ZA 2VMGA 5AC93 1W06A 2HWB1 2COMA 3ML6A 1ZZ7A 2OA2A 3J80K 2COBA 2QZ3A 1K4TA 2MEV2 1H88C 2VKEA 4IHTA 4Q1PA 2WO3A 4QKDA 1UAIA 1W6PA 5B4NA 2WLPA 1XC6A 2YX7A 1KYWA 4ESJA 5A6QA 1STZA 4BJ6C 1OF4A 3MIFA 3DEUA 1B6AA 5FLXK 3AZZA 2BBAA 1QIQA 4XQFA 2A3XA 5A3OA 4HX8A 3ZMDA 3M7AA 3ZMVA 2PMUA 3GZUC 4ETSA 2BXZA 1Y0NA 3H35A 4IHYA 1WLWA 5GAEJ 2EICA 2BWCA 2NN8A 4JK1X 4AHWA 2XVCA 4Y13A 4MADA 4BXXJ 2CS3A 4RGUA 4QQ2A 4AVBA 1YS7A 1PMIA 2C5DA 5E1RA 4C3IJ 1JYXA 1ZH5A 3GTGJ 5FUIA 4XKCA 2EIJH 4CDUC 2VTFA 2NVXJ 2ARAA 2ZS6B 3RKXA 1VE0A 1KQ9A 4Y1XA 3HGGA 2DW4A 5LLQA 2BY3A 3VZNA 4XFHA 4JGZB 3P9CA 3V65A 4MSVA 3H50A 1GV2A 3NAPA 1PGW1 2VQTA 3EDPA 1PHMA 4LBNA 3KP5A 4ENJA 4P9LA 3MUY1 5D6EA 3PUBA 1RUE2 4G7OF 2KP6A 3H8OA 1QXRA 3G2BA 5JAXA 2AACA 1Y0UA 2P5VA 1CAWA 3IN9A 4IGQA 2EJRA 5AVAA 4CP0A 5DUXA 5CIRA 4ZYEA 2PLV1 1TZOA 5EHDA 1R1A1 5LGUA 2K9ZA 3GTKJ 1H9TA 2XUBA 2DVFA 2ZXQA 4B7EA 2LMDA 3JTHA 3GFLA 1V6JA 2FSWA 5CADA 5IOYA 4U87A 3Q8AA 3GF6A 2BP6A 4XUOA 1CAVB 5JLVA 2KJBA 4A3FJ 3OB8A 3GZTB 3THTA 4H55A 1R71A 1KJRA 3NKTA 1H9GA 2JPBA 2JSCA 4DRVA 1O59A 4OCTA 3J7YJ 1KQ8A 3OUJA 1X2NA 2OQRA 4R4ZA 3LSEA 3K4KA 1VQNI 3RZZA 3FXKA 3OGRA 3PU3A 1F8VA 3HOBA 2VE9A 5JZGA 2P6HA 4IEZA 4UI9L 4FX0A 1VQ7I 4XRFA 2KIMA 1GU3A 5FZHA 2ZXWH 3POJA 1W8FA 5J37A 1R1UA 3ZMUA 4IQPA 4KQ7A 1L7QA 3K2ZA 3WODF 3RYRA 1JHNA 1ETOA 2RDQA 3OGVA 5IHRA 1Q5OA 1S1AA 5FMCA 4UW5A 4LBOA 1MMDA 5FP9A 3TDZC 3C7FA 4PJMA 1BW5A 4IV1A 3I55I 3H3ZA 2RS51 2HWE1 1OPMA 2DUPA 1D3YA 1K83J 1S9HA 2EALA 4LB6B 2HQRA 2IA2A 2PA7A 5G04L 4OIRF 4WV8A 4X6AJ 2R0HA 3DUIA 2Q8EA 4NHYA 1B59A 4QGMA 2ZNZA 2B9UA 3BIEA 2O6GE 2RR11 3PFYA 4ZZ5A 3HSFA 3VBUA 4CYCB 1IJWC 2IGOA 3S14J 5FJKA 2FBHA 3IZOA 1P7JA 4E27A 4IO9F 3WG7H 1R49A 1WCSA 5BQTA 1ALYA 3MVPA 1AYN2 4LO5B 1JXNA 3VD5A 1AF9A 3T4HB 1RVF3 1U12A 3K4CA 1C8M2 5C3PA 1FIPA 2GOXB 2X05A 2F17A 4HDVA 5F9TA 1W03A 5T55A 