1ZRFA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 64
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrfA01
5BMZA 1QWRA 1UHMA 4HYEA 3E97A 3FXRA 4XF4A 1TQIA 2QM3A 4HX4A 3ABUA 4HV6A 1HKSA 1DPUA 2LNBA 4D0PA 4EJVA 4QLCU 1ZN2A 1ZH5A 5BPDA 3ACLA 3CUQB 3PFIA 5K1YA 2KIMA 5BOXA 4ZYDA 3KMHA 1IN8A 4AIKA 2MC3A 2QNKA 2H27A 1XGNA 1TQPA 4HDVA 4R8HA 1RNLA 1TQMA 1BI3A 2P17A 5T3NA 1EH8A 4IRHA 4ESJA 1K79A 3O14A 1B9MA 4H7LA 4ORFA 2FXAA 1O5LA 1XN7A 2QCSB 2FNPA 2V6CA 3WTSC 3H7YA 4A0YA 3WW1A 2G9WA 1NE4A 2JSCA 2DQRA 2ELHA 4I98B 5BXXA 2XKPA 2EA7A 2VPVA 5CU1A 4ZH4F 1MJ9A 3CO2A 4XFBA 4HDUA 3KP3A 3ELNA 5H6QA 1J2XA 5CVIA 2QBYA 5JSOA 2CAUA 2DK8A 1SQ4A 5IT9Z 1FBQA 4FBFA 1RZ4A 4RS8A 1SMTA 2VC1A 3F3XA 3E5QA 3VODA 2DBBA 2Q8KA 4QGNA 2XGXA 5E16A 4YFNF 1SD6A 4HLXA 4A0XA 5I91A 2Y75A 1ZG3A 5CVUA 1J59A 4MEYF 4G6DA 2FEZA 2UWMA 2EK5A 4RB0A 4BQAA 2UY9A 1XSDA 2FE3A 1HKQA 5D5WB 5JVTA 1F9NA 3KZYA 2QENA 3BROA 1QQIA 4CO8A 4Z2YA 3CUQC 2M30A 1BC7C 3RPQA 4UVAA 4Y13A 1J3QA 4TLFA 4XFGA 1YLLA 3V8KA 4IEUA 4KIFA 2M5WA 3GFJA 3HUGA 1P4XA 5DUKA 3EJKA 4QXKA 2ZKZA 3KP4A 2Z33A 4I2OA 4JV4A 4YYOA 1MD0A 1IPKA 3H1YA 2BV6A 4EV0A 1DP7P 4AIJA 3IDCB 1IXSB 3IWFA 2B5HA 2P5LC 1PUEE 2CO5A 4KT5C 1UPIA 1PM7A 3MDPA 3TDUC 4KU7A 3NSTA 3N4MA 1FZPB 2KJCA 1YWKA 2W57A 1P4WA 4MGKE 1WQ2A 2GA1A 5I8TA 3VB2A 4A12A 4KN7X 4DNCA 4GCVA 1ZRFA 2XROA 1FP2A 3CJNA 1IZ1A 1MJAA 5E20A 3HSRA 1YS7A 1I6XA 5LRRA 2IT0A 2STTA 3UKTA 1DZTA 3L2CA 3KCCA 2XLFA 5HI0A 4I0AA 3F22A 1G3WA 4EMSA 3ISPA 3JTGA 4EM1A 1S7OA 2X0LA 4UXNA 4L9NA 4WXDA 2P6SA 4LLLA 2P6TA 5CVVA 5LBQA 3ZDSA 4YFXF 5JI6A 1NZCA 1O3QA 1P2FA 4L18B 3IKVA 3H92A 1VTNC 5BS6A 5ICGA 3QU3A 3CO6C 4YIIA 4IEPA 4XSXF 2ET7A 3OOPA 1YQAA 1BBYA 3H50A 2ESHA 1Z6RA 1KGSA 4O9EA 1U5TA 2O3FA 5E1ZB 1QBJA 1I1GA 1J0RA 2OZJA 3U0ZA 2KIUA 4LUMA 1JXSA 3JAMK 2E1CA 1KYWA 4XF9A 3QU6A 2B0LA 4YFKF 3RNSA 1SFXA 1B6AA 4LLGF 2A07F 2GC3A 1YFYA 3V7SA 2ISZA 1FPQA 3WTZA 5E8GA 3SXWA 1MDMB 1QXJA 2KKOA 3SCFA 2NNYA 4NVPA 3WU0A 2K02A 1BI1A 2HWVA 3K69A 2ET1A 1XGOA 5D6EA 1CAUA 2PHLA 2WC2A 2OYZA 3R60A 1SFNA 1NXMA 2GC0A 3WTUC 4EGZA 3O3KA 4Q5SF 1R1TA 2EFQA 3FXUA 4J1WA 4B09A 1KQ0A 4XLPF 1UIKA 3HRSA 3K1MA 2O61A 5I0RA 3WTTC 4G8XA 2DLLA 1QO0D 4G7OF 3RKXA 4KWJA 5D8LB 2FSWA 1ZGJA 2NYXA 2VOPA 4RB1A 3D0JA 5I93A 5ILUA 2ZO4A 1TTYA 1YYVA 4XBFA 3U9GA 3J81Z 2ZNZA 2OZUA 2DT5A 3GX4X 3GFLA 1BIBA 2P7CB 2VT2A 5H6RA 3FXQA 3Q9SA 1JHHA 1U12A 5HDNA 4AWXB 2D2WA 2GXBA 4NQWA 2Q2EA 5J6XA 4U0VA 2K7LA 5EZWA 2DO7A 5DD8A 3MYXA 3SCHA 2VN2A 2ATFA 3H9AA 3BJOA 2GC2A 3CO7C 1X82A 2VXZA 3KEQA 2GQQA 1UCRA 3UKVA 5CLSA 4HQMA 4E2QA 4XETA 1CX4A 5ILSA 2XAHA 1YFHA 2IA2A 3CLPA 3E3VA 4AXOA 1HSJA 3KEOA 1YW9A 5FQ0B 2AS5F 3BJ6A 1EV7A 3LA2A 1IXRC 2BE5F 1U8RA 3MWMA 1CAVA 4JK1X 3GFIA 1GQHA 4U7BA 4J1XA 3J80Z 2VE9A 1EH7A 3LWFA 3FM3A 4N9HA 5K5OA 2ZFWA 1T0FA 5HDGA 1CAXA 3DF8A 4EGYA 4M72A 4N0BA 2M8EA 1UCXA 4AIHA 2L3DA 2F5FA 1QZYA 2G7UA 4M71A 1L3JA 2ZJ2A 2J5PA 4Z07A 5K5QA 5J48A 2IVMA 1SEFA 4XF3A 4R52A 2OQRA 4FAHA 2XL9A 3KE2A 3MEXA 1ZG5A 1HBXG 5BQTA 5LEKA 5E17F 2VC0A 3BOQA 4PGGA 4MGYE 1FWZA 3R0AA 4HVRA 2NS0A 3H3ZA 4IERA 1XSVA 5HDKA 1G3YA 1YHFA 1BM9A 1DZRA 5CVJA 1A04A 2R3SA 5LHHA 3ML6A 5DV5A 3KGLA 3F8CA 4L0ZB 5A2QZ 2ETHA 3T1BA 3ES4A 3ZMDA 4OMYA 3TOBA 1NYWA 2OAZA 5TJJA 5L3EA 3RYPA 2XASA 1XE8A 3RI4A 4I02A 3CUQA 1WSUA 2ZXJA 2VBWA 2FA5A 4HBNA 1O3RA 2MBFA 4YNIA 4PDKA 3KP6A 2K0GA 2UXXA 3LZZA 3E6CC 2RVCA 2DK5A 4EJOA 4G7HF 3IL2A 4CYDA 4FX4A 1B1BA 3DPTA 2MD5A 3R4KA 3DL3A 2L02A 1T38A 4JVAA 4ON0A 3MQ0A 2A6HF 1LQ1A 3OF1A 3BJAA 4KMFA 4EROA 4BNCA 1RTVA 2I45A 3O2PE 1MJBA 4LK0F 4XF0A 2H6CA 5AIQA 2WTEA 4WXHA 4EJWA 1DPRA 4O6JA 5HVQC 5D5UB 1G4DA 1V70A 1VJ2A 1ZX5A 2V1UA 2UYBA 2M87A 4CHUA 2V1DA 3GO5A 3PVBB 2XKOA 2IXKA 3S7EA 1YW7A 3WW2A 4JTNA 4ZU5A 1XCVA 3HSEA 3V8JA 3HRUA 4K2EA 1YFUA 5FLIA 5LGNA 2PA7A 1Z91A 2RN7A 3ZMZA 4E2GA 2XLAA 4PJYA 3TO6A 5AIPA 4OU0A 5F64A 3E5XA 4GULA 4E2SA 4L5JA 4PIZA 1B9NA 5C6CA 3L09A 2A69F 4XF1A 4HW0A 4CZZA 1J7KA 2ACJA 1HKTA 1KQ9A 2XV4S 3V4GA 2LF7A 3CLOA 1S29A 4UNOA 4P9UA 2IJLA 3I5UA 3LQRA 2YPRA 3QPHA 1D5VA 2MA3A 3TKYA 2O8QA 3WTYC 3GBFA 3WE3A 2GA2A 3LA7A 1Z05A 3ELKA 2K4JA 2OZ6A 4CICA 1OYYA 3LFKA 3K9TA 3WGIA 1BJAA 1IN6A 1O5UA 3PQJA 4GYIA 4Q29A 5FPZA 3B02A 3EETA 3ZP5A 2D1VA 5L3CA 4O3MA 4M9XA 2D5HA 4Q0UA 4MTEA 2M1BA 3WODF 3FX3A 2PLYA 3DN7A 2YSRA 3EHKA 5I8SA 3TOAA 2A61A 4EQQA 5FFXA 3EDPA 4A5MA 1IN4A 1L3LA 5JCTA 5BPIA 4ZYEA 1XCBA 4AVPA 1OFNA 3QP6A 4ENKA 1OYIA 4N9IA 2V9VA 1RL3A 3T0YA 5E8IA 4HOBA 2PTMA 1MKMA 3JTHA 5DD4A 3E6MA 4FHTA 2ADUA 2WWYA 5DCMB 1FOKA 2QVOA 4KICA 3CDHA 1ZRRA 4HMZA 2UYAA 3JZVA 5HOOA 4OFGA 5J7MA 3M9AA 4YRDA 2TDXA 3VEPA 4LTAA 3G73A 1ON1A 3E6BA 3ZMUA 5F1RA 4MH0E 1TNTA 2W24A 3CUOA 3TO7A 3OD0A 5I0UA 2FBHA 1LR5A 5HS9A 3RZZA 2CFXA 1U2WA 4XFCA 4OIOF 3ZMVA 3ECHA 2KRFA 1W4MA 5ICCA 1IRGA 2X4HA 5D8KB 1GVJA 3VHRA 4UBGA 3N97A 2HZTA 4S04A 2FRHA 3SHFA 1UW8A 3KZZA 1IN7A 1SAXA 4KNYA 4HV5A 4MUVA 4JQFA 3IRRA 3IBMA 4IPAA 4HLYA 1R00A 1YO5C 3GUDA 3BPZA 2FNAA 1T39A 3TNPB 4G94A 1J9IA 3F6VA 3FJSA 1X8EA 1BI0A 4L2NA 1J58A 1LDKB 