1ZRTD

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
257
structure length
252
Chain Sequence
SNVPDHAFSFEGIFGKYDQAQLRRGFQVYNEVCSACHGMKFVPIRTLADDGGPQLDPTFVREYAAGLDTIIDKDSGEERDRKETDMFPTRVGDGMGPDLSVMAKARAGFSGPAGSGMNQLFKGMGGPEYIYNYVIGFEENPECAPEGIDGYYYNKTFQIGPDTCKGVKITHGSWARMPPPLVDDQVTYEDGTPATVDQMAQDVSAFLMWAAEPKLVARKQMGLVAMVMLGLLSVMLYLTNKRLWAPYKGHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase/metal transport
total genus 51
structure length 252
sequence length 257
chains with identical sequence Q
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1zrtD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1zrtD02
1CIEA 2BGVX 1BE3D 3O1YA 4DY9A 5IY51 1DW2A 3WFEC 3WFBC 1I54A 1BGYD 2B4ZA 1ZRTD 1C6OA 5C9MA 2PCCB 1CYJA 2ZBOA 4RJTA 2ZONG 3OCDA 1RZ5A 1HH7A 4EIDA 3PXSA 1GIWA 3ZIYA 1NTMD 1A8CA 4D6TD 2YCCA 1I6DA 1CSUA 1FI7A 2CA4B 1CRCA 3JBTB 1FHBA 3A0HV 1DVVA 1AYGA 2KNCB 2RMZA 1E8EA 1DIQC 351CA 1CC5A 1KYOW 1E2RA 3OCDB 2CA3B 4PD4D 2LIRA 1YNRA 1JDLA 4O1WA 1L0LD 2QJKB 1YEBA 3L71D 1BCCD 2FRCA 4L1QA 2BCNB 5B5EV 2ZOOA 3L74D 4O1QA 1CIHA 2IBZD 1SQBD 1HCMA 2PCBB 1N15A 1LC1A 3H1ID 1CHHA 3MK7C 2HV4A 1OCDA 1CRHA 1M60A 1CYIA 2C1DB 1CSXA 3KHUA 1K3HA 1C6SA 1PP9D 3WFDC 4A7PA 5B66V 2QJYB 4RSZA 1HZUA 3WU2V 2I8FA 1A2SA 1KB9D 2N9YB 1IZL0 5TISV 1DVHA 1H32A 1CRGA 2BLFB 1FI9A 4AANA 3ITKA 1I8OA 1RZ6A 2LITA 1BL9A 1N50A 1NNOA 1VYDA 2QG4A 1RAQA 5KLIB 3TF5A 1CXCA 2B0ZB 5B6QA 3PHLA 2C9XB 2AXTV 1L9JC 5CICB 3O5CA 2MTAC 4FA4A 4PW9B 1CHIA 3CX5D 1YEAA 4EIFA 3PTZA 5E79V 1DW0A 4WQBA 2FYUD 3H1LD 3NBSA 1MZ4A 3ZBMA 2ZXYA 1H1OA 3PXTA 1IRVA 5CIFB 1HJ3A 1QYZA 3NBTA 4YE1A 3L73D 3L72D 4Q5PA 2N18C 2XTSB 1CXAA 1CYCA 2RN0A 3GW6A 2FYNB 3HQ7A 2C1UA 1CCHA 3A0BV 3C2CA 4FA9A 1GQ1A 1FJ0A 5CIBB 3BCCD 3L4OA 5CIEB 4V2KA 2OZ1A 4GEDB 5GTIV 4WQ9A 1C7MA 4U3FD 5DJQC 1N9CA 1GU2A 1I55A 3PRJA 4WQDA 2YK3A 3SVWA 4FB1A 3H1JD 1YFCA 2ORLA 2D0SA 4AAOA 1C6RA 4L3GA 4FANA 2L4DA 3CXHD 4FA5A 4AALA 4MU8A 1YTCA 4KMGA 2C1DA 1U74B 1MG2D 3GG2A 2FWLA 2OZ1B 4XYDB 5KAIV 2GIWA 1QL3A 3PXWA 3L70D 3HQ9A 1MG3D 3TGUD 3WUIA 2GC7D 2L91A 1P84D 3CP5A 3CU4A 2YQBA 3L75D 2B12B 4WQ8A 1W2LA 1B7VA 2C2CA 2DGEA 2VHDA 2C8SA 2B11B 4LJIA 4IL6V 3SJLA 3ZOXA 2N3YA 3WFCC 1I5TA 1S5LV 1FI3A 3ZOWA 4EDFA 4PWAA 5CYTR 3DP5A 1CRYA 4AX3A 2ZZS1 2D0WA 1NTZD 5KKZB 1H9XA 1M6ZA 2Q3EA 1CTZA 5TJHA 1FOCA 3O0RC 1AOQA 5DFSA 3ORVA 1GDVA 1S6VB 1NU1D 3RLMA 1FCDC 4EICA 3CXHW 1N90A 1H33A 2JQRA 4JCGA 1CO6A 3CYTI 3HQ8A 2N3BA 4NFGB 1NMIA 1KX2A 3SLEA 1R0QA 1IQCA 5H2FV 2O3JA 1C2RA 3O20A 5C0ZA 3PLNA 2C1VA 1W5CT 4N0KA 1AOFA 1CSWA 1I8PA 1CIGA 1HROA 3ZOYA 1H33B 2BH5X 1CCRA 451CA 1A56A 2B10B 3M97X 3X39A 1CTJA 1CEDA 1SQVD 1IO3A 1DW3A 3H1KD 4FAVA 3TDKA 1QKSA 1J3SA 2CXBA 1CIFA 1OAEA 4WQ7A 3OA8A 2A06D 3H1HD 5DF5A 1KB0A 4P4QB 2AI5A 1L0ND 1HJ5A 1KX7A 1DIIC 1IRWA 4J20A 2N9IA 2KS1A 4WQAA 1YIQA 5AURA 3MK7B 1EB7A 1RAPA 2Y0CA 3CX5W 2QJPB 3SWSA 3OA8B 4Y5RA 3L4MA 1F1CA 1KV9A 1F1FA 3HQ6A 1LMSA 2JTIB 3RN1A 2EXVA 3NWVA 1C52A 2JWAA 1CHJA 3FWLA 1E29A 3VMAA 3RMZA 2GC4D 2CE0A 3DR0A 1QL4A 1CNOA 2PACA 1H9YA 1SQXD 1NTKD 3VYMA 5CIDB 1HJ4A 4XXLA 2BH4X 1GJQA 3CWBD 1QN2A 1CSVA 4GYDA 1YICA 2V07A 4PJ0V 2CE1A 4H0JA 1LC2A 5KAFV 3A9FA 2GB8B 1COTA 4FA1A 5EXQA 3PH2B 1CRIA 1NMLA 2V08A 1H31A 1HRCA 2AIUA 1ZZHA 1ETPA 4WQEA 1CORA 1HZVA 1SQQD 4EIEA 1C75A 2N9JA 1WEJF 4L3HA 1GKSA 1CRJA 155CA 1WVEC 3VNWA 1K3GA 4K3IA 3WC8A 1M70A 1PPJD 2N18B 3SXTA 1YCCA 4WQCA 1I6EA 1AKKA 2Y0DA 1DW1A 3ZOOA 3ZCFA 4AAMA 1H31B 1SQPD 1LFMA 1U75B 2BPBB 1KIBA 1KYOD 2K9JB 1EZVD 3RN0A 5GTHV 1L9BC 2BCCD 1CTYA 2DVHA 3DMIA 5CIHB 2Y0EA 4H0KA 4QAOA 3VRDA 3TYIA 5DJQB 5CIGB 1H32B 2YIUB 4UB8V 5KLVD 1DT1A 1NIRA 3KZIV 2MHMA 4UB6V 1LS9A 1C2NA
chains in the Genus database with same CATH superfamily
3CWBG 1CIEA 3L72J 1QVFO 1OFCX 1Y47A 3O1YA 4DY9A 1GL2A 1DW2A 1ZP0C 1Q7YQ 5B5EH 1BGYD 2B4ZA 2WTYA 4YPCA 4H0LC 1FZCC 1RZ5A 3C8VA 3PXSA 3BCCE 3CCJP 3PH0A 3AE4C 1LT1A 1NTMD 1A8CA 2G8YA 3HUSB 2E42A 1CRCA 3JBTB 3V4WA 1GL2B 1DEEG 1N73C 5AW7B 5BVZA 1GZLA 2OYIB 1LTJA 3E7KA 3R4YA 1KQSO 5KTBA 1DIQC 351CA 1KQFB 1KYOW 2D2CD 3MP7B 1HGVA 2LIRA 1YNRA 1L0LJ 5AW0B 1JO5A 3V2RA 1EZVG 3D71A 3BATA 2BCCG 5CJ0A 5B66E 1A02J 1J1EB 3L74D 4O1QA 1LTJB 2IBZD 5E79H 1X8YA 3G3ZA 1Q81Q 5AVSB 1N15A 2HV4A 3GHGC 2WPVB 2M5AA 2C1DB 1BE3G 4YTPC 3KHUA 1SQXE 2WMMA 1PP9D 1QGKB 2AXTE 1AQ5A 3P8CE 4H0LD 2RKLA 1KB9D 2N9YB 1DVHA 1CRGA 1KD1Q 4Y28J 1PGJA 3SWYA 1FI9A 4HB1A 4IFMA 3A0BH 2LITA 1RAQA 1SQQE 3TF5A 1RF0A 1CXCA 2B0ZB 1NTKK 2K37A 3O5CA 2R5DA 1LP1A 1VF5D 2NPSA 3CX5D 2W6BA 1PPJE 1YEAA 4EIFA 1D7MA 4PV1B 4U7JA 4WQBA 3CCSP 2E76B 1MZ4A 4H0LB 2ZXYA 2E75C 1H1OA 3PXTA 2AEMA 5CIFB 1KYOE 3AEDC 1BCCG 4R4MA 2R3CA 3H32A 2NPSB 2N18C 3AE1C 5K5GB 1QVGO 1AJYA 5CCHC 5CHXA 4N78D 1VF5B 3BCCJ 1CCHA 1FJ0A 4DOJA 4IL6H 4DCKA 5GTIV 2HYNA 1S5LH 3H32B 1N9CA 3B71A 3PRJA 3CD6P 2IFMA 3H1JD 4L3GA 2P10A 3HRNA 1YTCA 4KMGA 1IFPA 1YJ9P 3L4FA 3LIEA 3L70D 5AW8B 1MG3D 3RBZA 3BASA 1EXIA 3WUIA 3Q1MA 3W67A 2L91A 1HJ0A 2FYUG 1P84D 3CU4A 3L75D 2YQBA 2E75D 5KAFE 2IZ1A 1FZGA 2VRSA 1USEA 2WSCH 2Q9IA 1NHLA 4WY4C 5AVZB 1NOHA 5CJ4A 1HBWA 1SQXJ 1OZHA 4LJIA 3RGUA 5AVVB 3SJLA 5CCHD 1LTTC 1KB9H 3CWBE 1VQ7P 4EDFA 3DP5A 1LGHB 1USDA 1YTZI 1ZMEC 2ZZS1 1NTZD 5KKZB 4W7ZA 1YTZT 4IOIH 1H9XA 3RK3C 2R3SA 2Q3EA 2YXQB 1AOQA 1RE4C 3ORVA 3H1HG 4XE5B 1KILC 3AEBC 3M0DC 3CYTI 3TYYA 2WSEH 1K04A 4Z1MH 2N3BA 4NFGB 1KX2A 2QE7H 2KZIA 5H2FV 2O3JA 3O20A 