1ZRUA

Structure of the lactophage p2 receptor binding protein in complex with glycerol
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
263
structure length
253
Chain Sequence
b'TIKNFTFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lactophage p2 receptor binding protein
molecule tags Viral protein
source organism Lactococcus lactis phage p2
publication title Receptor-binding protein of Lactococcus lactis phages: identification and characterization of the saccharide receptor-binding site.
pubmed doi rcsb
total genus 57
structure length 253
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zruA02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 1zruA01
3U6XA 3DA0A 4RGGA 2F0CA 3D8MA 4RGAA 4L92A 4HEMA 4HEPA 2BSDA 2X53A 4IOSA 4L99A 4L97A 1ZRUA 4L9BA 2WZPA 3HG0A 2BSEA 3EJCA
chains in the Genus database with same CATH superfamily
1YG9A 3P2DA 2LR4A 2YGOA 1U8LB 5IBLC 2PTTB 2CA4A 3O6FB 3O6KL 1RZ8B 3EOAB 3S34L 2CLZA 5L9DH 5FV1L 3MCKB 4HJ1A 4Q58C 4Y19B 4URTB 1YRKA 5KVGE 1IBFA 3ARDA 3B5GA 2P3YA 4DCQA 3QDGE 1U2CA 4LSUH 3QFGA 2WMPB 5DD3H 5I1AA 5J8OA 2VXQA 3H3PH 3MBEC 2VITA 4EKXA 4L9LB 4XODA 4G9FE 4APQD 3EBIA 4J3OF 5D1QB 3TO4B 4EUPA 2NZ9C 3MV9A 5H37H 2GIXA 3QCVL 1FYTA 2B9AA 1DBBL 3DJSA 2D3NA 1BFVL 4QAWA 3NGBC 1JF6A 3ME0B 4PJCF 2JTDA 4AQAB 3ZLQC 3OM3B 4QRQA 4DEUA 4OVVA 4DW2H 1TZIB 3FPYA 2EDHA 2CGRL 1F3RB 2CKBB 4WNQB 3C6EA 2CHNA 4MA7L 4JEGB 1A6WH 1EXGA 3A4EA 4TULL 3AREA 3BZ5A 4R90L 4RZKA 4LPXA 3DOSB 1CZ8H 3OJVC 4Q6IB 4BK8A 4WK4B 1OLZA 2A1WH 4R84A 1CFQA 2ZXAA 3MBWA 1FC2D 1SM3H 3CFEB 1NBZA 4GG8A 1RERA 4GRWH 4QRRD 1MCNA 1F02I 4NIYE 3S96A 1PDKA 2H9GB 2OTWA 3EJZC 4ZUVA 3UC0L 3ZMEA 1N26A 3STLA 4JM2A 4PAZA 5FK9A 2NZ9D 1DL7L 3EO0A 4TQEH 3GUTA 1I3UA 2HKFH 3TCXA 3DROA 4XNUL 1W8NA 2RACA 4BQCA 4FQLH 3SDAD 1F58L 1H5BB 2W5PA 4OLYL 1H19A 1S9VB 4N68A 4HCRH 5GRYA 1I3GH 3V4UL 1X6LA 1MY5A 1VEPA 3NIFE 4JM2B 1DQDH 2VR5A 4PD4K 3W81A 4MHHI 4AIZB 2BOBB 2OBGA 4JFQA 5ICZB 3QAZB 1MCHA 3BKYH 4YUEL 3T08A 1I1AC 5EEXA 3VVWA 1BM7A 1RJLA 3ESVF 4EN3C 1RZKL 2YXWA 3OC5A 4IRSD 3SDDD 2NY6C 4HUWA 1XX9C 3EG9A 5HJDA 3WUWA 3UEQA 4R2GC 1WH0A 3KJ4C 3X2QB 2OR9H 2YLHA 5GISL 2EUVA 3QCVH 3MLRL 3QSKB 2QPDB 3T2NH 2CIKB 4X5QA 2CKBH 4G6ML 5FO7A 3VXSD 1C7TA 4G8AC 5IB3B 1Q94A 4PP1D 1PZSA 4ZXBB 1FO0L 1CC3A 4RFNC 4L3CA 4DQOL 2QQQA 5DGRA 1NC4D 2BM3A 4FXGA 5JDSA 1RV6X 4AQZA 3VFPB 3VXQB 4Y7MA 4KQ4H 2X7LA 1AGDA 5CP3H 1HHGA 4OCWH 5IESL 2X4TA 4WWPA 2O93L 3WHE0 4CVXB 2W0PA 3QHTC 3N85H 4RAHA 4YFDB 1T1WB 3CX2A 5HYSG 4I9WD 2FSEB 2J6EH 3EHBD 1MFVA 1VEMA 4KJPC 5HHOA 2APVA 2DMKA 4Q2ZA 5ALCH 3FO0L 3K6IA 3OC8A 3LNGA 4NN5C 4R4ND 1B0IA 4RFEB 5KVDL 1PEZA 5I9QB 4JPIA 5J7CC 3ZT5A 2XTSA 1BOGB 3NIGF 1PKQE 1DDHB 2MKLC 5E94A 5B1AB 2W59A 2NQCA 3GSRB 4UOJA 2OMYA 4XNMA 2H4EA 3K91A 3TS8A 1URLA 1EFQA 2ZOKA 3KPLA 2DQDL 1CF8L 4LLQB 2W81C 1MFAH 1QSFA 1QQDB 4OR1A 1U4EA 2M1KA 5CBEA 4XBGA 1LE5A 1J18A 2NQDA 3II2A 3MRPB 1J0KA 5E00B 3QDMD 3QRFM 4JDEA 3TA3B 1ASOA 3GMNB 3RJOA 3EGXB 1KGIA 1OTUC 5HDQL 1OTTD 2NXZB 5TK2A 3ZTCC 1IAIL 1KCLA 3X12A 5I17A 3IWVA 5DT1L 2EIJB 1PZ2A 3FN0H 3IDIB 5T33H 3GMRB 4FP8H 1EVTC 5KBKA 1EAQA 1S7SB 1JGDB 1M57B 1KPVB 2ZOUA 4OIFA 4P2YA 1NM4A 1T2QH 4GQRA 1KXVA 1U8HA 1B6UA 4Y1SA 3X1GA 4IOSA 3WIHL 2O5YL 3QEHB 1CL7I 3FU0A 3FSZA 4ZO9A 2GY5A 4M8QB 1FE8L 1XTMA 3QJVB 1ZE3C 2GJPA 3AUWB 4UTBA 3IDMB 3BPOB 5IHZB 1FAIL 1HSBB 2KT6A 4NC2B 4U6VL 1FLTX 2GJ6E 3LV3B 4X5WA 3Q3GB 3SKUD 1I4FA 2XI9A 1QBLH 3UYRH 2QT6A 2JI3A 5IR1B 1FNFA 4Z7UF 3TWCH 2UVFA 2TAAA 4R7DA 5KVDH 4OCMC 3T1FA 3VH8G 1XDTT 3PWPD 4KV5E 2ZCLL 4XCNA 4AGPA 2X1QA 1GGTA 4EN3B 4N6QA 3WCYA 3WY4A 3KWUA 5KG9A 1Y1UA 4HJGB 2JFCA 4MD0A 4GRLC 1R46A 3N06B 3SB3A 3RUGB 4HKBA 3IMUA 2WO4A 2AJXL 4DEWA 3KPQB 1N3NA 1JZEA 4YDJB 2Q3ZA 3DBXA 2QSTA 4M29A 3U25A 7PCYA 1XF5B 3IETA 3UOAB 1PSKL 4JDVA 2FJFA 4JREC 4RA0C 5ANHA 1YEJH 4UIKH 4U6HB 3C9NB 4MJIE 2A4EA 1NCWL 1F8TL 3PGDA 1NKOA 2IQ9L 4JUSA 4GRWF 1OANA 2P8LA 2BFVH 1KC5H 4NO3A 3WI9A 2F7PA 2XT1B 4KRMB 4BE6A 2GCYA 3BEVA 3UACA 2CWRA 4P3WA 3LQAL 4MMZC 3FFCD 4UQ2A 1A2YB 4MJ6A 2XZCL 4K73A 3RU8H 2JELH 1NCBH 2E7DA 3UGXA 4ZUTB 1N8OE 1A02N 3VRJA 5G55A 4JFDD 5F89A 3RKDD 5K9JH 1TEGA 2MWCA 2H32H 3P4OA 3Q5YA 3DRTA 3OHXA 4DZ8B 1NC2B 2YMXL 3NCCB 3EYSH 3GS7A 2EXTA 2HVJA 5I0YA 3VGDA 5AVYB 2IEPA 3X1NA 2CJUH 3CFIC 5C92A 2GJRA 5INCA 4RISH 3GJEB 2EDNA 3QCTH 4OB5H 4PJIE 4E9XA 1LMKA 2NX5D 2IAND 2W0KA 2EADA 3WY3A 1N6QH 1G0XA 3EJUA 4KTDL 4MSWB 3DI2B 5KSAB 1BQRA 3PHSA 1Z2KA 2WSPA 1FHGA 3LIUA 3MUGB 3O41A 3OB8A 2WK2A 1X4YA 1A9VA 1JS4A 2E6JA 1FNSH 1BEXA 2VDMB 3EFFA 4I18A 4DGIH 4P9HL 3AAZA 5IK3B 4JKKA 3UBFA 2RQEA 2Y3NA 3KYNA 4GXFA 1KENH 4BHUI 1FNEB 4GW4B 2DH2A 2IAMA 2G2PA 1YMHA 2GUYA 2R29H 1EX0A 4YHOL 1IE5A 3L9RA 1IAMA 1ETJA 1EJ6A 4P57A 4RIRB 4MNQE 4XHJD 3EHBC 4K0OA 4LCWB 5CZXC 3UGEA 1MWAH 4WW1A 4CKVX 2AQ3A 1Z3GH 2MRYA 3G5YB 3NCMA 5DJYA 1FFNA 2ED6A 3MBED 5C0CB 3TZVB 5CFAA 2AJSH 2DW5A 3KNBB 4HBCL 4HEMA 5EA0L 1FNAA 4H13C 1FVEA 1LO2H 2ZP0T 3GBML 3NIDE 5C0BB 4Q7DA 4UT6H 5KBDA 3RZCA 3ARBB 2G9HB 5FUZL 5I23A 4PG9B 1J9TA 2A2QT 5C0AE 2W9EH 4JFZH 1I8LA 5I18L 1VLXA 4X9FA 4ZNCD 3QIBC 