1ZRFA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 64
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrfA01
3BPZA 3IBMA 5AIPA 1LDDA 4AIKA 1GHCA 3TOBA 2O3FA 3KP5A 5JCTA 5ED4A 4XF0A 1T0FA 3ELKA 3GXOA 1YIOA 3GEZA 2BNOA 4XF4A 4Q0UA 1V3FA 2XGXA 1S29A 2QM3A 2N7GA 3M1EA 1XSXA 5J3UA 1YG2A 4BHPA 2CFXA 4MV2A 2FBHA 4WK8F 2NRAC 1XMAA 2ZBKA 5I93A 4ZZLA 3S7EA 4XFIA 4WXCA 1DUXC 4AVPA 1QZZA 1O7LA 1IN5A 1ZG3A 4BNCA 1LB2A 5HVQC 3FF5A 1IPKA 3F6VA 5DYMA 1V70A 3PNAA 1J75A 4AQ6A 1F5TA 2IRFG 4HF1A 1TQ5A 1T2KA 3K1NA 5LGTA 2P5VA 2QQAA 3SHRA 5KHJA 5I8YA 4MUVA 4ONUA 2MH9A 4YNIA 3GFJA 1LEAA 3FM5A 2PMHA 5FB2A 2EFOA 5DD8A 3T8RA 1IN8A 3EYYA 4JBAA 3DV8A 1ZN2A 4EWDA 5I0UA 5FLXZ 2RNJA 4MTEA 3I7DA 3CDHA 3REOA 4ENNA 5KBFA 2GIVA 3EQEA 2G9WA 3IDCB 3JTHA 2CQKA 2AXLA 1ZG5A 4MH0E 2L4AA 4N9HA 1ZAOA 2HJIA 2ATFA 3RPQA 2GA2A 1FP1D 4WWCA 2MH2A 4L18B 3EO6A 1JHFA 4ENJA 3NKTA 3WE3A 5E17F 2IP2A 1R1UA 1ZYRF 4ZYEA 2QQBA 4XETA 2E1CA 5IT9Z 2DQRA 3LSTA 1WQ2A 3WW1A 2BEOA 2P7VB 3IIAA 4FT8A 3U10A 2PFWA 4GYIA 2IVMA 3ZN0A 2HEOA 4NHJA 2UXNA 1F9NA 3ECHA 3TDUC 2VPVA 2FMYA 3FHZA 1YFHA 2VBZA 1HQCA 1SD6A 5E1ZB 5BQTA 4KU8A 2YX7A 4YFKF 1LR5A 2ZJ2A 4KIBA 5FPZA 1QWRA 2MC3A 5DD4A 3QACA 5FFZA 1NYWA 4KUMA 5DDGA 3GWZA 4U0VA 2DW4A 3GFIA 5CVVA 3HHGA 2Z9OA 2M30A 3GFMA 4OMYA 5HS8A 3GFLA 3KLOA 4RB2C 2VOOA 3VEPA 2H6CA 1HSJA 4PJYA 2CG4A 3K1MA 1S7AA 1U2WA 2JZYA 3P9CA 3Q5FA 2MLGA 4IEXA 4PGHA 3E6MA 3E97A 4Y15A 2STTA 3QU3A 5JI6A 3QAHA 3S0MA 5HLGA 4Q0SA 4L9TA 2OD5A 3ZN1A 4L2NA 4G6DA 4N0BA 2VN2A 5KHHA 3WW4A 5HDNA 3FHIB 4P96A 4HBNA 3F8CA 4I01A 1CF7B 1K78B 1DGRA 2IC1A 1KU2A 4MZUA 3BWGA 1FY7A 2VC0A 3HIFA 3V8KA 4YIFA 5J6XA 2D93A 1XGSA 3E6BA 1YO5C 4HN0A 2DLLA 1FBSA 1TTYA 4QX5A 4PIYA 2OZ6A 3TOAA 1WI9A 1EH6A 1ZGAA 4O9GA 5HDGA 5BY5A 2PYTA 1BIBA 2DT5A 4G9YA 2RGVA 2DK8A 3ABUA 1PMIA 4HDUA 2CW0F 2FMLA 5LGUA 1O3QA 2HKOA 4OMZA 2V9VA 2DBBA 3FE5A 3WGIA 2FOKA 2L02A 1YFXA 1IF1A 3CJNA 1T38A 4DINB 3I53A 4N9IA 3HTSB 2D2WA 4Q0QA 2FNPA 3GX4X 1WA4A 4XLPF 2Z5UA 2IXIA 3IL2A 3RNSA 2PAMA 2GC0A 3LAPA 3KZZA 1ZZ6A 1OYWA 4EM1A 1J58A 2EAAA 2EFPA 3RDIA 3HRSA 3UKNA 3TQNA 4EMSA 3IRQA 1TNSA 3H7YA 3G3ZA 2HFHA 2O0YA 3SZTA 1X8EA 2CAVA 1UHMA 3ZMUA 2C0ZA 4XF3A 2XAGA 3RTRA 1HKQA 2ESHA 1ZH5A 3IC7A 2VONA 5JAXA 4AVBA 2MLKA 4LB5A 2CSOA 1P4XA 4MNUA 2WTEA 5LHGA 4YYOA 2VODA 1I27A 1ZZ7A 2D5HA 5CLSA 3GBFA 2ADUA 3I59B 4EJVA 3WTWC 3ML6A 4L9VA 5FLHA 1ZZCA 4KU7A 1XCBA 4I02A 1QXRA 4O9EA 3U1DA 1GXPA 4BH9A 4RB3C 3I4PA 3GLXA 2XLFA 2EA2A 2FQ3A 4HX8A 3SCHA 1U5TB 5DCMB 1SQ4A 2KIFA 2QYOA 2D45A 1I5ZA 1BI2A 3RZZA 3OTFA 1DPRA 2E1NA 3USSA 5L3EA 2ZCWA 3U2RA 1OR7A 3KZYA 4JTOA 2H94A 1XE8A 4RGXA 1UFMA 4YFNF 3RKXA 1B1BA 1JE8A 1ON1A 2MA3A 1FYLA 1HW1A 4M72A 3RKWA 2XRNA 1IAWA 2HR3A 2MPFA 4HSJA 3ISPA 2DK5A 2QVSB 2LKPA 2EA7A 3C7JA 1R22A 1J7KA 3HYIA 5CJ9A 4ZZDA 1ZLJA 1D8JA 4UVAA 1XDUA 1Y0UA 1O3TA 2R3SA 5HOOA 5LEKA 1BJAA 2WFPA 2LDUA 5E8IA 3PQJA 4BYYA 1ODDA 4G94A 1JHHA 4MQVA 2XLAA 3GZ5A 2BNMA 4ESFA 3H1WA 5FD6A 4BAYA 2F5FA 3KP3A 2LNBA 2B8MA 3V7SA 2A61A 3ST7A 2V6CA 2KRFA 3LAGA 2IA0A 3W6KB 1RTVA 1YHFA 2UYBA 1L0OC 3V8JA 1ZZ9A 2EV0A 3MWMA 3HSEA 3LFKA 3WE2A 2Y48A 2XAQA 3ZMVA 3OGJA 4M6XA 3QP5A 2OA2A 4UHTA 2HOEA 4OFGA 1TW3A 4WVZA 1XSVA 4A6EA 1HW2A 1E17A 4LUMA 1J3QA 3TDZC 1ZRCA 3H9AA 1KQ8A 2A07F 4OIOF 3SXWA 5A2QK 2EV5A 1O3RA 3FXQA 4IETA 4L9NA 2UY9A 4HQMA 2HZTA 2PQQA 3RIRA 3D82A 1RC6A 1T98A 1G6NA 5HLIA 5E16A 1UIJA 1Y3TA 4GCVA 1DP7P 1CAUA 4MEXF 2FE3A 1ZARA 3O2PE 3C1DA 4BIFA 2HDCA 2KIUA 3WTTC 3F6OA 2XUBA 1USTA 3R6SA 2NNYA 1H1IA 4FAHA 1K79A 3PVBB 2Q8KA 1H1MA 5BXXA 4JTNA 2O61A 4XF9A 2UY8A 1O5UA 4QXKA 1BOAA 5JR3A 3K2ZA 3HQXA 3NW4A 1CF7A 3WW2A 3NRVA 4FX0A 4IEYA 1YYVA 4G8XA 4RAYA 4BHBA 1XDSA 1O7FA 3MPBA 4R8HA 1EY2A 3JAMK 2Y0MA 3ULQB 2O1QA 2R7DA 2HTJA 4XSZF 2M45A 1KQ0A 3R61A 1B6AA 5BPIA 3M70A 3FFQA 5EEHA 5D5XB 3J7AO 2K9ZA 4OIPF 3MYXA 2GAUA 1QGPA 2P17A 2A5YB 1IN4A 1CAWB 5EEGA 3DPTA 1OFNA 1DPUA 1ON2A 2QVOA 1VJ2A 5CVRA 2P5LC 3R4KA 1HXDA 3WW3A 4GULA 3NJZA 5ILUA 1O3SA 3WTYC 3OOPA 4PCQA 3DN7A 1ULYA 3L09A 5FD5A 1BN5A 4EQQA 1XCVA 2X4HA 2B5HA 5K1YA 2LSOA 3ZQ7A 2QUFA 4KWLA 1OPCA 1MDMA 2GH2A 3R60A 4YARA 4PDKA 3KEOA 5D6EA 3RYPA 1UCXA 5L3BA 3MDPA 2GC2A 4OLLA 1BIAA 1L3LA 1KU9A 2Y0OA 2ZNYA 3UKVA 3BJOA 2PQ8A 3BDDA 3JAMZ 1U78A 2GC3A 1LDKB 4M9ZA 2QDRA 2C6YA 4FHTA 1KA8A 5FLXK 3CO7C 1IZ1A 1SFXA 2K27A 3M3IA 3PQKA 5EFUA 1YLLA 1FXZA 3VODA 4META 3LWFA 1T6SA 1QQIA 2JT1A 2GXBA 1CAVB 4Z2YA 5KVRA 3DFGA 3D0SA 5K5QA 1K7AA 1U5TA 5DCMA 2A6EF 2D40A 4Q4ZF 4HSLA 3BALA 2OBPA 3C18A 3OV8A 2YU3A 3CO2A 3CUQA 5IT9K 2P6SA 1BC8C 2MHFA 3TNQA 5E20A 5K5RA 1SD4A 2CGPA 2H6BA 3QRFF 1C0WA 2DCTA 2QBYB 2WC2A 4OU0A 3I58A 1WLTA 3VOEA 1FP2A 4EJWA 1QPMA 3FX3A 1XMKA 1QBJA 2BYVE 4IRIA 2OYZA 4XFGA 4A5MA 2MNGA 4ZYGA 3G73A 4ASNA 2UZKA 4KT5C 5LEJA 3CF6E 1REPC 3FZ3A 4Y17A 4RB1A 5EZWA 5ICCA 4MGRA 3N4MA 1V4RA 4J1WA 5FQ0B 5D5UB 1NXMA 5J7MA 1WRJA 1K6OA 5ICFA 1H9GA 3EHKA 1YQAA 1KYWA 2UXXA 4U0WA 5JR7B 4JQFA 5DV5A 4EJUA 5KHGA 3LQQA 3RI4A 1H0MA 1OYYA 3FM3A 3I54A 1WGPA 2VQAA 4EM2A 4RAZA 3QOPA 2PMUA 2QZ8A 3NEUA 