1YIOA 2D5FA 1MDMA 1WLTA 1ZVFA 3I54A 1W7PB 5FFZA 1VP6A 1XD7A 4ZYGA 3GVAA 3ZMTA 2PI0A 2XVCA 1J3RA 4NB5A 3BPXA 2IP2A 3P7NA 3H1MA 3FHIB 1KU7A 2L54A 4KFCA 1I5ZA 1PP7U 1H1IA 2XAGA 3F8BA 3KGZA 1P92A 2HTSA 1ZZ7A 5JSPA 1HW5A 2H6BA 1K7AA 2VBZA 4ONUA 4UUVA 2O1QA 3GFMA 3H3UA 1H9GA 1B4AA 1USSA 4LA3A 4LLOA 3RJPA 2P5KA 3ZN1A 4QMAA 1BIAA 1Y9QA 2BYVE 1IN5A 4H0EA 2DU9A 3QRFF 4MZUA 2ZKLA 4HVOA 4M6XA 1ULYA 4IEXA 4LK1F 3I4PA 2H94A 1TW2A 3D82A 2OU2A 4A6DA 2PAEA 4WVZA 4EM2A 1EH6A 3MFKA 4KWKA 4ZZDA 5J8FA 4I01A 2W25A 5HLHA 5L3DA 1ZNPA 3ST7A 2EV5A 3SMHA 2UY8A 2Z99A 1YW8A 3R6SA 3SFZA 3WE2A 1FBSA 1LDJA 3GZ5A 4MHGA 1K78B 4A6EA 3CEWA 4TV7A 5LHGA 1SFEA 2B9UA 4MGIE 2Z3YA 3EUHA 1GXQA 1Q1HA 2HOEA 4MEXF 1YG2A 3ULQB 1OD5A 1CAWB 5KHGA 1R5HA 2KIFA 3T8TA 4LG0B 2A3SA 4HA8A 3LOIA 2PJPA 5FQ0A 2F2EA 2D93A 3RKYA 1RIOH 3WTVC 2O03A 4QM8A 3UKNA 5KHKA 2HKXA 4EWAA 5KHHA 3DXJF 1H1MA 3DP7A 4YIFA 1V4RA 3GYHX 2D1HA 4OIRF 1QGPA 2OA2A 5C8WA 2OBPA 1NHAA 4G7ZF 2A5YB 2EFNA 1PDNC 1X7NA 1JGSA 3HT2A 3EQEA 4AQ6A 3GW2A 4U7DA 3BB6A 4L9VA 3L7WA 3CTAA 2QUFA 3JAMZ 2DI3A 4Q0VA 2MH9A 4HLTA 4EJUA 3QOPA 2PAMA 3F8FA 4IEWA 3CL1A 4L5IA 3PLQA 3WW4A 2O8XA 1DDNA 1OKRA 1E2XA 2BGCA 4R1HA 2VECA 2N7GA 4F8AA 3SZPA 4GO1A 3DV8A 3F72A 5L3BA 5BY5A 2QQAA 5ILVA 3BPVA 3G7DA 2JT1A 4IHTA 3KETA 1FXZA 4LGWA 2Z2SB 4ZYHA 2LSOA 3GLXA 3I71A 5TRDA 4Q0SA 1FSEA 1FC3A 2F5CA 1AWCA 1F5TA 3GWZA 4MGRA 3RYRA 4L9TA 2D45A 3I7DA 3D5LA 3OTFA 2XRNA 2IRFG 4HN0A 1R1UA 2IXLA 2LF8A 1W5SA 3HHGA 3HQXA 1SFUA 1HQCA 3IWZA 2Z69A 4Q48A 1V3FA 2JZYA 1KU2A 3IRQA 1Y3TA 3EQLF 1MZBA 5I0TA 2Z5UA 4L0YB 4KDPA 1UIJA 2E1NA 4RAZA 5HLIA 4XFHA 2VODA 4OINF 3RTRA 4HF1A 2CV6A 2V79A 3B73A 2CQKA 5LGUA 2BEOA 1HSTA 1T6SA 2RV8A 1ZZ9A 3JW4A 2HS5A 4KIBA 3K1NA 2K4BA 1D8KA 4LB6B 1FSHA 3TQNA 4EVIA 3GZ6A 3W6KB 4I0BA 4BIFA 4XFFA 2FOKA 4RGXA 2AXLA 4ENNA 4B8XA 4HZFA 4RGRA 3R61A 2STWA 2W85A 3FM5A 1DGRA 2GU9A 1UD1A 2HR3A 4WX9A 4L11A 2NRAC 4I09A 1WWXA 4EJTA 3OGJA 3KP5A 3SXYA 3LQQA 2F5EA 2RNJA 3S2WA 1ONVA 2FBKA 3I0TA 1JHFA 2O0YA 2VONA 2FQPA 1SD5A 2EFPA 3K1PA 2QDRA 3BCWA 4KWLA 5I8YA 3U2RA 3GEZA 4L9JA 5CYVA 3M8FA 1ZZBA 2J5OA 2L4MA 2Y0OA 3QACA 4AD9A 2NAZA 4X6RB 5BUVA 3WTWC 2P5VA 3KSCA 1XE7A 4ESBA 2ZMEB 1KYZA 4CGZA 3V7CA 1LRHA 1OYWA 4K8FA 1OI6A 1G6NA 3LWCA 5JR7B 2CAVA 2H0VA 3LAPA 1S3JA 1XDUA 4AVCA 3NL1A 5FLXK 1EY2A 3FMRA 2PBIA 1QY4A 1TBXA 1B59A 1F4KA 4LJZF 1TNSA 2M45A 2RQPA 1IW7F 5FDBA 2Y48A 3TO9A 1GQGA 2ZCWA 1O7FA 2DFIA 3FMQA 4U0YA 4MQVA 5CJ9A 3KFWX 1FT9A 5DDGA 4Q0PA 3BWGA 2BNMA 4LULA 3F21A 5DCMA 1W7PD 3MCZA 3WGGA 3JSPA 2MNGA 1Z1DA 3ABTA 2MPFA 4HX8A 1SD4A 4LLNA 3RKWA 4QWQA 2PHDA 1ZGAA 3KLOA 2XUBA 3REOA 2BBYA 3WG9A 4CXFA 3T5XA 3IKTA 2EV6A 5HLGA 4UVBA 1PP8F 4A0ZA 1IUYA 1HW1A 4IF4A 1X8MA 1XB4A 1FYLA 2IA1A 4LEJA 3NEUA 4IRIA 1LB2A 5IT3A 4G6QA 1ZRDA 1O57A 1S7AA 3MZHA 2RGVA 2EA2A 2NNNA 3LAGA 2IA0A 2Q4SA 1G3SA 1Z6TA 3MPBA 5AONA 2HYGD 5EEHA 4O9GA 3U10A 2VBXA 2IW5A 3S7IA 2K9ZA 4S05A 4BHCA 2FU4A 1W7PA 5FD6A 1QZZA 3ZN0A 2XHKA 2CWEA 2Y0MA 1LJ9A 5CVRA 4CDGA 3G3ZA 5D5VB 1P4AA 4Q4ZF 1LKNA 1EP0A 4LMYA 4FX0A 2CYYA 2GXGA 4ESFA 4UVCA 4ZZLA 1OR7A 2O6GE 2RKHA 1Q3EA 1ZYRF 4LA2A 4ASNA 2MHFA 4EWDA 2YX4A 4MTDA 2IXCA 1UHWA 2RC4A 4KN4X 4ETSA 2QVSB 4RGUA 1ZRCA 1OPCA 1J1LA 1S8NA 3TNQA 5FPXA 1TW3A 3CF6E 3SCGA 3F8MA 4WK8F 3C7JA 2GH2A 3DQVC 2DAOA 4BH9A 5JSRA 1YTYA 5DYMA 4M73A 1FY7A 5FD5A 4JTOA 5E18F 3E5UA 1TQ5A 3OCPA 2EJRA 3SQNA 5FGMA 1Z9CA 2F5DA 3U1DA 5FO5A 5FLHA 4QX5A 3U11A 4NHJA 1YFWA 2P8TA 4P55A 1K78A 1CGPA 2A68F 4UV9A 4WXCA 2HJIA 1FNNA 4P96A 3USSA 4WCGA 4ZU4A 4IVNA 2JTVA 3Q5FA 4MNUA 3ZQ7A 1YUDA 4DINB 2ZBKA 2VQAA 1CAWA 3ZPLA 3LAJA 3HOSA 4LG0A 5IT9K 5H20A 4HF0A 1JE8A 3BP8A 5KBFA 4B29A 4U88A 2FBIA 2QQ9A 2V09A 2Q0AA 1RUNA 4PIXA 2Q1ZB 2GZWA 1SMYF 2VT3A 3LA3A 2Q0OA 4KA4A 5D1IA 3NVCA 3M7GA 2Z9OA 3M1EA 4WBBA 1RC6A 1YLFA 1CF7B 2E7WA 1R22A 4F7ZA 3I59B 2Q30A 3BALA 1XRUA 4Z82A 3KP2A 1I1SA 1J3PA 1Z7UA 1IAWA 2GWRA 1LDDA 4KIGA 3J7AO 1D3YA 4RGSA 3KLNA 2DPUA 1Q5OA 1YFXA 4AVAA 2XAFA 1ODDA 4KU8A 1IRFA 4IESA 4IEOA 5JFRA 5E1XA 3BDDA 3RYKA 3T8RA 3HYIA 2WV0A 2EB7A 1RGSA 2OPKA 2K27A 3ZMSA 5J8CA 5JHUA 5KHJA 2FMYA 3C3VA 2ZNYA 2ISYA 2EV0A 2LDUA 4GGGA 2PQ8A 2DW4A 3FWEA 3HT1A 3C18A 4ENJA 3GXOA 4MV2A 1WI9A 4OIPF 4GYGA 1WGPA 1ZG1A 3HTSB 3DKWA 5JR3A 2GIVA 1KA8A 3V8LA 2P7VB 2HQRA 3BZ6A 2L01A 2DQLA 1XMKA 2CG4A 1JUHA 2BNNA 2KJBA 1RI7A 1LEBA 3KP7A 3EYIA 3ROUA 2PFBA 4Y15A 4ZU7A 2E9QA 3TGNA 1IPJA 2G7HA 2DTRA 4LB5A 2FF4A 4IEZA 4IEYA 2XLGA 2PEXA 1L0OC 4E70A 3IC7A 2CSOA 1YS6A 1USTA 5LEJA 1OMIA 1RUOA 2QBYB 1FP1D 3VFZA 1PMIA 3H7JA 3PNAA 4PZJA 1XGSA 4IRGA 1O7LA 5E1RA 2COMA 4LFUA 1XDSA 2HDCA 3L2HA 4XLNF 3MZYA 2RDPA 4XRFA 2FQ3A 1R1VA 3M8EA 3NW4A 2YX7A 1WRJA 4XSZF 3FE5A 3BU7A 4LUKA 5CADA 3F6OA 3ETQA 3O6BB 3M3IA 4XFAA 1I27A 3CJXA 1QNTA 3Q9VA 4HBLA 3R0JA 2DCTA 5D5XB 4AVBA 4KL1A 4UHTA 1AOYA 2OQGA 2HFHA 2HKOA 4RAYA 4HAMA 5FLJA 1FYMA 1O3TA 1BC8C 2D40A 5EFUA 2H09A 2BNOA 2KXLA 4QGMA 2HGCA 1WA4A 5L3FA 1J75A 1XMAA 5KK1A 4HQEA 1G3TA 2XAQA 5FB2A 2YR2A 2ZMEA 5DUIA 4P9FA 2PN6A 1KU9A 2XAJA 1LVAA 2HTJA 4KYWA 1H9TA 