1DLFH 1QUNA 1AANA 4NCC1 2OMNA 3NRQA 4PWIA 2B77A 3DPBB 2B1HL 2ZUXA 4D9QE 4U3XA 5T5FH 5BJTB 4ONOA 2DQCL 2ZQKA 2Y7LA 4J1UA 2BRRL 5F7DB 2OW6A 4FF9A 2GBUA 3WJMB 2VCOA 4RAUB 1N10A 3BDBA 2CIIB 5E8NA 4NWTH 3KR3L 2QR0A 3FTSA 1DDTA 2ZT9C 3J2PA 3WEAA 1E7VA 1MCBA 3NIFF 2WZ6A 3MLTA 1PQZA 2YD5A 3DX9B 1X6NA 1T7YA 4IJTA 2TSAA 3LRHA 3WGUB 4B60A 4HUXB 6PAZA 4FJYA 4ZFQA 2VLLB 2VDMH 1AE6H 4TOYL 2EC9T 4ZMQA 1U8QA 4RAUA 4DEPC 2OMZA 3Q7JA 4ODTH 3GJFK 2CCLA 3C6SA 5F96H 4JFFA 3E7JA 2D31A 3FTYA 1I7ZA 1Q8MA 1VJSA 3MZGB 5HI3C 5BV7C 3PL6C 1TYEB 1A3RL 1MFCH 1V3JA 4MLSA 1YSOA 3QHZL 1DVFA 4HH8A 3ZIMA 4U0QB 4NZUL 5E2WH 2RFXA 5ESAB 4G9FB 2WUBH 5SV4A 1NM9A 3SY6A 2CMRH 2BVTA 2YMTA 4FXGC 1KJVB 2GAZA 3CZKA 3EFDL 4GXVH 5E5UB 1FYTE 5HHPB 2WJ5A 1DBMH 3L08A 3PL6A 4UILL 5F88A 1GGIH 1NEPA 1SJHB 3L9BA 5J6HB 2HX8A 4F5CE 1SDAB 4QNPF 3VI3F 1ZHKB 3VGFA 4E41A 1L6XA 4HKXB 3RBGA 4NO3B 1UENA 1V54B 4KROB 4M1DH 1G9NL 1WD8A 1C5CL 1UB6B 3TZVC 4BGLA 4L97A 4WHTB 1IQDB 2D4DA 2DTSA 5HGHA 1LK2B 3EDKA 4FLHA 3RVUD 4JL1A 2UUDK 4GKLA 3SE4C 4L99A 3D18A 3G6JB 2YZ1A 3SBWA 3WUZA 2LW3A 3B2UC 3I50L 2FH8A 2R1YA 3AY4C 3VFVB 2F6AA 5J6HA 5GSRB 2KH2B 2F19L 5I1IL 4MX7B 1NGYA 2QADB 1CYWA 4FQ2H 3O4LB 2A9BA 1U95B 4AEHL 1EXUB 3WFCL 3LEYL 2XN9B 4QXTB 4QHNB 1WTLA 5D96C 2K9UA 1PZ3A 3WXWL 1LDPH 5DVKA 5HPMB 1KIRA 1H0DA 4DO6A 1L6PA 4MJIB 5IKCB 3CVHL 4OF3A 4B0MM 2F8IA 3BDYL 2BFVL 1T04B 3W2DL 2YPLB 4AUYA 1RSFA 2J43A 2WJ7A 4X7CC 3PWUA 4WWOA 4OT1L 4KO9A 5CIPA 4ELMA 4BSJA 3V4PH 2QV4A 1KBKA 2B16A 1CICA 2BC4B 1KTJA 2BXYA 5CLZA 1TQBC 2FD6L 2X40A 1H6TA 3X14B 4GI9A 4F1ZA 2IANA 5K9JL 1AJ7H 4DP5X 4FLOA 4ZX4A 1IV8A 4C47A 3DK0A 1BEYH 2GT9A 3UG3A 4G1MB 3E1F1 4Q0XH 4JCWA 1FVEB 3C5XA 3NSXA 5CWSB 1I9IL 1GAFH 5BNXD 5EUOB 4HULB 1MW1A 1BDYA 1JPST 3QH3B 2CBPA 4F80A 1S9KC 1BQUA 1FDLH 4PP1C 1W0YT 1JFHA 1AGBB 4LCCA 3BZDA 8FABB 1LGVA 3L1FA 3X3GL 4XN5A 1BWWA 5TE4H 3L95A 4HT1H 4Z7NF 3EH1A 2J12B 2ZCKH 1ZPUA 4TULH 1BMWA 2DOCA 3MGOB 4JKNA 4UQBA 2XTLA 2NDGA 4MNHB 2X1OA 3ALPA 5IBTH 3KPRD 2VMCA 4JRWA 2WUCH 4DJMA 2AEWA 2J8UE 2K45A 1CFSA 3HR6A 4UM9B 5AVSB 5IFHL 2OMTB 3RJQB 3GSUA 1TU2A 3MACH 1MG3C 1HOCB 4PJEA 3OKNB 2FJGB 4TOYH 3II1A 1FL3A 12E8H 1Z7JA 1EAPB 1KELL 1S3KH 3FT3A 5L88L 3L7FB 2QKIA 5CF3A 1FL6A 5CD3A 5JXEC 5BRPA 5JZ7C 5F97E 3PHOB 1NUNB 2XBTA 3GLZA 4PJIF 4NPYA 1QNZL 2HB0A 1RIHH 1RIVH 3HMXL 3I6KB 1RZFH 4LKCA 1YPZB 5M94B 1CWVA 4PTTA 5GS3A 3MNMA 4WI9A 1OARH 3P4MA 3L9EA 1J1XL 1JP5A 1TVDA 3T77A 2BRRH 2VABB 2FECL 1CO1A 2A6IA 3EJZD 5IBUG 5D72H 1A6PA 1ROWA 3M17B 3RL1A 4F24A 3NVQA 3BSZL 5DK2A 1OQOA 4C4KO 2ODHA 3GRGA 2W60B 3VXQA 2X4UA 3KG5A 3LTVA 5IM7B 3EDDA 4G5AA 4NKIH 3HEIB 1Y1DA 3L4CA 1K4DA 3S4SB 2L4OA 4WEBL 4HWBL 3RGVB 5EDXA 4ZAKD 4YBLC 1AR1B 4GS7B 5C08E 3SE9L 2B59B 3HG1B 4KKLC 4HF5H 3C5JA 1PYWB 3QA3A 1A4KA 1IIIA 4PRAB 5E99H 1MLBA 3DYOA 5HHOB 5D7LE 4PJ5E 3WNJA 2AMGA 3QUZA 5BZZA 4N25A 3MJ9A 2ZSVB 1DBAH 1MDAA 1UT9A 3PXJA 4F7KA 1CBVH 4YGVB 3QJSB 2FEDD 2R56L 5HGBA 1JK9A 1O9ZA 1MJJB 4P2QD 3B7UX 1PG7L 4A7TA 3N44B 4PLNC 4L0ZA 3OWEA 4FCHA 1JWSA 1CLOL 1KXTA 1R6VA 2WSDA 3MRFA 3N6YA 3O2DL 3KVPA 5FOJA 5GS0H 4P2OD 1H5BC 4E2OA 4NQUA 5I16B 4NKMA 1E3ZA 1JF5A 1WAAA 3K3QA 4HWNA 4BFOA 4J6RH 3ILQD 5BQ7A 2P26A 3MRGA 4EF3A 1OCZB 4OT1H 4F37K 1H5BA 3BMWA 3Q0HA 4U1GC 4Z76B 4E9LA 1LE5B 5JIHA 5DJ8A 2VM3A 4ODTL 2RD0A 2NSXA 4NEHB 4PUBL 5CEXB 4WFGE 5C70A 4GLRH 3RB5A 4KK5C 5BCAA 4IIQC 3PGCA 3GSNH 2D7QA 1W91A 3RWDA 4WY7L 1Z5HA 5D2LA 3D4CA 3E1ZA 4JE0A 3FN9A 1KULA 1UWXK 3CFJB 1MXDA 3BPCB 3QI9D 4UYPA 4X6EB 3IDIA 3BKYL 2YD8A 3DMMA 5IREA 1RVFL 3EIFA 1JGDA 1KPVA 2XWXA 1D6EB 2G2NA 2H26A 4RRPA 4B50A 5GZND 5IFAL 4ZYKB 3RWHB 1VDGA 1FLRH 3MODH 1MFBH 3G5VA 1IJNA 2XPZA 3L3DA 4OJFH 4XP9H 4Z7UA 3DMMC 5DYOA 3TIDA 1MWAB 1MCCA 3FF7A 4HLJA 4LOUD 3ZDXF 2Q5BA 4FQJL 2YAFA 5ID0B 1L6ZA 2V9QA 3CZEA 3IU4L 4WK0B 3CLFH 1AYOA 2FX9H 2XWZA 4PGEA 5FECB 2C3XA 1NAML 4L3CB 1TTRA 3U2JA 3MRIA 2APFA 1YEDA 2QELA 2WKLA 3VRIB 4DP1X 3DX8B 1OCRB 2YXMA 5F0JB 5L6YL 1IKFL 3BT0A 4HFWB 1QFWI 4HCIA 1NAMH 3O6FA 4NJAH 2AJZA 4KQ4L 4KX7A 2GSIB 2XIBA 5D1QD 1IT9H 4TMPA 4GRMA 4ABUA 5FYKH 1CZ8L 5J11B 2BW4A 2WMPA 4HUKB 4NKDA 4V2CB 2KKQA 3MV8E 2CDEA 3HNSL 2C7UB 1ZTXE 4ANXA 1QPPA 1QHPA 3EFOA 2ZCZA 4H44C 5C0CD 1HWGB 4FNLL 4L9LA 4EUPH 4OD3L 4NUPA 4PN6A 5KSUB 2PO6A 4QPEA 4F8LA 3LDBC 5KTEH 3P9WB 4GRMB 4Q4EA 1AQHA 3QCUH 1JXFA 2ADFL 4P5MB 3TYGL 5GS1C 3ARED 4U7MA 2EABA 1ZLSL 1R5VB 1IC7L 4K8RH 5KSBF 4F7EB 4BSWA 4HK0B 1E30A 4RISL 2QGEA 5F8QC 5AKSA 3EJYD 4NNXA 5JO5B 3LKPA 3QIBD 1F3DJ 2W07A 4JO3L 4QYOB 2FB4H 1GSMA 1I1YB 2RTTA 2WCPA 5D1XD 3ZQ9A 1M3IA 1I8KB 1D6VH 3K0YA 4KJQD 2Z93B 5IHUH 3S34H 3VX0A 2I9TA 4LSRL 3ZE2E 1J0IA 2WXHA 3P3TA 2WXIA 4W4NA 1D9KD 5TGBA 2DLIA 1A4KB 4PRAA 3ZDWA 3IS0X 2R0WL 2FWLB 2Y25A 4QRSB 4PJ7E 3CVHH 1TCRA 5DD6B 4J39A 3FT1A 5ECGA 3VD4A 3TV3H 4GIOA 1OALA 2WUCL 2MIZA 1F86A 2XZAL 3MGTB 4N8VA 4LCYA 4ZUUA 2WXKA 3TEWA 5EA0H 1A7OL 2F08A 3FT2B 4P2CG 1WV7T 1SQMA 1MAML 3Q2CA 3QXUA 4YDZA 2HJKA 1C1EL 1XBRA 1E4WH 1UWEL 3MXWL 4GY4A 4OSUL 2AV1B 1X7TA 3OKMB 5BQ7B 4PREB 3CN3A 1B4RA 1M1XA 3D25B 3KL0A 3MOBH 4MCYA 5C7XL 5H4ZA 2KQNA 3BRDA 1NLBL 2YA2A 1LEKA 5JOPE 