1K05A 2CPBA 3TGUG 1FDOA 5APTA 4N0KA 1RHZB 2FYZA 1HROA 3IFMA 4WY4D 1MUUA 4DZOA 2YO3A 2B10B 3M97X 3G9RA 1SQVD 2HLOA 1EDJA 2M3BA 2Y9YA 3TDKA 3L36A 4ASVA 4HH2A 1GU5A 4WQ7A 1QL2A 3OA8A 3G4SP 2GUSA 5DF5A 3RK3D 5KAFH 1KX7A 4I2LC 1IRWA 4J20A 4BRYA 4DJGA 2JP3A 1EDIA 2FYUK 1YIQA 1KILD 4YXWH 2JKVA 1NVOA 3CC7P 3FXEA 1N7LA 3OA8B 1J2JB 3A2AA 1UIXA 1LMSA 4BRYB 3A5TA 3RN1A 1RE3A 4B86A 1E29A 2IYOA 1JOCA 2JJLA 3V6IA 1NTKJ 1S1CX 1K73Q 3E1RA 3CWBJ 4GDOA 2ZT9C 2BH4X 1GJQA 1BCCE 4HJGH 3II6A 4H0JA 1LC2A 4OVNF 1VQ6P 5TISE 1URQA 4UB8H 4W80A 3PH2B 1ZZHA 3CCEP 2AEJA 2K9JA 2A06G 1HH0A 1N2DC 1BGYG 4ZKUA 4L3HA 1L0NG 2K1AA 3GF3A 1OW7A 155CA 4OGQC 1S5LX 4I7ZB 2KZJA 2M8RA 1URQB 1LTAC 1NTMG 3ZCFA 2E74C 3RK2D 1SQPD 2LR2A 1JB0J 2K9JB 3AEEC 2BCCJ 1NWQA 3RN0A 5GTHV 3EWKA 3M9QA 2Y0EA 1CTYA 1FZBA 2IPPA 4QAOA 2HG5D 1JY3N 1VQKP 1VQ9P 3CXHI 1SP4A 1NAYA 2UWJE 1RF1C 1CSBA 1JM0A 2ZT9D 4UB6V 1LTBC 1BE3J 4JF7A 2BGVX 4NPEA 5IY51 4NPDA 3RK2B 1T3UA 2IBZG 4KHXA 3WFEC 2KNCA 3A0HE 1NO4A 3WFBC 1PGOA 3W68A 1JY2N 2PCCB 4W7YA 2ZBOA 1XTCC 4JYBA 3OCDA 4EIDA 3D6YA 1PP9G 3ZIYA 1SQQG 2YCCA 1HGZA 1FI7A 2CA4B 1NGMB 4OGQD 5BU8B 2P67A 3MD0A 1AYGA 2ZT9B 3H1HE 1PPJG 4M3LA 2KNCB 1H89A 1RQUA 1E8EA 2E74D 3KYQA 5TISH 3WMM0 1JEKA 5B5EE 1E2RA 3OCDB 2CA3B 1VQPP 1GTWA 1S9KD 1L0LD 3L71J 1BCCJ 2QJKB 1YEBA 2ZFCA 2N9BA 3CX5I 1PIXA 2OQQA 4L1QA 2BCNB 1DD3A 1L0NK 5KLVG 2ZOOA 4OGQB 1YBKA 1SQBD 3WU2E 4C7NA 4L75A 2POHA 1WRGA 1NTMK 1CSXA 1GW4A 2C0WA 3MZWB 1YIJP 1JCDA 2WSFH 1J1DB 5B66V 2QJYB 1UIIA 2ZYDA 4ZNCA 1FJKA 1HZUA 2I8FA 1GU4A 1OX3A 1Q86Q 1IZL0 1VDFA 1H32A 3B5NC 1M7LA 4C7NB 4D6TG 2BASA 5CCGC 1N50A 1NNOA 2QG4A 1RF1B 1DH3A 2AXTV 1LTSC 5CICB 4AUWA 2QSIA 3A0HH 3GF7A 1HTLC 1E79H 3O6QA 3M9HA 1OVUA 2FYUJ 3RL0C 3SWKA 2OYHA 4XFJA 5CMZA 5AW5B 3NBSA 3VP9A 2W6AA 3ZBMA 3CC4P 2DW3A 1IFDA 3A0BE 3L70G 3HUSA 1EQ7A 2PGDA 3G6EP 1SQQK 3PJSK 3CCQP 2KLUA 2I1KA 2GA1A 3A3YB 1P84I 1CXAA 2OYIA 1N7SC 3O6QB 2RN0A 4I6MC 1BDDA 1BDCA 2OYHB 3QH9A 3IN6A 1GQ1A 3BCCD 2ZJSE 5CIEB 2OZ1A 1NH4A 4WQ9A 1C7MA 5KAIE 2V4HA 2A06E 3B5ND 1LJ2A 1BGYE 1NTZG 1L0NE 2LKMA 3OAKA 4H44D 3WU2H 5CCGD 4WQDA 2W6JH 4JYCA 3OJAB 5KLVK 2D0SA 3TNUA 2L4DA 3CXHD 3AECC 1Z56A 1NTME 2C1DA 1U74B 2C0XA 2OZ1B 5AW4B 2GIWA 4KT0J 1QL3A 4IL6E 1VQ5P 3HQ9A 3TGUJ 5AW3B 5AW1B 3RL0D 3HD7D 1S5LE 2CPSA 3F5HA 3CP5A 5AW9B 4WQ8A 3HD7A 3TNUB 1B7VA 4H44B 3NXSA 2Q3IA 1WMKA 3L73G 2B11B 2K9YA 3Q5RA 3ZOXA 2D2CB 2QJPC 1N7SD 1FI3A 2Y9ZA 1SQVG 3L74E 2JDIH 1IFMA 2IBZE 1FZFA 1CRYA 4AX3A 1QLED 2D0WA 2FXOA 2BEZF 2QVAA 3HD7B 2FBWC 1VQMP 2FXPA 3Q2YA 1FZCA 3CMEP 5TJHA 1FOCA 4MN4C 4U3FG 1SS1A 1PP9E 1X22A 1NU1D 3RLMA 3F89A 1FCDC 3TK1A 1H33A 1KB9E 3PP5A 1N73A 1CO6A 1KQGB 3HQ8A 2N1TC 1N7SB 2NRGA 1IQCA 1JY3O 1C2RA 5C0ZA 1FZCB 1IFJA 1MZ9A 2YNYA 5KAIH 1W5CT 3I55P 2E5YA 1VQ8P 1W2BO 1CIGA 4K35A 1H33B 1N73B 1CTJA 1NTZK 3ABVC 2WZ7A 5KLVE 1CEDA 4XA4A 1DW3A 3H1KD 1JY2O 3JCUH 5KLIC 4N3YB 3GHGA 3RBXA 2CXBA 2B9BA 1JMBA 2HR3A 1BGYJ 2W83C 1L0NJ 2KLVA 1N86A 3MUDC 3U1CA 1XTGB 4N78E 3CXHH 2MJZA 1GW3A 4TLFA 2HFED 2KS1A 4EI2A 1NTMJ 4D6TE 1EB7A 3GHGB 3JC22 1H88A 4KJMA 4AQRD 2N1TD 2QJPB 3MGNA 4ZKPA 4Y99C 4Y5RA 3L4MA 1F1CA 1KV9A 3HQ6A 1SQVK 1SQPG 1FJPA 1C52A 2KS1B 2ZYAA 4K3AA 3FWLA 1QL1A 1PGQA 1VQOP 1VQLP 1NYHA 1QL4A 3VN0A 1VL2A 3NTNA 1NTKD 3L70E 2A45I 3CWBD 1QN2A 2O01J 4IFDK 1CSVA 5EFWB 4PJ0V 1P84E 2QRXA 3O8ZA 2GB8B 1COTA 5CCHA 5EXQA 1SVFA 2WSCJ 1CRIA 1JTHA 1VQNP 1Q2NA 2WSSH 1FDIA 1SQQJ 2NZ2A 2E75B 2KYVA 4WQEA 1HZVA 4EIEA 5AVUB 3CX5H 1C75A 4DT0A 1GKSA 1WVEC 2Q7CA 1KV4A 4K3IA 2N18B 5APXA 1NTZE 1YCCA 1I6EA 4L76A 5AVWB 1DW1A 3ZOOA 4UB8E 1FOSE 1JTHB 3KZIE 1IK9A 1U75B 3R2PA 3L37A 2B87A 3AE7C 1EZVD 3CCUP 1YQ4C 2BCCD 3DMIA 5CIHB 2LXBA 2WSEJ 5KLVJ 1AVYA 1DT1A 2XNXA 1IC2A 4WY4A 1GK6A 1LS9A 5APSA 1C2NA 3H25A 2E43A 1BE3D 2B87B 3L73E 3KXDA 3L35A 1SQBG 3V4QA 2BEQD 4WBAA 1ZRTD 1C6OA 4RESB 5C9MA 1SQVE 2ZONG 5AVRB 3VOPA 1HH7A 4D6TJ 4WY4B 1GIWA 1SQPK 3LW5H 1I6DA 1CSUA 3P8MC 3QWOC 1RE4A 1LWUC 2YKQA 3A0HV 4U3FE 2OTLP 3V5BA 2GM4A 1SFCC 1YJWP 1P84H 1KILA 5KJ7C 3IAOA 2Q5UA 3M0DA 2FYNC 1CC5A 2WVRA 4PD4D 1K8AQ 1KILE 1KMIZ 3AEFC 3RK3B 1JDLA 4O1WA 4GIFA 3L70J 2IDBA 4BWNA 3L71D 2V7QH 2M0BA 1BCCD 3G71P 1YYCA 1NKZB 1KILB 5B5EV 1CIHA 1YI2P 4WVZA 2PCBB 2Z5HA 1HWTC 1R5SA 2I8DA 3H1ID 1CHHA 3MK7C 3KZIH 4LLHA 1CRHA 1M60A 1CYIA 1K3HA 3BVHA 3N7NA 4A7PA 2XNDH 4RSZA 1U57A 1IZNB 3WU2V 1A2SA 1NTZJ 2FFDC 1K9MQ 1RQVA 2BLFB 1LTGC 4AANA 1I8OA 1BL9A 1VYDA 3CCLP 5APUA 3HTKA 1Y8AA 1SFCD 5B6QA 1FZAA 1L9JC 4L74A 4FA4A 1L2PA 3VYIA 4PW9B 1VPCA 2M3EA 1SQBK 3PTZA 2R5BA 5E79V 1DW0A 2FYUD 3H1LD 3EFFK 1SQPE 3HTKB 2MKVA 3L73J 1G2CA 1QYZA 1X9VA 4YE1A 3M91A 3L72D 3MHVA 3L74G 3AE5C 3AE2C 2XTSB 1SFCB 1SQVJ 1L4AC 1Q90D 2ZXEB 1CYCA 4GOFA 4BXLA 1LT9C 2FYNB 3HQ7A 3A0BV 4FA9A 3C2CA 1M1JC 3L4OA 4V2KA 2QA4P 4GEDB 4U3FJ 1G2CB 4JPZB 2O1JA 2YKPA 1ZN5A 4ZMDA 5DJQC 1FZEA 2YIUC 2FXMA 1T3JA 2WT7A 2QM7A 2YK3A 3AE9C 1YFCA 3S4RA 2ORLA 4AAOA 1AFOA 4MU8A 1NU1G 3BRTB 2XKMA 3GG2A 1QX8A 5KAIV 1U7JA 3PXWA 3CCMP 3EQ2A 2ITAA 3TGUD 2XZRA 2WT7B 5DJTB 2B12B 1IFIA 3CCRP 4WWIA 4C7RA 3I5CA 5H2FH 2DGEA 1S9KE 1KYOI 2E74B 1RF1A 1W2EA 4IL6V 1HF9A 2N3YA 3WFCC 2JO1A 1L4AD 1I5TA 1S5LV 3H6PA 2WITA 5CYTR 1SQBE 1OXZA 3H1KG 2Z5IA 1R5LA 1Q82Q 1M6ZA 1JMMA 5DFSA 3NMDA 2A45H 1TU3F 2WSFJ 4EICA 3N4XA 3OA7A 1IFNA 1J1EC 3CXHW 1N90A 1LTJC 3H1JG 3S9OA 2IX7C 3JSVC 1L4AB 1HUCA 1SQPJ 3SSUA 1ZR4A 3E1IA 1AOFA 1I8PA 3L75G 2L5GB 2BH5X 