4D7TA 4XEZA 3DFGA 1SD7A 1IXCA 3J81K 1DUXC 2F4PA 4D7SA 1KQ8A 3BY6A 4UXAA 1T2KA 2PG4A 1NE6A 2L4AA 3COAC 3MAJA 3WGHA 5J3UA 4OIQF 1ZZ8A 4BHBA 4IXAA 3K0LA 4UV8A 4U0WA 2UZKA 2HYFA 4QM9A 2WFPA 2QLZA 1EPZA 4Q47A 2JRTA 2VBYA 1ZLKA 3TDZC 5D4RA 4HF2A 1ZHFA 2QQBA 1UFMA 1Q43A 1R23A 1LEAA 3RPUA 2HEOA 4PGHA 3HHHA 4WWCA 1XSXA 2QWWA 1GHCA 4M74A 2IXHA 2GC1A 1LNWA 1F1ZA 2IPQX 4HN1A 2C6YA 1O3SA 3EO6A 3HOTA 2IXIA 5AVPA 3FZ3A 3J80K 3ERED 5LHIA 4HSJA 3NRVA 3RIRA 4A2UA 3H8UA 2MH2A 2PYTA 3PQKA 4P9GA 4RB2C 4META 3I53A 5E1WA 2QYOA 3HRMA 2V1XA 3SHRA 1QPMA 1U5TB 4M6YA 5BV6A 2P4WA 1D8JA 4RD7A 3W6JB 3NKTA 5I0SA 2EWNA 3FF5A 2DPDA 5ED4A 3L9FA 3FFQA 1ZZ6A 4YARA 3NQOA 3WTXC 4JBAA 3QP5A 4I7HA 1U78A 4RB3C 3EBRA 1TLHB 3EYYA 4P5OA 5DCFA 2C0ZA 4BAYA 1BI2A 1U6GA 3C3WA 2PFWA 3HSFA 4IHSA 4HVQA 3P9IA 1P6RA 1T98A 2HQNA 1S6LA 3HRTA 4KMUX 4WZCA 3I64A 2LKPA 5L3GA 3H1WA 4HSLA 1K6OA 2PMHA 1CAUB 3FMSA 5HS8A 3JSOA 3FHZA 1QXRA 6PAXA 4IJAA 2EAAA 4DQ2A 5KVRA 5ERIA 5A2QK 4IEVA 3NJZA 1HXDA 2JPBA 3C1DA 1GXPA 4X6QB 2K86A 4YSFA 4ENMA 3OV8A 4YG2F 4EWEA 5K8SA 2R7FA 2MLKA 3F8NA 1ZAOA 3ECOA 4XFIA 2EFWA 4I3PA 4O5VA 3RDIA 1J5YA 2E7XA 5FLXZ 4Q0QA 3M70A 5DEQA 2A6EF 2VOOA 1R36A 4BXUA 2XL7A 3E6DA 1U3EM 2OA4A 4R79A 5EEGA 1IF1A 4BHPA 1KU3A 4GXOA 2IC1A 3DPLC 1U5TC 3GF2A 3WU1B 1ZREA 2QJVA 2JPCA 5LGTA 5D6FA 5BPXA 1Y0UA 1WKMA 2XIGA 4OMZA 2PAKA 3SZTA 2W84A 1XGMA 2GAUA 4EM0B 4Y17A 1EYBA 1VR3A 3IDBB 3I58A 4OLLA 1C0WA 3V7RA 3HIFA 4MX3A 3S0MA 4M9SA 1MGTA 4G9YA 5KHIA 2ETEA 1BN5A 5FCCA 3IHUA 3GYDA 4PCQA 5JAXA 4QGLA 5HS7A 3F23A 4MQ9F 1DGWA 3IIAA 1FLIA 1CAVB 4WF2A 1HW2A 3AAFA 3ES1A 1X3UA 4IETA 5F6FA 1FX7A 3P9KA 1STZA 2CGPA 2YU3A 3D0SA 4A5NA 1CF7A 1CAXB 2B8MA 4AQ2A 1H0MA 3I59A 5ICEA 5LLQA 4OOIA 1FI2A 2PMUA 1REPC 4IEQA 2EFOA 4UBHA 3QAHA 5ICFA 3K2ZA 4PIYA 3DEUA 1ZZCA 3VOEA 1O4TA 2UXNA 2FMLA 3FZVA 2QZ8A 4KUMA 4M9ZA 1W5TA 4BYYA 5K5RA 1FYKA 2EVXA 1ZARA 1ON2A 2CW0F 4FAGA 1R58A 2R7DA 4LD5A 2EA4A 1R7JA 1ZLJA 2OD5A 2PQQA 1BOAA 1FBUA 3QPTA 2IXJA 4HX7A 1E17A 4MGZE 3P9CA 3L00A 3HTUA 3WW3A 4FT8A 5D4SA 1R5GA 5LRSA 1UB9A 2ESNA 3LSTA 2MLGA 2VE8A
chains in the Genus database with same CATH superfamily
4BLIA 3T3YA 1QWRA 1UHMA 4HYEA 1XYPA 4RFRB 2V4VA 1RUH3 3KWVA 3HOUJ 2JK3A 4NRPA 3QYBA 4C91A 3ABUA 1H2NA 4HV6A 1DPUA 2LNBA 2VXDA 3FLTA 3K3OA 1ZH5A 2YHJA 4RA0A 5C4WA 3CUQB 5K1YA 2HWD1 3O0VA 3ZDVA 5LY2A 2KIMA 2DMPA 3OY8A 1IN8A 2ARCA 4AIKA 2DUPA 2WNUC 2QNKA 3IAPA 2N8GA 3AMQA 1OLMA 2P17A 2X6XA 1R1A3 4E4HA 3O14A 1LOAA 1PGL1 1B9MA 4H7LA 4NOTA 3KF5A 3LSJA 3JB4C 2KA3A 3A0BC 2Y6LA 1VAKA 3WTSC 2GN3A 2LKXA 2JDZA 5SV5A 2YG0A 1GZWB 1OLME 1NE4A 2DQRA 3M3YJ 1S2BA 3N7LA 5BXXA 2VPVA 5CU1A 3I2OA 3QYEA 2AO9A 3CO2A 2JUCA 4B3XA 5IVVA 3ELNA 1KJLA 3ME2A 1QJY2 1MBJA 2VZSA 2WV1A 1BYHA 5IT9Z 4FBFA 1SMTA 2Y60A 3E5QA 1FIPA 1H2KA 3IMMA 4HLXA 2Y75A 2LLKA 5C9AC 2R0HA 3J7NA 4Y26A 5CPRB 2EK5A 2AUYA 2RS13 3PVEA 1XSDA 1NK3P 4XURA 1SANA 2VW1A 1W6NA 4AM3A 3KZYA 4MGSA 5HCHA 2X53S 2RDNA 4COYA 3CUQC 1LULA 2CWSA 1BA5A 3LL7A 4BQ3A 2VUAA 3LGRA 3GALA 3OGRA 2C26A 3T08A 1JUMA 4OUSA 4XFGA 2OTLI 3KCXA 4KI5M 2OQ6A 2DMTA 3V8KA 2VJ4A 1R1A2 1UOBA 1RVF1 3GJAA 4FE7A 3AL0B 1XC5A 2Z33A 4CCKA 1JTYA 2NMNA 4LBQB 1C3HA 1XPWA 3N9MA 3MIHA 3OYBA 4YVWB 3LCPA 1DP7P 1NLRA 4QPIB 3THCA 2LH9A 3MDPA 5GZCA 4ZS2A 4XXAA 1YIPA 1JZ7A 3AM2A 3ZFGC 2ZJCA 4E7KA 2LTPA 1XX5A 5AFBA 5FY8A 4UI9L 4IXLA 4GCVA 2KISA 1ZRFA 2RS12 3CJNA 5FO8B 1MJAA 3RZOJ 3L2QA 2OS2A 3Q9OA 3L2VA 4JX6A 3JTGA 3PU3A 3WQ7A 4L9NA 3OMYA 4WXDA 5LA2A 3X2QH 4XBLA 4QQOA 4BE1A 3F2ZA 3WF3A 5JI6A 1KZHA 1O3QA 1P2FA 3M4FA 2BPA2 2VCCA 4K40A 2L0KA 4XPVA 3K10A 5A3PA 3TOJA 4MIMA 3C2GA 3AL0C 5ICGA 1RXFA 1ETKA 4IEPA 4XSXF 4XZPA 1JKPC 4LO7A 3ACGA 4QPOA 5HNFA 4YVWC 5A33A 1Z6RA 2X51A 5B4NA 4QPIC 5A7PA 3ZYFA 3MKWB 1OUXA 2KIUA 3Q3SA 3QODA 5T5JA 4NUBA 1MEC2 4FXGB 1KYWA 2NQYA 4HKOA 4XF9A 3QU6A 4GDFA 2MW8A 4PF1A 2B0LA 3RNSA 3RWNA 1O8PA 1SFXA 2A07F 2V73A 1QXJA 3ACHA 2F4OB 4HKLA 3MV11 2NNYA 4XKBA 2RVAA 5DG2A 3WU0A 3PNYA 5FFOC 2ORXA 4AEKA 1XGOA 3VBFA 5D6EA 1CAUA 3CCYA 2WC2A 3BR6A 1SFNA 3PUQA 1POV3 3WQBA 4AU7A 1MMAA 4BQ4A 1R1TA 1YX3A 2EFQA 4J1WA 5FY4A 3PFYA 5J3LA 2QQ8A 3HGGA 2BBAA 3HRSA 3H3LA 3S30A 3W21A 2Y6JA 1F43A 4Q4V3 4NROA 2NVQJ 1RJ8A 3A4UA 2NYXA 3D0JA 4RB1A 5ILUA 3J81Z 1JHNA 5IVJA 1XQNA 1PGW1 1BIBA 5IT6A 5A70A 1G8WA 2P7CB 2E31A 4P9WA 2LRDA 1OT5A 5KC6A 1UG2A 1Q8PA 2ZMNA 4A42A 1JTZX 2B39A 4CCDA 1DIWA 5FY9A 3W5MA 4EN0A 2GLOA 1X82A 2VXZA 3KEQA 5FZBA 1D5YA 1CZTA 2VQHA 1MBFA 1DYKA 1D1BA 4B43A 2HWC1 1NT0A 2WY8Q 4DBRA 2C9AA 3AL5A 1U8RA 3VKFC 3H1CA 3GFIA 5M5YJ 2GN7A 1GQHA 3J80Z 1NA1B 1EH7A 4JZRA 2RS53 5K5OA 5HDGA 4M72A 4CDQB 4Z8BA 4UT5A 3SKJE 4Q4V2 3H3VK 2OC6A 4PBPA 4RLQA 2ZGTA 4AI2A 5CIRA 4K1ZA 1F5FA 3N3HA 2G7UA 1AR91 2LG4A 1L3JA 2ZJ2A 4Z07A 1NCQB 4P14A 1JZ6A 1SEFA 2C5DA 4XF3A 3V42A 4QAWA 4FAHA 4LBOA 4QD2A 5BQTA 5KC5A 5GP9A 2XGCA 2VC0A 4PGGA 3HBZA 4PT6A 4XQDA 3H3ZA 5C9AA 1XMXA 2OPTA 1A04A 2R3SA 5LHHA 3CLQA 3TRSB 2ETHA 3BC8A 1KXGA 2ZX0A 5IVYA 1Q8QA 3POBA 2JVHA 4MFDA 3B01A 3KZ4C 5BNOB 4W65A 1ZA7A 2WNOA 3RI4A 3CUQA 2F6CA 