3LXBA 3UTZA 4KKBD 3GKWH 4HPOL 4LNRA 4NAMA 3BH9B 3F7PC 3AT0A 5EOCH 3MJ8B 2OA9A 4ZMTA 4MD5B 4LMQI 2O4EA 2QLVB 3PWLA 5FV2A 2M26A 1D5BA 4W9ZA 3ZT7A 4LAJH 2MTPA 3DROB 4KGJA 5C09A 1D5IL 4E9YA 2WLMA 1KYUA 4FQXC 3BZFB 3MRDB 1U8KA 2OP4L 5D7KD 3H2WA 5DMIH 3UTSB 4JRYE 2XTJB 3MUHL 3P40A 4XMXA 3L4TA 5F9AC 4JN1H 1X7SA 2BIPA 2SODB 4P2RA 1UA6H 2ITDB 3SDDA 4F33B 1U93B 4LHUD 2AJ3B 3M86A 4JDEB 3TA3A 4XBPB 2N1TE 1P7QA 1FIGH 3PWLB 4Y0GA 4HDIA 1IKNC 5ICZA 3LN5A 4V1DB 4DQAA 1BVZA 2Z7WA 2ZIDA 4MDIB 5DJDA 1UZ8A 3CZLA 4A2MA 3R19A 4YXLL 3RVTD 3WO4C 3EH4B 4RFOL 1A9BB 2KL6A 2QHRH 5GZNA 1TJIL 3D0LA 3FO9B 3HVNA 4ICWA 1Q0YL 3DX0A 4KRPB 5ISZA 2EE2A 4PRNB 3DO7B 1P5UC 1EQWA 3O3DB 1XMEB 3R4RA 1ZS2A 4HIPA 4I88A 5JW3L 1NEUA 3G9VA 4YHKL 3AS0A 3L6FB 4APXA 1IRAY 5I5IA 3OKKB 1MH5A 2HJLA 4OBRA 4KBPA 1U0QA 2WP3O 3KE0A 3V79C 1DJXA 2Z34A 4KI5F 4OZ4A 2IMMA 5D1ZC 3OJDA 4OLXL 1OP3K 3S36X 1HXMA 3FUFA 4BD4A 3OV6A 1P4LB 2MCAA 1O6SB 3D08A 4OTXL 1BYOA 5ALBH 4GAGH 1F58H 1KIPA 1UH3A 4P8QA 1XIWA 1R24A 2OMBA 3VSUA 3BUQA 5EU7C 2N0MA 5BV7B 1PZAA 4GAFB 4RWYH 5BVPH 5AAPA 5D4JA 3FMGH 1PTZA 2HAZA 3NFNB 4IU2A 1NZRA 2IWKA 2XU9A 4NLHA 1G1YA 3MCLH 3RY4A 2F7RA 4WU5A 4U33A 3CQQA 1SVCP 1IGTA 3TO2A 1BBJA 5HGHB 4J2QA 4KJPD 1YEIL 4BUGA 4IDJL 1P69B 4TRPL 3LZNA 4PJBB 3RI5K 5F0LB 2E9GA 4GQQA 1F4HA 5B3SB 1HDMB 3HLKA 4OH2A 1NDMB 1O75A 2Z6FA 5F9OL 3MBEB 2G4GA 3RFZC 4XCCH 3GBNH 5AOJA 3R8BB 4LGSB 5KS9A 3EHBB 2P42B 3ESOA 3TBVA 4N0FA 1H3PH 2FUQA 2YR3A 4AQ1B 4LCUB 3DUSB 2R15A 4GG6A 5ITBH 5DUML 4BGDA 4F7PB 3WKMH 3KLHC 1BQHA 4ICXA 4N2KA 1UD3A 1RJZB 3MNVA 1Z9MA 3QZNA 3HHRB 3VWKD 5I0XA 2MCG1 2CLVA 4PQXA 1LDSA 1S9YB 1ZAGA 1MCOH 1IBBA 3MXWH 4OSUH 3U0WL 3VXSE 1ESOA 5D7KE 4XMWA 4JR9H 4ZOBA 5F7DA 1F4WH 3JWOC 4NZ8A 2XZQH 2K0RA 5FKAB 4X6DB 3BAWA 4OLZH 3D85A 4A2LA 5L9DL 5DLLA 4XR8C 5E6YA 4GKNA 4Z6AT 2BC4A 5AALA 4WU7A 1DANT 3O9WD 1J8SA 2YQ2A 8CGTA 1R47A 2CCWA 4NN7B 4PLJD 4XNQB 3QXAA 2EIKB 1WEJH 1WA0X 2VQUA 5FHAL 2FEEI 5GGQL 3H9HB 3FFCE 1FH5L 1L9PA 2XTJD 2X70B 3SOTA 4ZMAT 3FYIB 5EEVA 5ECJE 3MRKA 2GB2A 3PG2A 3V6FA 1FNEA 4GW4A 1OWRM 2JCCF 3WLBB 3FFCB 2BX5A 4TUJA 3QO0B 1IC4L 3ARYA 1AZNA 1WBXA 4FQCH 2R0LL 1MHPL 4G6AD 5I2IA 1R3IL 1AQ8A 3SYQA 4BFBD 2HTKD 1N5YL 4M6OH 3BT2L 5DD5H 1OT1A 3S8GB 1D5XA 1TEYA 4GW1A 4JG0L 5CP3A 4OQTL 5GRJL 1YQ2A 5I75C 1A1NA 3PWNA 4A1RA 5DHYB 1RP9A 3UCRA 4OIAA 4DZ8A 1MI5B 4H88H 2BO0A 3U4BH 3F12B 4HWEH 3ZL4L 3F7KA 4ZDHA 1MRDH 4MJ2A 3TBSA 3IFPB 5D5MF 3S36H 3VG9B 5AZUA 3HPLA 2V7HA 4EN3D 2YMXH 3QVAA 4Z0XB 1S7RB 5EOQL 2WOYA 3WIAA 3PWNB 3AY2A 1AXTH 1CIUA 1T7WA 2BNRE 3FO1B 1KPRB 5D2NE 1BFVH 2QPEB 4Z7WE 1GCYA 4KFMA 1CXEA 5CJ8A 2YRBA 4IKLA 2A6DA 3I9PA 3FQ2A 4JFHD 2IOMA 4HXBH 1L9NA 4K4KA 2XWTB 5E1AB 2XN0A 3GXTA 2Q3XA 4L4VE 4YUEH 3BPNB 4UQ2B 3T0EE 5JHMA 5BUGA 3VB9A 2HWZL 5HY9A 4X9BA 5DFAA 4HW6A 5JORA 1FFNB 3TZVA 4HQQL 2RGSA 3UZEC 2VN4A 2EIZA 2WAQA 4LDOB 4RQQA 3CFNA 4EBQH 3KPSA 1MJ7H 1X9QA 2A9AA 2AJYL 3ASNB 4LO9A 4M1GH 5GS0L 1FN4A 3LPPA 5HHVH 1WSST 4ZI8A 5K59E 4XNZB 4H0GA 4YPJA 4G8EB 5HYJA 3FQWB 3AMKA 4NN5B 5H94A 2QKSA 4BWUA 5AAMA 1MHHB 2I85A 5E5MA 2DQIL 1CICC 4HIXH 2AGJL 3LRKA 5FO9A 5F3BA 1QA9B 4YZFF 1T5XA 3I75A 3MLYL 3TBVB 4QRPB 1NFDF 1OGSA 4GAYB 1LP9F 3RWIA 2HLAA 3VACA 3MRRB 3B9KA 2C9UA 2FJUB 1TKWA 4LVHB 2DAVA 4AMWA 3QO1A 3OJ2C 3ECQA 4FNLH 4XXWA 3IDGA 2QTVA 2FT7A 4O51B 3TNNB 3GMRA 4LCWA 4GRLB 1HHKA 3GSOB 4KI5C 4WSKA 3OKEB 4AG4L 5FGSA 1T1XA 1BECA 1N0LB 2GTZA 1NCBL 1P5VA 4MLIA 1XTLA 4JZOA 4XI5D 5ERWB 1NSNH 4P59H 2VXQH 4TPRH 5BW7A 2YUWA 5IOKA 4QRAA 2NXZC 3JUYA 4WU7B 2R27A 1M2VB 2XX0A 4WW2B 3VGHA 3JVGC 4AKOA 3TNNA 5EORH 2P44B 3WSQH 3OMNB 2APWA 1V10A 1DVUA 2D7NA 1H15B 4Z3JA 1L7IH 3HW7A 1T89A 3P30H 4JO5A 1WCQA 4ZD3H 43C9A 5EF3A 1SHXA 3IMRA 5B1JC 5AD0B 3GI9L 4GMTL 2V4LA 1VSCA 4WSJA 4ZX3A 2FNBA 3KBPA 2Q76A 2BLFA 2HT3C 1VFAB 4K2UL 2F53A 3BUDA 2OZ4L 3KPRE 2UWEE 5DUJA 5L4IA 2EDQA 3SKJH 5MP6L 4NJ9L 1TJIH 1E0OB 3OLGA 1DE4A 5ICXA 5KYWA 3LIZH 2GJ6B 3UL4A 3HE6D 4AV5A 3BFOA 4JPSA 1FZJA 2B4CL 1LO3L 4A67A 4TF4A 3RZWA 1AD0B 4HFWA 1FSKB 3RI5F 4NB7A 4IRSB 5D7EA 3F7VA 1MW2A 3CZFA 4DKTA 2F74B 5DHVB 5DHMC 4XCFH 4HGWB 3X11A 3P77A 2I25N 3KMDA 4G11A 2VRKA 2NY6B 1JDAA 3U0PA 3FB6A 5EU4B 3SO5A 1A2YA 1N70A 4HCFA 1ZGLA 3BQVA 3C60B 4WEBH 1LO0L 1D5MB 3MREA 4S10A 3GM8A 3I02B 4U05A 4L1LA 4HU8A 4GS7C 1UG9A 2AXJA 2LU4A 3GQFA 4MA8H 5DK3A 1CCZA 2YPKB 5K93A 2D3JA 3ABGA 3B34A 3ZZSA 1A0QL 5BV7L 1J5CA 4PY7B 5ACZB 5CCJA 5LXGL 2ZG2A 4ZT1A 3IN0A 4EQ2A 3MLZH 1T0MB 3SZ6A 4A2GA 2RMNA 1MHCA 2NXYB 4CUCA 3E0GA 3QJXA 3LKOB 5DWUL 4X4XA 3U7WH 5GRXG 2LGNA 4MYWB 2CKBL 4LESA 4QRRB 2Y5TA 4L9DA 5D7LB 3AAZB 4DP0X 3CFKA 4UTAL 1E4XH 5AG9A 2AABH 4ONFH 4Z76A 4L4TD 4Y1AB 4M7JH 3PWJA 3BAXA 5C08B 4BWTA 15C8L 1HL9A 2Z93A 1Q0YH 2BIIA 4X8XA 4NQDA 4AEFA 4F5CA 5L88H 4PJBF 1BAFH 1XF4A 3POCA 1P2CA 3HUJB 3L81A 1HXYA 3TBWB 1F00I 4B9FA 5IQMA 1EGJL 2JJVA 4OFVA 1Z9PA 2WQXA 4WW2C 1Q9LB 4QRSA 2ZUUA 2HH0H 1BX2A 4NQEE 2AEPL 2HFEB 1QI5A 3MV7D 5JW5A 4HKZA 3ULVL 3QNYB 2AK4E 2JNZA 2X3CA 4HXAL 4N20A 2C5DC 3D51A 4LCYB 5MEPB 4XPTH 3RLSA 5D6DC 1QO3B 3GHEL 5JPNA 5DRXA 1BVNT 1TR7A 5E2TL 1R5IB 4W6XB 4DSYA 4V2BA 3FB7A 3G5VB 