1ZRUA

Structure of the lactophage p2 receptor binding protein in complex with glycerol
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
263
structure length
253
Chain Sequence
TIKNFTFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lactophage p2 receptor binding protein
publication title Receptor-binding protein of Lactococcus lactis phages: identification and characterization of the saccharide receptor-binding site.
pubmed doi rcsb
source organism Lactococcus lactis phage p2
molecule tags Viral protein
total genus 57
structure length 253
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zruA02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 1zruA01
2X53A 4RGGA 4L97A 3DA0A 4HEMA 3EJCA 4IOSA 4L92A 1ZRUA 4L99A 2WZPA 2BSEA 2BSDA 4HEPA 4RGAA 3U6XA 3HG0A 2F0CA 3D8MA 4L9BA
chains in the Genus database with same CATH superfamily
1BXUA 4G5ZL 4BKLB 1KWKA 3VGAB 3H7BA 2AFNA 4JPVL 4NJAL 5I26A 1DSWA 1ZLUK 1D7BA 2WINB 4QF1A 3F64A 3CFIC 3ULVF 5IVXE 3CH1B 4G8GB 4PJFE 3S3BB 2BWDA 4ZFZB 3L7FB 4KOBA 3I6KA 4ODBD 4GKZA 1HKLH 1NLBH 2W07B 5HDQH 5LAXA 3WU1A 3T0XA 3JWNC 3VXRA 2FD6H 1AH1A 2IBZX 3BKJL 4QO1B 3L1GA 2P8LA 2XV2A 5DJ6A 2X9XA 1O9VA 1XGRA 3MA9L 3KWUA 1E8YA 3PE9A 3TVMC 3VI4E 2C3VA 4N26A 1KFAH 4JKWA 4KHTL 4Z5RB 3LV3B 2JXMB 4IRZH 2EC8A 1CGTA 2OFQA 3VXUB 3BUQA 5BOZG 2VXSH 3D85B 1M2OA 3ZDXE 3ZZQA 2CHDA 4H0IA 4M43H 4C59B 2ZP0T 1EX0A 4AJ0A 4K55A 2HKFL 4PV8B 3WCYA 3HW7A 3WG7B 1DSYA 3OPZL 4NQXB 2W9EL 3ENEA 4MA8L 3MODL 1N18A 4FNRA 4JPKH 5C08E 4JK0D 3ULUH 1FFPB 4LSRL 4F7TA 1BYPA 5CJ5A 4NQCE 3AVEA 1E4XI 1R17A 2OR8A 2Z91A 5ACLA 1XSIA 2HT2C 2WLIA 3IYLW 3RUGF 1IEAA 1CLOH 5JHBA 4M1DL 4OIAA 4PP1D 4X7CC 1HZHH 3K74B 2XBDA 3GSXA 4C56A 1H0DB 3IU4L 3IU3A 5KVDL 5HI4D 1PY4A 3D51A 1NCNA 3QWOA 5ICUA 4U0RC 5C3LD 4RDQF 2NLJB 4JO1H 3SCMC 4XZUA 2DKUA 3FPXA 4PJXB 4D0DA 3U9UB 2F58L 5BOJA 3O11B 4L4TD 4PVMA 3SPCA 3UTZA 5HDWA 3TM6A 1MJJA 3LH2H 1J48A 4QR7A 4UTAA 3JXAA 2NNAA 4P2QA 1G0XA 1X9UA 4H7VA 1E30A 5DEZA 3VFNB 5KSBF 4FCHA 4Y19D 4FNLH 1DVFC 1NAMB 3HZMB 2KHAA 4LFHG 4QY8B 4C8XA 3O3BB 1R24A 2O30A 3CPLA 3OQ3B 4NNPH 4BA0A 1UD4A 2E9GA 5EO1A 1SJMA 3DPBA 