2VBWA 1NA1C 4CUAA 1QOTA 3H0OA 4M3CF 4R9DA 2MBFA 2RS52 4HSRA 2Q5TA 2V6EA 3I3EA 5TSWA 2TEPA 4CDQC 2QKLB 1QOSA 3E6CC 3I56I 2VLAA 3IL2A 3OYMA 3UT0A 2JECA 3DWLE 2HEVF 2MD5A 3FLPA 3R4KA 3JRIA 3DL3A 4KITB 1QJY1 3VYSB 5IATA 1GZWA 2A6HF 1LQ1A 2PHRA 3OF1A 2IEKA 2V9PA 4KG0A 1S0EA 4BNCA 5DTDA 3OYIA 3O2PE 3CQOA 4AVSA 1IC8A 3VN4A 4LK0F 5FOBB 1SDWA 2C4XA 2V1UA 4MXVA 2DT7B 4A3MJ 2V1DA 1DFQA 1XU2A 4ZU5A 3VBSB 4K2EA 2R6QA 4A3FJ 2W52A 2RN7A 1JYTA 2CHHA 2VTFA 3K4CA 9ANTA 2RREA 4OU0A 5IAXA 4B4RA 2AEYA 4E2SA 1YO8A 4PIZA 4PFPA 1B9NA 2YFZA 5FXZA 4HW0A 2IXSA 3J7MA 1XSRA 5GZFA 4UNOA 5BNOC 4MGQA 3I5UA 3LQRA 1S7EA 1YI7A 1F4AA 4C90A 2YPRA 4QIWN 4QPYA 1AX2A 3K70C 3WE3A 2XQXA 5FJ8J 3LA7A 3RZGA 2DBIA 1KS4A 5DPNA 3MN2A 1OYYA 1NX9A 3K9TA 1NAEA 4KJZA 5GADJ 4F93B 4F91B 1IRXA 1WBLA 1JH5A 3KYCB 3AP9A 1E3HA 1ZA4A 3MHZA 3VYUB 4LBQA 2HI3A 4O3MA 1AR63 4J01A 4LIVA 5JLWA 1GDTA 4MTEA 4CCOA 1ETOA 1WA6X 2JXAA 2PLYA 3EHKA 3AK0A 1EV13 1V00A 2LOOA 5FFXA 1OLRA 2WWUA 4A5MA 2W94A 4XK4A 1DQ4A 2EXJA 3MICA 4ZYEA 1XCBA 4AVPA 2P34A 1OYIA 2V9VA 1RL3A 3T0YA 3O7OA 4HOBA 2X1CA 5DD4A 3MW4A 3WR0A 4FISA 1LESA 2WWYA 1D1AA 3RSNA 2QVOA 1BVVA 4HMZA 3F95A 1MH3A 2DA5A 1FNYA 1DDLA 4EN7B 3NNJA 4LTAA 3E6BA 2GM4A 4BEHB 2JUGA 2VOXA 4LIUA 2YBPA 2L7ZA 4F55A 3OD0A 3H8OA 4ISQA 1GZTA 1KDMA 4S2GA 5F7UA 2AEZA 2P4EA 2ID6A 5K7FA 4LITA 1X1DA 1VAVA 2JIGA 5ICCA 1MEC1 1CJDA 5GALA 5D8KB 1GVJA 4UBGA 4AAXA 2L7KA 3OR2C 2FRHA 4I99C 4HONA 3ASIA 4JQFA 3IBMA 4IPAA 4HLYA 1EV12 1SLCA 3O0WA 3GUDA 2FNAA 2A6WA 4M3BA 4G94A 1J9IA 4UYBA 3S16J 1JI6A 4BQWA 2VMIA 1X8EA 1ONAA 1LEMA 4D5CA 3GZAA 1UF2C 1J58A 4UW4A 3SEZA 4AI1A 2BFUL 1YIOA 4E7ZA 1ZVFA 1VP6A 4ZYGA 2PI0A 4RYDA 1E5SA 3BPXA 2IP2A 2VU9A 3P7NA 1ODNA 2EIDA 5K7PA 2R043 5LK7B 2XAGA 1LECA 3F8BA 3RQ4A 1KRIA 2VBZA 4UUVA 4GALA 1MBKA 3BUCA 3LKJA 1H9GA 2IUWA 4S2HA 1OOPA 3FHNA 3GXUA 2KQRA 2O7OA 4LLOA 3RJPA 2A5ZA 2ZX2A 1UZVA 3WCRA 2ZKLA 2IGMA 4HVOA 1CR7A 4UOJA 4NIHA 4HETA 1RUE2 2OU2A 2PAEA 3CESA 4QQLA 1HDPA 3D6EA 4WVZA 2P3JA 4CH7A 3LMMA 4I01A 5LCWL 1VE0A 2EV5A 5J96B 1Z77A 2Z99A 1YW8A 4FOQA 4FFIA 1TME1 1DQ0A 1K78B 2E7AA 3W5NA 2ILMA 3RKQA 3EUHA 3ONQA 2JIJA 3BODA 4S2FA 1YG2A 5C3RA 1OD5A 1CAWB 2QA4I 3KIOA 2KIFA 3T8TA 2KPMA 1UY0A 4XIKA 2PJPA 3LDRA 4OCTA 3KV5A 3AMPA 2ZX3A 2J7MA 2HKXA 4EWAA 3DXJF 1W36D 1I5PA 1NA1A 4B4QA 2R042 3A03A 2F6BA 2OA2A 1V6NA 2OBPA 3K70D 2WYSA 1PK6C 1X7NA 4RGGA 1TEIA 3EQEA 3OR1C 2HPMA 2DMUA 2JDKA 5F0HA 2XDVA 1BHGA 3CCVI 1RJ7A 3JAMZ 2PLV3 2DI3A 1LFBA 2ECBA 2PAMA 4E8CA 1RR7A 3CL1A 3CQZJ 5EZHA 4G3YC 1DDNA 1HB4A 1NCQA 1AR82 2ZZQA 1OCPA 1U9OA 1E2XA 4Y3OA 4R1HA 5GZGA 1CIWA 3VBHB 1N3QA 1WMFA 2ZMKA 4ZS3A 2XB6C 1EUTA 4PF5A 5F5AA 3IAQA 5ILVA 1JKRC 2YS9A 4QX1A 4LGWA 5A80A 2Z2SB 1HB2A 2LSOA 3AMMA 4S0HB 1WMEA 2TRTA 5FYIA 3J7AY 2F5CA 5A3UA 4YW6A 3MZ8A 3MKYB 3I7DA 4NRQA 1X4OA 5BNOA 3HPHA 1VZ0A 2IXLA 2LF8A 4C2UA 1S0FA 2K9QA 2FX0A 4IE5A 1HQCA 2BVBA 2Z69A 3ZR5A 2L9LA 3RWKX 4NIGA 2H0BA 1C8M3 1R092 1MZBA 5I0TA 4MO3M 1IS5A 4L0YB 2Y2ZA 1HXS2 1UIJA 2VD7A 2E1NA 4RAZA 4Q4Y3 2PLV2 2K2SA 1Z3YA 3I8TA 1YJWI 3PUBA 2VUCA 1CD3G 3N9LA 3POYA 3D1NI 1HCRA 1U0JA 2ZHNA 4Y24A 1ODMA 1OH3A 2BGOA 3VBHC 4I0WB 1NXD1 4KIBA 1D8KA 4LB6B 1V6IA 1EJ9A 2QZ2A 1PX4A 4WM8B 1KONA 3IM0A 5CQEA 2E34A 1NLSA 1YCIA 2QKDA 3VBSA 3T2QA 4I6ZA 1JHJA 3OYDA 2DTWA 4OI4A 1UYZA 1X33A 2W85A 1RXGA 4JDNA 5LA0A 4HOOA 3FM5A 2GU9A 1UD1A 2JB8A 3ZCOA 2NRAC 4CCJA 2WZR3 5KHDA 2OX0A 1WWXA 4EJTA 3SXYA 3AMNA 2NP0A 2F5EA 1KD7A 1BK0A 3NNLA 2GP5A 1AHDP 5EDNA 1VRH2 1BL0A 2R7SA 3GBGA 3AYCA 2VZ1A 2QDRA 1KQRA 3U14A 1C8M2 1D0XA 2Y0OA 4UY8I 3RI8A 4AD9A 1ACIA 5BUVA 4Y4YA 2P5VA 4GXLA 1R081 4Q4Y2 1XYOA 3M8LA 1LRHA 5A1FA 4LR4A 1OURA 4CU7A 1S3JA 2WWJA 3H9GA 4EN9B 3VGIA 1EY2A 3S5QA 2BHYA 3HOBA 1UPSA 2VZ3A 2W0XA 2ID4A 1VQLI 3ABZA 2Y48A 2O9LA 4DXTA 4BXFA 1GQGA 1TE1B 5BYNA 2EXIA 2DFIA 4A41A 3G71I 1QQP1 4WM8C 2VGDA 4AUXA 4CEWB 3ZN5A 1GNYA 1FT9A 1B8IB 2VZOA 3WNNA 4X6AJ 2KDZA 3A7QA 3NV3A 3KV9A 4RA2A 2CQQA 1GZ9A 3ZQCA 2E5ZA 1MZFA 1W8TA 2NM1A 1Z1DA 3ABTA 4NAMA 1FPN3 2DN0A 1JJ8C 5A3TA 4UFKA 3HBKA 4YFZA 3KLOA 2XUBA 2BBYA 5EYYA 1OC1A 2ADEA 4BEHA 3CJIA 2D6LX 5F0FA 4CXWA 3TMOA 1XB9A 3DYMA 2GXAA 3ZXAC 1HW1A 1FMWA 2WFF3 4LQRA 2WN3A 4IF4A 2VASA 1FYLA 1FJLA 2VL4A 2IA1A 4NN0A 3VKLA 4LEJA 1VIWB 1AL0G 1NTCA 3EUKL 1LOGA 4DRVA 1O57A 2ZAAA 4EATA 5A7QA 2RGVA 2EA2A 3VSLA 1G2HA 5CA6A 3HOYJ 2IA0A 2XJUA 2Q4SA 3OPTA 1Z6TA 2W48A 4XRSA 2ZXWH 2XHNA 1SC7A 2RDRA 2LALA 5EEHA 2VBXA 4OI0A 2IW5A 1FATA 1KFXL 3P5BA 1NG7A 2K9ZA 1SFOJ 4CEWC 2KFDA 1SLBA 3J8F3 5D2AA 2VZQA 1EPWA 2ZC2A 3G3ZA 3GTJJ 4GJYA 3O1UA 1XOYA 2RMU2 1E0EA 3KV6A 5EJZB 4MXWB 2VUJA 2LS6A 2VZTA 3DXTA 2RKHA 1JS9A 2GNDA 3Q8FA 2ZJRF 4EWDA 2YX4A 1RUE1 1UHWA 2RC4A 1A36A 1GVDA 4KN4X 4ETSA 2QVSB 2YBSA 4DFSA 4RGUA 1VBB1 1ZRCA 1J1LA 1VMHA 2WFF2 3TNQA 1TW3A 3F8MA 3I9V2 1Y9MA 3DQVC 5F04A 1YTYA 5DYMA 4M73A 1H89C 2WSVA 4JTOA 2R4GA 5E18F 5EWSA 1TQ5A 5JI7A 1D7PM 1RITA 3OCPA 4RGKA 1HN0A 1TWGJ 4ZDOA 4UUSA 5EZGA 5F0CA 3BU0A 1QJX1 2EICA 2HWE1 3CMAI 1GNZA 4K8RB 3AG2H 2P8TA 1ZBE3 1K78A 2A73B 2A68F 1ND3B 2IFWA 3WU2C 