1ZRTD

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
257
structure length
252
Chain Sequence
SNVPDHAFSFEGIFGKYDQAQLRRGFQVYNEVCSACHGMKFVPIRTLADDGGPQLDPTFVREYAAGLDTIIDKDSGEERDRKETDMFPTRVGDGMGPDLSVMAKARAGFSGPAGSGMNQLFKGMGGPEYIYNYVIGFEENPECAPEGIDGYYYNKTFQIGPDTCKGVKITHGSWARMPPPLVDDQVTYEDGTPATVDQMAQDVSAFLMWAAEPKLVARKQMGLVAMVMLGLLSVMLYLTNKRLWAPYKGHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase/metal transport
molecule keywords Cytochrome b
total genus 51
structure length 252
sequence length 257
chains with identical sequence Q
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1zrtD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1zrtD02
2C1UA 2FWLA 4L3HA 1RZ6A 1LMSA 4EICA 1CSUA 1N15A 4IL6V 2OZ1A 3PLNA 3WFCC 1L0ND 1CSWA 2XTSB 2Y0EA 1QL3A 2C9XB 3PXWA 3M97X 2V08A 5DJQC 2JWAA 4UB6V 2PCCB 4U3FD 1DVVA 2YIUB 2OZ1B 1YICA 3O1YA 3H1LD 4WQAA 1N90A 3L4MA 4WQ8A 2B12B 4PWAA 2FYNB 2ORLA 1CXAA 3L4OA 3OA8A 3RN0A 1CRHA 3TGUD 2N18B 1GQ1A 5KLIB 1C6RA 2EXVA 3CYTI 5CIFB 1BE3D 1DIQC 2RN0A 1NU1D 1DW0A 1FHBA 1DW1A 1R0QA 1I8OA 5C0ZA 1CTJA 155CA 1OAEA 5CIBB 3JBTB 2MTAC 2ZZS1 2AIUA 1H1OA 1GDVA 1AOQA 1QL4A 1NTMD 3ZOYA 2BCCD 4WQEA 1K3GA 2A06D 2KS1A 1OCDA 3CP5A 2DVHA 1FJ0A 1I6DA 5CYTR 2Q3EA 1H9YA 1H32A 2GB8B 1NTKD 3L72D 2JTIB 3RN1A 3SJLA 2AXTV 3VYMA 2ZXYA 3PXSA 1KB9D 4AAOA 1DW2A 3PH2B 1HRCA 1CC5A 1M6ZA 3PXTA 4RJTA 3X39A 451CA 2B10B 2AI5A 3WUIA 1CIEA 4WQBA 1CNOA 1S6VB 1W5CT 1CEDA 1C2RA 1IRVA 1I55A 3OA8B 5CIHB 5CIDB 1I54A 2K9JB 4WQCA 4WQ7A 2CA4B 1RAPA 1MZ4A 5E79V 4FA9A 1CCRA 1GU2A 3KHUA 2B0ZB 3ZOOA 1NIRA 2L91A 3RLMA 2BCNB 1HCMA 3CX5W 1DVHA 3L73D 1IQCA 1BCCD 1C2NA 3HQ6A 2D0WA 1H9XA 3ZOWA 2BH4X 2C1VA 3CXHW 4PJ0V 2BPBB 2ZBOA 351CA 4P4QB 3H1KD 1M60A 1CO6A 1CRYA 1NNOA 4UB8V 3NBSA 1SQQD 2C2CA 1CSVA 4L3GA 1EZVD 4XYDB 1C52A 1CHIA 1PP9D 4FA1A 2QJKB 3SLEA 3VRDA 4L1QA 1WVEC 1AKKA 5C9MA 1FOCA 3ZIYA 1ZRTD 1HJ4A 4LJIA 1YCCA 3NBTA 2L4DA 1H31B 2V07A 2RMZA 1GJQA 3DP5A 1HJ5A 3WFDC 1CHHA 3WU2V 3H1HD 1IO3A 1N50A 1L9JC 1DIIC 1C6SA 2PACA 1KX2A 1CIHA 1NMLA 1JDLA 1MG2D 5B5EV 3TYIA 2YK3A 4EIFA 1W2LA 1F1FA 2C1DB 2LITA 1CIGA 5KAFV 3L71D 2O3JA 2DGEA 4YE1A 4J20A 5H2FV 3GG2A 2C8SA 1CYIA 1A8CA 1CYCA 4FANA 2JQRA 5TJHA 3MK7B 2HV4A 1CORA 3DR0A 5B66V 1CHJA 2QJYB 3SVWA 4EDFA 3C2CA 1LC2A 2YCCA 1S5LV 1L0LD 1E8EA 3SXTA 1A56A 4N0KA 5IY51 3FWLA 1AYGA 1E29A 5GTHV 3WFEC 1LS9A 5CIEB 2B4ZA 4WQDA 1DT1A 2Y0DA 1SQBD 4PW9B 1FCDC 1YFCA 2PCBB 2FRCA 1GKSA 4O1WA 4FAVA 1FI7A 1YEBA 1LFMA 5AURA 5TISV 1CRCA 5GTIV 1CRGA 2N9IA 3SWSA 3WC8A 3GW6A 2QJPB 1YNRA 4EIDA 3VMAA 2KNCB 4QAOA 3L74D 5DFSA 3ZBMA 1C6OA 2CE0A 1COTA 2N9YB 1KYOW 1U75B 1NMIA 2MHMA 2GC7D 4XXLA 5KAIV 3ZCFA 4Q5PA 4FA4A 4GEDB 1H31A 2YQBA 1SQPD 4H0KA 1NTZD 4WQ9A 2CA3B 4AX3A 2C1DA 2ZONG 3A0HV 5KKZB 1KYOD 1C7MA 3CU4A 3TDKA 2N3BA 1BGYD 2N9JA 1PPJD 4K3IA 1LC1A 4EIEA 1K3HA 5EXQA 3PHLA 3H1JD 1BL9A 2BLFB 1I6EA 3H1ID 1IZL0 1EB7A 1CIFA 1HZVA 5DF5A 1I8PA 3CXHD 1SQXD 1GIWA 4D6TD 2Y0CA 1HZUA 4PD4D 1CYJA 3OCDA 2N18C 4AANA 1YEAA 3CWBD 4A7PA 3HQ9A 5B6QA 1KX7A 1U74B 1WEJF 3PRJA 5DJQB 1FI9A 1HROA 1C75A 1DW3A 3O20A 2IBZD 1B7VA 2N3YA 1P84D 3DMIA 4RSZA 1HJ3A 4FA5A 1H33B 2B11B 1CRIA 1I5TA 3BCCD 1N9CA 4DY9A 2D0SA 4AALA 3L75D 1SQVD 2BGVX 1KB0A 3A0BV 1QN2A 2ZOOA 1KIBA 1E2RA 2I8FA 1CTYA 3KZIV 1IRWA 1M70A 1VYDA 1CCHA 3OCDB 1CRJA 4V2KA 1AOFA 4NFGB 4Y5RA 2BH5X 3L70D 3PTZA 2LIRA 1ETPA 1QYZA 1F1CA 1RAQA 4KMGA 1CSXA 3A9FA 1CTZA 3VNWA 4JCGA 3O0RC 4H0JA 2GIWA 5CICB 4MU8A 1KV9A 2CXBA 3NWVA 3CX5D 2QG4A 1ZZHA 4O1QA 1FI3A 3HQ8A 3WFBC 2GC4D 5KLVD 2FYUD 3RMZA 1J3SA 4AAMA 2CE1A 1A2SA 1HH7A 2VHDA 4GYDA 1YTCA 3MK7C 1MG3D 3ZOXA 3HQ7A 3O5CA 1RZ5A 1L9BC 1YIQA 3ITKA 3ORVA 5CIGB 1QKSA 1H32B 1CXCA 4FB1A 1H33A 3TF5A
chains in the Genus database with same CATH superfamily
2K37A 1KQGB 2FWLA 3RK3C 1GZLA 5TISH 3MUDC 2A45I 2C0XA 4AQRD 5H2FH 2OZ1A 3CWBJ 3E1RA 3PLNA 1YI2P 2Y0EA 2C9XB 4PD4E 5H2FE 2KZJA 3M97X 2V08A 1NTKJ 3VYIA 1GTWA 2YIUB 1EDIA 1GL2C 2KSEA 3HD7C 1M1JA 1WT6A 2K1AA 1YICA 2J5UA 1DH3A 1FJKA 4WQAA 2KNCA 1N90A 3L4MA 3VMYA 4WQ8A 2PP6A 1NJIQ 1J1DB 3AE2C 3H1HG 2YXQB 3HTKA 1GQ1A 5KLIB 1N73C 4AYCA 2QJKC 3OJAB 4IOIH 3PJSK 2EXVA 3CYTI 1JCCA 2N1TB 1BE3D 1DIQC 2RN0A 3V4WA 2WPRA 1I8OA 3CC7P 3H1KE 1CTJA 5CIBB 5AVVB 1Y9BA 2MTAC 1M56D 1KTMA 2ZZS1 1SQQK 5AVUB 1N7LA 4OGQD 4NPDA 4N78D 3HE4B 3BCCE 1L2PA 1VQMP 1IK7A 1HH0A 3R2PA 1QL4A 3AEDC 2PGDA 3ZOYA 4ZNCA 2KS1A 1OCDA 1BGYE 1FZEA 1IK9A 2ZYAA 4L74A 4GDOA 2AXCA 2E43A 4WB4A 1H9YA 1Y8AA 3CCVP 5CCHA 2XDJA 2GB8B 3V5BA 5GTHE 1NTKD 1M90Q 3GLMA 2JTIB 1SFCC 1X22A 3SWKA 2O01N 1FDMA 1NAFA 1M6ZA 1IFIA 3A0HE 1FJPA 2B10B 2AI5A 1HGZA 1L0NG 3CX5H 1KYOH 2CPBA 1KN7A 5BU5A 1I55A 2HPCB 3LW5J 4JBZA 4CPGA 3V2NA 1I54A 4WQCA 4WQ7A 4HB1A 2NPSA 1OVRA 2HFED 3L70E 3CCUP 1Q81Q 2L91A 2A06E 5KKZC 3L71J 1SQBJ 3CX5W 1DVHA 1YJ9P 2BASA 1LTAC 3L73D 2OTLP 3H25A 1BCCD 3VMZA 3CI9A 2MKVA 4PJ0V 3H1KD 1M1KQ 4UB8E 1CRYA 1NNOA 4UB8V 2WSEJ 2C2CA 4OVNF 1EZVD 4XYDB 1C52A 3L70J 3CCJP 1M1JC 2W6BA 2YO3A 3RL0B 3EQ2A 3SLEA 2KB7P 1IZNB 2Y9ZA 1DIPA 3T97A 3KDPB 4BWNA 2D2CC 2QSIA 1WVEC 1NTZJ 2K88A 1KILC 3KXDA 1X79B 1RH5B 1KILD 3L70G 5KTBA 1H31B 2IYOA 4KJMA 1NU1G 2D2CD 5AW7B 2IYPA 2IBZE 1PV3A 1KQLA 2LXBA 1HJ5A 1S9KE 1GU4A 4PJ0H 2I8DA 1HWTC 1DIIC 1X0TA 2PACA 1L4AC 1GL2D 3HD7D 3M91A 4ZMDA 1IFNA 4H0LC 5CJ0A 1HUCA 3HUSB 2WSFJ 4Y28J 3B5NA 1F1FA 2OYHC 3CPWO 1NTME 1OVUA 5B66H 2W6JH 5H2FV 1CYIA 2H89C 1PGQA 