3GLMA 3EFGA 1CCRA 3D6ZA 3V2PA 5CBNA 1IO3A 3I56P 3U59A 2W90A 4FAVA 2OARA 1NU1K 1CIFA 3H1HJ 1OVVA 2P1JA 2A06D 2O1KA 1KB0A 4PV1C 2C9NY 2AI5A 1L0ND 1HJ5A 2H43A 1OVRA 2KXPB 2SPZA 2H89C 2E76C 1RH5B 3B5NA 2KOGA 5CCGA 1FC2C 1RF0C 4R4LA 3JCUE 1RAPA 3CX5W 5AW6B 3WUTA 2KSJA 1G1IA 1OW6A 2IFNA 2HPCA 1KN7A 2NPSC 2Q6QA 1U7MA 3A7OA 3SWSA 4OWFA 3FX0A 3GMAA 4HKZH 1VF5C 3B4SA 1DEBA 3NWVA 5AW2B 2JWAA 3CXHE 3M9BA 3Q3DA 3WUUA 1YQ3C 3B5NB 3M06A 5APVA 1GK4A 3VMAA 2B89A 3RMZA 2CE0A 1T6AA 2PACA 1EZVI 1H9YA 1SQXD 2HPCB 1KZUB 5CIDB 1HJ4A 1M56D 2IYPA 3MTUE 4WB4A 5GTHH 4GKGA 1OIPA 1SQBJ 4GYDA 5CBOA 1YICA 2XDJA 3V2QA 2CE1A 3P8CD 5KAFV 1CW5A 1N7SA 1ZV8A 2RH0A 4GT1A 4O9BA 3CPWO 3RL0B 1H31A 1IO4A 4UB6H 2AIUA 3VTPC 1CORA 4L73A 1SQQD 2W8ZA 4PV1D 2P7JA 5M1BA 3T97A 1S3JA 2E76D 3VNWA 1K3GA 3WC8A 1PPJD 2WQYC 1YITP 1NAFA 1AKKA 1HJBA 4NPFX 1AV1A 2NPSD 1H31B 2M5AB 2OTKE 2B88A 3FGAD 1VQ4P 2BPBB 1IK7A 1NU1E 1KYOD 2H7HA 3T97B 1S72P 3AE6C 3CX5E 2WPRA 3VMXA 3CL3D 4H0KA 3MIWA 1S4XA 5CIGB 5KKZC 1M1KQ 2JEEA 2E5TA 4UB8V 5KLVD 4PD4I 3NFQA 3BRVB 4GODA 3KZIV 2MHMA 1MFZA 2W27A 3KDPB 4JQ0D 1CZQA 1M8OB 1MKMA 3L71G 1AA0A 1LP1B 4JBZA 1OW8A 1M57D 2QIWA 1I54A 4QMAA 3H1IG 2WPSA 5DJUB 1CYJA 5L8RJ 2I1JA 4RJTA 2FY8A 2K88A 3H1KE 3CCVP 3B8EB 4D6TD 3FXDA 1ZXGA 4AYCA 1FHBA 2QEXP 3AE8C 1BSHA 1DVVA 5B66H 4EIJA 1EDLA 2FKWB 2RMZA 3C1LA 3VMYA 1PZQA 3KQGA 2HODA 3S1KA 3H1JE 2PAJA 1PV3A 1FAVA 2N1TA 1MFTA 1X0TA 4IFFA 1GD2E 2ZVOB 1OMIA 1KORA 1KC8Q 2O01N 2YKOA 2A45G 2AXTH 2O01H 2P58A 1LNQA 2FRCA 4RO0A 3L74J 2OGUA 1T2KC 3H1LG 2LXCB 3L75E 2HODB 4TT3H 3Q5PA 3VMZA 1KQLA 4GOEA 1HCMA 2N1TB 1LC1A 2WPQA 1AVOA 1CI6A 1OCDA 2R32A 3L72G 4EOTA 1PP9J 1NTKE 3RL0g 1FE6A 4I1LA 1C6SA 1JCCA 3WFDC 3P32A 2IZ0A 3MUDA 5TISV 3IR9A 1JUNA 4YXDC 1ZW0A 3ITKA 3ZDMA 3IF4A 1RZ6A 1CI6B 1EDKA 1KYOH 1NU1J 5KLIB 1JNMA 3PHLA 3FWNA 2C9XB 3LIDA 5BU5A 2MTAC 1GMJA 1FOSF 1CHIA 1ZLLA 1OWAA 1RE3C 4C46A 2ZXXA 4RKUJ 1L0LG 1EC5A 1IRVA 1NKNA 2YMKA 3C9IA 2PRRA 1T2KD 1HJ3A 3CI9A 1EZVE 3NBTA 3L73D 2OTJP 5GTIE 4Q5PA 2BCCE 4I7ZC 2PP6A 1YJNP 1URQC 4Y99B 1S2EA 5APQA 3GW6A 3TSIA 3H1KJ 3AEAC 2KK7A 2C9LY 2C1UA 1PFIA 5CIBB 1BE3E 4U3FD 1GU2A 1ZRTE 3UIAA 2OYOA 1I55A 3H1JJ 3RK3E 2J59M 3SVWA 4FB1A 1YHQP 1EXJA 2H8PD 4H13C 1C6RA 4FANA 4FA5A 4AALA 1JY3P 3CMAP 1MG2D 2FWLA 3LW5J 4N6JA 4XYDB 2Q1KA 1W5CE 3RK2C 5AVXB 1FU1A 3P7KA 2GC7D 3L75J 4PJ0E 1IJDB 1W2LA 4CPGA 3HE4A 4PD4E 4ASWA 2C2CA 2VHDA 1JY2P 2C8SA 1WT6A 3HE5A 3L71E 1URQD 2V7QJ 3AEGC 2ZYGA 3ZOWA 2Z4EA 1ZR2A 1NJIQ 4PWAA 1Y9BA 3BCCG 3H1IE 3HE4B 1FDMA 3SWFA 1CTZA 5H2FE 3O0RC 3HE5B 1L0LK 2QJKC 1GDVA 1S6VB 5KJ7D 2YXRB 3SFEC 5GTIH 4IL6X 1LWUA 2JQRA 4H13D 4JCGA 1SFCA 5KJ7A 2GUVA 1NMIA 3SLEA 2KUBA 1R0QA 2YO2A 5APWA 2KIKA 5C39A 3PLNA 2C1VA 1AQTA 3VP8A 1J1DC 2QJYC 1PGPA 2WWWA 1M90Q 1KTMA 1CSWA 2H88C 1LWUB 3ZOYA 3KPEA 2YMYA 2AXCA 451CA 1A56A 3X39A 1FS0E 2FYUE 3M0AA 3H1LE 5APYA 4H13B 4LC1A 1SQXG 4LGDE 3K5BA 1QKSA 1J3SA 2KB7P 2KI7B 3L72E 1OAEA 3CC2P 1KFNA 2P2UA 1DD4A 3H1HD 4HYTB 3D0WA 2IBZI 3WUVA 4P4QB 4PJ0H 2JWDA 1DIIC 2N9IA 2FFDA 4PD4H 1SLQA 4WQAA 1GDTA 5AURA 3MK7B 2Y0CA 5AVYB 1QEXA 3CLQA 2R44A 1KB9I 1PL5A 5AVTB 2OYHC 1F1FA 2JTIB 2FFDB 3V2NA 2EXVA 1X79B 1HVVA 1FBMA 1CHJA 1H0TA 1R8EA 3HUSC 2GC4D 3DR0A 1L0LE 1CNOA 1BSNA 1KFMA 3VYMA 2KP8A 1DX7A 1GL2C 4XXLA 2G3AA 3TGUE 2JR8A 1RY3A 2OYIC 2XV5A 3SFDC 2KSEA 2V07A 3A9FA 2AEFA 4EYYQ 4FA1A 2XU6A 1H8AA 1MV8A 1L4AA 1LTIC 3H1IJ 1LT9A 1NMLA 2V08A 3USSA 1H0TB 1HRCA 2ZVNB 1ETPA 1M1JA 1A02F 2PFXA 3AE3C 1N8RQ 2N9JA 1WEJF 1CRJA 2K3RA 3Q5SA 3OW2O 1G1JA 2QM8A 5GTHE 1M70A 3SXTA 4WQCA 2Y0DA 5E79E 4H44C 1LT9B 4AAMA 3D70A 2CK3H 1LFMA 2D2CC 1KIBA 1M1JB 4UB6E 1SQXK 1L9BC 2DVHA 3VRDA 2ZAEB 3TYIA 5DJQB 4OH8B 1H32B 2YIUB 3H1LJ 5AVQB 3HD7C 1ZOYC 1NIRA 1DIPA 2J5UA 1T8ZA 1GL2D 3U1AA 2J58A 1NTKG 1E5WA
chains in the Genus database with same CATH topology
1CIEA 2BGVX 1BE3D 3O1YA 4DY9A 5IY51 1DW2A 3WFEC 3WFBC 1I54A 1BGYD 2B4ZA 1ZRTD 1C6OA 5C9MA 2PCCB 1CYJA 2ZBOA 4RJTA 2ZONG 3OCDA 1RZ5A 1HH7A 4EIDA 3PXSA 1GIWA 3ZIYA 1NTMD 1A8CA 4D6TD 2YCCA 1I6DA 1CSUA 1FI7A 2CA4B 1CRCA 3JBTB 1FHBA 3A0HV 1DVVA 1AYGA 2KNCB 2RMZA 1E8EA 1DIQC 351CA 1CC5A 1KYOW 1E2RA 3OCDB 2CA3B 4PD4D 2LIRA 1YNRA 1JDLA 4O1WA 1L0LD 2QJKB 1YEBA 3L71D 1BCCD 2FRCA 4L1QA 2BCNB 5B5EV 2ZOOA 3L74D 4O1QA 1CIHA 2IBZD 1SQBD 1HCMA 2PCBB 1N15A 1LC1A 3H1ID 1CHHA 3MK7C 2HV4A 1OCDA 1CRHA 1M60A 1CYIA 2C1DB 1CSXA 3KHUA 1K3HA 1C6SA 1PP9D 3WFDC 4A7PA 5B66V 2QJYB 4RSZA 1HZUA 3WU2V 2I8FA 1A2SA 1KB9D 2N9YB 1IZL0 5TISV 1DVHA 1H32A 1CRGA 2BLFB 1FI9A 4AANA 3ITKA 1I8OA 1RZ6A 2LITA 1BL9A 1N50A 1NNOA 1VYDA 2QG4A 1RAQA 5KLIB 3TF5A 1CXCA 2B0ZB 5B6QA 3PHLA 2C9XB 2AXTV 1L9JC 5CICB 3O5CA 2MTAC 4FA4A 4PW9B 1CHIA 3CX5D 1YEAA 4EIFA 3PTZA 5E79V 1DW0A 4WQBA 2FYUD 3H1LD 3NBSA 1MZ4A 3ZBMA 2ZXYA 1H1OA 3PXTA 1IRVA 5CIFB 1HJ3A 1QYZA 3NBTA 4YE1A 3L73D 3L72D 4Q5PA 2N18C 2XTSB 1CXAA 1CYCA 2RN0A 3GW6A 2FYNB 3HQ7A 2C1UA 1CCHA 3A0BV 3C2CA 4FA9A 1GQ1A 1FJ0A 5CIBB 3BCCD 3L4OA 5CIEB 4V2KA 2OZ1A 4GEDB 5GTIV 4WQ9A 1C7MA 4U3FD 5DJQC 1N9CA 1GU2A 1I55A 3PRJA 4WQDA 2YK3A 3SVWA 4FB1A 3H1JD 1YFCA 2ORLA 2D0SA 4AAOA 1C6RA 4L3GA 4FANA 2L4DA 3CXHD 4FA5A 4AALA 4MU8A 1YTCA 4KMGA 2C1DA 1U74B 1MG2D 3GG2A 2FWLA 2OZ1B 4XYDB 5KAIV 2GIWA 1QL3A 3PXWA 3L70D 3HQ9A 1MG3D 3TGUD 3WUIA 2GC7D 2L91A 1P84D 3CP5A 3CU4A 2YQBA 3L75D 2B12B 4WQ8A 1W2LA 1B7VA 2C2CA 2DGEA 2VHDA 2C8SA 2B11B 4LJIA 4IL6V 3SJLA 3ZOXA 2N3YA 3WFCC 1I5TA 