1ZRUA

Structure of the lactophage p2 receptor binding protein in complex with glycerol
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
263
structure length
253
Chain Sequence
TIKNFTFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lactophage p2 receptor binding protein
publication title Receptor-binding protein of Lactococcus lactis phages: identification and characterization of the saccharide receptor-binding site.
pubmed doi rcsb
source organism Lactococcus lactis phage p2
molecule tags Viral protein
total genus 57
structure length 253
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zruA02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 1zruA01
4L99A 2BSDA 2F0CA 2X53A 1ZRUA 4HEPA 3DA0A 3D8MA 4IOSA 4HEMA 4L9BA 2WZPA 4RGGA 3U6XA 4RGAA 3EJCA 4L97A 4L92A 3HG0A 2BSEA
chains in the Genus database with same CATH superfamily
2IPTH 3F7YA 1P1VA 4XHQA 3RUGF 2I5YL 5I2IB 4GUQA 1GJWA 1XH3A 1F45A 1XEUA 3ARBC 5CU5A 2B0SL 3WFZA 3QWRD 2H2PC 4OV6F 1LEGB 2GJRA 2H3KA 3LKOA 2X6BA 1E28B 2QADC 3RU8H 2AEIT 1QSEA 4FHKA 2MQ0A 4MCMA 4Q2ZA 2E3VA 2IANB 3M86A 4FTVA 2ID5A 3U4EB 1EDQA 3JVFC 5F7KC 4P5KA 1VZGA 4QGYA 4YHYB 4LVHC 4ECNA 1QSEE 3NCXA 3JUYA 2FT8A 1Q94B 3IBEA 4Y2DC 4ZQKA 3TIDA 4NIYE 4OLWH 2QKIB 1F3RB 3AZUA 2BRRH 3S7GA 2ZONA 1RUKL 4N0YL 3L3IA 1OAYH 2I9LA 4FTVE 5C8JA 2GJJA 2OW7A 4U1KA 5FYKD 2YO3A 1O6TA 3RWHA 3EYUL 5I17B 4JRWA 1U8HA 4PWEA 1SMDA 3OAUL 1U3YA 1FIEA 1C08A 2K6YA 1NCNA 3G5VA 5D8JH 3AUWB 3PGFL 2VZTA 1F4YL 4A2DA 2YJQA 3ALPA 2VMDA 2IDCA 2KI6A 1ORSB 4YHIA 1JZ5A 1M53A 5GJSL 3WLBA 4C4UA 1T2QL 5C92A 5I76A 3VMNA 3A6BH 4ODTH 1YLBB 3ROOB 5FHBH 4FERA 2Z31A 4FYRA 3IM1A 3L54A 4EDWH 2FB4L 5TH2A 3LKNA 1X9UA 3GXMA 3K4DA 4XBEL 4YPGA 4KROC 4QKXB 1NC2A 2W94A 4PJBB 1RAMA 1JGVL 3KCWA 5EBWA 3HHSB 1CU4L 4HUCA 5DHMC 4XO9A 1V3MA 3GB7A 3H7BA 4DQOL 4ERSL 3AWGA 1JNLL 1QQDB 3WXWL 4P46A 2DAVA 4M43L 2ZCZA 2FWOB 2ZF8A 5TK4A 5I1GL 4GAFB 4N2NA 2VDRH 4XPBL 1T7WA 1XCTB 4FQIL 1MIMH 1U91B 5DUPL 3I6GB 3KGUA 5E4OA 4ATTA 2HWZL 4CMHC 3DMMB 5JW5B 4JFOA 4PLJC 4DP4X 3IJHA 1N9PA 3MFFA 4XWOD 5DJYB 2C7UA 3NFSL 3MCLH 4IJ3B 1KLGB 2LVCA 2KQMA 3K71A 5BO1L 1LXMA 5KN5B 1B2WL 4TOYL 1AZRA 1UQSA 2UZYA 4YDJB 3TEWA 4L4TA 5HGHB 1M4KA 1FLRH 1AXTL 1H3PH 2AJ3A 2EYTB 4OGXH 4P49A 3GIVB 1XF4A 3SDDA 3LPWA 2R69H 1AD9A 3D08A 4JREB 2KQNA 3N40P 4ZUTB 3UTPE 1E9QB 3RIFK 1ML0A 2WUBH 3WKMH 2CKBB 2OXGA 4FQXA 4L4TE 5HYSA 4MJHA 4G42B 1IIKA 1FG2A 1PDKA 3GQFA 2NDGA 4RFOH 3A4DA 1EXHA 4UUJA 3EGDA 4ABQA 5CCKH 2X44D 5E7BA 1YAZA 2WYTA 3CWGA 1JPEA 4NO5B 3QZWA 4X0NA 4PCTA 1KTDA 3WO3B 1DLHA 4LCYA 4PRAA 3ES6B 2F53B 4KDTC 4X5RA 2A9AA 1T0MB 2B8OT 4HK0A 3SB3A 1TLMA 4C56B 1NGYB 3TCLB 3NEOA 4P2AA 3MVSA 1P5UC 5EC2A 1BVLA 3FQ2A 2A1WH 1VB9A 5C0DA 1FCCA 4HCGA 2VM3A 1FZOA 3OB8A 3TJEH 1QKZH 3MGTA 1BV8A 4IRSC 3BZEA 2WZ6A 1PPIA 4Z7WF 5CEYA 5IBTH 5D6DC 2JCCF 3OKKB 5KUKA 5B1AB 1H3GA 3SBWA 1X7QA 1BEXA 3EYVA 4NN6B 1QLEH 4NJAL 1AP2A 1IO4C 2IBBA 4I3RH 5DK0B 2WBJC 3PV7A 2AEWA 5DJ0B 1RZQA 4K7PL 5DQDH 5G4MA 3UIYA 3TASA 1WFTA 4XAKE 4HD5A 1FO0B 4BXSV 3MRNB 4LASL 5CIPB 1GPOH 3A23A 3QI9C 4OLVL 2HUHA 4JRYB 5BQ7B 1DBJH 3H7LA 2VISA 4NFCA 4JY4A 1ZE3C 4FULA 4Z76A 3DETC 3BEWB 2VW4A 1XF2A 3MGOA 5E9DA 1A9EA 4AEHL 2J5LC 1QR1B 2GK2A 3TPUB 1XH3B 3IEAA 4NZRH 4MD4B 2QVIA 4G1EB 2HFEA 5J06A 4Y2NA 5MERA 3JWOH 4JGMA 3LKOB 3BGMA 3WHE1 1Y1DA 3CVHL 3W2DL 2DDQL 4LLUA 4F7PA 3FCGA 3ULUD 4R4FH 4N8PA 4HCRH 4YLCA 4OZGF 5KEZA 4Q2ZB 2W07A 1JI1A 3WFCH 1BZ8A 3ETBF 2Q8BL 3LS4H 2P5WD 4FTVB 2Z1KA 4YHPA 2BSDA 3HLAB 2ZYRA 3F58L 4TNWK 2DEWX 3P2TA 4P5KB 1EJFA 1HQ4A 3E1ZA 2CK0L 3AS2A 2YPVL 4FXTA 1F97A 2XXFA 4RAUA 4ZQKB 1JI2A 3UC0L 4ODXA 1CL7I 2EDTA 1AXSA 1NEPA 3MJ7A 3S35X 2EIBA 1TZHB 1WBYB 3L3IB 5C8JB 1E5CA 2P47B 4U1KB 4UM8A 3QWRA 4NKOA 1M6UA 3LEVL 2FO8A 1H15A 1JGIA 1JWMB 2YKKA 2X2YA 3IMUA 4AQ8C 4FZEL 4Y5XB 4AYFA 3KYOA 3FB5A 2X4PA 1HYSC 5KYUA 4YUEH 1KIUA 4OD1L 2YJLA 4PJDB 4HZLA 4YHIB 5L7XH 5B8CA 3DA0A 2HN7A 1OO2A 5I76B 4PGCB 3LIZA 4FQ1L 2FGZA 3CDZA 4WV1C 4W81A 5E56A 5HDQH 2E0PA 2IMMA 3OKYA 3D07A 3VH8G 3TEZA 5EU7C 4KK5C 3N55A 5TH2B 2X2JA 3LKNB 3B2XA 4NSKA 2Y2TA 3Q3GB 1JZ3A 1R24B 2GEEA 3HA0A 4IRJD 3VD9A 4AJVA 2JQAA 1L0XA 3H9ZA 4EJ1C 3BPLC 5EBWB 3L3OC 5HI3D 5CBEA 3E6HA 3QUZC 3FFCD 3LRLA 4PJ9B 1U8LA 3H7BB 2FX7H 3EFDL 4L3AA 1OTSC 3TVMD 1CFVL 3LEYH 4NDMB 2OYLA 2WMPA 5D96C 5FYKE 4P46B 1CCZA 2FX8L 4BH7A 1UXSA 1EZSA 1OGAB 4MZ3A 1ZY9A 5D2LB 5BOJA 3LXUX 3VXOA 3VI4A 3BEVA 2EDWA 1I85C 4UI2A 4G5AA 3D4CA 4JFOB 3IJHB 3DHMA 4KJPD 4PS4L 3MFFB 1DUYA 4O00A 4OIFA 3DX7A 4IRZL 3K71B 3KJ4C 4LESA 3F7LA 2C4FT 2A3TA 2NTFB 1SXCA 4TL4A 4L4TB 3VI4E 1I8MA 4DVBB 2AJ3B 4WJKB 3SPIA 4MMZC 4XX5A 2C3XA 3HNSL 5AYUH 3ZL4H 3QUYD 4TSBH 1XF4B 4N5ED 3ILQD 3SDDB 3V9EA 4DEPB 4PJAF 1AD9B 3O2WH 3QDMD 3MRPA 3POCA 3RYMA 4YC2B 4I5BB 3KJ6L 2OXGB 1QI5A 4UT9L 5HYSB 4AMWA 3BPCA 4N0CD 3R0NA 1FG2B 1N0LA 1PDKB 3IMVA 1PBYA 3QRBA 4U3HA 3ZL1A 2BX5A 2LU4A 4A7GA 5IG7A 4UUJB 3CLFH 1WFUA 1NDMB 5AAWC 3ZTCC 2BY3A 4EN3C 3A4FA 3HUJF 1G1CA 1N8ZB 2JJWA 4Z7AA 1KFAL 5JPNA 5LBSA 2CGYA 3GTVA 4ADIA 2HLFD 1DLHB 3ENEA 4PRAB 4N3UA 4HK0B 1UA6H 1PQZA 1WZAA 4LPUA 