4OZXA 4WXCA 2HJIA 2WS92 1BVP1 4NNJA 1S0CA 3USSA 1POV0 2JTVA 2ZBKA 4XDQA 3RZJA 5F3IA 1CAWA 3N9OA 3ZPLA 2R7EB 3CP8A 1UHSA 5F8PA 3S15J 5IT9K 5F5IA 4HF0A 3VKMA 3QLQA 1OF4A 4G12A 3MKZA 1YQ5A 2BWAA 4B29A 2XJSA 5A1LA 2QQ9A 1RUNA 1QVUA 1Z0HA 3AFKA 3DU5A 3AJYA 3LA3A 4OWRB 4ZDLA 5D1IA 3NVCA 1OPOA 4WBBA 2FQ4A 1LHOA 4RBOA 1GNHA 2GDFA 4NRMA 1ZELA 1VLNA 3BALA 2Z5WA 1XRUA 3FL7A 3WDTA 2P37A 2BOIA 1AR81 3W2WA 1QHDA 1TNFA 2GWRA 4QB2A 2JDPA 1O91A 2XWJB 3S2HJ 4KIGA 3K48A 3J7AO 5BNGA 3FBYA 1D3YA 1RMU3 1UG0A 3SISA 1WJCA 4B3AA 4PDWB 2IS6A 5FZ1A 4AVAA 2XAFA 5LY1A 1ORKA 5D21A 5GZDA 1IRFA 2R7XA 4IESA 4KQ7A 3ZKUA 3T8RA 1HLCA 1RHI3 3H5AA 4I30A 5DG1A 4P9LA 3VBHA 4FETA 1UXZA 3OS2A 1OUSA 3RJRA 1EAH1 2OT7A 4QXCA 1ZBE2 3C3VA 2X5IA 1ND3C 3AZXA 4LKSA 4M00A 1AKHB 3ZN4A 3MLJA 3VDDB 3HT1A 1QNYA 3C18A 4CZCA 3L2RA 3GXOA 1W8HA 4MV2A 5C5UA 2Z1DA 2YYOA 2E2JJ 1R091 4RM2A 4R9AA 3GZUC 3KYDB 1MNEA 3IAM2 1HXS1 2JJ6A 3V8LA 1WWYA 3OYWB 3BTJA 3BZ6A 3S3OA 4JHTA 1SZBA 1N77A 3DU6A 3I4MJ 3KV4A 1UJ8A 1JW6A 2KJBA 1RI7A 1D0HA 3KP7A 4DOUA 3ROUA 1YJNI 3TGNA 2DTRA 3IDAA 2FF4A 1W2UA 1RMU2 4IEYA 4PDWC 2XLGA 2PEXA 4CCMA 1L0OC 2CSOA 1YS6A 1PNGA 1RHI2 1FP1D 2WZEA 1PMIA 3PJRA 1LFUP 4IRGA 1ZBA3 1O7LA 2ZTNA 4LFUA 3LSMA 1MQTB 4WM8A 4U87A 1HV1A 2E1OA 5JOXA 2KD7A 3M8EA 5ABJA 4K20A 1K4SA 3NW4A 1S0BA 3VDDC 4CEYB 2HWF2 1FTTA 4UFIA 4LUKA 3KQ4B 1VRH1 3ETQA 4A3LJ 2JDNA 1F31A 1WH7A 5FXVA 4GWIA 5JIUA 5FP3A 3CJXA 4BS9A 4KL1A 1ULEA 1SFKA 5DDJ3 2HFHA 1H6XA 4H55A 4HAMA 4DQAA 1FYMA 2RJLA 1G8XA 3CC4I 2Q8EA 2KXLA 4IHWA 1AXYA 2HGCA 1WA4A 2VOVA 2RNGA 5L3FA 1BR4A 5EGOB 2DFHA 3K4BA 3FKJA 1K45A 5JI9A 4HQEA 1RYYA 2BOLA 5HLTA 3WDXA 5FB2A 4B1RA 4XIOA 5HCBA 3LPGA 1ZQ3P 1LVAA 4DUVA 2B46X 4E7LA 2QSHX 2GNBA 1GR3A 3DFGA 3J81K 2VNGA 4I76A 4XCBA 3SEEA 1YITI 2ME6A 1CPMA 1OLTA 1T2KA 3FK6A 1ZBA2 3PTRB 4IV1B 1MQTC 2ARBA 1D1CA 4CEWA 1WI3A 3ABMH 1B8IA 4IGPA 4ZHNA 5F3GA 2WFPA 2QLZA 1EPZA 1OCTC 2JRTA 3RGBA 4M01A 5E89A 5D4RA 1UZYA 1ZHFA 4D6QA 3U07A 2HEOA 1JZ2A 3JXSA 4WWCA 2A3XA 2QWWA 4DBQA 1GHCA 2R072 3ZXKA 1LNWA 1G9BA 4UB6C 4XJWA 4HN1A 2C6YA 2IXIA 5IVEA 1TL8A 3GTMJ 3J80K 4E7JA 3ERED 2NMOA 2E63A 5KXEA 2PYTA 3PQKA 4P9GA 2QYOA 1AX0A 4ET7A 4A69C 4Y1XA 1QPMA 1U5TB 4Q1RA 4UFJA 2AYHA 2OUMA 2UWAA 5I0SA 1BKZA 3DEEA 5ED4A 4GD4A 1BEV3 2HDDA 3N9QA 4I7HA 2RMU1 4P5OA 4K3UA 4IV1C 1MS5A 1U6GA 3LQCA 4OMDA 3BOWA 3PIOF 4IHSA 3LSGA 3VD5A 2X6YA 3AYDA 4XICA 3LEKA 3HRTA 4LKDA 2K46A 3CCMI 3I64A 4PQ9A 4GMP3 1WHUA 3QQAA 1WCKA 4W6XA 4MXWA 4GB33 1WJFA 5B3SH 4XRSG 1QXRA 1J1TA 2AENA 3WHUA 2XMLA 4IEVA 1H9WA 5FO7B 1HXDA 4FO9A 2M8GX 5L19A 1GXPA 1Y0NA 3PUSA 1RKWA 2R7FA 2MLKA 1ZAOA 3H42B 2EFWA 4I3PA 4O5VA 3W9AA 3RDIA 5A7WB 3MW2A 5E3MA 4EN8B 4XUTA 2OV7A 5DEQA 3M70A 1REEA 4RFT0 5FUIA 1W8NA 4JYKA 2DU0A 4Y5TA 2ZGRA 4BHPA 4GXOA 2WS91 3UETA 1U5TC 4CZSA 3GF2A 2CW7A 2D3PA 4KGQA 2JX9A 1OKQA 1EA3A 1JKQC 5BPXA 3SZTA 2W84A 1XGMA 2QZ3A 3ZXJA 4EM0B 2HEYF 3KHBA 4Y17A 4OLLA 5JIAA 1C0WA 3OGGA 1MSFC 4EZHA 1MGTA 3ZR6A 2DBNA 3U4XA 4AYUA 3GYDA 3LSIA 4PCQA 4M3GA 3NJVA 3IP4B 4MQ9F 1FLIA 1CAVB 4WF2A 1ERDA 4GB32 1JODA 1VBC1 2ZFUA 1KFUL 2WT1A 2ZGUA 3P9KA 1YC61 3AX4A 4BDZA 1IDZA 2BWCA 1STZA 1CAXB 1W6MB 2J22A 4AQ2A 5EJ3A 1VB4A 4ZC3A 5HV4A 2PMUA 4J00A 3ESWB 2EFOA 3QAHA 5ICFA 5C8CC 1XTAA 5AC93 3TEZA 2CDPA 2D6PA 4WM7B 2WO7A 4PDWA 4W50A 3D5SC 1A78A 1ULPA 2UXNA 3J7YJ 2QZ8A 2YXSA 4BYYA 5K5RA 1BBT3 2W1WA 2WYFA 1FYKA 5GLTA 4HNVA 4W6WA 1QJZA 2JWPA 1ON2A 4JGZB 1K83J 1R58A 2PJRB 4K1YA 5FBZA 2EA4A 1RKTA 4IKFA 3VZLA 2PQQA 1BOAA 1E17A 1ZK8A 4MGZE 3HTUA 1K5MC 1R5GA 1UB9A 1AKHA 4LK7A 2QCSB 3KYLA 3QCWA 4MSVA 5BNPA 3E97A 5E88A 4XF4A 1W06A 5CNAA 1A6CA 2GNTA 1SFPA 3P5JA 4LO5B 2ZHKA 3EYPA 3B69A 4AE2A 3WEZA 3KX2A 4OAZA 5BPDA 2WO1A 3OYWA 4FPCA 5ERLA 2H27A 1XGNA 3WVJA 1TQMA 5EIYB 5FY7A 2NS8A 1W9TA 3WP3A 3IMNA 3JCIA 4ORFA 1XN7A 3HQUA 3UESA 2VKVA 1LGBA 2V6CA 1UQXA 4YWAA 5AC92 1AYM3 1VNDA 5FYTA 5A3MA 5B5EC 3NARA 4WM7C 3LEMA 4X8PA 4AYBA 1WCSA 4L97A 2BERA 4ZH4F 1U5IA 1MJ9A 2W9XA 4XFBA 4HDUA 1BBT2 1I50J 5H6QA 1J2XA 3HPNA 4IQPA 4JGZC 1YI9A 2YZ4A 1JZ8A 2CAUA 2HWF1 2YBKA 4YVSA 2AC1A 4RS8A 3VD4A 3F3XA 2EBIA 5E16A 3G6EI 4YFNF 1MQTA 2D3SA 1W6PB 1SLAA 2XVLA 5FR3A 5I91A 1J59A 2VJ5A 4YZ4A 4BQQA 4G6DA 2RQQA 1QH6A 2FEZA 4BU2A 4CEYA 2UWMA 2WAQN 4RB0A 4BQAA 5D5WB 1R49A 1IRZA 2E6VA 1VQ4I 4HPKB 2QENA 1QQIA 2VCAA 4DUWA 2I2SA 4CO8A 5HNHA 4LNVA 4Z2YA 4J25A 2O0OA 1BC7C 2DCYA 3RPQA 2P6CA 5C7GA 4M4PA 4UVAA 3N36A 3BR0A 2WSUA 3S8PA 2X6OA 5EGOA 3ZSKA 4NIDA 4DB5A 3EJKA 1WW6A 4I2OA 4R9CA 2DF7A 1QEXA 1IPKA 2W39A 3H1YA 2RG4A 2VVEA 2BV6A 2PHUA 5FRAA 4LO8A 1APNA 1XC6A 4EZ4A 3RSJA 1IXSB 3URFA 3IWFA 2P5LC 1CPNA 2JEMA 1PM7A 2BY3A 4V2FA 4N43B 4C9YA 2X6WA 1VQ7I 5L36A 2VXJA 1W0TA 4XN3A 2KJCA 3NO8A 2W57A 4C0HA 3VZOA 3WNXA 4DRRA 2SLIA 1MMGA 1F35A 4IV1A 1COV1 1WQ2A 1PO21 4CPBD 3GDBA 4DS0A 3DLLF 4ZTFA 3VD3A 3WNMA 2XROA 2ZX1A 3N7KA 3JBG2 3G4SI 2R071 1S0GA 1YS7A 2ZGQA 1Z3XA 2STTA 4FOYA 5HI0A 4XACA 1G3WA 3ISPA 1MS0A 4LHNA 2PX9A 5M5XJ 4JOMA 5ACA3 3AP7A 1NQJA 3ZDSA 3MPPG 3KM5A 4COZA 4L18B 3H92A 4MYEA 3S1RJ 5J40A 