2ZEYA 5IT9Z 3MV11 1Q8QA 2K4JA 1YXWA 1ZG3A 2YROA 5GLVA 2L7ZA 1BVVA 3T0BA 2BW8A 1X3UA 2X6WA 4OWRB 1RUC2 2ZACA 4NIIA 2MD5A 4MHGA 5HCHA 2YV8A 2JWTA 1K4SA 2LUWA 3OEBA 3RZLA 2Z16A 1E5SA 2RR12 3VGIA 3KSCA 5LGTA 4HF1A 2E53A 4Y52J 4YW5A 3FFQA 2NQYA 4N43C 4XDQA 1LFBA 3WU0A 1BQPA 3MN2A 1JXSA 1QJY3 2DFIA 2ZAAA 4QB2A 4HXCA 5FBZA 2D43A 1H4HA 3HBLA 3VYTB 5B1AH 3OYJA 4DBQA 1LU2A 1HJGA 1SPPB 2BNNA 2QVOA 3VOEA 1DGRN 2X09A 5DAQA 3PNVA 5HPOA 2WRAA 2CAUA 5L3GA 4XDPA 3L2RA 2KL4A 1X3ZB 3HM5A 1BXHA 2FCTA 3MZ8A 3VD3A 4MFDA 1FMVA 3RCOA 4WWCA 5E8AA 5B1BH 3HXLA 3LE0A 1I1GA 3T1LA 4JGZA 3S1MJ 2VBZA 2PEXA 4ANJA 1HB4A 1XG1A 3HQRA 1RHI3 3GCXA 4A4AA 2EZKA 4PGHA 3H1YA 5B3SH 1D1CA 4BS9A 1GLNA 1ZN2A 2W82A 3Q8CA 3LZZA 2ZSHB 4UBHA 4W4ZA 3B3QE 1MJBA 4UV9A 2ELKA 4PDKA 5ACA3 4FBFA 4IHWA 1R4NB 4P5HA 1OPCA 2MC3A 4CDXC 1YOVB 3O8HA 3QPSA 2BOJA 2K4BA 2W25A 4CCCA 4JCKA 1MBKA 1WHUA 4G12A 3DPLC 4L0PA 4M3CA 4LK1F 5T54A 2MEV1 1Q8VA 3RI9A 1O91A 1X82A 4MEXF 3PO2J 1CONA 3RPUD 2EFQA 3HKZN 2BV4A 3WTUC 4DQAA 3BODA 1USTA 3VYRB 1JODA 5AC92 4QDRA 3CTAA 5ABJC 2EXIA 5DAWA 3CJIB 4BHCA 4NAOA 5H6QA 3MYXA 5F0FA 2ZMEC 5A7SA 3H8UA 1Q1HA 1D2SA 2I45A 2HKOA 3ISPA 4EM0B 2VNRA 3ZXAC 2IZWA 1ODDA 2E63A 4N8MA 2HTJA 4XKWA 1VQ5I 5KAFC 1Q8PA 1LAJA 5FMBA 2VMDA 1NY72 4V19K 2E2JJ 2LDUA 2Y0MA 1G9FA 3GF2A 2Y6LA 1A36A 1AX2A 1CIWA 4CUCA 3LAJA 4CDGA 2UWBA 1D5VA 1OCZH 2E7AA 3RZMA 3S1NJ 2FU4A 2R7XA 1AOYA 2A6ZA 1RRJA 3BWGA 3T0DA 4XRSG 1LOAA 3KB5A 3CLPA 2A5WA 1D0YA 1H0MA 4ZTJA 3N7LA 1IS3A 5FZ8A 1ZX5A 5T3NA 1LOEA 1JGSA 3HSRA 4TN7A 3JBG1 1WJCA 4C3JJ 4EN9B 3RMXA 3JRHA 4IE7A 1TME2 1Q8OA 2WB1N 5KXEA 2Q8CA 2M0MA 2HWD1 2BPA2 1J9IA 4HG6B 1MZEA 1QJU3 3EUKL 1V9U1 1QGPA 3P9KA 2LALA 2Y26A 4L0YB 3CD6I 5FGMA 4GWMA 5CLSA 4LG3A 3I8TA 3JBG3 1SLIA 1YYVA 2Y6FA 4L97A 4URAA 1OVSA 1T2XA 2XH6A 1JOJA 1UOFA 4AK3A 1I5PA 3C2UA 4E8DA 4HRIA 2E60A 3R0AA 