1ZRFA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
203
structure length
203
Chain Sequence
b'TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 64
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrfA01
1H9TA 4U88A 1MJ9A 1QO0D 5J7MA 3EYYA 2M87A 1ZH5A 3ERED 2O03A 1ZZCA 4ESBA 5LHIA 4Y17A 4EJWA 3BOQA 3EDPA 4HSLA 5DCMB 1REPC 1EV7A 4EMSA 1Z7UA 2KJBA 1DGRA 1P92A 3CUQB 1UHWA 4G8XA 2FQ3A 1XDSA 2GA1A 4O5VA 2VPVA 1ON1A 2EFWA 4I3PA 1CAXB 5D1IA 1YHFA 2A5YB 4RAYA 4HA8A 1BJAA 4LLNA 1V4RA 2Z69A 2P5VA 5ILSA 2PQ8A 4I0AA 4UVAA 5DD4A 5HDNA 1MD0A 1AWCA 4XF0A 3ZMVA 4B09A 1JHHA 1IN8A 2ZNZA 2IW5A 2GC0A 5ILUA 4Z82A 5LEJA 2OZ6A 2FF4A 2B0LA 1MKMA 4E2SA 3ZPLA 1UCRA 3K0LA 1Z91A 3HSEA 3K2ZA 1J3RA 2QDRA 4ON0A 1O3TA 4D7SA 3PFIA 1XE8A 4R8HA 4I0BA 3KP4A 3M7GA 4KMUX 2IVMA 5I93A 1DPRA 1Q43A 3R61A 3VODA 1SQ4A 1GXQA 1XCBA 4LTAA 3FX3A 1OYWA 4N9IA 4L11A 4HLXA 4L0YB 4UUVA 3CTAA 1TTYA 1J3QA 2JPBA 2P5LC 1B59A 2XLFA 3EBRA 3TGNA 1U78A 5CVVA 2K4BA 4N9HA 1EH8A 1NE4A 3DXJF 3DQVC 1SEFA 4P96A 5BS6A 4G7HF 3ZDSA 2E9QA 4IEOA 4M73A 2FEZA 2KIFA 1QZYA 4HV5A 1B6AA 3H7YA 2MA3A 2P4WA 1RZ4A 2A61A 4DNCA 1BOAA 4PCQA 5I0UA 2MC3A 4GO1A 3OGJA 4Q0VA 5JI6A 1IZ1A 1WI9A 2AS5F 4WXHA 5BPIA 2VODA 3BPXA 1J0RA 2IXJA 1Q5OA 2CGPA 2IPQX 4RGRA 5HDKA 1FI2A 5HLGA 1YYVA 3K9TA 3AAFA 1LJ9A 3JSOA 3G7DA 2F5FA 3E6MA 1IPJA 5FQ0B 3CO7C 1O7LA 2TDXA 4HX7A 5JSOA 1FC3A 3OV8A 3DL3A 5T3NA 5L3DA 5CLSA 1J1LA 1XD7A 4N0BA 2P6TA 2PFWA 5I91A 1R22A 2W24A 2QBYA 1H1MA 2COMA 1LB2A 5E1XA 2JZYA 3ZN1A 1SFNA 5LGUA 1XGSA 1FOKA 4OMYA 1HKSA 4EGZA 4HF0A 2ET7A 4KIGA 4XSXF 3DN7A 2G7UA 5KHKA 3WU0A 4ESFA 4JBAA 3PVBB 1Z6RA 2BGCA 4I98B 3HOSA 4LLGF 1TQMA 3T1BA 3IRRA 2IP2A 3ZMUA 1UW8A 3T5XA 3GF2A 2KJCA 2GWRA 4EROA 1YS7A 2PN6A 2JRTA 1SD7A 3ABTA 3K1PA 1BC8C 3EO6A 3ECOA 3LOIA 2PFBA 2QENA 2EA4A 3GXOA 1IPKA 4A5NA 1FP2A 2RVCA 2ZMEA 3SMHA 3NL1A 3SZPA 4PGGA 2OPKA 3ULQB 4O9EA 1LKNA 3BY6A 5E8GA 4CICA 2XUBA 2ATFA 1I5ZA 1KQ0A 3RJPA 2EFPA 4MGRA 1J2XA 2GZWA 3RDIA 4BHBA 3RZZA 2OBPA 4A0YA 4BAYA 5K1YA 1QQIA 1XSVA 4KDPA 3V8JA 3WU1B 5FFZA 2PHLA 3HSFA 3V7SA 1HBXG 2O8QA 1XMKA 2H94A 2JTVA 1Y0UA 3BP8A 2VQAA 1HW5A 3VHRA 3EYIA 4HVOA 4LG0B 4U0YA 2HYGD 1MJAA 3S2WA 3FHIB 1UPIA 3BJ6A 2CQKA 3ELNA 3D0JA 3E6BA 4XFHA 3FJSA 1ZHFA 4YFXF 1VP6A 5LRSA 1RC6A 4A5MA 4M9SA 4CGZA 3FM3A 4D0PA 3WTYC 3TNPB 1CF7A 3U2RA 4DINB 5LBQA 1D8JA 5FLIA 5ICFA 4NHJA 5ED4A 2FE3A 2FQPA 4LD5A 1CAWA 1PP7U 5DYMA 4KNYA 2STTA 4ZYGA 4MQVA 4KU7A 5KHIA 3FFQA 2ISZA 2MD5A 2L4AA 3J7AO 4XF4A 1ZLJA 5F1RA 1O3QA 5FB2A 4MHGA 2FSWA 3ZMTA 5BPDA 3K69A 5D5VB 4LJZF 4XLNF 2H6BA 4OLLA 1CX4A 5DUIA 5I8SA 1G3WA 1TBXA 1DZTA 2P17A 3SHFA 1QXRA 3O14A 2HGCA 2ZXJA 4KICA 3ZMSA 2LSOA 2NYXA 4YNIA 5BXXA 3HSRA 3T0YA 1XMAA 5HVQC 5E1WA 1XGNA 5KHHA 5FLHA 4LA3A 1YW9A 2H0VA 3BCWA 1ZZBA 4J1WA 2R7FA 4P5OA 4PIZA 3H1YA 4UVCA 2RDPA 2GIVA 1KU9A 4BH9A 3FMSA 3R4KA 4UBHA 2Z9OA 4A6DA 2BEOA 5FD5A 4NB5A 4IERA 2D1VA 4A2UA 2OYZA 3SCHA 1YG2A 4ZU7A 3C7JA 4ZYDA 2J5OA 1WSUA 5E20A 3FE5A 2H6CA 1ZREA 3GLXA 4GGGA 2IXCA 4EM0B 3LA7A 2HWVA 4S05A 2O8XA 1EH6A 4PDKA 3I53A 4E2QA 1SAXA 5TRDA 2DLLA 3TKYA 4UXNA 2X4HA 1P4WA 5I0TA 4KUMA 2YX7A 3CL1A 3WTTC 1ZZ7A 2WC2A 5JR3A 2NAZA 1HSJA 2HTSA 3QOPA 3V7CA 3W6KB 2AXLA 3H92A 1U8RA 1UIJA 1U3EM 3KCCA 1ZVFA 3HHGA 1F4KA 4U0VA 2IA1A 3SXWA 3DKWA 4ZYEA 5IT9K 1J9IA 4U7BA 2GU9A 3GBFA 3UKNA 2K02A 5FDBA 5J6XA 2P6SA 3RYRA 4JTNA 5L3CA 2QUFA 5FD6A 1RTVA 4CYDA 4XEZA 3PNAA 3DPTA 4MUVA 3CO2A 1EH7A 2Y75A 5IT9Z 3NW4A 1FSHA 4ZU4A 2E1CA 2VOPA 1FP1D 3L9FA 3GYHX 1XN7A 4KA4A 1ODDA 2RGVA 4HN1A 1OR7A 4FAGA 3JTHA 3F8MA 2Q0OA 5DV5A 1OPCA 3GZ5A 4U0WA 4E70A 3GX4X 2P8TA 4AD9A 3H1WA 2M8EA 2VE8A 5HS9A 1YFHA 2HOEA 3WTWC 1BM9A 2QWWA 2D1HA 2MPFA 5L3EA 5KHGA 1R5HA 4IPAA 4YYOA 2HZTA 3REOA 1E17A 5D6EA 1LEBA 2CSOA 4ESJA 2NNNA 2Z5UA 4OOIA 2KIUA 1YLFA 3KE2A 4UNOA 1R1UA 3V7RA 3NVCA 2V1UA 1P4AA 1FYLA 3WE2A 3UKVA 3L7WA 2ESNA 4Q29A 2Q30A 2OQGA 4IEQA 2FMLA 2DPUA 1YLLA 2UXNA 3IHUA 3DFGA 2YSRA 2UYAA 2W84A 4B8XA 4AWXB 4UBGA 1ZLKA 3DF8A 1V3FA 4ZYHA 5FFXA 3ZMZA 2CG4A 2PLYA 2Y0MA 5CVUA 2P5KA 3HRSA 3ES4A 1JXSA 5I8TA 4R52A 4L9JA 4DQ2A 3Q9SA 2QNKA 3L00A 4KWKA 1IRFA 4IEWA 4X6RB 3PQKA 4OINF 1KU2A 5CVIA 1LNWA 2M5WA 2OAZA 2V6CA 4EGYA 2KIMA 2ET1A 1YFUA 1B4AA 2RQPA 1OFNA 1U5TC 1L0OC 2I45A 1WWXA 1TW3A 4A0XA 2KRFA 5JR7B 1R23A 4QX5A 4GYIA 1ZG1A 4FBFA 2QZ8A 1X8EA 1XSXA 1IW7F 2ZFWA 4EM2A 1SD5A 1H1IA 3IKVA 3F8BA 1B9MA 1LDJA 2PI0A 2PAEA 3P7NA 1HKTA 3NJZA 2D45A 2L3DA 5FPXA 3KZZA 4WZCA 3U1DA 1U12A 4Q0UA 4MX3A 2HTJA 4X6QB 5HS8A 2HJIA 3VOEA 2M45A 1ZG5A 3USSA 3F6OA 4RD7A 3P9CA 5HS7A 1GQGA 4XFFA 4ENKA 2QBYB 4KYWA 2WFPA 1KQ8A 2ISYA 4ZH4F 3RYPA 5KVRA 3ETQA 3EJKA 4FX0A 2UYBA 3IL2A 2IXHA 4HX8A 4LMYA 5JVTA 1HW2A 5CADA 3QU3A 1WKMA 4BIFA 2FNPA 1FBSA 3MEXA 3ELKA 4G94A 2PA7A 1I6XA 3LA2A 2IJLA 2BNOA 2BBYA 3V8KA 1ZRFA 2OZJA 2F2EA 1FX7A 3E6CC 4IF4A 4NQWA 4CHUA 3BALA 1ZNPA 2K27A 4KWLA 5AIQA 4XF1A 3KLNA 2OQRA 4WVZA 4HW0A 2A6EF 3LAGA 1L3JA 5DCFA 5F6FA 2PMHA 3D0SA 4PJYA 1YTYA 1WRJA 5F64A 2DK5A 4PIYA 1JE8A 4HAMA 5J48A 2B9UA 5JHUA 3Q5FA 2YX4A 1O7FA 2GC2A 3IC7A 4XLPF 