3D71A 2W27A 2WPVB 4LC1A 3SVWA 3WU2H 3BRVB 3L73E 3C2CA 1L0LD 5AW9B 1E8EA 1URQA 1A56A 1J1EC 4KT0J 5IY51 2Z5HA 1FOSF 4WQDA 1SQQG 1FZCC 1SQBD 1A02F 2FRCA 4FAVA 3MGNA 1QVGO 5APSA 1LFMA 2K9YA 1PP9E 1SFCD 2Q1KA 5M1BA 1SQXE 3SWSA 1LTTC 3WC8A 4YXDC 1NWQA 1PIXA 1M57D 1YNRA 3VMAA 3L37A 1AJYA 1KB9I 3D6ZA 1U7JA 1BCCE 2MHMA 3ZCFA 4Q5PA 4EOTA 3JC22 3M0AA 4OGQC 1H31A 1DD4A 1SQPD 4H0KA 1NTZD 4WQ9A 4AX3A 1URQB 2IDBA 2C1DA 4I2LC 1U57A 1DX7A 1QVFO 1NTZG 2W8ZA 1OWAA 1NYHA 2N9JA 4K3IA 2O1JA 4EIEA 5EXQA 5AW8B 1I6EA 2CK3H 2G8YA 2I1JA 5CCGD 1SFCB 3MD0A 1NTKG 4XE5B 3BVHA 1GIWA 1JB0J 1LWUC 2ZYDA 2POHA 3OCDA 2IZ0A 1L4AA 3AE5C 2A06G 2GM4A 2Q6QA 4L76A 5AVSB 4ASVA 1VQNP 5DJQB 1FI9A 1HROA 1C75A 5CBNA 1AQ5A 1J2JB 1SQBG 4GOEA 2IBZD 4OH8B 1AV1A 1S4XA 4FA5A 2P10A 1KB9H 3AECC 3L72E 1SQVD 2BGVX 1R5SA 1K05A 3CCLP 2ZOOA 1J1DC 1CTYA 3FXDA 2B87B 1CCHA 1CRJA 4NFGB 4Y5RA 2BH5X 4DZOA 1F1CA 4KMGA 2IBZI 1P84I 3O0RC 4MU8A 3CLQA 1UIXA 3CX5D 1FI3A 3HQ8A 2JJLA 3RMZA 2FYUD 1FS0E 1QEXA 2HODB 1SQVE 1BE3J 3O5CA 2W90A 5KLVJ 2R3SA 3RBZA 2KS1B 2JO1A 2O1KA 3ORVA 1OVVA 3BASA 3B5NC 3L36A 2ZVNB 1H33A 1USEA 5DJTB 3TF5A 2K9JA 1W2BO 1N7SB 2V4HA 3TYYA 2FY8A 1VQ6P 4GT1A 3S1KA 1ZRTE 2H7HA 3D70A 4IL6E 1L0ND 2RKLA 2WVRA 2XTSB 1S5LX 3RL0D 3O8ZA 1LWUA 3NMDA 4U3FD 2OZ1B 5KJ7C 1OIPA 2WT7A 3H1JG 4HYTB 1EQ7A 1DD3A 3Q5PA 3FXEA 3RN0A 3OW2O 1LWUB 2N18B 1H0TA 3Q3DA 1USDA 2M3EA 1YHQP 1ZR2A 1NU1D 1FHBA 1DW1A 1R0QA 5C0ZA 5GTIH 2YNYA 3MUDA 1MZ9A 4PV1D 1SQXK 2LKMA 1NTZK 3RK2B 5CMZA 1GK6A 3VP9A 1H1OA 2A45G 1JM0A 1AOQA 3CCQP 5BU8B 3B71A 1JTHB 2BCCD 4WQEA 3I5CA 3O6QA 1K3GA 1I6DA 2UWJE 5CYTR 1PGPA 2KOGA 2N1TC 3RN1A 2NPSD 3H1IG 3N4XA 3L74E 1YQ3C 3VYMA 1BCCG 1PGJA 2NPSB 1XTCC 1XTGB 1SQBK 3GHGC 2HLOA 4RJTA 3GHGB 1QL2A 1KB9E 1SFCA 3AE6C 5C39A 2WSSH 1CNOA 1W5CT 1LT9B 1R5LA 1C2RA 1IRVA 3U59A 3EWKA 4XFJA 1JOCA 1BE3G 2FFDC 2WQYC 5CIHB 1NTMG 2E74C 5CIDB 2K9JB 2CA4B 4RESB 1MZ4A 3PP5A 1VQ8P 1QL1A 5APUA 2B0ZB 1NIRA 1FC2C 4OWFA 3A0HH 2N1TD 1NGMB 4NPFX 1HCMA 1NKZB 3WUUA 3KZIE 1LT1A 1L0NK 3A7OA 1C2NA 3GMAA 1HVVA 2FYUJ 2OYIC 1H9XA 3ZOWA 1YQ4C 1G2CB 5CCHC 3CXHW 1K04A 3GF7A 1T3UA 351CA 3P32A 1DEEG 5AVQB 1PFIA 4JYCA 3CL3D 2KZIA 1WRGA 1M60A 1H89A 1CSVA 1E79H 1KYOE 1M8OB 5CCGA 1RF0C 4H44B 3VRDA 3A3YB 4L1QA 2V7QH 2BCCE 1AKKA 5C9MA 4BRYB 1N2DC 1G1IA 1HJ4A 1JY3N 2L4DA 2B87A 1X8YA 2V07A 5K5GB 1VQ9P 1CSBA 4L73A 3CC2P 1IFPA 2PFXA 1KD1Q 3WFDC 1L0LJ 1ZXGA 5AVWB 3H1HD 1IO3A 1N50A 1L9JC 2XV5A 1C6SA 3IFMA 1NU1E 1SLQA 3G4SP 2E42A 4WY4D 1NHLA 3RL0C 1JNMA 2Q5UA 4HH2A 2PRRA 2QJPC 4H44C 1KQSO 2LITA 2J59M 4YE1A 3BRTB 5DJUB 3B5NB 1CYCA 4FANA 2OYIB 3IF4A 1SQVK 1BDCA 1CORA 1KQFB 5KLVK 1PGOA 1S3JA 3GF3A 3CMAP 1FAVA 2E74D 2JP3A 1DEBA 1NTZE 1AVOA 2E74B 1LTJA 3FWLA 1JUNA 2B4ZA 2KUBA 1LT9C 5AW3B 4C46A 1JCDA 4PW9B 4MN4C 1FCDC 2M5AB 2Z5IA 4O1WA 1FI7A 4M3LA 3L75J 5GTIE 2NPSC 5TISV 5GTIV 2WZ7A 3CXHE 1SQPG 3ZDMA 2ZT9B 1LTBC 2QJPB 3AE4C 4EIDA 3VP8A 4QAOA 4WBAA 5DFSA 4B86A 2CE0A 4K3AA 2KLUA 1COTA 2OARA 5APVA 1KYOW 1U75B 2GC7D 4PD4I 1IC2A 3HUSA 3AE3C 2M5AA 4KHXA 1SQXJ 2ZONG 1RF0A 1VQKP 1KYOD 1C7MA 3CU4A 2IFNA 1PPJD 1NTMK 2L5GB 1K73Q 3H1JD 1BL9A 3JCUE 2QIWA 1EB7A 1I8PA 1EZVI 1BE3E 3P8CE 1N7SD 3AEEC 5E79E 1M7LA 4PD4D 2AXTE 1CYJA 3T97B 1LGHB 2N18C 1SQPJ 2OYIA 1YEAA 1NU1J 1G1JA 1YJWP 2R32A 4I1LA 2B88A 5B6QA 2ZT9C 1KX7A 1FZAA 1HGVA 3MZWB 3SWYA 4OGQB 2M0BA 1B7VA 2N3YA 2OYHA 3DMIA 1H33B 1RQUA 1S1CX 1NTMJ 2B11B 1KZUB 2XKMA 1BGYG 4DY9A 2KK7A 1YTZI 3RK3B 2IZ1A 3H1JE 1QLED 1M70A 1VYDA 1NU1K 3Q2YA 1ZMEC 5AVRB 1IJDB 1AOFA 2QRXA 4TT3H 2E5TA 1RE4C 1CI6A 3L70D 3PTZA 2E75C 5AW4B 5E79H 3S9OA 1QYZA 3A9FA 1OW7A 4JCGA 3H1KJ 4GODA 2GIWA 2CXBA 1AVYA 2QG4A 3WFBC 2CE1A 3I55P 1HH7A 4XA4A 2HODA 3H1KG 1VQ5P 3TNUB 1K8AQ 2WSCJ 3Q5SA 3ZOXA 5AW6B 1NTKE 5AVZB 3ITKA 3RGUA 4O9BA 1VQLP 5CIGB 1E5WA 2M8RA 1QKSA 2ZXEB 1H32B 2C1UA 2DW3A 5B5EE 1RZ6A 2E76D 3CC4P 4IL6V 4Y99B 1JEKA 1LTGC 5BVZA 1CSWA 3MHVA 4WY4A 3WMM0 3PXWA 2A45H 1P84E 2O01H 4UB6E 5KLVE 4H0LD 5DJQC 4UB6V 2PCCB 1SQPK 3SSUA 5CHXA 1L4AD 3O1YA 1L0NE 3H1LD 1S5LH 4NPEA 3H1JJ 3CXHH 5CCGC 3G71P 2B12B 4JPZB 2R44A 4PWAA 2FYNB 3H1HJ 2ORLA 5AVXB 4I6MC 2KP8A 4LGDE 3L75G 1C6RA 3AEGC 5CIFB 3U1AA 2P58A 4IL6X 1DW0A 1CZQA 4EYYQ 2K3RA 1NO4A 4C7NB 155CA 1OAEA 2QA4P 2B89A 4GOFA 2ZAEB 3WUVA 1T2KD 3S4RA 1MV8A 2AIUA 2WSFH 1GDVA 3BCCJ 1JY3P 1NTMD 3NXSA 2DVHA 1FJ0A 1KV4A 4K35A 4WVZA 2XNXA 1A02J 1IO4A 2Q3EA 1EDKA 1H32A 4WY4B 3L72D 3CCSP 3CMEP 3HE4A 1GW3A 3SJLA 3UIAA 2YKOA 1KB9D 4AAOA 1PPJG 1PPJE 1VL2A 1YBKA 3AE9C 1DW2A 3PH2B 1HRCA 1CC5A 3C8VA 5APQA 3W68A 1ZR4A 2N9BA 2N1TA 3H1IJ 1CIEA 2OQQA 2OYOA 3OA8B 4W7YA 3G3ZA 4C7RA 3VMXA 1RAPA 4U3FJ 5KAIE 1CCRA 2P7JA 3KHUA 3ZOOA 2C0WA 3USSA 3PH0A 1FBMA 1GL2A 3HD7A 4YTPC 4N6JA 3SWFA 2YKPA 1N7SA 2C1VA 3M9BA 1SVFA 3WU2E 1CO6A 3MIWA 3ABVC 1P84H 1JY2P 4L3GA 1T2KC 5AW5B 3A5TA 4EIJA 4H0LB 1PP9D 4FA1A 1OFCX 3IAOA 4UB8H 2QJKB 1VQ4P 3EFGA 1OMIA 1URQD 1MKMA 3ZIYA 2IPPA 4LJIA 1URQC 1YCCA 1LNQA 2PAJA 1EZVG 2RMZA 3DP5A 4DT0A 3TGUJ 2Q9IA 1KILB 2NRGA 1RE4A 1CHHA 3TGUG 2ZJSE 1YIJP 1KX2A 2QE7H 1SQPE 1CIHA 5AVTB 1M1JB 5CJ4A 3WUTA 1JDLA 2YO2A 1IFJA 2D2CB 5B5EV 2YK3A 4EIFA 1W2LA 1BSNA 2O3JA 1R8EA 1EXIA 3KPEA 2DGEA 2J58A 2E76C 2Y9YA 1VQOP 3GG2A 3RK3D 2C8SA 5KAFH 1VQ7P 3MK7B 1BDDA 2FYUG 2JEEA 1FZCB 3DR0A 3AEBC 1CHJA 2QJYB 1S72P 2KIKA 4LLHA 5B66E 1PZQA 4EDFA 2GUVA 1S5LV 3C9IA 2W83C 4N3YB 3H1IE 1RF1B 1AYGA 1E29A 3B8EB 1BCCJ 3NTNA 2C9NY 3LW5H 