4RGAA 5LA9A 4MGSA 1RVF1 3MO4A 1FPQA 4FTBA 1GNYA 3VL9A 2LVSA 2RJLA 2AQEA 2OPTA 4DW6A 4XMAA 4XFAA 5BNNB 5L3FA 2KDOA 1DCSA 1O7FA 4HLXA 4HF0A 1YW7A 2CMPA 2V5DA 4A7YA 2R061 5JLXA 3TYJA 4OIQF 2BW3A 4XLHA 3SFIA 5F39A 4N53A 2WLQA 1A34A 5IK5A 5HI0A 1OJLA 1UMQA 2EBIA 3MZYA 3D8CA 2KFDA 2Y9YA 3WNXA 1MPXA 2JA7J 1OCRH 5K4LA 1LEAA 4AE2A 5K7HA 1MSEC 5HV4A 1D0ZA 3I5UA 2Y34A 3THCA 3VBOC 2W85A 5D8LB 1AR62 3ZXLA 1ETKA 4HBLA 4R9AA 4UAPA 1RJ8A 2BFUL 4WZFA 3DYPA 5K7FA 2CW7A 4YM2A 3EUHC 3O6BB 4OI2A 4BXFA 3PIOF 2D6PA 1UZVA 4NDLA 2RE9A 1IRZA 2Q5TA 3ABKH 1K12A 3ZYFA 1ENXA 3I2FA 4MGYE 4DXSA 4FPJA 4D7TA 4LLLA 1W36D 1GOHA 1Z7UA 1QJU1 2R16A 3OYWB 3CEWA 4G94A 3PTYA 3K4DA 2VT3A 4A3GJ 3QACA 3M3CA 3WDVA 5ABJA 3IRQA 3LQQA 2DCZA 1Z3YA 4L0ZB 3J9SA 1RHI1 2JT1A 3SCGA 4ZS2A 2UWAA 1GANA 4COYA 4R9CA 2OT7A 4NIGA 5DABA 1SFUA 3WNKA 5F7UA 3ROUA 1OUSA 2XAHA 4FSJA 5HDGA 2CGNA 4YG3A 2LBFA 1UYXA 1F35A 5F3GA 4E4DX 1EH8A 1FNZA 1KYZA 1X50A 1MS1A 3D0JA 3BTZA 4EGZA 2VOKA 3CHXA 1BI2A 3HUGB 2R1DA 3JRBA 1LOGA 3KGZA 3QAHA 5FKKA 1VMFA 3B69A 1ULOA 1XN7A 1EAH2 3GFIA 1KONA 5J40A 1PO21 1FOD3 2ZMLA 3JQXA 2YR2A 2ZEZA 5DYMA 3TP0A 4HLTA 2VPVA 2D3SA 2JRTA 2ZO4A 4K3UA 3DBLB 5JXJA 2VKHA 3S3NA 1ND3C 2P37A 4HV5A 2OYZA 4XLAA 1RUF1 1ZK8A 2A6WA 3VB2A 1N1TA 4ENKA 4L8QA 1UIKA 2R042 3HNYM 3TP3A 3OS2A 4CP9A 5GALA 3OJBA 1IXCA 1POV0 2C24A 1XNKA 3IPVA 2QDRA 1JGGA 4XW3A 3SLIA 1G9DA 1SD7A 2OUMA 1CR7A 4G9SB 2ZGQA 3SCHA 2DA1A 1J83A 1IC8A 2O14A 1UHSA 4I0AA 4HDUA 3ERMA 5CFCA 3HOYJ 3S5AA 4CU7A 4HX4A 4PFOA 1QQP2 4KMFA 4DIQA 4BK5A 4FAHA 2VXDA 2VG9A 5CKQA 5EGOB 4BHBA 3KT4A 2FDHA 2ZKNA 4TZDA 5K0UB 4LJZF 2J7MA 4NVPA 1JYIA 3OGSA 5I0SA 1KGSA 3BJAA 3HJEA 5BNNC 2DK8A 3KF5A 2WV0A 5IYBJ 3AKSA 2HYKA 4MO3M 2DA4A 3RQIA 2AEYA 4A69C 2VLAA 1KD7A 1WMFA 1SVMA 3V0AA 5LB6A 2ADUA 2A3WA 3OUHA 4AF9A 2PLV3 2RS11 3VZMA 2KPMA 1RHI2 3NVCA 2C9KA 4JRLA 