1ZRFA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 64
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zrfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrfA01
4HLYA 3BWGA 3EDPA 5E8GA 3QAHA 5JSPA 1UHWA 1S7OA 3QU3A 1RL3A 1ZNPA 1IXRC 3D0SA 4U7BA 2Q4SA 1PMIA 1CAXB 2QBYA 1QZZA 3HHGA 1OYYA 4QGMA 2XLGA 3GVAA 1J0RA 4HVRA 2MBFA 5E1XA 1G3YA 4A5MA 5DEQA 2VBZA 2R7FA 4X6QB 4WXHA 3WTYC 1B1BA 1TNSA 3SZPA 4P96A 1UPIA 4IEUA 3WGGA 3FMSA 1XSDA 1WA4A 4WX9A 2PTMA 1T0FA 3ELKA 4HZFA 5CVRA 3ACLA 4FAHA 4P9FA 1S8NA 3FXUA 3KP2A 3IC7A 3TO6A 3FMQA 4YYOA 4ZU4A 2ETHA 1WLTA 1UFMA 3IHUA 1SMTA 4UVCA 3WTVC 4HF1A 2RC4A 2C6YA 1L3LA 3MZYA 2EB7A 3EETA 4HA8A 3JSOA 5A2QZ 2DLLA 3KEOA 2RKHA 4EVIA 1J5YA 2OQRA 4HYEA 4HBNA 2FMLA 3DXJF 2GXBA 2C0ZA 4D7SA 1KYZA 2P7CB 3R60A 1I5ZA 1KU9A 2JT1A 4E2QA 4LFUA 4HDVA 3O14A 1CAVA 3M8EA 4KWJA 3HSRA 2VT3A 2FE3A 3HOSA 3Q9SA 3FZ3A 1X3UA 5D4SA 2B0LA 4ZH4F 2HFHA 2A6HF 3HQXA 1UB9A 4M74A 1J58A 3EBRA 3KCCA 1ZRFA 4UV9A 3VFZA 4XF9A 2DTRA 1FBQA 1V70A 3AAFA 4UNOA 3QPHA 1W7PB 1JUHA 1SD5A 3MDPA 4O6JA 3ZMDA 3QOPA 2XKPA 4A0YA 1YO5C 4LLGF 3P9CA 2ISYA 4NVPA 3SFZA 4AWXB 4AVBA 4Q0VA 1ZAOA 4YARA 2PHDA 3GXOA 2GH2A 2GC3A 1ZRDA 2W57A 1V4RA 4FBFA 2HYFA 5HS7A 3S7IA 5LBQA 2PG4A 3WODF 2HOEA 2PFBA 4KU7A 2PBIA 4AQ6A 5ED4A 4L9JA 3BPVA 1G3TA 3K1NA 3LQRA 4LLOA 3LFKA 4L9VA 5ICFA 5LHGA 5FLXZ 4RAZA 5ILUA 4MV2A 4M73A 4OU0A 2CV6A 3KLOA 4YG2F 5DDGA 4MTDA 3ES1A 4UXAA 2QCSB 2VODA 1T38A 3BALA 1R7JA 1ZHFA 2A3SA 1ZH5A 2XLAA 4BQAA 1NE4A 1CX4A 3E6MA 2DPDA 4I0AA 2DI3A 1T98A 1QPMA 5FLJA 4BYYA 4X6RB 2HQRA 2XAHA 1BBYA 4AD9A 5JSOA 4R1HA 4ESJA 1U2WA 1YQAA 4IETA 5K1YA 2IT0A 3I7DA 3ZMSA 3HRMA 1JHFA 2QVOA 4HX7A 4AVCA 3PQJA 2NNYA 2NAZA 3MEXA 2NS0A 3MZHA 2EFNA 1FC3A 4AIKA 2EV6A 5C8WA 1FLIA 3J7AO 1FZPB 4EJOA 3I64A 3GX4X 1CGPA 2CW0F 2R7DA 1R1VA 5JR7B 3LAJA 2OZUA 3NKTA 5D5VB 5F1RA 1LVAA 2CAVA 1LEAA 3H1WA 4WF2A 4I09A 5AIPA 4L5JA 1MDMB 3HRTA 2DFIA 2QUFA 3KZYA 2HS5A 4H7LA 2PEXA 2P4WA 4YIFA 2DCTA 1R00A 2RVCA 2XL7A 2HEOA 4MGYE 3M3IA 1JGSA 1FPQA 3J81Z 4XFIA 5J8FA 2VBYA 4FX0A 3COAC 1W5SA 3QACA 3ETQA 3GYHX 2XV4S 5HLGA 2X4HA 3CEWA 2VBWA 2XAFA 3V8JA 1LNWA 2RN7A 4RB3C 2ADUA 2F5FA 4RGUA 2EV5A 3KGZA 1E17A 3GFMA 5FQ0B 5DCMB 1HKQA 1IN5A 1U78A 2K02A 3KFWX 3G7DA 3FZVA 3R0JA 3QPTA 1X7NA 1CF7A 3E6BA 4QGLA 1ZZ9A 2O0YA 2PQQA 2BNNA 1HXDA 2D1VA 3NW4A 4M6XA 4ENNA 1XCBA 1IN8A 2XKOA 3BP8A 4PGHA 1YTYA 2MLKA 2TDXA 4M72A 1OKRA 1EYBA 5HI0A 3DFGA 4WK8F 1UIKA 3BJAA 1ZVFA 5AIQA 5JR3A 2F4PA 3S2WA 2EWNA 2EA2A 1QNTA 1YFXA 3R6SA 2XHKA 1T6SA 5K5QA 2A69F 1W5TA 3GF2A 4Q29A 3OTFA 5D6EA 2K27A 4P9UA 4S04A 2BNMA 3ZMUA 4KYWA 1JXSA 5LGNA 1OYIA 4EM1A 4MH0E 1ZG1A 2EFOA 2DQRA 2ZO4A 5JVTA 2Z9OA 3KP3A 4KIFA 1S7AA 3SHRA 2M8EA 4Q0QA 4RS8A 1ZN2A 4XSZF 1FXZA 4RGXA 3WTSC 3F21A 1R1UA 4Z2YA 5HS9A 4KMUX 3I59B 1SEFA 3K9TA 1HKTA 5HLHA 3NJZA 5J3UA 3IKVA 2G7HA 4OIPF 4G8XA 3DKWA 2XLFA 3PLQA 3E3VA 2COMA 3WTXC 3C3VA 3UKNA 3I5UA 4XBFA 2VN2A 2V1UA 3MPBA 3U2RA 5I0RA 1FP2A 2YR2A 1TLHB 3LAPA 5BQTA 4L18B 1FP1D 4A0ZA 2VECA 2BV6A 5LRRA 4AIHA 1FNNA 2HYGD 2FBKA 3OD0A 1RZ4A 1X8EA 4PIXA 4L0ZB 1R58A 4HVQA 2ATFA 3JW4A 3VEPA 4EGYA 1CAVB 3I53A 4A6DA 1RGSA 2G7UA 5DV5A 1ZG5A 3LWCA 3HHHA 2JTVA 1ZLJA 2G9WA 4EQQA 2F5DA 2P8TA 3KMHA 1Q3EA 4K2EA 3O2PE 3EYIA 3RKYA 3I54A 2Z5UA 2L3DA 5FCCA 1F1ZA 4IPAA 5DCMA 4UXNA 1DUXC 2OZJA 1OYWA 2W85A 1USSA 4BXUA 1BC7C 4OIOF 2M45A 2QQ9A 5HLIA 5DCFA 1YW8A 1WGPA 3CDHA 1ZX5A 2GC0A 1LDKB 3B02A 4LB6B 1F4KA 5CVUA 3TOAA 1Z6RA 4Q4ZF 3BPXA 2PLYA 3NSTA 3M70A 1TW2A 4I7HA 1XMAA 2UYAA 3GLXA 4N9HA 5K5RA 5CLSA 4RGRA 1QGPA 3NL1A 1IAWA 2CYYA 1O4TA 1B6AA 1U8RA 3F8BA 5LLQA 1V3FA 3TDUC 3CUQA 5BV6A 1K78B 4Q0SA 1ZZ6A 1KU3A 1P4WA 3K1MA 2O3FA 2FSWA 3SQNA 2HR3A 2QQAA 2WC2A 5IT9K 5DD4A 1GXQA 4ZYGA 4G6QA 1BIBA 4I3PA 3U10A 2HTSA 2QM3A 4LK1F 1XD7A 1YFYA 4M71A 5HDGA 1BJAA 1XGMA 4JQFA 3JAMK 1YIOA 4BHPA 3U9GA 4HLTA 3LA2A 4NQWA 2UY8A 1UCRA 3H1YA 2LF8A 4A12A 4KL1A 3L7WA 4UVBA 4YFXF 2IXCA 4IJAA 3CUOA 1NE6A 4JTNA 3G3ZA 1SQ4A 2JRTA 3KP4A 3TO9A 1MKMA 1HSTA 1XGOA 1P92A 1D5VA 4QXKA 3M7GA 4OMYA 2D5FA 2GC1A 1LKNA 1YS6A 1O7LA 3UKVA 2Y75A 4EROA 2Z2SB 2DU9A 4MGZE 1F9NA 3PNAA 3SCFA 1TTYA 4IEXA 1QWRA 2ELHA 2IJLA 4BAYA 3DF8A 1SAXA 3TNQA 2HQNA 4OFGA 1FSHA 4I98B 4Z07A 5FFXA 3KP5A 5LEKA 3HSFA 4HLXA 2GAUA 3RKXA 3GYDA 4ENJA 1KU7A 4MGRA 4M9SA 2A07F 1PM7A 1YLFA 1O7FA 2X0LA 3K2ZA 3L9FA 2BE5F 1J3RA 2GWRA 4KT5C 4MGIE 1U5TA 3WTUC 4GYIA 3BJ6A 4CGZA 3V8KA 2HZTA 3WGIA 3G73A 4F7ZA 1LRHA 1QXJA 3CF6E 1RUOA 1KQ0A 3P9KA 4LG0B 1ONVA 2MA3A 4A6EA 4G94A 2ET7A 4ESBA 2L02A 4I0BA 3L09A 3CJNA 1CF7B 3FXQA 3DPLC 2EFPA 3K69A 4I02A 3L2CA 4JVAA 3BY6A 2XASA 1Z7UA 3DPTA 1GQGA 2O8XA 3IRRA 5BXXA 5KBFA 2UY9A 5JAXA 2Z69A 5FFZA 2V09A 2M30A 3WTZA 3V8LA 4O3MA 2D2WA 4QM9A 2IP2A 5CVIA 3WW2A 5L3BA 1XCVA 2RNJA 2YU3A 4KN7X 3EO6A 5CJ9A 1T39A 1BI1A 4UV8A 1Y3TA 1LR5A 3O6BB 1IUYA 4DINB 1O3RA 2FRHA 4KA4A 5LHHA 3H50A 4QMAA 4EGZA 1IZ1A 2Q2EA 1H1IA 2F2EA 4D0PA 2W84A 1K7AA 1K78A 1RC6A 4IEWA 1RI7A 4YNIA 5JI6A 4ZU7A 3T8TA 5BY5A 2K4JA 1FT9A 2UXXA 2XRNA 2PHLA 5J6XA 4XF1A 1IXSB 1DPUA 3NRVA 