4IERA 4QGNA 2ISYA 3FZVA 4P9FA 2VBXA 3KGZA 3BPXA 1JXSA 3WTSC 4Q47A 1B59A 1SFEA 5DCFA 1ZRFA 2W25A 2DPDA 2V1XA 3E5XA 3HRTA 3FMRA 5F64A 1XN7A 1JUHA 3ECOA 2DQLA 1ZNPA 1DDNA 3C3VA 4ETSA 5CADA 3WTVC 6PAXA 3ETQA 3FXUA 1ZVFA 2F2EA 4DQ2A 5ICEA 4WCGA 5HS7A 5JSRA 4HVRA 2HS5A 5F1RA 2EFWA 4KFCA 3SCFA 4ON0A 5D5WB 4ZU4A 3J80K 4RB0A 5KHKA 3IKTA 1ONVA 3PLQA 4I0AA 1SAXA 4XFHA 4L5IA 2PI0A 1J5YA 4G7ZF 3F8MA 1EPZA 5E1RA 2K4JA 5H20A 4GXOA 4B09A 4KIGA 2XIGA 2VT2A 1Z1DA 5I91A 3KP2A 1FC3A 1Z6RA 3UKTA 4RGSA 1FWZA 2ZMEB 4ENKA 3B02A 5KK1A 3LOIA 2EV6A 4I2OA 1HKTA 3GUDA 1A04A 2G7UA 4WBBA 2D1VA 3D0JA 4EJTA 3BU7A 5LLQA 2Q30A 2FF4A 4PIZA 4HLYA 1Z7UA 4XBFA 4O6JA 2D5FA 2XL7A 1R7JA 4FBFA 2EJRA 4UVBA 1F1ZA 3U9GA 4HW0A 4XFFA 3HT1A 4OOIA 3FXRA 2XKOA 3J80Z 3QPTA 1FSEA 4WXHA 4LA2A 3COAC 2EWNA 1IN7A 2L4MA 1CGPA 4L5JA 2A69F 1ZG1A 4JVAA 3CUOA 4IEWA 4X6RB 5JFRA 2V1DA 4Q5SF 1R58A 4XSXF 5I0TA 1ZZBA 2Q4SA 3J81K 1FLIA 1U3EM 2YR2A 1KGSA 4WX9A 2B0LA 5LRRA 3GVAA 4XRFA 1ZRDA 1TQPA 5BV6A 1ZHFA 2P6TA 3B73A 1TNTA 3HRUA 2RV8A 3WTUC 2LF7A 2D1HA 1XGNA 5ILVA 3FJSA 2CAUA 2M5WA 3L00A 1XE7A 4IEZA 2VE9A 3VB2A 2F5DA 4XFAA 4X6QB 2QENA 2XVCA 3MZHA 4HF0A 3M9AA 5E18F 2K02A 4B8XA 4HQEA 2M87A 1PDNC 3EYIA 5E1WA 4G7HF 5DUIA 2HYFA 4CZZA 4P9UA 4LFUA 3EJKA 2PBIA 4KA4A 1BC7C 3F3XA 4YRDA 3GO5A 1R5HA 1Z9CA 5AONA 1G4DA 3H7JA 4RD7A 1UCRA 1HSTA 1Z05A 1IXCA 4CICA 4ZU7A 4DNCA 5H6RA 2H09A 1XRUA 2XHKA 2FA5A 4I7HA 3T5XA 4AVCA 2L54A 2V09A 2O6GE 3KSCA 4D7TA 3KEQA 5I0SA 3J81Z 4F8AA 3IWFA 1ZGJA 2CWEA 3SZPA 1P2FA 4OIRF 1RL3A 2G7HA 1XD7A 1MJBA 5E8GA 2ZKLA 5FLIA 3LAJA 1P4WA 5HS9A 3TGNA 4M74A 3VFZA 2A6HF 3KP6A 1EH7A 1IPJA 5T3NA 3EETA 5FQ0A 2NNNA 5BS6A 2GA1A 4HLXA 2HQRA 2YPRA 1MKMA 1L3JA 2L01A 1OI6A 1OKRA 2J5PA 4KN4X 4R79A 2E7WA 3O6BB 4LA3A 3H8UA 3H3UA 3H1YA 4HAMA 2IXHA 2ZO4A 2IPQX 4UV9A 3TO9A 1PP7U 4HZFA 3IHUA 1U12A 2ETEA 2RDPA 3BJAA 1UHWA 2PA7A 2J5OA 2M8EA 4L9JA 1W7PD 3CLPA 1UD1A 1LDJA 5D1IA 4EROA 4Q29A 1YS7A 2Z2SB 1YFWA 2KJBA 1Y9QA 2Q0OA 1VTNC 2FQPA 1S7OA 1LVAA 4CYDA 2DFIA 2VOPA 3F72A 1X8MA 4IHSA 2Z99A 2FRHA 3H1MA 1SFNA 5LBQA 1E2XA 3P7NA 4EV0A 1MJ9A 1IRGA 2H27A 5CVUA 3CJXA 4I3PA 3CUQC 2XAHA 1RZ4A 1SEFA 4HX4A 2DAOA 4O3MA 2K4BA 1I1SA 4BXUA 1USSA 3U11A 4LJZF 2IXJA 2OQRA 1OMIA 2WWYA 3E5UA 1AWCA 4QMAA 4RS8A 1CX4A 1FPQA 4D0PA 4LEJA 4KMUX 1YW7A 1GXQA 5J48A 2A3SA 1FZPB 4QM8A 4JK1X 3IWZA 4IPAA 3I71A 2W85A 4FAGA 2QLZA 3ABTA 1DGWA 1Z6TA 1K78A 4OIQF 3M7GA 3I64A 3WU0A 1J59A 2IXLA 4S05A 4KNYA 3WG9A 2HTSA 2ELHA 2FNAA 1P4AA 1W7PB 4IEUA 4UXAA 3IDBB 4IVNA 3ACLA 4RGUA 5FPXA 2COMA 2XV4S 3HT2A 1G3WA 3SXYA 4QGLA 4Z07A 1BI3A 3KETA 3MZYA 4P5OA 2ISZA 2R7FA 3BZ6A 4EVIA 3LA7A 1BM9A 3D5LA 1X82A 1KYZA 2RQPA 3ZMTA 2IT0A 5ICGA 1HKSA 3L2HA 4TLFA 3H3ZA 4AVAA 3JSOA 3ZPLA 1W5SA 1STZA 3KP7A 4HN1A 3ZP5A 2KIMA 3LQRA 4CDGA 5LGNA 1R23A 2RC4A 3G7DA 2Q2EA 3CEWA 4KL1A 5JVTA 5I0RA 4KYWA 2QNKA 3JSPA 1G3SA 5ERIA 4A0ZA 1HW5A 4NB5A 2GQQA 4OINF 4ESJA 3KLNA 4CXFA 2OA4A 5BMZA 3ZDSA 2GC1A 1NHAA 4A0YA 2DI3A 3I59A 2XAFA 3GF2A 1EV7A 1KQ9A 4LLNA 3NQOA 3K69A 3BJ6A 3RYRA 2ZKZA 5K5OA 4JV4A 3L2CA 3RJPA 1BI1A 1T39A 1O4TA 2ESNA 2XKPA 3SHFA 3HOTA 1TBXA 5D6FA 4I09A 3I0TA 1MD0A 2HWVA 5D4SA 5C8WA 4ESBA 4IHTA 1YUDA 2Q1ZB 3ZMZA 1I1GA 1YTYA 1Q5OA 5FGMA 3PFIA 2VXZA 2IJLA 4BQAA 4R52A 4S04A 2KXLA 3E3VA 3O3KA 2JPBA 5D4RA 4ZU5A 2W57A 4ZYHA 4RGRA 4P9GA 3RPUA 3FMQA 3QPHA 4F7ZA 2B9UA 2VECA 3L9FA 3GYDA 4LG0B 5FCCA 1EH8A 1NE4A 1J2XA 3MQ0A 4QM9A 2K7LA 4AQ2A 3DF8A 1G3YA 4QLCU 1OYIA 2OZUA 5BOXA 4MGIE 1J3RA 4KIFA 4ZYDA 1QO0D 1SD5A 2O8XA 2FSWA 1XGOA 2OU2A 3F8NA 2STWA 4YFXF 2Z3YA 1YW9A 2EFQA 3SMHA 1YFUA 4LTAA 4Q0VA 4MQ9F 4AIJA 1J3PA 1TQMA 1SMTA 4XEZA 4PZJA 2DPUA 4IJAA 4UXNA 1S6LA 5DUKA 4HF2A 4ENMA 4EM0B 3HHHA 2IA2A 4LLGF 3IRRA 5ILSA 3V7RA 1P92A 2V1UA 1LRHA 4Q48A 4G7OF 3RKYA 1MGTA 5L3CA 2RN7A 1RNLA 4HVOA 4A6DA 3DKWA 2QCSB 2PJPA 4PIXA 3FWEA 3LA2A 3K1PA 4Y13A 4AD9A 5F6FA 2O8QA 2EFNA 2YSRA 2F4PA 2ACJA 4D7SA 2PG4A 5JSOA 1LQ1A 1X3UA 3NL1A 1SMYF 3H50A 2MD5A 4IRHA 2P8TA 4YSFA 4GGGA 3V8LA 1QZYA 2QWWA 2OQGA 3Q9VA 3DP7A 1TLHB 3R0JA 1P6RA 1D8KA 4GO1A 3WTZA 3BOQA 1R1VA 2HYGD 1WKMA 4L11A 5LRSA 5E1XA 1IXRC 4XFBA 3IKVA 1IRFA 5IT3A 2IW5A 3LWCA 1G3TA 4YIIA 4NVPA 5BPDA 4U7DA 2VC1A 4G6QA 5D8KB 3ZMSA 4LMYA 1S3JA 1SFUA 1UIKA 3O14A 2UYAA 1PM7A 3T1BA 4KMFA 3E5QA 2BNNA 4IEVA 2FXAA 2W84A 1RI7A 3EUHA 1CAUB 1EYBA 5L3FA 4EGYA 4LK0F 3MFKA 1X7NA 4ORFA 1W7PA 2ZFWA 3FMSA 2P7CB 2EB7A 1TW2A 5BUVA 1B9NA 4UVCA 2XL9A 1WWXA 2PTMA 3E6DA 2PFBA 3HSRA 1FT9A 3HOSA 3N97A 1CAWA 4O5VA 1DZTA 2VBWA 3MAJA 2KJCA 3EBRA 4CO8A 3SCGA 4MGYE 4WXDA 1J0RA 4XLNF 3TO7A 1CAXB 4LD5A 4XF1A 1Q1HA 2JTVA 3H92A 3T0YA 4KICA 1XB4A 3NSTA 4IESA 3NVCA 3V7CA 2PLYA 3F8FA 5L3DA 4H0EA 3JTGA 1UW8A 2GXGA 4M6YA 4HOBA 4R1HA 5HI0A 2FBKA 4M9XA 3DQVC 4MX3A 3GYHX 4M73A 2Z69A 3JW4A 3S2WA 4K2EA 1RUNA 2I45A 3LA3A 3L7WA 1AOYA 4BHCA 2PEXA 4U88A 1R36A 5CYVA 2BV6A 2H0VA 1QY4A 1IN6A 3HUGA 3GZ6A 2E9QA 1Q3EA 1H9TA 1QNTA 4HLTA 3KP4A 4LB6B 1RIOH 4HMZA 5D5VB 4J1XA 4EWEA 3F8BA 2M1BA 4B29A 4EWAA 1U8RA 5JSPA 1MZBA 4IF4A 1FSHA 1W4MA 1IUYA 2OAZA 