4R4BA 3BYYA 1DLHB 3AWEA 3NFSH 4I9WE 5T3ZL 4N6RB 2OCJA 4Y5YB 3P9LA 1VESA 1T7ZA 2H41A 5I17B 3TURA 3TO4A 4JM2C 1JZ8A 2YRLA 1LEKB 1A3LL 4OBSA 5CZXD 5I24A 2WKOA 2K7PA 2ADJA 3ML8A 4OJCA 3TTYA 5A6IA 4FMVA 4YNYA 1RUMH 5EU5B 1QO3A 3MJ8A 4JHUA 1S7WB 3H0TB 3JYCA 3IB4A 1QATA 4OCYH 4HF5L 4FQCL 3CIQA 2K8MA 4FS0A 1A6AB 1NTDA 1T5WB 3FRUA 3E38A 3FUHA 4RZCA 1XHHA 5KJ7E 1KJ3L 5L8KB 2JCCE 3IXAA 4Q8BA 2MFNA 2AQSA 3DOSA 3FU7A 1FZOB 4PLJC 2CDEB 4FLQA 3Q2WA 43C9B 4XOBA 3VH8B 3BWSA 2VLJE 1S7WA 3H0TA 2ZPKH 4AT6B 4MAYC 2ATPB 2AABL 4ONFL 2CU9A 5D72L 2AVFA 3AZUA 3HPJA 1S3RA 3RWFB 5FO7B 3W9EB 4DKEL 3EBAA 3P0VL 1SGKA 5HHQA 1E9OB 3KD4A 5JIIA 3L3HA 4QUOA 4WHYG 4BCZA 3RUGA 4P5MA 3QZBA 3SPJA 2PO6C 2VN7A 3PLYA 5JDSB 4KWUA 4YSRA 3D0LB 4R3SB 5EBWB 3HI6L 1HZHL 3GSNA 4BCYA 1JZ5A 5GJSH 1OLLA 2H26B 1IC5H 2YKLH 4LKCB 5EH1A 3T3PE 4W9LC 3TN0A 1ZCRA 3F6IA 3QQNA 4Z7UB 3TIDB 4HGWA 2JQZA 1BIIB 4JMNA 2VDQH 4YBQD 1N18A 3IJSB 3PHQB 4X80H 1DL7H 4UOZA 3IDJB 5AZ2H 2FECI 2VM4A 5TQ0L 4BK5A 2BZCA 2NY5C 3UJJH 2VSKB 3QJHA 4PJXE 1RP8A 5D5MA 5B1KA 4V1DD 1WWCA 2COQA 2J6WA 3EAKA 2F1EA 4UCFA 2R7EB 3PFUA 3UZEA 3HBZA 2AERT 1CLYH 3FOMA 1QUPA 4QOKB 3HG3A 2XV2A 5J13C 1NGXB 2UV3A 3HRZB 5FK9B 4KROD 4AQ8A 1H3GA 5DRWA 4PSPA 4H0HB 3H9SA 4W1TA 2D9CA 5KS9F 5J0BA 3CVDA 3GLEA 3CE1A 3WMQA 3D25A 2NY5L 3EJRA 2JKNA 2EDYA 5C6TH 3M1CA 4QO1A 2LVCA 3EOAA 4QMEA 4BQ9A 5LBSL 4G9FD 4BBWA 4NQTA 3MRHB 3O3EA 3WELA 2AXGA 1JWSB 4Z7VA 4AV4A 2UZXA 1RZGB 1J9CT 4J28A 3U83A 3L3DB 3CSTA 4JW3A 5DYOB 5DSCA 2X88A 1KCRH 2I26N 2XIIA 4YHKH 2QSCH 1DCEA 4HBCH 3WLWC 4BZ1A 4O58H 5C09B 1XH0A 1NINA 3CU7A 2DJSA 4G1EA 2VGLM 2WYIA 3RIKA 1BFOB 1X5GA 5D1ZD 4EIZC 2CJ3A 2V8MA 1HEHC 3SE3A 1FGNH 4FFVC 1E8ZA 2BSRB 4LEXH 1YQVL 3D4YA 1AS6A 3OG4B 2EH7H 1P4IH 2NW3B 2V2TA 4XNYL 4WQOA 5DJZB 2F58L 3I84A 3CFBA 1V3MA 3LKQB 3WFEH 3E8UH 2OAAA 4TVPL 1QTYT 1PPIA 2ICWI 1G6RL 3FS9A 5D2LF 3DTXA 1RUAL 2QBWA 2KLRA 4AYMC 2X4RB 3D2UA 3DTDA 3HS8A 5CJQH 4XXDB 5C07E 1L9SA 1UD4A 1IAOA 1OAJA 4UU9A 1VAHA 1MCPL 2VJ0A 3BKJH 3CN4A 4G80A 5FKPA 3K4DA 5IQLA 3LN9A 1GZHA 4R9HA 5EO0A 5EUOE 3WFDH 2EZ0C 3FUIA 4L8BA 3LIZA 3VGAC 4MNQD 2F54E 3HIZA 1T83A 3PABB 5DRZB 1IGFH 4N0CC 2P1YA 4UF7C 4AGMA 2HVKA 1NBQA 3MDJA 3Q5OA 4TUKH 1AHWB 2A73A 4HX1A 4KX8A 3WIHA 3US9A 1UM5H 4FKKA 4X4MA 4WFED 4AIOA 1RQ5A 4AKPA 4ZFFB 1YMME 3QUYD 5D70H 2XOTA 5GRUH 5DK0A 2V2XB 3HZMB 3T4AA 3ARTA 3ZY7A 3ZZQA 1YO4A 4N9GA 2FBJH 5IB2A 1PF3A 3IF1B 4YDIH 2GEQA 2W07B 1G43A 3T8VA 3VM5A 3ULUF 1YYLL 4ZPVA 5DQ9B 4A6YA 2DEWX 2WUBL 1OD7A 3UPRA 2OX5B 5DVLA 1FAIH 3L3HB 3C6LC 5AVXB 3M17A 3LPGA 3NDYE 3K2UL 1WBYB 4U1KA 3J07A 2EO1A 5HYSB 3ZDZF 1HT6A 3D52A 3NZUA 3NP4A 3VXMB 3ZKQD 4AJYV 4R7XA 4F2FA 5C0CE 3ZBMA 1HE8A 2AQNA 3WEXB 3IJ9A 4LAQL 1OB0A 3C5SB 3LNEA 2WXOA 4M03A 5D1ZA 5BZDB 2NX5B 2PO6B 2F15A 3S5LA 2F1BA 4QRRE 4X2UA 4RDBA 4ZMNA 1XR8A 5KVDE 3D4ZA 3MRBB 5DMGD 3GT6A 1PD0A 5H35B 5SX5H 1QRNE 3CHRA 1KN4L 2VISA 3P4LA 4XNYH 5E2TH 5KJ4A 4HEPG 2ESVE 1U2HA 43CAB 3G6JE 3BN3B 4WV1B 2DF3A 2VDPL 1PAZA 1RK1A 3ARDC 3UAAA 1J8HE 1E2ZA 5HPOA 5FYJU 2BSTB 4JHZA 1XCQB 3ETBF 3L5IA 4YK4C 1MRDL 2WLKA 3N41F 3OJMB 1GZQA 5DZLA 2R69L 4N0RA 4LRIA 3B7TA 3ZDYE 1XAKA 2CR6A 3ZUNC 1KEML 2VWEE 4WUUE 2CXGA 4JX0A 3QZLA 1UKTA 4K71C 1X9UA 3H2PA 1KDIA 1KGCD 1R34A 4R5TA 1JV2B 1TIUA 2EC8A 2JKXA 3OL2A 2B7DT 3ISYA 5F1OB 2WQWA 2GI0A 2HKAA 5HI4C 3PJLA 3S5YA 2CO6A 3UZVB 4JZNB 3SYCA 3KCPB 4LXFA 3T0BA 5LJYH 1QBMH 4L4VB 4QXGH 2CQVA 1RLBA 1OSZB 4Y4HA 1DQTA 3ET9F 3OWRA 5E5MB 4M4RA 2YZ8A 5EUKB 3Q9QA 5IBTL 3GXUB 4XHQA 3NN8B 3KPMA 1LD9B 4J4PD 2CHZA 1UADC 3GXNA 3OG6B 2YRZA 1FH5H 5TTRA 4F7TA 3I50H 4JO4H 4Q9CA 1IAKB 5T1JA 1I85C 4FHJA 4YHML 1F0LA 2Z7UA 1ZANH 1FE8H 2Z92B 4OZHA 3WJJC 4HGMA 2YOCA 3HMWH 4X99A 1KMGA 2JJSC 5AZEH 4BM7A 5I76B 1SF5A 5JPMA 3F7YB 1SMAA 1D5XB 2H45A 3S3CB 2Z31D 4NC1E 3P3UA 3CD4A 3QIBA 2CXKA 4M6OL 5DD5L 1DN0A 3MN8A 3FPXA 5KZCD 3CZSA 4AM0B 4ZPTB 4F58L 1B90A 1JGEA 4UV7L 5HGDA 3DGGB 5C6WH 2DM2A 4H4NA 3O8XC 3L3GB 4FYTA 4KJWC 3NJVA 1ZPLA 5HHMB 2XY2A 3MA7A 1C8PA 4MQXD 4MS6A 4LPWA 3GUFA 4AL8L 1TZ8A 5DDHB 1OP4A 4HCGA 4XWOC 4YHLH 1WAPA 1U93A 4ZMXA 2BVUA 3NA9L 3NIDB 3OKOB 5F1NB 4J8QA 5CIPH 4UT9H 4PJHE 1EGJH 3EYQD 1JE6A 4IMKC 4QI3A 4IS6A 4AM0A 4PCYA 1CS6A 1BM3H 3DVFA 1NMAH 3LH8A 4IU2B 3UDWC 3QDJE 2UZPA 2WD0A 2Y6TE 3HG0A 1HOCA 2HVJB 4L4TE 3KHOA 4W6WB 4O02L 4XXCC 4GQPH 1JZ6A 4OLVH 3SDYL 3T9WA 3N1GC 2WZ5A 1UB5B 2NXYD 3FT3B 4JG5A 4ZOEA 1GMIA 1LEGB 4KZEH 3RTQA 1HJCA 3MLVL 4GO6B 1DJHA 4H8QA 4TN9A 5E6IB 1JPTL 4JDTL 1HQRA 4K3JL 1EO5A 4WO0A 3W1ZA 4C56D 3K81A 2AXHA 5FPIA 4NI3A 5MEOB 2QDVA 3C6LD 1JYVA 3PGFL 4NM4H 3RTQC 1B2YA 3IMBA 2WWMC 4OIIH 3UJTL 4HFUH 2AI0H 4M62L 2J6EL 4AQ1A 3DBXB 2AJUH 4P59L 5IW1B 3ZYZA 1UACL 4F7PA 1FN4B 3G08B 5BXFB 3C5SA 5HGAA 3IFOB 1JGLH 3L9YA 3WD5L 5HYJE 2AJYH 4S11A 2XWJA 1J8RA 2N0KA 1CVSC 4FA6A 1SEQH 2Z0BA 2P5EE 3GIVA 5CSZA 4X9HA 5HBBA 1RIUL 3WKNA 3FU3A 4HYTB 1UOVA 4LLDA 3GDCA 2CDGA 5F3BB 3S8FB 1MHPH 1T0NB 5E99L 2HVBA 1NGQH 3RZCB 4G8GA 5MERB 1HL8A 1O5PA 3A6CL 4XAWH 5GS1B 1DJZA 3LEXB 3HS0C 1MCDA 1RUAH 1R3HA 1INQB 3QWQB 4PY8J 3VXME 2VZUA 3HC0A 3N3EA 3CH1B 4NQCE 3BVVA 5D2NB 4ADJA 3LAFA 4MD4B 