2PYTA 1TQ5A 2PAMA 2ET1A 4AXOA 2B8MA 1HBXG 3KSCA 1KA8A 2MPFA 2LDUA 2HKXA 1OPCA 2OD5A 2B9UA 4HN0A 2LF7A 4WXDA 1H9GA 4RAYA 1RUNA 1W7PA 1IN4A 1P4XA 1X82A 4AVPA 4JK1X 4KMFA 3FHZA 3DV8A 1R5GA 3WTWC 3K0LA 3IKTA 3NEUA 2H27A 4XSXF 5KVRA 2EV0A 3LWFA 2CG4A 2IXHA 2CO5A 5TRDA 4XFAA 3I58A 3CTAA 2ZKZA 3D0JA 1ZRCA 4G7HF 3T8RA 5H6RA 1HW2A 4LA3A 2GC2A 5BPDA 2HGCA 2H09A 2A6EF 3UKTA 1MJAA 2RV8A 2O03A 3M9AA 5LRSA 1MZBA 1EV7A 4WBBA 3TNPB 1J75A 1U5TB 5D1IA 2JPBA 2QDRA 2GQQA 1U12A 4PJYA 3LA3A 5BMZA 1GVJA 1XSXA 5FD6A 3M1EA 1YHFA 1OD5A 4ZYHA 2DBBA 3RDIA 5E1RA 3JAMZ 1DGRA 2KIFA 4LGWA 4RB0A 5E1WA 3D82A 1J1LA 4META 3H8UA 1B4AA 4HQEA 4RB2C 3E5UA 5ILSA 3ZPLA 3FM3A 2RGVA 4DQ2A 3ZN1A 4U7DA 4I01A 5J7MA 1R1TA 4MQVA 2QYOA 1FWZA 2CFXA 2FNAA 1IN6A 3SHFA 4L9NA 1WSUA 1B59A 1R36A 3CLPA 5EEGA 1VJ2A 5ICEA 1ZZ7A 3ISPA 3SZTA 1H1MA 4Z82A 2STTA 1CAUA 3USSA 5ICCA 4MUVA 2K9ZA 3C1DA 4IF4A 4EM2A 3TO7A 3HT1A 4U0VA 4KNYA 4BH9A 1UCXA 4IEVA 4EM0B 2D40A 2KJBA 4H0EA 4D7TA 1Z1DA 3DL3A 5JHUA 1LDDA 1XRUA 3H7JA 3F22A 5F64A 4L5IA 1U6GA 2H6BA 2I45A 5DUKA 2D93A 4QX5A 2WTEA 4HF0A 4WZCA 2P5VA 2VBXA 3TQNA 3KGLA 4XRFA 2OZ6A 2F5EA 2A61A 1J9IA 4J1WA 5FQ0A 3HOTA 4ENKA 4XFGA 4BHBA 1LEBA 1S29A 3BCWA 3B73A 5D5XB 4CICA 2FU4A 1FYMA 3GUDA 5JFRA 3GZ6A 1YFWA 1FX7A 5FD5A 2VE9A 4UHTA 2KIUA 3VHRA 3MAJA 3KZZA 4CHUA 2D1HA 3ROUA 4U88A 3WW1A 1LQ1A 5E18F 1A04A 2Y48A 2KJCA 5A2QK 2N7GA 4YRDA 3BOQA 3HTUA 3TKYA 4EWAA 1XGNA 1USTA 3U0ZA 3ZMTA 2Q0AA 2IXKA 4OOIA 2IRFG 3ES4A 3OCPA 5I0TA 2OPKA 2KXLA 5D5WB 1CAWB 4DNCA 3CO2A 3DP7A 5E17F 2K86A 3F72A 2XROA 4RB1A 1C0WA 2F5CA 2YSRA 3RJPA 4LUMA 3VOEA 4KN4X 1IPJA 3ULQB 5BPXA 1ZGJA 5LGTA 2H0VA 5K8SA 5KHKA 4HOBA 1DZTA 4KDPA 1NXMA 2O1QA 1G3SA 4PCQA 4LB5A 4XFCA 3N97A 3GW2A 4QWQA 1XDUA 1J2XA 1S6LA 1REPC 2A5YB 3RTRA 1AWCA 2FXAA 3REOA 3CUQB 1VTNC 2QLZA 5BOXA 3GWZA 2PAEA 2QJVA 3HTSB 4HAMA 2WV0A 2UWMA 1FOKA 2EFQA 4F8AA 5FB2A 3L2HA 2V79A 1Q5OA 1EH6A 1I6XA 3DN7A 3F8CA 4WVZA 1XSVA 4GCVA 3T1BA 2YX7A 3ZDSA 2D5HA 1GQHA 3WE3A 1TW3A 3WG9A 4LLLA 5LGUA 2IXLA 1RNLA 1GHCA 5FPXA 2ISZA 4M6YA 3JTHA 4HX8A 2Q0OA 4EWDA 4MGKE 4MTEA 4MZUA 3O3KA 1R22A 2QZ8A 4XLNF 2LNBA 1SD7A 2YPRA 2E7XA 3F6VA 4HV5A 4L2NA 2E1NA 2CAUA 2MD5A 4J1XA 1MD0A 4IERA 4KWLA 5CVJA 4M9ZA 5CVVA 2Z33A 1O3QA 2UZKA 1OR7A 2VC0A 5I8TA 1WRJA 4ORFA 2A68F 3WW3A 2ZCWA 2IA0A 2M5WA 3KE2A 2P5LC 1ZREA 2Q1ZB 1H0MA 1IXCA 1TBXA 3I4PA 1KQ9A 3CO6C 5EZWA 3HIFA 2Z99A 5KHJA 2PN6A 4Q0PA 4L9TA 2JZYA 3V7SA 2L4MA 4UVAA 2GU9A 4ON0A 4WCGA 1MGTA 4KICA 2HTJA 4IRHA 1S3JA 4XFBA 3VB2A 1WQ2A 3RKWA 1XE8A 3BU7A 3V4GA 2XAGA 1SFXA 4Q48A 2H94A 2OA2A 2AXLA 1QXRA 4IVNA 2E9QA 2GXGA 4XF3A 5L3GA 2XL9A 3HT2A 1O5UA 2DPUA 3RYKA 1ZZ8A 2FBIA 3P9IA 4GYGA 1BI3A 2EK5A 2K4BA 1PP8F 3F3XA 3FXRA 2PI0A 3IBMA 3GO5A 2R3SA 2IXJA 1HQCA 2FA5A 4P55A 3LQQA 4L0YB 2J5PA 3ML6A 4CDGA 3H92A 3HYIA 1CAWA 4Y17A 2O61A 4E2SA 2IVMA 1TQIA 2PFWA 4NB5A 4EMSA 3GEZA 5D6FA 5AONA 4ZZLA 2RDPA 4KFCA 1HW5A 3OGJA 2VOOA 2GZWA 4MHGA 1D3YA 3CO7C 1P2FA 2V9VA 3ZQ7A 1J3QA 3Q5FA 1D8KA 3E5QA 5DUIA 4Q47A 1QO0D 5KHHA 1G4DA 1SFNA 5CU1A 2XAQA 3C18A 4HVOA 3IRQA 1CAXA 1Z9CA 1YS7A 2AS5F 5TJJA 1ZARA 5FLXK 2ZKLA 4IEQA 1O5LA 4QM8A 5C6CA 5H6QA 3RZZA 4G9YA 2Q30A 2PAKA 4KUMA 3S7EA 1EH8A 1Z05A 3GFIA 4YSFA 4S05A 3EQEA 4PIZA 4TV7A 1W4MA 5IT9Z 2BGCA 3IIAA 2P7VB 5JSRA 2FBHA 1IW7F 5L3EA 4OLLA 2OAZA 1VR3A 5EFUA 2P17A 2GIVA 1BI2A 3GBFA 3R61A 3DQVC 5D4RA 1ZRRA 4NHJA 1CAUB 3BJOA 4MNUA 3C3WA 3SXWA 1X8MA 4XF4A 2B5HA 1EY2A 3MQ0A 3ELNA 2NYXA 4O5VA 1BM9A 3FWEA 5FO5A 4GO1A 3EYYA 1SFEA 4OMZA 4QLCU 4UBGA 1K79A 3EQLF 4HF2A 1J3PA 4MX3A 2GA1A 1LB2A 2STWA 4EJWA 1KQ8A 1BC8C 3FF5A 4A2UA 3DEUA 1KYWA 2ZFWA 1OFNA 3MFKA 4YFNF 2FQPA 4RGSA 5T3NA 2KIMA 4LG0A 1IPKA 3CUQC 2M1BA 2GA2A 5LHIA 3JZVA 3F8MA 3H3UA 3MYXA 1YW9A 1XDSA 5E20A 1E2XA 3OF1A 3BZ6A 3W6KB 3KP7A 2V1XA 3LA7A 1DDNA 5HS8A 1YFUA 1O57A 4ASNA 5KK1A 4U0WA 4M9XA 2OA4A 3HRSA 4GGGA 3IDBB 4RD7A 1XN7A 4IEPA 3PVBB 5HVQC 2OQGA 4U0YA 5HDKA 1DP7P 2ESHA 2VT2A 3LSTA 1H9TA 5K5OA 4ONUA 4B29A 1XMKA 4JTOA 2L4AA 4E2GA 1W7PD 3P7NA 3ECHA 3RIRA 1IRFA 3L00A 1ON1A 1PDNC 4MEYF 3GFJA 4LEJA 5HDNA 3HRUA 1FSEA 4A0XA 4CYDA 4LULA 2XUBA 2WFPA 2V6CA 4Q5SF 2JSCA 4R79A 2O8QA 4O9GA 1UD1A 5DYMA 1DPRA 1GXPA 3FM5A 4O9EA 5F6FA 1NHAA 1B9NA 2VXZA 3ST7A 1MJBA 2QQBA 2ZXJA 2MH2A 3NQOA 2W25A 1ZGAA 3ABUA 5H20A 2YX4A 4R52A 1O3TA 3E97A 2W24A 2MNGA 3LAGA 3ZN0A 2NNNA 1K6OA 1F5TA 4PIYA 1IN7A 3WTTC 1YUDA 1FY7A 2M87A 4EJVA 5D5UB 2ZJ2A 1BN5A 3U1DA 5BUVA 2K0GA 5LEJA 1WI9A 3IDCB 3M8FA 2Y0OA 2VC1A 4HMZA 1UHMA 5CYVA 3BB6A 4ETSA 3HUGA 4KU8A 1JE8A 3F6OA 1AOYA 3F8FA 4XLPF 2CGPA 4XETA 2V1DA 4HDUA 4UUVA 3NVCA 1I1GA 2Z3YA 2FNPA 1G6NA 3OV8A 4LA2A 3V7RA 2EFWA 5EEHA 1QBJA 1OI6A 1R23A 3FX3A 5FLIA 3D5LA 3T0YA 3E5XA 4L11A 5I93A 4AQ2A 2FOKA 1LDJA 4IXAA 4QGNA 4G7ZF 2VE8A 1SMYF 3E6CC 2ZMEA 4KIBA 4UBHA 2ZNZA 2UYBA 4HSLA 3WE2A 2DQLA 3Q9VA 2P5KA 2DW4A 1WKMA 2BYVE 3IWZA 4EWEA 3KLNA 3SXYA 5KHGA 5E1ZB 2IW5A 4IESA 3WU1B 3EJKA 4HX4A 4XFHA 3J80Z 1ODDA 3RNSA 2JPCA 3ZMZA 4CZZA 3VODA 2QVSB 1HW1A 1O3SA 2IXIA 3SCGA 5JCTA 2MC3A 1BIAA 1MJ9A 3F8NA 2CQKA 1EP0A 