1S5LV 1FI3A 3ZOWA 4EDFA 4PWAA 5CYTR 3DP5A 1CRYA 4AX3A 2ZZS1 2D0WA 1NTZD 5KKZB 1H9XA 1M6ZA 2Q3EA 1CTZA 5TJHA 1FOCA 3O0RC 1AOQA 5DFSA 3ORVA 1GDVA 1S6VB 1NU1D 3RLMA 1FCDC 4EICA 3CXHW 1N90A 1H33A 2JQRA 4JCGA 1CO6A 3CYTI 3HQ8A 2N3BA 4NFGB 1NMIA 1KX2A 3SLEA 1R0QA 1IQCA 5H2FV 2O3JA 1C2RA 3O20A 5C0ZA 3PLNA 2C1VA 1W5CT 4N0KA 1AOFA 1CSWA 1I8PA 1CIGA 1HROA 3ZOYA 1H33B 2BH5X 1CCRA 451CA 1A56A 2B10B 3M97X 3X39A 1CTJA 1CEDA 1SQVD 1IO3A 1DW3A 3H1KD 4FAVA 3TDKA 1QKSA 1J3SA 2CXBA 1CIFA 1OAEA 4WQ7A 3OA8A 2A06D 3H1HD 5DF5A 1KB0A 4P4QB 2AI5A 1L0ND 1HJ5A 1KX7A 1DIIC 1IRWA 4J20A 2N9IA 2KS1A 4WQAA 1YIQA 5AURA 3MK7B 1EB7A 1RAPA 2Y0CA 3CX5W 2QJPB 3SWSA 3OA8B 4Y5RA 3L4MA 1F1CA 1KV9A 1F1FA 3HQ6A 1LMSA 2JTIB 3RN1A 2EXVA 3NWVA 1C52A 2JWAA 1CHJA 3FWLA 1E29A 3VMAA 3RMZA 2GC4D 2CE0A 3DR0A 1QL4A 1CNOA 2PACA 1H9YA 1SQXD 1NTKD 3VYMA 5CIDB 1HJ4A 4XXLA 2BH4X 1GJQA 3CWBD 1QN2A 1CSVA 4GYDA 1YICA 2V07A 4PJ0V 2CE1A 4H0JA 1LC2A 5KAFV 3A9FA 2GB8B 1COTA 4FA1A 5EXQA 3PH2B 1CRIA 1NMLA 2V08A 1H31A 1HRCA 2AIUA 1ZZHA 1ETPA 4WQEA 1CORA 1HZVA 1SQQD 4EIEA 1C75A 2N9JA 1WEJF 4L3HA 1GKSA 1CRJA 155CA 1WVEC 3VNWA 1K3GA 4K3IA 3WC8A 1M70A 1PPJD 2N18B 3SXTA 1YCCA 4WQCA 1I6EA 1AKKA 2Y0DA 1DW1A 3ZOOA 3ZCFA 4AAMA 1H31B 1SQPD 1LFMA 1U75B 2BPBB 1KIBA 1KYOD 2K9JB 1EZVD 3RN0A 5GTHV 1L9BC 2BCCD 1CTYA 2DVHA 3DMIA 5CIHB 2Y0EA 4H0KA 4QAOA 3VRDA 3TYIA 5DJQB 5CIGB 1H32B 2YIUB 4UB8V 5KLVD 1DT1A 1NIRA 3KZIV 2MHMA 4UB6V 1LS9A 1C2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CIE A;  2BGV X;  1BE3 D;  3O1Y A;  4DY9 A;  5IY5 1;  1DW2 A;  3WFE C;  3WFB C;  1I54 A;  1BGY D;  2B4Z A;  1ZRT D;  1C6O A;  5C9M A;  2PCC B;  1CYJ A;  2ZBO A;  4RJT A;  2ZON G;  3OCD A;  1RZ5 A;  1HH7 A;  4EID A;  3PXS A;  1GIW A;  3ZIY A;  1NTM D;  1A8C A;  4D6T D;  2YCC A;  1I6D A;  1CSU A;  1FI7 A;  2CA4 B;  1CRC A;  3JBT B;  1FHB A;  3A0H V;  1DVV A;  1AYG A;  2KNC B;  2RMZ A;  1E8E A;  1DIQ C;  351C A;  1CC5 A;  1KYO W;  1E2R A;  3OCD B;  2CA3 B;  4PD4 D;  2LIR A;  1YNR A;  1JDL A;  4O1W A;  1L0L D;  2QJK B;  1YEB A;  3L71 D;  1BCC D;  2FRC A;  4L1Q A;  2BCN B;  5B5E V;  2ZOO A;  3L74 D;  4O1Q A;  1CIH A;  2IBZ D;  1SQB D;  1HCM A;  2PCB B;  1N15 A;  1LC1 A;  3H1I D;  1CHH A;  3MK7 C;  2HV4 A;  1OCD A;  1CRH A;  1M60 A;  1CYI A;  2C1D B;  1CSX A;  3KHU A;  1K3H A;  1C6S A;  1PP9 D;  3WFD C;  4A7P A;  5B66 V;  2QJY B;  4RSZ A;  1HZU A;  3WU2 V;  2I8F A;  1A2S A;  1KB9 D;  2N9Y B;  1IZL 0;  5TIS V;  1DVH A;  1H32 A;  1CRG A;  2BLF B;  1FI9 A;  4AAN A;  3ITK A;  1I8O A;  1RZ6 A;  2LIT A;  1BL9 A;  1N50 A;  1NNO A;  1VYD A;  2QG4 A;  1RAQ A;  5KLI B;  3TF5 A;  1CXC A;  2B0Z B;  5B6Q A;  3PHL A;  2C9X B;  2AXT V;  1L9J C;  5CIC B;  3O5C A;  2MTA C;  4FA4 A;  4PW9 B;  1CHI A;  3CX5 D;  1YEA A;  4EIF A;  3PTZ A;  5E79 V;  1DW0 A;  4WQB A;  2FYU D;  3H1L D;  3NBS A;  1MZ4 A;  3ZBM A;  2ZXY A;  1H1O A;  3PXT A;  1IRV A;  5CIF B;  1HJ3 A;  1QYZ A;  3NBT A;  4YE1 A;  3L73 D;  3L72 D;  4Q5P A;  2N18 C;  2XTS B;  1CXA A;  1CYC A;  2RN0 A;  3GW6 A;  2FYN B;  3HQ7 A;  2C1U A;  1CCH A;  3A0B V;  3C2C A;  4FA9 A;  1GQ1 A;  1FJ0 A;  5CIB B;  3BCC D;  3L4O A;  5CIE B;  4V2K A;  2OZ1 A;  4GED B;  5GTI V;  4WQ9 A;  1C7M A;  4U3F D;  5DJQ C;  1N9C A;  1GU2 A;  1I55 A;  3PRJ A;  4WQD A;  2YK3 A;  3SVW A;  4FB1 A;  3H1J D;  1YFC A;  2ORL A;  2D0S A;  4AAO A;  1C6R A;  4L3G A;  4FAN A;  2L4D A;  3CXH D;  4FA5 A;  4AAL A;  4MU8 A;  1YTC A;  4KMG A;  2C1D A;  1U74 B;  1MG2 D;  3GG2 A;  2FWL A;  2OZ1 B;  4XYD B;  5KAI V;  2GIW A;  1QL3 A;  3PXW A;  3L70 D;  3HQ9 A;  1MG3 D;  3TGU D;  3WUI A;  2GC7 D;  2L91 A;  1P84 D;  3CP5 A;  3CU4 A;  2YQB A;  3L75 D;  2B12 B;  4WQ8 A;  1W2L A;  1B7V A;  2C2C A;  2DGE A;  2VHD A;  2C8S A;  2B11 B;  4LJI A;  4IL6 V;  3SJL A;  3ZOX A;  2N3Y A;  3WFC C;  1I5T A;  1S5L V;  1FI3 A;  3ZOW A;  4EDF A;  4PWA A;  5CYT R;  3DP5 A;  1CRY A;  4AX3 A;  2ZZS 1;  2D0W A;  1NTZ D;  5KKZ B;  1H9X A;  1M6Z A;  2Q3E A;  1CTZ A;  5TJH A;  1FOC A;  3O0R C;  1AOQ A;  5DFS A;  3ORV A;  1GDV A;  1S6V B;  1NU1 D;  3RLM A;  1FCD C;  4EIC A;  3CXH W;  1N90 A;  1H33 A;  2JQR A;  4JCG A;  1CO6 A;  3CYT I;  3HQ8 A;  2N3B A;  4NFG B;  1NMI A;  1KX2 A;  3SLE A;  1R0Q A;  1IQC A;  5H2F V;  2O3J A;  1C2R A;  3O20 A;  5C0Z A;  3PLN A;  2C1V A;  1W5C T;  4N0K A;  1AOF A;  1CSW A;  1I8P A;  1CIG A;  1HRO A;  3ZOY A;  1H33 B;  2BH5 X;  1CCR A;  451C A;  1A56 A;  2B10 B;  3M97 X;  3X39 A;  1CTJ A;  1CED A;  1SQV D;  1IO3 A;  1DW3 A;  3H1K D;  4FAV A;  3TDK A;  1QKS A;  1J3S A;  2CXB A;  1CIF A;  1OAE A;  4WQ7 A;  3OA8 A;  2A06 D;  3H1H D;  5DF5 A;  1KB0 A;  4P4Q B;  2AI5 A;  1L0N D;  1HJ5 A;  1KX7 A;  1DII C;  1IRW A;  4J20 A;  2N9I A;  2KS1 A;  4WQA A;  1YIQ A;  5AUR A;  3MK7 B;  1EB7 A;  1RAP A;  2Y0C A;  3CX5 W;  2QJP B;  3SWS A;  3OA8 B;  4Y5R A;  3L4M A;  1F1C A;  1KV9 A;  1F1F A;  3HQ6 A;  1LMS A;  2JTI B;  3RN1 A;  2EXV A;  3NWV A;  1C52 A;  2JWA A;  1CHJ A;  3FWL A;  1E29 A;  3VMA A;  3RMZ A;  2GC4 D;  2CE0 A;  3DR0 A;  1QL4 A;  1CNO A;  2PAC A;  1H9Y A;  1SQX D;  1NTK D;  3VYM A;  5CID B;  1HJ4 A;  4XXL A;  2BH4 X;  1GJQ A;  3CWB D;  1QN2 A;  1CSV A;  4GYD A;  1YIC A;  2V07 A;  4PJ0 V;  2CE1 A;  4H0J A;  1LC2 A;  5KAF V;  3A9F A;  2GB8 B;  1COT A;  4FA1 A;  5EXQ A;  3PH2 B;  1CRI A;  1NML A;  2V08 A;  1H31 A;  1HRC A;  2AIU A;  1ZZH A;  1ETP A;  4WQE A;  1COR A;  1HZV A;  1SQQ D;  4EIE A;  1C75 A;  2N9J A;  1WEJ F;  4L3H A;  1GKS A;  1CRJ A;  155C A;  1WVE C;  3VNW A;  1K3G A;  4K3I A;  3WC8 A;  1M70 A;  1PPJ D;  2N18 B;  3SXT A;  1YCC A;  4WQC A;  1I6E A;  1AKK A;  2Y0D A;  1DW1 A;  3ZOO A;  3ZCF A;  4AAM A;  1H31 B;  1SQP D;  1LFM A;  1U75 B;  2BPB B;  1KIB A;  1KYO D;  2K9J B;  1EZV D;  3RN0 A;  5GTH V;  1L9B C;  2BCC D;  1CTY A;  2DVH A;  3DMI A;  5CIH B;  2Y0E A;  4H0K A;  4QAO A;  3VRD A;  3TYI A;  5DJQ B;  5CIG B;  1H32 B;  2YIU B;  4UB8 V;  5KLV D;  1DT1 A;  1NIR A;  3KZI V;  2MHM A;  4UB6 V;  1LS9 A;  1C2N A; 