5I1JL 2NCEA 4J3OG 2YKLL 4F33A 5AZEH 1AD0A 1UXWB 2DJMA 2NX5B 2ZF9A 5EC2B 1BVLB 1RZKH 5AW3B 1RULH 5EZOL 4NP4H 4F15C 4UT7H 2AJSH 4YJZL 5C0DB 3D85D 1FZOB 2ZPKH 3MGTB 1UT1A 4KK6C 4XCFH 5ILTL 4G5ZL 1DANT 3JVGC 4QXUL 4YBHA 1EO8L 4EE2A 3VFSB 5CEYB 4XWGL 4Y1AE 2EDBA 1QLFA 3NACL 2R2HA 1X7QB 3EYVB 1QBLH 1TEYA 2BSBA 1H9DA 5EV7A 1YHPA 2VR4A 2NY3B 2Y36H 4HT1L 4LPYA 3RAJL 2HRHA 1MFCH 3BP7A 1BFVH 4E2OA 2EDXA 4Z23A 1NL0H 2JJSC 3UADA 1DVQA 5HGDA 2OL3H 4NUMA 1T6BX 2UX6A 4HPOH 1DR9A 1QD0A 2XXGA 3GSQA 1MVUA 1HZHL 1UHVA 3H2PA 4KX8A 5CEZD 2W9EH 2DQCL 4G6FB 1J11A 2R0WH 5ECGA 2VISB 3BRGC 4TULL 4Z76B 4DKFH 1I1AC 1XCXA 4AIXA 3INUL 3MRGA 3MGOB 5E9DB 2OMZA 4GEIA 3X3GL 2AQ1A 2Y25A 3HE6C 1YECH 4WW2F 1FFRA 3VWKD 1J5OL 4GFXA 1ID5I 3TZVC 1E6JL 3EDEA 1CF8L 5MERB 5F3HA 1JYNA 2OR8A 4HG4K 4YSCA 4LLUB 4F7PB 4YK4B 3PU7A 5EUKA 3VRLE 4N6RB 2W07B 3QQ9C 1MI5E 4I13B 1ADQH 4YHPB 5DD1H 5GRVK 2B39A 1MJ8H 1AYRA 5FPIA 1J87A 3HBQA 1NAMA 2PF6A 4RAUB 2A9MH 4ODXB 1AXSB 2J7LA 2O5XL 3MJ7B 3VGFA 5I1HL 2JK5A 2X9ZA 3C5SB 5E4EB 3OV6A 4ZO6A 5KWYC 4F9LA 2VRAA 3EOAA 4UM8B 4Q9QH 4ZFZA 4NKIL 4AIZA 5IJVA 5ADOL 3P1VA 2XLLA 3BHBA 2YQGA 4Y19A 5CCJA 4PD4K 4AYFB 3KYOB 2X4PB 2ICEC 4XAWH 2Y3AA 1T6VN 5KYUB 4JG1L 5IHZA 1KIUB 2P5WA 4HZLB 2XETA 3CSGA 5FW8A 2OYMA 3DSFL 1BYPA 4MJ4A 4OZFG 3CDZB 5FYLL 1TT6A 2CBOA 4M5TA 3C09C 4CU6A 3PNWA 1LQBC 3ULUE 5KTEH 3SYAA 1ORQA 4LARH 3S5LA 4GJTB 2SODB 2EIMB 2X3CA 1K8DA 3O2DH 4S1SL 3K3QA 2P5WE 4YDMA 3H3KA 4H7VA 2C9VA 4U6TA 1UG9A 2E7MA 2HRPH 3W56A 4DW2H 4NSKB 4PB0H 3EO1A 1A0QH 1LO3H 2XT1B 1N19A 3FN0H 1HNFA 4OGQC 2EIJB 4XP9H 5E6IA 4F3FB 4KNQA 4NCDA 3G5ZA 3W39A 5CBEB 3E6HB 3QFDA 3ABKB 4ZPVA 1JNNL 4P2RE 2NY1D 3UZQA 1BQHB 2AQ3A 3KVQA 2L7QA 1SDDB 2JNZA 3UBXI 5KOVC 3GJFA 5L2KB 1UXSB 1TCMA 4H25A 1HDMA 2NRDA 4HIXH 2CO7A 3CN4A 3CXDH 1W0WA 3RFZC 3UGEA 3VD0A 5IFJA 3ZGHA 3FSOA 3VXOB 3BEVB 4E9QA 1Q8MA 3VQLA 2BS8A 3V95A 3WNNA 3QJHA 3VTTA 2ZWLT 1PKQA 1DVXA 2APBA 4Z95L 1YJDL 2VXSH 4CU7A 1DUYB 1IT9H 2Y06H 3V52L 1GTNA 1FRGH 4IRJA 2OTPA 3C8KB 3DX7B 4FFVD 1SDYA 3ZDWA 2FH6A 3PNRB 1YUHA 4QYOB 3VGAB 5FHAL 2C1OA 4CSSA 4KMTL 4MQ7A 4MRCA 1I8MB 1HL5A 4GAYB 3WKYA 5I9QC 3AWFA 3TVMA 4X6CE 2XV0A 1FFTB 2DKMA 1PKQE 2BNRD 2WQWA 1DVYA 2E7DA 3TV3H 3X14A 2QEJA 2DBLL 3KR3H 1I8UA 3IETB 2CQVA 5A16A 3QDJD 3FFCE 1BSIA 3RL1B 3BPCB 1N0LB 4QCIB 2OCCB 5E6SB 3BCDA 1KNOA 5ALCL 3P69A 1RUPH 2V5MA 1MCFA 1MNUH 5JPNB 5IVXF 1HHKA 1J8KA 4MXVF 5ICZB 2BK8A 4V2CB 2UY6B 4KHXH 5BV7B 3H42L 3GHEL 3QUYA 4HV8B 4WAFA 4F33B 1AD0B 1PD1A 4M7LT 3ZQ9A 4I18C 3OJ2C 1IBYA 1IC5L 5EO0A 3GO1H 2MIZA 3FXIC 3MU3A 5KS9F 2BWDA 5F9DC 4Z7UA 2IC2A 1GOGA 1EEYA 3QXWA 4MZRA 2WBKA 2NY2B 2RBLA 2DI7A 4YOKA 3QDME 3MV7D 4OBSA 5EZLA 3VX0A 3KPPB 1QLFB 4YQXH 3L5WA 2R2HB 3RVTD 4D9LH 4QTHA 2DPKA 4Z7UE 3VYPA 2GABA 5CKGA 1A3RH 4LAQH 2DMBA 2GEQA 3ULVD 1D7DA 2YK1L 3BP7B 3DJSA 1CGSH 2YOCA 4S1QL 4HLZH 1LK3H 5HGDB 3IDXH 3EDFA 5DR5H 4K71C 4HCFA 2HKFH 1MVUB 2EKJA 1NAKL 3OHXA 1QG3A 3D85A 4RDQF 3RX8A 3BVTA 4NO3A 4PRDA 3RX5A 1KWKA 3CNKA 1G7IA 4KNTA 5I71C 4I4WB 4JX0A 2BHYA 1IAOA 3IDUA 2J8HA 2AJYH 4U7KA 1TQWA 2FUQA 4OCXL 2XNAA 2AEQL 3MV8A 3VMOA 3MRGB 2H0JA 5DS2A 3P2BA 3WY3A 1JFQH 1P84J 5DZ9A 1CQYA 2CE6A 1KJ3H 4N1CA 3SIKA 2C4FU 4OTXL 5K93A 5EOQL 3I02A 2IDUA 4XX1E 1A7NL 5F3HB 1WYJA 3GRWL 5CSBA 5DZVA 4H8PA 4W4NA 3WTXA 1L9RA 4P5TD 2VZUA 3F6IA 4ONFH 3SGEH 4OF3A 1W6LA 3CIQA 3GEFA 5EUKB 4CNIA 4MXWL 4Q6IA 2ZUVA 4NUGL 1KG0A 4UNUA 1PZBA 2WXNA 3BJLA 3GJFK 1HI6A 3BD5A 3MLZH 4HIPA 1E4XL 5EU6D 2CUAA 2ZX8A 1RIHH 5I1CH 1NLDL 3IT8D 2G2NA 3QJOA 3S34H 2R23A 5CEZE 2JK5B 4NC1E 3T1WA 3MUHL 1BW8A 4WK4B 3EOAB 2YBGA 4B96A 4YHLL 3IXTB 3S37L 1UH2A 5EC1A 4ZFZB 1ZJBA 4AIZB 5ELIA 4MA3A 3BHBB 1BF8A 2Z8RA 3HVNA 4Y19B 1CTOA 1V5JA 4NN7B 1IVTA 1M7IA 3SQOL 1E30A 5GRJL 4JHUA 5E0FA 3G6AA 5IHZB 5L2JA 2CGRH 4K7PY 1HL8A 1YMMB 4WU7A 2QDWA 4BZ2A 2ZQKA 4CKQA 4MB3A 2N7SA 3EYSH 4IOFD 2DN7A 3O3BB 4MA7L 3PNWB 2Y7LA 5F7FA 1ORQB 3SDXF 2GY5A 2P42B 3S5LB 4KOCA 3BIAX 1K8DB 2H32H 1S9KC 2VDMB 3X1FA 1B6UA 1YYLH 3EO1B 4XNUH 3RJQB 1VGEL 1Z5YD 5E6IB 1HNGA 2NNAA 3G5ZB 3GI9L 5D4IA 5C2BL 3K5RA 2QQQA 4L5FH 1H3WM 5B22A 4ZPVB 1A4JA 1DQJB 3LPFA 5EBLA 3UZQB 2FIKA 3TFBA 3D0VA 2GG1A 3GJFB 3TA3C 2AHIA 2X41A 1I8LA 4D0CA 4H25B 1HDMB 4JQVC 1I7UA 2YPKA 1GS6X 4M8VA 4POZC 3UXFA 1W0WB 3V0IA 5DGQA 3BVVA 1WBXA 5IFJB 4KBPA 2CRIA 2Y5EA 3UAJC 4AV4A 3C6SA 3CVIH 5EFIA 3S8GB 4RVBA 1X44A 4IRJB 3CBJB 3ZMNA 4BE5A 2CHNA 1JAEA 2ZWZA 1QW8A 1YUHB 1MW0A 1RZ7L 3O11A 4MNQD 4OIIH 2C1OB 5JMOC 2GK0A 2W9DH 4MAYD 1BMGA 4KY1H 4XN9A 2W38A 3KPRD 5FC9A 4KDVA 1XIWD 4ZFOA 2H8PB 4LIQE 3BPNC 3L16A 3NRQA 3HBPA 3ZOAA 3MJWA 4N9GB 5IMKB 5KVFE 3EGSB 4BQBA 4M6NH 5F6HI 5KAQF 5A16B 2B4CC 1MFNA 4K2UL 3HC4L 1EO5A 1II4E 15C8H 3H9SD 3HS0A 5AVUB 3S88H 4E41A 1KCUL 2FHBA 4NAMA 3DX6A 3D6GA 1HHKB 2GVYA 1I8IB 4XOBA 2F18A 3OKDA 3QIWD 3MUUA 2O5ZL 5HVHC 3IN2A 3ARFD 3LKQB 3ZKSD 3QUYB 3DGCR 1KMGA 4WEEA 4PRNA 1P4IH 4MBOA 4HBCL 1MFDL 3QDJA 3WIHH 3RGBA 1MFBL 2EDYA 2N0MA 1EEYB 5L6YL 3CQQA 4NC0B 2BNRE 2G0KA 4PVLA 5HHQA 4J28A 3EZJB 4XBMA 2FLMA 3GMOA 4H8HA 1KCVL 2ICWA 3QIUC 5EZLB 4Z6AT 4DP8X 4HOXA 5IJDC 3S4SA 3O3UN 1L9SA 4QTHB 2YXMA 