4IRGA 1PUEE 2ETEA 3OOPA 3J81K 2VONA 3EHKA 3FJSA 3RPUA 3N4MA 3ZMVA 4CXFA 2XIGA 3ERED 1JHHA 2XVCA 2LSOA 3KP6A 2BNOA 4HQMA 4N0BA 3I0TA 4WXCA 5I8YA 1YYVA 2LKPA 2OU2A 2P6TA 2H6CA 3QU6A 4MEXF 1BOAA 1G3WA 5J8CA 5AVPA 3PQKA 4BHCA 2IA1A 5I0SA 4JBAA 3BROA 3WGHA 3J80K 2D45A 2XGXA 2HDCA 1ZZBA 4HN1A 3V7CA 2Y0MA 4GULA 5I91A 1T2KA 2DK8A 4LJZF 1QQIA 3U11A 2DAOA 1XE7A 2VQAA 4ENMA 2PJPA 1TQPA 4KWKA 5CADA 1Q43A 3H7YA 3JTGA 3ABTA 2HJIA 2PA7A 2BEOA 3FE5A 3WU0A 4K8FA 5ERIA 4PZJA 1J59A 1Z91A 4P9GA 2EJRA 4XF0A 3EUHA 1YFHA 1YLLA 1TNTA 4HBLA 2P6SA 2QNKA 2ACJA 3S0MA 3FFQA 1WWXA 3ZP5A 1HKSA 1UIJA 1PP7U 4B09A 4IHTA 4ZU5A 4R8HA 3E6DA 4FT8A 2WWYA 4HSJA 4G7OF 4OIQF 2KRFA 1ULYA 1QY4A 2XAJA 3RYPA 3FMRA 5FLHA 3KETA 4HW0A 2BBYA 3CLOA 1MDMA 1QZYA 4LK0F 5J48A 2MLGA 2PQ8A 3JSPA 1Z6TA 3TGNA 4LD5A 4LTAA 3LOIA 1I27A 4PDKA 4BNCA 3ECOA 5ILVA 1P4AA 1U5TC 5E16A 2RQPA 5KHIA 4Y13A 3BPZA 4EV0A 4N9IA 3CL1A 5L3FA 5L3DA 1ON2A 2VPVA 4FHTA 2EAAA 1ZYRF 1RTVA 1NZCA 1FBUA 1FYLA 5DD8A 1RIOH 5I8SA 4AVAA 4YFKF 2L01A 1L0OC 2ZMEB 3RYRA 2MH9A 2QBYB 4HV6A 4GXOA 3R0AA 4LMYA 4Q0UA 3MWMA 1L3JA 2UXNA 3IL2A 4A5NA 4EJTA 2EA7A 3WW4A 3PFIA 3H3ZA 5FGMA 1OMIA 4I2OA 1Q1HA 4OIRF 3HSEA 5E8IA 1BI0A 4LLNA 1Y0UA 5ICGA 4JV4A 1U3EM 3CJXA 3RPQA 4AIJA 1KU2A 2ESNA 5FPZA 2MHFA 3C7JA 3IWFA 4YIIA 2CWEA 5BPIA 3BDDA 2NRAC 1FI2A 1IF1A 2ZBKA 3SMHA 1ZG3A 1KGSA 4IEOA 1STZA 2FF4A 4KIGA 4ZYEA 4BIFA 5I0UA 5D8LB 2EA4A 3MCZA 4MQ9F 6PAXA 1D8JA 1ZLKA 4TLFA 5D8KB 1HSJA 1EH7A 2K7LA 3I71A 4WWCA 3QRFF 1DZRA 2HWVA 1UW8A 3TOBA 2IA2A 2E1CA 2DT5A 1I1SA 2CSOA 2EVXA 4XEZA 4ZYDA 3RI4A 3I59A 5FDBA 1YG2A 5IT3A 1J7KA 5BS6A 3GFLA 4IHSA 1B9MA 2KKOA 4PGGA 4OINF 2E7WA 2Q8KA 3TDZC 5HOOA 4LUKA 2O6GE 1XGSA 3QP6A 2QWWA 4XFFA 2OBPA 1YW7A 1P6RA 2ZNYA 4Y15A 1LJ9A 1R5HA 2PMHA 4IRIA 2HKOA 3SCHA 3H1MA 4IEZA 4EJUA 2OYZA 3KEQA 3GZ5A 2J5OA 4IEYA 2IC1A 4ESFA 1FYKA 4B8XA 4CO8A 2L54A 1DGWA 2DK5A 1XB4A 1EPZA 3K1PA 4G6DA 1SD6A 3T5XA 1TQMA 2FQ3A 3LZZA 2PMUA 5L3CA 3W6JB 1SFUA 2DO7A 1IRGA 1VP6A 4FAGA 3QP5A 2FEZA 1SD4A 1FBSA 2FMYA 4FX4A 3FHIB 1Y9QA 1YWKA 2QENA 4P5OA 3R4KA 4E70A 2VOPA 1NYWA 1ZZCA 3F23A 2IPQX 4ZZDA 3H9AA
chains in the Genus database with same CATH superfamily
3QAHA 1MEC1 3AG1H 1ZR2A 3F95A 1UHWA 2ZJPF 1RL3A 5GPAA 3PDQA 1BA5A 1IXRC 2VKVA 3BR6A 2R0HA 1PMIA 2NMNA 2QBYA 4AVTA 4QGMA 2VJIA 2RM23 5LK7B 5IYBJ 3ZMNA 4ZXKA 1YCIA 3C7HA 3RZMA 2VQGA 5DEQA 3D6EA 5LK5A 2SBAA 2AEZA 3C2GA 3VBFC 2E35A 1VMJA 2R7TA 2RDNA 4PBPA 3ZYRA 4IHWA 3CZJA 4CH7A 3ELKA 2OVUA 5CVRA 1VRH1 5BNNB 1N1YA 1MS4A 3FXUA 1OLQA 3FMQA 4DYRA 2UWAA 1UWWA 4Q4X3 4YM3A 3I2HA 1UFMA 1NCRA 3IHUA 1SMTA 4HF1A 4CDXC 3DXTA 1UX7A 4KBBA 3CMMA 1HB3A 3EETA 5A3WA 1SLAA 3W2WA 2Z4FA 2DLLA 2XB0X 4H14A 2RKHA 1YRNA 4AIDA 2AUYA 1B8IA 1A6CA 2QQIA 3VHNA 4I30A 1I5ZA 1KU9A 1L7LA 3AKRA 3DKQA 5IATA 3AKZA 1CAVA 5A6QA 4BB3A 1W2TA 3M8EA 3U21A 3HOSA 1AHSA 5L9VA 2JJ7A 2BY2A 3UYJA 5J98B 3HQXA 3BG5A 3OS2A 3KCCA 3R4UA 2DTRA 2VZTA 4B48A 1JUHA 2DA6A 5C7GA 2JDAA 1SLIA 2ZGQA 4D3WA 2WAQA 2XKPA 4NIIA 4A0YA 4AI3A 2VG9A 5GZCA 3OYNA 5JUVA 4XKCA 4Q0VA 2KP6A 3OPWA 1P7IA 3FMGA 2HXIA 2XVKA 4HT1T 1TNRA 4FBFA 5HS7A 2HOEA 5LD2C 3EXUA 4LOSA 1ULFA 4L9JA 5FP8A 3K1NA 1K61A 2R7ZJ 2XONA 5ICFA 2GALA 1F5JA 1W9TA 1H8VA 4MV2A 2D6LX 3RZDJ 4YG2F 4MTDA 3ES1A 2WQ4A 1JKRC 2VODA 3BALA 2A3SA 2VMHA 2ELKA 2VW0A 3T0DA 4AI8A 1OQEA 4OI4A 1T98A 4F55A 1RIRA 1N3QA 4A7YA 2ECCA 1WBLA 4NO4A 3PUIA 1RUI3 3RZKA 4PJMA 2QVOA 1Q8PA 5FYHA 3WHTA 3G6EI 3KHCA 1JW6A 2ORZA 5A3OA 2L9NA 3OB8A 2NNYA 2NS0A 2NYYA 3HQRA 4LBLA 2RREA 1UQXA 2NVXJ 2VCBA 2XF7A 2NVYJ 1VB2A 3WEZA 2CW0F 2R7DA 5JR7B 3LAJA 1LOBA 1HOMA 3HEIA 3HUGB 2R5ZA 4MOAA 4WF2A 2F6BA 9ANTA 5IVYA 1D0XA 5EZHA 3T0AA 1WJBA 1ETVA 1Y8RB 2PEXA 4FTBA 1S0GA 4DEQA 2FCUA 3M3IA 1JGSA 4DOUA 3J81Z 5CKQA 1AR63 3L2YA 3AYCA 3QACA 2VCCA 3GYHX 3ETQA 5HLGA 3CEWA 4RGUA 2EV5A 1HQNA 3SC7X 3GFMA 1XC6A 1VI0A 1OFCX 5DCMB 3SYTA 1HKQA 2VVEA 4LITA 4LNVA 3K70D 2EIBA 2HQAA 2JDZA 1DQUA 3Q0VA 4FTSA 1PGSA 5ERLA 4DGWB 3PU3A 1CF7A 3E6BA 5GAGJ 4NOTA 4QGLA 1WJFA 5M5WJ 2BNNA 2DJNA 5JXIA 2D1VA 1GICA 2MLKA 5T5JA 2EZHA 4WK8F 1R083 4OYUA 1NQDA 3K4KA 4ANJA 3KVAA 4CXWA 1K42A 1PZ8A 5AC92 5C71A 3OIQA 2XHKA 1T6SA 2CQ7A 2LY9A 2A69F 2YUSA 3BTZA 3GF2A 1W6QA 3BIEA 4Q29A 1GOGA 4AYBN 1A35A 2JECA 5D6EA 3OD4A 3WDVA 4KYWA 4U87A 3S1RJ 3LDBA 1JXSA 5LGNA 1WJ5A 1OYIA 2CW8A 4X8NA 2EFOA 1F5FA 1R082 1STMA 3ZOIA 3OYWA 1X2NA 5IPAA 3I3BA 1EAH3 1FXZA 3HOWJ 2V1NA 3LB9A 1XQNA 3LDRA 4KMUX 4DQAA 3I59B 1W2UA 1SEFA 3K9TA 4CA0A 5F9TA 3E1SA 3UT0A 1LECA 3N9LA 3IKVA 2G7HA 2I74A 4BKXA 3FHAA 1W6PB 2JUGA 2GDFA 2X1DA 3CJRB 1PO22 4H4KC 3N9QA 2WA3A 4A3DJ 4XBFA 2V1UA 1C8M2 3MPBA 1U9NA 2YMZA 2YR2A 5JI7A 2NOGA 4RGKA 3PL0A 1FP1D 5CA6A 4JGYA 2XGDA 3LL7A 5F3EA 4XMYA 4DUVA 3CCUI 3CF2A 1R58A 3I53A 4A6DA 4C2TA 1W5CC 2EXIA 4XHXA 2JTVA 5F0FA 3KMHA 3FIWA 4CEWB 2VJ4A 3ZXKA 1UOBA 5L36A 4M6VA 2L3DA 5FCCA 2XQRA 4UXNA 2OZJA 1OYWA 5JMOA 4BXUA 4OIOF 3K4ZA 2QQ9A 2DOAA 1XSQA 1SVOA 1WGPA 3CDHA 1WUVA 3TBIA 1POV3 3LDKA 4MO3M 4DY3A 3G1MA 3FXLA 4Q4ZF 4NC7A 4LBNA 2W47A 1YX3A 2M0MA 2PLYA 2VR4A 