#chains in the Genus database with same CATH topology
 3CWB G;  1CIE A;  3L72 J;  1QVF O;  1OFC X;  1Y47 A;  3O1Y A;  4DY9 A;  1GL2 A;  1DW2 A;  1ZP0 C;  1Q7Y Q;  5B5E H;  1BGY D;  2B4Z A;  2WTY A;  4YPC A;  4H0L C;  1FZC C;  1RZ5 A;  3C8V A;  3PXS A;  3BCC E;  3CCJ P;  3PH0 A;  3AE4 C;  1LT1 A;  1NTM D;  1A8C A;  2G8Y A;  3HUS B;  2E42 A;  1CRC A;  3JBT B;  3V4W A;  1GL2 B;  1DEE G;  1N73 C;  5AW7 B;  5BVZ A;  1GZL A;  2OYI B;  1LTJ A;  3E7K A;  3R4Y A;  1KQS O;  5KTB A;  1DIQ C;  351C A;  1KQF B;  1KYO W;  2D2C D;  3MP7 B;  1HGV A;  2LIR A;  1YNR A;  1L0L J;  5AW0 B;  1JO5 A;  3V2R A;  1EZV G;  3D71 A;  3BAT A;  2BCC G;  5CJ0 A;  5B66 E;  1A02 J;  1J1E B;  3L74 D;  4O1Q A;  1LTJ B;  2IBZ D;  5E79 H;  1X8Y A;  3G3Z A;  1Q81 Q;  5AVS B;  1N15 A;  2HV4 A;  3GHG C;  2WPV B;  2M5A A;  2C1D B;  1BE3 G;  4YTP C;  3KHU A;  1SQX E;  2WMM A;  1PP9 D;  1QGK B;  2AXT E;  1AQ5 A;  3P8C E;  4H0L D;  2RKL A;  1KB9 D;  2N9Y B;  1DVH A;  1CRG A;  1KD1 Q;  4Y28 J;  1PGJ A;  3SWY A;  1FI9 A;  4HB1 A;  4IFM A;  3A0B H;  2LIT A;  1RAQ A;  1SQQ E;  3TF5 A;  1RF0 A;  1CXC A;  2B0Z B;  1NTK K;  2K37 A;  3O5C A;  2R5D A;  1LP1 A;  1VF5 D;  2NPS A;  3CX5 D;  2W6B A;  1PPJ E;  1YEA A;  4EIF A;  1D7M A;  4PV1 B;  4U7J A;  4WQB A;  3CCS P;  2E76 B;  1MZ4 A;  4H0L B;  2ZXY A;  2E75 C;  1H1O A;  3PXT A;  2AEM A;  5CIF B;  1KYO E;  3AED C;  1BCC G;  4R4M A;  2R3C A;  3H32 A;  2NPS B;  2N18 C;  3AE1 C;  5K5G B;  1QVG O;  1AJY A;  5CCH C;  5CHX A;  4N78 D;  1VF5 B;  3BCC J;  1CCH A;  1FJ0 A;  4DOJ A;  4IL6 H;  4DCK A;  5GTI V;  2HYN A;  1S5L H;  3H32 B;  1N9C A;  3B71 A;  3PRJ A;  3CD6 P;  2IFM A;  3H1J D;  4L3G A;  2P10 A;  3HRN A;  1YTC A;  4KMG A;  1IFP A;  1YJ9 P;  3L4F A;  3LIE A;  3L70 D;  5AW8 B;  1MG3 D;  3RBZ A;  3BAS A;  1EXI A;  3WUI A;  3Q1M A;  3W67 A;  2L91 A;  1HJ0 A;  2FYU G;  1P84 D;  3CU4 A;  3L75 D;  2YQB A;  2E75 D;  5KAF E;  2IZ1 A;  1FZG A;  2VRS A;  1USE A;  2WSC H;  2Q9I A;  1NHL A;  4WY4 C;  5AVZ B;  1NOH A;  5CJ4 A;  1HBW A;  1SQX J;  1OZH A;  4LJI A;  3RGU A;  5AVV B;  3SJL A;  5CCH D;  1LTT C;  1KB9 H;  3CWB E;  1VQ7 P;  4EDF A;  3DP5 A;  1LGH B;  1USD A;  1YTZ I;  1ZME C;  2ZZS 1;  1NTZ D;  5KKZ B;  4W7Z A;  1YTZ T;  4IOI H;  1H9X A;  3RK3 C;  2R3S A;  2Q3E A;  2YXQ B;  1AOQ A;  1RE4 C;  3ORV A;  3H1H G;  4XE5 B;  1KIL C;  3AEB C;  3M0D C;  3CYT I;  3TYY A;  2WSE H;  1K04 A;  4Z1M H;  2N3B A;  4NFG B;  1KX2 A;  2QE7 H;  2KZI A;  5H2F V;  2O3J A;  3O20 A;  1K05 A;  2CPB A;  3TGU G;  1FDO A;  5APT A;  4N0K A;  1RHZ B;  2FYZ A;  1HRO A;  3IFM A;  4WY4 D;  1MUU A;  4DZO A;  2YO3 A;  2B10 B;  3M97 X;  3G9R A;  1SQV D;  2HLO A;  1EDJ A;  2M3B A;  2Y9Y A;  3TDK A;  3L36 A;  4ASV A;  4HH2 A;  1GU5 A;  4WQ7 A;  1QL2 A;  3OA8 A;  3G4S P;  2GUS A;  5DF5 A;  3RK3 D;  5KAF H;  1KX7 A;  4I2L C;  1IRW A;  4J20 A;  4BRY A;  4DJG A;  2JP3 A;  1EDI A;  2FYU K;  1YIQ A;  1KIL D;  4YXW H;  2JKV A;  1NVO A;  3CC7 P;  3FXE A;  1N7L A;  3OA8 B;  1J2J B;  3A2A A;  1UIX A;  1LMS A;  4BRY B;  3A5T A;  3RN1 A;  1RE3 A;  4B86 A;  1E29 A;  2IYO A;  1JOC A;  2JJL A;  3V6I A;  1NTK J;  1S1C X;  1K73 Q;  3E1R A;  3CWB J;  4GDO A;  2ZT9 C;  2BH4 X;  1GJQ A;  1BCC E;  4HJG H;  3II6 A;  4H0J A;  1LC2 A;  4OVN F;  1VQ6 P;  5TIS E;  1URQ A;  4UB8 H;  4W80 A;  3PH2 B;  1ZZH A;  3CCE P;  2AEJ A;  2K9J A;  2A06 G;  1HH0 A;  1N2D C;  1BGY G;  4ZKU A;  4L3H A;  1L0N G;  2K1A A;  3GF3 A;  1OW7 A;  155C A;  4OGQ C;  1S5L X;  4I7Z B;  2KZJ A;  2M8R A;  1URQ B;  1LTA C;  1NTM G;  3ZCF A;  2E74 C;  3RK2 D;  1SQP D;  2LR2 A;  1JB0 J;  2K9J B;  3AEE C;  2BCC J;  1NWQ A;  3RN0 A;  5GTH V;  3EWK A;  3M9Q A;  2Y0E A;  1CTY A;  1FZB A;  2IPP A;  4QAO A;  2HG5 D;  1JY3 N;  1VQK P;  1VQ9 P;  3CXH I;  1SP4 A;  1NAY A;  2UWJ E;  1RF1 C;  1CSB A;  1JM0 A;  2ZT9 D;  4UB6 V;  1LTB C;  1BE3 J;  4JF7 A;  2BGV X;  4NPE A;  5IY5 1;  4NPD A;  3RK2 B;  1T3U A;  2IBZ G;  4KHX A;  3WFE C;  2KNC A;  3A0H E;  1NO4 A;  3WFB C;  1PGO A;  3W68 A;  1JY2 N;  2PCC B;  4W7Y A;  2ZBO A;  1XTC C;  4JYB A;  3OCD A;  4EID A;  3D6Y A;  1PP9 G;  3ZIY A;  1SQQ G;  2YCC A;  1HGZ A;  1FI7 A;  2CA4 B;  1NGM B;  4OGQ D;  5BU8 B;  2P67 A;  3MD0 A;  1AYG A;  2ZT9 B;  3H1H E;  1PPJ G;  4M3L A;  2KNC B;  1H89 A;  1RQU A;  1E8E A;  2E74 D;  3KYQ A;  5TIS H;  3WMM 0;  1JEK A;  5B5E E;  1E2R A;  3OCD B;  2CA3 B;  1VQP P;  1GTW A;  1S9K D;  1L0L D;  3L71 J;  1BCC J;  2QJK B;  1YEB A;  2ZFC A;  2N9B A;  3CX5 I;  1PIX A;  2OQQ A;  4L1Q A;  2BCN B;  1DD3 A;  1L0N K;  5KLV G;  2ZOO A;  4OGQ B;  1YBK A;  1SQB D;  3WU2 E;  4C7N A;  4L75 A;  2POH A;  1WRG A;  1NTM K;  1CSX A;  1GW4 A;  2C0W A;  3MZW B;  1YIJ P;  1JCD