4KVNH 5CXPA 1UT9A 2JKWA 1KIRB 1ITCA 1OALA 4AV5A 3J8F7 2YUZA 4FFWC 2L8AA 3UCQA 4M7JH 2Q3XA 3E1F1 3Q8BA 2J2ZA 5IROD 1KCLA 1BZDA 1MY7A 1UYWH 3O3DA 3FCTA 4LQFL 3VA2C 5T5NG 4X7SH 9PCYA 4ELME 5CILH 1FL3A 4K07A 1AGFA 3J27A 4ZJ9A 1WQVT 3OHXB 1BPVA 2KMWA 3D85B 3KS0H 5IB3A 1FE8H 2VR8A 4NO3B 3UYRL 4Z7NF 3IU4H 1O7SA 3LSOA 4UAHA 1IAOB 1KXTA 5KUMA 1VERA 3U6RA 1E5UI 3MV7A 4FFYL 5DJDB 5B3NA 5I1DA 5ETUA 3MV8B 3M7OA 5MEOA 3GLEA 4UTAA 4FG6C 3CMOH 2FQDA 3U0WL 2DH3A 5GZOA 3SO5A 3UJJL 4IS6B 1IEAA 3VE0A 3W38A 2O4EA 3MXWH 4KUCF 1TNNA 5GHWL 5EEVA 1Z3GL 4IW4C 1UA7A 2BP8B 3MV7E 5HXMA 5CHNA 3U2IA 4X80L 3MRIA 4WI9A 4CNIB 2MOVA 4DP1X 4Q6IB 2GUOB 4UTBL 5BZWA 4JFHD 2CO4A 3BH9A 2X9WA 1I3RA 1Z6JT 2Y1ZA 1ET7A 5LCVA 3U4KA 7CGTA 5IMLA 1JZ4A 1ZCRA 4AMKL 4RRPA 1HC1A 5FUOL 3QQ4A 2WP3O 2WB7A 1ZK5A 2ZOKB 2A0LC 4AM0Q 3BUQA 4KXCA 4Q9BA 5JOEA 5F7LB 1DQVA 1WCBA 3IJSA 2XTSA 2WBXA 1BZEA 4H20H 4TTDD 5I19L 3PXLA 5EC1B 1R3JA 3PYCA 4JCMA 1DDTA 1OQOA 3L4VA 1J5CA 4P5TA 4F27A 2FGWL 3PGFH 3TXAA 2VE6B 1A7RH 1QFPA 3G6AB 3KGRA 5MP6L 3DROA 1UKSA 3FT0A 1N18A 3P3UA 3UPAA 3NCYS 3SE8L 5A40E 3MI6A 1S7SA 5EU6A 1F02I 4P4KD 5GGTH 3DK0A 2IPUK 1TEGA 4I1RA 5IQLA 3ECWA 3QG6A 1RD6A 4RGOH 2V6HA 3KHQA 4JG5A 5F6HJ 3AXLA 5EU6E 1INDL 2UXVA 4G7SB 2NNAB 4LU5L 5TQ0L 4DFHA 4GSRA 2J88H 5AOKA 4DQOH 1J8HE 5EBLB 3VXPB 1E65A 2FIKB 3FUHA 3EHBB 3DNKA 3Q6FB 4D0CB 1I7UB 1G4MA 2PR4L 3N1PC 1MJ7H 1SXAA 4JQIA 5CLTA 1LK2A 1J9RA 2P80A 2ZKYA 3RPBA 4RGMB 3C5XA 4YE4L 2Y7NA 1WBXB 3QZOA 3KBHE 4PYHA 3U4BH 4MSWA 3JTBA 4HA1A 3X11A 1TTBA 3I9GH 1AY1L 1ULVA 2ZOLA 3FW6A 3BWAA 3DI2B 3GKWL 5L8KB 1ICTA 4A2GA 4PVNA 3LOWA 4B9YA 1R3IL 2VSMB 4MZ2A 4KKZA 4HEPA 4O58H 4XP1L 4JK0D 3IJ9A 2NY1B 3WN5C 2VZ3A 2H0FA 4ZFOB 4NLHA 4MRBA 4BQCA 3FTSA 2NNRA 2VXQA 2VDQB 1SLUA 3QZNA 3DIVA 2J8UA 5FWRA 2G2RB 4NBXB 2D3JA 4EN2A 1FORH 4UB0L 4BDVA 4XVTL 3U7WL 4TUKH 3HS0B 2P45B 3V7AG 1NKRA 4Z8FH 1O7DE 1NFIA 4E41B 2IOOA 3QAZC 1T89C 2HX8A 3QDAA 4XC3H 2ADIA 1I9EA 4MNQA 3RVWC 2ZXWB 2H1PL 2VC2L 3TESA 1AAJA 4LKXB 3KPRA 2I07A 1WSST 1XIWA 5C0EA 2CUMA 1UH4A 1IQDB 2CLVA 5IBLD 3RHWF 4HU8A 1I9RL 1TQTA 1FZJB 2X05A 2YGOA 5J6GA 1FZMA 3QDJB 2HYMA 3KL5A 2X4RA 3ZE1B 3D09A 2P44B 2MOQA 3BVWA 3KPRE 3H9SA 3JV4A 2ZXEB 5HHQB 3ETBJ 1KC5H 4LRIA 4NX0A 4JLRA 4L8CA 3BD4A 3GMOB 3IGFA 3IPFA 2ICWB 2MCPH 4MA1C 2R4RH 1IC0A 3VGEA 1FLTX 2DTML 2IALA 1VSCA 3H6AA 1EA9C 4LGSB 3NAAL 1DSFL 5TE7L 3H3PH 3QIWA 2WLZA 3H9SE 4IDJH 3ARFA 2A2QT 1C7TA 1NUDA 3O3DB 1NEUA 2CIKA 4QRUA 1S9XA 2BVOB 4OQTH 1FL3B 2HT2C 1AGFB 5BZZA 5EBMA 3K6NA 1MWAH 2F19H 4OLVH 5ALBH 3GM8A 5IB3B 4UNVA 3GSNL 1EPFA 3QISA 5JMRA 1A3LL 5D1XC 2YARA 5I8OH 1UOWA 4U6XB 3TH4T 3CZSA 3SE4C 3CFKA 3ZE0B 5I0DA 3U6RB 4R4NC 1FVCA 5B4MD 5I1DB 1MG3C 4NQSB 1JVOA 3F2LA 5ETUB 5GRZA 3RTQB 4TSAH 5EF2A 2QT6A 3MRRA 5T33L 2ESVD 1MPAL 3JT0A 4UQ3B 2V7HA 5DI8B 3CDYA 1IEAB 1NCGA 2OZNA 3DURB 4NNYB 3QZMA 4P2OD 4NC2B 1MJUH 3W9DB 5IROA 2HP4A 3CN3A 4YL4A 2WM0A 5CHNB 5EU5A 1QNIA 4ZYKA 3HMXA 3MRIB 2OV0A 3IMTA 4LSTL 2D7MA 1RU9L 4FFZL 2EC8A 4JDTH 4PCKA 5IJBC 1KZQA 3LN5B 3VI3F 5BZWB 3BH9B 1TJXA 3FU7A 3U30B 3FMGH 1AIFA 1OP4A 5L4JA 3SYPA 3IKCB 4QLWA 4HOWA 1KB5H 3WGUB 2K4AA 4EAEA 3ZMEA 4WUUD 3MUJA 4LSQH 5SWSD 5JHLA 1HL4A 2VQ1A 2VO5A 3WTYA 2J1KA 5IFAH 2E27L 3LEVH 4Q6KA 2VWEE 3L7FA 1R3JB 1T4KA 1MREL 4WFHD 4ETQA 5I6MA 1KEML 4PCSA 5GGSY 3NTCL 4XN4A 2WXQA 4WI5A 2A9CA 1SGKA 3AU1A 4JY6A 2C9QA 1AI1H 1XB8A 3QARA 4WY7L 1DJGA 3VSTA 2JIXD 3DROB 4YBQD 5HD8C 1H8SA 2FJHB 3PXJA 4A2HA 4CC1A 2I27N 1JGDA 1CXLA 3QRGH 5SWQB 3QPQC 4KXBA 1GRWA 3JZ7A 3EBGA 5FLVA 4PSRA 4CC4A 1QFOA 3FK3A 4J12A 2BP5M 3LNHA 4NNXA 4AJ0A 1RLWA 1RZKC 3QIBC 3QG6B 3S8FB 4JFHE 1HL9A 4AEIL 3OKMA 2R0ZL 4LCUB 3AXLB 3WY2A 4S0SD 5C6PB 2NT0A 1SDAB 4QEGA 4BZYA 3LKPA 2R8SL 4NGHL 1XF3A 3EFDH 3QO0A 3MJ9L 1C1EH 3QR0A 1PAZA 4LK4A 4ACPA 3WS3A 3E2HC 4ZODA 1P4UA 3REWB 1AFVL 1YQVH 4OLXH 4M93C 4AQEB 4YHNB 1BEYH 2D4FA 1LK2B 1MCPL 3NPSB 3NIFE 3SZ6A 4LBAA 4OJDH 4DGIL 3KPSE 1MXGA 1TG8A 4CU8A 3CFCL 4DKTA 2XZAL 4Z7OF 2BMKA 4DZ8A 3IBOA 4MSWB 3X11B 3T3PF 3ISYA 1XGQA 2CMRH 2ZOLB 3RVVD 1EXUA 2JVUA 4HKBA 4A7QA 3E0GA 1FFOB 4AZ8A 1A6WL 1J7VR 2DWSA 3CFNA 1QFUH 4LRNL 4Y4FD 4LLQA 4ZFGH 3DX0A 1OHZA 2AQPA 5K9KA 1KSRA 4H8WH 4HJ1A 3X12A 3ZQXA 2ZUXA 2NY4C 2J8UB 4BRJA 4HGMA 4UT9H 3NN8A 1IBGH 3DBXA 1U6AL 4BDVB 5F7WC 2QZ5A 4EVNA 4HIQA 1NCCH 5DO2C 3IDGA 2NNFA 4XN1A 4YPJA 5J1SC 4XXWC 2Q8AL 4H1LH 4CL7A 4GSQA 2SEBA 3GIZL 4M7ZC 3SO3C 3TBSA 4KH2A 4AE0A 5E9AA 2ADIB 3FU6A 5AOJA 2QKSA 4MNQB 2XBDA 1N2RA 4MDJA 3GS0A 1OP5K 4IKLA 4FXGA 1ZTXL 2J25A 3NJFA 3MUGB 1AR1B 2M8XA 2I07B 4M61B 1XIWB 4NKDA 5C0EB 3FO9B 1A7PL 1AACA 1HSBB 2WQVA 2CLVB 1WZKA 2ZE0A 3PUCA 3ESVF 5J6GB 1HINH 3B2VL 1FZMB 1EV2E 1U2CA 1JBJA 3JWDH 2HKHH 3D39A 2X4RB 1U4FA 3FF7A 5DZAA 5ILTH 1P6FA 3JYBA 3JV4B 5I73C 4YHKL 4RAVB 1BM3H 1XXDC 5LNGA 1KDIA 3ARQA 2M83A 5A3ID 1RV6X 3LZLA 3NACH 3PL6B 2YZ8A 1J1OL 3CFMA 2PWEA 1ZJAA 2BDNL 4EQ3A 1JTPA 2IALB 3WFEH 4F2FA 5FKPA 4HT1H 2O93L 4DN3H 3IMRA 3AG4B 3QIWB 1MCWW 4WUKH 5D2NB 3S5ZA 1UJ3C 3ARFB 3OL2A 2YR3A 4FLQA 5D4HA 2OYKA 2L7JA 3AMKA 1CGXA 3BUIA 3KYMA 5K69A 4DO6A 3B4NA 4QRUB 1S9XB 1TJHL 4TUJA 4AZUA 2OFQA 