3AFGA 1N1SA 3OSGA 2JE7A 3NSTA 3T2QA 1TW2A 1W9WA 3N36A 1WHUA 3PSFA 4N7IA 2ZMNA 1DYKA 1S0DA 4LT5A 1QU3A 1QGPA 3VWBA 1ENHA 1S0IA 4RAGA 2R16A 3N9NA 2D3RA 1MS0A 3K46A 1S0CA 2OIIA 4QPQA 3VD7A 3OR2C 3MKZA 3VZLA 3FLTA 3TDUC 5DG1A 1NZIA 3T2OA 1DU3D 3HJEA 1ZZ6A 3GHMA 1JZ2A 4PLMA 5DAXA 2HR3A 3ASNH 4BU2A 2QQAA 1X3ZB 2C9AA 1GXQA 5C4WB 3ONQA 5K7HA 5CNAA 4I3PA 2VMIA 4OVEA 5IVJA 2QM3A 5LASA 1U5IA 1PMHX 1BJAA 3CNAA 4HLTA 1GWLA 4KI5M 1YI2I 3ZCOA 3BIWE 2V26A 2LF8A 4A12A 3JRFA 1WI3A 4KL1A 3VDAA 1KRIA 2ZOEB 3AP7A 2J7MA 3V0BB 1SQ4A 3SKJE 2Y9YA 2YY1A 1EUUA 1XGOA 4NIAA 4QXKA 2D5FA 5FXXA 1G8XA 1AX2A 4C3IJ 2R7RA 1Q56A 3E7LA 1LKNA 1UKRA 4M3FA 1WCMJ 2Z2SB 2RDSA 3UNPA 5A7NA 3HPGA 2DA7A 3VPRA 2E7AA 1TTYA 1GWKA 1QWRA 4S2DA 4BAYA 5FYBA 2IGOA 2QTWB 4Z6YA 3K4AA 4Z07A 3HSFA 2WZPP 4LKEA 2QKDA 4ENJA 2E53A 4MGRA 3ZN6B 4V2WA 2X0LA 3K2ZA 2V7FA 1J3RA 3OL3A 1UY2A 4QPIC 4CZSA 4LKFA 1Z78A 3V8KA 2HZTA 4F7ZA 1RUOA 3P9KA 4A6EA 2MA3A 1C3HA 1EV11 2VPLA 1N3PA 4I0BA 1OCPA 2NPIA 3ZFFB 3DPLC 3H8RA 3CJTB 3K69A 3UV9A 4XCAA 4II2A 3BY6A 2GBYA 1Z7UA 3O1OA 1GQGA 2FBEA 4IE7A 4AFBA 2O8XA 1V9U2 3OYCA 4XQFA 3VBSA 4AEMA 2JE9A 5KBFA 2UY9A 2WAEA 5FFZA 3MICA 2QQNA 4B4QA 4YG6A 5FWJA 1QDCA 5CVIA 2O8OA 5L3BA 4KG0A 3SITA 5F7UA 2E33A 2WS91 4JX0A 1I9RA 5LHHA 1JYVA 1ZQ3P 1MS8A 1IZ1A 1VBC3 4QAWA 1RC6A 1SANA 1RI7A 4XZPA 1W39A 4XNFA 3CKHA 5ABJA 1XYOA 4KQ7A 5L9RA 1X1DA 1QJU2 4XLHA 3CCQI 1IXSB 1DPUA 3NRVA 4HPKB 1TQ5A 3BI3A 4MG2A 5M0TA 1XBFA 1KA8A 4QB1A 2LDUA 1OPCA 4WXDA 4MFEA 3QBQA 1IN4A 2C24A 4AVPA 3I2IA 4D5FA 1NOVA 3S16J 4Y1XA 1QJEA 1AF9A 5FP7A 2OPTA 1ND3B 3WNKA 1SG3A 3DV8A 3WTWC 3HWJA 4A3EJ 3NEUA 1IV8A 3DYMA 5IFPA 3I2FA 2IXHA 2CO5A 1A8MA 2JDHA 2HVQA 5TRDA 4XFAA 3V64A 1RUI1 2ZKZA 1ZRCA 3VSKA 5H6RA 1HW2A 3PTRB 2Y0SN 4LA3A 5D8AA 5DDJ2 2W1OA 3LEGA 3A03A 1O59A 1BEV1 3PIGA 3UKTA 2DU1A 3M9AA 5LRSA 1MZBA 2NMOA 1NA1C 2HWF3 2BBAA 5D1IA 2GQQA 1U12A 4NR1A 2WZR3 4QPGB 4S0HB 3S57A 4YFWA 2DMUA 3M1EA 1YHFA 2BZDA 2GMPA 4QPWA 3ZFGA 2DBBA 5A6ZA 5E1RA 4QPYA 2DODA 1EF4A 2JXAA 1ETOA 4HQEA 1W06A 1JTZX 1AR61 2DFBA 2HVRA 1ORKA 5C9AA 4FISA 1T95A 3N9OA 4AYUA 1OXCA 4L9NA 5E89A 1IGOA 3HGGA 5ICEA 4Z82A 1LFBA 2X5IB 3Q8BA 2DUPA 3ME2A 2JUCA 3A0HC 1GFF2 3C1DA 4QT6A 4XVHA 5ACA1 3TO7A 3HT1A 4LMFA 3SQOA 1XOYA 1VBE1 5A7WA 2D40A 1IKQA 3SLIA 3ZFEC 4CDQC 2KJBA 5FFOC 1Z1DA 5JHUA 1U6GA 5F64A 3DBHB 3JRIA 2JA6J 4CP9B 1KFUL 2D93A 3VKLA 1HQLA 4XN0A 3FFZA 2HWD1 4YG0A 2LD5A 1OQYA 3VL8A 3SZGA 3HOTA 4GIQA 4YVWB 1D1BA 5FZHA 3AL5A 5EXOA 1GDTA 4CICA 1K6YA 2QF7A 5JFRA 3GZ6A 5FUNA 1PNFA 2A3XA 1FX7A 1PGW1 2VE9A 3EUAA 4OHZA 1OA2A 4NHLA 1DCSA 3VHRA 3MAJA 1HXS2 4YZ4A 1NK2P 1OVPA 5K7ZA 4CHUA 3RZLA 3ROUA 4FASD 2KM2A 2RS31 2BXZA 5A2QK 2ENRA 2W92A 2XJVA 2VMEA 3HTUA 3GBWA 4OHWA 3U0ZA 2L7MP 4OOIA 3OCPA 4RQPB 2GM4A 1DDLA 1DYPA 3O1VA 2Y9ZA 1TMF3 3F72A 3TEZA 4RB1A 3VD5A 2F5CA 2PELA 3PSIA 2OKXA 2CUJA 5BPXA 1ZGJA 2H0VA 5FY0A 4HOBA 4PCQA 2WB1A 1T8IA 2CNAA 4E4ZA 3N97A 1DGWY 2WNVB 4QWQA 1S6LA 3RMXA 2IS1A 2W1UA 4COWA 2VVFA 4BWOA 1NY71 2M2EA 5BOXA 5EYYA 2MEV3 2UWMA 1Y39A 1BW6A 3L2HA 4FVVA 3V42A 2VC9A 3IAQA 3VBFB 1QJZA 4XOPA 2CW7A 1EH6A 1I6XA 4A6SA 5DMYA 4RL7A 3DN7A 1XSVA 2DT7B 5BNPC 1VQNI 2YX7A 1DQ1A 4D7YA 2GXAA 1GQHA 4UAPA 4XTPA 1TW3A 2JRMA 1H6YA 5EJ1B 1RUF1 2IXLA 3PFYA 1C5HA 3ZYHA 4RAFA 1CZTA 4ZPIA 4EWDA 4MTEA 1NLQA 4IOAF 1R22A 2WT1A 2LNBA 1FV3A 2YPRA 4HV5A 1H2LA 4XMIA 4BZ4A 4M0NA 4Y1ZA 4J1XA 4ASMB 3ASOH 4HG2A 3OYLA 4IERA 1RVF2 4JZRA 5CVJA 3H5AA 4F52A 1O3QA 1VQPI 4CUGA 1V5FA 1WRJA 2L7KA 4LKDA 2UV1A 1RR8C 4AFAA 1OT5A 5HBAA 4H3WA 1U9OA 2Q1ZB 4XLFA 3GGLA 2KZGA 1LNSA 2Y31A 3PMEA 4Q0PA 4L9TA 2JZYA 3NRUA 1FOWA 4UVAA 4ON0A 5EG0B 2HTJA 2EZKA 4OUEA 4XFBA 3RKWA 1XE8A 1FNYA 5FIXA 3V4GA 3JBG2 4CEYC 1UY4A 2HWF2 3T09A 1BEV2 3CCEI 2AXLA 2MYSA 2P6HA 3BKZA 1QXRA 4AF9A 4IVNA 4XF3A 2WQ8A 3M2MA 2XL9A 2RJ2A 3RYKA 4LHNA 3I56I 1PIV3 2PHTA 5GLWA 2W7NA 5FR3A 2EK5A 1POQA 4J19A 5FYZA 3FXRA 1QA6A 2FZ2A 1JT0A 5G05L 1UKGA 1W3XA 4MGQA 2FA5A 2GNTA 3S30A 4UW3A 4JHTA 2CDOA 4R4XA 4RQPA 1WPKA 3POSA 3CBNA 3H92A 1CAWA 1IO2A 2IVMA 1TQIA 3GTPJ 5G04L 2XBO2 4NB5A 2RDPA 1HW5A 3NAPB 1HA8A 3HBKA 5IUQA 1URXA 2LR8A 4AVSA 1D3YA 1W8WA 1P2FA 1SFYA 5FKMA 1LU2A 3Q5FA 3ACFA 2H8RA 4GJYA 5DUIA 1QO0D 1G4DA 4C9YA 3ZVXA 5CU1A 1H9WA 4HVOA 3OJBA 4FE4A 4Y52J 3ZPOA 1VAMA 3WD5A 2ZGKA 5TJJA 5FV3A 4QM8A 5J3LA 1WW6A 3S7EA 3FXMA 1Z05A 4YSFA 4WV8A 3WG2A 3PUHA 2ERFA 3RMYA 3MMYB 4N43B 1PK6B 2C1FA 2FMDA 3IIAA 4A3CJ 3SFIA 4OLLA 2YG0A 1UMIA 2GIVA 1JI8A 3GBFA 3R61A 3WXPA 3A0BC 1HIXA 2GOMA 1HRV2 2Y0IA 1WMDA 3C3WA 5LZ6A 4MHRA 4FCAA 2WNUA 1ODMA 2VW2A 4XMAA 2W52A 1IS3A 3H8XA 1BM9A 1RUH3 5FO5A 3GF6A 4GO1A 3EYYA 1GZ9A 1SFEA 4OMZA 1JOJA 1A31A 1MMSA 2GA1A 4HRIA 3NWKA 2OX0A 4AHWA 4XLAA 1REFA 3I3QA 4SLIA 2YBKA 4Y26A 4NIDA 3B94A 4DZJA 1B35A 4JDOA 5T3NA 4OI0A 2UWBA 2KIMA 3FXOA 5T5PA 1BMV1 2CU5A 3VBHA 4FQZA 4E4SA 5K7PA 1YW9A 4IV1C 1E2XA 5J1RA 2A1XA 4CDXB 3LA7A 4M9XA 2OA4A 1AZDA 3IDBB 4DXSA 2DA1A 1X19A 4QX3A 5JOYA 1XN7A 4PDWB 3WQ7A 4OQ8A 5HVQC 3JBG1 4U0YA 1AHDP 2ESHA 4EQVA 3G1OA 1NG7A 5K5OA 3M1CA 2KT0A 3Q8FA 