A;  2WSF H;  1J1D B;  5B66 V;  2QJY B;  1UII A;  2ZYD A;  4ZNC A;  1FJK A;  1HZU A;  2I8F A;  1GU4 A;  1OX3 A;  1Q86 Q;  1IZL 0;  1VDF A;  1H32 A;  3B5N C;  1M7L A;  4C7N B;  4D6T G;  2BAS A;  5CCG C;  1N50 A;  1NNO A;  2QG4 A;  1RF1 B;  1DH3 A;  2AXT V;  1LTS C;  5CIC B;  4AUW A;  2QSI A;  3A0H H;  3GF7 A;  1HTL C;  1E79 H;  3O6Q A;  3M9H A;  1OVU A;  2FYU J;  3RL0 C;  3SWK A;  2OYH A;  4XFJ A;  5CMZ A;  5AW5 B;  3NBS A;  3VP9 A;  2W6A A;  3ZBM A;  3CC4 P;  2DW3 A;  1IFD A;  3A0B E;  3L70 G;  3HUS A;  1EQ7 A;  2PGD A;  3G6E P;  1SQQ K;  3PJS K;  3CCQ P;  2KLU A;  2I1K A;  2GA1 A;  3A3Y B;  1P84 I;  1CXA A;  2OYI A;  1N7S C;  3O6Q B;  2RN0 A;  4I6M C;  1BDD A;  1BDC A;  2OYH B;  3QH9 A;  3IN6 A;  1GQ1 A;  3BCC D;  2ZJS E;  5CIE B;  2OZ1 A;  1NH4 A;  4WQ9 A;  1C7M A;  5KAI E;  2V4H A;  2A06 E;  3B5N D;  1LJ2 A;  1BGY E;  1NTZ G;  1L0N E;  2LKM A;  3OAK A;  4H44 D;  3WU2 H;  5CCG D;  4WQD A;  2W6J H;  4JYC A;  3OJA B;  5KLV K;  2D0S A;  3TNU A;  2L4D A;  3CXH D;  3AEC C;  1Z56 A;  1NTM E;  2C1D A;  1U74 B;  2C0X A;  2OZ1 B;  5AW4 B;  2GIW A;  4KT0 J;  1QL3 A;  4IL6 E;  1VQ5 P;  3HQ9 A;  3TGU J;  5AW3 B;  5AW1 B;  3RL0 D;  3HD7 D;  1S5L E;  2CPS A;  3F5H A;  3CP5 A;  5AW9 B;  4WQ8 A;  3HD7 A;  3TNU B;  1B7V A;  4H44 B;  3NXS A;  2Q3I A;  1WMK A;  3L73 G;  2B11 B;  2K9Y A;  3Q5R A;  3ZOX A;  2D2C B;  2QJP C;  1N7S D;  1FI3 A;  2Y9Z A;  1SQV G;  3L74 E;  2JDI H;  1IFM A;  2IBZ E;  1FZF A;  1CRY A;  4AX3 A;  1QLE D;  2D0W A;  2FXO A;  2BEZ F;  2QVA A;  3HD7 B;  2FBW C;  1VQM P;  2FXP A;  3Q2Y A;  1FZC A;  3CME P;  5TJH A;  1FOC A;  4MN4 C;  4U3F G;  1SS1 A;  1PP9 E;  1X22 A;  1NU1 D;  3RLM A;  3F89 A;  1FCD C;  3TK1 A;  1H33 A;  1KB9 E;  3PP5 A;  1N73 A;  1CO6 A;  1KQG B;  3HQ8 A;  2N1T C;  1N7S B;  2NRG A;  1IQC A;  1JY3 O;  1C2R A;  5C0Z A;  1FZC B;  1IFJ A;  1MZ9 A;  2YNY A;  5KAI H;  1W5C T;  3I55 P;  2E5Y A;  1VQ8 P;  1W2B O;  1CIG A;  4K35 A;  1H33 B;  1N73 B;  1CTJ A;  1NTZ K;  3ABV C;  2WZ7 A;  5KLV E;  1CED A;  4XA4 A;  1DW3 A;  3H1K D;  1JY2 O;  3JCU H;  5KLI C;  4N3Y B;  3GHG A;  3RBX A;  2CXB A;  2B9B A;  1JMB A;  2HR3 A;  1BGY J;  2W83 C;  1L0N J;  2KLV A;  1N86 A;  3MUD C;  3U1C A;  1XTG B;  4N78 E;  3CXH H;  2MJZ A;  1GW3 A;  4TLF A;  2HFE D;  2KS1 A;  4EI2 A;  1NTM J;  4D6T E;  1EB7 A;  3GHG B;  3JC2 2;  1H88 A;  4KJM A;  4AQR D;  2N1T D;  2QJP B;  3MGN A;  4ZKP A;  4Y99 C;  4Y5R A;  3L4M A;  1F1C A;  1KV9 A;  3HQ6 A;  1SQV K;  1SQP G;  1FJP A;  1C52 A;  2KS1 B;  2ZYA A;  4K3A A;  3FWL A;  1QL1 A;  1PGQ A;  1VQO P;  1VQL P;  1NYH A;  1QL4 A;  3VN0 A;  1VL2 A;  3NTN A;  1NTK D;  3L70 E;  2A45 I;  3CWB D;  1QN2 A;  2O01 J;  4IFD K;  1CSV A;  5EFW B;  4PJ0 V;  1P84 E;  2QRX A;  3O8Z A;  2GB8 B;  1COT A;  5CCH A;  5EXQ A;  1SVF A;  2WSC J;  1CRI A;  1JTH A;  1VQN P;  1Q2N A;  2WSS H;  1FDI A;  1SQQ J;  2NZ2 A;  2E75 B;  2KYV A;  4WQE A;  1HZV A;  4EIE A;  5AVU B;  3CX5 H;  1C75 A;  4DT0 A;  1GKS A;  1WVE C;  2Q7C A;  1KV4 A;  4K3I A;  2N18 B;  5APX A;  1NTZ E;  1YCC A;  1I6E A;  4L76 A;  5AVW B;  1DW1 A;  3ZOO A;  4UB8 E;  1FOS E;  1JTH B;  3KZI E;  1IK9 A;  1U75 B;  3R2P A;  3L37 A;  2B87 A;  3AE7 C;  1EZV D;  3CCU P;  1YQ4 C;  2BCC D;  3DMI A;  5CIH B;  2LXB A;  2WSE J;  5KLV J;  1AVY A;  1DT1 A;  2XNX A;  1IC2 A;  4WY4 A;  1GK6 A;  1LS9 A;  5APS A;  1C2N A;  3H25 A;  2E43 A;  1BE3 D;  2B87 B;  3L73 E;  3KXD A;  3L35 A;  1SQB G;  3V4Q A;  2BEQ D;  4WBA A;  1ZRT D;  1C6O A;  4RES B;  5C9M A;  1SQV E;  2ZON G;  5AVR B;  3VOP A;  1HH7 A;  4D6T J;  4WY4 B;  1GIW A;  1SQP K;  3LW5 H;  1I6D A;  1CSU A;  3P8M C;  3QWO C;  1RE4 A;  1LWU C;  2YKQ A;  3A0H V;  4U3F E;  2OTL P;  3V5B A;  2GM4 A;  1SFC C;  1YJW P;  1P84 H;  1KIL A;  5KJ7 C;  3IAO A;  2Q5U A;  3M0D A;  2FYN C;  1CC5 A;  2WVR A;  4PD4 D;  1K8A Q;  1KIL E;  1KMI Z;  3AEF C;  3RK3 B;  1JDL A;  4O1W A;  4GIF A;  3L70 J;  2IDB A;  4BWN A;  3L71 D;  2V7Q H;  2M0B A;  1BCC D;  3G71 P;  1YYC A;  1NKZ B;  1KIL B;  5B5E V;  1CIH A;  1YI2 P;  4WVZ A;  2PCB B;  2Z5H A;  1HWT C;  1R5S A;  2I8D A;  3H1I D;  1CHH A;  3MK7 C;  3KZI H;  4LLH A;  1CRH A;  1M60 A;  1CYI A;  1K3H A;  3BVH A;  3N7N A;  4A7P A;  2XND H;  4RSZ A;  1U57 A;  1IZN B;  3WU2 V;  1A2S A;  1NTZ J;  2FFD C;  1K9M Q;  1RQV A;  2BLF B;  1LTG C;  4AAN A;  1I8O A;  1BL9 A;  1VYD A;  3CCL P;  5APU A;  3HTK A;  1Y8A A;  1SFC D;  5B6Q A;  1FZA A;  1L9J C;  4L74 A;  4FA4 A;  1L2P A;  3VYI A;  4PW9 B;  1VPC A;  2M3E A;  1SQB K;  3PTZ A;  2R5B A;  5E79 V;  1DW0 A;  2FYU D;  3H1L D;  3EFF K;  1SQP E;  3HTK B;  2MKV A;  3L73 J;  1G2C A;  1QYZ A;  1X9V A;  4YE1 A;  3M91 A;  3L72 D;  3MHV A;  3L74 G;  3AE5 C;  3AE2 C;  2XTS B;  1SFC B;  1SQV J;  1L4A C;  1Q90 D;  2ZXE B;  1CYC A;  4GOF A;  4BXL A;  1LT9 C;  2FYN B;  3HQ7 A;  3A0B V;  4FA9 A;  3C2C A;  1M1J C;  3L4O A;  4V2K A;  2QA4 P;  4GED B;  4U3F J;  1G2C B;  4JPZ B;  2O1J A;  2YKP A;  1ZN5 A;  4ZMD A;  5DJQ C;  1FZE A;  2YIU C;  2FXM A;  1T3J A;  2WT7 A;  2QM7 A;  2YK3 A;  3AE9 C;  1YFC A;  3S4R A;  2ORL A;  4AAO A;  1AFO A;  4MU8 A;  1NU1 G;  3BRT B;  2XKM A;  3GG2 A;  1QX8 A;  5KAI V;  1U7J A;  3PXW A;  3CCM P;  3EQ2 A;  2ITA A;  3TGU D;  2XZR A;  2WT7 B;  5DJT B;  2B12 B;  1IFI A;  3CCR P;  4WWI A;  4C7R A;  3I5C A;  5H2F H;  2DGE A;  1S9K E;  1KYO I;  