4YG3A 3QU3A 3KF3A 3A2KA 1YQAA 1BBYA 5FZ7A 3W6VA 4BL0B 1KGSA 4XBQA 1U5TA 2O3FA 5E1ZB 1CESA 5E79C 1S5LC 2OZJA 2HYJA 2X8KA 3JAMK 4N43C 3AP5A 5DAVA 2W91A 1PIV3 4Y1VA 3SITA 4YFKF 4CPBA 1B6AA 4LLGF 3IV5A 3WP5A 2ISZA 2P2KA 3WTZA 3T1LA 3BG7A 4P02B 4DZPA 3S93A 2FDJA 4NVPA 3GZEA 2IGKA 2QGUA 2ET1A 3WCSA 1JYWA 2PHLA 3N9NA 3KT1A 1OCZH 2Z79A 5IW0A 3WTUC 4PBOA 4NIIA 3GTLJ 4Q5SF 5C3PA 4B09A 2ZX4A 1G9FA 3BQYA 1A34A 4XLPF 1QJFA 2YY1A 5FMOL 2DLLA 1QO0D 4FPHA 4G7OF 1MNMC 5FZOB 5J36A 2VUDA 4Y1ZA 1POGA 4FTEA 2FSWA 4Y1UA 1C1LA 5A7WA 5I93A 2W00A 2ZO4A 5JVVA 3GF6A 2CTVA 2F4IA 2OZUA 2LUWA 4YELA 3GFLA 5J98B 3A23A 3FXQA 5JUVA 3Q9SA 2IS4A 4K6BA 1JHHA 5HDNA 1LHUA 3UK9A 2VB6A 4NHMA 3S17J 2LP0A 5J6XA 2K7LA 5EZWA 2DO7A 2VMEA 3MYXA 3SCHA 2MABA 4XLFA 4HPQA 2VN2A 5IYYA 1PIV2 3CJQB 2ATFA 5JWPA 1U8BA 2D44A 2L9NA 1XNCA 4BY7J 4LG3A 4GMP1 1MS3A 5CLSA 5FYZA 5A32B 1X1AA 1K61A 1NG0A 1HRV3 2DTZA 3E3VA 1ACCA 4AXOA 1R4NB 1HSJA 3KEOA 5FQ0B 2FCUA 3BJ6A 4AGRA 1EV7A 2G9ZA 1MS8A 1HDKA 1CAVA 4JK1X 1W6OB 4H14A 3BTIA 4J1XA 1OXCA 1VQMI 2RJ2A 3LWFA 4WV8A 5FWJA 3CCUI 4DO0A 1G9DA 2ZFWA 1CAXA 1W6MA 2M34A 1EF4A 1SFYA 3TEWA 4OVEA 1DU3D 1UCXA 4GZ9A 3ZYGA 1KS5A 2L3DA 2OF7A 3TW7A 4BMEA 4H4KC 3UKGA 1UYPA 4II3A 3EUAA 4IEJA 4M71A 4WM7A 5JR2A 4ASKA 3V0BA 2R0FA 5J48A 4ITVA 2VBPA 1SHWB 5FZDA 4GKXA 2OQRA 2IS2A 4JGZA 3KE2A 1V54H 2PJRA 2QTWB 5E17F 3BOQA 3VHPA 4IQJA 1WVRA 2NS0A 1XSVA 1G3YA 1UX7A 2BUKA 1OD3A 3K4NA 5DV5A 3HM5A 1HRV2 3KGLA 4L0ZB 1RUG3 5A2QZ 2ECCA 3QPSA 3ES4A 3WSOA 3TOBA 1HRI3 3AMHA 1NYWA 5DAXA 5TJJA 4WVMB 5FZ6A 3OJBA 2XASA 1QJEA 1FMD3 1JOJA 2VJIA 1R64A 2ZXJA 1T8IA 1UMHA 5TGTA 2FA5A 1AU7A 2EF6A 1UZCA 3KP6A 4F3QA 1W28A 3GZNB 5FXXA 4XVHA 1Q8SA 5LD2C 3WNOA 4EJOA 4BACA 4CYDA 4FX4A 1B1BA 3W2AA 4KISA 3RZMA 1IQDC 2HYKA 2ZGOA 2QQKA 2CRGA 1DCSA 1T38A 1YEWA 4JVAA 4ON0A 3MQ0A 1AXKA 3BJAA 5FUNA 4AI0A 4KMFA 4YW1A 3RFRA 2I45A 4FOVA 4XKVA 5FUPA 2H6CA 4QKFA 3WUDA 3GZTB 4N7UA 4RR3B 1G4DA 1V70A 3RQ0A 2JD9A 3POWA 4CHUA 3GO5A 3TN93 3C2UA 2XKOA 1IPSA 2DVBA 1X3WB 4JTNA 3BZCA 1W6PA 1H2MA 5JHFA 4AVVA 4QX8A 3HRUA 1W9SA 2QQMA 5FLIA 4JDOA 1B35A 3H35A 1Y39A 1FOD1 5F64A 1RUG2 3N05A 1HKDA 2XJVA 3JUUA 3IPVB 4HPKA 1Y43B 1BJQA 2CSGA 2CY6A 3V4GA 2LF7A 3CLOA 2R7VA 4P9UA 1OCOH 4XR6A 3ABLH 4XHBA 2MA3A 3G1OA 4BISA 1DBNA 1GLHA 3ITQA 1Z05A 3ELKA 2K4JA 2ZZJA 1MBEA 2OZ6A 4CICA 3LFKA 4A3DJ 2B7YA 1XU1A 1O5UA 1ENRA 1TWFJ 3NMBA 2Z16A 4Q29A 3V56A 5LK5A 4HEA2 3ZP5A 2D1VA 4A3CJ 2VH9A 3ON7A 2M1BA 2W1OA 4ABZA 5C33A 4QDQA 1JGGA 4SLIA 3FX3A 5I8SA 1REDA 3A01B 3DN7A 2ZEYA 4EQQA 1A3KA 4N43A 2K9SA 1IN4A 1TMF3 5CFCB 2E5NA 3JBG1 1BQPA 2A75A 1QXPA 1UOGA 3TN92 1OFNA 1T0FC 4N9IA 1MKMA 3PO2J 3JTHA 3E6MA 4LHLA 2ADUA 1FOKA 4IUGA 1ZRRA 2UYAA 2XGDA 3RZDJ 5HOOA 4CA9A 2WAQA 4Y5Z0 4YRDA 2M0MA 2KM2A 4JGYB 2NOJB 1OA3A 4G4FA 3ZLIA 2DT6A 3HNBM 1TNTA 2W24A 2KP6A 2GBYA 1DGRM 1LR5A 3C2HA 1BR2A 3JR9A 3LFIA 2MC4A 1U2WA 1WLDA 2G1MA 4OULA 3ECHA 4QX2A 4BQXA 3Q0UA 4CP2A 2LFBA 3PURA 1W4MA 1VQKI 2X4HA 4CUCA 1NY72 3HPGA 3R05A 1H1AA 3UR3C 1IN7A 3IRRA 4QU2A 3MV01 4V2VA 2BV4A 1R00A 5J1YA 2HWB3 4DPNA 1T39A 3TNPB 4IL7A 1TMF2 3F6VA 5CFCC 2G4IA 3FJSA 2HWD3 2PHFA 2BZTA 4XL9A 5LA1A 1OA4A 1WLTA 4OQ8A 1N1TA 4QPGB 1ZM1A 3ZPYA 4TTGA 1J3RA 5FKLA 3C7FA 4QTRA 1MSEC 5FYCA 4AHWA 2EIJH 2CGOA 3FHIB 5L7OB 4BQOA 1RPWA 2PHTA 4RGAA 3ZXSA 3KGZA 2NPIA 5CFDB 1CJPA 1P92A 2HTSA 5JSPA 1HW5A 2H6BA 1S2EA 4JGYC 4R4XA 3PL0A 3I2FA 4ONUA 4DEQA 2ZOEB 2VZPA 2YPDA 3NAPB 2WBKA 1B4AA 5FYSA 1USSA 5FZOA 2P5KA 3ZN1A 1BIAA 1IN5A 4BY1J 1X3ZB 2D6MA 2WNEA 2H94A 4YGCA 1XG1A 1BOBA 3D82A 4A6DA 3DUIA 5KXBA 3LFUA 4QDRA 4ATFA 1EH6A 3MFKA 1H4HA 2LTNA 5L3DA 3ST7A 1IV6A 5E3LA 2EH3A 2EQRA 4FPEA 1GBGA 4TLGA 1W05A 3I4NJ 4P9IA 2MD0A 2C6SA 2JN6A 2HWB2 3R6SA 4DJAA 1FBSA 3WG7H 4TV7A 4YGDA 2B9UA 2HWD2 3H36A 2DVAA 3N7JA 1ZR2A 5A32A 3ULQB 2WAFA 2H8RA 4QPGC 3ZYBA 5IUQA 2A3SA 3F9KA 1RVF3 2E2IJ 2OW4A 5DUUA 4BM8A 5FQ0A 1PGL2 2EIGA 1S0JA 1W2OA 4QM8A 5KHKA 5L7OC 5CZKA 4AGVA 2DA4A 1NZIA 2WABA 1H1MA 2Y33A 1W6OA 3OOXA 5H9SA 2D1HA 3MIBA 5CFDC 3PNTA 1WCUA 4OIRF 3TAYA 5C8WA 5M0TA 4NC8A 2BQPA 1L7LA 3E1F1 3HT2A 3KLSA 3NAPC 2GMMA 5IFTA 3GW2A 3OY9A 3OYHA 4DIQA 3BB6A 3L7WA 4XLEA 2G9GA 2ADDA 2QUFA 4L0PA 4Q0VA 5M3MJ 4EJUA 4E4SA 1C5IA 1VBE1 4N53C 4IEWA 1UWWA 1YQ2A 3WW4A 5GM0A 3S3MA 3BGAA 4QB6A 3POJA 2FOWA 2WUHA 3DV8A 2QQAA 3VD7A 3G7DA 2DJNA 1JUIA 2JE9A 5IWFA 4ZYHA 2JG9A 1E5HA 3IKWA 4V1PA 4D7MA 1NQDA 4LHSA 4Q0SA 3HOZJ 1FC3A 1AWCA 1F5TA 2W92A 3FK7A 4MGRA 2G0EA 2DJIA 3D5LA 2X48A 2LREA 1RUJ1 4WVMA 1PGSA 2RAEA 1SLLA 1SFUA 2PHXA 4AHZA 3B6CA 3IWZA 1V3FA 2JZYA 4A6OA 2WADA 2V9KA 1U5ZA 5IVBA 5FZKA 3IRQA 1D0GA 4IGOA 4D1QA 4PJMA 4CP9A 4KDPA 2FD8A 5GLZA 1X9PA 5D8AB 2M7BA 4BXSV 3WUCA 1PHMA 4OINF 3WNPA 3QBQA 4CSWA 3THPA 3VDXA 4A3IJ 3B73A 5IOZA 5LGUA 2BEOA 2DVFA 5F5CA 5JXHA 2DURA 4RR3A 2C24A 4FP2A 3OYEA 2XBO1 1E57A 4UUTA 1RUG1 2W87A 1FSHA 2GALA 3ZFFA 4I0BA 4BIFA 1UAIA 4TWTA 2FOKA 3GM8A 2AXLA 4ENNA 1GP5A 3CMMA 1CIYA 4RGRA 1AJKA 3CNAA 3DYOA 4L11A 3IPVA 4I09A 3L2YA 4PSWA 3K3NA 2VCBA 3CDZB 2A6YA 4OUMA 3S2WA 3I0TA 5FYBA 