1NPNA 4XP4H 5EU7E 3T2NL 1AZCA 4YIQA 4MHHG 1T1XB 4G7QB 3R7RA 3BLPX 3Q44A 1S5HB 4J1UB 1TFPA 4LSQL 4GSUA 4AG4H 4G8GB 2V0AA 4WHTA 3QO0A 4XNXH 4UTCA 1E27A 4D9QD 2VZOA 3PNWB 2OJEB 1KTKE 5D1QC 1QHQA 3ARRA 3L2NA 1UD6A 2WWKO 4FXKB 4Z95H 4A38A 1HZKA 4RDQG 1NGWB 4XP6L 5JIDA 5DWUH 1E6OL 3Q9PA 1DQIA 1DQDL 1X5HA 2VR9A 4KO7A 3CNKA 3SSGA 1JZJA 4K94C 1S9YA 4PHZA 4CILA 5JLZB 2J1XA 2YAHA 3NN8A 5EORL 3O4LA 4QWWD 1BOYA 1UM4L 1HQ4A 4FQHB 5GS0C 4WWKD 4PJCA 2EYRB 5J57B 3RE0A 1CGUA 2VL5B 1KJMA 2WKOF 1ODUA 1A14L 3U46B 1RUQH 3V4PA 1TXKA 1B6DA 3CSYA 4XRCB 2B15A 5IHHA 3KNBA 4NKOB 2GK0B 2WTRA 4CN1A 5IWLA 3SE8L 2EVIA 3QNFA 5HHPA 4K5NA 4X9GA 3DA0A 3QUML 3V6FB 4RMWA 4P2QA 2APTA 2B20A 1E90A 3QI9C 3KW7A 4Y5YC 4M1CD 4KXCA 1QUNB 1YYMH 2D4FA 2E5EA 2YD6A 2DWSA 1MSPA 5DO2D 3RPKA 1H3XA 4PJ9B 1LO3H 3STZA 2FEDC 4KI1A 1FC1A 3RX7A 4A68A 2HT4C 1MEXL 4JRYB 3OAUL 4LQFL 4X83A 1CTMA 3VI3A 4AYFB 1PY9A 2XWBA 1P5UA 2KZWA 4EI5C 1UOLA 1J5DA 5GSRA 3S9DB 4JR9L 3O3AA 5HYQB 1K8IA 2H7WA 1CT8A 2ATKA 2ZWYA 3F12A 4RMSA 2R0KH 4XPAL 3TYFB 3MLVH 4JANB 1ZVSA 4K3DH 2FD6H 1N67A 3PF2A 5IQ9A 3VGGA 4B9IA 3DJTA 3U6RB 2XX1A 1ZTXL 2ZKXA 4ZTPL 1GYWA 2Z64C 1NMBH 2AK4D 4KK5D 2C7UA 4Y4FD 2Z1KA 3HKFA 4U1NB 2E0PA 4LLMB 3N50A 2O5YH 5E8DH 2X0VA 4TKWA 4HOZA 1C16B 1XL4A 4XMKL 1J88A 2UY6B 5LGYA 1IM3D 3FUJA 3JV4B 4K5OA 4DESA 4DP7X 5DO8A 2VE6A 2BIOA 4XO4A 3RX8A 4LCWE 3TH3T 1BFTA 3VXRD 4AEHH 5F7KC 3S88H 2ED8A 4JO1L 4PP2B 4YHYB 1VKXB 3MU3A 1SFHA 3HOGA 4N8CH 1QLRB 4IK6A 1HZHH 3EDJA 4MNGA 5I19H 3SYPA 1AFVH 4CNIB 4BZ2A 4AITA 3APNA 2QFRA 2EO9A 5D70L 3SGDH 1CD1A 4HC1L 1E5ZA 1AXIB 4LSPH 3ULUC 3QEGL 2NY4D 2P7TA 5T3XL 2GUOB 3TH2T 1UZ6E 1RUPH 5I9QC 5TDOA 3IMVA 5I1EH 2CAKA 1SPDA 3BESR 3H7BA 3ZDXB 5GGRB 1JTTA 1YNKL 1OOWA 2ED7A 4YDLC 1NIDA 5I26A 3ULVD 3QNZB 4XX5A 5LBSA 1VA9A 3MUY1 3IAGC 1H3UA 5JQHC 3R7QA 3LZLA 3OD3A 2YPVA 2X6AA 2Q7YA 4M7LT 1Z0MA 3DX4A 2F53D 2WNWA 5BS0E 3FMGL 1D9KA 5D4QA 1ETZB 4Z3EA 4UQEA 4F15B 2D7MA 5E03A 1X7QA 3UTPD 1Y18A 4ZFOB 4TQ8A 2X9XA 1MIEH 3GJFB 4WO4B 3SPVB 3MX0B 3VXNA 4MFHA 3RGHA 3MLWH 2BMKB 4PBDA 2G9KA 5J12C 1CDHA 2DMHA 3EBGA 2WWOA 1S9VA 2E6QA 3UP6A 1H6UA 3HZKA 4ZQKA 3ZQXA 5BO0D 3MLWL 4IRJA 3AQZA 2DQJH 2LT9A 4G43B 3WFHA 2JB6B 3NCBB 1JZHA 1A6ZA 4JFFE 3DHPA 3ROOA 3DPDA 1SJMA 1PIFA 3DIVA 2AMUA 4OFQA 5CGBA 3K2MC 1MRFL 1YECL 4WFFE 1TEFA 4EXPX 2XQBL 4G3YH 2EXWD 3FTXA 3RUGE 4FG6D 5CCHE 3QBTB 3A22A 1KTBA 5DVPA 4OCRH 3VE0A 4M8VA 3V6OC 1JSYA 3UPAA 5CLWA 4KQ0A 4FL4C 1P1VA 4G43A 1MOEA 4U0RB 4RBPH 5TF1L 2NY2D 3QIUA 1T0OA 1G7JA 1VFUA 4F93B 1DBJL 1BPLB 1MCKA 2WLJA 3JTTA 4WJ5A 3S4SA 3UDWA 3IYLW 3WFBL 5FOBB 5I30L 1T0MA 2ZICA 3RVWD 1XSOA 4FQIH 4DWHA 5KVEL 4MAYA 5AAWA 5KUKA 3O6FC 5AVUB 1CB4A 2CO4A 2ENPA 2ZKMX 3ORJA 4AZUA 4DVBB 3BC9A 2K9FB 1JDCA 3FQNA 1MFMA 1AKPA 1NH6A 4MA3A 4ZOAA 3NP3A 4KUZH 2NY3B 4XPAH 2DY2A 1D5IH 4Z5RA 1XVSA 5ANMA 3ILPA 3AG2B 3DVNA 4J3XA 1T5WA 3FRUB 5CZKA 3JTTB 2BS71 4JLRA 1A65A 4JHAH 4WJ5B 5F7LB 2R0ZL 1BZEA 3N1MC 1DJYA 5LKNA 3V6ZB 1TT6A 2EH7L 4F7MB 3TVMA 1YC8A 3MRIB 5L6YH 4XPGL 2NCEA 3O3BA 5LDUA 4PLKC 2DM4A 3G5XA 3SBWC 2CRMA 1AP2B 3PHAA 4I0PB 4LSRH 4W9EC 1N8ZB 3AS1A 3HLAB 4QYOA 1CBVL 4DO5A 3WO4B 1VERA 2P5WE 1HI6B 4P3DB 3V5HA 3VJ6A 5KVMC 2L7UA 3TT1H 1DUYB 1HS6A 1VZHA 3MODL 4BQBA 4U3SB 2G0KA 2ZYHA 1L3WA 2CR3A 4XE0A 3TVMB 4OKDA 5AOZA 2IGFL 3FOLB 5DVNA 1QFUL 3CFJA 3WL9B 4FYRA 4G5ZL 2ZOOA 3LQAH 2WNGA 3ATDA 4JM0A 4ZMPA 4X6BA 1K4DB 3DX3A 2HLAB 1JF1A 3OPZL 2DDQH 4FFZA 4YNYB 3VJ6B 1T2XA 1J8KA 2DIEA 1ANUA 1PFOA 1Z9SA 3RVXD 5KOMC 5FCUH 1G1CA 3JVFC 1XSIA 3VFOA 3VQMA 3VNZA 1VGKA 1XMWA 4PD4J 4HZ1A 4PVNA 4R8WH 1EO7A 2IBGA 2ENSA 1G9NC 1MDTA 3IXAB 3BE1L 3P3SA 4KITB 1CU4H 5LAXB 3ARZA 5L8LB 4AYSA 4OZFA 3D87B 1RKRA 5IVXA 4HZLA 4IRZA 5MEPA 2R23B 4XB8A 5DUBA 1GOGA 3N0PB 2HRLA 4G72B 1YPZE 2V5RA 4MBOA 1DSFH 5KTEL 5DMKA 1HFUA 3NSJA 4PJ5A 3WIIH 4KTEL 4I2XB 1JI1A 5ESQA 3P9LB 4NKDB 3IDNA 1S7VA 1WFNA 4ADIA 4DGYH 2ZX5A 3E9TA 2J55A 4WGVB 5CCKH 4MCZA 1PDKB 2AXGB 2H9GA 2OTWB 3OKYA 3CFCL 4W9DC 2JXMB 3HE7B 5IOPA 5FDWB 1W8EA 5IVOA 3KLDA 4KHXH 3AU1B 2E7LC 2PPDA 4YO0A 3L4VA 2ZAIA 1CI5A 2PWFA 1BQSA 1TLMA 1GOHA 2XNAA 4K07A 5AENA 5JNYA 3MO1B 1XT5A 4R0LB 2AQ2A 4PJCE 3ULVF 4NX0A 3RQ3A 1XXFC 4DFHA 4PMEA 1A5FL 2Y72A 4ALAC 1R17A 1DBJH 5DD1L 1KEGH 2B3IA 2DBJA 1F56A 5LGKA 4ZYKA 1ITCA 3W37A 4BUQA 2YBRB 4FNSA 5DJ0A 3CSFA 3RWFA 1MFEH 3ENEA 3E6HA 1MIML 2EILB 1IBDA 3IU3B 5H37A 4LHUG 5AUMB 2PYEA 5FECA 1IX2A 1VENA 3C60A 3CDZA 5T1MB 3U7YL 1G4MA 4ONHB 5BRZE 4HUWB 4M5ZL 5HYFA 4NN6C 4Q2ZB 3MLRH 4JHVA 4B6ZA 1X5IA 4AI7A 5A2KH 1WFUA 3N1FC 3V55A 1S7RA 2QMJA 1GYVA 1EHKB 4GSDL 4FFYH 1IILE 2ZSWA 4TLSA 1G6VK 1RI8A 1CDYA 3BPLC 3NJXA 1MIEL 1KY6A 2PCYA 3TF7C 5DHEA 4NQVB 1NFIB 4AH2B 4JK0D 2H8PA 5E2WL 2X4SB 4PRHA 1WZKA 2QPFA 2WHVA 4IOFD 5MHSD 4YEFA 5CCKL 4X9IA 1Z9OA 1I9JH 3LQZB 3B8SA 2I9LA 4PVMA 5AQ0A 4XN2A 1A4JB 1BVLA 4G42B 1F97A 3GSXB 2YEZB 4MDJA 4GXUN 4JG1L 5K39B 1RUPL 3LKRB 2IPTL 2Y07L 1KJ2A 2ADIB 4PWJA 3UROR 1A47A 5DJAB 4FLRA 3FUMA 4XBMA 4AENA 1K85A 1A66A 4RMVA 3FB8B 4YIQB 1ZT4B 4MZ2A 2BCMA 1N12A 4LOEA 6FABH 1EMTL 3HI1B 3WNPA 3WJJA 5GZOA 1I9RL 2WGNB 1AIZA 2CCVA 1KCSH 2GKIA 5T1LA 