2E74 B;  1RF1 A;  1W2E A;  4IL6 V;  1HF9 A;  2N3Y A;  3WFC C;  2JO1 A;  1L4A D;  1I5T A;  1S5L V;  3H6P A;  2WIT A;  5CYT R;  1SQB E;  1OXZ A;  3H1K G;  2Z5I A;  1R5L A;  1Q82 Q;  1M6Z A;  1JMM A;  5DFS A;  3NMD A;  2A45 H;  1TU3 F;  2WSF J;  4EIC A;  3N4X A;  3OA7 A;  1IFN A;  1J1E C;  3CXH W;  1N90 A;  1LTJ C;  3H1J G;  3S9O A;  2IX7 C;  3JSV C;  1L4A B;  1HUC A;  1SQP J;  3SSU A;  1ZR4 A;  3E1I A;  1AOF A;  1I8P A;  3L75 G;  2L5G B;  2BH5 X;  3GLM A;  3EFG A;  1CCR A;  3D6Z A;  3V2P A;  5CBN A;  1IO3 A;  3I56 P;  3U59 A;  2W90 A;  4FAV A;  2OAR A;  1NU1 K;  1CIF A;  3H1H J;  1OVV A;  2P1J A;  2A06 D;  2O1K A;  1KB0 A;  4PV1 C;  2C9N Y;  2AI5 A;  1L0N D;  1HJ5 A;  2H43 A;  1OVR A;  2KXP B;  2SPZ A;  2H89 C;  2E76 C;  1RH5 B;  3B5N A;  2KOG A;  5CCG A;  1FC2 C;  1RF0 C;  4R4L A;  3JCU E;  1RAP A;  3CX5 W;  5AW6 B;  3WUT A;  2KSJ A;  1G1I A;  1OW6 A;  2IFN A;  2HPC A;  1KN7 A;  2NPS C;  2Q6Q A;  1U7M A;  3A7O A;  3SWS A;  4OWF A;  3FX0 A;  3GMA A;  4HKZ H;  1VF5 C;  3B4S A;  1DEB A;  3NWV A;  5AW2 B;  2JWA A;  3CXH E;  3M9B A;  3Q3D A;  3WUU A;  1YQ3 C;  3B5N B;  3M06 A;  5APV A;  1GK4 A;  3VMA A;  2B89 A;  3RMZ A;  2CE0 A;  1T6A A;  2PAC A;  1EZV I;  1H9Y A;  1SQX D;  2HPC B;  1KZU B;  5CID B;  1HJ4 A;  1M56 D;  2IYP A;  3MTU E;  4WB4 A;  5GTH H;  4GKG A;  1OIP A;  1SQB J;  4GYD A;  5CBO A;  1YIC A;  2XDJ A;  3V2Q A;  2CE1 A;  3P8C D;  5KAF V;  1CW5 A;  1N7S A;  1ZV8 A;  2RH0 A;  4GT1 A;  4O9B A;  3CPW O;  3RL0 B;  1H31 A;  1IO4 A;  4UB6 H;  2AIU A;  3VTP C;  1COR A;  4L73 A;  1SQQ D;  2W8Z A;  4PV1 D;  2P7J A;  5M1B A;  3T97 A;  1S3J A;  2E76 D;  3VNW A;  1K3G A;  3WC8 A;  1PPJ D;  2WQY C;  1YIT P;  1NAF A;  1AKK A;  1HJB A;  4NPF X;  1AV1 A;  2NPS D;  1H31 B;  2M5A B;  2OTK E;  2B88 A;  3FGA D;  1VQ4 P;  2BPB B;  1IK7 A;  1NU1 E;  1KYO D;  2H7H A;  3T97 B;  1S72 P;  3AE6 C;  3CX5 E;  2WPR A;  3VMX A;  3CL3 D;  4H0K A;  3MIW A;  1S4X A;  5CIG B;  5KKZ C;  1M1K Q;  2JEE A;  2E5T A;  4UB8 V;  5KLV D;  4PD4 I;  3NFQ A;  3BRV B;  4GOD A;  3KZI V;  2MHM A;  1MFZ A;  2W27 A;  3KDP B;  4JQ0 D;  1CZQ A;  1M8O B;  1MKM A;  3L71 G;  1AA0 A;  1LP1 B;  4JBZ A;  1OW8 A;  1M57 D;  2QIW A;  1I54 A;  4QMA A;  3H1I G;  2WPS A;  5DJU B;  1CYJ A;  5L8R J;  2I1J A;  4RJT A;  2FY8 A;  2K88 A;  3H1K E;  3CCV P;  3B8E B;  4D6T D;  3FXD A;  1ZXG A;  4AYC A;  1FHB A;  2QEX P;  3AE8 C;  1BSH A;  1DVV A;  5B66 H;  4EIJ A;  1EDL A;  2FKW B;  2RMZ A;  3C1L A;  3VMY A;  1PZQ A;  3KQG A;  2HOD A;  3S1K A;  3H1J E;  2PAJ A;  1PV3 A;  1FAV A;  2N1T A;  1MFT A;  1X0T A;  4IFF A;  1GD2 E;  2ZVO B;  1OMI A;  1KOR A;  1KC8 Q;  2O01 N;  2YKO A;  2A45 G;  2AXT H;  2O01 H;  2P58 A;  1LNQ A;  2FRC A;  4RO0 A;  3L74 J;  2OGU A;  1T2K C;  3H1L G;  2LXC B;  3L75 E;  2HOD B;  4TT3 H;  3Q5P A;  3VMZ A;  1KQL A;  4GOE A;  1HCM A;  2N1T B;  1LC1 A;  2WPQ A;  1AVO A;  1CI6 A;  1OCD A;  2R32 A;  3L72 G;  4EOT A;  1PP9 J;  1NTK E;  3RL0 g;  1FE6 A;  4I1L A;  1C6S A;  1JCC A;  3WFD C;  3P32 A;  2IZ0 A;  3MUD A;  5TIS V;  3IR9 A;  1JUN A;  4YXD C;  1ZW0 A;  3ITK A;  3ZDM A;  3IF4 A;  1RZ6 A;  1CI6 B;  1EDK A;  1KYO H;  1NU1 J;  5KLI B;  1JNM A;  3PHL A;  3FWN A;  2C9X B;  3LID A;  5BU5 A;  2MTA C;  1GMJ A;  1FOS F;  1CHI A;  1ZLL A;  1OWA A;  1RE3 C;  4C46 A;  2ZXX A;  4RKU J;  1L0L G;  1EC5 A;  1IRV A;  1NKN A;  2YMK A;  3C9I A;  2PRR A;  1T2K D;  1HJ3 A;  3CI9 A;  1EZV E;  3NBT A;  3L73 D;  2OTJ P;  5GTI E;  4Q5P A;  2BCC E;  4I7Z C;  2PP6 A;  1YJN P;  1URQ C;  4Y99 B;  1S2E A;  5APQ A;  3GW6 A;  3TSI A;  3H1K J;  3AEA C;  2KK7 A;  2C9L Y;  2C1U A;  1PFI A;  5CIB B;  1BE3 E;  4U3F D;  1GU2 A;  1ZRT E;  3UIA A;  2OYO A;  1I55 A;  3H1J J;  3RK3 E;  2J59 M;  3SVW A;  4FB1 A;  1YHQ P;  1EXJ A;  2H8P D;  4H13 C;  1C6R A;  4FAN A;  4FA5 A;  4AAL A;  1JY3 P;  3CMA P;  1MG2 D;  2FWL A;  3LW5 J;  4N6J A;  4XYD B;  2Q1K A;  1W5C E;  3RK2 C;  5AVX B;  1FU1 A;  3P7K A;  2GC7 D;  3L75 J;  4PJ0 E;  1IJD B;  1W2L A;  4CPG A;  3HE4 A;  4PD4 E;  4ASW A;  2C2C A;  2VHD A;  1JY2 P;  2C8S A;  1WT6 A;  3HE5 A;  3L71 E;  1URQ D;  2V7Q J;  3AEG C;  2ZYG A;  3ZOW A;  2Z4E A;  1ZR2 A;  1NJI Q;  4PWA A;  1Y9B A;  3BCC G;  3H1I E;  3HE4 B;  1FDM A;  3SWF A;  1CTZ A;  5H2F E;  3O0R C;  3HE5 B;  1L0L K;  2QJK C;  1GDV A;  1S6V B;  5KJ7 D;  2YXR B;  3SFE C;  5GTI H;  4IL6 X;  1LWU A;  2JQR A;  4H13 D;  4JCG A;  1SFC A;  5KJ7 A;  2GUV A;  1NMI A;  3SLE A;  2KUB A;  1R0Q A;  2YO2 A;  5APW A;  2KIK A;  5C39 A;  3PLN A;  2C1V A;  1AQT A;  3VP8 A;  1J1D C;  2QJY C;  1PGP A;  2WWW A;  1M90 Q;  1KTM A;  1CSW A;  2H88 C;  1LWU B;  3ZOY A;  3KPE A;  2YMY A;  2AXC A;  451C A;  1A56 A;  3X39 A;  1FS0 E;  2FYU E;  3M0A A;  3H1L E;  5APY A;  4H13 B;  4LC1 A;  1SQX G;  4LGD E;  3K5B A;  1QKS A;  1J3S A;  2KB7 P;  2KI7 B;  3L72 E;  1OAE A;  3CC2 P;  1KFN A;  2P2U A;  1DD4 A;  3H1H D;  4HYT B;  3D0W A;  2IBZ I;  3WUV A;  4P4Q B;  4PJ0 H;  2JWD A;  1DII C;  2N9I A;  2FFD A;  4PD4 H;  1SLQ A;  4WQA A;  1GDT A;  5AUR A;  3MK7 B;  2Y0C A;  5AVY B;  1QEX A;  3CLQ A;  2R44 A;  1KB9 I;  1PL5 A;  5AVT B;  2OYH C;  1F1F A;  2JTI B;  2FFD B;  3V2N A;  2EXV A;  1X79 B;  1HVV A;  1FBM A;  1CHJ A;  1H0T A;  1R8E A;  3HUS C;  2GC4 D;  3DR0 A;  1L0L E;  1CNO A;  1BSN A;  1KFM A;  3VYM A;  2KP8 A;  1DX7 A;  1GL2 C;  4XXL A;  2G3A A;  3TGU E;  2JR8 A;  1RY3 A;  2OYI C;  2XV5 A;  3SFD C;  2KSE A;  2V07 A;  3A9F A;  2AEF A;  4EYY Q;  4FA1 A;  2XU6 A;  1H8A A;  1MV8 A;  1L4A A;  1LTI C;  3H1I J;  1LT9 A;  1NML A;  2V08 A;  3USS A;  1H0T B;  1HRC A;  2ZVN B;  1ETP A;  1M1J A;  1A02 F;  2PFX A;  3AE3 C;  1N8R Q;  2N9J A;  1WEJ F;  1CRJ A;  2K3R A;  3Q5S A;  3OW2 O;  1G1J A;  2QM8 A;  5GTH E;  1M70 A;  3SXT A;  4WQC A;  2Y0D A;  5E79 E;  4H44 C;  1LT9 B;  4AAM A;  3D70 A;  2CK3 H;  1LFM A;  2D2C C;  1KIB A;  1M1J B;  4UB6 E;  1SQX K;  1L9B C;  2DVH A;  3VRD A;  2ZAE B;  3TYI A;  5DJQ B;  4OH8 B;  1H32 B;  2YIU B;  3H1L J;  5AVQ B;  3HD7 C;  1ZOY C;  1NIR A;  1DIP A;  2J5U A;  1T8Z A;  1GL2 D;  3U1A A;  2J58 A;  1NTK G;  1E5W A; 