3HC7A 1X1AA 3WSOA 3L00A 4A3MJ 3VN4A 1RMU3 4AI2A 4LEJA 1CZSA 1AKHB 3HRUA 2D6PA 1FSEA 3NV1A 2YBSA 2V6CA 2WFF2 2JSCA 2O8QA 4CUCA 3OYMA 1UD1A 1HDKA 5JPMB 2DYRH 1GXPA 2L5QA 3FM5A 3OS0A 3AMPA 4C0BA 1JU4A 1Z67A 5F6FA 3GTJJ 2XJTA 5FBJA 1SFKA 4XRMA 1MJBA 1QVUA 2Y64A 3NQOA 1TMF1 1WW5A 5F5AA 1ZGAA 2VO5A 2WDBA 3AX4A 5DQ0A 4CTEA 2JICA 3TOJA 4NUBA 3OY9A 2CQQA 2W24A 3HPHA 4MGTA 3LAGA 4RHV3 1DGLA 4BL0B 2NNNA 3HN1A 3MEPA 2WIIB 1IN7A 3OGSA 3WTTC 1NA1B 4EJVA 1YUDA 2AGSA 2ZJ2A 3GM8A 5BUVA 1IHMA 1FX5A 3VBOA 1QJY1 5LEJA 5EP9A 3M8FA 2VC1A 2WL1A 1UHMA 3G2BA 1JH5A 4FFHA 2O0OA 1AOYA 2BY3A 4U2AA 5BNOA 4BQ3A 5FY9A 3ZSJA 1MH3A 1YRNB 4QKBA 2HLEA 4OZXA 3BUCA 1G6NA 4LA2A 2IZWA 3OWTA 4JQTA 3UGHA 1OI6A 4AUXA 1JXNA 1X58A 2ZGPA 3D5LA 3E5XA 2DA5A 2YC0A 5FJ8J 4K20A 1D0GA 1TE1B 2EIKH 5LY2A 3W9AA 1SMYF 3F9KA 2ZMEA 2YPJA 4R9BA 2ZNZA 2PHWA 1FEXA 2EAKA 3Q9VA 2P5KA 4RM3A 3KLNA 3BYWA 5E1ZB 3WU1B 3PNTA 2XBO1 4HX4A 4LPLA 4XFHA 4HPQA 4CZZA 2WNUC 3VODA 3VBUC 2QVSB 1OURA 1IQDC 4GH4B 1ZBE3 4N7UA 3BTJA 3SCGA 3O0WA 2HQ5A 1MJ9A 3F8NA 2PQSA 3PJQA 4ISQA 4DB5A 5C9AB 3J8F3 3J81K 2HNHA 3GZAA 4XILA 1ZGWA 1CIWA 2C26A 3ZMVA 4XKWA 2WO2A 4XDQA 2B7YA 1R092 1LEDA 2XVCA 4YVWC 4HQMA 5HXVA 2X5IA 2LKPA 2OU2A 3NNJA 4CCLA 4OI1A 2P6TA 1IC8A 4GJZA 1XSRA 4MEXF 2X8KA 2VY0A 2FHRA 5J8CA 3PQKA 2IA1A 5I0SA 3WGHA 1R4NB 3J80K 4EN0A 5FKCA 2XGXA 3OPTA 3V7CA 2VQLA 4E7LA 1QQIA 3I9V2 3DEWA 1LOFA 1XE7A 2VQAA 3OSFA 2FDFA 2ZA9A 5GM0A 1JZ8A 4XLEA 1QOOA 1TQPA 4KWKA 2Y69H 1GBGA 1LFUP 5FRNA 5BNNC 1FOXA 2PHFA 3OL4A 1M4WA 3DGTA 3TB0A 1RUC2 5ERIA 1WCDJ 1W8FA 2HWC2 3T4VA 5GAHJ 3MV01 1SBEA 2YC4A 2P6SA 1YO8A 4CPBD 1GZTA 3ZP5A 4QPIB 3TL4X 1UIJA 4FO9A 4ZU5A 2QFEA 3E6DA 3G71I 4HSJA 2XAJA 5D2AA 1QJX3 4QQHA 2BFUL 4MFDA 3JSPA 3AP4A 1X3WB 2V5DA 3RQ4A 2A6WA 4LD5A 1Y43B 4PDKA 4BNCA 2OUMA 1UX6A 3K75B 3QH7A 2WINB 1VBD1 5E16A 1E5IA 3WDXA 2R072 4Y13A 4EV0A 4N9IA 5L3FA 2QSHX 2W1QA 4NIHA 2YUEA 3CHXA 2P6CA 1AX0A 3NKGA 1RTVA 1FYLA 3VBRA 4LKSA 2BP6A 1XC5A 1LFPA 1L0OC 2ZMEB 3MIGA 5F5CA 3EYPA 3AL6A 4GXOA 2AACA 1YI7A 3R0AA 3BGAA 4DS0A 2WY8Q 4D5CA 3IL2A 1T6GC 5FYTA 2EA7A 5CBLA 3P5JA 1VBB3 2KDOA 4E4DX 1Q1HA 2LP0A 3O1RA 2XJSA 2M4GA 3A7QA 4LLNA 2HWF1 5FO9B 2BY1A 3IT8A 1RESA 3CJXA 3DPUA 2YV8A 5KCMA 5FMCA 2CWEA 2QQ8A 3PM1A 3W5NA 3RQ0A 1ZM1A 5JZGA 3IV5A 3VL9A 2J1SA 4KIGA 4ZYEA 4C8DA 5D8LB 2EA4A 4OWRB 2A6TA 2IWGB 1ZLKA 4TLFA 5D8KB 1COV2 3ZXAC 1HSJA 5EJCA 1UZZA 4YWAA 4GB31 1ULGA 2LK2A 3CLQA 1QJY2 1G8WA 1VRH2 4WWCA 5FPLA 1RUH2 5HNFA 3MLKA 2V72A 2IA2A 1KDMA 2Y6FA 2PMZN 4JX4A 1YHQI 4TSVA 2VZVA 5FDBA 3WG7H 1S0EA 3KV9A 1H9PA 4BEHB 4MHUA 1YG2A 5IT3A 1BLZA 2A7AA 5H9SA 2E7WA 2Q8KA 1R71A 1AR81 4LUKA 3QP6A 1H8TB 2JG8B 4XFFA 1ULPA 1YW7A 4Y15A 4J01A 4IE4A 1GNZA 4M01A 2OUHA 4IRIA 2HKOA 1W8OA 5BNQA 4JDMA 2DA3A 4EJUA 4ASLA 3S6PA 3GZ5A 1QOTA 5A3LA 4IEYA 2VULA 2LBFB 1FYKA 4TWTA 3OBRA 2X10A 2L54A 3A23A 3DXUA 1ETKA 1SLLA 3OUJA 5A6XA 5JI9A 4K7JA 3K1PA 4XZUG 5EPAA 2XGEA 2WSUA 4N90A 1VNDA 3W6JB 1SFUA 1IRGA 5FAXA 4PJNA 2WQZC 1H0BA 4FAGA 1W6QB 3TYJA 4AEDC 1FBSA 2FMYA 1Y9QA 1YWKA 4CEWA 3B6CA 1K4SA 3F23A 4ZZDA 3S1QJ 5E8GA 2IGNA 1UZ0A 3A01B 4Q1PA 2BPA2 3A0KA 4DZGA 1G9AA 1CAXB 3K51A 1OYYA 4M00A 3GVAA 1PO11 2MBFA 5E1XA 1G3YA 3U07A 4A5MA 1JGGA 1DF0A 2R7FA 4X6QB 2ZGRA 1TNSA 1UG2A 4WM8A 3SZPA 2LOOA 4Q4Y1 1UPIA 3ZXSA 3FMSA 1XSDA 4OUSA 3ZYPA 4W4ZA 1AJOA 1K4TA 1OCTC 4A69C 4P9FA 1WLCA 4FFGA 1ETQA 4GKYA 3KP2A 3TO6A 4LHKA 5HCBA 4AYBA 4FETA 4PSWA 3WTVC 2C6YA 1L3LA 2W00A 1NCQB 1FTZA 4HA8A 3JSOA 4L99A 2AEYA 2F5VA 2FDKA 4HBNA 3AZXA 2GXBA 4D7SA 3B93A 3R60A 1UOJA 1LU1A 4CU9A 1WGXA 4P1WA 3IH4A 4HDVA 3OYHA 1U5ZA 2XWJB 3HSRA 3H0OA 5D4SA 1CD3G 3POJA 2UU8A 1B35B 2HFHA 1TNFA 2A6HF 3FHNA 5DZFA 3AMQA 3OOXA 2XRLA 1ZRFA 4XF9A 2WYFA 1V70A 1W7PB 4QQOA 1UMHA 2QQOA 1SD5A 2HYJA 2K85A 3MDPA 4O6JA 3OYEA 2CHHA 3CJIB 1Q8OA 2OPWA 2E1MB 5GKAC 1H8TA 4B8EA 5DDJ1 1XX5A 1QHDA 4OHXA 3RS6A 1RC9A 4AVBA 4EZHA 1ZAOA 1VBB2 2PHDA 3WNOA 3GXOA 3VHOA 5ACA3 2VE1A 2BGOA 1NX9A 2W57A 2HYFA 2ZEYA 3S7IA 4CDUA 2LBFA 1E3OC 3WODF 5IOZA 2R93J 4KU7A 3DBLB 2PBIA 3WVJA 1UZWA 4CEWC 2X1EA 4MO7A 2RE9A 3TRSB 4N4OB 4LLOA 3LFKA 4L9VA 5DZGA 5FLXZ 5FZ8A 1A6QA 1KFXL 1Z7S2 1H6XA 4OU0A 3KLOA 4IHXA 5T54A 4GB33 4AOCA 2QCSB 2PLV3 4DRRA 5FPBA 4BGDA 1ZH5A 1VQKI 4BQAA 2YDEA 1OPOA 4ZDOA 3Q8CA 2JKBA 3JD71 4FI9A 3J7MA 1W9SA 4JAAA 3S2DJ 1XNAA 2LYCA 4R1HA 1JJ6C 1ZBA3 4UB8C 4XKVA 3I7DA 3ZMSA 3WCSA 5CFCA 5JLWA 3PQJA 1GUUA 4HK9A 2NAZA 3H1CA 1UZYA 3KWVA 4RDUA 1G9FA 3T4HB 4KH9A 2EFNA 2WKKA 4BK4A 1FLIA 2RR13 1FZPB 2X6WA 2QSGX 4EJOA 1HRI2 2JN6A 3VBOB 3GX4X 2K9QA 3I55I 3TWIA 3OYBA 2V5YA 5D5VB 1CX1A 5H9PA 1LGNA 1UNBA 5F1RA 1LVAA 3IP4B 5FZIA 3H1WA 2VD7A 2X1CA 4QX8A 5BNOB 4I09A 4O7XA 4L5JA 2JA7J 4Y1VA 3CC4I 1HV1A 3ZO0B 3AP9A 2VKEA 4S2HA 2JWTA 3GTLJ 2VUJA 2RVCA 1FPQA 2JA2A 2QGUA 3VD9A 1O4XA 5F3IA 1FMD2 1W5SA 2XV4S 3UK9A 2Z79A 2VBWA 2XAFA 5JHFA 3VBUA 2ADUA 2IS2A 2HBTA 4FQGA 3KGZA 3I49A 1E17A 3QWLA 3KHBA 5FQ0B 2R30A 3ZR6A 2K02A 1JYXA 5KHDA 3R0JA 1X7NA 4DRVA 2BXYA 3CDLA 4GH4A 2F4MB 3U4SA 3W2AA 1LOEA 2PQQA 1HXDA 4ENNA 1XCBA 4CCCA 3VBSB 