3ZE0E 4M93C 3J8F7 5BV7H 1I31A 2YBGA 3MJ6A 5SWZB 2B4CC 2Y1AA 4RCAA 3IRPX 1CF1A 3JTBA 1MLCA 5H37G 4JFVA 4POZC 1V3LA 1V7NL 5KN5A 4GSRA 5FF6A 3BZEA 2WVTA 9CGTA 4HAFA 5IB2B 4Z7NE 4M3HA 2V5TA 2D73A 4HS3B 3LRSA 1OKEA 2Z31A 3HB3B 1BZOA 5DLMH 5F7MC 5FM8A 3HZVB 4UNVA 3KWTA 3MV9D 3HAEA 5EU3A 4KKNA 3H7LA 3L5JA 3CSYB 3MLTB 1E4HA 1PQZB 2VT0A 4XRCA 4APQA 3ARUA 3OF6D 5IVXE 2Y24A 3MLSH 1ZGLM 2Z3FA 4P2OB 4WKZB 4DTGH 1CLZH 1GY1A 3M7OA 1OAZL 5FYKU 1E4XI 4FYSA 3G6AB 4ZZKA 4HIIA 4P2QB 4FQ1H 2BNQA 4QCIB 2P5EA 1SXCA 4BKLA 3KBFA 5IP4A 5IB5B 2Z9TA 1A5FH 3BSGA 4FNQA 4OCNC 4F8PA 3RL2B 1KEGL 3Q6GL 5EZOH 4LSTL 1G0DA 3II3A 2PYED 2BDNL 2VRQA 4A04A 4M6NH 2R4RL 1ILSA 1MWOA 4WGKA 2UVEA 1H3TA 3S7GA 3WIFA 5JYMA 1DEEB 4WNSA 4TTGA 1JHTA 1FFTB 5I6XB 2MQGA 2RCSL 3IKKA 2WLZA 1ZT7A 1Z6JT 1S7QB 3VMNA 4AQ1C 3LN5B 3FFCA 5I28A 3IPEA 4XXCA 2I32A 3S5LG 3HE6C 1C8QA 1DVFC 2AV7A 4QHPA 4A63A 4ZX6A 5A2AA 4KKQA 3E8UL 1BLNA 4N0UB 3MCLL 4G8IB 2NYKA 2OM5A 1DUZA 4NT6A 4XC1L 1T7XA 3N04A 1N64L 3CLEL 4UAOB 1OTUD 4PJGE 2ALAA 4OAWB 5AW9B 4P9HH 1NA8A 3MJWA 4Y4KC 4MSWA 1DO5A 4PR5B 2OZ4H 3SKJL 2IQ9H 5CGTA 1DQLH 1G7IB 1HEZB 3N9GH 2Q10A 2KS0A 5KVGL 4QR7A 1LQBC 2E9JA 4Y16D 3BKCH 1TG8A 1IGFL 1MNUL 5FKAA 3CXHJ 1E9PA 3GMPB 2X2IA 3B2PA 1OF2B 1IGIH 3D69A 1EANA 4MVBD 2B8OT 4QKXB 1TFHA 4TQIA 5CEZH 4PJIB 1TZOA 2WGXA 3VDCA 3HAEG 5C0CA 4XMLH 2FBJL 2FHFA 4ZMLA 3DRTB 3OHXB 3WKPA 3DHMA 3MBXH 3DURA 4A7UA 5LGJB 1H3VA 4KI5D 3BD4A 3BKMH 4PGZA 3MRNB 4M02A 3MRRA 4WI4A 3UYPA 3V9EA 1CICB 3BCDA 3POHA 1F6LL 4KUZL 1KJ2L 4MASA 1CL7H 4G59C 1P53A 1TO5A 2F1AA 4RX4A 3SJVE 4AE1A 2VO8A 2E9BA 2BRQA 3MUGA 2JCCA 3O41B 1BZ9A 4IW4C 3K8MA 3WUWG 4V1DE 4PRPB 3CFBB 3FQTA 3GK8H 1ET5A 3MV8D 3MUUA 2X89D 1K4CA 4M7KL 3QPXH 3RVXC 1I1AD 1BP3B 1MI5A 5E8OA 2RJMA 2OTUB 2G3NA 3ZQWA 3MKKA 5GRZA 2A9NL 4U1GB 5E4EC 5AB1A 2DKSA 3DV6B 4F8OA 1PZ5A 5HHXL 3BUIA 3KH4A 3OKDB 4PJAA 1J05A 3QUYA 4M5YH 5F7EL 3OKLB 5AVWB 4JQXA 5BQDA 3CC1A 1QBBA 3LNFA 3FL7A 2NRDA 3MRJB 2ZG1A 4FNRA 3A6OA 4O2EA 5B7MA 5GS0D 1U8QB 5IF0B 3QG6A 1P1ZA 4PRBA 1HILA 1YEEH 1NIBA 4MDRA 1T21A 5CEYA 1T83C 5IHZA 4JQVC 2C9PA 1KPRA 1IGYA 1W15A 1WZLA 1DANU 3U0TB 1TQSA 5E7FA 4KAQH 1I4FB 5DJXA 1IFGA 3FTUA 1DVFB 3ULSA 5GGTL 3BGMB 3O6KH 4S1SH 1OGTB 2Q8AL 1USQA 3MV7A 5ADOL 3WN5A 3BZ4A 3PL6B 4NDMA 3T09A 1ORSB 4YR6A 4OZIF 4ZS6D 3VA2C 2YEVB 3V0VB 4JN2B 4AIXA 2HMIC 4F9PA 1OTSD 3BWUF 2X2YA 3RL2A 5DZ9A 5I5RA 1VKXA 2WWNA 1J9SA 3EGDA 3HC3L 1GY2A 4OCXH 2HT2C 3OSKA 4E41D 4YXKL 4EMZA 4LARH 4QEGA 1GS8A 5GJSL 1O6SA 1WCBB 4ETQB 1KJ2H 5FO8B 4UM8A 1LNUA 3N2JA 2FB4L 4GW1B 4X6FA 4EI5D 4NZRL 1M05A 5FYLL 4CSZA 5ADPH 1U30A 2B1HH 4U1SB 3IPBA 3V7AG 5IMOB 4NQXB 1UXSA 5EHFA 1G7MA 1LILA 4DGIL 2OYLA 2GSGA 1MXGA 4NQQA 2DQMA 5TQ0H 3X3FL 4JFDE 1ECZA 1BIHA 1CICD 3PE9A 4YBHA 5L2JA 3V4VA 3TO2B 3BQUD 1W72L 4IMLA 1S4IA 3MUJA 3VCLA 3P9MA 4B7IA 4L5FL 5CHNB 1EFXB 1GGIL 4MMXC 5KSBB 4J3BA 4BH7B 3QJTB 5AW7B 2J72A 3QT2A 4XCYA 3CBKB 5EU6D 2P9RA 2QV2A 2QLYA 1XO8A 2XWRA 3K6DA 4WTZG 1JMXA 3VWJA 5FLVA 2BSEA 3LRGA 1MRFH 1RCYA 3D2TA 5K9OA 4GT7A 1ACXA 1SJEA 2EEDA 4R26H 4WWKA 5EB9A 5FCSH 3FQUB 1YNKH 1PKQB 1UWGH 4LVNC 4MB1A 5F96L 2WQVA 4DIXA 1PLGL 1UT1A 1XH3B 3KCPA 1Y6KR 3V0FA 4NFCA 5MP6H 4A6YH 1SXZA 3DX7A 2YUZA 4Y8AA 1W16A 4M48L 4XH2A 4QKTA 5A2FA 3INUL 4C58B 1AGCB 1FVCA 2GQHA 2WO3B 1S8DA 4HUMB 5I1CL 2PTUA 1EEZA 3AB0B 4RIRA 2BK8A 4UUJA 1JPEA 4NWTL 3OBAA 1EIBA 2JB6A 1T66D 1IZJA 1Y6NR 2DKUA 1I85A 5DQDH 5DSCB 4JO2H 4QNPE 3QFJB 1AOZA 3GXIA 4NRZA 1JMZA 4RWYL 5BVPL 3ULVC 1IEBB 2FK9A 4NHUA 1RUML 1Q72L 3TLRA 2JJUA 2ZZUT 4FJZA 4ONGL 2G0LA 2NNAB 1NEZA 3DMMB 4JCMA 1SLUA 4OZFB 5ESVB 5IVXB 4P07A 3TCLB 3S96B 4GW5A 4PIRF 2UZYA 2IDTA 2WN3A 5B8CB 1WHPA 1AO7A 4A2EA 2IBBA 1M42A 4KDTC 3VD0A 3TZVD 2PXYD 4H20L 3NSYA 4PS8A 3ZIYA 3SCMA 1E4WL 4MQTB 1KB9K 2RIKA 4KY1H 2X4NA 4UZSA 3N42B 3PQYA 4GKZB 4QGYA 2FLBT 4QXVA 1ASPA 5IF0A 4LQ1A 3BRFA 4WUKL 4JFUA 2UXFA 3KLLA 4OGAD 4BFRA 4LSQH 5IHWA 5AOIA 1MCEA 3U4AA 4L8BB 4LPYA 4HP5A 4YOKA 5AAWC 1XGRB 3NSCA 3KXFA 5GSVB 3NCYP 4NQCD 1ZK5A 3AU1A 2QFPA 3TJPA 1DLHA 3ZMRA 4ZK8A 3WIIL 4Q14A 3ZR5A 1QWHA 3F65A 5AB9A 2DWEB 2HN7A 4XBEL 2BERA 5FWQA 4IOIB 1U8CB 4KJYA 2VZTA 3LVEA 1E6OH 2FYVA 3TFBA 2Q20A 3E8VA 4L37A 3WJLA 2XZQL 3KBEA 5EU5A 1B9ZA 3ETSA 2I5YH 3GSUB 4ZMWA 2PR4H 1AC0A 2E59A 4Y9CA 4YL9A 3AM8A 2VUYA 3MV9E 2UWEF 4K3HA 1R9FA 5E2VL 4KJWD 1DYZA 3FUEA 4ZFGL 1FF5A 2NY0C 3EZJB 3F84A 2XZZA 1MUJB 2X2JA 3RTQD 1I8UA 2OJZH 4U1SA 1LK3H 2QHRL 3QJHB 1IL1B 3CLWA 4N0YL 4X6CB 3H7BB 1F11A 3I9AA 2VOTA 1ZJBA 4LDEB 4UT7H 1OSPH 4K2UH 1Q0XH 1IAIH 5DHVA 1JXDA 3JWNE 3FOMB 4QOKA 4N24A 4N2OA 4OGZA 4EEEA 1ADQA 2J8HA 35C8H 1JXJA 4PCKA 1LO2L 3GBMH 3WDJA 4DN4L 3ESUF 4PJFE 1YLBB 5C7ZA 4H8PA 4ECNA 4L8DB 2EP6A 4XP1L 2F5AL 3HI5L 2OSXA 3NQKA 4DVBA 2FTAA 2ZXWB 4XCYB 5DWPA 3ERXA 4FADA 4XMUA 3GSNB 1MFDH 3MX0A 3OF6A 4JY6B 3BAIA 1TCRB 1CFMA 1WIUA 1K8DB 2YPKA 3QHFL 5A2CA 2ICEA 2JIXA 2AKRB 4WWKB 3LSOA 4G8FA 1OPGH 1I3RA 3PCYA 1I9IH 1F18A 4JB9L 4FN0A 1J8HD 1MCIA 4XTRD 5DZJA 2PPEA 1I1RA 1T22A 2O1AA 2FX7H 1YN6B 2ILLA 2VO5A 4NM4L 3VAEA 3LH2L 3NCEB 5B38A 1FFOA 2ZX7A 3SOBL 2EKJA 2VSCA 5FGCB 3RFZB 1AGCA 1MRCH 