1ZRCA 2UYBA 3B9CA 2A3YA 5CPRB 2WT2A 1DGRM 1H1MA 2IXKA 3M9AA 2WT1A 4PK4A 4AVAA 3N35A 2H8RA 1AYN1 1VRH2 2LY2A 2F6BA 3I2HA 3GNEA 3OOXA 3UNPA 1TE1B 5DS9A 1QQP3 2J1EA 4OZXA 1C3HA 2CWSA 2JEMA 1R22A 3K2AA 2AC1A 3S2WA 1I27A 3Q9OA 4KH9A 3SEPA 3SYTA 4WX9A 5KK1A 1DQUA 2R3SA 5JXHA 4EN7B 2DA2A 4FQZA 3RWKX 4CVUA 3WTTC 4XUQA 4IVNA 2V09A 2JVHA 1E5IA 3ZGKA 4XILA 2WNOA 4M9ZA 2JICA 3SHRA 4EWEA 2XAUA 4XC9A 4NRPA 5H6RA 2W1OA 3T4VA 3QPHA 3RSNA 4IHSA 3HD8B 4Y24A 1VQMI 5H20A 3AZXA 3E5XA 3BR3A 2VZTA 2Y0SN 4BACA 4Y1ZA 4YM1A 1DZTA 2VW1A 3I3BA 1AR61 5SV5A 2HWD2 1GZWB 1WBFA 4JKMA 5FPLA 2JG8B 3KCXA 1MS4A 4QHBA 1W04A 2DJIA 1E0EA 3N7MA 3U4SA 1EF4A 2EA2A 2DBBA 2RS31 2YGMA 1DYOA 5FYSA 4A42A 3OYGA 4JDOA 3WXPA 5K0UC 5JHFA 2CQKA 3FIWA 3VYSB 1UQXA 3I4IA 1DU6A 2HI3A 2R7TA 4GYIA 2EWNA 3WG4A 5KHJA 1EV11 4BYYA 4V1PA 1W4MA 1UB9A 2WSVA 2EFOA 3KT7A 1LNWA 2EFWA 5BYNA 5E1XA 4S0HB 2JE9A 2WZ8A 3BTAA 3GTOJ 3J7ZI 3TN93 1C0WA 4JAAA 1FIAA 2VW0A 3GM8A 4QKNA 2PQ8A 5LBBA 1RUD3 2DFBA 2HWB2 2LY9A 5ICFA 3P9IA 5A3PA 1O3TA 4D5CA 1ON1A 5TGTA 3OUIA 2V6CA 3WSOA 3DECA 3RJPA 1KITA 2ZMNA 4ZYDA 4LHLA 3VBFB 3SITA 3WCSA 1DZRA 1UKGA 2KLOA 3H9AA 4AR2A 1ULFA 5FAXA 5H2FC 3VDDB 5EJ1B 4BE3A 4C8DA 4ZZDA 3ECHA 2HYGD 5LASA 4AHYA 1I1SA 3W6KB 4PCRA 1ZBA1 4IEQA 5C4XJ 2XRNA 3VFZA 1OURA 5CAZA 2YU2A 4NUBA 3S5QA 3WGIA 1KQRA 2VBBA 3BT9A 4OI1A 3ZQCA 2Z5WA 4YEJA 4MTEA 1BC7C 3MFAA 2DF7A 2W47A 1FV3A 5J4VA 2GNBA 1VBE2 4CDUA 2VJJA 2A3SA 2IBDA 1UXXX 5C33A 3WF3A 4KITB 2W08A 4RGGA 4CDWA 1U5YA 5FO7B 1ZAOA 2Z3YA 2HWF2 5FZ7A 4J19A 1W6NA 4MO7A 1T56A 3WNLA 1JKRC 1B72B 5K0UA 4XFCA 1CIYA 4B4CA 4GJYA 1RIOH 2X4HA 4XUPA 1WMDA 2FBIA 4OIOF 1W6QB 3POBA 5FFOC 3DPRC 3JRAA 5C9AB 3BZCA 4YARA 5HNFA 2JG8A 4NPRA 3J7AY 4YVSA 5LRSA 2EK5A 2YDEA 1S72I 1O8PA 3N36A 4GDFA 2VVFA 4L5JA 2Q8KA 2JUCA 1YEWA 4K8RB 1BC8C 3USUB 3ZSKA 1Q1VA 1FNYA 1QHHD 3QBQA 4AM3A 