1DT1A 2Y0DA 1YFCA 2PCBB 1YEBA 3L75E 2FXMA 1N73A 1MFZA 1CRGA 1H8AA 3AE7C 3GW6A 1AA0A 3V6IA 2KYVA 3ZBMA 1C6OA 1OX3A 3E1IA 4AUWA 1NMIA 5KAIV 3L35A 4FA4A 3V4QA 4GEDB 3SFDC 3MTUE 2FBWC 4ZKPA 3L4FA 5CBOA 2CA3B 2QM7A 4D6TJ 2IX7C 1T3JA 2Q3IA 1OXZA 3TDKA 1YTZT 2N3BA 2P1JA 2JKVA 1JY2O 3D0WA 1S9KD 3PHLA 3L73G 3RK3E 1MUUA 1AFOA 1CIFA 3H32A 4W80A 1SQXD 3CD6P 1CI6B 1KILE 1X9VA 4IFDK 1HZUA 2WSCH 1OW8A 3B4SA 3IN6A 3L73J 4AANA 1N7SC 1W2EA 1N86A 3MP7B 4A7PA 2IFMA 3HQ9A 1GL2B 3HD7B 4PV1B 1VF5C 1LP1B 3H32B 3M0DC 1FU1A 1NVOA 1JTHA 1KC8Q 1DW3A 3O20A 3CCEP 3QWOC 4RSZA 5KJ7A 2YIUC 1HJ3A 3Q1MA 1CRIA 2YMKA 3P8CD 2RH0A 2D0SA 4U3FE 3L75D 1J1EB 3A0BV 1QN2A 2GA1A 1E2RA 1S2EA 1LJ2A 3KZIV 4YPCA 2YKQA 4HJGH 1FDIA 1RQVA 3OA7A 2LIRA 5APXA 5APYA 1RAQA 1SQQJ 3AE1C 3VNWA 2HR3A 1HTLC 1VDFA 1ZP0C 4H13C 4H0JA 3VTPC 2OYHB 1HJBA 2SPZA 1PP9G 1ZZHA 3O6QB 4O1QA 1KORA 4AAMA 2H43A 2H8PD 2E75D 4RKUJ 1L4AB 1T6AA 2AEMA 1SQVG 1MG3D 2FYUK 4L75A 1L0LK 1OW6A 1AQTA 1SQVJ 5KLVG 3HQ7A 2FYZA 1L9BC 1YIQA 1NH4A 1TU3F 3TGUE 2GUSA 1H0TB 1PL5A 3A2AA 1ZW0A 1CXCA 1JO5A 4FB1A 1JY3O 3GHGA 4BXLA 2BEZF 3CX5I 2ZFCA 4L3HA 1VPCA 4D6TE 1LMSA 4TLFA 4EICA 1CSUA 1GW4A 4JQ0D 3VOPA 1N15A 2LR2A 4H44D 3WFCC 1Q2NA 1QL3A 1KFNA 1T8ZA 2ZT9D 3TNUA 2JWAA 1DVVA 1N8RQ 1LTJC 2E76B 2E75B 3TSIA 3HTKB 3M9QA 5AW0B 2V7QJ 1CXAA 3L4OA 4ZKUA 3OA8A 1CRHA 3TGUD 1KMIZ 1EZVE 1EDLA 2FFDB 1QGKB 4C7NA 2WT7B 3KQGA 5KAFE 2WITA 2AXTH 4ASWA 5APTA 4RO0A 3JBTB 5APWA 3L72J 3EFFK 4I7ZC 3FGAD 1Q82Q 3CX5E 3V2QA 2CPSA 2FFDA 2HPCA 3RBXA 1YJNP 1NAYA 4GIFA 2A06D 5CCHD 3H6PA 1BGYJ 3CP5A 4GKGA 5KAIH 3FWNA 2JWDA 3LIDA 3FX0A 2ZVOB 1FDOA 2G3AA 4R4LA 2HYNA 1L0NJ 2BCCG 2AXTV 4QMAA 2ZXYA 3PXSA 3H1LG 2XNDH 2KXPB 1KFMA 2P67A 1JMBA 1U7MA 3RK2C 5TISE 3PXTA 2JDIH 3X39A 451CA 1D7MA 3W67A 3WUIA 3R4YA 2ZYGA 4WQBA 1S6VB 1CEDA 4DCKA 1RE3A 2W6AA 3RK2D 5GTHH 2C9LY 5E79V 5KLIC 4WWIA 4U7JA 4FA9A 5AVYB 2R3CA 1GU2A 3L71G 2AEFA 3RLMA 2BCNB 2HG5D 3HRNA 1IFDA 3V2PA 2WTYA 1IQCA 3A0BH 3H1HE 3HQ6A 4I7ZB 2D0WA 1GK4A 3V2RA 2WMMA 4U3FG 3VN0A 2WSEH 3L72G 2BH4X 2BPBB 4Z1MH 2ZBOA 4P4QB 2YMYA 4WY4C 2QM8A 1SP4A 3NBSA 1SQQD 2FXOA 2ITAA 3CXHI 4YXWH 1CHIA 3IR9A 1YITP 1JY2N 3G6EP 1ZOYC 3QH9A 1L0LG 1Q86Q 1YYCA 3L74G 4JYBA 1LTIC 1FOCA 1ZRTD 4PD4H 3NBTA 2NZ2A 1LTSC 1GJQA 5AW1B 2FXPA 1LTJB 3WU2V 1VF5B 3L74J 1QX8A 3AE8C 1CW5A 5KJ7D 1SQBE 1NMLA 1GDTA 4UB6H 2FYNC 1MG2D 2B9BA 3TYIA 2JR8A 2XU6A 3C1LA 3CWBE 2C1DB 1CIGA 5KAFV 3L71D 4J20A 1Z56A 2R5DA 1FZBA 1A8CA 2JQRA 5TJHA 1K9MQ 1L0LE 2HV4A 3CCMP 2FKWB 3F5HA 5B66V 4HKZH 1FZCA 1LC2A 2YCCA 1Q90D 3HUSC 2I1KA 2Z4EA 2FYUE 3SXTA 4N0KA 2LXCB 2OGUA 4JF7A 3U1CA 5GTHV 3WFEC 1RE3C 1LS9A 5CIEB 1GD2E 3P7KA 1LP1A 2IBZG 4BRYA 5EFWB 4R4MA 1RF1A 4H13B 1JMMA 1GKSA 1WMKA 1BSHA 3M9HA 5AURA 1CRCA 1PP9J 1ZV8A 2XZRA 3L71E 5AW2B 1KYOI 2N9IA 2WWWA 3BCCG 2AEJA 1FZGA 1Q7YQ 1Y47A 1S5LE 2KNCB 3L74D 1FE6A 3M06A 1FOSE 2N9YB 3OAKA 1SS1A 1RHZB 2KLVA 4XXLA 4EI2A 1G2CA 4IFFA 3I56P 1N73B 2H88C 3AEFC 1UIIA 2YQBA 3CWBG 1NTKK 4PV1C 1HF9A 5B5EH 3HE5A 3H1LE 4D6TG 3A0HV 5KKZB 1SQXG 1BGYD 2E5YA 1LC1A 1K3HA 2BCCJ 4DJGA 2BLFB 1VF5D 3H1ID 2R5BA 1IZL0 1HZVA 5DF5A 3CXHD 2KSJA 1MFTA 1OZHA 4N78E 1EC5A 2O01J 1SQQE 3Q5RA 3HE5B 4D6TD 2Y0CA 3F89A 3JSVC 3A0BE 2OTKE 2MJZA 2WPQA 3CWBD 4IFMA 3II6A 1U74B 1WEJF 3PRJA 3RL0g 1W5CE 1EXJA 2P2UA 1NOHA 1P84D 1NKNA 4IL6H 3G9RA 2Q7CA 1LT9A 1I5TA 3BCCD 1N9CA 2ZXXA 1HBWA 3BATA 4AALA 2BEQD 3B5ND 1KB0A 1KILA 1H88A 1HJ0A 1KIBA 1VQPP 2I8FA 1IRWA 3OCDB 4V2KA 3P8MC 1FZFA 4DOJA 3LIEA 3N7NA 3KYQA 1ETPA 1EDJA 1ZLLA 2KI7B 3E7KA 1CSXA 3SFEC 1CTZA 1RF1C 4Y99C 2WPSA 5CICB 3JCUH 2QVAA 1KV9A 3NWVA 3K5BA 3AEAC 4H13D 3H1LJ 3CCRP 2GC4D 5KLVD 1J3SA 1IFMA 3M0DA 3D6YA 1A2SA 4W7ZA 2M3BA 2VRSA 3NFQA 3KZIH 2VHDA 4GYDA 1RY3A 1YTCA 3MK7C 2OTJP 2QJYC 1RZ5A 2QEXP 1ZN5A 4PJ0E 1GU5A 2YXRB 1GMJA 5L8RJ 3TK1A
chains in the Genus database with same CATH topology
2C1UA 2FWLA 4L3HA 1RZ6A 1LMSA 4EICA 1CSUA 1N15A 4IL6V 2OZ1A 3PLNA 3WFCC 1L0ND 1CSWA 2XTSB 2Y0EA 1QL3A 2C9XB 3PXWA 3M97X 2V08A 5DJQC 2JWAA 4UB6V 2PCCB 4U3FD 1DVVA 2YIUB 2OZ1B 1YICA 3O1YA 3H1LD 4WQAA 1N90A 3L4MA 4WQ8A 2B12B 4PWAA 2FYNB 2ORLA 1CXAA 3L4OA 3OA8A 3RN0A 1CRHA 3TGUD 2N18B 1GQ1A 5KLIB 1C6RA 2EXVA 3CYTI 5CIFB 1BE3D 1DIQC 2RN0A 1NU1D 1DW0A 1FHBA 1DW1A 1R0QA 1I8OA 5C0ZA 1CTJA 155CA 1OAEA 5CIBB 3JBTB 2MTAC 2ZZS1 2AIUA 1H1OA 1GDVA 1AOQA 1QL4A 1NTMD 3ZOYA 2BCCD 4WQEA 1K3GA 2A06D 2KS1A 1OCDA 3CP5A 2DVHA 1FJ0A 1I6DA 5CYTR 2Q3EA 1H9YA 1H32A 2GB8B 1NTKD 3L72D 2JTIB 3RN1A 3SJLA 2AXTV 3VYMA 2ZXYA 3PXSA 1KB9D 4AAOA 1DW2A 3PH2B 1HRCA 1CC5A 1M6ZA 3PXTA 4RJTA 3X39A 451CA 2B10B 2AI5A 3WUIA 1CIEA 4WQBA 1CNOA 1S6VB 1W5CT 1CEDA 1C2RA 1IRVA 1I55A 3OA8B 5CIHB 5CIDB 1I54A 2K9JB 4WQCA 4WQ7A 2CA4B 1RAPA 1MZ4A 5E79V 4FA9A 1CCRA 1GU2A 3KHUA 2B0ZB 3ZOOA 1NIRA 2L91A 3RLMA 2BCNB 1HCMA 3CX5W 1DVHA 3L73D 1IQCA 1BCCD 1C2NA 3HQ6A 2D0WA 1H9XA 3ZOWA 2BH4X 2C1VA 3CXHW 4PJ0V 2BPBB 2ZBOA 351CA 4P4QB 3H1KD 1M60A 1CO6A 1CRYA 1NNOA 4UB8V 3NBSA 1SQQD 2C2CA 1CSVA 4L3GA 1EZVD 4XYDB 1C52A 1CHIA 1PP9D 4FA1A 2QJKB 3SLEA 3VRDA 4L1QA 1WVEC 1AKKA 5C9MA 1FOCA 3ZIYA 1ZRTD 1HJ4A 4LJIA 1YCCA 3NBTA 2L4DA 1H31B 2V07A 2RMZA 1GJQA 3DP5A 1HJ5A 3WFDC 1CHHA 3WU2V 3H1HD 1IO3A 1N50A 1L9JC 1DIIC 1C6SA 2PACA 1KX2A 1CIHA 1NMLA 1JDLA 1MG2D 5B5EV 3TYIA 2YK3A 4EIFA 1W2LA 1F1FA 2C1DB 2LITA 1CIGA 5KAFV 3L71D 2O3JA 2DGEA 4YE1A 4J20A 5H2FV 3GG2A 2C8SA 1CYIA 1A8CA 1CYCA 4FANA 2JQRA 5TJHA 3MK7B 