3FU7B 2RBLA 4YSSA 2J5LC 4E9WA 2WLLA 2VXUH 5E0QA 4HBQA 1G9ML 4X5XA 1T2JA 1RZQA 3QIUD 1RURL 4OZGF 5GGUB 4CC0A 4ZW8A 2F53E 3KPRA 1A8ZA 3KHQA 3WDHA 4ODBD 3ULUL 2IANB 1KXHA 4OIBA 4R83A 1RPUA 4KGLA 4DW2L 2VNCA 4ZFOA 1N68A 2ADYA 3C8KA 4TNGA 1DR9A 2MNUA 3LQMA 1E42A 4JFEA 3EXJA 4A55A 3UTOA 5JW5B 4OU3A 2F68X 5TF1H 2C3WA 3V4VH 1EEYA 2AEQH 1THCA 2BNQE 4J3TA 1DFBL 3CUPB 4NQDE 4ELME 4X0KA 3O2DA 2UZYB 4UDUB 5EBGA 2HX9A 5EZJB 4CC4A 4KU1A 1M7DB 1P9MC 5B3JE 4I2XE 4UINL 1HHHB 1JPFB 1FG9C 4O58L 5CZVL 1BWMA 4JVWA 3I2CH 5KYWB 4UZUA 2Y5QA 4QT5A 4UQCA 1QACA 4IBLT 2Q6WA 1JHLH 1E67A 4CC4C 5IGXH 2HKFL 3E9UA 2R4RH 3MOQA 5FS5A 1DVSA 5C0EA 5BRQA 5F7WC 3M8OL 3O81A 4C56E 5DFWH 2BVQB 2KBGA 3PDDA 4L3EB 3C6LB 2Y07H 1AO7D 2PMZA 3OKOA 5F1NA 1XR9B 3JUZA 1AQDB 1NCIA 2APBA 1OM3H 2RQ8A 3C87A 4WFHD 2MKWA 4J3SA 3U0PB 4R2GB 1IC4H 2P8MB 1NGPH 5K9KA 2LABA 3BP6B 1A8JH 1QD0A 3EF7A 3WENA 4Q74A 1Q9OA 4QTFA 3WIFB 3MXVH 1BLIA 4AT6A 4ATTA 1CN4A 3Q13A 5C0ND 4DKAA 2OYKA 2NY0B 1NCDL 2A9CA 3JV4A 4PY8I 5C2BL 3KL3A 4XMZA 3FQYA 3DC0A 1KB5B 2PCPB 3GSQA 4LGRB 1NFDA 4L3FA 1QFUH 3WOVA 5GZOD 3QJZA 3QDGB 4ELKB 5F0PB 1H3WM 1ZE3H 2BVPB 4GG6E 5IG7B 4RMTA 5K39A 1AACA 4KX9A 3U7WL 2FX9L 2OMVB 4K3GA 1JPGB 4M3JA 3FAXA 3QDJD 3MSPA 1TCMA 2ITFA 4FFVD 2JIXD 3NACH 3CFEA 3D8MA 1T4KB 1NDMA 2XVGA 2R4SH 1QYGL 4GG8B 4I48B 4MQXC 4E0RB 4KROC 3LPFA 3P11L 3IEAA 2B59A 2J73A 1B3IA 3FCGA 2X4QB 2IJ0C 5H2BA 2CO1A 3UZQB 4AQEB 1WZMA 4Q6IC 4S0HA 2VLKD 4PJAE 1AGDB 4BZYA 2MHAA 2ZSVA 1XEDA 1NSNL 4HXBL 1TZAA 2W38A 5GZOC 1I8MB 4N90E 5T5NF 3WXWH 3T0EB 3GNMH 5FYKD 5C1MB 3T0WA 5CN2A 1FNGB 5DXWA 4JG0H 2FT8A 4M3KB 1BJMA 5CJXC 4PJFA 4NFBA 3N42F 1FYTD 2RCSH 3K1DA 3RKPA 1JFQH 1XCQA 1HE7A 4ILDA 2I24N 5BMFH 5DJCA 3ZL4H 5JW4Q 5IJVB 5F2FA 4MA1B 3L3IB 5DS8A 1NCNA 5F7EH 5I76A 1BZ9B 1H8OA 1W72H 4QF1A 1ZHBB 2DBLL 5CMAA 3KLKA 5D7IE 4MJJA 4HS6B 3D12B 4IBUA 1FHNA 3ZHLA 2EIBA 2DS4A 4PG9A 1CDIA 2IADB 2LLGA 4CVZB 3K5RA 1L0QA 3VD9A 4P9HC 3CVHA 3CV5A 3QUXA 4FFWC 4K7FB 4RH4A 4D8PB 4JRXD 1JHKL 3S37H 3J27A 1I8AA 4FNUA 3IGAB 1KCKA 4K94L 1BD2B 4K9EC 5E95B 5BJTA 2R69H 4QF1B 2J1KA 3MCG1 4AGQA 2FX8L 4PV8B 3TBTB 4HJJL 1I53A 3IXTA 4JQIA 1TTAA 1UFGA 4XCEB 2R83A 2VDKH 1JVKA 2GJ6D 1YY8A 2HKHL 3GS4A 5TQ2H 2Y06H 4LLUB 3QG6B 4AQOA 5D2LE 3U9PH 1P7KA 2CO3A 2PO6D 5FCUL 5MI0C 2IADA 4CVZA 1NDTA 4KXDA 4GKSB 3THML 2VDOL 3HNTL 4WJG3 2D3LA 5GGTA 3A23A 1A3ZA 1KC5L 1OAKH 4IMKA 2H8PB 1ID2A 3HPLB 2OMWB 4UMGA 3Q06A 5T1KD 1J0HA 1JVLA 4K9EH 1HKLL 1WVZA 3BEWA 1BV8A 4HS3A 2VWEC 1NFKA 3LOWA 4JPKL 2R9HD 3MRLB 1DN0B 2OMZB 2HZHA 2ZF8A 5DD3L 1LO5B 4M7LL 1T6BX 5AVRB 2Q7NA 3GGWA 2QMKA 1CE6B 1QFOA 3CN1A 1KB5L 4I5BA 5I8OH 5FA3B 4BFEA 5C0RH 5ISZB 2RFXB 1KPUA 2BZ7A 3CIAA 3HAEH 2BPBA 2VLRE 2ZE0A 5T3XH 3VGBA 1QLEB 5IQ9B 3D69B 3O3DA 3SODB 1W72B 2VMJA 5DQ9A 1I7TB 1RULL 2ESVB 4QJ4B 5CSZB 4PB9L 2VTFA 4AZ8A 4ZNEA 3SDAC 4E41B 2OXGB 3OVUB 2EIZB 2Y1ZA 5ENWB 3PIQB 3F3HA 4I0PC 3SPHA 3KPQA 5A2JH 2NX5E 5GHWH 1ODAA 2V17H 4NZUH 2CRYA 2VSMB 1UXMA 1A7NL 5E1QA 4MQ7A 1UB5A 2B2XH 4KQ3L 4N0UE 3ULVE 5E1HB 1YYCA 2V3DA 4PJBE 1D7BA 3VFVA 5FF6B 3BZEB 3DXAE 5E51A 2I9LB 2XG4B 1CVRA 1UM6L 4PRPA 5IT2H 3UTTE 2X38A 4UT9L 4S1SL 1U91B 1OAUH 3VXRB 3WMSA 4Y9EA 4X6DA 1LE9B 5T3ZE 5I0DA 5IW1A 3BSZH 3W82A 1EXUA 5AAMC 4J27A 4MTMA 3QO1B 4OAWA 1EUUA 4FXKA 4JGMA 5CJBA 5C09D 3RX9A 3BVNA 1C08B 1OV8A 4LPTA 4EO5A 3HC4L 1YEHH 2XWJB 5EUOF 1DVQA 1QRNA 4P3CH 1HEZA 5I1DB 1JFQL 1LO4L 4K7PX 4J7RA 4X7SH 4XVJL 5KBMA 2GITB 5ICYB 4TUOA 3CVCA 3QRGL 3KYMB 1A3QA 3M6DA 4HIIB 2V3EA 32C2A 2XPGB 5IROD 2XN2A 5E6UB 1T21B 1IAII 1MJ8L 5J1TC 3GTNA 1S7VB 5GRJH 4RFOH 1BJ8A 3QUXD 3GYRA 3NJIA 4WNJA 1U8NB 3FK3A 2K1MA 3D5OF 5MEND 4GBXC 4MXVE 1GL4B 2OMXA 1QWNA 2RHEA 4HV8B 1D5BB 1KYOJ 1JYXA 5D7JB 1NIFA 1BQ5A 3LRSB 5KYUA 4QOKD 4H25B 2JJWA 1GH7A 3HNVH 4YSDA 5E4EB 1A7QH 3VXTA 1CIDA 3SKMB 3SDXB 4PI0A 4QXGL 2ARWA 2EDWA 2BCKB 3QXAB 4HEME 5C3LD 1CUOA 4JKPH 4LOVA 2UWEB 4Q6YA 3HHMA 4L9BA 1Q1JL 1PJWA 4ZSOB 1GKOA 3ARSA 5LGHH 4JFYB 2VC2H 1HKFA 4N9GB 3V0EA 3JT2A 3ZVVA 4JQVA 2WC7A 2ZTBA 2V8LA 2YBRA 2ZXGA 5DJ0B 4HJEA 2EDDA 2KMWA 2O6FA 2DJMA 4TUJB 4YGAB 2XA3A 1E4XL 3F6JA 3CX5J 4FQ1L 4LLDB 5HGDB 1NCTA 5BZXA 1F4WL 4QIRA 4Y16B 1YMMD 4H40A 1R3JB 1QSEB 3EYOA 1UCBH 2HT3D 4LLVB 3FF8A 2BS8A 2VW7A 4URKA 4JCLA 3UJIL 2ZJSL 4DK3A 1BZQK 4F9PC 4I0CC 4MAYB 3WJMA 1CQKA 2H3NA 4QRTA 1BQLL 3GFUA 3C9NA 4IS6B 4RRPG 3L1EA 3B37A 2QVMA 4WUUA 4B9GA 1J11A 4XC3H 2LQRA 1SNRA 3VI4E 4X0NA 4B7LA 4NZTH 3MRCB 4HLZG 1WLHA 2ERJB 5DJ2A 4EZKA 4I3GA 2Q2LA 4MXQD 3ZSSA 2X4PA 4P4KC 4G8GD 1MJ8H 5JIMA 3IGKA 2YD7A 3MVSA 1NOLA 3QZOA 5FHBL 4F7MA 4WW1B 1KIQB 5TPWH 2XHNA 4YHPA 2IH3A 1SDDB 3FU5A 3TT1L 1RIVL 1T0PB 2H0JA 3NFNA 3SE8H 2COVD 4ACPA 4BRJA 3U0WH 3QPQD 2OMYB 4HJ0D 1L5GA 2IQAB 2H1PL 1KT2A 4QTHA 3QC5X 3FCSA 4HJUA 4WU5B 3T3PB 4PGDB 1CXFA 5IJDC 2X9YA 4UAHA 5GIRA 2ZOWA 1CYXA 3Q6GH 5EZOL 3W0WE 2OYMA 5A2LH 3RYMA 5LDSA 2W0FB 2MQCA 2DQTL 4I4WB 4Z0BH 3RP1A 3VD5A 3NJGA 3T5WA 1WISA 1TNMA 5I71C 1AMXA 1KB5H 3BP5A 3BRGC 4IHOB 3KPMB 1JGUL 3TFKD 1NEZB 2GG1A 4JDZA 5CAYB 5HP5A 4JFHE 3N43B 3CLFL 3WEOA 4JZJA 4J3OD 1BQHB 1BQKA 2FQEA 1EHLH 2A6JA 4KZCA 4TLTA 5CHNA 2R0LH 