2A5UA 1ZVSA 5EBMB 3KBEA 3VX1A 1G9MH 3ZKMC 3A4AA 4IM8A 4EIBA 2G5BA 2MHAB 2UWEB 4AJYV 4LOFA 1BAFL 3BT2H 4XB7A 3ZBMA 1EERB 2VDNH 2RR3A 4MX7B 5DSCB 3ILDA 3CFKB 4BSVA 4E9SA 2W0LA 3VD1A 1OEZW 3LQAH 4YR6A 1KYOJ 4OCWH 1FP5A 3CFDA 2V7HB 2OMWA 3IGAB 3UX9B 4OAWB 5ITBL 3N6YA 1FNEB 1KV7A 4O5LH 1OTUD 1YEDB 4KITB 5I28A 1GYUA 3FOLB 2QBWA 2X6UA 1UGNA 2XZCL 2Y9RT 2EDHA 1RPKA 3DUHA 3TO4C 4ZYKB 2XPZA 1NMAL 3GRBA 3MCG1 2MRYA 4QRRE 3TT3L 2IPKA 3DLQR 3QNFA 1CWVA 1RVFL 2W0FA 3O6ML 4JN1H 1IC4L 1J9TA 4RFNC 2WZPD 4LF3A 4CVZA 4X98A 3LYRA 2P5ED 4XB8A 4LLAA 3FU7B 4NKMB 4MJ5B 5A2CA 1AIFB 4B9GA 4LFHG 1DLFL 4FJYA 1MFMA 2ESVA 2D4DA 1U8MA 1LO4L 1F00I 1MUJA 1A9BA 3DX9A 1QPPA 4HS3A 2HPTA 2VQ1B 1SYVA 4G8IA 4NKIH 4B9KC 3MPCA 4JPKL 4PG2C 3H53A 4ETQB 4D3CH 1LEIA 3FQNA 4IOIA 1KJ2A 2BIHA 1NCWH 3DYPA 3PP3H 1UD3A 3AU1B 4JY6B 4KK8C 5KSUA 3EBHA 2IAMD 3S3PA 3T0EC 4YEFA 2WP3T 5TDOB 5J57B 3VWJC 1WAAE 2GT9A 4PBXA 2VNCA 5AW8B 1E5AA 4FQPA 5HYQA 1JGDB 2VSDA 4WFGD 4DPCX 2DIJA 2PYFA 1P6WA 1ZS8B 3N41F 1NZRA 4WSGA 1MHPH 5KJRL 2ITFA 1JXGA 2APVA 1KB9J 1ZHBA 2OR9L 3DVGB 4NNXB 4WUUA 1S7RA 5F0MB 5SWSA 2VZVA 4NRXB 1EAJA 4TF4A 3VXSD 2BZDA 3MLXH 2VZ1A 1G7LA 5DFAA 3OKMB 4I3SH 3T3MB 5HYEA 5G5DA 4KKPA 4TQIA 1FAIL 2YN5A 3C6LB 1GIGH 4O4YL 3LKPB 1XF3B 3TEXA 2VXVL 2GUYA 5SWSE 3ZE2F 4RBPH 1ND0A 2PO6C 3QO0B 4BIKA 5IW6A 2JIXA 4OY9A 5AVYB 3UTOA 2QGBA 2EEXA 3WS3B 4R0LB 1YZZA 5I5IA 4PGBA 5D93B 2BW5A 4WFHE 4X6FA 5EN2A 3UBGA 1Z66A 1QSFD 1DYZA 1TETH 3L3GA 3T4AA 4XT1C 1FH5H 1FH2A 3VVWA 3Q01A 2W0PA 5J3HC 2VW7A 5ABAA 3PP4H 5MI0B 5KBLA 1MFAL 3RGVC 2H2PD 1XGQB 1GZHA 2BFVH 1H8NA 1EAOA 2CRZA 1EXUB 2EIDA 2QADD 3Q2WA 1AS7A 4QHNA 4HKBB 3T5WA 4AGOA 2WXOA 2XYBA 3ML9A 1KPUB 1OY3B 1PEZA 2XV6B 4LCIL 4PJEB 4WW2C 1A3QA 2R0KL 2ZCLL 4PB9L 4X6DA 5K9KB 2AQSA 2NR6C 5JZ7C 1RUAH 5G4NA 1BJ8A 2QELA 3WFHA 4W68A 3WL9A 5F71A 5IHHA 4LVOC 3HPJA 3NN8B 4J6RH 3QJUB 3RZCC 5AVZB 2J57A 3DBXB 1TQSA 4EVNB 3IDGB 4L9LB 4PJGF 4ACTA 1HWGB 4MZIA 4ZMOA 2EECA 2SEBB 3KS0J 3TBSB 1OSEA 1RLBA 3RX7A 3QHFL 1BLIA 2DLIA 4MDJB 4M8QA 2BRQA 4FXGB 2LAGB 2QSVA 4NKDB 1TJGH 4Y4FA 4F93B 2EUVA 2K7QA 4ODSL 4G2AA 2CA4A 4A2LA 1UXLA 2CR3A 3GPSA 1N8OE 1KN2H 1P4LA 4PJ7A 1CVRA 1F3JA 3SBPA 3TBTA 2TRHA 3D39B 3HRZC 5K33A 3MROA 1IM3A 5MHSD 3X17A 2O72A 3C2AL 4KROD 1T1WA 4I2XE 4YWGH 1LO5A 5CLWA 1QSZA 4FHJA 2CALA 2NY6B 3FO0L 1S8DA 5FKPB 1DBKL 4QKTA 2X09A 4XZUA 3FCUB 3ULSA 1SVCP 4DGYL 4OH2A 1HNYA 3CQPA 2X4SA 1WFOA 3F7QA 1FZKA 4LCCC 5T3ZH 1LTXA 4KGLA 4P48A 5BRZD 5J11B 3HN5A 1L7IL 2O61A 3I84A 3TJHC 4X5XA 4E9WA 3FJTA 1GY2A 4J3UA 3CFTA 3OJMB 5EH1A 1WGOA 4PLJD 3ZDYE 1TKWA 4PQXA 4AG4L 3UEZA 5KSAC 1NANH 1RZFL 3GBDA 2VQ4A 35C8H 3MBXL 3QUKA 4YR6B 4TQPA 4IMKC 4C47A 4EPSA 5JHBA 4OTXH 3CFDB 2P43B 5D5MA 2OMWB 5C6TL 3QORD 1ZXQA 4FRWA 4BCYA 3TF7C 5F21B 5KBNC 4ALAC 2FJFA 4LLVA 4JRXD 5DA0B 3VXRB 3WNMA 2ARJA 1ECYA 1A6VL 4U1GB 3ZIMA 4PV9A 5CEZH 5J0BA 2GIMA 1NJ9A 1ZRUA 2W0FB 3RWGA 3CLEL 4O2EA 5IVZA 4X98B 4NWUL 1T04A 2BM3A 2IWGA 2PW2A 5AEAA 1WAEA 1MQ8A 1NIFA 2AK1L 4JO4L 2LW3A 3BDBA 4ZTPL 4D9RD 2ESVB 5HDBE 5SX5K 5BOZG 2FWUA 2A4CA 3FU5A 2NZ9D 1MUJB 2ZSWA 1A9BB 3DX9B 1MHEA 3IDIA 4HS3B 1MW2A 1SYVB 3NJXA 4G8IB 2Y5TA 1B4JL 5I66A 2QTEA 2RTTA 2UX7A 2OA9A 1DQDL 1LEIB 2E6PA 3FQNB 1YEHL 4IOIB 1KJ2B 5IWLA 3J07A 3UOAB 2E5EA 4C4KO 1M2OA 1KTLA 5KSUB 2WIIB 1CT8A 4I77L 1IFRA 2QTVA 2WZPA 5FAAA 2WWKT 3LIZL 4XRCA 4MMXB 2XG5A 2P5EA 1OAJA 3OQRA 3IFLH 5HYQB 4L4JA 3N42F 2LGNA 4BE6A 2PYFB 3KE0A 3QAZB 3VFNA 1HS6A 4WRLA 1ZHBB 4WUUB 1S7RB 4AX3A 2RQEA 2WBJD 4E5XB 5MEQA 4FLRA 5E6ZA 5D7IF 1WHOA 1RKRA 4YBLB 1G7LB 1M05A 2F54E 4FS0A 2HVJA 5HJBA 4F58H 5AB2A 5G5DB 3GI9H 4GFTB 5T1DL 5GRVL 1UM6H 5F7DA 5M7QA 4GKSA 3VGDA 2IAMA 1ZLVK 1ND0B 4WI2A 2ZP0T 4NQUA 4OGYL 1BWMA 5DGRA 1MHHA 3CG8A 3R7RA 3IAGC 6FABL 3QDHA 4X6FB 5GRYA 4GY4A 2JMRA 1LP9B 3IMSA 5K9JL 3L3GB 3MACH 3IU3A 4EUPA 4FCHA 1A64A 1B0IA 1MAKA 4UTCA 3FHEA 3ZL2A 3I50H 4C57C 3VXSA 2OMUA 1U3NA 2AXFA 4GG6F 4U4IA 4X99A 4OJFH 1P4BL 2ZUTA 1D7BA 4WTQA 2F5AL 2BJML 4WFGE 3ZDZE 1X5ZA 1J5HA 4HWEH 1Q1JL 1GCFA 5F3FA 4JFFD 4QHNB 1WIOA 3OF6D 5DMIL 3W81A 5A7EA 1J8SA 3UTQA 1WF5A 4L3FA 3ARTA 1SY6H 4X6DB 1F4WH 1U8IA 3BJ91 3L5JA 5BQDA 3WL9B 1UB6A 4ENEC 1AR2A 1SJMA 5HI4C 2R56L 3HPJB 1QSFA 3HC4H 4ZMPA 4HGWA 4NAJA 3WEAA 3GS7A 4N0RA 1L9PA 4A1RA 1RZJH 1S5HA 5HJDA 4XO3A 5LBSL 1AGDA 3HE7A 2VR6A 1ZLWH 4MHHG 4NP9A 3RVXD 2V0AA 4O2CA 3WEXB 5BV7L 2FO1A 5FUCC 5C0IA 1HYSD 1S7XA 4Y4HC 3OAYH 1I1CA 4ZUWA 4OF0A 4QJ5B 4AYSA 1U8PA 4HPYH 1JNJA 1MFDH 4PJ7B 1HIML 5AQ0A 5FYJD 3KDMA 3TBTB 4A55A 4GRWE 2EIEA 4KK5D 3MROB 1IM3B 4JO1L 5DJ8B 1FFNA 3EOTL 4ANUA 5J13C 1GZQB 1DL7L 1LM8V 1T1WB 1FBIH 2I7OA 4WJ5A 3INOA 1LO5B 1OAQH 4JFZH 2QDVA 1P7HL 1Z5LA 2GSGA 1PZ5A 1OL0A 1QFWL 2ZXDA 2XHNA 3WCYA 3LH8A 1IEBA 1OT4A 1VAHA 4F37F 2G4EA 4U3SA 2X4SB 1JCVA 4PU2A 3ZX1A 3FUJA 4PUBL 2O61B 3MLVL 4EIZC 3GZKA 4X5XB 3LS5L 3WTUA 3HEIB 3O2VL 4PJCF 5H4ZA 4HUWB 1MKFA 5IY5B 4FNQA 1QOKA 4PG9A 4D94A 4EIUA 3ECBA 5GS0H 4GIAA 1TKWB 4FFYH 3UROR 4PJ8C 4AIOA 1T22B 5E6RB 3CXHK 3IDJB 4ODWA 2F58H 5IESH 4F8TA 1FVEA 1OAUL 1MCLA 4J4PC 3V6FA 4EO5A 2XWZA 5D7JB 3OZLA 3CIAA 5D5MB 5MHSE 4UANA 3MA7A 