1I3AA 2O0YA 4UFMA 4E7IA 4IL6C 3CF2A 3K1PA 2VMCA 4KWLA 3AP4A 5CYVA 5A1AA 1W3VA 4YZ3A 1DGWX 3DKQA 1OPMA 5FMOS 3LSKA 2L4MA 1TP4A 3L9JT 5FYUA 4FQ4A 4X6RB 1QNWA 4URTA 1WJ5A 4ESBA 1UU6A 5D8AC 4CGZA 2WKKA 3OS0A 4HK9A 3V7CA 3IIIA 3PVNA 3MI8A 5L73A 3J7HA 3M8JA 3LWCA 2HWC3 1UELB 4ARYA 2X29A 5FZEA 3A01A 3NL1A 4X8NA 1F4KA 1XPXA 2WR9A 1WPKA 2M45A 2I07B 2RQPA 5CFCA 3JRGA 3PSFA 2ZGMA 2JRMA 5A6XA 1O6UA 3KFWX 1ENQA 5DDGA 2EZLA 1LHNA 3ACIA 2VNOA 3B93A 2BNMA 4LULA 4GIQA 3CMEI 2XVKA 3MCZA 4MHRA 4FPGA 3JSPA 2OUJA 4XQWA 2MPFA 1IG0A 1GYKA 5FMDA 4LLNA 3RKWA 1PGW2 3S1QJ 3HB9A 4GH4B 1ZGAA 5DAQA 2VKEA 1SLTA 4CXFA 3T5XA 3IKTA 1YJ9I 4UVBA 2M0CA 1PP8F 4YM2A 3ZQQA 4IV3B 1XB4A 1RR8C 2W2IA 3AKTA 3RVHA 5JXIA 1T08B 1W8FA 4DGWB 3CF5F 1RUF3 5FP8A 2QBXA 1BZWA 2P0WA 2JA8J 4JQRA 1UL9A 3NEUA 3G2BA 2GSYA 2QDNA 4IRIA 2RS31 4BQYA 5T50A 5IT3A 1ZRDA 4TSVA 3RMYA 1RRJA 2HWC2 4YZ2A 5IP6A 2NNNA 5EQUA 2WNUB 2LY9A 2E35A 3POSA 1PM4A 2HYGD 4DYQA 2QFEA 2EIBA 2IGOA 5IVCA 4S05A 3BCBA 4RSUA 4OZOA 4DY3A 2FDHA 4Y5SA 4X0GA 2Y0MA 5C4JJ 5CVRA 4FPJA 5D5VB 4YZ1A 2R49A 4LMYA 1UOJA 5L7OA 2CYYA 2XSJC 3BOPA 1OR7A 4RMNA 5CFDA 1PO12 4GH4C 4Q8KA 4ASNA 1DZQA 2IXCA 5FZCA 3NAPA 3AKZA 4B8EA 2ZGKA 4LE3A 4JQTA 3NWKA 4IV3C 5GLUA 3CF6E 3ZN6B 3SCGA 3C7JA 3MLKA 2HWB1 4N8MA 1RUF2 2DAOA 4BH9A 2GMEA 3LEIA 3VWBA 4O61A 2ELJA 3PUFA 1Z9CA 1IOAA 3U1DA 1V6OA 3T0BA 3U11A 4NJ4A 3BR2A 4XLHA 4XN0A 3BG6A 4L9BA 4QDSA 1XJAA 2UWCA 1GFF2 4UV9A 4WCGA 4DINB 1YUDA 1PJRA 2HOAA 3PM1A 3D4KA 2VQAA 3Q8BA 4F92B 1YX5A 3K6GA 1JE8A 3QYFA 4YRVA 4B44A 5KBFA 3FIWA 3TWIA 5FJHA 2I5UA 4A4AA 3ZFGB 1SMYF 4KA4A 2Q0OA 2VMGA 3SC7X 1QF3A 3V64A 4KMQA 2QUOA 4CDXA 4Q4W3 2D6KA 1CF7B 4F7ZA 3CCLI 2E33A 2GMPA 2R1DA 1S9HA 1I1SA 1J3PA 5EHDA 1Z7UA 1R1ZA 4N90A 5FKCA 3TB0A 1IAWA 2CDOA 2HU9A 1LDDA 5EP9A 1V9U2 5F6LB 2YMZA 4LPLA 4RGSA 3GGLA 4FASD 3CU7A 3NWTA 2DPUA 4Y22A 1ODDA 1FX5A 5E1XA 1F4HA 1S2KA 2EB7A 1C1FA 2DFBA 2M2EA 1D4VB 3UYJA 1S1AA 1KGYA 2R061 1JYCA 5HCAA 5EG0B 5EJCA 5KHJA 3DPRB 3CCSI 5BNNB 1DQ2A 2ZNYA 2JKXA 1VQOI 4GGGA 4WZFA 2XB0X 2JENA 1IS4A 4OHXA 4BQNA 2BVMA 5G05L 4D6RA 1WI9A 1SBDA 1N1SA 5FYVA 1CWPA 3RMXA 4FTHA 1MEC3 4XMAA 1WGPA 2IVIB 2R16A 1ZG1A 2VQLA 1KJRA 2QQVA 4W97A 3LEGA 4NMIA 4ZTJA 5FOJB 2L01A 2ZKNA 4Q4W2 3WDWA 4OHYA 1WW5A 3FBNB 5HV0A 4FXKB 4AWDA 2E51A 2CG4A 4FQGA 2J42A 4COWA 3JD73 4DYCA 1LEBA 4XYXA 2PFBA 4ZU7A 4YFWA 1IPJA 2Q1FA 1UX6A 5D8AA 4LB5A 5F08A 2DCZA 4UW6A 4UB8C 4U2AA 3IC7A 1J84A 5ISLA 4LHKA 1L7QA 3CC2I 4LKFA 1RUOA 1EUUA 1SDDB 2CU7A 2M9HA 4DY5A 1Y8QB 4PZJA 2LBFB 3DPRC 5BNNC 3CMGA 1TWCJ 2KMUA 2PN5A 3L2HA 2L7FP 4XRFA 1FYUA 3AG4H 2YX7A 3JRHA 3FE5A 1ENHA 1R71A 4A3ZA 4XFAA 4XE9A 2AHQA 4YG0A 1DHKB 2FDIA 4G9SB 4ANJA 4HBLA 3R0JA 1ENXA 4UHTA 3PMSA 3U4SA 4RAYA 2P1BA 2WT0A 2E26A 4Y4RA 1XNBA 3AYEA 1MVQA 1BC8C 3ZVXA 2D40A 1T2XA 3BLYA 4BLJA 1TME3 1XMAA 3KPHA 3UGGA 3JD72 3PVOA 1TZOA 1WUVA 3VYRB 2MEV1 2YR2A 4YEJA 2PN6A 3I2GA 1KU9A 2XAJA 2EPFA 2P6HA 4D7TA 4BBRJ 3WF0A 4XEZA 2DXIA 3C7GA 2CQXA 1SD7A 1QJU1 4XKCA 2D7FA 2AGSA 2VQ0A 4UXAA 4D94A 2DYSH 3M1CA 4V2GA 1PNFA 4AFCA 2MGQA 4FE4A 5K4LA 4UV8A 1JYIA 4Q4X1 1Y1VJ 5CEHA 2BRTA 4XC9A 1VAMA 2AXTC 3KD4A 2EAKA 4RDUA 2VBYA 1ZLKA 3H0DA 3VSKA 1O4YA 4HF2A 1WD3A 2QQBA 2I10A 1CN1A 1UFMA 3SLIA 1Q43A 2HXOA 4PGHA 4AI9A 4GH4A 2FMDA 1W6QA 2IXHA 3BG9A 3P3PA 1CX1A 3VUOA 1AA7A 3EO6A 2X85A 5AVPA 1Y6IA 3ZIWA 4IV3A 1TME2 2WA0A 1HJFA 1HIXA 1U5YA 1ND2B 4HSJA 4H2AA 4AQTA 3NRVA 3Q0WA 3TBIA 3DGTA 2CS3A 4NHYA 4RB2C 4META 4JX0A 5E1WA 2JJ7A 2DVGA 1GSLA 2KRHA 2R92J 3SHRA 1D8JA 2WNUA 1F2NA 4QHZA 3WG4A 3W6JB 2O8OA 2LD5A 3NKTA 1VQ8I 3FFQA 4YARA 2BDRA 3R4UA 3D8CA 1MS4A 3WTXC 3QP5A 1U78A 4RB3C 1TLHB 3EYYA 5DCFA 1BI2A 2PFWA 4QKDA 1PO11 4KBZA 4HVQA 3P9IA 3UNPA 1VQ5I 4AI8A 2CGNA 1GQPA 3H5RA 5L3GA 4HSLA 2XF7A 3FMSA 2ZGNA 3FHZA 2CYFA 1NKGA 2YV8A 2EAAA 3EPZA 5KVRA 5ERIA 5A2QK 4Z2AA 1S0IA 1RUF1 2FCTA 1UO9A 4X6QB 4YSFA 3BTZA 5C44J 2QQOA 3ECOA 2R30A 5F1JA 1DP3A 3SDBA 4XKWA 2JSPA 1ND2C 4BOWA 2CW8A 1WJBA 3ILFA 2VOOA 1PUFB 4BXUA 2DMNA 2OA4A 2K3PA 1IF1A 2HOSA 4HG6B 4ZJZA 4P5YA 2WL1A 4NQWB 1E5IA 2JPCA 5LGTA 5JOYA 1UY4A 3H8RA 2PAKA 4QQPA 3FXKA 2ZB9A 3IDBB 3WDUA 4MX3A 4NWVA 4B4PA 3S0MA 4G9YA 3KQRA 4KGGA 1GUIA 3CZ6A 1BN5A 1B09A 3CCQI 3IHUA 4A7KA 3MLLA 2M7AA 2XB5A 2HQAA 4Z92B 3F23A 1XNKA 1R083 1HW2A 3ZFGA 3AAFA 3HNYM 1V9U1 5IYBJ 3VHOA 3D0SA 1CF7A 2NZ9A 1H0MA 2X05A 3BZKA 5ICEA 5IYCJ 1VBA2 3ZYHA 1FI2A 3SDGA 4IEQA 3U37A 4A6SA 1QQP3 1W36C 4Z2WA 2XR4A 5FP4A 3WDVA 4C1XA 1O4TA 4TZDA 1FOWA 3AKPA 1SACA 3FZVA 4KUMA 2P5BA 4SBVA 2CW0F 1I6HJ 4FAGA 4Q27A 2JB4A 1ZLJA 5ANQA 4CTEA 3DPRA 1LHWA 3WNKA 5BNNA 4N4NB 3L00A 3K4MA 2ESNA 1S0DA 2MLGA 3Q8EA 2VE8A 5A3LA 4NO4A 5BMZA 1JTXA 3ASNH 1ST8A 4YVWA 2QM3A 1SAUA 3FXLA 4HX4A 4QPIA 2YROA 4Q4W1 3MMYB 4EJVA 3OB8A 4QLCU 1ZN2A 2BW3B 1R082 4QXHA 3TP0A 5BOXA 4ZYDA 3H5NA 1KEXA 4HDVA 4B7KA 2R32A 4R8HA 1BI3A 1FIAA 1EH8A 1SLIA 1K79A 3I2HA 3GTKJ 2UURA 5EPAA 2RR12 3HL2A 2FXAA 3POEA 3RRDA 2FNPA 1QQP2 2F17A 3WW1A 2G9WA 3JQXA 2JSCA 3PIPF 2XKPA 2FDKA 3OBAA 2BP6A 4BPZA 5K0UB 1ETXA 5JSOA 1SCSA 2E53A 1FBQA 