The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
263
|
structure length |
253
|
Chain Sequence |
TIKNFTFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Receptor-binding protein of Lactococcus lactis phages: identification and characterization of the saccharide receptor-binding site.
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| source organism |
Lactococcus lactis phage p2
|
| molecule keywords |
lactophage p2 receptor binding protein
|
| total genus |
57
|
| structure length |
253
|
| sequence length |
263
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2005-05-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08931 | Caudo_bapla_RBP | Receptor-binding protein of phage tail base-plate Siphoviridae, head |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
| Mainly Beta | Sandwich | Triple-stranded beta-helix | Phage fibre proteins |