1CPUA 1ED3A 4JBSA 5BUAA 4X8XA 1YEJL 4O51A 1MCSA 2FJFB 4LLVB 4NI6A 3G04A 5BRZA 1JGUH 3ATEA 2ARJB 1PYWA 3RVUD 3DV6A 1R0AH 3BUTA 4PV9B 3T77A 1I3UA 2EJ1A 1NJ9B 2XWEA 3RWGB 5T3XE 2Q20A 4XCNA 3FN3A 1NEZG 5IVZB 4FA6A 1NAML 5EEZA 1T04B 4EN3D 5D7EA 2PW2B 4G6KL 3QNZA 5BRZE 4V33A 1ACXA 4GP5B 1ZLSH 4OI7A 4GW5A 4LDOB 2X1WL 5TGBA 4HSQA 4JPWL 4R3SB 2OLDA 5FW6A 3WG7B 2ZSWB 3ECUA 2A74A 1MHEB 1UM5L 3IDIB 4M5YH 4ONHA 5JQHC 5FGSA 1FIGL 4OFYD 2VR9A 2WLIA 3QORA 5I66B 4KKCC 5LNEA 2R1XA 2W65B 3ULUL 2JKLA 2OJEA 1K4CA 4H88L 4JRXA 1D5ZA 3PDGA 4OZHE 3O3AB 1N0XH 4K8RD 4JHWL 4TRPL 2NY0D 5IR1A 4F9PA 1KTLB 3TS8A 1CT8B 2GBUA 3BLBA 4KZDH 2EEFA 3D2UB 1EJOL 2XG5B 2P5EB 5DEGA 1I7TA 3RRQA 5IREA 4JRXE 3LNGA 4XCYA 4JJOA 5DHVH 3VFNB 2OMNA 4YX2L 2VDML 4C59B 4QIRA 2R2CA 3T2NL 5MEQB 3EGXA 5BVPH 5GS2H 1IX2A 5CLYA 4RETB 4PJBF 3F7RA 1M05B 1KTCA 2YEZB 1K2DA 2V3FA 1SFDA 3GLAA 2HVJB 5J1AA 4UYQA 4N0UA 1CO1A 1IZJA 1T66C 5IHBA 4D9RE 3WELA 3HIZA 5CJQL 1EHKB 5F7MC 2HTLC 4GKSB 2EUWA 2IAMB 3DGGA 3LZOA 1ERNA 1OCOB 1QHQA 1L7TL 2FBJL 5CWSA 5KVGH 1MHHB 2MCMA 5JXEC 2XQBH 2OSWA 3SDAA 3WS6C 3W9EA 2WVSA 3KLAB 4DEUA 2VZOA 1D3CA 4N0UE 3V6ZA 4X7TA 1YDPB 3W3BA 3IU3B 1XF5B 3HE6D 5JIPA 4FEMA 4XPGL 2CD0A 5IK3B 3VUAA 4HFUH 3VXSB 4PRPD 3TZVD 2AXFB 1E7VA 2XDHA 3FTUA 4X99B 4JE4B 4G3YL 2J1WA 1M3JA 3L5XL 2Y6SD 1JFHA 5IQ9B 4YIQA 2GYSA 1DQML 1OWRM 5ANME 3O6LH 3WENA 3ALXA 3N9GH 3GT6A 4WEMB 1OLLA 5DTFB 3FT4B 5I75B 1IU1A 3UTQB 3QQ9D 3FCBA 1X5AA 4YSAA 4QPEA 5E95B 3TYGL 2R15A 3CN0A 3QCTL 2GCYB 1BQLH 5C7XH 2BCKB 3QR1A 2A9NH 3VM7A 2XTJD 1UB6B 2UVFA 5ABDE 4TQ8A 2CLZA 2VDOH 1QSFB 1XH1A 2FNWA 4HGWB 2H2SC 2X87A 1NIEA 3PPSA 4ZTOL 2K3TA 1NCAH 4WW1A 1PU0A 1NDGA 2YEQA 3H1ZA 3JSSA 1S5HB 1G1YA 3EYFB 4WFED 5DWUH 1AGDB 3HE7B 4DK3A 4O2CB 1CBJA 4HKJA 4K23L 3OF6A 4F2MA 4M6ML 4LPCA 3DSNA 4R9HA 5C0IB 3SYOA 4AY0A 2XN9B 2X0VA 2FQGA 5JR1L 2QQKL 2WZ5A 1S7XB 2FEEL 4KUZH 3BUDA 4ZUWB 2A4ZA 5D71H 2HZHA 4L92A 4Y16D 4L9DA 2B20A 3NBNA 5GGRA 4XNAA 3HG3A 1V7NH 3JV6A 4JFFE 3FQWA 1E8WA 5JW3L 2YEVB 5DC4B 2CPCA 4LLMA 2CJTA 1S5IL 4Y1SA 4DOHB 1N70A 2FX9L 3FU3A 3FYIB 4PLNC 3NJMA 1KENH 3NABL 1FFQA 3D25A 2GSGB 4TS6A 1PZ5B 3UTSA 3HI6L 2JXMB 2VDPH 1EBPA 2XC8A 3P4NA 1A1NA 4BFFA 2HT4C 4EI0A 3LN9A 1IEBB 4KX7A 4Y89A 4Q74A 3RIFF 2W9LA 5F9WB 1KDJA 3AVEA 4KQ0A 2F1AA 4AMXA 3S3BB 2C9RA 4BGDA 5CINL 4G9FD 5IIEA 4L99A 1JZ8A 3DVIA 3MFGB 1NGPL 1E67A 3ABGA 1NANI 1RUQH 2EYRB 5HYSG 4KFZC 1DVFC 2OJZL 1Q9WB 4PG9B 1JRHH 1Z9PA 1PD0A 4O2FA 3SGDI 4DUVA 3MLWL 3UMNA 2GB2A 2KBGA 3FU9A 4QMEA 1NCBH 5AG9A 3L3OA 5FYJE 3IMBA 1FVEB 2VL5B 2GAZA 3QZWG 5D1QB 3M1BA 2EDLA 5EU7E 3V6FB 2FHCA 4OFPA 1IAMA 1X5MA 5DC0A 5FB8A 4JM4L 3RWJA 1ED3B 2ZOTA 3PDOA 4O51B 3G04B 5EIQA 1EVUA 3DV6B 5HVWA 4N22A 3ZRSA 4LSTH 3T77B 2MQCA 2BP3A 5B1JA 1R47A 4XVJH 2YRPA 4FFZH 4HJJH 4R4BB 1C5BH 1E4XI 5C0CD 4X7CC 4XCNB 1SM3L 2CDGB 4GQZA 3RQ3A 2BNQA 4NYLA 3SKJL 3OR7A 3UJTH 3QNZB 3AY4A 4OZFA 4XXCA 3QEHA 4F1SA 4GW5B 1N67A 2J72A 3M17A 4H8WC 4WI6A 5I0YA 5TGBB 1BA9A 2B7DT 3BQUD 3D7PA 1E2WA 3VH8B 2A74B 4ONHB 4MMZA 3FPYA 1VLXA 5CAYB 3QORB 4E0RA 1F58L 3T0XA 2R1XB 1K4CB 4GAJH 1KEMH 2A83A 1FYHB 4KI5F 3T1FA 3ZKXC 1F4AA 4HKZB 1NQBA 2E86A 4PREA 5E24E 2DQTH 1YYCA 2CJUH 5IR1B 4GB9A 1Q9OB 1QWNA 2EACA 4WY7H 4BZ2L 4DPRA 4PJDF 3FQ1A 1CBVL 3ROLA 2WGXA 1I31A 1UOKA 4HIJA 3BOVA 4YSSA 4GXVL 1CICB 4EN3A 2V2XB 4WZ9A 3V4VH 1N6QH 3TNNA 3U0TB 4XCYB 4L8SC 2Z4QA 3F00A 2VUKA 4L1BA 5JPMC 1WWCA 3R0MA 2ERJB 2FBOJ 1LEKA 1SBSH 3VO0A 3ERXA 4Q89A 4PWKA 1CGVA 3BZFA 2AERT 2WLLA 3JWDC 4OFYA 2JWYA 4KGJA 4P05A 4AEIH 2R1WB 4C4KT 2R0ZH 1K2DB 2NW2A 4HC1A 2C9SA 2VOTA 5J1AB 2YD3A 4N0UB 5I1IL 1NGZB 4RMSA 3L45A 4NGHH 3IJ8A 3BKYH 3HC3H 5EEUA 3MJ9H 4NQXA 2D0FA 3D87B 1K8IA 3B56A 1AFVH 3SDAB 4TXVB 5F6IC 5D2LF 1PMYA 3FFDA 1YEGH 3KAAA 1OANA 3BUYA 2ITDA 4TLTA 4OZIE 1CZ8L 1FG9C 4B0MM 2JI1A 1I9IH 2R4SH 2LVEA 1U3ZA 5F9OL 1MWOA 5KVFL 2Z0BA 1OGTB 4F5CA 1GXEA 1I1FB 1SEQL 2BVPB 4N1EA 4OLYH 2CGZA 2R9HD 5EG6C 1I7ZA 1A5FL 4E9TA 4ZFOL 3A67L 2YFNA 2WUCH 3LQAC 2NYKA 2OI9C 5INDA 2VDQL 4QNPE 2AJUH 3C8DA 1MHCB 2CKBH 1E8YA 2ROXA 1EZVX 4PW4A 3HI5H 3L7EA 4H26B 2BY0A 1D2PA 3KGSA 2CLZB 5T1MA 4GXUM 4YDNA 2VB5A 3B37A 1DJXA 3HE6A 4K3GA 4PV8A 5DT1L 5DZOA 4NUPA 4PRPA 1NDGB 5FOJA 1DSWA 3KWWA 3H9YA 1W15A 3FU0A 4PTUA 5E2JA 1KGYE 5AVVB 3CVDA 3Q5YA 4X2UA 2DQJL 4GAGH 4A67A 3Q8CA 4HKJB 5J12C 3UDWA 4F2MB 3IVKA 3RY6C 2CKNA 1E4KC 5MEPA 1AMYA 4PRPE 2LR4A 4EI5C 3DPBA 2BP0A 4KRNA 3TA4D 2DI8A 3DOSA 2VL4A 2XIDA 3JV6B 2RCSH 3FQWB 3O9WD 4CADA 3F04A 4FLSA 5EORH 4LLMB 3N06B 5LXGH 1PX8A 4BK5A 4L1LA 2QR0A 3BKMH 4R5XA 1ILSA 1KJMB 3VD5A 3LDBB 4IBZA 1HAUA 1J5DA 3D25B 3HFML 3NQIA 3UTSB 1DVUA 2P9RA 3OXRB 4JPVL 4G6ML 1P7QD 1FO0H 3P4NB 4OLEA 3PREA 1KEGH 4XNMA 5GRXG 2YQ3A 5AW4B 2RFXA 2Q1EA 3OQ3B 3H6JA 2DJSA 3MOBL 4K9JA 2PPDA 1G84A 3O4OC 4WFEE 3TA3D 4TQEL 1WD8A 4Y16A 4E68A 5CD5C 1JN6A 1TJHH 3AW5A 2IV9A 2GBTA 5IIEB 2ZX7A 3EO9H 3ESPA 1NFKA 5HY9A 4MQXC 4HVBA 4JKWA 2NOYA 3STBA 5JYMA 1L6PA 3Q6GL 4O2FB 4GQ9L 5FCUL 2D9CA 3JWNE 4KO9A 3NCJH 2NW3A 4UTAL 5FO8A 4FD0A 1IM9D 4WKXA 4D8OA 3K2UH 3CXFA 3ULVL 3T65A 4L97A 5CU9A 1EHAA 3M1BB 1TTUA 1V3KA 2ENYA 32C2A 