1GQGA 2HGCA 3KMHA 1CAVA 1IW7F 5HLHA 1MDMB 1UPIA 4IEOA 4LLLA 3KE2A 4HV5A 1U6GA 2RKHA 3EDPA 1LJ9A 2F5CA 2HKXA 2EK5A 2V79A 4K8FA 2DTRA 1NZCA 1YLFA 3DPLC 3V4GA 4WZCA 2P4WA 2WV0A 3WU1B 4A2UA 3K0LA 5DEQA 3CLOA 2X0LA 2PAEA 1QXJA 5L3GA 3BB6A 1HBXG 1DZRA 2OPKA 4HV6A 1OD5A 4IXAA 4CGZA 3M8FA 2KKOA 3WGGA 2QBYA 2EA4A 5I8TA 4U7BA 2VT3A 1IXSB 2ET1A 1FYKA 3TKYA 1GVJA 1PP8F 4MTDA 3KFWX 2PHLA 4E70A 3HSFA 4MHGA 3OCPA 1FX7A 4A12A 2OZJA 3DEUA 3WODF 4LG0A 5J8FA 2Q0AA 3BP8A 3S7IA 1O5LA 3CTAA 3ES1A 4IEQA 1XSDA 4UUVA 4UBHA 3CUQB 1WSUA 4ZH4F 4Q0PA 2BE5F 1I6XA 4HDVA 1ZREA 2CV6A 2BGCA 2IXCA 2PN6A 3F22A 5LHHA 5KHIA 4H7LA 3Q9SA 3WTXC 4KWJA 3ROUA 3K9TA 5FDBA 4FX4A 2RVCA 4LLOA 1SD7A 2HQNA 4M71A 4TV7A 3WGHA 3AAFA 2QQ9A 4YG2F 5I8SA 3M8EA 5J8CA 4E2QA 5AIQA 5K8SA 3QU6A 3SFZA 4L0ZB 4EJOA 2CYYA 4AWXB 2VBYA 1B9MA 4KWKA 3LZZA 4HVQA 1B4AA 5TJJA 2A68F 3CO6C 1YW8A 4MEYF 5H6QA 1ZZ8A 3OD0A 1PUEE 4KN7X 2UWMA 3BPVA 2GWRA 1Q43A 3BCWA 3VHRA 3EQLF 4AIHA 1O57A 2XROA 5AVPA 2DU9A 1MJAA 1F4KA 3RYKA 5JHUA 3ELNA 2XASA 5HDKA 1YS6A 2XAJA 4NQWA 3GW2A 3I5UA 4IEPA 2PHDA 2JPCA 3P9KA 1U5TC 4QGMA 4KDPA 1EP0A 2JSCA 2PAKA 4HA8A 2FU4A 2P5KA 1LKNA 3SQNA 5CU1A 4LUKA 1BI0A 4IRGA 3T8TA 2DO7A 1KU3A 2CO5A 2NAZA 3BY6A 1FOKA 1FI2A 2ET7A 1D3YA 4MGKE 3R0AA 3BROA 4XFCA 2NYXA 4A0XA 3DL3A 2ETHA 1YFYA 1FYMA 5CVIA 1D5VA 1VP6A 2FBIA 5D8LB 2LF8A 2ZMEA 2GU9A 4EGZA 2BBYA 3QP6A 1TQIA 3E6CC 1S8NA 2GZWA 1ZRRA 1VR3A 4L0YB 2NS0A 1ZX5A 4CHUA 3HRMA 4Z82A 1J1LA 2O03A 2IXKA 2Z33A 1JGSA 1CAXA 1YWKA 2W24A 4LULA 5TRDA 1R1TA 4E2SA 3ERED 3TO6A 3MCZA 4U0YA 5BPXA 2XLGA 1KU7A 4HYEA 1UB9A 4WF2A 2MBFA 2K86A 1LNWA 1J9IA 3JZVA 3ZMDA 4LGWA 4UBGA 4P55A 5A2QZ 3OF1A 1Z91A 2IA1A 3HTUA 1LEBA 5CVJA 4UNOA 2TDXA 4AXOA 5LHIA 2QJVA 2E7XA 5C6CA 5FO5A 1FNNA 4E2GA 2K0GA 4HX7A 2Y75A 2L3DA 2YX4A 2AS5F 5FLJA 4M9SA 3CL1A 2F5EA 1ZLKA 1R5GA 3KCCA 4I98B 4A5NA 4HBLA 3F21A 3TNPB 1FBQA 1XGMA 3DXJF 5FFXA 4I0BA 1NE6A 4PGGA 2JRTA 4LK1F 3F23A 2ZXJA 3C3WA 1W5TA 3U0ZA 1FBUA 2ZNZA 4QWQA 1BBYA 2FEZA 3P9IA 1GQHA 1RUOA 3MEXA 4UV8A 1RGSA 2VE8A 3ES4A 4GYGA 3KGLA 1R00A 3W6JB 4MGZE 2EVXA
chains in the Genus database with same CATH superfamily
5EIYB 3IBMA 4AIKA 3TOBA 1P7IA 5JCTA 1T0FA 3ELKA 4N43A 2XSJC 5FR3A 1VI0A 1K83J 2XJSA 3R0RA 4YFWA 3LDKA 1S29A 2QM3A 2NN8A 2DJIA 3LQCA 3I2JA 3PMSA 3RRDA 4WK8F 4M3CA 2NRAC 1XMAA 3S2HJ 2ZBKA 5I93A 3S7EA 2AXTC 4Z8BA 1HRI1 5B2GB 1DP3A 4ET7A 2WZR1 3A1YA 3OYNA 1JUIA 1W2TA 2IS6A 1QJEA 5LGTA 3S1RJ 1W8HA 3M7AA 2QQAA 4MUVA 5GZFA 1BK1A 2GN7A 4FQZA 2DT6A 4XONA 5DD8A 4CPBA 3U37A 3T8RA 4YGEA 2W00A 3DV8A 2RNJA 3PTRB 2ZHNA 1W39A 4ATEA 2WIIB 5F37A 5F32A 1GU3A 5K7ZA 4XTPA 2L4AA 1ZAOA 2HJIA 4LKDA 2ATFA 1JBCA 5CFCA 3VSLA 4L18B 1OF3A 1S0EA 1FIAA 2BWAA 3EO6A 1DGRN 3Q9OA 2IP2A 4W97A 1BR2A 5J40A 4ZYEA 2QQBA 3IH4A 4TSVA 2VJJA 1OURA 2DQRA 2DA7A 5A7NA 4Y4RA 3LSTA 2LKSA 3WW1A 2BEOA 5FY7A 2P7VB 4LMFA 1JYVA 2WADA 1ZBE3 2ZGLA 3U10A 2PFWA 3ZN0A 2UXNA 1F9NA 3I97A 2DWRA 1EUTA 3FHZA 5B66C 1SD6A 4DBQA 2VOWA 1IKPA 3GTQJ 4XZPA 3C7FA 3FBIB 3GF6A 4KIBA 1QWRA 1H8TB 2MC3A 1V6KA 5FFZA 1NYWA 4KUMA 1S4CA 2HDWA 3SEEA 3HHGA 4OMYA 5HS8A 2W5FA 2D3PA 3ZR8X 3TAYA 5LY2A 1FAYA 2H6CA 2HXIA 2H0BA 1REDA 4PJYA 3VBSA 2CG4A 4GDFA 1S7AA 1PO11 1QHHD 4IEXA 1WUVA 3LDRA 4CCCA 2YUEA 2STTA 3QU3A 5FREA 4GWNA 3RQIA 2ZEWA 5JMCA 4Q0SA 1HRI3 1W2UA 2JD4A 1APNA 3T4HB 4K7JA 3ZN1A 4MHRA 4N0BA 5C71A 2YBPA 1HQLA 5HDNA 3A22A 3FHIB 3BC8A 4I01A 1CF7B 3LKJA 1K78B 2IC1A 4QU2A 1KU2A 3VGIA 2WQ8A 3BWGA 2VC0A 5J6XA 1QH6A 2D93A 3OBTA 2L5QA 2XPJA 2PJRA 1CZSA 2RR11 2VQUA 2YG0A 1DQ2A 3E1SA 2OIIA 4BE2A 4JAAA 2DK8A 4RDUA 1XE0A 3ZXGA 2WKKA 4FPCA 3U4SA 1FOD2 1BA5A 1O3QA 2HKOA 1RIRA 2VOTA 1YFXA 1T38A 3JRHA 4A3MJ 2ADEA 2LRPA 2YXSA 3M3OA 3G4SI 1VBA1 1KXGA 4Q0QA 3GX4X 3IL2A 2GC0A 1TNRA 2VJXA 1I9RA 3ZFGA 1MBKA 1REFA 2EFPA 2O0OA 4L0PA 4YG6A 3THCA 5CAZA 4EMSA 3H7YA 2DODA 2Q2EB 3WXPA 1X8EA 1YRZA 3ZMUA 1FJLA 1XNDA 5IP6A 3USUA 1ND3A 2XAGA 2RS32 3J8F2 1AX2A 4KGGA 4XE9A 2VONA 1TC3C 1T08B 1QOSA 5JAXA 2MLKA 1RJ8A 1P4XA 4AFCA 5LHGA 4YYOA 5E89A 3CJIB 5ERLA 1OISA 5CLSA 1NAEA 4ISRA 3ML6A 3A01A 4JRAA 5C8CB 1V6OA 5LA2A 3VHNA 4KU7A 4COZA 4I02A 4F3JA 5FZ4A 5BNPA 4XLCA 3OPWA 2VBBA 5FKOA 1RRJA 3LSMA 4HX8A 5FWJA 3UYJA 5DCMB 1SQ4A 2WA3A 2KIFA 2D45A 2YBSA 1NCQC 1Q8VA 3C2BA 2H94A 4RGXA 1UFMA 3POIA 4YFNF 3OY8B 3TN91 1UU4A 4HSRA 2R062 2ORXA 3RQ4A 2MA3A 3RKWA 3S3NA 3PIJA 1SACA 2P6CA 2XG3A 5M5YJ 2C24A 3A2KA 3ISPA 1PNGA 1JZ7A 1FMVA 2QVSB 5EYXA 2RR13 2E1MB 2AENA 1ZLJA 3BR3A 2ZGUA 1PVXA 3RGBA 2QGUA 2DF7A 4W65A 5CFDA 1BJAA 2WFPA 2J1SA 3G2BA 2VW0A 1MMAA 3BKZA 3N7KA 4MQVA 3POFA 5C4JJ 1VBA3 4BAYA 3RCOA 3ZN4A 4IHVA 1SDWA 4EN0A 2R0QC 1Z0XA 2V6CA 3BTCA 3LAGA 2DA3A 2Y31A 2HBUA 2HPMA 1QHDA 1PMHX 1IKQA 3PURA 3ZMVA 5FP9A 4MXWB 3QP5A 4XACA 1W8FA 1UAIA 4LO7A 5FOJB 4OFGA 4LBQD 3HPHA 4PDWA 1W90A 1HW2A 3CCYA 3DKXA 4A6EA 1ODMA 2BZDA 5EXOA 1LUJB 4LUMA 3VDXA 1D0YA 3FDYA 5FYHA 4OIOF 2EV5A 1ALYA 1W36D 3CF5F 2RVAA 1MMSA 3WDUA 2X85A 3Q0VA 4NWWA 1QJY2 3D82A 1GWLA 4D94A 2Z79A 5FLMJ 1CAUA 2FE3A 1ZARA 3K10A 5DZFA 2XVKA 1ETXA 2XUBA 3WDTA 3R6SA 1GV2A 1H1IA 2XGDA 1VQ7I 5GJ6A 4BJ0A 1OJLA 4JTNA 1ENSA 2DVGA 2UY8A 2G4IA 1O5UA 4XF9A 5M5XJ 4PBPA 3HXLA 3RZJA 1MNDA 3POGA 4IEYA 4O61A 1YYVA 3TN93 1O7FA 1AZDA 3MPBA 4R8HA 2WAQA 1PHMA 4S2GA 3KV6A 3ZGKA 3ULQB 1NG0A 1OPOA 2JICA 3Q8BA 3I3MA 4Q2FA 2R7DA 4XSZF 3FFQA 5FIXA 4J19A 5EEHA 2O8OA 2K9ZA 4XXPA 3DTIA 3MYXA 1AR83 2BVBA 1IN4A 1A6QA 3DPTA 4LBQB 1OFNA 4NRPA 1ON2A 2ILMA 4LO8A 2IGNA 4YFZA 4KBZA 1DGRM 5CVRA 3K4NA 2K46A 2LW8A 4PCQA 4CUCA 3UJOA 5K1YA 2LSOA 3AG3H 3ZQ7A 1H2LA 2QUFA 3AP4A 1ZBA1 4AEMA 4V2GA 5FYYA 1ENXA 2JMWA 3JRDA 1HDDC 2ZEXA 1MDMA 3ZQQA 4YVSC 3R60A 2R5ZB 1UWWA 1XC5A 2X1CA 3KEOA 3RYPA 2HWC2 4A6SA 4QX0A 3FC0A 3KB5A 2Y0OA 2UUZA 2ZNYA 3BDDA 3JAMZ 1LDKB 3CDZB 4CXYA 5A1FA 3ACFA 2VW2A 1KA8A 3P3PA 1BMV1 2Z4FA 2K27A 3PQKA 4QDSA 9ANTA 2JUCA 3GTKJ 5DZGA 5CKTA 3A4UA 1QQIA 1DLLA 2ZABA 2GXBA 1CAVB 2NLRA 3DFGA 3GBWA 1OLRA 3D0SA 4M3CE 2A6EF 3IKWA 4HSLA 3ENRA 3BALA 1PK6C 4DY5A 4BE1A 2ZXWH 2YU3A 4V1PA 3KYDB 5F8PA 2BERA 2MHFA 4AGVA 3TNQA 2VBDA 1MBJA 3QRFF 3MFAA 3GHMA 2QBYB 3AYAA 4OU0A 5C3PA 4PI0A 2GDFA 4YM0A 1XMKA 1RMU1 2BYVE 1O91A 5AC91 2VNGA 3S32A 5CKMA 5KXEA 3ILFA 1ZTRA 1O59A 2MNGA 1UY1A 3KT4A 1U0JA 5FYTA 3CCMI 2V26A 1QA6A 2VZOA 1REPC 4XDOA 1UU5A 1VBE2 3WY6A 1V00A 1JZ3A 3ZSEA 4UFIA 1C4RA 1V4RA 2K40A 5LK5A 4HNTA 5T55A 3BOPA 5FQ0B 1UZWA 1N3PA 5D5UB 4AG4A 1NXMA 3IV5A 1W6QA 1J84A 1JU3A 5J7MA 3M8LA 4ZDOA 2Y34A 4CVUA 4U0WA 1D4VB 3NWTA 5KHGA 1H0MA 3NKGA 5EQUA 4PFPA 1ZBA3 3FM3A 4RYDA 4EJRA 2QZ8A 3PUBA 4IERA 1NA1B 4QGNA 2ISYA 1RUE1 4HL0A 2RS51 2F4IA 4Y1ZA 3BPXA 4Y24A 1NCRB 1B59A 1SFEA 5DCFA 3BG3A 2WAFA 2W25A 1BEV3 1UPSA 2DPDA 4I3GA 2GIZA 3I8TA 3K4AA 3NAPB 3GCMA 2JECA 2KDZA 1YQ2A 2IFWA 3OPTA 3M1HA 4ETSA 5CADA 3NO8A 1UMHA 3FXUA 1ZVFA 5ICEA 5EZGA 4A4AA 4BDZA 5EJCA 5A32B 4ON0A 2FDFA 2O5RA 5D5WB 1Q8OA 2XPVA 1SFPA 3IKTA 1ONVA 4G3YC 4I0AA 3FUQA 3HL2A 4XFHA 3S30A 4L5IA 1V9U1 3OY9A 3VBOA 2IGOA 3LGRA 4QTRA 1EJ9A 3NV4A 5LA0A 1EPZA 5E88A 4PJ0C 3JR9A 4B09A 3JB8A 2VZVA 5GAHJ 4GJZA 2VT2A 5I91A 3S1QJ 5JLVA 4FOWA 1ETQA 1RMU3 1YO8A 1Y9MA 4NROA 3ZYFA 5AC93 2ZMEB 1YRNB 2WNUC 3NJXA 5FXZA 5LA1A 1YEWA 5JZGA 1DGLA 4INDA 4I2OA 5FYIA 5C3RA 3IP4B 3OL4A 2D1VA 4EJTA 2Q8OA 4AGRA 1RUC3 1SG3A 4M01A 2ZZJA 1UMIA 4PIZA 1Z7UA 2D5FA 2RDNA 2XL7A 4O65A 4P9WA 4YW7A 5HODA 4BIOA 4UVBA 2XPWA 4HW0A 4RS5C 3HT1A 4CXXA 2JVHA 4OOIA 3SQOA 4A3XA 2L9SA 1IN7A 2BHYA 2DDAA 4M4PA 5DUUA 1SBEA 1K5MB 4RM3A 5JFRA 2V1DA 3CMMA 5I0TA 1V6IA 2CU7A 1ZZBA 2Q4SA 2RS53 3DKQA 3J81K 1FLIA 2CDOA 2YR2A 1KGSA 3AKPA 4OZXA 4G12A 3ZDVA 1TQPA 5F3GA 2P6TA 5GZCA 2ZGTA 4CA0A 2LP0A 2D1HA 5LB6A 3FJSA 5DQ0A 2M5WA 1BQPA 4MHUA 4IEZA 2ZX1A 2WA4A 3GTMJ 4X6QB 5FYCA 4XLFA 3M9AA 2FD5A 5E18F 1PIV3 1FPN2 4AVSA 4QKDA 1AL21 2YZ4A 3OB8A 3RSJA 4YW4A 1OLTA 5JPMB 5DUIA 4FPEA 3LSEA 2HYFA 1FTTA 4P9UA 3EJKA 2LLKA 3GO5A 2VZRA 3DYPA 5LBBA 5BNGA 4OI1A 4COVA 1IXCA 4XR6A 1DU3D 5KAIC 2J22A 1QVTA 2H09A 1UMQA 1XRUA 2BY0A 4I7HA 1H8AC 1W5CC 4D7TA 1R4MB 4ZC3A 3IWFA 2CGOA 4CCLA 2Y30A 2E7AA 4Y22B 2EXHA 1OLQA 4IL7A 1H9PA 1XSRA 1RVF3 3MIFA 2AC1A 3B00A 5IAXA 2MC4A 3VFZA 2E2IJ 4F83A 2VZUA 5DXDA 5T3NA 5KC6A 3EETA 2QEXI 5EJ3A 4HLXA 3I55I 2HQRA 2DCYA 5LD2C 2EIJH 3P6BA 2Y6FA 1X4PA 5KXDA 1OKRA 5IVJA 3FBYA 2P81A 4R79A 3S57A 1QNYA 3H3UA 3BN6A 2DT7B 3AJZA 2IXHA 4ASKA 4N53A 1UY3A 3IHUA 3BJAA 3DPRA 4EROA 4Q29A 1YS7A 4XKVA 2VD7A 4Z1VA 1YFWA 4FTHA 1EUUA 4CYDA 1LU1A 2NMNA 4RQPA 1W03A 4LK6A 3F72A 4FPJA 4IHSA 1WGXA 2Z99A 2HWE1 4DYQA 4IZZA 1SFNA 3HMYA 1GDTA 1MJ9A 3N9NA 1ERDA 2H27A 1OUXA 1H2MA 1AL23 2VXJA 4UAPA 1S2KA 1USSA 3U11A 2MSYA 2WUHA 2IXJA 2LRDA 2DDUA 4D7NA 2OQRA 4K20A 3E5UA 1DU0A 4RS8A 4LEJA 4ABZA 1GXQA 1ENRA 1C8M2 1BJQA 3ZOIA 2A3SA 4JK1X 3W2AA 1HLVA 4UY8I 3VKLA 3BR5A 3I71A 2E1MC 2IS1A 5JXGA 5FJHA 2AEZA 2GNBA 3DBLB 2NQYA 2DA5A 1J59A 1MNEA 3AMNA 3W58A 1ZBE2 3RZDJ 1N1VA 2E7QA 2ZAHA 5F2WA 3WG9A 1P4AA 1OC1A 2UWAA 3L2YA 3ZXDA 4HK8A 4XZUG 5FZAA 5IYCJ 4EZHA 2C5DA 1OOPA 1QGLA 2COMA 4FQ4A 3SXYA 1E5HA 1W3VA 1W9FA 1BI3A 4P5OA 3SC7X 3BCAA 3LA7A 5KNLA 5F9TA 1X82A 1NCQA 5KXBA 4ZZ5A 3ZMTA 3RWKX 2CFOA 4UW4A 4QQOA 3MV11 3PHMA 3ZFFC 3TW6A 3MW2A 4RLQA 4ES9A 2X5IB 1W5SA 1VAMA 3VZLA 4M3CF 4IQPA 3AG4H 1W8UA 3PUIA 1W2OA 3U4XA 5I0DA 4NUBA 5E3OA 4XOTA 1OBNA 3AZVA 1IHMA 4KL1A 3CC4I 2D98A 2QSFX 1ULDA 3WDXA 1T8IA 2VZ1A 4NB5A 2GH8A 4GWJA 3KLNA 1JGGA 3ZDSA 4NAMA 2HWE3 3I49A 5F3IA 2EZLA 3NWSA 4PJMA 1N3OA 4FASD 2DI3A 3CMEI 4PF5A 5KHDA 1MBHA 2OUHA 2E2HJ 4RAGA 2R7EB 1RUF2 1AYM2 3NQOA 3DTKA 2EIDA 2K9MA 2PLV3 4D5FA 3T09A 3ZFEB 3C7HA 3WHTA 3SHFA 3ZSKA 2R5YA 3WHBA 3M3EA 1WJBA 4A7YA 1MD0A 3HN1A 1Y1WJ 1QQP1 5D4SA 2MD0A 2OF7A 3VBHB 3ZMZA 1SBFA 1Q5OA 1Z3YA 1JJ8C 1MSFC 4R9BA 4S04A 1HJGA 2KXLA 3V0BA 4UF0B 1RUI1 4A41A 5D4RA 5KC5A 3GZTB 3OSFA 4P9GA 4BISA 4F7ZA 2B9UA 1UZCA 5FCCA 1XC6A 1C28A 2LK2A 3MQ0A 4NBQA 2CV1A 4QM9A 2K7LA 5A3PA 1OYIA 2A6ZA 3MLJA 3N36A 3VHOA 1L7QA 5EGOA 4HRIA 1OVPA 4AI9A 2Z3YA 1W06A 1SMVA 4C8DA 3AYCA 2DTZA 1ZK8A 1YFUA 1TMF2 4Q0VA 1I1EA 2NPIA 5C4WA 1Y56A 3JRFA 3RZOJ 5DG1A 1C1FA 1LENA 4Y20B 1LFUP 3VBFC 3KF3A 5ILSA 2KT0A 3JD71 4Q48A 4AVZA 