2HV4A 1CORA 3DR0A 5B66V 1CHJA 2QJYB 3SVWA 4EDFA 3C2CA 1LC2A 2YCCA 1S5LV 1L0LD 1E8EA 3SXTA 1A56A 4N0KA 5IY51 3FWLA 1AYGA 1E29A 5GTHV 3WFEC 1LS9A 5CIEB 2B4ZA 4WQDA 1DT1A 2Y0DA 1SQBD 4PW9B 1FCDC 1YFCA 2PCBB 2FRCA 1GKSA 4O1WA 4FAVA 1FI7A 1YEBA 1LFMA 5AURA 5TISV 1CRCA 5GTIV 1CRGA 2N9IA 3SWSA 3WC8A 3GW6A 2QJPB 1YNRA 4EIDA 3VMAA 2KNCB 4QAOA 3L74D 5DFSA 3ZBMA 1C6OA 2CE0A 1COTA 2N9YB 1KYOW 1U75B 1NMIA 2MHMA 2GC7D 4XXLA 5KAIV 3ZCFA 4Q5PA 4FA4A 4GEDB 1H31A 2YQBA 1SQPD 4H0KA 1NTZD 4WQ9A 2CA3B 4AX3A 2C1DA 2ZONG 3A0HV 5KKZB 1KYOD 1C7MA 3CU4A 3TDKA 2N3BA 1BGYD 2N9JA 1PPJD 4K3IA 1LC1A 4EIEA 1K3HA 5EXQA 3PHLA 3H1JD 1BL9A 2BLFB 1I6EA 3H1ID 1IZL0 1EB7A 1CIFA 1HZVA 5DF5A 1I8PA 3CXHD 1SQXD 1GIWA 4D6TD 2Y0CA 1HZUA 4PD4D 1CYJA 3OCDA 2N18C 4AANA 1YEAA 3CWBD 4A7PA 3HQ9A 5B6QA 1KX7A 1U74B 1WEJF 3PRJA 5DJQB 1FI9A 1HROA 1C75A 1DW3A 3O20A 2IBZD 1B7VA 2N3YA 1P84D 3DMIA 4RSZA 1HJ3A 4FA5A 1H33B 2B11B 1CRIA 1I5TA 3BCCD 1N9CA 4DY9A 2D0SA 4AALA 3L75D 1SQVD 2BGVX 1KB0A 3A0BV 1QN2A 2ZOOA 1KIBA 1E2RA 2I8FA 1CTYA 3KZIV 1IRWA 1M70A 1VYDA 1CCHA 3OCDB 1CRJA 4V2KA 1AOFA 4NFGB 4Y5RA 2BH5X 3L70D 3PTZA 2LIRA 1ETPA 1QYZA 1F1CA 1RAQA 4KMGA 1CSXA 3A9FA 1CTZA 3VNWA 4JCGA 3O0RC 4H0JA 2GIWA 5CICB 4MU8A 1KV9A 2CXBA 3NWVA 3CX5D 2QG4A 1ZZHA 4O1QA 1FI3A 3HQ8A 3WFBC 2GC4D 5KLVD 2FYUD 3RMZA 1J3SA 4AAMA 2CE1A 1A2SA 1HH7A 2VHDA 4GYDA 1YTCA 3MK7C 1MG3D 3ZOXA 3HQ7A 3O5CA 1RZ5A 1L9BC 1YIQA 3ITKA 3ORVA 5CIGB 1QKSA 1H32B 1CXCA 4FB1A 1H33A 3TF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1U A;  2FWL A;  4L3H A;  1RZ6 A;  1LMS A;  4EIC A;  1CSU A;  1N15 A;  4IL6 V;  2OZ1 A;  3PLN A;  3WFC C;  1L0N D;  1CSW A;  2XTS B;  2Y0E A;  1QL3 A;  2C9X B;  3PXW A;  3M97 X;  2V08 A;  5DJQ C;  2JWA A;  4UB6 V;  2PCC B;  4U3F D;  1DVV A;  2YIU B;  2OZ1 B;  1YIC A;  3O1Y A;  3H1L D;  4WQA A;  1N90 A;  3L4M A;  4WQ8 A;  2B12 B;  4PWA A;  2FYN B;  2ORL A;  1CXA A;  3L4O A;  3OA8 A;  3RN0 A;  1CRH A;  3TGU D;  2N18 B;  1GQ1 A;  5KLI B;  1C6R A;  2EXV A;  3CYT I;  5CIF B;  1BE3 D;  1DIQ C;  2RN0 A;  1NU1 D;  1DW0 A;  1FHB A;  1DW1 A;  1R0Q A;  1I8O A;  5C0Z A;  1CTJ A;  155C A;  1OAE A;  5CIB B;  3JBT B;  2MTA C;  2ZZS 1;  2AIU A;  1H1O A;  1GDV A;  1AOQ A;  1QL4 A;  1NTM D;  3ZOY A;  2BCC D;  4WQE A;  1K3G A;  2A06 D;  2KS1 A;  1OCD A;  3CP5 A;  2DVH A;  1FJ0 A;  1I6D A;  5CYT R;  2Q3E A;  1H9Y A;  1H32 A;  2GB8 B;  1NTK D;  3L72 D;  2JTI B;  3RN1 A;  3SJL A;  2AXT V;  3VYM A;  2ZXY A;  3PXS A;  1KB9 D;  4AAO A;  1DW2 A;  3PH2 B;  1HRC A;  1CC5 A;  1M6Z A;  3PXT A;  4RJT A;  3X39 A;  451C A;  2B10 B;  2AI5 A;  3WUI A;  1CIE A;  4WQB A;  1CNO A;  1S6V B;  1W5C T;  1CED A;  1C2R A;  1IRV A;  1I55 A;  3OA8 B;  5CIH B;  5CID B;  1I54 A;  2K9J B;  4WQC A;  4WQ7 A;  2CA4 B;  1RAP A;  1MZ4 A;  5E79 V;  4FA9 A;  1CCR A;  1GU2 A;  3KHU A;  2B0Z B;  3ZOO A;  1NIR A;  2L91 A;  3RLM A;  2BCN B;  1HCM A;  3CX5 W;  1DVH A;  3L73 D;  1IQC A;  1BCC D;  1C2N A;  3HQ6 A;  2D0W A;  1H9X A;  3ZOW A;  2BH4 X;  2C1V A;  3CXH W;  4PJ0 V;  2BPB B;  2ZBO A;  351C A;  4P4Q B;  3H1K D;  1M60 A;  1CO6 A;  1CRY A;  1NNO A;  4UB8 V;  3NBS A;  1SQQ D;  2C2C A;  1CSV A;  4L3G A;  1EZV D;  4XYD B;  1C52 A;  1CHI A;  1PP9 D;  4FA1 A;  2QJK B;  3SLE A;  3VRD A;  4L1Q A;  1WVE C;  1AKK A;  5C9M A;  1FOC A;  3ZIY A;  1ZRT D;  1HJ4 A;  4LJI A;  1YCC A;  3NBT A;  2L4D A;  1H31 B;  2V07 A;  2RMZ A;  1GJQ A;  3DP5 A;  1HJ5 A;  3WFD C;  1CHH A;  3WU2 V;  3H1H D;  1IO3 A;  1N50 A;  1L9J C;  1DII C;  1C6S A;  2PAC A;  1KX2 A;  1CIH A;  1NML A;  1JDL A;  1MG2 D;  5B5E V;  3TYI A;  2YK3 A;  4EIF A;  1W2L A;  1F1F A;  2C1D B;  2LIT A;  1CIG A;  5KAF V;  3L71 D;  2O3J A;  2DGE A;  4YE1 A;  4J20 A;  5H2F V;  3GG2 A;  2C8S A;  1CYI A;  1A8C A;  1CYC A;  4FAN A;  2JQR A;  5TJH A;  3MK7 B;  2HV4 A;  1COR A;  3DR0 A;  5B66 V;  1CHJ A;  2QJY B;  3SVW A;  4EDF A;  3C2C A;  1LC2 A;  2YCC A;  1S5L V;  1L0L D;  1E8E A;  3SXT A;  1A56 A;  4N0K A;  5IY5 1;  3FWL A;  1AYG A;  1E29 A;  5GTH V;  3WFE C;  1LS9 A;  5CIE B;  2B4Z A;  4WQD A;  1DT1 A;  2Y0D A;  1SQB D;  4PW9 B;  1FCD C;  1YFC A;  2PCB B;  2FRC A;  1GKS A;  4O1W A;  4FAV A;  1FI7 A;  1YEB A;  1LFM A;  5AUR A;  5TIS V;  1CRC A;  5GTI V;  1CRG A;  2N9I A;  3SWS A;  3WC8 A;  3GW6 A;  2QJP B;  1YNR A;  4EID A;  3VMA A;  2KNC B;  4QAO A;  3L74 D;  5DFS A;  3ZBM A;  1C6O A;  2CE0 A;  1COT A;  2N9Y B;  1KYO W;  1U75 B;  1NMI A;  2MHM A;  2GC7 D;  4XXL A;  5KAI V;  3ZCF A;  4Q5P A;  4FA4 A;  4GED B;  1H31 A;  2YQB A;  1SQP D;  4H0K A;  1NTZ D;  4WQ9 A;  2CA3 B;  4AX3 A;  2C1D A;  2ZON G;  3A0H V;  5KKZ B;  1KYO D;  1C7M A;  3CU4 A;  3TDK A;  2N3B A;  1BGY D;  2N9J A;  1PPJ D;  4K3I A;  1LC1 A;  4EIE A;  1K3H A;  5EXQ A;  3PHL A;  3H1J D;  1BL9 A;  2BLF B;  1I6E A;  3H1I D;  1IZL 0;  1EB7 A;  1CIF A;  1HZV A;  5DF5 A;  1I8P A;  3CXH D;  1SQX D;  1GIW A;  4D6T D;  2Y0C A;  1HZU A;  4PD4 D;  1CYJ A;  3OCD A;  2N18 C;  4AAN A;  1YEA A;  3CWB D;  4A7P A;  3HQ9 A;  5B6Q A;  1KX7 A;  1U74 B;  1WEJ F;  3PRJ A;  5DJQ B;  1FI9 A;  1HRO A;  1C75 A;  1DW3 A;  3O20 A;  2IBZ D;  1B7V A;  2N3Y A;  1P84 D;  3DMI A;  4RSZ A;  1HJ3 A;  4FA5 A;  1H33 B;  2B11 B;  1CRI A;  1I5T A;  3BCC D;  1N9C A;  4DY9 A;  2D0S A;  4AAL A;  3L75 D;  1SQV D;  2BGV X;  1KB0 A;  3A0B V;  1QN2 A;  2ZOO A;  1KIB A;  1E2R A;  2I8F A;  1CTY A;  3KZI V;  1IRW A;  1M70 A;  1VYD A;  1CCH A;  3OCD B;  1CRJ A;  4V2K A;  1AOF A;  4NFG B;  4Y5R A;  2BH5 X;  3L70 D;  3PTZ A;  2LIR A;  1ETP A;  1QYZ A;  1F1C A;  1RAQ A;  4KMG A;  1CSX A;  3A9F A;  1CTZ A;  3VNW A;  4JCG A;  3O0R C;  4H0J A;  2GIW A;  5CIC B;  4MU8 A;  1KV9 A;  2CXB A;  3NWV A;  3CX5 D;  2QG4 A;  1ZZH A;  4O1Q A;  1FI3 A;  3HQ8 A;  3WFB C;  2GC4 D;  5KLV D;  2FYU D;  3RMZ A;  1J3S A;  4AAM A;  2CE1 A;  1A2S A;  1HH7 A;  2VHD A;  4GYD A;  1YTC A;  3MK7 C;  1MG3 D;  3ZOX A;  3HQ7 A;  3O5C A;  1RZ5 A;  1L9B C;  1YIQ A;  3ITK A;  3ORV A;  5CIG B;  1QKS A;  1H32 B;  1CXC A;  4FB1 A;  1H33 A;  3TF5 A; 