3TEYA 4WJG3 5FB8B 4L8DA 2NSXA 2QGCA 5F1IA 4XI5C 8PAZA 2BHFA 2G75A 5EZJB 3VA6A 1SXNA 3MUZ1 1X6LA 1YJDC 1UZ8A 4G9FA 1NMAH 4AXWA 5LCVL 4PJXE 2D0HA 4DVRL 2JTYA 2X7LB 3KCPA 3KNBA 4EI6A 1CLCA 2BNQB 4NYLB 3ILPA 2ILLA 5E8PA 2AV7A 3OR7B 2NYYC 4F7EB 1KF9B 4OZFB 4G9FE 3M17B 4UOW1 1UOVA 5L9DH 4XC1L 3CHSA 5D55A 3BZ5A 1ZT1A 2YFOA 1E43A 4QD2E 2ATAA 2MQGA 3CBKB 4KK9C 2A83B 1NMBH 2DLEA 3T1FB 1DBML 2QLVB 4ZX4A 1E3ZA 1R5VB 1F6LL 4BFBD 5C0CA 4FKKA 3ROLB 4ZD3L 1HKFA 3QYMA 2EXTA 1G5AA 3O6FD 3RDTC 3N50A 3PGDA 5AAMA 4B9FA 3QIUD 3N04A 2OR9H 4AW7A 4JM2B 3BQUA 1LEKB 2PABA 2NLJA 2XPGB 5DHXB 3QEGL 5DYFA 1NKOA 3BZFB 1ZLUK 5KVDE 2WLLB 2BSSB 3OG6B 4F8PA 1PY0A 2EDJA 3C60C 3MNVB 1FL5A 1S7TA 4FQLH 4TLSA 3ARDC 4XP4L 5KJ4A 3CZKA 1WG3A 2QQNL 2DZEA 2NMSA 2NY0B 1HH9A 4U4BA 1NGXA 3IMWA 4B9ZA 1AS8A 2ENJA 2PTTB 1NBCA 3Q8FA 4NQXB 1OE2A 3N3EA 4OM0H 1K8IB 1VFBA 2PPCA 3VFWA 3SDYL 3UG4A 2VM9A 5HHOB 1L3WA 4JHVA 4N2AA 2BSED 4FG6D 2W59A 4S1RL 1D5MA 4RQQA 3A6CL 1WT5A 4KV5E 4L4VD 3OKLB 2GI0A 2B5IC 5EEYA 4HLEA 5IFHH 4JFDB 4FZ8L 1FDLH 1F4HA 2AJXH 6PAZA 3OKNB 1I7ZB 1CTMA 1IAKB 1N3NB 4P23B 3SOTA 2JJVA 4WKZA 5F8RC 3FTYA 2NXZC 3NP3A 5A1AA 3GDBA 2VXQL 2R0KH 4W9GC 4PJ6A 2WK2A 1F2QA 2ZXAA 4Z3TA 2MOGA 4QHPA 1N5YL 2AW2A 4S2SA 1UWGH 1MLBA 4P07A 3HZVA 3SHSA 5LGHH 1TVBA 2HMIC 1XGTA 2B59A 1CK0H 4A7GF 4J7RA 2A6JA 4KXAA 2DQIH 4ZS6C 1NBVL 4PV8B 5I74C 3N1QC 1B0WA 4WWNA 3S5LG 2YD9A 4XBGA 3GMLA 2MQ3A 1QO3A 2XX1A 4PTUB 1F13A 4X0KA 3KWUA 4FAAB 5F1SA 2Z3FA 1ESOA 5MEPB 1UH3A 1HEZB 3BGFC 2DLTA 2YUWA 3ASOB 2E59A 3DPBB 2BP0B 4V11A 4RWYL 3DOSB 1F1DA 2XTJB 1G6RA 3HNVH 1QNZH 1DHKA 1RP8A 4XNZB 1FFPA 4P8QA 3LH2H 4CADB 4U2ZA 1H5BB 5FDWB 3HAEH 3VU1A 2A6IB 3BLPX 2MNWA 2IOIA 1PG7L 4A63A 4ORGA 1PCSA 2B1OA 4KKLC 4RMUA 5C7ZA 3EOBB 5EF3A 2Q7NA 2V2WA 4PW3A 3Q06A 3F5WA 5JUEL 3WFBH 2VMJA 1Y0LA 1WP6A 4TKWA 3R06A 1P2CB 4G1MB 2EH7L 1UWXK 2DOCA 5DFVC 1W0YT 3MAWA 3V0VA 2FJUB 3K1KC 1MJJA 4N2MA 1U8QA 2ED7A 1KY7A 4XNMB 1DUZA 1EUUA 3IFOA 3KLSA 4F7MB 4Y16B 1JN6B 3MBEA 3OG4B 4K94L 4NQEB 3V0WH 3FUFA 5T8IA 2YC1B 3O9WA 4TN9A 1H9VA 3E8UH 4RNRA 5HY9B 4P59L 1S9VA 1MDAA 3M8OL 3VFTA 2EE6A 3KLHD 2YUXA 5A2LH 4GSXA 4BUGA 2NW3B 3P77A 1A4AA 1X5JA 3MBXH 2XZQH 3QRLA 1QA9A 1I3VA 2K9UA 5AFAA 3T65B 4WWKA 2B1HL 5D7SH 1HT6A 1P7QA 4UQBA 3IRZA 32C2B 4L8DB 1QRKA 4LOEA 2Z8SA 2LU7A 3HMXL 3TA3A 1S7UA 4Y8DC 5GSRA 3I9AA 1U2YA 4F57L 4NFBA 3RZWA 1UZ8B 4AXWB 3FUDA 1NIAA 3SOBL 4PRIA 3TP4A 3ETSA 3H2QA 2H1XA 3KCPB 4M3KB 2P49B 3KNBB 4EI6B 3RL2A 3ILPB 4BXVA 2WWMC 3FB7B 4WO4C 4HSCX 3THML 1IM9A 1HJCA 2Q9OA 2E6QA 1TQCB 5JHLL 4MD0A 2GKIA 3VXMD 3E8VA 4L0YA 4Z3IA 3WFDL 4I0PA 1ZT1B 2F0CA 1VEOA 2V7NA 3DVNA 2P8MB 2JB5L 1BZ7A 2AAVA 2K6ZA 2R2BA 3GMRB 5EU3A 4K7FA 5DD6A 3ULUF 1J48A 1RZJC 1CYXA 4JG9A 4Y88A 4NOFA 2HAZA 4P9HL 2WXKA 2NXYB 5E1AA 4AYMC 5C0CB 3KYKL 3OJDA 4R8WL 4U6VL 3RPIB 1U95B 2HVKA 3UBHA 3PGDB 5EOCL 1BX2B 1JPTL 4MHHI 4XX1G 4EZJA 3O41B 2FH8A 5HHPB 3ZIYA 5GISH 3IAQA 3BQUB 3ETTA 2FBRA 4OLZH 4GO9A 1T3FA 2NLJB 3QWOA 2E9WA 4FQQA 1FGNH 1AGCA 1B0GA 3KYNB 2I9TA 1RK1B 1MOEA 2ZWKA 2CCVA 1FL5B 3U7YH 5FGCB 4M7LL 3GHBH 2HT2D 4U49A 1OF2A 1HH9B 1NGXB 4QDGA 2YXFA 3HTLX 4Z3EA 2CM6A 3RY4A 5TDPA 1VFBB 4TNVK 4X7FC 3O6FA 1OF0A 4G6JH 3IRPX 3G6DH 2E8YA 3QIUA 2WXHA 1X6NA 3WMSA 3O8XA 5TF1H 1T1XA 1D5MB 1KYDA 1SHMA 2V9TA 4AVHA 4E42A 2P8LA 3PWUA 2IXQA 4NO0A 4RQQB 3Q9PA 4WFFD 4Z7VE 3LD8B 5BZXA 4D0BB 2OAAA 4QJ3B 3UO1H 3ZYIA 3WDJA 1Q1JH 5DRZA 2R0LL 1TZIA 3F62A 3VG0H 4X4ZA 4WKZB 4YHZH 4CUCA 1IGCH 5GZNC 3VQ2C 1O0VA 2H6PA 5EZIH 5BUGA 4Z7QB 5IV2A 1QFHA 4S2SB 1MLBB 4FE9A 1YEKL 2Y07H 3CHOA 3HZVB 4PJIA 3EFOB 4QAMB 2V17H 3T2PA 3V8OA 4MQSB 4UT6H 3OLDA 1M1XB 1XGTB 2B59B 4E9XA 5SX4H 5L88L 2A6JB 3UBXA 3D3VE 4Y5VA 5EDXA 4L4VA 3ARGC 4RX4D 1YPZA 1E0OB 3GMLB 2AP2A 5A43C 1VRSA 1NFDF 1QO3B 3NZSA 1YUKB 1BZ9A 4PJIE 4X0KB 1JPST 5GGUA 4GKNA 1JS4A 1D6EB 2X3AA 5DYOB 5JA8B 3PRZA 2HJFA 5ACLA 4JHBA 2ED6A 3SY0A 5DRXA 3L4WA 4L4VE 5AW2B 4AEEA 1UEMA 3CX2A 2IGFL 1WFIA 1YPZE 1ZHNB 3AS1A 5HD8D 4ANVA 5CCGE 3FONA 4B7IA 3W82A 4W9JC 5DVPA 1S7QB 2W81C 5I26A 2R69A 3H0TA 2CBTA 5ADPL 3QPXH 3QUXC 2A38A 3QIBD 4ZMZA 1X5IA 2Z7UA 4ORGB 2E9BA 2XIBA 4FI6A 1SXSA 2Z8VC 3LN4A 4KTYA 5KANG 1L6XA 4D2NA 1ZANH 1O5DT 1Y0LB 3O45A 2W60A 1QHOA 3R06B 4MA8L 1TSRA 4JANA 3V0VB 2B15A 1BOYA 5ID1A 3CTTA 1MJJB 3WD5L 1U8QB 4ZZKA 1J1XL 1DUZB 2HLEB 3AQDA 3ZDXE 1FSKB 2AF2A 3IFOB 5JHDA 2ZJSH 3MBEB 2BHUA 4JKPL 3QFJD 2CWRA 3O9WB 3P73A 5EO1B 3PQYA 5F1KC 3NCYP 2JKSA 1V7MH 5KSBB 1S9VB 1AZBA 1TYJA 3FT3A 3VFTB 1NA8A 4FX5A 4YSPA 3KPOB 3NIGB 1KCSH 2HJLA 4A6YH 3BKJL 3X3FL 4OCRL 1OD9A 2AEPL 3BFOA 5I0VA 1AQHA 4WWKB 4OUOA 2WNKA 1HH6A 1Z5HA 4K5MA 2VDKL 5T3XH 3VG9B 5AL8A 3I85A 3U4AA 3RKPA 2QLYA 3VRJA 4OM1H 1S7UB 4FYTA 5GSRB 1C9SA 4TVSa 3HB3B 5DD0L 4QHKJ 3CK0L 1ZA3A 5F7NC 2QHRH 1T1YA 1XCQB 3LZRA 3QJQB 1OP3H 4PRIB 4YSDA 1CDCA 2LU5A 5DO2D 1NLBH 7PAZA 3NDZE 5EUOB 3RL2B 2VMEA 2QPDB 3Q9QA 4GW4B 1B88A 3EDDA 4NWTL 4P3WA 3V79C 3FAXA 4MD0B 4X4KA 3RUGA 4HS8L 4JL2A 3T2OA 5F96L 3S4SG 3MSPA 1K9TA 1E8XA 3MRCA 1W8NA 4I0PB 4PCYA 1KJ2L 3DVNB 5CGTA 1BZ7B 1FI8C 2NQ3A 4G43B 1BXXA 4K7FB 5DD6B 5E2UL 2R7EB 1OCCB 3VTMA 3G6JF 4JHWH 