4HVOA 2Y9YA 4X1EA 3NV2A 2PJPA 4PIXA 1SLLA 4B4RA 1EAH3 3WT3A 2O8QA 2J1RA 3TEWA 2YSRA 4XAEA 2F4PA 3MV01 3CCJI 5JSOA 2P34A 3NL1A 3VBRB 3H50A 2MD5A 4YSFA 4A44A 2DTWA 3NJVA 4RSUA 4FQGA 4AHZA 2OQGA 3V0AB 1D8KA 4AFMA 1CONA 4IV1C 1AR72 3FXLA 1WKMA 4L11A 4GMP1 2VTXJ 1N75A 4PBOA 5IK7A 3PNYA 5FPUA 5LRSA 4XFBA 4NIIA 2WWJA 5FZ1A 2Y6LA 3LWCA 1G3TA 4YIIA 4W8JA 1DG6A 4S0HB 4G6QA 5HCFA 2ZGSA 4RA2A 3H3VK 3ME2A 3NMBA 1UIKA 3MUZ1 1PM7A 1F31A 3PL0A 5JXIA 2FXAA 3FLPA 1G9AA 3EUHA 3HG9A 4LNVA 2A3YA 1RUI3 3ZQGA 4YZ1A 3FMSA 2P7CB 3OGRA 2EB7A 2DFFA 5TGTA 4KG0A 4NJ4A 4YM2A 1WWXA 2PFBA 1C1LA 1RUG2 2R49A 3N97A 2DOFA 1NY71 5A6QA 4C1WA 5EEAA 4DRVA 3MAJA 1JHJA 3PU8A 3SCGA 4MGYE 4H4KC 1BOBA 1CAXB 3AP6A 2DN0A 4BY1J 3UESA 1NA1C 3T0YA 1MBGA 4KICA 3HDDA 5LBEA 4ZS3A 2PLYA 1NCRC 4KQ7A 4BXSV 4M6YA 1NQJA 3ACGA 4HOBA 5HI0A 1RC9A 4M9XA 3S17J 5GP9A 2NXNB 2HDDA 4M73A 4ZDPA 4PLNA 4DUXA 2Y6GA 3RZGA 3S2WA 2W0XA 4QPGB 3FN9A 1RUNA 2I45A 3LA3A 1B35C 1AOYA 1NX9A 1B8IA 2P37A 5CYVA 4IE0A 1DQ0A 3B9CA 1XMXA 3C2HA 2H0VA 1QY4A 2E9QA 2EIGA 2MGQA 3RQ0A 1UOGA 5F08A 2ZGRA 1OQ1A 4BOWA 4EWAA 1QHGA 1U8RA 2V4AA 1RKWA 1COV1 1HXS2 1LOEA 2OAZA 5HBAA 1W6NA 4IHWA 4CPBD 4COYA 2Z1DA 2E26A 3CCLI 3OYJA 5FJ8J 1EF4A 3F0CA 1RESA 3EDPA 4TXWA 1F35A 2WO3A 2EK5A 2V79A 1E3OC 1NZCA 4YZ5A 2WV0A 1AR82 3WU1B 2XJVA 3K0LA 5FP3A 4G6TB 3L2RA 4N7IA 1QXJA 5L3GA 3BB6A 1B09A 3BIEA 5SV5A 3DEEA 2V73A 1OQEA 3CDLA 2IWGB 3CNAA 1DZQA 1LHNA 2FUG2 5I8TA 4U7BA 4WM7C 3JU9A 3SDBA 3RS6A 1MH4A 2A73B 2Y0SA 3HSFA 1O4XA 1JYXA 1FX7A 1CZVA 4QX8A 1IGNA 2OZJA 3DEUA 5J8FA 4LG0A 2Q0AA 3BP8A 3VPRA 4H14A 5JIAA 3CTAA 4IEQA 1XSDA 2Z5WA 4UBHA 4M3CB 4ZH4F 5D2AA 3BR1A 3NQHA 4LOCA 1Q8PA 5EYRA 1S2BA 4HDVA 1OQDA 2IXCA 2CYFA 3DCFA 3Q9SA 2R7UA 4LIUA 5M5WJ 1VNDA 1P9QC 3AMMA 2YS9A 3LSPA 4B43A 4N90A 2QQKA 1OCPA 4QXCA 2QQ9A 4HKWA 5HXMA 3M8EA 1W3XA 4E2QA 2DUOA 3SFZA 3QWLA 1NZIA 4XUNA 4FTEA 3TP3A 2VBYA 2AZ5A 2DYCA 1B9MA 1GR3A 2L0KA 4A93J 1POV1 4HVQA 1SZBA 3ITQA 3KCYA 1B4AA 2A68F 1OCCH 4MEYF 2JA5J 4LLFA 3W21A 2COBA 2GWRA 2VXRA 3DWLE 1REEA 2ZMLA 2XROA 2HNHA 3S5AA 3POJA 5AVPA 3L2QA 5J1RA 4XLHA 1MJAA 1F4KA 4XKBA 1JH5A 3ELNA 5CQGA 5A7WA 5GKAC 1COV3 4RS5A 3I5UA 3TEDA 2JPCA 4QGMA 5HPOA 4KDPA 4NPLA 1HB2A 1ZM1A 4CU7A 5HXVA 2JSCA 2E6VA 5A3NA 1S72I 2K2SA 2PAKA 5G04L 3S14J 3BU0A 4PT6A 3ABMH 2P5KA 1AX1A 2WFF1 3ETPA 1KU3A 1GOGA 2CO5A 3BR6A 1FI2A 4UW3A 3BVCA 1XNCA 3R0AA 4IKFA 4GJYA 1RR7A 2NYXA 2K3FA 5FMDA 1KONA 1LE8A 2JJ7A 3KF5A 2W7NA 4QPQA 5CVIA 3J7LA 3RMYA 1UG0A 2W47A 2LF8A 1JT0A 2CUFA 1WVRA 3QP6A 3OYEA 5ACA2 1YC61 2XB0X 1VR3A 4QHOA 3VBSB 4L0YB 5A7PA 2FDGA 1MZ5A 1PGW1 1PGL1 2VTXA 5A33A 1S7EA 3DUIA 2R16A 4KITB 1GUUA 4IGPA 4LULA 5TRDA 3IH2A 3ERED 1DDLA 3CP2A 4CCMA 2ME0A 2R30A 2GLOA 3U07A 3PJQA 4WF2A 1LOBA 1WCDJ 4BU2A 2LOOA 3JRIA 1J9IA 5C44J 4II3A 3DCQA 5IVYA 4O7XA 5H9RA 1R49A 4P55A 2KZVA 1Z91A 2L9NA 1AR62 2VZ3A 3HTUA 1LEBA 1POV3 3SITA 5CVJA 2KLOA 2ZX4A 5FZMA 5KAFC 1HN0A 4D8MA 1FNNA 1UYZA 1D2QA 3KYLA 3KV4A 4XNFA 5GZDA 1OLMA 4U36A 4A69C 4YVWA 1OCZH 4LK7A 4UW5A 4LO6B 4MSVA 3TNPB 1FBQA 3LEIA 3AMQA 4CDXB 1W6OB 3SEQA 4I0BA 1ONAA 1E57A 2UU8A 3WDVA 3FFZA 4LK1F 5J4YA 3C3WA 5EDNA 2W1UA 3AM2A 1C5HA 2WFF3 4XOPA 4IHXA 2R1BA 4RR3B 2PHFA 3MW4A 2VE8A 2L9VA 2VVEA 4HNUA 2XB5A 5IVVA 2RNGA 4BPZA 2MEV1 2EVXA 1D4M3 3CJTB 3BG7A 5IWFA 5IVCA 3K4BA 3A7QA 2O3FA 2A6TA 3I4NJ 1YCIA 2GSYA 4B1RA 4XF0A 1WJFA 3GXOA 3A01B 3K70C 4DZPA 3GEZA 2BNOA 1V3FA 2XGXA 2N7GA 3VDDB 1R1A1 2RM22 4LBJA 5BNPB 2FBHA 1E5RA 1Y7BA 3WOGA 3ZLIA 1RITA 1O7LA 1IN5A 4RLFA 1H6YA 2XUEA 3CZJA 3FF5A 3H0GJ 1RUD1 4AQ6A 4H55A 5CYYA 1VQNI 3T1LA 3K1NA 4CUAA 4YRVA 2YBKA 1E5SA 2ICWG 2MH9A 1LEAA 2Y33A 3IDAA 3CC2I 2KM2A 3EYYA 4JBAA 5I0UA 5FLXZ 3VLBB 2VNOA 4V2VA 3E1F1 1WWYA 4ENNA 3A0HC 4XJ9A 2CQKA 1ZG5A 1PJRA 3BCBA 3RPQA 2NP0A 2MH2A 3HQUA 5LFAA 2OV7A 4MGSA 1DIWA 2FDJA 4Q8LA 3WE3A 1Q8SA 4KGQA 1SFKA 2RV9A 2V72A 3W5NA 2TRTA 2EAKA 1WJEA 1WQ2A 4AQTA 2EZIA 3IIAA 1X9PA 3SNMA 4FT8A 4GYIA 4EE2A 2L7KA 5F0CA 5GAEJ 4JGYC 2QQJA 4XRMA 5FZGA 2HEOA 3VWBA 1RVF2 4Y1XA 2LY9A 3JQXA 3TDUC 3G1OA 2VPVA 2NVYJ 2YB7A 4CEYC 5CISA 1MVEA 2JG8C 1UU6A 3FLTA 5A6YA 3TEXA 2ZJ2A 5FPZA 2WT1A 3KZIC 4YG0A 2MEV3 2Y0IA 2R92J 3V64A 3EXUA 5DD4A 3GWZA 4U0VA 2DW4A 1MNMC 3O12A 4BXFA 5FY0A 5L7OB 3KLOA 2R6QA 4RB2C 1GVDA 4Q26A 2A71A 2VOOA 4RHV2 2H8WA 1PO23 2ME6A 1HSJA 2CNAA 1R1A3 3K1MA 1D2SA 3Q5FA 2ZPXA 2ZEYA 3B6CA 1MW7A 5JI6A 1VIWB 2VIXA 2C1FA 2VG9A 4GB32 2OD5A 4M0NA 1US2A 2AREA 1H2NA 3S16J 3RZMA 4G6DA 2VN2A 2VKVA 4P96A 2QKMB 3F8CA 2NM1A 1W28A 5FLVA 3FK6A 4Q4X2 5F3EA 1FY7A 3HIFA 3HN3A 2K3PA 1FBSA 5FXVA 1TTYA 3CDIA 2WJSA 5FZOA 4QX5A 2VZTA 4BZ4A 2OZ6A 3TOAA 4ZTFA 3CJQB 1EH6A 4O9GA 5HDGA 1LPQA 1Z7S3 2DT5A 1Y0NA 4I76A 4G9YA 2QFEA 1PMIA 1YIFA 2LBFA 2B7YA 5LGUA 2JXAA 1IS6A 4LG3A 2V9VA 1Y4WA 2ENRA 4K40A 2PMZN 4N9IA 5FPLA 1ACCA 4MFEA 2IXIA 4XRSA 4Q1RA 5IAVA 5IYDJ 2PAMA 3UKGA 1ZZ6A 2EAAA 2LREA 3HRSA 3VBUA 4CEWA 3LF7A 1XOYA 3TQNA 2TCTA 3W2VA 1AX0A 2SBAA 3ACIA 1F36A 3DKYA 3HOZJ 1UHMA 5CQEA 4XF3A 2UV1A 3OYLA 2VTFA 5T5JA 3GTGJ 3UJQA 4A42A 2BVVA 5DDJ1 