2OA2A 1WQ2A 2ZMEB 3M8FA 2VBWA 1G3SA 5D8KB 1UD1A 4UXAA 2HDCA 2MLKA 4K2EA 1W5TA 4O6JA 1YO5C 3TDUC 2O61A 2HR3A 1CAVB 3HRMA 1USSA 1R36A 3D5LA 2C0ZA 2ZNYA 4IRHA 4QMAA 2DU9A 2XIGA 5AVPA 3HRUA 3VFZA 1O3RA 1EPZA 2LKPA 3R6SA 1PM7A 2DBBA 2XAJA 4UV9A 1PDNC 1YUDA 1SMYF 3PLQA 3QP5A 4XFAA 3E6DA 1ZRRA 2QQBA 2VT3A 3C1DA 3LSTA 3WTZA 1P6RA 3MYXA 4QXKA 5JSPA 1FYMA 1BIAA 1UCXA 2QVOA 1IF1A 3S7IA 3TOAA 4BQAA 1USTA 1U5TB 2WTEA 1OYYA 5ICEA 4I02A 1KU7A 3MFKA 3F6VA 3MAJA 4BHPA 3QACA 3KP3A 1BC7C 4CDGA 5D6FA 1W7PD 4XFBA 2XAFA 1DP7P 1C0WA 4F7ZA 1W4MA 4KWJA 2EJRA 2K4JA 4IETA 1TQ5A 3TNQA 1FWZA 2F5EA 3KP2A 1K6OA 3E5UA 1ZRCA 5L3BA 2XAHA 3R0JA 5JAXA 3J80K 2JPCA 2E7XA 3OD0A 1KU3A 3H3ZA 3JSPA 1CAVA 2IXLA 1GXPA 4OU0A 1CF7B 4S04A 1XE7A 2D5HA 4QGLA 4LGWA 3I59A 2DPDA 1J3PA 2CO5A 2KXLA 4P9UA 4AVBA 1CAWB 2L01A 2PEXA 4NVPA 3WGHA 3J80Z 4FHTA 5AONA 1RL3A 4UV8A 3I5UA 5KK1A 1FBQA 3JTGA 1B1BA 2Q1ZB 3LWCA 2XL7A 1G3TA 2EA7A 5LHGA 2FU4A 3U9GA 2H27A 3QRFF 1BBYA 3GO5A 4RB0A 4Q0SA 4GCVA 4GYGA 1BN5A 1ZGJA 2ZJ2A 1J75A 4L9VA 3M70A 4L9TA 4MEXF 1U5TA 1XDUA 3IDCB 2ZO4A 3GW2A 1CAUA 3G3ZA 5CU1A 4L0ZB 1MDMA 2RNJA 1Z1DA 4YIIA 1ULYA 3SCGA 2ETHA 2OZUA 5J8FA 1HXDA 1YW8A 5K5QA 1W7PB 2HKOA 4HDVA 4RGUA 1FLIA 3I7DA 3DV8A 3WW1A 1EY2A 1NZCA 4RAZA 3R0AA 1IN4A 3KP5A 1IRGA 3CLPA 4RB1A 4KU8A 1IN7A 1YFXA 3RNSA 1JHFA 2YPRA 3KGLA 4P9GA 3IBMA 1S7AA 2B5HA 3LAJA 3OTFA 2HEOA 4HSJA 1BI0A 2UZKA 3MPBA 3CO6C 2HQNA 3RPQA 1Y9QA 3KEQA 4K8FA 2EV0A 4E2GA 1WA4A 4IEPA 3F3XA 1T39A 3SCFA 2ETEA 3H8UA 2FBHA 3T8RA 3O6BB 5HOOA 3RPUA 2F5CA 4ORFA 1SFUA 3WTUC 2DK8A 2IT0A 2O3FA 4WF2A 5EZWA 4HLTA 3EETA 5ICCA 4FT8A 3FM5A 1TQIA 3NQOA 2QLZA 2XRNA 1FYKA 5KBFA 4H7LA 1KYZA 4PIXA 1F1ZA 1G3YA 2W85A 3I64A 2UWMA 3HTUA 2C6YA 5CVRA 5E1RA 3BJOA 2BV6A 2XKOA 3GWZA 1W7PA 2M30A 1IXRC 4MEYF 2PBIA 3H9AA 1X7NA 2V1DA 4PGHA 2O0YA 1GHCA 2VBXA 4R79A 2EAAA 3TO9A 5E18F 4J1XA 2NS0A 2O1QA 4P9FA 5BQTA 3BB6A 2EK5A 4MNUA 1IXCA 3FF5A 1GQHA 2L02A 3OCPA 3GZ6A 2ESHA 5LHHA 2X0LA 4JQFA 2EFNA 3E97A 4Q5SF 3LWFA 5D5WB 4AQ6A 1IAWA 2FXAA 4EJVA 4XFCA 1D3YA 1JGSA 1O5UA 2ACJA 1I27A 5BMZA 2B8MA 2DQRA 4ENNA 2STWA 1ZGAA 4WWCA 3ZQ7A 3WE3A 3P9KA 3HIFA 4I2OA 4UVBA 4HV6A 4LLLA 3EUHA 1T38A 2FNAA 2VOOA 1ZZ6A 3U11A 4QM9A 3KEOA 1KQ9A 3M8EA 3MDPA 3CUOA 3ZP5A 2K7LA 3KZYA 3D82A 2R7DA 2D5FA 4HDUA 1YS6A 5I8YA 1J5YA 1J7KA 3QU6A 2IC1A 3F8CA 2XHKA 4IEZA 4U7DA 1PMIA 4WXDA 3BPVA 3BU7A 2FBKA 3ML6A 5HDGA 1OD5A 1UB9A 2UY9A 5E17F 1UIKA 4KIBA 3P9IA 4MGKE 2FOKA 1O57A 3HOTA 3V4GA 1DZRA 4P55A 1NE6A 1FNNA 2IXIA 2BYVE 2QM3A 4WX9A 2DAOA 4ZU5A 1S3JA 1YW7A 1RUNA 2GC1A 2EV6A 5DD8A 2QQAA 1F9NA 4RB2C 2PMUA 4PZJA 3TO7A 5KHJA 3CF6E 4IESA 3SQNA 4WK8F 2RV8A 2PJPA 3RKWA 4BHCA 2ZKZA 2IXKA 2P7VB 1WGPA 3U0ZA 5LGTA 3SZTA 3ECHA 1VR3A 3JZVA 3IWFA 4EQQA 1YFYA 2J5PA 1R58A 1A04A 3KGZA 4KMFA 1QZZA 5D5UB 2WV0A 2OU2A 4Q0QA 4MZUA 4L18B 1FPQA 3O3KA 1Z9CA 4I09A 1K78A 3HHHA 4L2NA 1F5TA 4QM8A 4M6YA 2CWEA 4HX4A 2K0GA 3SFZA 3K1MA 3GEZA 4JK1X 5TJJA 3H1MA 2LDUA 2VT2A 4XBFA 4LEJA 3B02A 4WXCA 3H3UA 3LFKA 1E2XA 1LEAA 3MQ0A 1TNTA 5HLIA 4H0EA 1QY4A 3KP6A 4EJOA 2YU3A 4Q0PA 2VN2A 1ZZ8A 4LLOA 1S6LA 3EQEA 1LR5A 2YR2A 2RN7A 4TLFA 3FZVA 1R5GA 2F5DA 3GFJA 1S8NA 1XCVA 4MGIE 3S0MA 1FXZA 1ZG3A 5H6QA 4EWDA 2WWYA 1UHMA 3KLOA 3U10A 3F23A 4D7TA 5BV6A 5D4SA 4OIQF 4XF9A 2XGXA 5BY5A 2JSCA 5E1ZB 4META 2MH2A 3DPLC 1X8MA 3I58A 4IEVA 1NHAA 2XL9A 4LUMA 1QGPA 3N4MA 2K86A 2V79A 4YFKF 2IA0A 1EP0A 1VTNC 1T6SA 1SD6A 4EM1A 1Y3TA 3WTSC 2HYFA 1U2WA 5LGNA 2PAMA 5BPXA 3WW3A 2NNYA 4XRFA 4CZZA 1P2FA 5J3UA 4EJTA 4IEXA 3QPHA 1XGOA 3HQXA 1KGSA 5DEQA 4MGYE 3F22A 4LA2A 2EWNA 5CYVA 4Q47A 2DT5A 2FBIA 3NRVA 1ON2A 2HKXA 2GC3A 3F21A 3FHZA 1DPUA 3I0TA 1BI2A 4UHTA 3I54A 2XLGA 3M1EA 2LF8A 4M72A 2R3SA 3WGGA 5ILVA 3KETA 4ONUA 3FXRA 2VXZA 2D2WA 5DCMA 2E7WA 4L5JA 1ZARA 3ZN0A 2VONA 3CUQA 4YG2F 1TW2A 4MTEA 3F72A 4QGNA 5JSRA 2EFQA 1SFEA 1ONVA 1DGWA 3C3VA 4M9ZA 5FGMA 4O3MA 4M9XA 4HF1A 4EWAA 2EA2A 1CAXA 1IN5A 5H20A 2PAKA 1HKQA 2PTMA 3MZHA 3CEWA 4RGXA 4O9GA 4CO8A 2ADUA 5LEKA 2XAGA 1HW1A 4Z07A 2OD5A 4MV2A 2DCTA 1Q3EA 1BI3A 5FLXK 2V9VA 1ZYRF 4CXFA 3IKTA 4LFUA 1OYIA 5D8LB 1STZA 3LQRA 4HYEA 2QCSB 5K8SA 4LB6B 1U6GA 1AOYA 1RIOH 4A12A 2QYOA 2XVCA 4WCGA 2A07F 2Y0OA 1MJBA 3BROA 4F8AA 4R1HA 5D4RA 4M74A 2A68F 2VBZA 3LAPA 4AXOA 4A0ZA 2BNMA 3WTVC 5FLXZ 4LK1F 2EB7A 1PUEE 4HQMA 3NEUA 2FMYA 3C3WA 3IRQA 4AQ2A 3E3VA 1FSEA 2HS5A 2XLAA 2Q4SA 1R1TA 1ZRDA 3G73A 2EV5A 1L3LA 3GYDA 4LB5A 4GXOA 1EYBA 1ZZ9A 1B9NA 5H6RA 4IRGA 4HZFA 3WTXC 2Q2EA 1SD4A 4FX4A 1S29A 3I59B 3H7JA 2HFHA 3GVAA 3RTRA 5BOXA 1ZN2A 1RI7A 1RUOA 1LRHA 1RNLA 1IXSB 2LNBA 1KA8A 3SXYA 3HRTA 2EFOA 1R1VA 4EVIA 2V09A 5I0SA 2Z3YA 4JV4A 1D8KA 4AIHA 2XV4S 4QWQA 1WLTA 1XB4A 1QNTA 4HLYA 4IJAA 3IIAA 4LULA 2MBFA 4L5IA 5FCCA 2K9ZA 3HT2A 1CGPA 2PYTA 3ABUA 1W5SA 1BI1A 1R7JA 4RS8A 2OA4A 1NYWA 2VBYA 1I1GA 3HUGA 4I01A 2H09A 1HSTA 5DUKA 3FZ3A 1CAUB 3IWZA 1YQAA 2DW4A 2CAUA 1MDMB 5CVJA 1O4TA 3L09A 1YWKA 3LZZA 5C6CA 4G7ZF 4LUKA 1OKRA 1H9GA 4G6QA 5J8CA 3L2CA 4QGMA 3LQQA 2JT1A 2A6HF 2CW0F 4EWEA 5L3GA 3KP7A 1SMTA 3H50A 5FQ0A 5LRRA 4XFIA 