1CD1A 3FF8A 5TFSH 3RUGE 2IF7A 2WPGA 4OCMC 5E1AB 2PXYD 5E4AA 3OJDB 4WNSA 1OHQA 4OB5L 2BWQA 2ICCA 4QTIL 4HCRA 3J2PA 2ZOUA 2DMKA 1KN4H 2OSLB 3QDGD 3L6FA 7FABH 4H0HB 4MNGA 4J27A 3ZO9A 3WDHA 3V9CA 5JXAL 3O6KL 4F2EA 3VXMA 4FMVA 4PW9A 1OW0A 1OCWL 1AGCB 3UTZA 5I1KL 1B0GB 1UZGA 3NFNA 2I9TB 4Q0XH 1LE9A 1XSOA 4LPVA 1XAKA 3IE4A 2HRLA 2VJ0A 1BGXH 5GRUH 3VFGL 3VXME 1XTLA 2K78A 2QVKA 3ZKMD 1EHLL 3RWCA 3AABA 2QPFA 4AT6A 3LTVA 2ZYIA 2UZXA 3FT9A 1MCDA 2WLHA 5TDPB 4HIHB 4M6OH 5FM5M 2VLMD 3O6FB 1LO0H 1HHIA 2JKTM 3APFA 3O8XB 4AQ1A 1JXFA 1T1XB 2EH8L 3LVEA 4NLAA 2KDYA 4RRPG 4UBDC 3SJVD 2P8LB 2WCSA 1J05A 2IXQB 4NO0B 3ZR5A 2C3GA 2E6JA 4U1JB 4N2OA 1AS6A 4G3YH 4IIQA 3F3HA 4M1GL 1WO2A 1KXQE 2WB1A 1DQMH 5EU4A 1LLAA 4OCSH 5DRZB 3E9TA 3WGVB 3TO4D 1TZIB 1JMXA 3JYCA 4R2GB 2XWBA 3IDNB 1YNKH 2Y2YA 4S11A 4WI4A 5HI5C 3SYCA 2W95A 5EB9A 2H6PB 3MJ8A 5INCA 1N5AA 1EVTC 5IV2B 3BKCL 1IEHA 3D9AL 2J55A 3F7VA 4GMSH 3LB6C 4JJ5A 1T21A 3IGKA 4HJTA 3Q2CA 2QQLL 5F88B 1TTCA 3FDWA 3G5XA 1GA2A 2ZWYA 3SPCA 3BO8A 3UC2A 3TLRA 2FJGB 3HC2A 4AL8H 4Y5VB 5F7EL 2FJSA 1SJVA 2X12A 3GBNL 3Q1SL 4UCFA 5D1XE 4YDKH 2H47C 4I8DA 4YHYC 4ODHL 1BZ9B 2J73A 5GGUB 1VENA 3BH8A 3VMPA 1X9LA 3TGXA 2QKIC 1AE6H 1IGML 2HJFB 1SN2A 4KK8D 3V5KB 3K72A 2CO3A 43CAA 2F7RA 5DRXB 3SY0B 1J0HA 4QOKD 3KPQA 2V9UA 2ZUYA 3VWJD 3BMWA 4KU1A 1NFAA 3ZTJG 4DTGH 3FONB 2ARJQ 4FYQA 5FUZH 3ZE1F 2C7FA 4WO0A 1JJUA 3B83A 3PHAA 5AW7B 4N20A 3CFBB 3LN4B 2ZKHL 2VKXA 4Q4EA 1A6UH 4AUJA 3NABH 2DY2A 4FQCL 2W60B 3GTNA 4JB9L 3K8LA 2D03H 2YMTA 4BINA 3Q05A 1J18A 4JANB 3SPHA 4FOMA 2RQ8A 3U9WA 5ID1B 2PO6D 4HEPG 3UP1A 3MN8A 2E7LA 1XCWA 3FHQA 1U92A 2BIMA 3S36H 3QJVB 1IAIL 2JF1A 5JHDB 4Y5YB 2YS4A 3MLRL 1EMTL 3NDYE 3P9MA 5D7LA 2DM2A 2ZKMX 1UT2A 3MDJA 3P73B 1NGPH 5DJ6A 3HJ0A 1OPGH 4DCQA 3PQYB 3WIIH 3CJJA 3B7RL 1TTFA 3FT3B 1V8HA 3QIBA 4DAGH 5AWNL 5J3HD 3ZE0F 4ZPTA 3RWIA 5C09E 2I85A 5CGYD 1RUML 2E7BA 2ZX9A 2HJLB 1JF1A 4O9HL 4PY8I 5C0BE 4Z7WA 3QJRB 2VLKB 4UILL 3L3JA 5DLMH 1FYTD 2JCCA 5I18L 2OZ4H 3ULVF 2K0RA 1K4DB 1HH6B 1GOHA 3CFJA 4JM4H 4EZMA 3DMMC 1UACL 3WOVA 1OAZH 1XH0A 4YXHL 1E4HA 3VRJB 4PJHB 3VVVA 4IJ3C 4Z7WE 3NA9L 3CE1A 3QFJA 5FGBC 1BIIA 3HZMA 5LGJA 1Q9LB 1ZA3B 2JCCE 3MRBA 1T1YB 1AQKL 2XV2A 2IG2L 2HXAA 2OL3A 1EANA 4CN4A 1HVXA 2VN3A 3OPZL 1J5IA 3FQUB 2P24B 4X4MA 3CSYA 3FRPA 1G7HA 4ZO8A 2VQUA 4JREC 3NSFA 3GXIA 3QFJE 1AJ7H 3MOAH 4JR9L 4WHDA 2WIMA 3GSOA 1EJ8A 4RZKA 1RIUL 5JQ6L 1P0SE 1FC1A 3ZZLA 1ZK9A 3GI8L 3HG1D 5J6HB 4XNYH 3RFRA 2FYYA 3CBRA 1AGBB 2ENPA 2NXZB 3GK8L 4L8BA 2E47A 3R1GL 1SLVA 2YXVA 4NZTL 4FCAA 1UD5A 5F9JA 5LQBL 1ZGLP 2QGDA 2X4QA 1WLHA 3B1UA 5IQ7L 4KPHH 4OFIA 4OZGA 3DO3A 2DQGL 3V6BR 2WQXA 5LN8A 3L81A 1ADQA 5MEND 2RB8A 4MNGB 3ET9F 1OAKL 4HEME 2DMHA 4XP5H 5EULV 5AYTA 4I1NB 5K39A 2UZPA 8FABA 2UXTA 2NQCA 4TVUA 3VFOB 4OZGE 1QRND 2OSYA 4FABH 4M56A 1ZWIA 3UTZB 4ZS7H 1Z9LA 4DQAA 3NFNB 1B2YA 1OTTC 1KTRL 3R4DA 1LE9B 5GGVH 1LILA 4NN6C 3TJHD 4BELD 3WSQH 5C86A 2YD8A 1JYWA 1BVNP 4HUXA 1NCDH 2PXYA 4G9DA 3RWCB 5IUSA 3BH4A 4AT6B 3NVQA 2UZXB 5I15H 5CNHA 4Y7OC 5KSAD 3FS9A 3QDGA 3ZZ1A 4R26L 2HJKA 1HHIB 1QP1A 3EJQA 3H2WA 1GW0A 3MZTA 4HJ0C 4AQ1B 1RJYA 5AYQA 2EYSA 1CZ8H 4K5NA 5D7KD 1VEPA 2FD6L 4QF1A 2B77A 2HSIA 5C0FA 2YMXL 5E1GA 3QO1A 5IJKC 1YY9C 4OFVA 4OUUA 4BK4A 1UJ3A 1IBBA 1XB3A 2EP6A 5D7HA 4IIQB 1ZLEA 3RE0A 4CN6A 3QDGE 3K6OA 4R7LA 3O2DA 5EU4B 4JVWA 1KGCD 2EDOA 1A5FH 4ISVA 4X8CA 1SZNA 1S3KH 1B90A 1Q0YH 2H26B 4NZJA 4A7UA 1JUFB 5TTRA 1GW6A 4JQXA 2NY5L 4L23A 3MJ8B 3B2UC 4AE1A 5INCB 1RURH 5DURB 5ACZA 1E9PA 3DV4A 2J8UF 3BAXA 1GGBL 3GUTA 4JFVA 4JJ5B 4UDTA 5CD3B 3SJVA 5IM7A 2P4AB 3K6DA 2VXUL 3CLWA 4LHUD 1WFMA 1N10A 4IKKA 3SE9H 3KWTA 5IB1B 4KAQL 4XVSL 1KGUA 5I0XA 4XMPL 1BIHA 5JOPE 1D6VH 2VLME 5ID0B 3DJ9A 2Q7YA 4K9EL 2BSRA 3LPOA 1K3ZA 3GHPA 4RZCA 4AWJC 3D69B 3PXHA 3TO4A 4BRVA 1DJIA 3SJVE 2JELL 1OSPH 3OMAB 1T03H 1CFTA 43CAB 3K72B 2XKNA 3CDGA 2Q86A 1ZT4A 1IC7L 4IBYA 4XCCH 3F7PC 4XVUC 3DC0A 5AD0B 4P99A 1Y18A 1QTPA 1PFCA 2AI0L 4GNKB 4KHTH 3OGOE 5FFOA 4KI5C 1PX4A 4DSYA 4B3EA 1EEUA 2B1AL 1ETZA 2FO4A 2RACA 5ISZB 4H5SA 1R5IA 2N56A 1L4IA 3N2JA 4UV4H 5K1NA 1QFWI 3NCBB 4DEWA 1DQLL 4PJAE 2VJ8A 3HUJA 4BFIB 1JHLL 1QBMH 4X5LA 5AKVA 3EAKA 2J4WH 1ZV2A 1A47A 3EJZD 1U92B 2VSKB 4JHAH 3HUJE 1WEJL 3BAEH 5SV4A 3P9MB 5D7LB 4MNHB 2OTUA 2N59A 4OSUH 2UWEF 5B1BB 4PJ9C 4DCQB 2J21A 3BSZH 3K8KA 3CZFA 1H6UA 3G3LA 3MV9A 4QOKE 4W9FC 3T0EE 3PWJB 1N59A 4P46C 4ZPTB 1C5CH 3RWIB 4RGNB 1EFXB 3PIQA 1TQBB 3LRHA 4ZUSA 4WTXA 1TZGH 4DETA 4Z7WB 3L3JB 4DGVL 3P4LA 4OGZA 4A04A 4EOWL 2WQAA 1LO2L 1FL6A 3CFJB 2PO6A 5D72L 2IQ9H 4M3JA 4N2DA 4JZJA 4N8CH 5DMGC 5F97E 2MFNA 1VCAA 2PR9A 2UY7B 1IGIH 5DMKA 1XR8A 5I0ZA 4G7VL 4ENED 1A4BA 2RHEA 5HI4D 5LGJB 5LJYH 1FNGA 1DTUA 3BDYL 4MB1A 4CC0A 2OL3B 3GBML 3RWDB 4OI9A 1ZVYA 4NIKB 12E8H 1X7TA 5H94A 3CSYB 3FRPB 3SDDC 4DEPC 1N6UA 4ZFFB 1G7HB 3IFNL 3RA7L 1OAXH 3L08A 4PFEA 4YC2C 3FFOA 4KJYB 4OD3L 3SBQA 2N7AA 4LB8A 1RZ8A 3GSOB 1OOAA 4IBQA 4LSPH 1BLNA 1DBBL 4GS7B 1INEL 4Y4HD 3GJEB 4ZW7A 1OSYA 3TNMA 1ZGLM 3C5JA 2FYYB 4IOSD 4CVXA 4L8BB 3F6LA 4KNSA 4HKXA 4PD4J 4G7YL 3MODL 1XHHA 1YO4A 1OXYA 3GINA 3J7HA 1A14L 4R7NB 