4LB5A 3KV5A 3OIQA 3OBRA 2CSOA 3SH4A 5L9RA 4DGWB 3HNBM 4NN0A 1ZZ7A 2HYXA 3GBFA 3I59B 3WTWC 4XIDA 1IQDC 2JB4A 5FLHA 1GWMA 3OS0A 4OVEA 4GH4B 4XXAA 1QXRA 4O9EA 2E34A 3ATGA 4BH9A 4E7SA 4CDWC 3DU5A 4RB3C 1W04A 4LOTA 3I4PA 1L7LA 3GLXA 4FCYA 2EA2A 1LHWA 4DOZA 1FOD1 2XGCA 2QYOA 1X33A 2W92A 3RZZA 1DPRA 5L3EA 5IUQA 4GKYA 1YX3A 2RE9A 3MGUA 1OR7A 4JTOA 4IO9F 4ITCA 4BDYA 1HQNA 3VHPA 4AEDA 4E8DA 2ZOEB 1B1BA 4AAXA 1JYCA 1FYLA 1CESA 4CU8A 3VL9A 1IAWA 2MPFA 2P3KA 5FYZA 1WJAA 1BR1A 2X51A 3O8GA 2LKPA 2QCOA 4BEHB 1ST8A 4QPIC 1R22A 3HYIA 2RS31 3J8F1 2PLV2 2E60A 4M4RA 1BJZA 1XDUA 4AVTA 2HYJA 1KFUL 4GA9A 4QXHA 5F6KA 3WUDA 3PQJA 2QKLB 1STMA 1QH7A 3OYAA 5C33A 1G86A 4ZKTB 1MZ6A 1BL0A 4ESFA 5FD6A 5AFEA 2JDUA 2B8MA 4LHNA 4BGDA 3ST7A 2GP5A 2IA0A 1YHFA 3KVAA 4C1XA 2W1WA 3MWMA 3HSEA 3WE2A 3RKQA 2YGLA 1XU2A 3N3HA 2AH2A 1X4OA 3QD6A 4E8CA 1R082 4M6XA 1T6GC 2WZPP 1LEDA 5F1JA 2OA2A 5LCWL 2X1DA 4JX5A 5FK8A 2QQOA 1R5ID 1XS9A 5DZEA 3G1LA 2BPA2 3H1CA 1B35A 1T0FC 1E17A 2R061 1J3QA 4N43C 2JE8A 1TNFA 3TDZC 2K9LA 1ZRCA 4B3AA 4QX1A 3SXWA 2N8GA 1O3RA 3FXQA 4L9NA 2UY9A 2PQQA 1RC6A 2VKHA 4OUEA 1G6NA 5HLIA 2BP6A 4N4NB 1Y3TA 2VMIA 4MGTA 2B63J 4MEXF 3O2PE 4BIFA 2GM4A 2OT7A 1W8ZA 1FOD3 2B46X 4FAHA 1USTA 2GXAA 1YI2I 1K79A 3QOEA 1CZTA 3I3BA 4FE4A 4ASLA 5FKKA 1BOAA 3K2ZA 2VQ0A 1UF2C 1EAH2 4G8XA 4QKBA 4BHBA 1XDSA 1HB4A 4CZSA 2VI6A 5EWSA 5K7HA 2O1QA 4K3UA 4KMQA 4WZFA 3KX2A 5BNNC 2A3WA 1KQ0A 5BPIA 5CFCC 5JZGB 2EXJA 2ZGPA 2RS33 4OIPF 3KQRA 4ZYAA 4C3HJ 3HOYJ 2P17A 3Q8AA 4DS0A 3JUUA 5K0UA 2QVOA 4PCRA 4E7LA 1UN1A 1OLME 2P5LC 1HXDA 1H4GA 1WA6X 2L7FP 4GULA 2HQAA 3RWNA 3TW7A 1QJY1 3GCWA 1KITA 3ERMA 3L09A 5FD5A 1BN5A 4IQ4A 2CSGA 4AEJA 3W9AA 3VZNA 4QXBA 5IVFA 3HNYM 4QHZA 1OPCA 4IEJA 1G8XA 4Z6YA 4LJHA 2WT0A 5GADJ 4PDKA 2X6YA 3OUHA 5L3BA 1W0OA 4OLLA 5FZ8A 1BIAA 2P3YA 3SFIA 1KU9A 3UKVA 3VD5A 3GALA 1U78A 2GC3A 4M9ZA 4FHTA 3HOVJ 2R063 5FLXK 3CO7C 2LVSA 1SFXA 5EFUA 1YLLA 4Q8KA 2DXIA 1RUJ2 2F5VA 5GPAA 5T5OA 3LWFA 3VBSC 1FX5A 2W08A 2DUQA 3KLSA 1JI8A 4XIOA 3B69A 5IK8A 3TMOA 4Q4ZF 2Y6JA 3D3AA 2XF5A 4PJNA 4NIHA 1AR91 3CUQA 1AKHA 1YITI 5K5RA 3WF2A 1SD4A 2CGPA 4P9JA 1MBFA 1XYNA 1NXD1 1WLTA 1FP2A 1QPMA 3FX3A 1NLRA 2ZSHB 3FLRA 1SCSA 5CA6A 2OYZA 4BL0B 4A5MA 3TWIA 2HWC1 1W6MB 4CP2A 4CP9A 5FY9A 4E7ZA 5A1AA 4BMEA 3FZ3A 3ZIXA 3N4MA 3B01A 4J1WA 5CKNA 3ZFGC 3DEMA 5A3WA 2VNRA 4XOGA 1KYWA 1QJY3 2A6VA 3PTYA 1VFCA 4E4ZA 1F4HA 4JQFA 1U0AA 1ULOA 2M8GX 4EJUA 2FCUA 3LQQA 3RI4A 1OYYA 4N53B 1ND3C 1WGPA 2VQAA 3B6AA 3QOPA 1LOCA 1G9CA 3VYSB 3NEUA 5FWEA 3DPRB 1X3ZB 3B3QE 1XU1A 4Y4YA 2K9QA 5FZIA 4H7MA 1UKGA 2W1QA 1JTZX 1ZR4A 1MZFA 3HR9A 2V1XA 3I56I 4A7ZA 1XN7A 1JUHA 2ARBA 3R4DB 3T4VA 4RQPB 4FTBA 3WTVC 4NQWB 6PAXA 1H4HA 3FBMA 4N8MA 2BXYA 2F2EA 4DQ2A 2XPUA 1UAAA 5JSRA 2HS5A 5F1RA 4CA9A 2EFWA 2IBDA 2JWTA 1VBE1 3SCFA 4ZU4A 3NNMA 3J80K 2LTPA 1RJ7A 4XYXA 4FFIA 5FY1A 1HDPA 3CZUA 2PI0A 2QKDA 1QJX3 1LGCA 1A34A 1WLCA 5E1RA 2DURA 5H20A 4GXOA 2JE7A 1UJ8A 4QX3A 5L9VA 5FOBB 3KP2A 1F43A 3FXKA 5LK7B 2R7WA 1Z6RA 3UKTA 2AQFA 1JJ6C 1YXWA 2VOVA 1K5JA 4OUMA 5KK1A 2WYFA 2W2IA 3ZR6A 5CFDC 1KS4A 3LOIA 2HWC3 2EV6A 2LD5A 3AC0A 1UHSA 1S0FA 3T0DA 4WBBA 3ZSJA 1UX6A 3D0JA 3BU7A 3LSRA 1GLNA 4AVVA 5LLQA 3V56A 1OOPB 1MS4A 4HLYA 5JXHA 1VMJA 1OA4A 5IT6A 3CP8A 3OIPA 2ELKA 3U9GA 1NCQB 4XFFA 2DOAA 4JQTA 1SVMA 4ZPIA 3UT0A 4XM3A 3HNMA 1H1AA 2CQXA 1IV8A 3ZOBA 2EWNA 2EPFA 2L4MA 5HCHA 4L5JA 4RA0A 4PDWC 4YLZA 4JVAA 3CUOA 2RG4A 3BTLA 4GD4A 4AYBN 1TG7A 2QQPA 4XRFA 5BV6A 1ZHFA 3HRUA 1C3HA 4PQ9A 4HPKA 2LF7A 1J09A 2WV1A 2CAUA 4COUA 4NC6A 2VE9A 1EV12 2XVCA 3UK9A 5FKNA 2PHTA 4B8XA 4Z92B 3ZR5A 4HQEA 2VCBA 2M87A 4Q4W1 1VBE3 3RSNA 1I3QJ 1JYNA 1H88C 4CZZA 1M06G 1JS9A 1RUH2 3LNQA 1BC7C 4YRDA 1R5HA 1Z9CA 3QH6A 2KL4A 3PIOF 4YWAA 4I99C 3WG7H 3ZYJB 4ZU7A 3H3LA 4DNCA 5JMOA 5H6RA 1V5FA 5BYNA 3TBIA 5F0HA 4GAZA 3UNGC 4YZ2A 2W1SA 1Y8QB 4B1LA 4F8AA 3WG3A 2PMZA 1ZGJA 2CWEA 3MIHA 2D43A 1P2FA 4OIRF 3V0BB 4CCEA 4BACA 2G7HA 1MJBA 5E8GA 1P4WA 5HS9A 1G7YA 3TGNA 4M74A 3WNNA 4HT1T 3KP6A 2ECBA 1IPJA 2NNNA 3VD7A 2BY1A 2Y38A 1HN1A 2VQTA 4CZCA 1MKMA 1L3JA 4E7JA 1WZ2A 1MS9A 1OI6A 2WS92 2J5PA 3OEAA 1D4M2 5EGOB 4BM8A 1N3QA 4LA3A 1CJDA 1FPN1 3H1YA 4AI1A 4HAMA 1I6HJ 2OC6A 1TVGA 2ZO4A 4UV9A 2X1EA 1TWHJ 1PP7U 2ZAAA 3KV9A 4RGKA 4HZFA 2ETEA 4Q4Y3 4P00B 4PF1A 3GDBA 1UHWA 2J5OA 2VR4A 1LDJA 4FPKA 1YQ6A 1Y9QA 2Q0OA 1S7OA 2GMMA 2Y64A 3H9GA 1NK3P 1X8MA 3CQOA 2FRHA 4FPHA 1H8TA 1O4YA 3VL8A 1E2XA 4BQ4A 1IRGA 2ZJPF 4I3PA 1SEFA 4O3MA 1GQPA 1IOAA 2K4BA 3C8XA 1NKGA 4DJAA 2HPIA 1OMIA 2WWYA 4QMAA 2ELJA 5C9AA 1BK0A 2VMDA 4BE0A 1KGYA 4YVSB 3T30A 1MS8A 3K6GA 3AXDA 4QM8A 2XRLA 2RDRA 3IWZA 2WBMA 4FAGA 1DGWA 1Z6TA 1K78A 4CDUA 3GZAA 3WU0A 2XONA 4B1MA 5EV7A 4NHKA 1VAVA 4BCUA 3H8RA 4PSXA 4KNYA 2YROA 4AK3A 5DAWA 2HTSA 4L97A 3WF1A 4UXAA 2ZEZA 2BOLA 3AB0A 3W5MA 4XQWA 2XV4S 5EYYA 3HT2A 4R4ZA 3AZYA 1LFPA 4J6GA 1F2NA 4MFDA 4Z07A 4FPLA 3CF2A 4B3XA 3ZIWA 3LSHA 1WMEA 3MMYB 5ICGA 1HKSA 4FO9A 1VQMI 4XBLA 3FKIJ 4TLFA 3JSOA 3ZPLA 2PHUA 2CUJA 4IE4A 2VQLA 1STZA 4UB8C 1PO22 2FQ4A 4RFRB 3IMNA 4ASMB 