#chains in the Genus database with same CATH topology
 2K37 A;  1KQG B;  2FWL A;  3RK3 C;  1GZL A;  5TIS H;  3MUD C;  2A45 I;  2C0X A;  4AQR D;  5H2F H;  2OZ1 A;  3CWB J;  3E1R A;  3PLN A;  1YI2 P;  2Y0E A;  2C9X B;  4PD4 E;  5H2F E;  2KZJ A;  3M97 X;  2V08 A;  1NTK J;  3VYI A;  1GTW A;  2YIU B;  1EDI A;  1GL2 C;  2KSE A;  3HD7 C;  1M1J A;  1WT6 A;  2K1A A;  1YIC A;  2J5U A;  1DH3 A;  1FJK A;  4WQA A;  2KNC A;  1N90 A;  3L4M A;  3VMY A;  4WQ8 A;  2PP6 A;  1NJI Q;  1J1D B;  3AE2 C;  3H1H G;  2YXQ B;  3HTK A;  1GQ1 A;  5KLI B;  1N73 C;  4AYC A;  2QJK C;  3OJA B;  4IOI H;  3PJS K;  2EXV A;  3CYT I;  1JCC A;  2N1T B;  1BE3 D;  1DIQ C;  2RN0 A;  3V4W A;  2WPR A;  1I8O A;  3CC7 P;  3H1K E;  1CTJ A;  5CIB B;  5AVV B;  1Y9B A;  2MTA C;  1M56 D;  1KTM A;  2ZZS 1;  1SQQ K;  5AVU B;  1N7L A;  4OGQ D;  4NPD A;  4N78 D;  3HE4 B;  3BCC E;  1L2P A;  1VQM P;  1IK7 A;  1HH0 A;  3R2P A;  1QL4 A;  3AED C;  2PGD A;  3ZOY A;  4ZNC A;  2KS1 A;  1OCD A;  1BGY E;  1FZE A;  1IK9 A;  2ZYA A;  4L74 A;  4GDO A;  2AXC A;  2E43 A;  4WB4 A;  1H9Y A;  1Y8A A;  3CCV P;  5CCH A;  2XDJ A;  2GB8 B;  3V5B A;  5GTH E;  1NTK D;  1M90 Q;  3GLM A;  2JTI B;  1SFC C;  1X22 A;  3SWK A;  2O01 N;  1FDM A;  1NAF A;  1M6Z A;  1IFI A;  3A0H E;  1FJP A;  2B10 B;  2AI5 A;  1HGZ A;  1L0N G;  3CX5 H;  1KYO H;  2CPB A;  1KN7 A;  5BU5 A;  1I55 A;  2HPC B;  3LW5 J;  4JBZ A;  4CPG A;  3V2N A;  1I54 A;  4WQC A;  4WQ7 A;  4HB1 A;  2NPS A;  1OVR A;  2HFE D;  3L70 E;  3CCU P;  1Q81 Q;  2L91 A;  2A06 E;  5KKZ C;  3L71 J;  1SQB J;  3CX5 W;  1DVH A;  1YJ9 P;  2BAS A;  1LTA C;  3L73 D;  2OTL P;  3H25 A;  1BCC D;  3VMZ A;  3CI9 A;  2MKV A;  4PJ0 V;  3H1K D;  1M1K Q;  4UB8 E;  1CRY A;  1NNO A;  4UB8 V;  2WSE J;  2C2C A;  4OVN F;  1EZV D;  4XYD B;  1C52 A;  3L70 J;  3CCJ P;  1M1J C;  2W6B A;  2YO3 A;  3RL0 B;  3EQ2 A;  3SLE A;  2KB7 P;  1IZN B;  2Y9Z A;  1DIP A;  3T97 A;  3KDP B;  4BWN A;  2D2C C;  2QSI A;  1WVE C;  1NTZ J;  2K88 A;  1KIL C;  3KXD A;  1X79 B;  1RH5 B;  1KIL D;  3L70 G;  5KTB A;  1H31 B;  2IYO A;  4KJM A;  1NU1 G;  2D2C D;  5AW7 B;  2IYP A;  2IBZ E;  1PV3 A;  1KQL A;  2LXB A;  1HJ5 A;  1S9K E;  1GU4 A;  4PJ0 H;  2I8D A;  1HWT C;  1DII C;  1X0T A;  2PAC A;  1L4A C;  1GL2 D;  3HD7 D;  3M91 A;  4ZMD A;  1IFN A;  4H0L C;  5CJ0 A;  1HUC A;  3HUS B;  2WSF J;  4Y28 J;  3B5N A;  1F1F A;  2OYH C;  3CPW O;  1NTM E;  1OVU A;  5B66 H;  2W6J H;  5H2F V;  1CYI A;  2H89 C;  1PGQ A;  3D71 A;  2W27 A;  2WPV B;  4LC1 A;  3SVW A;  3WU2 H;  3BRV B;  3L73 E;  3C2C A;  1L0L D;  5AW9 B;  1E8E A;  1URQ A;  1A56 A;  1J1E C;  4KT0 J;  5IY5 1;  2Z5H A;  1FOS F;  4WQD A;  1SQQ G;  1FZC C;  1SQB D;  1A02 F;  2FRC A;  4FAV A;  3MGN A;  1QVG O;  5APS A;  1LFM A;  2K9Y A;  1PP9 E;  1SFC D;  2Q1K A;  5M1B A;  1SQX E;  3SWS A;  1LTT C;  3WC8 A;  4YXD C;  1NWQ A;  1PIX A;  1M57 D;  1YNR A;  3VMA A;  3L37 A;  1AJY A;  1KB9 I;  3D6Z A;  1U7J A;  1BCC E;  2MHM A;  3ZCF A;  4Q5P A;  4EOT A;  3JC2 2;  3M0A A;  4OGQ C;  1H31 A;  1DD4 A;  1SQP D;  4H0K A;  1NTZ D;  4WQ9 A;  4AX3 A;  1URQ B;  2IDB A;  2C1D A;  4I2L C;  1U57 A;  1DX7 A;  1QVF O;  1NTZ G;  2W8Z A;  1OWA A;  1NYH A;  2N9J A;  4K3I A;  2O1J A;  4EIE A;  5EXQ A;  5AW8 B;  1I6E A;  2CK3 H;  2G8Y A;  2I1J A;  5CCG D;  1SFC B;  3MD0 A;  1NTK G;  4XE5 B;  3BVH A;  1GIW A;  1JB0 J;  1LWU C;  2ZYD A;  2POH A;  3OCD A;  2IZ0 A;  1L4A A;  3AE5 C;  2A06 G;  2GM4 A;  2Q6Q A;  4L76 A;  5AVS B;  4ASV A;  1VQN P;  5DJQ B;  1FI9 A;  1HRO A;  1C75 A;  5CBN A;  1AQ5 A;  1J2J B;  1SQB G;  4GOE A;  2IBZ D;  4OH8 B;  1AV1 A;  1S4X A;  4FA5 A;  2P10 A;  1KB9 H;  3AEC C;  3L72 E;  1SQV D;  2BGV X;  1R5S A;  1K05 A;  3CCL P;  2ZOO A;  1J1D C;  1CTY A;  3FXD A;  2B87 B;  1CCH A;  1CRJ A;  4NFG B;  4Y5R A;  2BH5 X;  4DZO A;  1F1C A;  4KMG A;  2IBZ I;  1P84 I;  3O0R C;  4MU8 A;  3CLQ A;  1UIX A;  3CX5 D;  1FI3 A;  3HQ8 A;  2JJL A;  3RMZ A;  2FYU D;  1FS0 E;  1QEX A;  2HOD B;  1SQV E;  1BE3 J;  3O5C A;  2W90 A;  5KLV J;  2R3S A;  3RBZ A;  2KS1 B;  2JO1 A;  2O1K A;  3ORV A;  1OVV A;  3BAS A;  3B5N C;  3L36 A;  2ZVN B;  1H33 A;  1USE A;  5DJT B;  3TF5 A;  2K9J A;  1W2B O;  1N7S B;  2V4H A;  3TYY A;  2FY8 A;  1VQ6 P;  4GT1 A;  3S1K A;  1ZRT E;  2H7H A;  3D70 A;  4IL6 E;  1L0N D;  2RKL A;  2WVR A;  2XTS B;  1S5L X;  3RL0 D;  3O8Z A;  1LWU A;  3NMD A;  4U3F D;  2OZ1 B;  5KJ7 C;  1OIP A;  2WT7 A;  3H1J G;  4HYT B;  1EQ7 A;  1DD3 A;  3Q5P A;  3FXE A;  3RN0 A;  3OW2 O;  1LWU B;  2N18 B;  1H0T A;  3Q3D A;  1USD A;  2M3E A;  1YHQ P;  1ZR2 A;  1NU1 D;  1FHB A;  1DW1 A;  1R0Q A;  5C0Z A;  5GTI H;  2YNY A;  3MUD A;  1MZ9 A;  4PV1 D;  1SQX K;  2LKM A;  1NTZ K;  3RK2 B;  5CMZ A;  1GK6 A;  3VP9 A;  1H1O A;  2A45 G;  1JM0 A;  1AOQ A;  3CCQ P;  5BU8 B;  3B71 A;  1JTH B;  2BCC D;  4WQE A;  3I5C A;  3O6Q A;  1K3G A;  1I6D A;  2UWJ E;  5CYT R;  1PGP A;  2KOG A;  2N1T C;  3RN1 A;  2NPS D;  3H1I G;  3N4X A;  3L74 E;  1YQ3 C;  3VYM A;  1BCC G;  1PGJ A;  2NPS B;  1XTC C;  1XTG B;  1SQB K;  3GHG C;  2HLO A;  4RJT A;  3GHG B;  1QL2 A;  1KB9 E;  1SFC A;  3AE6 C;  5C39 A;  2WSS H;  1CNO A;  1W5C T;  1LT9 B;  1R5L A;  1C2R A;  1IRV A;  3U59 A;  3EWK A;  4XFJ A;  1JOC A;  1BE3 G;  2FFD C;  2WQY C;  5CIH B;  1NTM G;  2E74 C;  5CID B;  2K9J B;  2CA4 B;  4RES B;  1MZ4 A;  3PP5 A;  1VQ8 P;  1QL1 A;  5APU A;  2B0Z B;  1NIR A;  1FC2 C;  4OWF A;  3A0H H;  2N1T D;  1NGM B;  4NPF X;  1HCM A;  1NKZ B;  3WUU A;  3KZI E;  1LT1 A;  1L0N K;  3A7O A;  1C2N A;  3GMA A;  1HVV A;  2FYU J;  2OYI C;  1H9X A;  3ZOW A;  1YQ4 C;  1G2C B;  5CCH C;  3CXH W;  1K04 A;  3GF7 A;  1T3U A;  351C A;  3P32 A;  1DEE G;  5AVQ B;  1PFI A;  4JYC A;  3CL3 D;  2KZI A;  1WRG A;  1M60 A;  1H89 A;  1CSV A;  1E79 H;  1KYO E;  1M8O B;  5CCG A;  1RF0 C;  4H44 B;  3VRD A;  3A3Y B;  4L1Q A;  2V7Q H;  2BCC E;  1AKK A;  5C9M A;  4BRY B;  1N2D C;  1G1I A;  1HJ4 A;  1JY3 N;  2L4D A;  2B87 A;  1X8Y A;  2V07 A;  5K5G B;  1VQ9 P;  1CSB A;  4L73 A;  3CC2 P;  1IFP A;  2PFX A;  1KD1 Q;  3WFD C;  1L0L J;  1ZXG A;  5AVW B;  3H1H D;  1IO3 A;  1N50 A;  1L9J C;  2XV5 A;  1C6S A;  3IFM A;  1NU1 E;  1SLQ A;  3G4S P;  2E42 A;  4WY4 D;  1NHL A;  3RL0 C;  1JNM A;  2Q5U A;  4HH2 A;  2PRR A;  2QJP C;  4H44 C;  1KQS O;  2LIT A;  2J59 M;  4YE1 A;  3BRT B;  5DJU B;  3B5N B;  1CYC A;  4FAN A;  2OYI B;  3IF4 A;  1SQV K;  1BDC A;  1COR A;  1KQF B;  5KLV K;  1PGO A;  1S3J A;  3GF3 A;  3CMA P;  1FAV A;  2E74 D;  2JP3 A;  1DEB A;  1NTZ E;  1AVO A;  2E74 B;  1LTJ A;  3FWL A;  1JUN A;  2B4Z A;  2KUB A;  1LT9 C;  5AW3 B;  4C46 A;  1JCD A;  4PW9 B;  4MN4 C;  1FCD C;  2M5A B;  2Z5I A;  4O1W A;  1FI7 A;  4M3L A;  3L75 J;  5GTI E;  2NPS C;  5TIS V;  5GTI V;  2WZ7 A;  3CXH E;  1SQP G;  3ZDM A;  2ZT9 B;  1LTB C;  2QJP B;  3AE4 C;  4EID A;  3VP8 A;  4QAO A;  4WBA A;  5DFS A;  4B86 A;  2CE0 A;  4K3A A;  2KLU A;  1COT A;  2OAR A;  5APV A;  1KYO W;  1U75 B;  2GC7 D;  4PD4 I;  1IC2 A;  3HUS A;  3AE3 C;  2M5A A;  4KHX A;  1SQX J;  2ZON G;  1RF0 A;  1VQK P;  1KYO D;  1C7M A;  3CU4 A;  2IFN A;  1PPJ D;  1NTM K;  2L5G B;  1K73 Q;  3H1J D;  1BL9 A;  3JCU E;  2QIW A;  1EB7 A;  1I8P A;  1EZV I;  1BE3 E;  3P8C E;  1N7S D;  3AEE C;  5E79 E;  1M7L A;  4PD4 D;  2AXT E;  1CYJ A;  3T97 B;  1LGH B;  2N18 C;  1SQP J;  2OYI A;  1YEA A;  1NU1 J;  1G1J A;  1YJW P;  2R32 A;  4I1L A;  2B88 A;  5B6Q A;  2ZT9 C;  1KX7 A;  1FZA A;  1HGV A;  3MZW B;  3SWY A;  4OGQ B;  2M0B A;  1B7V A;  2N3Y A;  2OYH A;  3DMI A;  1H33 B;  1RQU A;  1S1C X;  1NTM J;  2B11 B;  1KZU B;  2XKM A;  1BGY G;  4DY9 A;  2KK7 A;  1YTZ I;  3RK3 B;  2IZ1 A;  3H1J E;  1QLE D;  1M70 A;  1VYD A;  1NU1 K;  3Q2Y A;  1ZME C;  5AVR B;  1IJD B;  1AOF A;  2QRX A;  4TT3 H;  2E5T A;  1RE4 C;  1CI6 A;  3L70 D;  3PTZ A;  2E75 C;  5AW4 B;  5E79 H;  3S9O A;  1QYZ A;  3A9F A;  1OW7 A;  4JCG A;  3H1K J;  4GOD A;  2GIW A;  2CXB A;  1AVY A;  2QG4 A;  3WFB C;  2CE1 A;  3I55 P;  1HH7 A;  4XA4 A;  2HOD A;  3H1K G;  1VQ5 P;  3TNU B;  1K8A Q;  2WSC J;  3Q5S A;  3ZOX A;  5AW6 B;  1NTK E;  5AVZ B;  3ITK A;  3RGU A;  4O9B A;  1VQL P;  5CIG B;  1E5W A;  2M8R A;  1QKS A;  2ZXE B;  1H32 B;  2C1U A;  2DW3 A;  5B5E E;  1RZ6 A;  2E76 D;  3CC4 P;  4IL6 V;  4Y99 B;  1JEK A;  1LTG C;  5BVZ A;  1CSW A;  3MHV A;  4WY4 A;  3WMM 0;  3PXW A;  2A45 H;  1P84 E;  2O01 H;  4UB6 E;  5KLV E;  4H0L D;  5DJQ C;  4UB6 V;  2PCC B;  1SQP K;  3SSU A;  5CHX A;  1L4A D;  3O1Y A;  1L0N E;  3H1L D;  1S5L H;  4NPE A;  3H1J J;  3CXH H;  5CCG C;  3G71 P;  2B12 B;  4JPZ B;  2R44 A;  4PWA A;  2FYN B;  3H1H J;  2ORL A;  5AVX B;  4I6M C;  2KP8 A;  4LGD E;  3L75 G;  1C6R A;  3AEG C;  5CIF B;  3U1A A;  2P58 A;  4IL6 X;  1DW0 A;  1CZQ A;  4EYY Q;  2K3R A;  1NO4 A;  4C7N B;  155C A;  1OAE A;  2QA4 P;  2B89 A;  4GOF A;  2ZAE B;  3WUV A;  1T2K D;  3S4R A;  1MV8 A;  2AIU A;  2WSF H;  1GDV A;  3BCC J;  1JY3 P;  1NTM D;  3NXS A;  2DVH A;  1FJ0 A;  1KV4 A;  4K35 A;  4WVZ A;  2XNX A;  1A02 J;  1IO4 A;  2Q3E A;  1EDK A;  1H32 A;  4WY4 B;  3L72 D;  3CCS P;  3CME P;  3HE4 A;  1GW3 A;  3SJL A;  3UIA A;  2YKO A;  1KB9 D;  4AAO A;  1PPJ G;  1PPJ E;  1VL2 A;  1YBK A;  3AE9 C;  1DW2 A;  3PH2 B;  1HRC A;  1CC5 A;  3C8V A;  5APQ A;  3W68 A;  1ZR4 A;  2N9B A;  2N1T A;  3H1I J;  1CIE A;  2OQQ A;  2OYO A;  3OA8 B;  4W7Y A;  3G3Z A;  4C7R A;  3VMX A;  1RAP A;  4U3F J;  5KAI E;  1CCR A;  2P7J A;  3KHU A;  3ZOO A;  2C0W A;  3USS A;  3PH0 A;  1FBM A;  1GL2 A;  3HD7 A;  4YTP C;  4N6J A;  3SWF A;  2YKP A;  1N7S A;  2C1V A;  3M9B A;  1SVF A;  3WU2 E;  1CO6 A;  3MIW A;  3ABV C;  1P84 H;  1JY2 P;  4L3G A;  1T2K C;  5AW5 B;  3A5T A;  4EIJ A;  4H0L B;  1PP9 D;  4FA1 A;  1OFC X;  3IAO A;  4UB8 H;  2QJK B;  1VQ4 P;  3EFG A;  1OMI A;  1URQ D;  1MKM A;  3ZIY A;  2IPP A;  4LJI A;  1URQ C;  1YCC A;  1LNQ A;  2PAJ A;  1EZV G;  2RMZ A;  3DP5 A;  4DT0 A;  3TGU J;  2Q9I A;  1KIL B;  2NRG A;  1RE4 A;  1CHH A;  3TGU G;  2ZJS E;  1YIJ P;  1KX2 A;  2QE7 H;  1SQP E;  1CIH A;  5AVT B;  1M1J B;  5CJ4 A;  3WUT A;  1JDL A;  2YO2 A;  1IFJ A;  2D2C B;  5B5E V;  