1YYML 5IB2A 1ZEAH 1FYTE 2X4QB 4H8QA 2VLJB 3T4YA 3QQ3A 2KUTA 3NZHL 5E5LA 1A7OL 3W0WD 4YXLL 4UAOB 5KVDH 3LHPL 4K3JL 4RISH 1W72H 3P30H 4Z0BH 1QWUA 3TN0A 4NHUB 3O0RL 3S48A 2CUHA 2QVMA 5K39B 5IBUG 2OTWA 1ACYL 8FABB 1EO7A 3WNLA 4HJSA 4HH8A 3HG1A 1HKLH 1FNSH 4PJFA 5EWIH 3VNYA 4YNYA 3T3MF 4I0CC 1JWUB 3HOGA 1PNCA 4TVPH 1CD9B 5T5FH 1RZIA 3L13A 2O5YL 3EADA 4L29A 5BPPA 3BYYA 2NY3C 3ZTDC 4XODA 4HUXB 4XP6L 2PXYB 4GP8B 1FCGA 4QRTA 2C34A 4TSCL 1U3JA 2IO5A 3P54A 1RFDH 5DRWB 1XGYH 3MC0A 4WIQA 2HJKB 4FTDA 2N01B 5MENA 4L2YA 4S1RH 2DLFH 3AC0A 3KGTA 1T0NB 2FECL 4KJQC 1RJYB 2EYSB 4PWJA 1U42A 3AXHA 3QEQB 4QF1B 3SN6N 1BAGA 1QPKA 3QO1B 4J4PD 5FA3A 5B21A 3ULAB 5JORA 3WIFA 4NM4L 1SYSA 4HS6A 2KLRA 1UUSA 2DM4A 4FZ8H 3CCHA 4LCCA 2H32A 4JKLA 3MRKA 3I6KA 3KPLA 4ISVB 3UTPD 1DQIA 5HYFA 2EE9A 4PJEF 3FKUS 4OZ4A 1QRNE 5LGYA 4UINL 5ACZB 1ZDQA 1ZMYA 1E9PB 1TTGA 4APXA 5C9JA 5CM1A 3GUTB 1XWVA 4UDTB 2WTPA 1JV2A 5FO7A 1CIUA 3MR9B 4YK4C 2C8NA 3G7TA 4J39A 3SJVB 1KCRH 2VN4A 2G30A 4IGBB 1A6TA 1BFSA 3K8MA 4WEBH 1I1YB 3Q48A 1W8EA 5KW9H 1WZ1H 2DM3A 3QUMH 2FQFA 3GSXA 4QT5A 2BVEA 4RIRB 4KKCD 1Y1UA 2V3EA 4JDVA 5AW6B 2Q7YB 4NEHB 2BSRB 2DQUH 2XV3A 2FEEI 4RZCB 3S2CA 1MFEL 4TPRL 4LMQI 4GSDL 3ZQWA 1NBYA 1CFTB 2BVQA 5E4EC 2XKNB 3EYOA 3CDGB 1ZT4B 5DDHA 1U58B 4JRLA 4U1LA 1MG2C 1Y18B 5E08L 2OK0L 1KBGH 3V5DB 2WVUA 2XBTA 5CN2A 4B53A 1ETZB 5F70A 3T6QC 4YMPA 3RG1C 4JO5A 4LHUA 3IDMA 5IKCA 1BM7A 5AUMA 4HMCA 1R5IB 1IBZA 1NBZA 2FAUA 3FQTB 3WUZA 4A7TA 3MXVL 1X5FA 3T04D 5I24A 1IVLA 4NPYB 3ZU8A 1F8TH 1T66D 1PVHA 5CJXC 4ZXBD 4A2FA 3ABMB 1GAFL 4Q9RL 1I3GL 3QHZL 1XZ0A 3OZ9L 4RMQA 1KPRA 2MCAA 4Z0XA 5JXED 2EDNA 2OJ1A 1LDPL 4Y9BA 3SQBA 1HILA 3DHJA 5DQ9A 2VC2B 2VH5L 2OTUB 2EO7A 3I2CH 5IVXE 3FRUB 3I75A 4G71B 4N3TA 4R7DB 2CDFA 2WQRA 1LVEA 2J6EH 4MXVE 3CZFB 3M8OH 1R1CA 2VLRD 3MV9B 1AO7A 1OP5H 3WIHA 1N59B 4OQ1A 5IHUL 1KXHA 3TYFA 3PIQB 2ZICA 4ZUSB 2ADGB 2WXFA 2DD8H 3KLKA 2AQQA 3X1BA 2Y23A 1UFUA 5A7BA 2DQHH 5KS9E 3FH5A 1D7FA 5E2WH 3IRCA 3LZNA 3U0PB 1LMIA 3V0JA 4BFOA 3A24A 1S7WB 3RWFB 4JO2L 4JZJB 1XGPA 5IB4A 1WUNT 5DMKB 1XR8B 1Q9KA 2GTZA 3GXDA 1F56A 3VGAC 3EH2A 4PS7A 2DWXA 2Y6TE 3QT2A 1FNGB 3MLSL 4W4OA 1BDYA 1JERA 3T0AA 2DLHA 5IOKA 4ZZFA 3LZFL 1NC4D 4NZUL 1KCBA 2O5NA 4NQTA 2OPCA 2A6DA 2WO4A 3ARZA 3LMJH 4PRHD 1NPNA 1RZ8B 2J8OA 4U7MA 4X9FA 1M7DA 2WC7A 4FQHA 2BOBA 4N6QA 1VCBC 4A2EA 1BLNB 3T8MA 1KYOK 1PLBA 4CMMA 3EBIA 2JKXA 3TNMB 2WYHA 1JD9A 4GRLD 3GXFA 3U1QA 4CVXB 5HHXH 1DQQA 4XWOC 4HKXB 1HZLA 2FT7A 4YO0A 2RMNA 5JPNC 1HHJA 4LSRH 2VZSA 3PLYA 4DUXA 5IB2B 2B4CH 5H37H 1Z9SA 3QGVA 3WXVH 4RMVA 2AJVH 2XWXA 3T4YB 3QQ3B 5KVEL 1AYOA 1GS7A 4R8WH 4DF9A 5BV7C 4Q8BA 4OT1H 5EA0H 3MJ6A 1VA9A 3R8QA 5EOCH 1AKJD 1ZV9A 4NNPL 4LDLB 3TN0B 2ZCHH 3GXNA 1KWGA 4PJ5B 2OTWB 4PLKC 2GTWA 5ESAA 1YNTF 4BUHA 3HG1B 3KEHA 2AQRA 2NY2C 4GIPD 1YEEH 4PJFB 5FYKU 4HC1L 2F5BH 1UATA 4YNYB 4UIKL 5CJOH 4K8RL 4RH4A 4WWID 4WTZA 2P3YA 3D33A 4ZMXA 3DIDA 3DWTA 3Q7JA 4R6UA 5FUCE 3V7MA 3Q5OA 4GBXB 4YS4A 3S35L 5K1VA 3W0WA 2V5RA 5E9NA 1KTJA 2Q7AA 4QRTB 4NHCH 3M1OA 5D1ZA 2APXA 1G0XA 1VGKA 2VMFA 3B7TA 3OGCA 4OCNC 1A25A 3EJYC 1LP9F 2YGNA 5MENB 5K5YA 3GGWA 3X1NA 3QCUL 4K4KA 2PW1A 2QMJA 1IQWH 2QVTA 3W0WE 2OMBA 3ZYOA 5DJ2A 4AYEC 5FA3B 4DP5X 5GGTA 2Z7WA 1NGQL 2HFGL 1A1MA 3WIFB 4MJ6A 5A6IA 1SYSB 3DRQB 5ICXA 2TAAA 1CTNA 3CCHB 2R0LH 1TQVA 5JQIB 4P2QD 4B95C 3MRKB 2HH0L 3I6KB 3KPLB 1PW3A 2A73A 1BG1A 4M48L 1YEFH 4OZ4B 4YHMH 3SDXE 1GKOA 4X6DF 4MJ2A 4A68A 2FR4A 2WXRA 4HK3J 4POYA 2ALAA 2CDEA 5C9JB 1BECA 3FUKA 4HXBL 5C97A 1OSZA 1JV2B 5FO7B 3OAWA 5FO9A 1ET5A 4Z77A 3RURA 1PSKH 1A6TB 4PV1C 4BM7A 4QGTA 5C0GA 1SN5A 4J4PA 2XWTA 4YSOA 5KYYA 3D4YA 3GSXB 3QQDA 4ZMNA 5H2BA 5CSZA 2Y7OA 3P0VH 3EF4A 2Y7SA 1XZWA 2I32A 3FT1A 3VGHA 3SDCD 2IWKA 1NBYB 2BVQB 4IK6A 3EYOB 4TL5A 2G3ZA 1DFBH 3EYQC 4U1LB 4Q4IA 4NUQA 4PJ7F 4IK7A 2EKSA 2ICWI 1XSKA 4NN7C 1I8KA 2BERA 4LDCA 4XPAH 5DUJA 1HX0A 3ULUC 4Y1AD 5GSVA 4EUPG 3IDMB 5IKCB 4OCLC 3FT2A 5AUMB 5JW4M 4J3BA 3SCMD 1NBZB 4ZNEA 3S36X 2YD5A 3L1OL 4WQOA 4OCYL 4IBUA 2BSTB 5B7MA 4K3DL 2B08A 1MXDA 4MA8H 1E9OA 3P3RA 3QG7L 1DEEA 1F6FB 3BEWA 1NUNB 1BBJA 2DIAA 4WHYH 1EDHA 4UM9D 1COBA 1NCOA 1KPRB 1EEQA 4Z0XB 3ZR6A 3LQZA 1EEZA 1CLYH 1U3HD 2R39A 5E6IC 4YN3A 2DV6A 1JXJA 2H0PA 3QS2A 3H56A 2ATPA 3I75B 4HIIA 4XMKL 2CDFB 3GSRA 4FP8L 3OSKA 1AO7B 3N91A 3AGVA 1J9QA 1SJHB 1NEZB 3TYFB 3BRDA 3V2AR 3L2NA 2VXTL 5TD4A 5AB9A 3CPUA 4M7KH 1CR9H 2GJ6D 3MRJA 5D5MF 3AWEA 2CJSA 1NM9A 1F4XH 4ZXBA 4KTEH 2DYPD 3Q2LA 1BXUA 3MNMA 1HCFX 3G5YA 4APQD 3PFUA 1I9JL 3CC1A 2CHWA 2IFFH 2ZG1A 5JXEA 1MI5D 2DQDL 1XV8A 3Q2NA 1J10A 4IRJC 4TUOB 5DD0H 1DJHA 2XJKA 5C07D 4MJID 1Q9KB 3UJIH 3WS6A 2GTZB 1WBZA 4XNQA 1O9VA 4DGUA 3MCKB 1UWEL 4OQTA 3P9LA 4HXAH 2OMYA 3G9AB 1H19A 1MWAA 2VABA 2DQEL 2P7TA 4G8GD 3VD3A 2A6DB 3TT1H 5EPMB 4AH2A 3WKNA 2XFXB 4FQHB 3F7YB 3F85A 4I88A 1WS8A 2VLRE 1CDHA 5TPWL 4Z7NE 1KELL 4KJPC 1IFGA 5E2VL 4EI5D 1DQQB 1TSHA 4AL8C 1ASOA 1J1PH 2XWRA 3UFIA 1BZOA 4YO0B 4PMFA 4W9KC 4L05A 2ZP9A 5DS1A 4NJ9H 5FM5O 1QSEB 1NSNL 2H6OA 3I9PA 2Z0UA 4QTIH 1TR7A 1GSKA 4KRPD 3QUYC 1T80A 4O02H 1NC4A 3ZT5A 3IS0X 2UZIL 3ZT7A 3MA9H 4JKMA 3P3YA </