3O7OA 3AVRA 2CDPA 2KIMA 4CDGA 5LGNA 3POSA 3JBG3 3G7DA 2Q2EA 1BZWA 4E9KA 3ZPOA 2WNVA 3CEWA 5JVTA 1G59A 2VMHA 3W6VA 1G3SA 3GMEA 2I8DA 1B8IB 1A31A 3ASNH 1HW5A 4EN6B 4ESJA 4F3QA 4CXFA 5BMZA 2ZB9A 4YW1A 3CKHA 1ZBE1 3CJIA 2XAFA 3K4KA 4QWNA 1W6NB 4HK9A 3VDAA 3BTYA 3VBOC 3K69A 4BQQA 2VO5A 2ZKZA 1YNAA 4BLJA 3L2CA 1Z7S2 1X2MA 3RJPA 2F48A 2ZHMA 1VQ5I 4XHBA 3M8JA 1OXCA 3HOTA 5EJZB 1WPKA 4I09A 2YHJA 1RUE2 3KHCA 5C8WA 5JLWA 3PDQA 5JZGC 3OY8A 2Q1ZB 1FOXA 1VBD3 3DPUA 3G1MA 3PFIA 5H2FC 5M0TA 4NPMA 3MPPG 4HKLA 3HGGA 1H89C 3O3KA 4LKFA 1JMUB 1UO9A 3RPUA 2GMEA 2VECA 3L9FA 4XLEA 4LG0B 1AXYA 3BTJA 1EH8A 1J2XA 5CZKA 2XQRA 4B47A 1BW6A 1O8SA 4QLCU 4COWA 1J3RA 1QO0D 5FRNA 1UY0A 1SD5A 2B45X 4A3IJ 1XGOA 2OU2A 3F8NA 2O9LA 3AX4A 4YFXF 1YW9A 3LSKA 1V9U2 1LULA 1GNYA 5IFTA 2HVQA 3T1MA 4MQ9F 1J3PA 1RUF1 1SMTA 1AYM1 1QF3A 4IJAA 4UXNA 1K42A 3GZUC 1IO2A 1U5ZA 4JDOA 4HF2A 4BQOA 4BJ6C 4UWDA 4CYCA 1LOFA 2WNUB 5BNNA 4RGAA 1CVNA 2QQWA 3CCQI 1C8M3 2V1UA 4G7OF 5C3QA 1X1BA 2RN7A 1RNLA 1IV6A 2QCSB 1FIPA 3FWEA 3K1PA 4AD9A 2JA6J 5F6FA 3ZXEA 2ZJQF 4E4SA 4P02B 2PG4A 4B7KA 1LQ1A 5FYUA 4IRHA 3SDGA 2P4EA 4RS5B 4B44A 1QZYA 4BJTA 1W0UA 3W20A 3DP7A 1BKZA 3R0JA 3WTZA 1NLQA 2KA3A 2KD7A 1R1VA 2CV0A 2E5NA 2VL4A 3N9LA 5E1XA 2WZEA 3JCUC 4JGZA 3ZRGA 2ZFUA 1AVBA 3ZMOA 2IW5A 3ILNA 4NVPA 1TMF1 1ETYA 1KQRA 1NK2P 3H0DA 3OR1C 4A3LJ 3JRCA 4DIQA 1CPMA 4QQPA 1Y43B 3IZOA 3AMPA 4KMFA 4EATA 3VKOA 3E5QA 4CU6A 4XPVA 1X7NA 1W8WA 1W7PA 5L9BA 3G71I 4QHBA 2CL2A 4UVCA 2XL9A 2EICA 3H8XA 4FOQA 5DM6F 3D5OA 1IRXA 4XJWA 5M3FJ 1DZTA 2IGMA 4A3BJ 4PSWA 4N53C 1R4NB 3D5RC 4CO8A 4FXGB 4XLNF 1J1TA 5C5TA 3AG2H 1TWAJ 1EKEA 2QQLA 3J7MA 3DPRC 5K4LA 1ETKA 3NVCA 3V7CA 1MS5A 5A3UA 2WWSA 5GAGJ 3F8FA 1S0CA 3CIHA 5L3DA 1RUF3 1AYM3 4YEJA 1VB2A 1UW8A 4R1HA 3IMMA 4XTMA 5KCMA 1AR71 3GYHX 3MEPA 4RQPC 4BHCA 3PUHA 2BV6A 2ZA9A 2XJUA 3GZNB 3HUGA 2D6LX 1Q3EA 4HLTA 2VKDA 4LB6B 4HMZA 5FZ7A 4X0GA 4EWEA 2ZTNA 3A23A 1PVC2 1FMD3 1ND2A 3ON7A 3SKJE 2CW7A 2HGCA 1E3PA 4EEFG 3BTZA 3J4UH 1CAVA 3WP6A 5HLHA 4IEOA 4LLLA 3KE2A 4FVVA 2DFEA 1IJWC 4BQNA 1RUG1 1U6GA 2Y60A 4J25A 4LO5B 1KJRA 4AEKA 1VRH3 2JDAA 4LKEA 2BW3B 1UZ0A 4WZCA 4OHYA 1X36A 5DEQA 3Q8EA 3CLOA 2DYRH 2X0LA 2PAEA 1HBXG 2M34A 2DCZA 2OQ7A 5FZDA 4CGZA 2YPDA 3I4MJ 3M8FA 2VUAA 2KKOA 1TMF3 4CDQC 3WGGA 2QBYA 2EA4A 3FK7A 2L7ZA 4AWDA 2ET1A 4NR1A 3ZQCA 2VVDA 2LFBA 5DAXA 5E3LA 4E70A 1Z0HA 4MHGA 1OOPC 1C8NA 3J9SA 4A12A 2BZTA 1G8WA 5A6XA 5IJRA 4UUVA 5FMOL 1GWKA 1E5IA 2RREA 4Q0PA 2YU9J 2W94A 5IP7J 3SJMA 1I6XA 3OD4A 1ZREA 3ZXKA 2VW1A 2PN6A 3F22A 3BZCA 4AYBA 1KFXL 1HXS1 3ROUA 3K9TA 3HD8B 5H9PA 5FDBA 4NNJA 2HQNA 1BVVA 2JG9C 4YG2F 3H8OA 5K8SA 2JSPA 2IFRA 5ABJA 2DMQA 4L0ZB 1DHKB 2OXBA 4AWXB 4WVVA 4Z2WA 1AR81 2BW8A 1GUIA 1AR73 3TEZA 4HFSA 2DA2A 1MSEC 4DPNA 4KWKA 1OKOA 5ISLA 3LZZA 2YPJA 5TJJA 5FZCA 3CESA 5H6QA 4TZDA 3D8CA 1PUEE 5A7QA 4MOAA 4NHMA 1Q43A 1IDYA 3K7AJ 3EQLF 3M4FA 2M4GA 3NAPA 1W05A 4NHYA 3WCSA 4HG6B 2E7TA 4AL9A 2DU9A 3OPZA 3RYKA 5DUWA 2XJPA 5HDKA 4K21A 3GW2A 5LA9A 1U5TC 2A6WA 4TYSA 3AYEA 3ZFFB 1M4WA 2YV8A 3WP4A 1RUG3 3AZWA 2PXJA 5F0FA 2DVFA 1LKNA 1BI0A 3T8TA 2C26A 3N9MA 4XJ8A 1SPPB 1SLIA 2JENA 3BY6A 2ET7A 2O14A 1GSLA 1IS4A 4MGKE 4D6RA 4XFCA 4A0XA 3DBHB 4JRLA 1YFYA 4H2AA 3ACHA 4BQ1A 1FYMA 1U9NA 2DU1A 3IAM2 2ZMEA 5A3LA 1YRNA 4EGZA 2OUMA 2WL1A 5JOYA 4BQ2A 2I07B 1ZX5A 4CHUA 1PGSA 5CEHA 3UNPA 3K3OA 2IXKA 3C2GA 4NC7A 5C4WC 2W24A 5JR2A 1UQXA 5FRMA 2PHWA 4AFBA 4MYEA 2X6XA 4QPYA 1HXS3 4OQ8A 2JKXA 3LOCA 2KFDA 2F4OB 1F5JA 4M6VA 4HYEA 2BRTA 3PUAA 3RMXA 4FETA 3TB0A 1QQP2 3HQRA 3ZMDA 3P5BA 2F6BA 2HEWF 4LGWA 5FZOB 1SLCA 4IW3A 1LNSA 2KZGA 3OF1A 5BNOA 2IA1A 3A4CA 1IZ3A 3LEKA 4QDQA 5A7OA 4DXZA 1N1SA 1PYVA 3SYTA 2VUJA 5C6CA 5K7PA 2HWB2 1QJX2 1V0AA 5F2SA 4E2GA 3ZX7A 2X6OA 1LJ7A 2D5VA 4XQDA 4YG3A 2Y75A 2L3DA 4L99A 2GOXB 4M9SA 5ACA1 2F4LA 4JZRA 4M3FA 3AP9A 4PQQA 4UUTA 4KNCA 2CQ7A 3KCCA 4HBLA 4UFHA 3F21A 3VBUB 1I3AA 1LECA 3K4MA 3J7NA 1BEV1 2QZ3A 3PMEA 3T0AA 1S9HA 1VBC2 2ID3A 4CCNA 1FBUA 4EZ4A 3P9IA 1GQHA 3VBFB 5B5EC 5FZ6A 3MEXA 2JDZA 4UV8A 3AL0C 1AA7A 2JDHA 3ES4A 1W9SA 1LHUA 3EUHC 3BPZA 2BBAA 1JN2P 5AIPA 1LDDA 3SH5A 4FPYA 3KP5A 2QBXA 3VD4A 2BOJA 4FTSA 3BOWA 1YIOA 2IUWA 4XF4A 1BXHA 4LBLA 3MO4A 4Y22A 1AYN3 1AR61 2X09A 5J3UA 1YG2A 4BHPA 3PNVA 4MV2A 1S0DA 3KQ4B 1Z78A 3WNPA 4XFIA 4D6QA 1ZG3A 1BLZA 3K4CA 4BNCA 1LB2A 4IV1B 4LHKA 2HVSA 4RGGA 3PNAA 1J75A 5T50A 1F5TA 4JHZA 1X1CA 3IAQA 2P5VA 3FBNB 3SHRA 5KHJA 5I8YA 2A75A 4ONUA 3K3NA 4YNIA 3GFJA 3QQAA 2PMHA 1S0BA 1IN8A 3OOXA 4D7MA 4HANA 5KBFA 1URXA 1RUC1 1ZKGA 2GIVA 3P1IA 3PSIA 3PUSA 3JTHA 2AXLA 2VE1A 4N9HA 2OTLI 4RFT0 5A70A 1YQCA 2J7MA 4DW6A 1JHFA 3NKTA 3VKMA 5E17F 1MBEA 1R1UA 1ZYRF 1XB9A 4XETA 1QIQA 1TME3 4JYKA 1IUFA 1J83A 2E1CA 2R0HA 3WUCA 4IHYA 2RM21 1VQ6I 5ACA3 5FBJA 2IVMA 2LMDA 4D9JA 4XJUA 2KPMA 2PHXA 5J1UA 1IG0A 2YU2A 2VBZA 3HKZN 3IM0A 5BQTA 4KU8A 1YQ5A 2D6PA 2DCKA 1WLWA 3HEIA 1LR5A 1B35B 3LSGA 5FP4A 1PIV1 5DDGA 3MIDA 3GFIA 3TOJA 5CVVA 4Y52J 2XQXA 2Z9OA 2OCCH 1GV5A 2DMPA 2I5UA 1WCUA 4GKXA 3GTLJ 3DLAA 3VEPA 4Q4Y2 2LM3A 1YE9A 1AR63 