1EV7A 2JENA 4QWNA 5D21A 3QH7A 1XYNA 4AFAA 1TW3A 2LBFB 3OBRA 1VBE3 4S2FA 2K7LA 4A12A 1RKTA 1P6RA 3B02A 1RMU1 2B9SA 1XJAA 1T39A 3NO8A 1BMV1 1YC61 5C3SA 2WNUB 2BJSA 2ZX3A 3IV5A 1V9U2 1QVUA 1D8JA 5FO9B 2DVBA 1ZLKA 3HOXJ 1J3QA 1VRH1 2RS13 4GA9A 1MIJA 3HOZJ 4J01A 2JIGA 2QE3A 1Y7BA 2WABA 2EFPA 3NWKA 4E7LA 3ASNH 3JB4C 4A3XA 2VC0A 4JGZC 1XSRA 3CF5F 1QA6A 1U5TA 1OMIA 4DINB 3U37A 1FTTA 5D4SA 2DODA 1P4WA 3W6JB 1HRV2 3L2CA 5LEJA 2IAIA 5FZLA 4TLGA 1REDA 2XLAA 4ES8A 1OFCX 2XPUA 1SFOJ 1ONAA 2DUQA 4IEXA 4MGRA 4Y17A 4BM8A 2MEV3 4JX5A 3FXMA 2BY0A 4GGGA 5LHGA 1VBC2 2Y6HA 3ILRA 3ZSJA 1NQJA 4G3YC 5F6KA 2L7FP 2O8OA 1HSTA 4Q4X1 1LR5A 3QU6A 3E6BA 1GQPA 1ZZ6A 5CFDA 2JSPA 2XBO2 3PJYA 1VMJA 5BNOC 3N9OA 2VH9A 3H8XA 4FOQA 5FPXA 2VUMJ 1KU2A 2W1SA 4Z07A 2YU9J 3LAGA 2X51A 3BVCA 2VW2A 4QPIC 1VBD3 1GICA 4IX7A 4GMP3 3COAC 4AWDA 2AS5F 3KFWX 5CQEA 3G1LA 5FLVA 5FZ4A 1ND3B 1SFPA 3HHHA 3AL5A 2E26A 3QD6A 5LZ6A 1UY1A 2D45A 1LPQA 3VKLA 1TQIA 1SFYA 2XLFA 3JAMZ 4WM7C 2J1RA 4QX1A 4XEZA 2VM9A 3NMBA 5FZMA 1ZBA2 1WW6A 5F5IA 3EUAA 4COUA 4OQ9A 3OYCA 1W6OA 4BY7J 1IRGA 4L18B 1T08B 1R083 2RS33 1RUOA 3WZ1A 5JVGF 3CMYA 3TAYA 1DHKB 2M7AA 1D4M3 3A0HC 4IUGA 2E31A 4AIHA 1VBA1 4YW6A 2XF5A 3C7EA 3DLLF 3ACHA 4NE9A 2DTWA 1K78B 1J58A 3S1QJ 1WCDJ 3KETA 4QX7A 4XNFA 1VQKI 1FYUA 4L11A 5K1YA 3WP3A 2UV1A 3AFKA 4M4PA 1W99A 3S2DJ 4OI4A 3FHIB 3HR9A 2XSDC 3R05A 2HLEA 1BJAA 3W5MA 2NLRA 1VLNA 4KGGA 3FBYA 4OQ8A 4RA0A 1IPSA 4X8PA 3NV1A 3M3EA 1Z7LA 4XRSA 5FCCA 3OIQA 2MSYA 4RGRA 3GDBA 1TT5B 1QJY1 3VDCA 5KXDA 1D7PM 2FOWA 1A6QA 2R7EB 2UXNA 1CVNA 1PX4A 1PZ8A 1QOTA 3I3EA 3KQ4B 5JOXA 4BE2A 3ZSMA 4LBKA 5EP9A 3MBWA 3ME2A 3PNTA 1IZ3A 3D82A 4QPWA 1CQTA 3J80Z 4P02B 3M70A 2QGUA 3RPUA 4FASD 1UJ8A 2RS52 2LOOA 1IDZA 1ZG1A 3WQ1A 2VZRA 1NYWA 4QD2A 5FB2A 2ID6A 1P2FA 4TV7A 2R073 2FE3A 4FE4A 1WCMJ 4FO9A 4HX7A 2Z1DA 5EZHA 2VKDA 2NMNA 