2YK3 A;  4EIF A;  1W2L A;  1BSN A;  2O3J A;  1R8E A;  1EXI A;  3KPE A;  2DGE A;  2J58 A;  2E76 C;  2Y9Y A;  1VQO P;  3GG2 A;  3RK3 D;  2C8S A;  5KAF H;  1VQ7 P;  3MK7 B;  1BDD A;  2FYU G;  2JEE A;  1FZC B;  3DR0 A;  3AEB C;  1CHJ A;  2QJY B;  1S72 P;  2KIK A;  4LLH A;  5B66 E;  1PZQ A;  4EDF A;  2GUV A;  1S5L V;  3C9I A;  2W83 C;  4N3Y B;  3H1I E;  1RF1 B;  1AYG A;  1E29 A;  3B8E B;  1BCC J;  3NTN A;  2C9N Y;  3LW5 H;  1DT1 A;  2Y0D A;  1YFC A;  2PCB B;  1YEB A;  3L75 E;  2FXM A;  1N73 A;  1MFZ A;  1CRG A;  1H8A A;  3AE7 C;  3GW6 A;  1AA0 A;  3V6I A;  2KYV A;  3ZBM A;  1C6O A;  1OX3 A;  3E1I A;  4AUW A;  1NMI A;  5KAI V;  3L35 A;  4FA4 A;  3V4Q A;  4GED B;  3SFD C;  3MTU E;  2FBW C;  4ZKP A;  3L4F A;  5CBO A;  2CA3 B;  2QM7 A;  4D6T J;  2IX7 C;  1T3J A;  2Q3I A;  1OXZ A;  3TDK A;  1YTZ T;  2N3B A;  2P1J A;  2JKV A;  1JY2 O;  3D0W A;  1S9K D;  3PHL A;  3L73 G;  3RK3 E;  1MUU A;  1AFO A;  1CIF A;  3H32 A;  4W80 A;  1SQX D;  3CD6 P;  1CI6 B;  1KIL E;  1X9V A;  4IFD K;  1HZU A;  2WSC H;  1OW8 A;  3B4S A;  3IN6 A;  3L73 J;  4AAN A;  1N7S C;  1W2E A;  1N86 A;  3MP7 B;  4A7P A;  2IFM A;  3HQ9 A;  1GL2 B;  3HD7 B;  4PV1 B;  1VF5 C;  1LP1 B;  3H32 B;  3M0D C;  1FU1 A;  1NVO A;  1JTH A;  1KC8 Q;  1DW3 A;  3O20 A;  3CCE P;  3QWO C;  4RSZ A;  5KJ7 A;  2YIU C;  1HJ3 A;  3Q1M A;  1CRI A;  2YMK A;  3P8C D;  2RH0 A;  2D0S A;  4U3F E;  3L75 D;  1J1E B;  3A0B V;  1QN2 A;  2GA1 A;  1E2R A;  1S2E A;  1LJ2 A;  3KZI V;  4YPC A;  2YKQ A;  4HJG H;  1FDI A;  1RQV A;  3OA7 A;  2LIR A;  5APX A;  5APY A;  1RAQ A;  1SQQ J;  3AE1 C;  3VNW A;  2HR3 A;  1HTL C;  1VDF A;  1ZP0 C;  4H13 C;  4H0J A;  3VTP C;  2OYH B;  1HJB A;  2SPZ A;  1PP9 G;  1ZZH A;  3O6Q B;  4O1Q A;  1KOR A;  4AAM A;  2H43 A;  2H8P D;  2E75 D;  4RKU J;  1L4A B;  1T6A A;  2AEM A;  1SQV G;  1MG3 D;  2FYU K;  4L75 A;  1L0L K;  1OW6 A;  1AQT A;  1SQV J;  5KLV G;  3HQ7 A;  2FYZ A;  1L9B C;  1YIQ A;  1NH4 A;  1TU3 F;  3TGU E;  2GUS A;  1H0T B;  1PL5 A;  3A2A A;  1ZW0 A;  1CXC A;  1JO5 A;  4FB1 A;  1JY3 O;  3GHG A;  4BXL A;  2BEZ F;  3CX5 I;  2ZFC A;  4L3H A;  1VPC A;  4D6T E;  1LMS A;  4TLF A;  4EIC A;  1CSU A;  1GW4 A;  4JQ0 D;  3VOP A;  1N15 A;  2LR2 A;  4H44 D;  3WFC C;  1Q2N A;  1QL3 A;  1KFN A;  1T8Z A;  2ZT9 D;  3TNU A;  2JWA A;  1DVV A;  1N8R Q;  1LTJ C;  2E76 B;  2E75 B;  3TSI A;  3HTK B;  3M9Q A;  5AW0 B;  2V7Q J;  1CXA A;  3L4O A;  4ZKU A;  3OA8 A;  1CRH A;  3TGU D;  1KMI Z;  1EZV E;  1EDL A;  2FFD B;  1QGK B;  4C7N A;  2WT7 B;  3KQG A;  5KAF E;  2WIT A;  2AXT H;  4ASW A;  5APT A;  4RO0 A;  3JBT B;  5APW A;  3L72 J;  3EFF K;  4I7Z C;  3FGA D;  1Q82 Q;  3CX5 E;  3V2Q A;  2CPS A;  2FFD A;  2HPC A;  3RBX A;  1YJN P;  1NAY A;  4GIF A;  2A06 D;  5CCH D;  3H6P A;  1BGY J;  3CP5 A;  4GKG A;  5KAI H;  3FWN A;  2JWD A;  3LID A;  3FX0 A;  2ZVO B;  1FDO A;  2G3A A;  4R4L A;  2HYN A;  1L0N J;  2BCC G;  2AXT V;  4QMA A;  2ZXY A;  3PXS A;  3H1L G;  2XND H;  2KXP B;  1KFM A;  2P67 A;  1JMB A;  1U7M A;  3RK2 C;  5TIS E;  3PXT A;  2JDI H;  3X39 A;  451C A;  1D7M A;  3W67 A;  3WUI A;  3R4Y A;  2ZYG A;  4WQB A;  1S6V B;  1CED A;  4DCK A;  1RE3 A;  2W6A A;  3RK2 D;  5GTH H;  2C9L Y;  5E79 V;  5KLI C;  4WWI A;  4U7J A;  4FA9 A;  5AVY B;  2R3C A;  1GU2 A;  3L71 G;  2AEF A;  3RLM A;  2BCN B;  2HG5 D;  3HRN A;  1IFD A;  3V2P A;  2WTY A;  1IQC A;  3A0B H;  3H1H E;  3HQ6 A;  4I7Z B;  2D0W A;  1GK4 A;  3V2R A;  2WMM A;  4U3F G;  3VN0 A;  2WSE H;  3L72 G;  2BH4 X;  2BPB B;  4Z1M H;  2ZBO A;  4P4Q B;  2YMY A;  4WY4 C;  2QM8 A;  1SP4 A;  3NBS A;  1SQQ D;  2FXO A;  2ITA A;  3CXH I;  4YXW H;  1CHI A;  3IR9 A;  1YIT P;  1JY2 N;  3G6E P;  1ZOY C;  3QH9 A;  1L0L G;  1Q86 Q;  1YYC A;  3L74 G;  4JYB A;  1LTI C;  1FOC A;  1ZRT D;  4PD4 H;  3NBT A;  2NZ2 A;  1LTS C;  1GJQ A;  5AW1 B;  2FXP A;  1LTJ B;  3WU2 V;  1VF5 B;  3L74 J;  1QX8 A;  3AE8 C;  1CW5 A;  5KJ7 D;  1SQB E;  1NML A;  1GDT A;  4UB6 H;  2FYN C;  1MG2 D;  2B9B A;  3TYI A;  2JR8 A;  2XU6 A;  3C1L A;  3CWB E;  2C1D B;  1CIG A;  5KAF V;  3L71 D;  4J20 A;  1Z56 A;  2R5D A;  1FZB A;  1A8C A;  2JQR A;  5TJH A;  1K9M Q;  1L0L E;  2HV4 A;  3CCM P;  2FKW B;  3F5H A;  5B66 V;  4HKZ H;  1FZC A;  1LC2 A;  2YCC A;  1Q90 D;  3HUS C;  2I1K A;  2Z4E A;  2FYU E;  3SXT A;  4N0K A;  2LXC B;  2OGU A;  4JF7 A;  3U1C A;  5GTH V;  3WFE C;  1RE3 C;  1LS9 A;  5CIE B;  1GD2 E;  3P7K A;  1LP1 A;  2IBZ G;  4BRY A;  5EFW B;  4R4M A;  1RF1 A;  4H13 B;  1JMM A;  1GKS A;  1WMK A;  1BSH A;  3M9H A;  5AUR A;  1CRC A;  1PP9 J;  1ZV8 A;  2XZR A;  3L71 E;  5AW2 B;  1KYO I;  2N9I A;  2WWW A;  3BCC G;  2AEJ A;  1FZG A;  1Q7Y Q;  1Y47 A;  1S5L E;  2KNC B;  3L74 D;  1FE6 A;  3M06 A;  1FOS E;  2N9Y B;  3OAK A;  1SS1 A;  1RHZ B;  2KLV A;  4XXL A;  4EI2 A;  1G2C A;  4IFF A;  3I56 P;  1N73 B;  2H88 C;  3AEF C;  1UII A;  2YQB A;  3CWB G;  1NTK K;  4PV1 C;  1HF9 A;  5B5E H;  3HE5 A;  3H1L E;  4D6T G;  3A0H V;  5KKZ B;  1SQX G;  1BGY D;  2E5Y A;  1LC1 A;  1K3H A;  2BCC J;  4DJG A;  2BLF B;  1VF5 D;  3H1I D;  2R5B A;  1IZL 0;  1HZV A;  5DF5 A;  3CXH D;  2KSJ A;  1MFT A;  1OZH A;  4N78 E;  1EC5 A;  2O01 J;  1SQQ E;  3Q5R A;  3HE5 B;  4D6T D;  2Y0C A;  3F89 A;  3JSV C;  3A0B E;  2OTK E;  2MJZ A;  2WPQ A;  3CWB D;  4IFM A;  3II6 A;  1U74 B;  1WEJ F;  3PRJ A;  3RL0 g;  1W5C E;  1EXJ A;  2P2U A;  1NOH A;  1P84 D;  1NKN A;  4IL6 H;  3G9R A;  2Q7C A;  1LT9 A;  1I5T A;  3BCC D;  1N9C A;  2ZXX A;  1HBW A;  3BAT A;  4AAL A;  2BEQ D;  3B5N D;  1KB0 A;  1KIL A;  1H88 A;  1HJ0 A;  1KIB A;  1VQP P;  2I8F A;  1IRW A;  3OCD B;  4V2K A;  3P8M C;  1FZF A;  4DOJ A;  3LIE A;  3N7N A;  3KYQ A;  1ETP A;  1EDJ A;  1ZLL A;  2KI7 B;  3E7K A;  1CSX A;  3SFE C;  1CTZ A;  1RF1 C;  4Y99 C;  2WPS A;  5CIC B;  3JCU H;  2QVA A;  1KV9 A;  3NWV A;  3K5B A;  3AEA C;  4H13 D;  3H1L J;  3CCR P;  2GC4 D;  5KLV D;  1J3S A;  1IFM A;  3M0D A;  3D6Y A;  1A2S A;  4W7Z A;  2M3B A;  2VRS A;  3NFQ A;  3KZI H;  2VHD A;  4GYD A;  1RY3 A;  1YTC A;  3MK7 C;  2OTJ P;  2QJY C;  1RZ5 A;  2QEX P;  1ZN5 A;  4PJ0 E;  1GU5 A;  2YXR B;  1GMJ A;  5L8R J;  3TK1 A; 