1JN6B 2CHDA 1E50A 3FB7B 4R4BB 4U1HB 2ZWSA 3IK2A 2JE8A 1VGKB 3RILA 3LVTA 4D0CA 4AC4A 2KPNA 3RDJA 2BSSA 4P23A 5L2KA 2Y22A 3PL6D 4PJHA 4PJ9C 3CC5A 3UTTA 2H3KA 1CGWA 1DP0A 1M9WA 1PD6A 1M1SA 1A7RH 3GZOA 3HZVA 2YD0A 1G9EA 1J1XH 3MLXH 3QQ4B 4JPWL 4NQED 4RMBA 1A6AA 3KXFB 5GSVA 2A9ML 4L3EE 1C12B 4IRZL 3HB3C 3QUXC 2HA1A 1HNFA 3H9HA 2HPOA 5GGRA 4OFKA 4P23B 1GRWA 3TP4A 5L2KB 1GIGL 1U8CA 2UXGA 3BGFC 4KJYB 1MW0A 2EQDA 2CJTA 1FQ9C 1N0XL 4JFTA 1A21A 1KTDB 5AYUH 3LZFL 2QADD 1YNTB 4ISVA 5K1NA 1YNLL 2DQUH 3A4AA 3CMOL 4L8SA 2ATPA 5GQBA 3BGFB 1NBCA 3QQ4A 1IVLA 4QRFA 1GCFA 2X3BA 4EZLA 3HPJB 1ZJAA 3WFEL 2FCBA 2XZCH 1OGAB 1BGXL 2BMKA 2QJDA 4OZHE 3AM8C 4OM1H 4YXLH 2NNAA 4PP2A 3MXVL 3WS6C 3DX8A 5KYXB 5ILTH 2XKNA 3ZDZE 3B1UA 3B7YA 2AFNA 2EDBA 4NBXB 1OEZW 4PS3A 3TN0B 4WEEA 1OAQH 1PZUB 4BDVA 4FG2A 3QGVA 4PJ7B 2NW2A 4KHTH 2BOLA 3GBEA 1JV5B 3P73B 3SJVD 3F6LA 3FHAA 4XMPL 3ZKND 1EHLL 4MB5A 3IMTA 4DPRA 1FZMA 1YEFH 3KJ6H 5IEKB 1YUKB 1NQBA 4L9LC 2BS9A 4L8DA 3C5JB 5CLXA 4GSDH 2HX7A 3M8OH 3O3BB 2Y5TB 5D7LA 1AD0A 2XRAL 3JWOL 2DQIH 2N7BA 2YD4A 4X7TA 1BHGA 4HKJB 3VA6A 3PV7A 5I5MA 1MJJA 3V5HB 2O61A 1EEZB 2BP8B 3MV11 3ARDB 4Y7OC 3S35H 3EJTA 3V0DA 3B9DA 4IMLB 3CDYA 4IOIA 5J12B 2AQRA 3WYRA 4NQEA 4CAGA 2VR4A 4BSWB 5KVFE 5FEBA 1E5BA 5I73B 1Z0NA 2VITB 4TM9A 4A7VA 1FFOB 4NNXB 4WVRA 2Z35A 4H1LB 4XPFH 1CJYA 2R1XA 4ZBJA 3SPIA 4ZO7A 5CINL 5EN3A 1ZD6A 4X6BB 4C4UA 1KT2B 5DD0L 4N28A 2IPTH 2VE6B 1I8KA 3QH3A 5D7HA 1A6TA 4OLWH 4X5XB 4XBEH 2R69A 1UWGL 2J5LB 1J0YA 4IJ3B 1QEWA 1HCFX 1WE5A 4JKPL 4QLRA 5GGVL 1YQVH 4B5ZA 1OGAE 4N6RA 4XH2B 4MZ3A 5D1XB 5EO1B 4JFEB 5ABDE 4NFDA 3KM2A 4U1JA 5FUOL 1RXLA 1N8ZA 2NLJA 3HLAA 2BY3A 3ILDA 3NRPA 4DFIA 4F7CB 1DZ0A 5A3ID 4P5KB 4Y9BA 1AMYA 5B3NA 4YDIL 1NOAA 2O6CA 5I1CH 4PG2C 4POYA 3RWHA 5AKTA 1AY1H 1QMUA 5TDOB 2AS5M 1L9RA 4JNXA 4PPTA 4LSTH 3PWPE 3BD5A 2NTSP 3EH5B 3V9CA 4D94A 4TSCH 4GSQA 3PDOA 2JKLA 3QUHA 1A4CA 2Y69B 5EU6A 4JQXC 2ZCHH 4AQAA 3TCLA 4XC3L 3EJCA 4PWKA 5IWLC 1JZ4A 3KDMA 4NUQA 5ANMB 3BCFA 2DJ4A 2VMEA 3NJLA 1LWJA 1AHKA 3I74A 1NUFA 1INDH 4X7FC 5ABZA 1QABA 4IBZA 1BXAA 2H2PD 4KXAA 1QW8A 2WIIA 5E9DD 4RGOH 3IPFA 5FYKL 2ARJB 2IPKA 3QUZD 2HRPH 1NBZB 3SGKA 3V7MA 5D55A 3INUH 2L04A 2NXYC 5DA4A 3SGJC 1J0ZA 4FZ8H 4GQZA 5DD0H 5C0GB 1AR2A 1C5CH 3ZU8A 1N6QL 1XGRA 4AYBA 4HC1A 2F7IA 2GBVA 4Z7OF 4ATWA 1FL3B 1CXLA 1PJ9A 2R2BA 2IXQA 1UKQA 4J23A 3WTXA 1Z66A 4CDHA 1GGBL 1X5LA 2DQFA 3Q8CA 5F71A 5TK4A 4N8UA 4R5XA 3F2LA 1JK8A 2CUHA 4XVSH 2YQ3A 2H6OA 2F19H 4GO8A 4FOMA 3EJSA 1FV1B 1M71B 1WD9A 1MVFA 5HHXH 2HSIA 4TQPA 4XWOD 3HRZC 4HUVB 3QI9B 1A6UL 1JK9B 3T6QC 1S7QA 1U3YA 3LY6A 3CQPA 1RJYA 3DIFA 5CP7A 4OI9A 1LO5A 4YSUA 1MQKL 1DSFL 3A24A 1P84J 4N22A 3QUKB 1RSYA 4PLKD 3UO1L 1EO8H 2YPLE 3CDGB 2KZKA 4FCAA 4AYID 1EK3A 3S3BB 3C5ZD 2VR6A 4Z8FH 4OCSL 3QC6X 3BQUA 4PMFA 1QP1A 2HRGA 4KVNH 1VGEH 2X10A 4Q6IA 2AITA 2CIKA 5T8IA 1UYWL 2SEBB 2ZCKL 4JPKH 4AZ8B 3QFDB 1E5AA 4NPJA 4RSYA 1VGEL 4FMKA 3RWGB 1XH3A 1T3FA 2QQLL 1G7HB 2P8PA 4NKIL 1HL4A 3BVWA 4A7GA 3AFLA 3PP4H 5JOFB 2Q9OA 1K6QL 3VWJD 2PCXA 5HXMA 4LBAA 1RMFH 2AJUL 2CGYA 1PG7X 3F7QA 5CJXA 4NLAA 4F37F 2A9NH 1FVCB 1RZKC 4UBDC 5IJVA 4LP8A 1RZPA 1DJIA 1ZOXA 2XQYA 3AREC 3MBEA 1WFOA 3GTTA 5HHOD 5CD5C 3KVQA 2XG4A 4YQXH 3GXPA 1IC5L 1AGFB 3TWCL 4F92B 1QEXA 3HUJA 3COOA 5GRVK 5KSAD 4ZD3L 3TBWA 1KYAA 4FFWD 4KMLB 4BKSC 3QORD 1KBGL 1V7ML 3SGDI 1XF2A 1RIHL 4IBTA 1TZHB 2WB7A 1P7HL 3IVKA 2RALA 1Q9LA 4DUXA 1D9KC 4NUJA 3VWKB 1GGBH 3L4UA 3N9GL 1XBDA 1M7XA 4IIQA 1MWAL 1Z32X 3TXAA 2PP7A 1A6WL 4X99B 3UJJL 2UZIH 3SIKA 2YARA 4OF7A 4G7VH 3VWKC 5I1DA 1CFNB 4OZHF 2WNKA 4CU8A 4ZXBC 2LLLA 1AGBA 3FQRB 1CK0L 3UZQA 4AQEA 2Z7YA 4DF9A 4XVUC 3NPZB 1OAUL 4R5VA 4LLUA 4C4KT 4J2XA 3R06A 2IDSA 3IMSA 1YN7A 3CAFA 4OTXH 3UBXA 5TQ2L 3NACL 5JQ6L 1DTUA 4FQXD 5DDHA 2WQUA 1R5WA 4FTDA 4UV4H 3W38A 1D2OA 4CJ1A 5IEHB 4QJ3B 2V2WA 3O8XA 4C56B 2Z65C 3QP3A 4N1HB 2ENJA 1C5DA 5E6ID 5HVWA 2CSPA 5C0IA 4D9RD 3QEQB 4LASL 3UC2A 4AYDC 5CKAA 4GUCA 3X3FH 1O7VA 5HDLA 2QKIB 1A0QH 3GGWB 2V33A 2X4RA 3LN4A 5AB0A 4EKJA 3SE6A 2ARJA 3JQOB 1ET8A 4YH6A 3BIKB 1SXAA 1JWMA 5IHBA 2IF7A 5E1IA 1I82A 2WZPA 5CFHA 2A0LD 1JZGA 2Q2EB 1F5WA 5AW1B 3LXUX 2ISDA 2HFGL 5ALBL 1LEGA 2VXSH 4EN2A 2VXTH 3HE7A 4PJ8D 3WJLC 5IOPB 2B0SL 1ZV2A 3OR7A 3PP3H 2PLTA 5BVJB 1RLWA 4OZGE 4JN2A 2OXGA 5JIKA 1PGRB 1R3LB 5CJOH 1BYPA 1A6VH 2CHWA 3NESA 1MPAL 5FYJD 3KPNA 5KAQF 4HU2A 2C1PA 3TT3L 1XZWA 2D8KA 2YGNA 4MMYA 4W6YB 5EBLA 5AW4B 7FABL 4AJVA 1BZDA 2ZXDA 4UM8B 3KPSE 3IXTB 5DZNA 3IFOA 2PCFA 2X1PA 4RMUA 5IB1A 1CXHA 4PJDA 3ABZA 1UGKA 2H0EA 3GBDA 1K5NB 3F58H 2P5EB 4OLZL 4PRID 4X42A 1KB5A 4HKBB 3ULUD 5T1MA 4PV1C 5CZVH 5K5YA 3WAKA 3ZDXE 3KPNB 3MNWB 4H5SA 3WTYA 3Q5TA 4JZNA 1UCBL 2XDHA 1L0XA 4DKDC 2NY0D 3WN6A 3QZWA 3IFLL 4HZAA 4LLWA 1AC6A 2SEBA 5AL0A 2P5WD 3QISA 2EDTA 4LBEB 1O6TA 2GPZA 5HJ3B 3VQLA 4HH9B 4AEEA 4KNSA 2DWDA 2XWCA 4ZW7A 43CAA 1JIBA 4MX7A 4FXKC 4D8OA 1G7HA 3C08L 4ZW3A 4DNLA 3HA0A 2XN9D 5HHOE 3HMWL 4AMKH 1WO2A 4F7TB 4QHLA 3AWFA 2YS4A 1XH1A 1N5YH 1E27B 1F90H 1OSEA 2HMID 1JG9A 4ERSL 5KEZA 3VW3L 1IGCL 2ZNWA 4LFHG 2O26U 4JFED 1QZNA 4YX2L 5IROC 3O11A 1NCGA 1SN0A 4PR5A