#chains in the Genus database with same CATH homology
 1CIE A;  2BGV X;  1BE3 D;  3O1Y A;  4DY9 A;  5IY5 1;  1DW2 A;  3WFE C;  3WFB C;  1I54 A;  1BGY D;  2B4Z A;  1ZRT D;  1C6O A;  5C9M A;  2PCC B;  1CYJ A;  2ZBO A;  4RJT A;  2ZON G;  3OCD A;  1RZ5 A;  1HH7 A;  4EID A;  3PXS A;  1GIW A;  3ZIY A;  1NTM D;  1A8C A;  4D6T D;  2YCC A;  1I6D A;  1CSU A;  1FI7 A;  2CA4 B;  1CRC A;  3JBT B;  1FHB A;  3A0H V;  1DVV A;  1AYG A;  2KNC B;  2RMZ A;  1E8E A;  1DIQ C;  351C A;  1CC5 A;  1KYO W;  1E2R A;  3OCD B;  2CA3 B;  4PD4 D;  2LIR A;  1YNR A;  1JDL A;  4O1W A;  1L0L D;  2QJK B;  1YEB A;  3L71 D;  1BCC D;  2FRC A;  4L1Q A;  2BCN B;  5B5E V;  2ZOO A;  3L74 D;  4O1Q A;  1CIH A;  2IBZ D;  1SQB D;  1HCM A;  2PCB B;  1N15 A;  1LC1 A;  3H1I D;  1CHH A;  3MK7 C;  2HV4 A;  1OCD A;  1CRH A;  1M60 A;  1CYI A;  2C1D B;  1CSX A;  3KHU A;  1K3H A;  1C6S A;  1PP9 D;  3WFD C;  4A7P A;  5B66 V;  2QJY B;  4RSZ A;  1HZU A;  3WU2 V;  2I8F A;  1A2S A;  1KB9 D;  2N9Y B;  1IZL 0;  5TIS V;  1DVH A;  1H32 A;  1CRG A;  2BLF B;  1FI9 A;  4AAN A;  3ITK A;  1I8O A;  1RZ6 A;  2LIT A;  1BL9 A;  1N50 A;  1NNO A;  1VYD A;  2QG4 A;  1RAQ A;  5KLI B;  3TF5 A;  1CXC A;  2B0Z B;  5B6Q A;  3PHL A;  2C9X B;  2AXT V;  1L9J C;  5CIC B;  3O5C A;  2MTA C;  4FA4 A;  4PW9 B;  1CHI A;  3CX5 D;  1YEA A;  4EIF A;  3PTZ A;  5E79 V;  1DW0 A;  4WQB A;  2FYU D;  3H1L D;  3NBS A;  1MZ4 A;  3ZBM A;  2ZXY A;  1H1O A;  3PXT A;  1IRV A;  5CIF B;  1HJ3 A;  1QYZ A;  3NBT A;  4YE1 A;  3L73 D;  3L72 D;  4Q5P A;  2N18 C;  2XTS B;  1CXA A;  1CYC A;  2RN0 A;  3GW6 A;  2FYN B;  3HQ7 A;  2C1U A;  1CCH A;  3A0B V;  3C2C A;  4FA9 A;  1GQ1 A;  1FJ0 A;  5CIB B;  3BCC D;  3L4O A;  5CIE B;  4V2K A;  2OZ1 A;  4GED B;  5GTI V;  4WQ9 A;  1C7M A;  4U3F D;  5DJQ C;  1N9C A;  1GU2 A;  1I55 A;  3PRJ A;  4WQD A;  2YK3 A;  3SVW A;  4FB1 A;  3H1J D;  1YFC A;  2ORL A;  2D0S A;  4AAO A;  1C6R A;  4L3G A;  4FAN A;  2L4D A;  3CXH D;  4FA5 A;  4AAL A;  4MU8 A;  1YTC A;  4KMG A;  2C1D A;  1U74 B;  1MG2 D;  3GG2 A;  2FWL A;  2OZ1 B;  4XYD B;  5KAI V;  2GIW A;  1QL3 A;  3PXW A;  3L70 D;  3HQ9 A;  1MG3 D;  3TGU D;  3WUI A;  2GC7 D;  2L91 A;  1P84 D;  3CP5 A;  3CU4 A;  2YQB A;  3L75 D;  2B12 B;  4WQ8 A;  1W2L A;  1B7V A;  2C2C A;  2DGE A;  2VHD A;  2C8S A;  2B11 B;  4LJI A;  4IL6 V;  3SJL A;  3ZOX A;  2N3Y A;  3WFC C;  1I5T A;  1S5L V;  1FI3 A;  3ZOW A;  4EDF A;  4PWA A;  5CYT R;  3DP5 A;  1CRY A;  4AX3 A;  2ZZS 1;  2D0W A;  1NTZ D;  5KKZ B;  1H9X A;  1M6Z A;  2Q3E A;  1CTZ A;  5TJH A;  1FOC A;  3O0R C;  1AOQ A;  5DFS A;  3ORV A;  1GDV A;  1S6V B;  1NU1 D;  3RLM A;  1FCD C;  4EIC A;  3CXH W;  1N90 A;  1H33 A;  2JQR A;  4JCG A;  1CO6 A;  3CYT I;  3HQ8 A;  2N3B A;  4NFG B;  1NMI A;  1KX2 A;  3SLE A;  1R0Q A;  1IQC A;  5H2F V;  2O3J A;  1C2R A;  3O20 A;  5C0Z A;  3PLN A;  2C1V A;  1W5C T;  4N0K A;  1AOF A;  1CSW A;  1I8P A;  1CIG A;  1HRO A;  3ZOY A;  1H33 B;  2BH5 X;  1CCR A;  451C A;  1A56 A;  2B10 B;  3M97 X;  3X39 A;  1CTJ A;  1CED A;  1SQV D;  1IO3 A;  1DW3 A;  3H1K D;  4FAV A;  3TDK A;  1QKS A;  1J3S A;  2CXB A;  1CIF A;  1OAE A;  4WQ7 A;  3OA8 A;  2A06 D;  3H1H D;  5DF5 A;  1KB0 A;  4P4Q B;  2AI5 A;  1L0N D;  1HJ5 A;  1KX7 A;  1DII C;  1IRW A;  4J20 A;  2N9I A;  2KS1 A;  4WQA A;  1YIQ A;  5AUR A;  3MK7 B;  1EB7 A;  1RAP A;  2Y0C A;  3CX5 W;  2QJP B;  3SWS A;  3OA8 B;  4Y5R A;  3L4M A;  1F1C A;  1KV9 A;  1F1F A;  3HQ6 A;  1LMS A;  2JTI B;  3RN1 A;  2EXV A;  3NWV A;  1C52 A;  2JWA A;  1CHJ A;  3FWL A;  1E29 A;  3VMA A;  3RMZ A;  2GC4 D;  2CE0 A;  3DR0 A;  1QL4 A;  1CNO A;  2PAC A;  1H9Y A;  1SQX D;  1NTK D;  3VYM A;  5CID B;  1HJ4 A;  4XXL A;  2BH4 X;  1GJQ A;  3CWB D;  1QN2 A;  1CSV A;  4GYD A;  1YIC A;  2V07 A;  4PJ0 V;  2CE1 A;  4H0J A;  1LC2 A;  5KAF V;  3A9F A;  2GB8 B;  1COT A;  4FA1 A;  5EXQ A;  3PH2 B;  1CRI A;  1NML A;  2V08 A;  1H31 A;  1HRC A;  2AIU A;  1ZZH A;  1ETP A;  4WQE A;  1COR A;  1HZV A;  1SQQ D;  4EIE A;  1C75 A;  2N9J A;  1WEJ F;  4L3H A;  1GKS A;  1CRJ A;  155C A;  1WVE C;  3VNW A;  1K3G A;  4K3I A;  3WC8 A;  1M70 A;  1PPJ D;  2N18 B;  3SXT A;  1YCC A;  4WQC A;  1I6E A;  1AKK A;  2Y0D A;  1DW1 A;  3ZOO A;  3ZCF A;  4AAM A;  1H31 B;  1SQP D;  1LFM A;  1U75 B;  2BPB B;  1KIB A;  1KYO D;  2K9J B;  1EZV D;  3RN0 A;  5GTH V;  1L9B C;  2BCC D;  1CTY A;  2DVH A;  3DMI A;  5CIH B;  2Y0E A;  4H0K A;  4QAO A;  3VRD A;  3TYI A;  5DJQ B;  5CIG B;  1H32 B;  2YIU B;  4UB8 V;  5KLV D;  1DT1 A;  1NIR A;  3KZI V;  2MHM A;  4UB6 V;  1LS9 A;  1C2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...