2W25A 5E8IA 4HBNA 4RB3C 3CDHA 1O3SA 4G9YA 2DO7A 3PQJA 2Z2SB 2FA5A 4G7OF 2DFIA 3VB2A 4MGZE 4WBBA 4HVQA 3S7EA 4Q4ZF 2MH9A 3COAC 3BJAA 4YARA 2Y48A 4ZZLA 1G4DA 2M1BA 3OOPA 4YFNF 4IXAA 1K7AA 1IN6A 3NSTA 2Q8KA 2W57A 4KIFA 4TV7A 2CFXA 2ZBKA 5E16A 1ZAOA 4XSZF 1XGMA 3RYKA 1T98A 1TNSA 2O6GE 5JCTA 3WGIA 2GA2A 4KT5C 6PAXA 3QP6A 4AIKA 3TO6A 3RIRA 4YSFA 4OIRF 1YFWA 4A6EA 4IVNA 1XRUA 4XF3A 3C18A 4MQ9F 4M6XA 4AVPA 1QPMA 1S7OA 4OIOF 4Y13A 3WW4A 1QWRA 2VE9A 3M9AA 2QJVA 1X82A 3M3IA 2XKPA 2KKOA 4QLCU 1FBUA 5BUVA 2RC4A 3HYIA 3I4PA 5FO5A 1J58A 1Q1HA 3CJXA 3GFIA 1P4XA 2DTRA 2XASA 1I1SA 4ASNA 4XETA 5AIPA 2L4MA 1GVJA 3WG9A 4ENJA 2MHFA 1UFMA 2HQRA 1XSDA 3MZYA 3BWGA 4I7HA 3CJNA 2UXXA 4KL1A 1V70A 4EV0A 4ENMA 2IRFG 3ISPA 1QXJA 3JAMK 3MWMA 5A2QK 4BNCA 2GXBA 2N7GA 1FY7A 5EEGA 3ACLA 2Z99A 2LF7A 3KSCA 1LDKB 2GXGA 3F8NA 2BNNA 4IHSA 4OFGA 4L9NA 1YIOA 2D40A 1VJ2A 3EQLF 2G9WA 2P7CB 5K5RA 4FAHA 2RKHA 3R60A 3JAMZ 2CYYA 5A2QZ 2UY8A 5D5XB 1IUYA 4RGSA 3LA3A 3HT1A 3E5XA 4LK0F 3CLOA 4LG0A 2CAVA 1MGTA 1PP8F 3FXQA 5ERIA 3O2PE 3B73A 2GQQA 4MTDA 2NRAC 3ES1A 1QBJA 4Z2YA 1R00A 4JVAA 2ZKLA 2MNGA 4G6DA 4OMZA 5LLQA 3CUQC 4IEUA 1G6NA 1FT9A 3RI4A 5L3FA 1LDDA 2XROA 2XAQA 2PHDA 2MLGA 3Q9VA 4M71A 4Q48A 5IT3A 3JW4A 4HOBA 3ZMDA 3ROUA 4AVAA 2Z33A 1HQCA 4XFGA 2D93A 3VEPA 4HN0A 3N97A 3BPZA 3FXUA 5K5OA 2PG4A 2PQQA 4ETSA 3UKTA 4KN7X 3L2HA 2L54A 5I0RA 3IDBB 3I71A 1BIBA 3V8LA 1SFXA 4IRIA 3EHKA 3OF1A 1K78B 1O5LA 3TQNA 4ZZDA 1MZBA 2VC1A 3BDDA 2QVSB 1T0FA 4BYYA 2V1XA 5EFUA 3RKYA 3T8TA 5ICGA 5HI0A 3QAHA 4AVCA 1TQPA 2IA2A 4JTOA 2GAUA 2Q0AA 5C8WA 2A3SA 3GFMA 5CJ9A 1Z05A 3GUDA 3TDZC 1T2KA 5FLJA 3GFLA 4HVRA 3SHRA 4BXUA 3QPTA 3DP7A 2FRHA 4HQEA 1LQ1A 1Z6TA 2EVXA 2BE5F 4AIJA 5JFRA 1OMIA 2E1NA 1FZPB 4YRDA 1D5VA 2A69F 2GH2A 3F8FA 3KFWX 3BZ6A 2F4PA 3J81K 2QQ9A 1H0MA 3E5QA 3RKXA 1DUXC 3FMRA 1DDNA 4KFCA 4IHTA 1JUHA 5DDGA 5EEHA 3TOBA 1X3UA 2VC0A 4EJUA 3ST7A 3K1NA 4HF2A 5HLHA 4YIFA 2G7HA 4MH0E 1ZX5A 3NKTA 3J81Z 2ZCWA 1RGSA 2ELHA 3MCZA 1LVAA 1TLHB 4IEYA 3WW2A 2CV6A 1K79A 3FWEA 4HBLA 5FPZA 1KYWA 1OI6A 2DI3A 1J59A 4B29A 3DEUA 3FMQA 3KMHA 4OIPF 4KN4X 3WODF 2DQLA 2VECA 3W6JB 3HTSB 1NXMA 4GULA 4Y15A 4HMZA
chains in the Genus database with same CATH superfamily
2LM3A 3ATGA 2WUHA 1H9TA 3JRBA 4NOTA 2JG8B 4FOYA 1QO0D 3POIA 3ZIWA 3CP8A 2BY0A 4O7XA 5K7ZA 3EDPA 4D6SA 1Z7UA 2KJBA 5LBFA 1P92A 2V72A 1UHWA 1W36C 1XDSA 2EAKA 3J7LA 1O59A 5FZ4A 2XPJA 5JXJA 1ON1A 3BQYA 2M9HA 3FXOA 1O91A 3K3NA 1ONAA 2A5YB 1UMQA 1NA1B 5C3QA 1BJAA 4LLNA 2HQ5A 4K40A 1EPWA 4I0AA 4A7KA 3GTPJ 3W58A 1AWCA 2EZHA 2M7AA 4XF0A 1R1ZA 2Z42A 1EV11 4HOOA 2AGSA 2ZX3A 4AFCA 4FPFA 1KDMA 2QQ8A 1PO22 3MMYB 1SLTA 4RAFA 3K0LA 2PHUA 3CCJI 1J3RA 3X29B 5L9BA 3M4FA 4GD4A 4QU1A 3DYPA 4I0BA 1PO11 3RZOJ 2E6VA 3ILNA 2PMZN 1MBGA 1Q43A 4Y5Z0 1XCBA 5F39A 2WNUB 4L11A 1YJWI 1MR5A 3CTAA 1JYIA 4FOQA 2EZIA 1YI7A 2JPBA 1VBC3 4AI2A 2A71A 4Z1VA 1RB8G 3EBRA 2BHYA 3TGNA 3T4HB 4D9JA 3AL0C 1ZBA3 4FI9A 1X58A 1NE4A 2WY7Q 3ZFEB 1NA1A 2QQLA 1W9TA 4RLQA 4IHVA 1IRZA 1AXKA 4IGPA 5FY5A 1W8ZA 1WD4A 2FEZA 1HN1A 3DU5A 2EIMH 1XNAA 3KLSA 3VD7A 1IS4A 1QNYA 5KAIC 2JA7J 2P4WA 1GUUA 4C8DA 1KD7A 1P9QC 5FAXA 1AU7A 4H4KC 2DFHA 4DNCA 1AR61 1MEC3 5KWRA 4QPIA 2MC3A 1RUF2 3OGJA 2D43A 3U78A 4WXHA 3VZJA 3BPXA 3ON7A 2IPQX 1FI2A 1MMGA 5HLGA 3K9TA 5H2FC 3AAFA 1FMD3 4K6BA 1YO8A 3D3AA 3ECQA 2HPIA 2F5FA 3WNLA 3CO7C 2IS2A 1XS9A 1O7LA 3FXKA 2LYCA 5CKTA 5T3NA 5L3DA 2G1MA 4FXKB 3LSEA 4CXYA 3JRCA 1J1LA 2Y69H 3AX4A 3MW2A 2PFWA 1NLQA 3VBOB 2E2HJ 1W6PA 5K0UB 1H1MA 1OQ1A 3ZFEA 1OURA 1W6OA 5E1XA 3CJIA 3LDRA 3VZLA 3ZN1A 3SNMA 1LOAA 3AMPA 5IVBA 3BTJA 1R1A3 5LK7B 2VULA 1H88C 2JE9A 2ET7A 2EIEA 2VQLA 4RA2A 3WU0A 2Q8EA 2MGQA 5GTIC 4AI0A 1REEA 4I98B 4EQVA 2XJVA 1TQMA 3T1BA 2VBPA 1TWHJ 2VIXA 2V4AA 4LBJA 2YS9A 1GV5A 4AW7A 2ZZQA 3A0KA 3GJAA 1TNRA 4AI3A 3IH3A 3BR1A 2MYSA 2HEVF 1UAAA 3OGVA 2XJRA 2PN6A 3O8HA 2HDWA 2WT0A 4DBQA 3KV5A 5J4VA 2B7EA 4QKBA 4MSVA 4M4PA 4E7KA 2Y6LA 5I0DA 4FO9A 4YPJA 2EA4A 2VL4A 4RS5B 3GXOA 4CTEA 2VCAA 4C0BA 1FP2A 1NG7A 1TC3C 2GN7A 4E7HA 3LSIA 3M1CA 1RUD1 4RHV3 1JT0A 2EIJH 1QQP2 2GNTA 2XUBA 5C3EJ 2HBTA 2ATFA 4UFLA 5FZOB 3VDDA 1I5ZA 3VZNA 1KRIA 3RJPA 5M5WJ 1AXZA 3R4UA 1AX2A 1JZ8A 4CE8A 4BHBA 5FYTA 1KQRA 5BNQA 4HSTA 2R1DA 2HYXA 3ALQA 1UF2C 2XB5A 3S2HJ 1VLNA 2X10A 2ZACA 3V7SA 2QKDA 1VNDA 2PQSA 1DZQA 1RVF1 1XMKA 2H94A 5FZMA 1GWLA 3T0DA 4J01A 3JD73 2WNEA 3WHBA 2IZWA 1C1LA 5IAVA 1ND2B 4HVOA 4U0YA 2HYGD 1BA5A 1H8AC 1BHGA 2YZ4A 2A3YA 1ST8A 1V6IA 2CQKA 1IGNA 4ITCA 1IPSA 1FOYA 1VP6A 3L2QA 1POV3 1O8PA 1VALA 3TNPB 4FISA 3OYMA 1LCLA 1PUFA 3U2RA 4YW7A 1D4M3 4NHJA 3PHMA 2FE3A 3UL2A 4KNYA 2L4AA 4XF4A 5F1RA 5FB2A 4KQ7A 2FSWA 3K69A 5C9AA 1OOPC 4IL7A 4WVMA 1RRJA 4Y3OA 1TBXA 1DZTA 1QXRA 3O14A 1UG2A 2HGCA 1D0XA 3ZMSA 2LSOA 3ITQA 4S2DA 3H42B 5JWPA 1QU0A 1UXXX 3MICA 1D2SA 1FOXA 5FP4A 1XGNA 5IP6A 5KHHA 3M3QA 1R091 4LA3A 4BA6A 3LSKA 2H0VA 2VVDA 5A1FA 1JYCA 4P5OA 3IUOA 1LEDA 4UVCA 3NV3A 1GNZA 2Z1DA 2PHRA 4FE7A 1MS9A 4TXWA 4F3JA 3VBRB 5KXEA 3FMSA 2Z9OA 3NV2A 3FDYA 4A6DA 5FD5A 1S0FA 3LPFA 4NB5A 1U0AA 4KG8A 