2VC1A 2LBFA 3LF7A 4A0XA 2DCKA 1XNTA 2XF5A 1RUE3 2UWBA 4MEYF 1F5JA 2UY9A 5B2GB 2A05A 1HKQA 1VBB3 5KCMA 3ZSMA 5JVTA 3CBNA 4B7EA 5JMOA 2CH0A 1W0UA 4UFHA 3JD71 4BWOA 2M30A 3GLLA 1D4M2 1YRZA 2HZDA 1UXXX 4IHVA 1LVKA 1QJX3 1I3HA 2HWE3 4UW3A 1HX6A 3K4DA 2ZPXA 1YLLA 4QPWA 2JA2A 3GFJA 4QXKA 5T5LA 3T2PA 4XMYA 2ZKZA 3PIGA 4XUNA 2VUMJ 4YYOA 2J1UA 1MD0A 4E7SA 3AZZA 4NBQA 4QHBA 3BKZA 4AIJA 3IDCB 4HNUA 1W39A 4OUEA 1PUEE 2CO5A 4KT5C 4XJAA 5FMCA 5K0UC 3K4AA 1RUD3 3TDUC 4KU7A 1PK6B 4M3DA 1MPXA 5FPLA 2BZDA 5C4WB 4D9JA 3N4MA 5CYYA 3PSIA 2M3AA 1YWKA 2CL2A 1RETA 4FPKA 4NHKA 5LBCA 3OY8B 1P4WA 5L9BA 4UF0B 3S57A 3DYPA 2KL4A 4C8DA 5I8TA 4A12A 4KN7X 4DNCA 3A02A 3TP3A 5APAA 2WT2A 2GOMA 1AR83 1JYVA 1FP2A 5E20A 1JXNA 1T6GC 1VBB2 3NNMA 3VBOB 5LRRA 3DTKA 1AR71 4PFOA 5L9RA 1DZTA 3L2CA 3OPWA 3KCCA 2XLFA 3F22A 4XOGA 3WQ0A 3OIPA 4RS5B 1PVC1 2X0LA 4UXNA 3D3AA 4LLLA 2P6TA 5JOZA 5CVVA 3VL8A 5LBQA 1QJX2 4BDVB 1NZCA 4NC6A 2HWE2 5T52A 1EAH3 4E27A 1ND2A 2A1XA 1VTNC 1V5GA 4F52A 5BS6A 3CO6C 1WGXA 1G59A 4MFEA 3OOPA 3VL9A 2VOWA 3H50A 2ESHA 1JOBA 1QBJA 1J0RA 4NPLA 2R7ZJ 4LUMA 1JXSA 3IB3A 1RIRA 1RUD2 1R093 4CDQA 1S72I 5FPAA 4A7ZA 4N7IA 3AC0A 4QB1A 5C4WC 1W04A 4C3JJ 2XC7A 3RPUD 1HXS3 3PJYA 1YFYA 4CP1A 1TVGA 1C5HA 1FPQA 5E8GA 1MDMB 5FBJA 2YU2A 3BVCA 1M06G 2J1TA 2BY2A 4AC0A 5FZMA 2J1RA 2KKOA 1RESA 2FZ1A 4K7JA 5T55A 2OKXA 2HEWF 4YM0A 3VBOC 2K02A 1BI1A 2HWVA 3K69A 3OBRA 2W3JA 3WZ1A 2KIQA 2W1SA 4HT1T 4RS5C 2GC0A 4EGZA 1DYPA 2KT0A 3FXUA 4XDOA 3ZQHA 4BXXJ 1KQ0A 3K1MA 5LATA 2O61A 3WTTC 1X58A 1ZGJA 4ZDPA 2XSDC 1EAH2 1N78A 5KAIC 1H9PA 1YYVA 3U9GA 2ZNZA 4BMBA 5F9TA 2ES3A 2CUFA 3GX4X 2JVGA 1A6IA 2DTYA 5H6RA 1U12A 4PLMA 1VRH3 2DYRH 4PJNA 4XXPA 4AWXB 2CUEA 2GXBA 4NQWA 2A3WA 1QHHD 3RS6A 4B1MA 2WRAA 3W3CA 1LODA 3BJOA 1MACA 2GQQA 4QX7A 1UCRA 5IP9J 2Q1MA 1DLCA 4XETA 1CX4A 3PTYA 1YFHA 3CLPA 1H2LA 3HMYA 2W82A 3BR5A 3BG3A 3LA2A 3OIOA 2BE5F 2WQZC 3MWMA 1VBA1 2ENRA 3ZYRA 4P00B 2VE9A 4RN5A 4ES8A 3FM3A 4XNFA 2VQTA 4V2WA 2XRLA 1HOMA 4AI3A 1CQ9A 4W8JA 2DDAA 1F8VA 1AUYA 3M7AA 4HL0A 4AQSA 4AIHA 2WY7Q 1JZ5A 3J7ZI 3OD4A 4XUOA 5EJ1B 3VKNA 2W1QA 4Q1PA 2KLOA 3K4JA 4JKMA 2P3KA 2QQIA 2J5PA 2IVMA 3JCUC 5FYYA 4R52A 1MZEA 2XL9A 3MEXA 1PYVA 3B7MA 1ZG5A 2XWBB 1HBXG 3OG2A 5LEKA 2W46A 2CUJA 5GJ6A 4MGYE 1OBNA 3M3QA 1FWZA 3R0AA 5GPAA 2L9RA 2B45X 1WLCA 5HDKA 2XF6A 1E3OC 1BM9A 4DZGA 1DZRA 4RAFA 5CVJA 4TYSA 2HVRA 3ML6A 4PI2A 1RB8G 2DCJA 3F8CA 3ZPOA 4B1LA 3IUOA 2VY0A 3USUB 1TT0A 3ZMDA 4OMYA 1ITYA 2K3FA 5L3EA 2TBVA 4HSTA 2ZJPF 1W0PA 4FI9A 2RR11 1CONA 2W7NA 2UUZA 1SPPB 4HBNA 1O3RA 4YNIA 3MIEA 4LOTA 1HQNA 2NYYA 3U75A 4N4OB 4PDKA 4AEDB 2WNVB 2K0GA 2UXXA 2RVCA 4G7HF 4ZONA 2COBA 1XYNA 3VBRB 1US2A 1UN1A 4W4ZA 4FPFA 2L02A 2RMU3 5H9RA 1NUKA 4EROA 5K0UA 1DPRA 1LPQA 5D5UB 1MMDA 1ZX5A 2M87A 4CP0A 4IW3A 1I39A 1GV5A 3PVBB 2IXKA 1Y7BA 3S7EA 1YW7A 5CG9A 1YIJI 3V8JA 3GHMA 3WG1A 1QGLA 3ZYIB 2PA7A 3ZMZA 2XLAA 4AR2A 3WHBA 4PJYA 5AIPA 3E5XA 3O1SA 1D4M1 5FMBA 1RUC1 2A69F 4XF1A 1J7KA 4BIOA 3WY6A 2XV4S 1S29A 3NV2A 3BTLA 2IJLA 3BIWE 3FLRA 3K51A 1ETQA 1D5VA 3AP6A 2WS93 2O8QA 2CMPA 3WTYC 3GBFA 2GA2A 5FZAA 3ECQA 3P1IA 4AEDC 2WNVC 5F6KA 4OYUA 5FZ9A 3WGIA 1BJAA 3VBUB 1WCDJ 3VBRC 4GYIA 1QZEA 2R1BA 3EETA 2Y0SA 5L3CA 4ISRA 5J37A 4M9XA 2D5HA 1P9QC 1SEUA 3WHTA 5IFPA 2YSRA 3MIFA 2A61A 2AREA 4XTPA 3EDPA 5FREA 3ZSJA 1PK6A 4W6YA 3VLBB 5JCTA 5BPIA 4JAAA 4BJ5C 1VBC3 4NE9A 4UF0A 3QP6A 1W9YA 4GJZA 5E8IA 3HG9A 1IQAA 1PMJX 1QHGA 2ELKA 4QQHA 5L9VA 5FV3A 5DCMB 1R9TJ 4JC1A 3DTEA 4KICA 3VBOA 1FV2A 3CDHA 1GU3A 3L2UA 2NVTJ 1Z7S2 2OVUA 1P8JA 4IHYA 4RS5A 5J7MA 1E5RA 2R5ZB 3SYTA 4YZ5A 5FK7A 1W1WE 3G73A 3ZMUA 5F1RA 4MH0E 4MOAA 2DA1A 3O5SA 3PMEA 5F39A 3F0CA 3TO7A 5I0UA 5E8AA 2YC2A 1HF0A 5HS9A 3DBLB 2XQRA 2AZ5A 5CBLA 5K9YA 4XFCA 3VBUC 5FYHA 4OIOF 2J1VA 3KHCA 2MG4A 1RUD1 3G1MA 3VYTB 4YG6A 3VHRA 3FUQA 2HZTA 4S04A 1RUH2 4IZZA 2V4AA 5FKKA 3KZZA 2VKDA 4EE2A 4PCRA 1R4MB 1YO5C 3S1NJ 1DQ6A 3BPZA 2Y38A 1BR1A 2LK2A 1LU2A 4AYBN 1VBC2 1C57A 4ASLA 2CU5A 1LDKB 2D5FA 1RINA 5A3WA 1MDMA 3I54A 1XD7A 4XMIA 2XVCA 4NB5A 2IWGB 1KU7A 3ZXEA 2QQPA 2L54A 1IS6A 4KFCA 1I5ZA 1PP7U 1M1EB 1ETVA 4HXCA 2GP3A 5IJRA 3JRBA 1ZZ7A 1MR5A 3MFAA 2VOTA 2DFFA 5HODA 2O1QA 3H3UA 2QQUA 1BCXA 1AVBA 2A6VA 3JRAA 4LA3A 2HWF3 1Y9QA 1IV8A 4H0EA 3QRFF 2DU9A 2V72A 4RHV1 4MZUA 1BMV2 1ULYA 3MUY1 3I4PA 4D69A 3ALQA 2BVVA 2QF7A 2KZGA 4BK5A 2QQJA 1LE8B 1T56A 1UZ0A 4ZZDA 5HLHA 1UU5A 1ZNPA 2OCEA 3VD9A 1GZCA 3H9QA 3AKQA 4C30A 3WT3A 3SMHA 2A6TA 3NV4A 5G04L 1HN1A 2YU1A 4B3NA 2L5QA 4D7NA 3G1LA 3GZ5A 4A6EA 2VULA 5LHGA 2UV1A 4E4ZA 3LOBA 3JREA 1Z78A 2HOEA 4MEXF 5FPVA 3JRDA 5KHGA 1R5HA 4AFBA 4LG0B 1UZWA 4XJ8A 4HA8A 3SFIA 4ZY9A 4DOZA 3PUHA 3O1RA 3RKYA 1RIOH 2O03A 5KHHA 3DP7A 3M4OJ 4D0QA 3AZVA 4YIFA 4COUA 2E1MB 2FD5A 1NHAA 2A5YB 2EFNA 5FROA 1PDNC 1JGSA 4IDZA 3THDA 5IK4A 4JX5A 1UY1A 4L9VA 3T1MA 3CTAA 1WCMJ 1POQA 1YI2I 2RDSA 2ZBJA 2MH9A 1COV3 3QOPA 1PO23 2PQSA 5IHRA 4L5IA 2VL8A 3M3OA 2NVYJ 5CB7A 4G6TB 5AVAA 2XH6A 4NAOA 2R073 2BGCA 1LOEA 3HEIA 2VAUA 3EXUA 5HBAA 1ULFA 3HGYA 2FHRA 2HYXA 4GO1A 5BY5A