#chains in the Genus database with same CATH homology
 2C1U A;  2FWL A;  4L3H A;  1RZ6 A;  1LMS A;  4EIC A;  1CSU A;  1N15 A;  4IL6 V;  2OZ1 A;  3PLN A;  3WFC C;  1L0N D;  1CSW A;  2XTS B;  2Y0E A;  1QL3 A;  2C9X B;  3PXW A;  3M97 X;  2V08 A;  5DJQ C;  2JWA A;  4UB6 V;  2PCC B;  4U3F D;  1DVV A;  2YIU B;  2OZ1 B;  1YIC A;  3O1Y A;  3H1L D;  4WQA A;  1N90 A;  3L4M A;  4WQ8 A;  2B12 B;  4PWA A;  2FYN B;  2ORL A;  1CXA A;  3L4O A;  3OA8 A;  3RN0 A;  1CRH A;  3TGU D;  2N18 B;  1GQ1 A;  5KLI B;  1C6R A;  2EXV A;  3CYT I;  5CIF B;  1BE3 D;  1DIQ C;  2RN0 A;  1NU1 D;  1DW0 A;  1FHB A;  1DW1 A;  1R0Q A;  1I8O A;  5C0Z A;  1CTJ A;  155C A;  1OAE A;  5CIB B;  3JBT B;  2MTA C;  2ZZS 1;  2AIU A;  1H1O A;  1GDV A;  1AOQ A;  1QL4 A;  1NTM D;  3ZOY A;  2BCC D;  4WQE A;  1K3G A;  2A06 D;  2KS1 A;  1OCD A;  3CP5 A;  2DVH A;  1FJ0 A;  1I6D A;  5CYT R;  2Q3E A;  1H9Y A;  1H32 A;  2GB8 B;  1NTK D;  3L72 D;  2JTI B;  3RN1 A;  3SJL A;  2AXT V;  3VYM A;  2ZXY A;  3PXS A;  1KB9 D;  4AAO A;  1DW2 A;  3PH2 B;  1HRC A;  1CC5 A;  1M6Z A;  3PXT A;  4RJT A;  3X39 A;  451C A;  2B10 B;  2AI5 A;  3WUI A;  1CIE A;  4WQB A;  1CNO A;  1S6V B;  1W5C T;  1CED A;  1C2R A;  1IRV A;  1I55 A;  3OA8 B;  5CIH B;  5CID B;  1I54 A;  2K9J B;  4WQC A;  4WQ7 A;  2CA4 B;  1RAP A;  1MZ4 A;  5E79 V;  4FA9 A;  1CCR A;  1GU2 A;  3KHU A;  2B0Z B;  3ZOO A;  1NIR A;  2L91 A;  3RLM A;  2BCN B;  1HCM A;  3CX5 W;  1DVH A;  3L73 D;  1IQC A;  1BCC D;  1C2N A;  3HQ6 A;  2D0W A;  1H9X A;  3ZOW A;  2BH4 X;  2C1V A;  3CXH W;  4PJ0 V;  2BPB B;  2ZBO A;  351C A;  4P4Q B;  3H1K D;  1M60 A;  1CO6 A;  1CRY A;  1NNO A;  4UB8 V;  3NBS A;  1SQQ D;  2C2C A;  1CSV A;  4L3G A;  1EZV D;  4XYD B;  1C52 A;  1CHI A;  1PP9 D;  4FA1 A;  2QJK B;  3SLE A;  3VRD A;  4L1Q A;  1WVE C;  1AKK A;  5C9M A;  1FOC A;  3ZIY A;  1ZRT D;  1HJ4 A;  4LJI A;  1YCC A;  3NBT A;  2L4D A;  1H31 B;  2V07 A;  2RMZ A;  1GJQ A;  3DP5 A;  1HJ5 A;  3WFD C;  1CHH A;  3WU2 V;  3H1H D;  1IO3 A;  1N50 A;  1L9J C;  1DII C;  1C6S A;  2PAC A;  1KX2 A;  1CIH A;  1NML A;  1JDL A;  1MG2 D;  5B5E V;  3TYI A;  2YK3 A;  4EIF A;  1W2L A;  1F1F A;  2C1D B;  2LIT A;  1CIG A;  5KAF V;  3L71 D;  2O3J A;  2DGE A;  4YE1 A;  4J20 A;  5H2F V;  3GG2 A;  2C8S A;  1CYI A;  1A8C A;  1CYC A;  4FAN A;  2JQR A;  5TJH A;  3MK7 B;  2HV4 A;  1COR A;  3DR0 A;  5B66 V;  1CHJ A;  2QJY B;  3SVW A;  4EDF A;  3C2C A;  1LC2 A;  2YCC A;  1S5L V;  1L0L D;  1E8E A;  3SXT A;  1A56 A;  4N0K A;  5IY5 1;  3FWL A;  1AYG A;  1E29 A;  5GTH V;  3WFE C;  1LS9 A;  5CIE B;  2B4Z A;  4WQD A;  1DT1 A;  2Y0D A;  1SQB D;  4PW9 B;  1FCD C;  1YFC A;  2PCB B;  2FRC A;  1GKS A;  4O1W A;  4FAV A;  1FI7 A;  1YEB A;  1LFM A;  5AUR A;  5TIS V;  1CRC A;  5GTI V;  1CRG A;  2N9I A;  3SWS A;  3WC8 A;  3GW6 A;  2QJP B;  1YNR A;  4EID A;  3VMA A;  2KNC B;  4QAO A;  3L74 D;  5DFS A;  3ZBM A;  1C6O A;  2CE0 A;  1COT A;  2N9Y B;  1KYO W;  1U75 B;  1NMI A;  2MHM A;  2GC7 D;  4XXL A;  5KAI V;  3ZCF A;  4Q5P A;  4FA4 A;  4GED B;  1H31 A;  2YQB A;  1SQP D;  4H0K A;  1NTZ D;  4WQ9 A;  2CA3 B;  4AX3 A;  2C1D A;  2ZON G;  3A0H V;  5KKZ B;  1KYO D;  1C7M A;  3CU4 A;  3TDK A;  2N3B A;  1BGY D;  2N9J A;  1PPJ D;  4K3I A;  1LC1 A;  4EIE A;  1K3H A;  5EXQ A;  3PHL A;  3H1J D;  1BL9 A;  2BLF B;  1I6E A;  3H1I D;  1IZL 0;  1EB7 A;  1CIF A;  1HZV A;  5DF5 A;  1I8P A;  3CXH D;  1SQX D;  1GIW A;  4D6T D;  2Y0C A;  1HZU A;  4PD4 D;  1CYJ A;  3OCD A;  2N18 C;  4AAN A;  1YEA A;  3CWB D;  4A7P A;  3HQ9 A;  5B6Q A;  1KX7 A;  1U74 B;  1WEJ F;  3PRJ A;  5DJQ B;  1FI9 A;  1HRO A;  1C75 A;  1DW3 A;  3O20 A;  2IBZ D;  1B7V A;  2N3Y A;  1P84 D;  3DMI A;  4RSZ A;  1HJ3 A;  4FA5 A;  1H33 B;  2B11 B;  1CRI A;  1I5T A;  3BCC D;  1N9C A;  4DY9 A;  2D0S A;  4AAL A;  3L75 D;  1SQV D;  2BGV X;  1KB0 A;  3A0B V;  1QN2 A;  2ZOO A;  1KIB A;  1E2R A;  2I8F A;  1CTY A;  3KZI V;  1IRW A;  1M70 A;  1VYD A;  1CCH A;  3OCD B;  1CRJ A;  4V2K A;  1AOF A;  4NFG B;  4Y5R A;  2BH5 X;  3L70 D;  3PTZ A;  2LIR A;  1ETP A;  1QYZ A;  1F1C A;  1RAQ A;  4KMG A;  1CSX A;  3A9F A;  1CTZ A;  3VNW A;  4JCG A;  3O0R C;  4H0J A;  2GIW A;  5CIC B;  4MU8 A;  1KV9 A;  2CXB A;  3NWV A;  3CX5 D;  2QG4 A;  1ZZH A;  4O1Q A;  1FI3 A;  3HQ8 A;  3WFB C;  2GC4 D;  5KLV D;  2FYU D;  3RMZ A;  1J3S A;  4AAM A;  2CE1 A;  1A2S A;  1HH7 A;  2VHD A;  4GYD A;  1YTC A;  3MK7 C;  1MG3 D;  3ZOX A;  3HQ7 A;  3O5C A;  1RZ5 A;  1L9B C;  1YIQ A;  3ITK A;  3ORV A;  5CIG B;  1QKS A;  1H32 B;  1CXC A;  4FB1 A;  1H33 A;  3TF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...