4L9BA 1PIV2 2OYZA 5E20A 2H6CA 2I5UA 3BTZA 3QD6A 3GLXA 3WHTA 2X6WA 1G9CA 2LOOA 4S05A 1ODNA 2BZDA 4OQ9A 3I53A 5LWBA 2YDEA 1I6HJ 1RUJ3 3MIGA 1RUE3 1P4WA 2JRMA 1HOMA 5CFDA 2YX7A 2K3PA 1V5GA 4X0GA 4CCOA 2HTSA 3QOPA 2YBSA 3H92A 1UIJA 3HBLA 3RZDJ 1U3EM 3TP3A 1WJEA 3BG7A 3HHGA 1F4KA 4U0VA 1H6XA 1IV8A 1DCSA 4MADA 1V6JA 5IT9K 4U7BA 1STMA 1CONA 2GU9A 3UKNA 1T8IA 3VL8A 4CP1A 2K02A 1IZ3A 4QHBA 1A6CA 1RHI1 2XGCA 1OLRA 3RYRA 4JTNA 2QUFA 5JOZA 3H5AA 4GWIA 3DPTA 1PNFA 4MUVA 2EALA 2UWBA 3NW4A 1FSHA 2VKHA 1V54H 2E1CA 4OMCA 3U37A 4V2FA 5A7PA 3GYHX 2WWSA 4OAZA 2D7FA 5BNOC 3SKJE 2HOTA 4CSWA 4XILA 3RMXA 5JPNB 4JHTA 2ZJRF 1WUVA 5EWSA 5DV5A 2X85A 4XHXA 4HL0A 2ZJPF 3H1WA 2M8EA 5HS9A 3SDBA 5B1BH 3WTWC 1OSGA 4A3MJ 3OL4A 2MPFA 5DDJ2 3K4KA 1R5HA 1ETQA 1BKZA 2WFF1 3N9MA 4YYOA 2WAOA 4QB1A 1SLIA 1T6GC 4LO4B 3LSHA 1VQNI 2CSOA 1BJZA 1IGOA 4LG3A 1YLFA 3KE2A 2BFUL 1HC8A 4A3GJ 1HXS2 1AZDA 4JGYA 3T2PA 3L7WA 1A6QA 4Q29A 1PM4A 2KLOA 3WCRA 2ECBA 2XJSA 4NC8A 1WCMJ 3DFGA 2YSRA 3KM5A 3N36A 3A0BC 2HWC2 1XSQA 4UFMA 4GMP0 3I8TA 4XR6A 4ZZ5A 2PLYA 1TME2 2XDVA 2Y0MA 2P5KA 1WH5A 2JJ6A 2B9VA 4II2A 2H1KA 2J1EA 4IV3B 5FKNA 1PGL2 1JXSA 3Q9SA 3AMQA 3L00A 5B2GB 1IRFA 2HWE1 3SEPA 2EILH 5B4XA 1KU2A 1U5IA 4NMIA 5E89A 3N7LA 5A3OA 5CVIA 2COBA 4P9XA 4QQPA 3HN3A 2R0FA 1UY0A 1WWXA 4A0XA 5JR7B 3CMAI 4G4FA 1X8EA 2K9NA 1XSXA 2J1VA 4PJNA 2ZFWA 4EM2A 4DIQA 2RS33 2WN2A 1PO21 4N7IA 1ZBA1 1B9MA 3TWIA 3AVSA 3U07A 1VBD1 1K5JA 3JBG1 5C3OA 2ZHLA 3U1DA 4Q0UA 2HTJA 2HJIA 1U9OA 1XG1A 3F6OA 1SVOA 1GQGA 4XFFA 3OBAA 4KYWA 2WFPA 2ISYA 4ZH4F 5IYDJ 1BVP1 1W6MB 1XMXA 3ETQA 3F0CA 4IV3A 2UYBA 1AR73 3IL2A 2NLRA 2L7KA 5JVTA 1RUC2 4B48A 1WVRA 4CZCA 5EGOA 4XL9A 4Q2FA 1MMDA 1WKMA 2WB1N 1FBSA 1YQ5A 3ELKA 4JP0A 2BBYA 3DCQA 3V8KA 4GMP1 3E6CC 4ZZ8A 3C7OA 4WM7A 2HI3A 4AVVA 4D7YA 3VYUB 4JZRA 2G9FA 2UWCA 3CKHA 3N9PA 4S2GA 5T55A 1ZNPA 5FZCA 2R5YA 2WBMA 5AIQA 2ELJA 3KLNA 4HW0A 2X1EA 5FKBA 2RNGA 2JE7A 2M34A 5A3MA 5F64A 1VBB1 1JE8A 5J48A 2B9UA 5JHUA 1X50A 3RZLA 2EICA 3WG2A 4QXCA 1PGSA 2GC2A 4MVTA 3IC7A 2CHHA 5F2SA 2RM21 2XC7A 3KX2A 1R1A1 2FHRA 3KZIC 4IUGA 2ZMEB 1W8WA 1GUIA 4XORA 5D8KB 1UOBA 2IEKA 3IP4B 2HDCA 2JA2A 2MLKA 1W5TA 2QCOA 4ISRA 1W6MA 3GTMJ 1YQCA 4D5CA 4NRMA 1USSA 2QQVA 1GMMA 2ZNYA 5GTHC 3TEXA 2XIGA 4WV8A 3VFZA 2K2SA 1EPZA 5A3NA 2K40A 4UV9A 2E31A 3HQRA 4M3CF 3BQZA 3QP5A 1YJ9I 4XFAA 3C1DA 1Y9GA 2RR13 3FXMA 3KQ4B 3N35A 3MYXA 2X48A 4QXKA 4CEWA 1FYMA 4ZKTB 4D8MA 5IY5H 3AZYA 5IOYA 3TOAA 3WZ1A 2AR6A 4D7NA 1HQLA 1HRV2 3F6VA 4Y22B 4CDGA 1RUI2 5D6FA 4PI0A 5F32A 2XAFA 2CGOA 4HONA 1CZVA 1RC9A 4UOJA 5FYYA 1FEXA 4F7ZA 1QH6A 3I49A 4BXFA 2F5EA 5FJHA 3OS0A 3JRHA 5JVVA 1TMF1 1R71A 4NC7A 4PDWB 3JSPA 4C9YA 3EUAA 1OR7C 1HKDA 1LHUA 5IATA 4ZC3A 2DPDA 1V00A 1T56A 1NCQA 2KXLA 4AVBA 1CAWB 3HJEA 3LF7A 2R30A 1WLDA 4PFOA 4UV8A 2X1CA 3BT9A 4B4QA 1GWMA 3JTGA 3PNVA 2BWAA 1WBFA 2XL7A 1K83J 1DP0A 3VBFB 2NOGA 1KS4A 2FU4A 4CDWB 3QRFF 2EPFA 3GO5A 3WSOA 1C3HA 2BGOA 4GRIA 5GZEA 4LLFA 4GYGA 5JOYA 1ZGJA 4EN6B 1HDPA 3INAA 3M70A 1TP4A 1UL9A 5CISA 3IDCB 3WDUA 2ZO4A 3UNPA 1CAUA 5FMOS 4L0ZB 3QPSA 3BTXA 1ULYA 3SCGA 1EJ9A 1S2EA 2ETHA 5KR7A 4BY7J 1X1BA 5LA0A 1O6UA 4QT6A 4BMBA 5K5QA 4RGUA 2ZZJA 5FBJA 1CVNA 3WW1A 2YXSA 5APAA 3KP5A 3GXUA 3RNSA 1AYM3 4BQQA 1S7AA 2KIQA 2DTYA 3OTFA 4AQSA 4HSJA 3PIGA 1V9U3 2HQNA 1G9BA 4NR1A 1D2QA 3BTLA 2CL2A 2EV0A 2LMDA 4IEPA 3F3XA 4K1ZA 2ETEA 4AOCA 4AC0A 1S0DA 1HRI3 1T6BX 3RPUA 5E3OA 1OUSA 4C1XA 1HX6A 4IE7A 3OB8A 2KHMA 1AR82 3EETA 2OF7A 1MNEA 1YQ6A 4JX4A 3FM5A 1TQIA 1RMU3 1G3YA 4RR3C 4Q8KA 2UWMA 5F3CA 4IV1A 3N7MA 3HTUA 5HCFA 2DFBA 2BV6A 2VBDA 3QOEA 2WWUA 3RWKX 3TMOA 4P9IA 1IXRC 2PBIA 1X7NA 2V1DA 2DOFA 2F4OB 1OPMA 3TO9A 2JJ7A 3BR5A 3K77A 2LY9A 4KNCA 2EK5A 1IXCA 2E26A 2L0KA 3FF5A 2L02A 4E8CA 5LHHA 2X0LA 2QZ3A 3E97A 2E51A 4Q4V2 2ID6A 2Y31A 2QSHX 1OQEA 4X1EA 1AL22 1OISA 3WEZA 5B66C 1PIV1 3NMBA 5BMZA 2CV0A 3WHUA 3CCYA 2STWA 3H3LA 1E5SA 1NCRB 4WWCA 3ZQ7A 4A3IJ 1LGBA 2WYSA 1WI3A 2DYCA 4Q1RA 4D1QA 3HIFA 1Z7S3 3NAPC 2R16A 2IBDA 3ACGA 3KB5A 1W8FA 1T38A 4OMDA 4NIGA 1RUG2 4E7IA 2VR4A 3M2MA 3ZSJA 3P3NA 2OXBA 4UW6A 3MFCA 2VZ3A 2D5FA 4HKLA 2GNMA 3F8CA 1LUJB 2XHKA 2KP6A 4GH4C 2F6CA 4JX6A 1UB9A 3RKQA 3P9IA 3OD4A 4NIAA 3V4GA 4QPWA 1JGGA 1DZRA 1PK6B 5L7OB 3E0JB 3T0BA 4RM3A 1YW7A 1RUNA 5DXDA 5F5QA 3BR2A 3IT8A 5E6HA 3AFHA 5SV5A 1F9NA 1QJZA 2DA5A 2MSYA 3ZLIA 3CF6E 4FETA 4YFZA 4WK8F 3K46A 3RRDA 2CY6A 3RKWA 2IXKA 1MQTB 1F15A 2JSPA 1UQXA 1XYNA 2YHJA 3KGZA 1GOGA 4KMFA 2WV0A 4Q0QA 3O3KA 1Z9CA 2JDPA 3AL5A 1AKHA 2ME0A 4A3CJ 3J7ZI 2ZJQF 3PDQA 4HX4A 1QIQA 2FUG2 5AC91 3SFZA 4FTEA 3GEZA 5E3MA 3H1MA 2BY2A 4XOTA 2GIZA 1JTYA 3NV4A 2K46A 2V73A 2DMPA 4XLAA 1JUSA 4EJOA 5A33B 2CRGA 2R043 5IK4A 4Q0PA 5AFBA 5DM6F 1HXS1 2R7VA 5GZGA 2VN2A 1ZZ8A 1BK1A 1SCSA 4BQ3A 2VNOA 2OX0A 3IV5A 3SZGA 4Y26A 2NZ9A 1S8NA 4LOSA 4AR2A 4MGIE 3S0MA 2VMHA 3HL2A 4QX8A 1M4WA 1SFOJ 3WU2C 1FTZA 3U10A 5BV6A 1W8NA 2NMOA 3VBHB 3FKJA 5FZGA 2JSCA 2E2JJ 2HWC1 4AHWA 2PELA 3I58A 5A6XA 1NHAA 3M8LA 2GOXB 1SAUA 4NQWB 2IA0A 1EP0A 1WW5A 1X9TA 1PGL1 4F92B 2HYFA 5LGNA 2R5ZB 2BOIA 3NNGA 