3OOUA 2MLGA 5E6HA 1NG7A 2CV2A 4CCDA 3QAHA 5HLGA 3DEWA 3S93A 4X6AJ 1IS3A 3WLUA 2FHRA 2DTYA 3OS1A 1IPSA 5KHHA 3BQYA 4XW3A 4HBNA 2L7MP 3BTXA 3MW3A 1DGRA 1NOVA 4MZUA 3VZOA 3GTJJ 3V8KA 2TUNA 3B7MA 4OHZA 4B8EA 4JX4A 3E6BA 1YO5C 1UOBA 2DLLA 2OVUA 1RVF1 5EF6A 2OPWA 4HN0A 2VL8A 2X5IA 2X6WA 3THPA 4PIYA 1SVOA 2G9FA 2ZX2A 4WM7B 1BIBA 3QH7A 1B72B 3ABUA 2CW0F 4XRSG 1FATA 3M1CA 3O8HA 4OMZA 3FE5A 2DBBA 3ZXLA 2Y69H 2XMLA 3I53A 1LOGA 4XBNA 3HTSB 5D8AC 2LC2A 1WA4A 5E79C 3C7EA 2Z5UA 3W59A 3RNSA 2BQPA 4RHV1 5JOXA 3H0OA 5JOZA 1XG1A 2QQVA 1N47A 3KZZA 2H1LA 5F04A 2RM23 1J58A 1T2XA 5ANQA 4M3GA 3CCSI 1W8TA 1WW5A 3CMGA 2FCTA 3G3ZA 1ETOA 2WY8Q 2O0YA 3SZTA 5FPAA 4FE7A 3ZQIA 1GZWA 3CLQA 2CAVA 4Q4V3 4LORA 1DCSA 1R1ZA 1K3IA 4W50A 3BI3A 3RTRA 1ZH5A 2LY1A 3IC7A 3HOUJ 3HOWJ 3DU6A 4A3EJ 3ZXJA 4AVBA 2WO1A 4Q4X1 4MNUA 2WTEA 1R64A 3MN2A 3RG0A 2HI3A 2D5HA 4KWUA 4EJVA 3VBHA 2IVJA 4L9VA 2ZGNA 3APBA 1ZZCA 2O8KA 2XH6A 4DOUA 2TBVA 4TWTA 5C3OA 2YC4A 3U1DA 1JHNA 3DYMA 4UW6A 5FPVA 3S8PA 3ZKUA 3K77A 3WDWA 1D1BA 3SCHA 4KT6A 3O5SA 3JBG2 4OAZA 5CB7A 5FZ0A 2HOSA 3ZSLA 1UXXX 3OTFA 3USSA 2ZCWA 3F9KA 1XE8A 2WA0A 5FK7A 1OA2A 1UZZA 2GBYA 1MS0A 4TTGA 4BBSJ 2FCVA 3NRUA 4FPGA 4NWVA 2WBKA 1ON1A 1VQ4I 1HW1A 3TP0A 1N25A 1SANA 1H2KA 3WQ1A 1G9DA 4HSJA 4IV3C 4XN0A 5A1LA 2EA7A 1GNZA 2HWD2 2WQ4A 5LY1A 4LIVA 2XDVA 4ZZDA 4A3KJ 3VKFC 3K4DA 1GOFA 4UVAA 4AI0A 4QPOA 4JKKA 1O3TA 4A3GJ 1F5FA 1CX1A 4YVWC 4DZJA 3ZXFA 2DDBA 3I2FA 2VPRA 4OCTA 4BYYA 1ODDA 4XKWA 2XLAA 2WAQN 3GZ5A 5FZBA 2XBO2 5SV8A 4GRIA 3ECQA 1ULGA 3KP3A 2LNBA 1UOJA 4Y1YA 1PGL2 3V7SA 5IOYA 1VBD2 2L9LA 4RHV3 1NH3A 3WG4A 3W6KB 1RTVA 2UYBA 4QB1A 1L0OC 3V8JA 1KS5A 3VBRA 2CUZA 2XAQA 4YW3A 3OGJA 3K70D 5JI7A 2VY0A 3V0AA 4WVMA 4L8QA 4GB33 4CXWA 4JC1A 2HOEA 5JDBA 5EG0A 3LD8A 2HYKA 4WVZA 2VMCA 1D7PM 4Q4X3 2GN3A 3H9AA 3VV1A 2A07F 3OSDA 3RIRA 1YYNA 3K2AA 3BR0A 2PLV1 5E16A 1UIJA 5GLTA 4Y33A 4M3BA 4GCVA 1DP7P 1SLTA 2G9ZA 1PUFA 1Y9GA 4CTEA 3C1DA 2HDCA 2KIUA 2BGOA 3WTTC 3F6OA 3H5RA 2M7BA 1MH3A 4XICA 1WMXA 2R042 3N9PA 2Q8KA 1H1MA 5FMCA 3G6EI 4C2UA 2D44A 2O61A 4QXKA 1XYOA 2WO2A 2XF7A 3NRVA 4FX0A 2A70A 4ZXKA 4C3JJ 4JKLA 1EY2A 3JAMK 2Y0MA 2MABA 2E1OA 4CDQA 1R081 2F6CA 2VUDA 2E53A 1JKOC 2PHRA 1YJ9I 2M45A 1B6AA 2B9SA 3M70A 4Q27A 5D5XB 2QQUA 4E4DX 3J7AO 2DVBA 1HV1A 3VD9A 3AP7A 2P0WA 2A5YB 1DBNA 4BKXA 1CAWB 1L7RA 4K8RB 1AXZA 1NT0A 3OGGA 1NUKA 1VJ2A 1SVLA 3OS2A 3WW3A 3DTEA 3NJZA 5ILUA 1O3SA 1F4AA 3WTYC 3OOPA 1ASJ2 1JZ6A 1MIJA 5FZKA 1ULYA 5APAA 2BDRA 2JEMA 3THTA 3BT9A 3ZCOA 2B5HA 2QUOA 2O7OA 1VB4A 3QYEA 1YJWI 3LSDA 4C0HA 5DTDA 4RM2A 1E0EA 2ZHLA 3KWVA 4KWLA 2XGEA 2J1EA 4IE6A 2JG9A 4RL7A 2R7VA 3MI8A 2IS4A 3I2GA 5D6EA 1UCXA 1QNWA 3MDPA 2GC2A 4XIKA 1DGWX 1FV2A 3MICA 1L3LA 2JK3A 1IG7A 4LQRA 3V65A 5GLVA 1EAH1 2PQ8A 3SISA 2QDRA 2C6YA 3O1OA 3VB9A 4RMNA 4Z2AA 1IZ1A 2CWMA 3HB9A 3HVDA 2AGSA 5FYSA 1V54H 3VODA 4META 1H0BA 2JT1A 1S2EA 4AI8A 4YM1A 4IOCF 1GP6A 2V7FA 2HOAA 1BHGA 2NOGA 4A3JJ 5K5QA 1CWPA 4SLIA 1K7AA 1U5TA 1TP4A 2D40A 2ZHKA 5F6LB 1VZ0A 3OV8A 3ESWB 4JGYB 4MLOA 3L2UA 5E20A 2DCTA 2Q8CA 2WC2A 3OR2C 1G9FA 4CEYB 3I58A 2JG8B 4AFAA 3VOEA 3PVEA 1VBB3 1FMD2 1QBJA 3IIIA 5JVVA 2VC9A 3N05A 3Q0UA 1U5XA 2WSUA 3AFGA 4XFGA 1R083 4OULA 1KDMA 4ZYGA 4XUPA 3G73A 3CJRB 4KT5C 4XILA 3CF6E 1VRH2 3BTAA 3HM5A 5ICCA 1DLCA 3ZN5A 4MXVA 4MGRA 2ZXQA 1I5PA 1LGNA 1RUJ1 3OBZA 1H6XA 1K6OA 1KEXA 1W8NA 4CRQA 5ICFA 3VBUC 1H9GA 4CEWC 2M0MA 3OSGA 2UXXA 3GZEA 2XXZA 1RKTA 5DV5A 1T56A 2BHZA 1FMWA 3I54A 1A78A 4NMIA 4EM2A 3VDBA 1VMHA 3POYA 3O0WA 2NVXJ 1S0IA 3KGZA 3WTSC 3KHBA 3PJYA 4Q47A 1ZRFA 2CJJA 4ISQA 3E5XA 2LS6A 3CCRI 1GICA 3DBRB 3P5JA 4AF9A 2WLPA 2RMU3 2TEPA 2Y8KA 1VLNA 5IP9J 1K61A 3ZN6A 3C3VA 4DQAA 5K7FA 4U87A 3ETQA 4LT5A 4GQ7A 1LKXA 4QU1A 2ZJCA 5DG2A 2X53S 5HS7A 3IB3A 3DGTA 4HVRA 1WJ5A 2PX9A 2ECCA 1OR7C 4ZS2A 3GGLA 4XQ4A 3PLQA 4AEDC 2WRAA 2KIQA 1GNHA 1HF0A 2QSHX 1HJFA 1WH7A 4GMP0 3ZXSA 1ZR2A 2XSDC 3INAA 5C9AB 3VZMA 4G7ZF 1ZYBA 2ZZQA 2WZR3 1GBGA 3NAUA 1ZA7A 4KIGA 4OUSA 2X48A 1UG2A 1HKDA 5DDJ2 4RGSA 2DCJA 5FO9B 4HOOA 4JDMA 3OYWA 2JDPA 3BIWE 4FFGA 4CDUB 3GJAA 4TLGA 1S5LC 3ZQFA 3FXJA 1S1AA 1JTYA 3HOXJ 4E7IA 2HEVF 1A36A 1HKTA 1A04A 3D4KA 2Q1MA 1Z77A 4CDWB 4BUPA 2OPTA 2ZGKA 4PJLA 2BGPA 1W2NA 2Y6HA 4P1WA 2ZMNA 5FY4A 3K48A 2FF4A 1RUJ3 4XBFA 4O6JA 1WZXA 3HKZA 1F1ZA 4ZDLA 1UYPA 1YI7A 2DJNA 3FXRA 2XKOA 3QPTA 1FSEA 4LA2A 5FO7B 2KR2A 1CGPA 3VZJA 2A69F 2WNOA 4X6RB 4Q5SF 4CDXA 1W6OA 3RPUD 1A35A 4XSXF 3Q8FA 1U3EM 2ZX0A 2E63A 4WX9A 5LRRA 1PX4A 1HC8A 2VUMJ 4QPIB 1XNKA 2EILH 2WNVB 1GKBA 1E3HA 3B73A 5FKCA 4BLIA 1TNTA 2BJSA 3TEYA 4RR3A 1GT0C 4C3IJ 4ZONA 2FDIA 3NNFA 1NQDA 2RV8A 3WTUC 4CE8A 1XGNA 5ILVA 1QKQA 2D6OX 2B39A 3IN9A 3VB2A 2F5DA 2QENA 3MZHA 1H9WA 3S3MA 1QMJA 1AU7A 4OI4A 4WM8A 2FD8A 1GP4A 1PDNC 3EYIA 5E1WA 3S3OA 1MVQA 3ZYIB 3VDDA 3PNTA 1OFCX 2PBIA 3AKSA 3WNKA 4EYUA 3F3XA 1PO13 4NDLA 5GM0A 2NVTJ 4DO0A 5AONA 3HBZA 1UCRA 5J96B 2DU0A 3LDBA 3W3CA 4L92A 2XHKA 2AACA 4DY3A 3SEPA 1YX5A 3VYTB 2MYSA 4AVCA 2XJTA 2O6GE 5FKBA 4N43B 4UOJA 1QPIA 3KEQA 3J81Z 1SFOJ 3SZPA 2XVLA 2Q8EA