2X48A 5HBAA 1ZRIA 4M01A 4KWLA 1DZQA 4OMDA 3A0KA 4ASKA 2HWC2 4KWJA 1ERDA 2GNDA 3GCMA 4OHZA 3USSA 3D5SC 2YFUA 2QM3A 3UESA 1RXGA 4DBRA 5FYTA 2PAKA 1JKOC 1UOJA 1S0EA 3AFHA 2IS1A 1WLDA 2X53S 1W0TA 1CESA 5FKMA 5TJJA 4CCKA 2V79A 3LD8A 4DRRA 2CWMA 3BJ6A 3LAPA 4QMAA 4ARYA 2W4SA 3BR0A 1DQ5A 2GC1A 5FY8A 5HV0A 4CU8A 1T95A 1YX3A 2H09A 1X19A 4CCNA 3S7IA 5FZOA 4XF0A 3L2VA 2FCUA 3POFA 3ZXSA 2A7AA 1VBA2 1R7JA 4LXLA 1PZ7A 2QLZA 1QJZA 4GH4C 3VKOA 3WUDA 4QHZA 4IEUA 4UUTA 4FXKB 5LCWL 4B4PA 1QZZA 2R7RA 1BCXA 1FX5A 5HS7A 3WU1B 5J09A 3CMGA 3IPVB 4QKFA 3WNOA 2NYXA 4XZPA 1DP3A 1SACA 2ZTNA 2E7QA 4HANA 5H9RA 5J1YA 3I9V2 3DV8A 1OFSA 4FPGA 4B8EA 1JJ6C 4SBVA 2Y8KA 4AG4A 1GMMA 2L9NA 3K70C 3NNJA 1O4ZA 2XIGA 3HQXA 5TRDA 3LQCA 1QJY2 5I0RA 4BQWA 1TL8A 2WQZC 2DYCA 2W9XA 1OLRA 2VBPA 1FT9A 3BI3A 5IFPA 1YITI 3AAFA 3AYAA 5LBEA 4CO8A 4H7MA 4PQ9A 4UF0B 2LD5A 2WZR1 4R9DA 4HV6A 2R30A 4IV3B 3LA3A 3FLTA 4FQGA 1RL3A 5AFBA 1PNFA 1NAEA 4IEWA 3KHBA 2R7FA 1BR2A 1RESA 4WM8A 2Y33A 1MBGA 4DO0A 1VQPI 1K5MC 1X7NA 3GGLA 1GUIA 2HYXA 1UCXA 5BXXA 1OQEA 1W7PB 1FX7A 5EXOA 2RVCA 2L5QA 1JU3A 2XB6C 3CZJA 1NLQA 5GZCA 4CXFA 3NJYA 2VXZA 1U5TC 4WXDA 4KICA 1LUJB 2VQCA 3UETA 2DQLA 4XCAA 2H6BA 4HOBA 1OVPA 4KIFA 4IHXA 3ATGA 3IKWA 3TO6A 4IHVA 2BVBA 2WNVB 2BERA 2A05A 3C7OA 3LFIA 3PVBB 3H1MA 2R7ZJ 4L9BA 2VNGA 2A5ZA 1RUG3 1UZWA 2O7OA 4G7HF 1ODMA 4AI8A 2W68A 2W39A 2VVEA 4RGKA 4B4QA 3WNMA 2UY9A 1QNWA 1K79A 3J7NA 4HPQA 1I6HJ 2STTA 1E5RA 4ZJZA 1G8XA 3ZSLA 5KXCA 2X6YA 3NARA 1W9FA 1S29A 3SEQA 5HLTA 5IAVA 1LU1A 4YVSC 3G6EI 3CDLA 4I01A 3HPNA 2DU9A 4AFCA 3RZHA 1Z6RA 3I7DA 1R081 2VZPA 3DCQA 3TKYA 1W2TA 4LBQD 4LITA 3VZLA 1BEV3 5F8PA 5EYRA 1NK3P 2Q4SA 4Y15A 1BZWA 5E6HA 1QPIA 1FBQA 2DA5A 5I0UA 4PZJA 1HB2A 1I9RA 4XXAA 1K61A 4I3PA 1VBB2 5HODA 2JKBA 2K9MA 1OBNA 1LESA 3HN3A 4RS5A 2YU3A 2VY0A 3KV6A 1VBA3 1LHUA 1AUYA 2X1DA 4L92