4M0NA 3TAYA 5KCMA 2H1LA 5M3FJ 2HWB3 1VAVA 3BUCA 2LLKA 3HQXA 1JUPA 1XNBA 3RQ0A 4FFIA 2L9SA 4LA2A 1NK3P 1MEC2 4P9YA 3OYEA 2W1WA 4QSHA 2DT5A 3HVDA 1AR71 2FBIA 1ON2A 1BI2A 1COV3 2ZEZA 1T08B 4YG3A 2XLGA 2O7OA 2R3SA 4XICA 3KETA 2XVGA 3FXRA 2VXZA 1MACA 4L5JA 3ZN0A 5BNPA 1G2HA 2R7OA 4MTEA 3PJQA 4OHWA 3NNMA 2M0MA 3ZFFC 3KEYA 2EFQA 1REDA 4YVSC 4DUVA 2WADA 1DGWA 3KV6A 4IHXA 4HF1A 3V42A 4W6YA 2AENA 4BJ0A 4RGXA 1BMV1 4CO8A 2K9LA 3CDLA 1H4GA 4QHZA 4WM8A 3PUQA 2WAQN 1BI3A 2R5ZA 2W1OA 3UKGA 2QFEA 4LFUA 1YOVB 1AOYA 4A12A 2XVCA 4COWA 2FDIA 1MJBA 1VBA3 1MVEA 4XMIA 4KJZA 5D4RA 2PN5A 3LAPA 4AXOA 3MIBA 3D5RC 3WTVC 4LK1F 2EB7A 1PUEE 2GP3A 4HQMA 1ZA7A 3FISA 3NEUA 1GP5A 4RGAA 1GZWB 2XLAA 4FFHA 5LD2C 3B9IA 4MO7A 2M7BA 3G73A 3K4CA 3GYDA 1UYYA 1ZZ9A 2JIGA 1N47A 5H6RA 4IRGA 5FRNA 1XU1A 1JZ2A 3LSPA 1YRZA 4C3IJ 1Z0XA 3I59B 3GVAA 5BOXA 4QD2A 1ZN2A 1RNLA 5JZGA 2VBBA 3SXYA 1R1VA 4RHV2 1K4SA 1ZBE2 5KXCA 1D8KA 2AO9A 3SEZA 2VUAA 4QWQA 4HEA2 3IIAA 2YFUA 5CG9A 4PLMA 4L5IA 4PCRA 3O7OA 4BDYA 5FCCA 2K9ZA 3NNJA 4QPGC 3W21A 2DA1A 3ABUA 2UURA 3GTGJ 1VMFA 4DEQA 1DGWY 2A6XA 1YIFA 1DQ5A 2LY1A 2F48A 2CU7A 3ENRA 2PMZA 5CIRA 3RG0A 4LUKA 1BZWA 3MLJA 1BEV2 3L2CA 1LE8B 3S1NJ 4LO6B 2A6HF 2CW0F 2QGUA 1GZWA 4EWEA 3KP7A 3SLIA 1V5EA 4FPKA 3JD72 3H50A 1UZYA 1WMFA 4XFIA 3ZYJB 4HBNA 4RB3C 3O5SA 3MW4A 2DO7A 4BQOA 3TN93 1XYOA 2DFIA 1XQNA 5C4WA 1FPN3 3Q0WA 2P3YA 1CQTA 4XDQA 3COAC 3BJAA 3IZOA 3K4DA 5CG8A 5CFCC 2Y48A 4ZZLA 2NXNB 1W6QB 3OOPA 5IYYA 3MIEA 2P6HA 3VBSB 1BCXA 4KIFA 5FZLA 2CFXA 3AKPA 1SPPB 4YG0A 5AVAA 1D4M2 1TNSA 4CVUA 2VZPA 6PAXA 2BJSA 2FZ1A 4YSFA 4N4OB 4A6EA 4K9SA 1XRUA 4BZ4A 3F95A 4XF3A 5A3LA 4E8DA 1GKBA 4MQ9F 2JDZA 3L2WA 2J7MA 1AYM1 1WW4A 4JRLA 1H9WA 5FY0A 3M9AA 2K85A 1LE8A 4W4ZA 1ZKGA 5K7HA 3A0HC 2ZSHB 1WH7A 3ZQCA 1C28A 3J7HA 2R7RA 5BUVA 1ASJ3 1DG6A 2HQAA 2Z4FA 3HYIA 5FO5A 3CJXA 3GFIA 1UZVA 1OD3A 1OCTC 4B4CA 4ASNA 4XETA 4GB32 1ENRA 1WCKA 3H3VK 3PSIA 3WG9A 1W6QA 4ENJA 4QQ2A 3NV1A 2HQRA 4CA0A 4CCNA 3M3YJ 4TN7A 1QOSA 4COZA 4I7HA 4HPKA 5FJ8J 2L7MP 4ENMA 2IRFG 1FAYA 3JAMK 2N7GA 5A7WB 5EEGA 2LF7A 2BNNA 3F8NA 3K4JA 2W46A 3ZFGC 3WG7H 3WX5A 2G9WA 3KT1A 3TEDA 1W8HA 3TEYA 1VRBA 2RKHA 3R60A 1RUJ2 2RDSA 4X6AJ 5EP9A 1UMIA 4PJLA 1JKRC 3E5XA 1VQ7I 3CLOA 4LG0A 1AR81 1UYXA 3W20A 1QH7A 5FPLA 4ZS2A 3ES1A 2NRAC 3WDVA 1W0OA 4JVAA 4A93J 2WA0A 4ZDLA 3A03A 4JCKA 4Q4W1 3S3OA 4RLFA 3DCFA 2K3FA 3CUQC 5K4LA 4V19K 3RI4A 5L3FA 4H2AA 2MLGA 2P4EA 3WG3A 5FKKA 2B42B 5IT3A 1MBHA 1LOEA 4B43A 4TLGA 4M3CE 4R9BA 2JUCA 1W04A 2RS13 1DQ2A 1E5RA 2D93A 2GALA 3BPZA 2BPA2 3FXUA 2EXIA 2PQQA 1X1AA 3IN9A 4Q4V1 4KN7X 2NS8A 1VRH2 1K5MC 3POJA 5I0RA 2M4KA 4I0WB 2K5CA 3WLUA 3I71A 3DPRB 2F17A 3V8LA 1Z21A 1R081 2CWSA 3TQNA 5LBEA 2CDPA 4QDQA 4BYYA 2R93J 4J6GA 5EFUA 3FBNB 2VQHA 3T8TA 4YM1A 2HVQA 5CAZA 1OHFA 2PLV2 4AVCA 4BQ4A 4JTOA 1AX1A 1MS3A 1JU3A 4FP2A 3WG1A 3CQZJ 2A3XA 3G1OA 3T1LA 3PL0A 4XBLA 3BOPA 4FQ4A 3GFLA 4HVRA 4CDXB 2AEYA 3QPTA 2LG4A 4HT1T 4XACA 4PQQA 5IW0A 3UR3C 1Z6TA 1URXA 3B7MA 4LXLA 4AIJA 3QPLA 2XPUA 2E1NA 1FZPB 1D5VA 2PJRB 3BZ6A 2MW8A 1KS5A 3J81K 1IS3A 1TWCJ 5DDGA 1KXGA 3LFMA 4AFDA 2VC0A 2NYYA 5GLVA 4AAPA 1F8VA 2ZX0A 4ZPIA 2OVUA 4HF2A 1PZ8A 5FZ6A 3NKTA 1F35A 2ELHA 4IEYA 3RQIA 3KYDB 5IK8A 1K79A 5FZBA 2CV2A 5FPZA 4LO8A 2YY1A 2KR2A 2E53A 3DEUA 2R041 4CCDA 3J8F1 3I2KA 3WODF 1LHWA 1H8TA 4DXTA 3W6JB 3B93A 1B72B 1ACIA 4TTGA 2QEXI 1W99A 4EYUA 3CC7I 4U88A 1IC8A 3EYYA 5D8AC 2P3IA 2LALA 2O03A 1ZZCA 5FMDA 5LHIA 4Y17A 2DCZA 3AXEA 4EMSA 2R7WA 1HLCA 3ZXSA 5FY9A 5B1AH 2E7QA 4BQWA 2VPVA 4M3GA 1VB4A 3QBQA 4YW1A 5D1IA 3D4KA 1YHFA 4RAYA 5GAGJ 1G9DA 4HA8A 2VLAA 1DQ4A 5FP3A 4UVAA 2FBEA 1X3WB 5CBLA 1MD0A 3WNNA 1JHHA 4IE5A 4EE2A 1HJFA 2IVJA 5LEJA 1F31A 3GM8A 2WO7A 4TZDA 1B72A 3VPRA 1UCRA 3MO4A 1Z91A 3HSEA 3S30A 2DDAA 3K10A 4W6WA 3I3EA 4D7SA 2CYFA 4R8HA 4KMUX 4G6TB 2IVMA 1RESA 4W1UA 4DJAA 1GXQA 5JIUA 4B4PA 4N9IA 3Q8AA 4UFJA 1ZQ3P 4L0YB 2MG4A 4UUVA 1TTYA 1YNAA 2VJ4A 3THTA 4FSJA 2ORZA 2XLFA 1YXWA 5J98B 4KGGA 4XONA 2YC2A 5CVVA 1IRXA 2VUCA 3IPVA 2R7ZJ 1E3PA 3DXJF 2XSDC 3KF3A 5DG1A 5FY1A 4G7HF 4IEOA 3MF9A 4M73A 1AF9A 4LNVA 3HOXJ 2KIFA 3MUZ1 4HV5A 4L5EA 5FZ7A 1B6AA 3Q8BA 2ZEYA 4MLOA 2D97A 3PFYA 3C7HA 2E7TA 3HUGB 1HF0A 1LTEA 5I0UA 4XQDA 5M5XJ 2JA6J 5M3MJ 4Q0VA 3ZKYA 5JI6A 3WUCA 2AS5F 2VODA 4BL0B 1YQ8A 1BR1A 4RGRA 4MXWA 1NQJA 1YYNA 1RINA 1YYVA 1H6YA 5BNNA 1LJ9A 3HBZA 3E6MA 3ZQLA 1IPJA 2BQPA 2TDXA 1FC3A 4UI9L 3OV8A 2BGPA 3ZXGA 2ZS6B 5CLSA 3NQHA 1VQPI 1XD7A 3VKMA 2H8WA 2W24A 2QBYA 3PNTA 3I56I 4NUBA 5IHRA 4HK8A 1LB2A 1V0AA 2BW8A 1ULOA 5IVCA 2WZR2 4OMYA 5GJ6A 2W94A 5EJ1B 2V6EA 2G7UA 1RYYA 1PVC2 4JBAA 4LBQB 2OUHA 2BOLA 3OSFA 5T5LA 1QVUA 3DLAA 3GHMA 1OH3A 3FLPA 4DXSA 1S0EA 1ZBE1 5FLMJ 3S5QA 3EMRA 2A6TA 1JZ3A 2KJCA 1W0UA 4EROA 4Y4RA 4MIMA 3GTJJ 1BC8C 5C8CC 3PSFA 3IAM2 4CDQC 3ZM8A 4AGGA 3D1NI 4XCBA 2FDGA 4CUBA 3VDXA 2JWPA 4A5NA 4LE3A 4KH9A 3NL1A 3V0BB 1BEV1 4CYCB 5ABJC 1SMVA 5E8GA 4CICA 4AEDC 4B47A 3WV6A 1QDCA 5E3LA 5FYVA 4CCEA 4DUXA 3AL0B 5M5YJ 2GZWA 2WB1A 2G9ZA 2WINB 2KPMA 3RZZA 3CCUI 4UF0A 4BAYA 5BNGA 4KDPA 3JUUA 