5CZKA 1PVC3 1ZA4A 1NK3P 1O8SA 4K3UA 5HI0A 3CC7I 3S3NA 1PO12 1MZFA 1UY1A 3LSJA 4W1UA 5DAPA 2ZB9A 3S2WA 2EWNA 2EA2A 1QNTA 3LSMA 3WQ0A 4D7NA 4Y4YA 4AHXA 1V5EA 2JIJA 3OTFA 4S04A 2BNMA 3BTAA 5DN2A 4MH0E 5CKTA 5FY5A 2W4SA 2EXHA 4QPGA 5GZFA 2Z9OA 4AG4A 1RXFA 3NMBA 4KIFA 2M8EA 3JQWA 3N05A 1AR62 4RS8A 2DCKA 3OBAA 1VQLI 1OCCH 1POGA 3I2JA 4HPKA 4Z2YA 2RS11 3JB4C 5HS9A 1R1A1 2GMEA 3VDBA 3ZKUA 1W2AX 3NJZA 1H4HA 1LJ7A 2D3SA 4HKWA 1F8VA 4Y5SA 1GMMA 5EGOB 1GVDA 3BG3A 3DKWA 1X9TA 1X36A 1US3A 2DV9A 1W1WE 2GNBA 1IRZA 2PN5A 3DECA 2LM3A 1T56A 1TC3C 3O1PA 3VZOA 1NCRB 3MKLA 1TLHB 3LAPA 2J1TA 3CJIC 5HODA 3JCIA 4P08A 3IIIA 5LRRA 3VYUB 3OD0A 1Z0HA 2XPUA 3AP5A 3JW4A 3HXLA 4EGYA 1CAVB 1UU4A 2ZGLA 1RGSA 3OS1A 4EN9B 1I3HA 1I6HJ 1OA4A 2P8TA 1Q3EA 1QH6A 4A3GJ 1Z0XA 4BE1A 4L9BA 2RDQA 4D7MA 4BDZA 2A3WA 5DUXA 3RKYA 2DUOA 3PJRA 5FZ4A 4IPAA 3DEEA 2W85A 5IK5A 1USSA 1NQJA 2L2OA 1OLRA 2M45A 1K83J 1DGRM 2WN2A 1ZX5A 1TT0A 1RR7A 2HPMA 3B69A 3Q3SA 4XICA 3B02A 4A3JJ 4XBQA 3TOAA 2RV9A 1Y1VJ 1Z6RA 1SPPA 4CCJA 1N1TA 1OOPC 2BY0A 3M70A 3KF3A 2UYAA 4N9HA 1RETA 3WR0A 2JG9B 5K5RA 5DS9A 5F2WA 4OQ9A 1SVLA 1OKQA 3IN9A 1O4ZA 1B6AA 1U8RA 1AR91 1L7RA 2TCTA 5LLQA 3CDIA 5A7OA 1G59A 3CUQA 3K1MA 2FSWA 2ZXIA 2WC2A 1D0ZA 5IT9K 5DD4A 5JOWA 4G6QA 4LK1F 1LOFC 4ES8A 1XD7A 2KPMA 1YFYA 4UUSB 4XXAA 2P5BA 1HV0A 1R6RA 3JAMK 1FAYA 3I3DA 2UY8A 1UCRA 3H1YA 4BXFA 1MSFC 4C3JJ 1W9FA 4YFXF 2IXCA 1F43A 1VQOI 4HFSA 2UURA 1SLTA 3I2KA 2WNOA 1HSTA 3CESA 4I0WB 1DQ4A 3OSDA 3EPZA 2GC1A 2IEKA 2QA4I 4FXGB 1KDKA 1K5MC 1YS6A 1FOD3 1QNYA 4EROA 2Y75A 1ENSA 2BOIA 1IOAA 1F9NA 3M8JA 3PNVA 1QF3A 1V54H 1U5XA 4Y3OA 2VW1A 2CMPA 2V73A 2IJLA 1NCRC 3DF8A 1CN1A 3M3OA 3PVNA 4IZZA 1FSHA 4K8RB 1VBC2 1FIAA 1BQPA 5FFXA 2Y38A 3KP5A 5LEKA 2GAUA 4PUSA 4MADA 1KU7A 2WY7Q 3WP6A 1PM7A 1O7FA 4CXYA 2BE5F 4LBKA 3MF6A 3SEZA 4PBOA 4MGIE 1U5TA 3WTUC 4A44A 4GYIA 5CAZA 3HKZN 4NWVA 3K2AA 2VVDA 1AXYA 1LRHA 2ZBJA 1MBEA 2ET7A 2L02A 1CF7B 5H9RA 3SEQA 1AVBA 1SACA 2JB8A 3WDTA 1WD4A 4WM8B 3WHUA 1NT0A 3T2TA 5JAXA 2Z69A 1QVTA 1APLC 3PJYA 4LLFA 2IP2A 4BQ5A 4MVTA 4PCRA 3QCWA 4OMDA 5CJ9A 1T39A 2G1MA 2CH0A 3O6BB 1CQ9A 1NCQA 1PVC2 2ZAHA 5LCWL 1FPN1 4DINB 2Q1MA 5IYDJ 3S32A 3H50A 4QMAA 1S72I 3SDGA 2VMCA 2I2SA 2J1VA 2F2EA 1X2MA 4COYA 4QWNA 1K78A 4IEWA 1N77A 2XSDC 5BY5A 2UXXA 1FT9A 1KS5A 5J6XA 2LREA 5IVEA 4CPBA 3QYFA 2ET1A 2DVAA 1MS5A 4V1PA 3KSCA 3JD72 1ZBA1 4Y22B 1AR73 1X9PA 2LF7A 3TEDA 1W7PA 1SLBA 3VHPA 3R0RA 1A5JA 4JK1X 4KMFA 1TWCJ 2PHUA 3S1MJ 5IYYA 4JYKA 3K0LA 3IKTA 4MLOA 2VQ0A 2EILH 5FP3A 3LWFA 1YOVB 2Q1FA 2BU9A 3I58A 3D0JA 1JZ4A 1JZ3A 1SDWA 4JGYB 5C9AC 2D6KA 4LO8A 4EN6B 5FJHA 3IZOA 3VKFC 1OF4A 2A70A 4Q4W1 2HWE1 2HWD3 4Y5Z0 2H09A 1W0PA 4AHYA 1MJAA 2O03A 3ZYIB 1HB1A 3H3LA 3LPGA 4GXLA 3RPUD 1SEUA 2HEWF 4Y33A 5DDJ3 4EEFG 1U5TB 3M7AA 2JPBA 1NG0A 1MZ6A 1W36D 4PJYA 1MW7A 3LA3A 4K6BA 1XSXA 1ENXA 4XRSG 1B72A 5FZKA 1IUFA 3WV6A 4CRQA 4ZYHA 2K5CA 4CDXA 1HDDC 1BL0A 4YGBA 2KIFA 4UOJA 3D82A 1J1LA 1B4AA 2KFDA 1QJX2 4RB2C 1V00A 3AVSA 2CL2A 2RGVA 4U7DA 3KB5A 2CSGA 5IVBA 1R1TA 3NAPC 2QYOA 3RG0A 2G0EA 3USUB 1IN6A 2LG4A 3VSLA 1R36A 3CLPA 1LHNA 1VJ2A 2GH8A 3T08A 3ISPA 3SZTA 5IT6A 1CESA 1HN0A 1AJKA 1BVP1 1CJPA 4CDWC 2K9ZA 1BOBA 4HANA 1RJ7A 1AKHA 2AO9A 3HDDA 1OISA 5F37A 4ZS2A 5F1JA 5CFDC 2YC2A 2X09A 3K3NA 4EM0B 4SBVA 2EIDA 5KC5A 4H0EA 2XVGA 2BHYA 2VZPA 4D7TA 1DQ0A 2VASA 5IVFA 4U36A 1XRUA 3F22A 2H6BA 4OI2A 2WTEA 2EIJH 2P5VA 3KGLA 4XRFA 3F0CA 2VAUA 4DYCA 1J9IA 2L0KA 3MW2A 4RMNA 4ENKA 4BHBA 2VXDA 1S29A 3B73A 5D5XB 1JN2P 1XNDA 2FU4A 2WZR1 2KIQA 5FZDA 1K45A 5FD5A 4XDOA 5FXZA 3KZZA 3HNMA 1LESA 1HJFA 4DOZA 4QQLA 2LS6A 2D1HA 4XJ8A 4U88A 3WW1A 1LQ1A 5E18F 2Y48A 2JJ6A 4QHZA 5D8AC 4HSTA 2DFCA 4EWAA 1IZ3A 4HL0A 1JYNA 3BT9A 2IRFG 3ES4A 3TN91 4FPYA 2OPKA 5A32B 3ZYFA 3BTLA 3MKYB 4AZZA 1PZ7A 4IGPA 4QIWN 2YSRA 3RJPA 1LOCA 1GR3A 1IPJA 5K0UB 1GNYA 4M4RA 5K8SA 1MBHA 1GSLA 2Z5WA 4KDPA 3WDUA 1NXMA 2O1QA 1G3SA 2F48A 4G9SB 3REOA 3QH6A 5AC91 5IVCA 4OUMA 3GWZA 2PAEA 3HTSB 4HAMA 1K3IA 4CU7A 2ELJA 4R9CA 4DBQA 2V79A 3PUSA 3CMAI 3FHQA 2JDPA 1A78A 3F8CA 2R042 2BVBA 2ES3A 1VQ4I 5K7FA 3WG9A 1BXHA 3AZZA 4EJRA 4A3BJ 4MGSA 5LGUA 4GB32 2WAQN 1H30A 1GHCA 5FPXA 5J1UA 4M6YA 4OMCA 3JTHA 2Y33A 3C7FA 5DXDA 4MZUA 2R041 3F6VA 4L2NA 1DYOA 2E1NA 4CCKA 4C2UA 2OTLI 2WZEA 2MD5A 1KONA 4II3A 4RLQA 5IHRA 1IG3A 1WCSA 2BERA 3HR9A 2WO3A 2VC0A 4ORFA 3BQZA 2D97A 3HBLA 2IA0A 3AJZA 1KXGA 2DMPA 3KE2A 2X51A 5CIRA 2B45X 1IXCA 2P37A 1X4PA 2ADEA 4WM7C 4GMP3 5EZWA 3HIFA 3UL2A 1YQ5A 2PN6A 2RS32 1GLHA 2L4MA 2JG9C 2RS13 4WCGA 4KICA 2NVTJ 1BK1A 3VB2A 1WQ2A 4HKOA 2XJQA 1SFXA 4Q48A 3HOUJ 2JDMA 2H94A 2OA2A 4ARYA 3SJMA 2XQXA 3HOYJ 3THTA 2I8DA 1DLLA 2DBIA 2E9QA 3HNBM 2R063 3MI8A 2PX9A 1ZZ8A 2FBIA 4GYGA 1BI3A 2K4BA 3AMMA 1PP8F 1W03A 2XJPA 2J1RA 1SPPB 2W1SA 1MQTA 3IBMA 1WCUA 2DCZA 3GO5A 2D6OX 4P9JA 1R5ID 5B66C 5IFTA 2HH9A 1WFXA 2JG9A 4P55A 3LQQA 4FOYA 1HCRA 4CDGA 3LPFA 4I6ZA 4DW6A 2O61A 1XYNA 2PFWA 1G86A 4EMSA 2VZ1A 5AONA 5D6FA 1S2BA 2DVFA 5A33A 3VBRB 3AG3H 3BC8A 2WUHA 3ZQ7A 1Q8VA 1D8KA 3ZXGA 1LE8B 1R4MB 4H55A 4FPHA 