5FFZA 1CPNA 3DTIA 2EZLA 1HBXG 2XQXA 2NM1A 4QB6A 2JTVA 4AZZA 5EYYA 1HRI2 5GZDA 1DGWX 3A2KA 3K4ZA 1UYPA 2CFOA 5DUXA 1ULPA 1XU2A 2OCCH 3VHRA 3EYIA 1BBT3 4LMFA 4N43C 1RMU2 2HWD3 1SBEA 2W0XA 4CCKA 1ZHFA 1ZRIA 5LRSA 4OUSA 3CNAA 3V0BA 5FP8A 2L9RA 4D0PA 2IGKA 4CYCA 2HPMA 1WMXA 3AZWA 3GBWA 4QX0A 3MLKA 2WY8Q 1CF7A 5LBQA 2Y0IA 5FLIA 5ICFA 4Q4X2 5FP9A 5FYCA 4MHUA 2R063 5DYMA 1OFSA 3KWVA 5J1YA 5KHIA 1CZSA 3FK7A 2ISZA 3FFQA 2MD5A 4GB31 1O3QA 3U75A 3TL4X 4XLNF 2H6BA 2OPTA 3G6EI 1CX4A 2RHPA 4AF9A 4XLEA 2P17A 3SHFA 1F4HA 4DY3A 2ZXJA 4KICA 2LK2A 2OQ7A 3MD2A 1MZ5A 5BXXA 5CKMA 1DBNA 1QU3A 2W52A 3A7QA 5HVQC 2ZXHA 2AZ5A 5FLHA 1HJGA 4P9JA 4E4ZA 3O0VA 5EPAA 1ZZBA 1Z7S2 4GWMA 1G7YA 3I3BA 4LIUA 1LOFA 5CZKA 2RDPA 1Y4WA 4AI1A 2O8KA 3ZMOA 3AP7A 1BW6A 3OYAA 3D6EA 4Z6YA 2EIDA 4UBHA 5LW9A 1QJU3 2WT1A 2BEOA 1O4XA 4IERA 5SV8A 2D1VA 1DGRN 3K4LA 1YG2A 3KVBA 2L5QA 2Y34A 1ZREA 3ZCOA 4M3CA 2YUEA 2V9KA 4XCAA 3LA7A 1FNZA 2O8XA 4PDKA 2W7NA 4RM2A 1R4MB 1OF4A 4AYBN 3JREA 2DV9A 3KT4A 4QXBA 3SEQA 4KUMA 1LNSA 4QPIC 5JI7A 3W2WA 3VKNA 3CL1A 3WTTC 3JR9A 1MS1A 3MLLA 2NAZA 3S8PA 2UV1A 2XBO2 1ULDA 5IP9J 3VBUA 4QPOA 1DIWA 3N05A 1O4YA 4ZYEA 5J1XA 1TEIA 2ZXIA 3RI9A 3PUSA 2KZGA 1UZ0A 3D8CA 5FDBA 4OHYA 1RTVA 3POWA 4JGZA 2PLV1 2Y75A 5IT9Z 5K7PA 2WRAA 4ZU4A 1XNCA 2VOPA 3CJIC 3SDGA 4LK6A 3LEKA 1CD3G 3V0AA 2YG0A 5DG2A 3WXPA 1GV2A 2Q0OA 2RS53 3PVEA 3UYJA 1OPCA 4LT5A 3Q8EA 5ANNA 1OCOH 2VTXA 4V2WA 3WDWA 2VE8A 1E5IA 1UELB 1YFHA 5A6YA 2BOJA 1BM9A 2C24A 2P37A 1MS8A 3RJRA 1OOPB 4IQJA 5HV0A 3LIHA 3N9LA 1D1CA 2R4GA 2HZTA 3O1TA 1E17A 4LK7A 4B44A 1LEBA 1JYXA 4FPOB 4OOIA 2KIUA 1ENHA 2F6BA 4BOWA 1R1UA 4CP0A 2CTVA 3DBRB 3WE2A 3UKVA 2ESNA 1S4CA 3W2VA 1UKGA 2OQGA 2HWB2 4IEQA 1VBE3 4A3DJ 1QRYA 4HANA 3ZOBA 1DDLA 2NOJB 2VI6A 2W84A 4Y4YA 4MG2A 4BK4A 3VDDC 1NUKA 5DABA 4A3ZA 4UBGA 1COV2 1W9YA 4U2AA 3DF8A 3L2YA 4B1LA 1VZ0A 4ZYHA 2X6XA 3LSJA 5FFXA 4UYBA 2BXZA 2CQ7A 3HRSA 2ZABA 4AIDA 3VV1A 3TYJA 2NVXJ 1HB1A 2KT0A 5FY4A 4E7LA 2CWMA 5LA1A 4KWKA 1OOPA 4IEWA 4X6RB 4B8EA 3PQKA 4OINF 1VQLI 1QF3A 1UWWA 4YG6A 2OAZA 1WW7A 2Y9YA 3WT3A 4A3LJ 2J1SA 4AWDA 2HBUA 2ET1A 5DAXA 4A6SA 1Q1VA 2PHTA 1U5TC 2NVQJ 3DBHB 3GTQJ 2I45A 3U1XA 4A44A 3Q0VA 1KITA 1ZG1A 1UPSA 2A7AA 1DU6A 3NRUA 2DCEA 1Q56A 4GJYA 4B1RA 4HXCA 4ET7A 5EQUA 4LO5B 4LKFA 4XBNA 1WCQA 1SD5A 2L2OA 3KHCA 5DAPA 3ZR8X 2VJJA 3P7NA 1WW6A 4E27A 3NJZA 4GAZA 2D45A 1AVBA 2B9SA 4JOMA 1EV13 4WZCA 5FPVA 1DQUA 4MX3A 1K12A 2V5DA 4Y1ZA 2M45A 5DPNA 4Y20B 4L97A 4H7MA 3P9CA 5HS7A 1UZCA 1FV3A 3MIHA 2CQNA 3RYPA 3EJKA 1QJX1 4WVVA 2KFDA 4FX0A 4KT6A 2VZSA 1Y8QB 4GFBA 1WJFA 1PO13 1MPXA 1HW2A 5BNOB 2GSYA 3VBSC 1MZFA 3QU3A 2FNPA 2IWGB 2ZGUA 1I6XA 1MZ6A 2D6OX 1WZ2A 2BNOA 5HNFA 1MW7A 2F2EA 3N9OA 1W03A 5GAHJ 2VTFA 4BQ5A 2I8DA 3H36A 4QDSA 3BALA 3VGIA 1IO2A 2P3KA 3OL3A 2ENRA 3PU3A 1D5YA 4O61A 2A6EF 3LAGA 2JE8A 1UY1A 2DCKA 1AHSA 3AZZA 3D0SA 3ETPA 1YTYA 2RMU3 2DK5A 2OTJI 2YX4A 3N9NA 1O7FA 2X1DA 4CUAA 5BYNA 4ZDOA 1RKTA 1G3SA 2R1BA 1UD1A 1AR63 2VGDA 3LOBA 4K2EA 1FX5A 4FPYA 2JMWA 1N78A 5HBAA 4FPLA 3MKZA 1W1WE 3S1QJ 2HR3A 3WQBA 4CP2A 1X36A 5BNOA 4QMAA 5AVPA 2HNHA 2LUWA 1O3RA 2D6MA 4IHWA 4D7MA 4QWNA 2ZAHA 1PDNC 2W1SA 5ACA2 1FJLA 2ES3A 3RPUD 1HB2A 1ZRRA 5CFDC 2GP5A 3AFGA 2VH9A 2W5FA 3WTZA 5B4NA 4N53A 1P6RA 4YW5A 2D3SA 1MIJA 1S55A 4OI4A 2FDKA 1TG7A 4PJ0C 4W97A 3S7IA 1PVC1 5F04A 2I2SA 4BQAA 1BL0A 1USTA 4FVVA 2WTEA 1ZYBA 1CIWA 2Q8CA 3KP3A 1BC7C 3KV9A 3DECA 3LEGA 4OULA 4KWUA 1W4MA 4G3YC 1C8M1 2K4JA 3TNQA 1FWZA 3E5UA 1V6LA 1X4PA 5L3BA 2ZX4A 4ES8A 3R0JA 2Q1FA 5JAXA 2JPCA 2JDNA 1KU3A 3H3ZA 2IXLA 5GLUA 4CCLA 1XE7A 2D5HA 1W9WA 1LECA 1ASJ2 5GKAC 2JG9A 4P9UA 2IGMA 2QZ2A 1XOYA 3OYCA 2GOMA 2DCYA 5AONA 1MMSA 5KK1A 3FXLA 2EXKA 4QPQA 5A6ZA 3VKOA 3AFKA 1G3TA 2VW2A 2LKXA 3PM1A 1BBT1 3O12A 4RB0A 1RUD3 1VQKI 3BGAA 4C3HJ 1J75A 4L9VA 2YBKA 4XJUA 3HOZJ 4DXZA 1ND3C 1RPWA 2BFUS 3GW2A 3G3ZA 5CU1A 4A7YA 4JGYC 1Z1DA 4GALA 4YIIA 1POGA 1SFKA 3A02A 5J1RA 4DBRA 3L9JT 3X2QH 4PFPA 2R061 2BU9A 1W7PB 2W68A 4CEYA 4R4XA 1FLIA 5J37A 3DV8A 1NZCA 1RJ7A 1RVF3 3WQ0A 4DRRA 1IN7A 1YFXA 3KGLA 4P9GA 2H0BA 4K20A 1QPIA 1IS5A 1LU2A 3MPBA 5JOWA 4DOZA 3H1CA 1Y9QA 4LQRA 2DA3A 1AJOA 2AACA 2R7TA 9ANTA 2DJIA 1T39A 4U87A 1SDDB 3VLBB 1UY2A 1OJLA 3H8UA 3CCQI 2WS91 3QODA 2I07B 3T8RA 3O6BB 1YRNA 1E57A 2F5CA 1XYPA 4ORFA 4Q4X1 4XOPA 2X05A 3RJ2X 1G8WA 2YU2A 3WTUC 2DK8A 3AP6A 4HNUA 3SYTA 2RS12 2O3FA 5CPRB 5EZWA 3HPHA 4HLTA 4XHBA 1OC1A 2ECCA 4YZ3A 1WPKA 3MKLA 1QJU1 4PIXA 5FZKA 2H8RA 3TOJA 4P02B 4BEHB 4KGQA 2C6YA 5CVRA 3BJOA 1JTZX 3GWZA 1W7PA 5L73A 5A7NA 1W8OA 3WF3A 2RAEA 2EINH 3WVJA 2O0YA 1NZIA 2VBXA 4HG6B 3TEZA 5FJKA 3S1RJ 5E18F 3MKYB 4P9FA 3S3NA 2FCTA 2K9MA 3BCBA 3ASNH 2AXTC 2X5IA 4AM3A 5IVVA 1MVQA 3ILRA 5FOBB 4AFBA 5FUNA 1XC6A 3QCWA 5G04L 4QKFA 2EFNA 2L9VA 3LWFA 2FXAA 4HG2A 4EJVA 3HZJA 4XFCA 3RZJA 3THDA 2ACJA 4JRAA 1LGNA 2DXIA 5G05L 3CU7A 4GDFA 4WM7C 1VQ9I 1XJAA 4ENNA 2WNVA 5AFEA 1FNYA 2ZSIB 3WE3A 1HCRA 3T08A 5DZGA 5A32B 4E4SA 4IO9F 2FNAA 1QOTA 3U11A 1CN1A 3KEOA 1KQ9A 4YVWA 3MDPA 3ZP5A 2K7LA 5F3IA 2K9QA 3A01A 2R7DA 4HDUA 1YS6A 1JODA 5I8YA 5GP9A 1BJQA 3QU6A 5LFAA 1A36A 4XNFA 4U7DA 1HB3A 3BU7A 3CF2A 2ZMLA 2BHZA 1R5ID 1UIKA 2YB7A 1CR7A 2O9LA 4P55A 4ZU5A 1S3JA 4GXLA 4P1WA 2VW1A 5DD8A 2VXDA 3AMNA 4RB2C 4A3JJ 2DVBA 5DQ0A 2PJPA 4RFRB 4LKEA 3OYIA 1MS4A 4BHCA 1RHI3 3LDBA 1WGPA 2ZHMA 3U0ZA 4CEWC 5A32A 4AEJA 2X51A 5FYHA 2CW8A 2HWF3 4WZFA 5D5UB 2EIGA 4AFMA 3B01A 1K78A 3B9CA 1F5FA 2IAIA 2K0GA 1W2UA 4RR3B 4UW4A 2JX9A 2W95A 4PF1A 2XB0X 4A41A 4XBFA 1XB9A 1AR91 5FIXA 5E8AA 3H3UA 3WQ7A 4M01A 4I76A 1W9FA 1E2XA 2WA3A 1QY4A 5LBCA 2YU3A 2WFF3 5F6LB 4DZGA 1YCIA 2WNOA 1S6LA 1NCQC 2XVKA 5DAQA 3PMSA 4XAEA 1DLCA 1R5GA 3ACFA 1ZG3A 2V4JC 1DU0A 4EWDA 4AVSA 2B39A 3KLOA 4YZ2A 3AG1H 4XF9A 2XGXA 5EV7A 2DVFA 5E1ZB 3DTKA 3ZSMA 2Y6HA 1BYHA 3ZYBA 3DKXA 3UNGC 2Y6KA 5B5EC 4LUMA 2LVSA 3CQOA 2K86A 4YFKF 5LY1A 1VTNC 1T6SA 4EM1A 1Y3TA 5FV3A 1U2WA 1UOGA 5A7OA 1KJLA 3NAPB 4R9CA 2NNYA 1Y1WJ 3NNFA 2A5WA 3QPHA 4DZJA 4KISA 2IXSA 2M3AA 3WP5A 3ZYIB 2GC3A 3M8JA 3FHZA 1DPUA 3I0TA 2HWE3 1S0IA 1YX5A 4LIVA 1S2BA 4GH4B 2JG8A 5J96B 3OSGA 2ZGNA 3WGGA 5JHFA 2B45X 3APBA 3K70D 1AYN2 2E7WA 1ZARA 4YG2F 1TW2A 3BLYA 4BIOA 4GIQA 3IM0A 5EXOA 2QQUA 1H8VA 3FK6A 3MIDA 3C3VA 1PGW2 2RDRA 4M9ZA 3SH3A 3JB8A 5FZ3A 4EWAA 1PO23 2EA2A 2PAKA 4FFFA 1HKQA 1VBD3 2PTMA 2W08A 3VN4A 3JBG3 2RMU1 3UV9A 2Y9ZA 3KD4A 2XPVA 1UOJA 5LEKA 1HW1A 2XUMA 4MV2A 1BXHA 2DCTA 2DJNA 1Q3EA 3POSA 3JRGA 2ZGTA 5FLXK 3TBDA 1LOGA 2V9VA 1ZYRF 4CXFA 5D8LB 1OYIA 3JQWA 5K8SA 2ZFUA 3QWLA 4IV1C 2DU1A 4JDOA 3HPNA 4CU7A 1UNBA 2BNMA 2BP6A 3CZUA 5FMBA 4IGOA 1H0BA 2FMYA 1G9FA 2LBFB 1FSEA 4GMP3 2WNUA 1WGXA 1R1TA 3FFZA 1ZRDA 2EXHA 2X29A 1MBEA 4JQRA 4LB5A 2FZ2A 1B9NA 4HZFA 1TWGJ 3WNKA 1OBNA 2P6CA 2J22A 2MEV2 4GWNA 1RUOA 3IMMA 1VBB3 2KQRA 3HD8B 2NVUB 4EVIA 2V09A 4JV4A 2RM23 4UFIA 1WLTA 3GCWA 4LULA 2MBFA 1IKPA 4DNYA 3HT2A 2W9XA 2PYTA 2VQUA 2R92J 1OKOA 4Q4Y2 1BI1A 5GPCA 1YQ2A 2OA4A 5ACA1 1I1GA 4AU7A 1ZGWA 2D44A 2VOWA 3A4CA 4ASKA 4Z8BA 1YQAA 1RUH2 1MDMB 1OA2A 1XX5A 3L09A 4BQ2A 1OKRA 4G6QA 5J8CA 3T1MA 4JHZA 2IS1A 2ZTNA 2QQWA 4AI9A 5LRRA 3AK0A 1F2NA 4G9YA 3PQJA 2Z2SB 2GNDA 2FA5A 1Y8RB 4MGZE 2CUFA 2CW7A 3S7EA 4Q4ZF 3UK9A 3VBOA 1CJDA 5K0UA 3FLRA 3ZN6B 4YFNF 2VKEA 1IN6A 4UB6C 1CESA 3ZFFB 4YVSB 2QQNA 2QQOA 4F3QA 5F6KA 5E16A 2LTNA 1ZAOA 4XSZF 1XGMA 5JCTA 4AUXA 4NPMA 4EJRA 2XGDA 3WGIA 2GA2A 3W9AA 2R072 1TMF3 3AXDA 3BTCA 3TO6A 3BCAA 1NH3A 4IVNA 1SLCA 2JN6A 1GLNA 3C18A 1QPMA 1S7OA 4CPBA 4Y13A 1QWRA 1UZWA 1UJ8A 5DAWA 2QJVA 2WV1A 4YFWA 2GM4A 3VD4A 2ZAAA 4RS5A 4QLCU 3A23A 3RZGA 4XN3A 1J58A 1Q1HA 4ZXKA 2DTRA 1V6NA 1UFMA 2BBAA 5FZOA 4YVSA 5F27A 2RDQA 4BM8A 2UXXA 4KL1A 3VSKA 4EV0A 1IJWC 3AYCA 2GXBA 5A2QK 3UJOA 1FY7A 1NK2P 3ACLA 3KSCA 2DUQA 4XJ9A 1W0TA 5F7UA 4OFGA 4OI0A 1N1VA 1QJEA 2CGNA 2SBAA 1IDYA 3FHQA 5FOJB 4Q5OA 4QPGB 3GTOJ 1RJ8A 3LEMA 1MMNA 3JAMZ 2CYYA 3MV01 4XABA 3CCMI 2A73B 4RGSA 4RMNA 3LA3A 3HT1A 2DVGA 3I55I 1VPHA 1ND2A 2VJXA 2CAVA 1ETYA 1O4ZA 1UMHA 1PP8F 2Y64A 3B73A 1NG0A 2GQQA 4MTDA 2P3JA 1R00A 4XE9A 3OBZA 3N3HA 3DGTA 4BB3A 1UU6A 5BNPC 3HOBA 4IEUA 5LLQA 1JUMA 1XE0A 1KDKA 2YMZA 4AL9A 4M71A 4Q27A 3AKZA 1CWPA 4BU2A 3S93A 4AVAA 3P6BA 5CFCB 4V2GA 2Z33A 3Q9OA 1HQCA 4CXWA 4XYXA 4XFGA 3OYWB 2JKBA 3N97A 2A3WA 3CIHA 3U1KA 4HFSA 4WM8C 5K5OA 5FO7B 3UGGA 4NO4A 3ASIA 3WP3A 1TT0A 2RG4A 2DODA 1JOBA 2YYOA 1X4OA 4QPGA 2XOMA 2CUZA 1LGCA 4ZZDA 2FMDA 4PI2A 3BDDA 1T0FA 2X6OA 1ETKA 3O1UA 1Z67A 4ZXEA 1HDKA 2D6NA 3MV11 1WHUA 4OUEA 4Z2WA 5HI0A 5IPAA 1TQPA 3ERMA 1C1FA 2Q0AA 3KYLA 4KI5M 5C4XJ 2A75A 2A3SA 3CCVI 3EXUA 1PIV3 1FIAA 4JX0A 3S16J 1Z05A 3GUDA 5EJZB 1DP3A 4YEJA 4KBBA 1T2KA 5FLJA 3RMYA 3SHRA 3DP7A 1J09A 2FRHA 2C4XA 3Q8FA 3OBRA 3VBRA 3OBTA 2FDJA 4RQPC 2D3PA 2VNGA 4O65A 1OH4A 1QZEA 3BIWE 4YRDA 2GH2A 3KFWX 2F4PA 1X2NA 4IDZA 5JZGC 1H0MA 2HWF1 2XWJB 3ME2A 3RKXA 1DUXC 1NX9A 4HK9A 1X19A 5EEHA 4IZZA 2LRPA 1X3UA 3ST7A 2JDHA 2G7HA 4MH0E 1ZX5A 2HEWF 5A3UA 3J81Z 3PJYA 3MCZA 2WZ8A 1FOD2 5A7QA 2CV6A 3ZFGB 2DTWA 1HQWA 4YWAA 3PUBA 1OI6A 2JB8A 2DI3A 1J59A 4RN5A 3MIFA 1JBCA 2Y33A 3KMHA 3G1LA 5GLWA 3SC7X 2UUZA 4KN4X 3BN6A 1IS6A 5FYSA 1REFA 2DQLA 2RQQA 3HTSB 1NXMA 2P81A 4MFDA 5KXBA 4U36A 4GULA 4IQPA 4HMZA 4LHKA 3R05A 4XKCA 4XQWA 2DDUA 4K8RB 5EYXA 5T54A 1JYNA 2RJLA 3LQCA 5J7MA 3BG3A 1OCRH 2M87A 5C4WC 2A6WA 4ESBA 5J36A 1D1AA 2IS4A 2XB6C 3BOQA 5TSWA 5DCMB 1REPC 3U4SA 4XVHA 1DGRA 2JD4A 3CUQB 3ZXKA 5FWJA 2FQ3A 3AZXA 4PF5A 3MFAA 2KM2A 1XSRA 3S1MJ 4O5VA 4BY1J 1AL0G 1D0GA 5AC93 1DYKA 5FZ9A 4I3PA 5IP7J 4BJ6C 1CAXB 1V4RA 1R6RA 3HOVJ 4AYBA 5FYBA 4BCUA 3DXUA 5ILSA 2PQ8A 1U5XA 5HDNA 1HXS3 3ZMVA 4WVWA 4B09A 2A1XA 1IN8A 3OMYA 5F2WA 1K5MB 2IW5A 3OR2C 2GC0A 1FYUA 4A4AA 4P00B 4Z82A 4CP9B 2OZ6A 1WJ5A 1DFQA 3DEWA 3ZPOA 4E2SA 3OPTA 1T95A 3NARA 1O3TA 3WD5A 4MGSA 3OGGA 3PFIA 3CMGA 3KP4A 3M7GA 4AFAA 1JHJA 4RGKA 1DPRA 2R7QA 2HWC3 4Y1XA 3VODA 1SQ4A 3FX3A 3M07A 1SVLA 4X8NA 4HLXA 3S17J 2C26A 3NJYA 2P5LC 1B59A 4XUTA 3UT0A 2X8KA 3P5JA 5HXMA 2Q2EB 2Y2ZA 1ODMA 5HCAA 4FCYA 1N77A 1U78A 5HCBA 4UWDA 2ZGQA 2K4BA 2FDHA 2OUMA 4N9HA 3KIOA 1V55H 5F0CA 3I3QA 1EH8A 3WOGA 1SEFA 4H3WA 4P96A 5BS6A 1AYN1 4M4RA 2Q1MA 2AYHA 2ZMNA 