5KHHA 4YW2A 1PIV2 2FD8A 4JOMA 2ZHMA 1AYM3 4IEQA 4D69A 5H6QA 2Q30A 2PAKA 1CIYA 1EH8A 2J1AA 3VDDC 1WMFA 2E2IJ 1W4MA 3FDYA 5JSRA 3AFHA 5L3EA 1SBDA 3VKNA 1I50J 2LVSA 4OAYA 5EFUA 3P3NA 3DQVC 2R32A 2XF5A 5IJRA 4Q8KA 4YW7A 4RLFA 4TZDA 4B47A 4BMEA 1JMUB 4ITVA 1MMNA 1Z3XA 3MQ0A 2R0QC 2GP5A 2ZACA 4H2AA 2ZX4A 1DU6A 4Q26A 1ACCA 3FWEA 1QH7A 1YC61 1PZ9A 3GMEA 1RUJ3 4UBGA 1K79A 5D8AB 1O4YA 2P3JA 1B8IB 2ZEZA 4OULA 4UY8I 2OT7A 4JKLA 1WJCA 3PNYA 3LSPA 5JIAA 4TLGA 2E5NA 3AZYA 5KNLA 2ZFWA 2W3JA 3I3MA 2VB6A 4YFNF 1TEIA 3VB9A 4LG0A 2M1BA 4E7ZA 4CCDA 5LHIA 3ZIWA 3O8GA 3ZYBA 2P2KA 4KITB 1XDSA 5E20A 4Y24A 4BXXJ 1RHI3 5HS8A 2UUZA 4N53C 3V65A 4ASNA 1N3OA 5KK1A 4GGGA 3DYOA 1XS9A 4XL9A 5CG9A 2H1LA 5HCHA 4RD7A 1MS1A 2OQGA 5HDKA 1DP7P 1UMZA 2HDWA 3JRBA 2W68A 4ONUA 1AR92 1MACA 4YG3A 2A05A 4JTOA 2E6VA 2KMUA 3ECHA 1IRFA 3UGGA 4PFPA 1ON1A 3GFJA 3PURA 2CRGA 1BVVA 3MFCA 2XUBA 2WFPA 1MBFA 4QX0A 5T50A 4Q5SF 2AXTC 3K4NA 3RRDA 3DBRB 5DYMA 2WA0A 1VQ6I 3H8OA 1R091 3ZPYA 1DPRA 4BY1J 3GXUA 1JYCA 2DWRA 4A3IJ 1NHAA 1B9NA 3VDXA 4P00B 1OOPB 2W39A 4RFT0 4XBNA 2TNFA 2QQBA 4DPNA 2MH2A 3FK7A 2LW8A 3FBYA 3GZUC 3POWA 3C7EA 4R52A 3TN93 2HOSA 2TBVA 3OOUA 2ARXA 3WDWA 1XU1A 4RR3A 4PIYA 4AGGA 2TRTA 3KX2A 5D5UB 1VALA 1BN5A 2P4EA 4CSWA 5HCFA 1WI9A 3IDCB 4LK7A 4BJ5C 2VXRA 1EV13 5CYVA 1PO21 3IB3A 3AYDA 3HUGA 4KU8A 1JE8A 2DCJA 3HL2A 3F6OA 4XLPF 2CGPA 4HDUA 2YPDA 3QLQA 4BLJA 4IKFA 4LO4B 1HN1A 1A8DA 2G9ZA 2PLV2 4CDUC 3V7RA 1TWHJ 1W90A 4YZ5A 4LIUA 2EFWA 1HX6A 5EEHA 3ZRGA 3GTKJ 3ZYGA 5FKLA 4L11A 4AQ2A 5GP9A 2PHXA 4KIBA 1RMU1 1ZBE1 4UBHA 2UYBA 1S0FA 2LRPA 4HSLA 3WE2A 3AKTA 1AYM2 3LIGA 4DUWA 3IWZA 3KYCB 2WLPA 2VM9A 3ZFEB 4CDQB 2E71A 2IW5A 1N47A 5FZ9A 1S2EA 2ZXHA 1X50A 1ACIA 3RNSA 5F3GA 3I3LA 3NJXA 2XHNA 2K2SA 1PUFB 4TTGA 5E3MA 4AU7A 4IHYA 2GIZA 1S9HA 2MC3A 3VBFA 3DUIA 1CQTA 1AL23 1POV0 2CQKA 2XAUA 1I3AA 4IRGA 4CDWA 3OOPA 4AAXA 5IK7A 3EHKA 4E6KG 2BW8A 3NV2A 4UYBA 3W3CA 3ERED 1FIPA 3ECQA 3H9JA 4QDSA 4N0BA 4PI0A 1BHGA 1BR4A 4YZ1A 3B9CA 1V6MA 3WF1A 3LKJA 4A3ZA 2VOKA 3LSIA 3QU6A 3ZOBA 4RS5B 1Y0NA 4JBAA 3LCPA 2D45A 1ZZBA 4HN1A 1NCQC 5I91A 1T2KA 2DK8A 2ZMEC 4XABA 2IAIA 5IW0A 2RG4A 2Q8DA 3CZUA 1D2SA 1SCSA 2D7FA 3ZSKA 1REDA 3W21A 3IH2A 1J1TA 1Q43A 3H7YA 5EEAA 3JTGA 4PQQA 3ABTA 2PA7A 4HNUA 1VBE2 3FE5A 5B1AH 2OF7A 2ID3A 2HYXA 3H0GJ 1J59A 1R9TJ 4HSRA 1NLRA 4LO7A 3KZ4C 2FJ1A 2OJED 4HBLA 2DYCA 2QNKA 1W05A 1JU3A 2WWJA 3FFQA 1WWXA 1HKSA 5DUVA 2ECBA 4G7OF 5IK4A 2WT0A 1QY4A 3MBWA 3AVRA 3RYPA 1OVSA 1WMXA 1ZRIA 1LAJA 2QQKA 1ND2C 5BNPB 1WZ2A 3ZDVA 5JR2A 2PQ8A 1Z6TA 2C6SA 3TGNA 4QTRA 1VQ9I 1PGW2 2AZ5A 3LOIA 5EZGA 4PJ0C 2DTWA 1W6NB 1BBT3 2COBA 3NNMA 1U5TC 1HXS1 2RQPA 2L7ZA 1ZTRA 5KHIA 5JIUA 3FBIB 1QXPA 3J7YJ 1VLNA 4FHTA 2NS7A 2EAAA 3WDYA 1ZYRF 3LIHA 1FBUA 1P8JA 2Z16A 1RXGA 3NNLA 2MH9A 2JDYA 1W8TA 3DU6A 5DAWA 1L3JA 2UXNA 4A5NA 2DOEA 5FK8A 1QJX1 1JZ6A 2JD4A 5FGMA 1YRZA 1VMHA 3O7OA 3S93A 1IQAA 1PUFA 4JV4A 3ZM8A 2HYKA 1X33A 2V9KA 2CU7A 3WNNA 1P9QC 5C3SA 4BE2A 2HWB3 1DP3A 3C7JA 2NRAC 3MF9A 4CUBA 5ABJC 4IDZA 3SMHA 3WF0A 3H36A 3VYSB 3TAYA 2FF4A 3CU7A 2EPFA 5GADJ 1VAVA 6PAXA 4QX7A 1JUIA 4CVUA 3KZIC 1AL0G 4L92A 3SEPA 4LBOA 2VQCA 2K7LA 2HWC1 3VZJA 5A7QA 4RHV1 4Q8LA 4NHYA 1UW8A 4UFHA 3GTMJ 4UB6C 1ULCA 3FKJA 1JOPA 3I3EA 1I1SA 1PVXA 4GH4C 1W6MA 3WCRA 4XEZA 3VBUB 5HV0A 4ZYDA 2CJJA 4ET7A 5BS6A 1VQ8I 3MPPG 4HONA 2R7WA 2WO1A 3TDZC 1UXZA 2VNRA 2O6GE 1PMJX 4Q4V3 1MEC3 1D0YA 2E1MC 1IGNA 3J9SA 3N9PA 1VBD2 4FFFA 3PIOF 2ZNYA 3CCMI 4CCNA 2E2JJ 4S2FA 2VTFA 3SCHA 2CV1A 4ZDLA 3KEQA 1LTEA 2EZLA 4DXZA 1MQTB 4AWDA 4B8XA 1XB4A 3PMSA 4ASKA 1EPZA 3K4LA 5CKNA 3T5XA 1FMWA 2PMUA 5L3CA 1NG6A 3SKVA 5FKKA 1PJRA 2D6NA 5CB7A 1KITA 1W6NA 3CZ6A 3ZN6A 4FX4A 2QENA 1E3PA 2QSFX 5GTIC 3CCJI 4A3FJ 4QX2A 4CP0A 1T0FC 3CD6I 2IPQX 3RWKX 3CMEI 4YFZA 3BWGA 3NAUA 2ZZQA 4C30A 1LHUA 1FPN3 4NWWA 2ZKNA 1ZNPA 3R4SA 4U7BA 3BOWA 1X1BA 4NMIA 1QZZA 3HHGA 2JB4A 2XLGA 1J0RA 3DPRC 3DCFA 4HVRA 1UU6A 1VRH3 2ZPXA 1YJNI 3S3OA 5HV4A 2VBZA 2MSYA 4WXHA 3WTYC 5FYMA 3X29B 1B1BA 4Q5OA 5HXMA 3GHNA 2CWSA 4P96A 1HF0A 3WGGA 4CCEA 2LLKA 5DABA 1Q1VA 4WX9A 4XE9A 3JRGA 1T0FA 4OCTA 1JZ7A 3WHBA 4HZFA 3ACLA 2R7EB 3IC7A 2R5ZB 2E31A 4ZU4A 3FN9A 2VZ3A 1WLTA 4PLNA 3JRDA 5A7SA 3MZYA 2BHZA 2EB7A 5A2QZ 3RJRA 3T1MA 1YQ8A 2ZS6B 3GBGA 1KYZA 4F92B 4E2QA 4LFUA 3O14A 2RHPA 3PO2J 2P3KA 4C90A 1Y56A 4KWJA 1VIWB 2YU9J 4AI0A 2VT3A 3AZVA 2QKLB 1X3UA 2XXZA 5C70A 1ZELA 2B0LA 5FMBA 1X4OA 4ZH4F 1VRBA 1VQ5I 4IQJA 1J58A 1YX5A 3I4IA 1BZWA 2KRHA 2DF7A 3AAFA 4UNOA 2EALA 3QOPA 3C2UA 1YO5C 3BTXA 4LLGF 3AKQA 4IV3A 3ASIA 2ISYA 1FMVA 4AWXB 1MZEA 4YARA 5EDNA 5L7OC 4IGQA 4XOTA 1GUIA 2GC3A 5CFCC 1ZRDA 2R0FA 3T2PA 2LROA 4A42A 2PG4A 2DJIA 5EYXA 3AKSA 5JOXA 4AQ6A 5ED4A 1OCOH 3BPVA 1G3TA 4XJ9A 1MNEA 3O8HA 3JD73 5ILUA 3GZEA 3BR2A 2DA4A 3ILNA 1Z77A 4UXAA 3W58A 3GCXA 4KWUA 1T38A 1PIV1 2QQUA 4A6OA 2E34A 3JR9A 1R7JA 1CX4A 3E6MA 4K9SA 4F3QA 3KV4A 5FLJA 1HQWA 1EA3A 1MMGA 4COUA 1RMU2 1JKOC 2A75A 2HQRA 2XAHA 1BBYA 4AD9A 5FP4A 1I39A 1BR1A 4KBZA 4A93J 3OMYA 2IT0A 3HRMA 3BR5A 3BOPA 4HX7A 3UJOA 4AVCA 2ICWG 