2ZHNA 1QZYA 1N3QA 1W6NB 3H7YA 2MA3A 4Y5TA 3VHOA 1WFXA 4BGDA 1RZ4A 1AJKA 1GOFA 4PCQA 1GZCA 3WHCA 3LKJA 4CCMA 1IZ1A 4FTHA 2Y0SN 2IXJA 1Q5OA 2M2EA 2ZC2A 1W0NA 1IG3A 2QQIA 4D3WA 3JSOA 1NY72 1M06G 5FQ0B 5JSOA 1RUF1 2YFZA 3I2DA 2VXRA 1DGLA 1KEXA 5D8AB 1SG3A 3G71I 3OEAA 2R7XA 1HDDC 2P6TA 4TSVA 5FO9B 5GAEJ 2DT7B 3GGLA 1GV9A 3HXLA 3USUB 3VSLA 1B8IB 4JYKA 1SACA 1FOKA 1HKSA 4S0HB 4HF0A 2LRDA 4XSXF 3DN7A 3ONQA 2WWJA 4ESFA 1IQDC 3PVBB 1W2TA 1Z6RA 1EAH2 1A6IA 2IP2A 1UW8A 3T5XA 4YW4A 2E5NA 1Y0NA 2GWRA 1YS7A 2JRTA 5FZIA 1QXPA 2VZVA 3ABTA 3K1PA 2VVFA 3EO6A 3NNLA 5JLVA 3ECOA 4Q4Y1 3DKQA 4XMYA 1WLCA 3S2DJ 1QJY2 3CDIA 2W87A 2FX0A 2PFBA 2MFZA 2QENA 3HC7A 3FIWA 1LULA 4RA0A 3L1PA 1IPKA 1RUH1 2JDAA 1SFPA 2RVCA 2ZMEA 3SZPA 3I4NJ 4PGGA 2OPKA 4QX2A 3ILFA 1CQ9A 1B8IA 2PHWA 4QTRA 4QQOA 1A34A 1UX6A 4QAWA 4DFSA 1KQ0A 4C90A 1RVF2 3I4MJ 3J7NA 3O1RA 4IHYA 4C2TA 4XUNA 1J2XA 3NJVA 1W5CC 3RDIA 1XC5A 2Z79A 4B3XA 2OBPA 4A0YA 5K1YA 2DOEA 2KL4A 1QQIA 1XSVA 1PNGA 2XAUA 5J47A 3V8JA 1HRV3 1OVSA 3OJBA 2CU5A 1QQP1 2PHLA 1MS5A 1GZTA 2ERFA 1AXYA 2O8QA 1Y0UA 4Y33A 3OIOA 2RJ2A 2VQAA 4FTBA 2EIKH 1VFCA 2R071 3FMGA 3LFIA 2CMPA 5CQGA 4YM3A 2ZEWA 5FK8A 4BISA 3OUIA 5F9TA 3S2WA 1UPIA 4Y22A 1X1CA 5K9YA 3BJ6A 1POQA 3ELNA 3D0JA 4XFHA 3FJSA 4JAAA 3ZXDA 5DAVA 4M3BA 2FDFA 1RC6A 4A5MA 5GADJ 4N90A 3WTYC 2OS2A 3QYEA 1LKXA 4F83A 3PO3J 3OR1C 4PDWA 2WQZC 2BVMA 2JQ7A 2OW4A 3WDTA 3OIPA 1CAWA 1PP7U 4ARXA 4CA9A 2STTA 4ZYGA 4MQVA 3KZ4C 4KU7A 3OUHA 1ZLJA 1R092 1LENA 1JKQC 4MHGA 1Q8VA 2W91A 1N1SA 5BPDA 4LJZF 1LEMA 3VBFA 3L2UA 4UFKA 4CDWA 5DUIA 5I8SA 1G3WA 1OCZH 4ISQA 3ZSEA 2DDBA 4NPLA 1N1YA 3POEA 1HA8A 3HSRA 3T0YA 2JDMA 3VKLA 1OKQA 4XAAA 1YW9A 1KFXL 1KGYA 2WO3A 4NPRA 4J1WA 1ZELA 2QE3A 2QUOA 4ZDPA 5C8CB 4LHSA 4X8PA 4CDQB 3PJRA 1G9AA 3OOUA 1KU9A 4XUOA 3R4KA 5HPOA 2HOAA 2HOSA 4F55A 3SCHA 3C7JA 1WSUA 5ABJB 3FE5A 4AEDB 5C3SA 3A21A 2DVDA 1AR83 1XPWA 4L8QA 4IL6C 4EM0B 2Y6FA 4LOCA 2V7FA 2VZ1A 4Q4W3 1SAXA 5TRDA 3T09A 3TKYA 1LHOA 1ETXA 5B3SH 5I0TA 4XM3A 2IGOA 3MGUA 2WC2A 1RHI2 2ZGSA 5JR3A 5HV4A 3ZYFA 1HSJA 3W6KB 3V7CA 2M8GX 2AXLA 1MBKA 1U8RA 3KCCA 1ZVFA 3B3QE 2IA1A 3SXWA 5BNNC 3DKWA 5EJCA 2J1TA 3HOWJ 5EG0B 1J9IA 1A35A 2LD5A 3GBFA 1WJCA 1OPOA 4RFT0 4XXAA 1GNHA 3CBNA 4Q4V3 4N43B 2QQPA 1NQDA 1B09A 2P6SA 3FHAA 4CXXA 5FD6A 4XEZA 3PNAA 2VKDA 4CUCA 3CO2A 1CPMA 1AL23 1R083 4MXVA 3GMEA 2OQ6A 1FP1D 3L9FA 4KA4A 5CKQA 3CZ6A 1JYWA 4I30A 4GJZA 3Q8CA 2VASA 2RGVA 3DKYA 3TEWA 4JKKA 4CDUC 4NIDA 4QU2A 1Y9MA 3GZ5A 4U0WA 2VOTA 3ZXEA 3HG9A 5HNHA 4AD9A 1K6YA 1PMJX 2HOEA 1NCRA 2D1HA 2KA3A 5L3EA 3U21A 3CCSI 5FZ0A 2RDNA 5L9VA 3REOA 2DURA 4XMAA 1HIXA 4ESJA 2NNNA 5EG0A 1FOD1 2Z5UA 4XOGA 4LPLA 3P5BA 2E63A 4BQXA 4PSXA 1IV6A 4N43A 1P4AA 2GMMA 1FYLA 5DDJ1 2VVEA 2G0EA 2Q30A 2OKXA 2FMLA 1IUFA 2UXNA 2L9NA 3IHUA 2DBIA 4AGRA 2UYAA 2M0CA 2ICWG 2A6VA 1PX4A 5JMCA 3BYWA 1PK6A 4DYCA 5L7OA 2C6SA 4AWXB 4NHLA 5J4YA 3VDAA 3J8F3 5FK7A 2HWE2 4BWOA 1BR4A 4ZHNA 4NN0A 1GLHA 5CVUA 4UUTA 4LBNA 2DF7A 2OPWA 3ES4A 3KS7A 2WO2A 4FFGA 1VBC2 5I8TA 4R52A 4DQ2A 3MUY1 2QNKA 1MQTA 2VUDA 2VCCA 5CQEA 3OYNA 5HCHA 1ZBA2 1TME1 1N1TA 4PK4A 1VBD2 5LY2A 4QPIB 1YFUA 1RR8C 3JBG2 1GOHA 2RQPA 2QDNA 4QPYA 5TISC 1L0OC 1TW3A 2XJTA 1R23A 4GYIA 1QKQA 2W82A 2QZ8A 1IW7F 3POGA 1H1IA 3IKVA 3MF6A 3F8BA 5FY8A 2PAEA 2GXAA 1L7RA 2KD7A 2L3DA 3VDCA 2VMFA 3KZZA 1U12A 3CC4I 3OYDA 5A33A 2W4SA 2YPDA 1O8SA 3USSA 2N8GA 4JX5A 3BVCA 4YM0A 1W6PB 1BLZA 1FMD2 2Q8OA 2JWTA 3C2BA 1W6OB 3CJIB 2IXHA 5F0HA 4HX8A 4LMYA 5EEAA 1U9NA 5EDNA 3TRSB 5C70A 1PHMA 3MKWB 3FBMA 3VBHA 5GZCA 4BIFA 3MEXA 3JQXA 2PA7A 3LA2A 4ARYA 2IJLA 1SHWB 1D0HA 3BOWA 1VBB2 3ZIXA 2OZJA 1FX7A 4ZTFA 4XKBA 5C3RA 1GR3A 4IF4A 4NQWA 4XC9A 1FOWA 1S0BA 3HOYJ 2RM22 1RUC1 1R1A2 2K27A 4KWLA 4C2MJ 3ZYGA 3JB4C 1VAMA 1L3JA 1LOFC 2CDOA 5DCFA 5F6FA 4LBKA 3WG4A 1WWYA 4JDMA 3CZJA 2PXJA 2VUJA 1YX3A 2DVAA 1UX7A 5LB6A 2OA2A 2OV7A 5CYYA 1IHMA 5F5IA 4BE0A 3M8FA 2VQGA 3FBYA 3VD9A 3I3LA 3ZRGA 3VYRB 4O6JA 2DMNA 3LB9A 2YBPA 1NY71 1CAVB 4XRSA 3D5LA 3VDDB 2C0ZA 3TW7A 5IT6A 4DYQA 5FKOA 3IAPA 3OYFA 1Z3YA 2DU9A 2KRCA 2LKPA 4QDRA 1JW6A 2DBBA 1WCUA 1DLLA 5FZEA 1SMYF 5J3LA 2B46X 3E6DA 5FZHA 2QQBA 2VT3A 3CDZB 3CP2A 3LSTA 1JZ4A 1BIAA 1UCXA 3VBUC 2E60A 3EUHC 1IDZA 4HRIA 2VD7A 1TMF2 1U5TB 1EAH1 3I9V2 2W00A 5ICEA 1YEWA 4RAGA 3QACA 1W7PD 4XFBA 4IOCF 3FLTA 1C0WA 3RZKA 4JGZC 5JLWA 4KWJA 2EJRA 3OWTA 4IETA 5GZFA 5C33A 3AG4H 1TQ5A 2BW3B 3KP2A 1ZRCA 1K6OA 2XAHA 1ZBE3 3J80K 2E7XA 1HRV1 4Y52J 3CD6I 1CAVA 1QJY1 4LO7A 4OU0A 4RYDA 1PUFB 3PL8A 4S04A 1NG6A 3Q0UA 1VMHA 5JMOA 1RUI1 2ZGOA 1T33A 3I59A 1J3PA 2CO5A 4AYUA 4NIIA 3LCPA 2L01A 3CF5F 2V9PA 4NVPA 4JDNA 2G4IA 4FHTA 4A42A 1FBQA 1FV2A 4P14A 5C9AB 3BIEA 4B7KA 2O14A 4WVMB 4LR4A 3U9GA 3MN2A 1LJ7A 1BBYA 3TB0A 4Q0SA 1BEV3 3A1YA 1OUXA 1ORKA 4XBQA 3U14A 4GCVA 1DGRM 1BN5A 2KISA 1YJNI 3THCA 2ZJ2A 4Y1VA 4SLIA 3TP0A 4J25A 2EBIA 1U5TA 2HXIA 1T2XA 1V6KA 3HEFA 1MNMC 2RNJA 3K3OA 3HEIA 1H2NA 4IQ4A 3U4XA 2XUEA 1X3ZB 5J8FA 1HXDA 1I3QJ 2BW3A 4BK5A 1SBDA 2HKOA 1I1EA 4EN8B 3I7DA 3JU9A 3R0AA 1IN4A 2Y30A 4CZSA 1IRGA 5DN2A 1XNKA