1GLNA 3CIHA 5EF6A 1C8M3 2EIEA 1PVC1 3G1LA 4BBRJ 2IFWA 2EV6A 3J7AO 2JVHA 1RUE1 4EN7B 2DURA 2WZ8A 3I64A 2R49A 4G6TB 1KGYA 1CGPA 3LD8A 1V6LA 4AR2A 2EIMH 1AXZA 5LBCA 2HPIA 3AYEA 5FPAA 2RM21 4N4NB 4RN5A 3RI9A 2RR12 4XURA 1X1PA 4XUPA 1MDMB 2ZSHB 3HRTA 2DFIA 4BDYA 4DXRA 4H7LA 4A3LJ 1EJ9A 2DCTA 1R00A 2XL7A 3PU8A 4CEYB 4MGYE 5J8FA 4XLCA 4P9LA 2VBYA 4FX0A 3WU2C 3G4SI 4Q4V2 3ZN4A 3COAC 4V19K 1CONA 4E7JA 4LQRA 4ISRA 3V8JA 2EIGA 1OUSA 2NS8A 3KD4A 1TG7A 5FZ3A 4E8DA 4LJHA 3IUOA 4YVWA 3ZFEA 4CDQA 1IN5A 1ALYA 3N9MA 5FYYA 1U78A 2GNMA 4BBSJ 3M07A 2F4LA 3FZVA 4X0GA 3QPTA 2ID4A 2RNGA 5C8CB 2YBPA 5J4VA 4FOVA 1ZZ9A 1RUD1 5FO7B 1D1CA 4M6XA 3K7AJ 3B3QE 1TZOA 1IN8A 4PGHA 1YTYA 4DBRA 1GQPA 1BR2A 2ZGNA 3HOBA 1ZVFA 2X6XA 1JBCA 3BZCA 1QOSA 2XC7A 5D21A 3DU5A 1IKPA 3IAPA 1TWGJ 5FXWA 1W5TA 4PK4A 4P9UA 3ZMUA 3L2UA 1GP5A 2BWCA 2LY2A 4L5EA 1WBFA 2VBPA 2BWAA 3K70C 3OYDA 1JT6A 2EQRA 2NXNB 2XF6A 1ZG1A 2CGOA 2A6VA 1QEXA 2DQRA 5IP7J 2HU9A 2ZO4A 5L7OA 5JVTA 3PVEA 3VZMA 4XQWA 3DCQA 1WZXA 1S7AA 3SHRA 1LHWA 2YXSA 4QSHA 4Q0QA 4XSZF 3PTYA 5FUIA 1N75A 1S1AA 5ANNA 4QDRA 4R9AA 4W6WA 1UYZA 4LXLA 1DP0A 3V0BA 4CYCB 1FATA 4JKMA 1HKTA 2DVGA 1R64A 5IWFA 1WH7A 2ZGSA 3OYKA 4W6YA 4MXWA 5FRMA 4D6RA 3BG6A 4OIPF 1LULA 3TBDA 4R9DA 5IAXA 4HK8A 2XLFA 5E88A 3E3VA 1F9KA 1VBE3 2PMWB 4UT5A 3J7HA 3WTXC 3C3VA 3UKNA 5DAVA 2EBIA 3I5UA 2VN2A 2R1DA 2W1WA 3K77A 1RPWA 3BCAA 5BQTA 1TME1 2IXSA 3S14J 3BR0A 1W3VA 2BJSA 1VE0A 1W0OA 3DLAA 3FXJA 1FNNA 3QODA 2HYGD 4AFCA 1RZ4A 1X8EA 2C4XA 4BQXA 4L0ZB 3QD6A 2ATFA 1L7QA 2JWPA 2Y6KA 2G7UA 1RUG3 5DV5A 3LWCA 1FNZA 4RGAA 1M1EB 2G9WA 4QHBA 4K2EA 1AYN3 1VBA1 5C3PA 3GCWA 5BYNA 1LHVA 1H88C 2VMDA 3LQCA 2JENA 3O2PE 2B63J 3WT3A 3EYIA 3I54A 1Z21A 5KAFC 3ZR5A 5FPVA 1F1ZA 3C7GA 3PUQA 2E63A 5DCMA 1DUXC 3BZKA 2HEYF 2WABA 4B1RA 2MG4A 1YW8A 2MW8A 4BS9A 1W36C 4S2GA 2GC0A 1LDKB 2Y8KA 4LB6B 5DUWA 3ZSLA 2W95A 5C33A 4ZZ5A 5L73A 1JJ8C 5C4WC 2BTVC 4I7HA 3GLXA 2OCCH 4BQ2A 1LCLA 5CLSA 1B35C 1PO13 2X5IC 4FPLA 3NL1A 1IAWA 2CYYA 1O4TA 4B1LA 1UF2C 3F8BA 5A7PA 3KYLA 3MV11 2Q2EB 1PHMA 1V3FA 4NIGA 1KEXA 2WV1A 1VMFA 5BV6A 3AL0B 3R05A 4Q0SA 1P4WA 2O3FA 1OH4A 3SQNA 2IVJA 1PM4A 1Y9MA 4PJLA 2NM1A 4PT6A 4Y1UA 4O65A 4LBQD 2YROA 1BIBA 2ZJQF 2HTSA 4X8PA 5A1LA 2QUOA 4G3YC 1NH3A 2ZEWA 3MIEA 1YIOA 4BHPA 4ZC3A 3U9GA 4NQWA 3GJAA 1G9BA 2ARCA 2JSPA 4XYXA 1UHSA 4IJAA 5FY7A 3L2WA 3KF5A 2ZC2A 3G3ZA 1GP4A 2JRTA 3TO9A 2XR4A 1MKMA 5FP9A 4IV1B 1P92A 1PK6A 3ERMA 3MIDA 1D5VA 5HPOA 4ZONA 4OMYA 3JXSA 5FZLA 3HQUA 5FXVA 3CJIA 4NC8A 1OSGA 2QZ3A 3JRAA 4HOOA 1O91A 4IXLA 3UKVA 3E0JB 2A71A 2DU9A 4NJ4A 1ODNA 2WS93 2E36A 3PNAA 5FZOB 3NQHA 4IEXA 2D43A 2ELHA 3AG2H 2IVIB 3ZXJA 2OXBA 3TNQA 2HQNA 4OFGA 3AJYA 1MSEC 2WSVA 2ZXWH 4KMQA 1YLFA 3CMYA 3BPSA 1E5HA 4DO0A 2EXKA 1Y8QB 3ACHA 3BJ6A 2YZ4A 4BQYA 3GZTB 1U0AA 4RQPC 4CGZA 4JGZC 3G73A 3CF6E 4G94A 3HOZJ 2HWE2 3VYRB 4IGOA 4C1WA 1DGRN 1LUJB 4GDFA 4IOCF 3L2CA 4JVAA 4IHVA 2XASA 3WLUA 1NAEA 3DPTA 4OZOA 2R073 3POGA 3ZLIA 1FJLA 3IRRA 4XKBA 4P9XA 1RVF3 4AI9A 3W59A 2JG8C 2V09A 2M30A 3WTZA 5T5LA 2BRTA 3V8LA 3W6VA 3LFMA 1NY72 3WW2A 1EUTA 1XCVA 5DAQA 4FPEA 2YU3A 2HWD2 1HRI3 1W0NA 3OBZA 1Y3TA 1O3RA 2FRHA 1R093 4EGZA 2R7XA 2QQWA 2I5UA 4N53B 2F4IA 1T2XA 2Q2EA 1DBNA 2BBVA 1K7AA 2AR6A 2QBXA 2ZHLA 4ZU7A 2VQUA 2K4JA 1XNTA 4X6AJ 2W91A 4M3DA 5J96B 3H9GA 2PXJA 1V0AA 4N43C 5C4WA 2HI3A 2PYTA 3ZFFC 2B8MA 1HBXG 3GJBA 4HN0A 2CV0A 2DTZA 4RAYA 1GT0C 1RUNA 2VOWA 4DJAA 1LPQA 5FYVA 1OR7C 1P4XA 2IS4A 4HG6B 5JWPA 1RVF1 3C2HA 2JEMA 1UZCA 1NA1A 2H8WA 1RHI1 4JRLA 5J1XA 3L2RA 3MVPA 3HPNA 2H27A 4FP3A 4XSXF 4HXCA 5KVRA 3RGBA 4ZJZA 2OQ7A 2G9GA 5BNGA 3CTAA 2ZHNA 2WZR2 3KT7A 3T8RA 4YVSC 4BE3A 1GOFA 2CGNA 1Y1WJ 1ETXA 4K1ZA 1W0UA 4MSVA 2V4VA 2GC2A 5H9QA 5BPDA 2HGCA 4FOQA 2A6EF 3Q0UA 2VU9A 4B1MA 4URAA 5A33B 2V6EA 2XG3A 2CFOA 1MEC2 2B4KA 4NROA 3WP5A 3ZXLA 4C2MJ 1ITYA 3FBMA 3VDDB 1POV1 1EV7A 3TNPB 4M3GA 1J75A 3MKWB 3ZSMA 4H7MA 2QDRA 1UO9A 1XPXA 3BVCA 3ZMOA 5BMZA 1GVJA 5FD6A 2BQPA 2JVGA 4BM8A 4CU8A 1ETWA 1C28A 1YXWA 3RDIA 2MC4A 2CUFA 3JAMZ 4RB0A 5E1WA 1ND3C 4D94A 4META 3KS7A 1WMEA 3CCLI 4LOCA 3E5UA 2ZABA 3ZPLA 3FM3A 3LOBA 2W9XA 4I01A 5ACA2 4FPCA 2RJLA 3H9QA 5A3PA 2FNAA 4D9JA 1W2NA 3SHFA 3WNPA 2BFUS 2EXJA 1WSUA 1D4M2 3H42B 1VBD3 5EEGA 1HKDA 1ZZ7A 1VF9A 1T33A 3RKQA 4XK4A 1WLDA 3USSA 4MUVA 2B7EA 2DMTA 4IF4A 3RZJA 4AVZA 4EM2A 1W99A 4J00A 3ZXDA 2XJUA 5AC93 4U0VA 1UCXA 4GWMA 3MHZA 3RI8A 1LGCA 1UYXA 2XMLA 2RVAA 5KR7A 3A22A 4N53A 1SC7A 1OBNA 3ZYJB 4DMIA 1OOPA 3OYFA 3HZJA 4QX5A 1RINA 2VBXA 3TQNA 2OZ6A 3RSJA 2F5EA 3URFA 2DDUA 2XPJA 1AU7A 2LUWA 4XFGA 5A1FA 5J37A 1LEBA 3AC0A 4XQDA 3BCWA 4UWDA 4Z8BA 2VQHA 1FYMA 1KJLA 2WBMA 1OD3A 4QU1A 4UHTA 2BZTA 2KIUA 3DTIA 5LBEA 3O12A 4CUAA 4QPIA 2N7GA 1YJLA 1LODA 3VKOA 2XB6C 1XGNA 1USTA 3E1F1 1K12A 1OHFA 4YIRX 2Q0AA 4LHSA 5D5WB 2D98A 1CAWB 3CO2A 3DP7A 1ENQA 2K86A 4TN7A 1IS6A 2XROA 4A41A 1LGBA 3LFIA 4P14A 3ULQB 4F91B 2YGLA 2XWBB 4XUTA 1W04A 5AVAA 4XIKA 3J8F1 4LB5A 1OLME 3CJQB 1D4M3 4J25A 2DVBA 1J2XA 3GTGJ 1OCRH 2A5YB 3RTRA 1RB8G 2FXAA 3CUQB 5JMCA 4COZA 2QLZA 1MBGA 3MIF