3REWB 5JQHC 4OSUH 4JO2H 5E9AA 1B4RA 2BRRL 3NFSH 4OJDH 5E6RB 4Y88A 5LCVA 2OCJA 4HG4K 1WUNT 2FX7L 2YKLL 3ZLQC 4H0LC 3NZHL 2NR6D 2QPEB 2OBGA 3DRQA 5I15H 3VFWA 2MKLC 3MNWB 1HSAB 4HUNB 4HETA 1X5ZA 5I6LA 4TLSA 2IFGA 2J1KA 5E4IA 4XPTH 4KZDL 4OTXL 2HUEA 1GHFH 1XXDC 4RGNB 2ZIDA 4EMZA 3BVUA 5AKRA 3CHPA 3T2OA 2GSGA 2FUTA 2BY0A 5DJAB 3X14B 1B9ZA 4ZAKC 3FYEB 5F88A 4DGYL 4MCYB 3MLXH 5EPMA 2WP3O 3EFOA 3P54A 4WW2B 3ZMRA 5T33L 2HP4A 1GYAA 1R3JB 1NGQH 3GI8H 4GI8A 3JTSB 3DYMA 4WHTB 4OF0A 5KBMA 2WZ6A 4DIXA 1E90A 2IH8A 2CNZA 2ZKXA 4AV5A 1CFTB 3QJRB 1FRGL 4L4JA 4P4RA 3TT1H 3WNPA 2ZOUA 1JL8A 5DJ0B 1TJMA 1GTNA 2HT3D 1KYUA 1EO8L 2OMWB 3V5HB 3ILDA 3JTTA 1OOAA 5E6IA 3ULSA 3RG1C 1JJUA 3EBGA 3IDIA 3MNZB 3CVDA 3QZPA 4X98A 3P02A 2HLAB 3V6BR 4PGDA 4K2UL 4HCGA 1AD0B 1UGNA 1R3HB 1NGZB 1FVCA 2QMJA 1P9MA 2PW2B 5DWUH 2NUTA 3ZU8A 2CWRA 3NIFF 2OAAA 3KJ4B 1ETJA 3MBWB 3QW9A 4G59C 2LV4A 3QUZA 1QFPA 4F3FB 4RGOH 1JN6B 1CDYA 1KNOA 2ZCZA 5EBLA 4OGYH 1LEIB 3UZVA 4PVLA 3L16A 2VDKL 4B5EA 1YECL 3PL6D 4P2RA 3AM8A 3TIDB 2OZNA 3WNJA 2DQFA 3G6JE 2MOQA 2BOLA 3QIUA 3R4RA 4KK9D 3LRGA 3LN9A 1BP3B 1YNKH 4WGVB 1H15B 1OALA 1OGTB 2UY6A 1GGIH 3BJLA 3HI1B 3L4TA 3QEQB 3QZWB 4ODHH 7FABH 1LP9F 4BIKA 4KXAA 2X70B 4XPFH 3V4PB 4U05A 3QWNA 1VFUA 2HN7B 4HIIB 4A04A 5CZKA 2CPCA 2XPGB 1NBYA 3QR2A 5DMGD 4JZJA 3VG0H 1JYVA 1JGUL 4JY5L 5I16A 3NPSB 3Q1SH 4ZTEA 4XC3H 3ARYA 1KN2L 3IWVA 1SHMA 4UTBL 3V4VL 2R56H 3P4OB 2LLLA 3IDGA 5AW0B 3BZEB 1A1MA 4NQVB 4OIIL 1TQCB 3K91A 1HDMA 3PUUA 2LGNA 2NX5D 1UZ6E 2AEOA 1BAFL 1RUQH 4P5MA 1M1XA 3AQZA 4TNVK 4P23D 2YLKA 4PV9A 4E36A 2VDNB 2YGOA 5JNYB 4UM8B 1S9XB 2FWOA 3D48R 1IQDB 4PTUB 1ORSB 2HVJA 2APFA 3S34H 3QNXB 3ZL4H 1C1EL 3A4EA 2WLLA 4E5XG 4UZUA 3IJEB 4ZMXA 1RZ7H 4WWPA 4PJ9B 1U3HB 3D52A 3BDYH 4PJIB 3JV4B 4QXUL 4MJ2A 4JR9L 5DMIL 5I1EH 4IHOB 1ES0A 4LCYB 1A7QH 1RY7B 3VWJD 2DMBA 3FQNB 2QQNL 1I4FB 2Z31C 5KSAB 1DQDH 3GJEB 1TPXC 1ZT7B 5DF0A 2BVQB 1A14H 2PPFA 5FC9A 1TVDA 3IMRA 3Q6GH 2BDNL 1BVKB 1SXBA 3M1BA 5L7XL 1PPIA 4FLRA 5FHBH 4PBWD 4EI6B 5I76B 1RZJC 1U8QB 1EAQA 3AWFA 1A6ZA 4GQQA 4OW6A 1J9SA 4FFYA 5AW4B 4OGZA 2G5BA 3LH9A 4E9XA 3EYFA 2VLLB 3CQFA 5DURB 5AD0B 5I18H 5JDJA 2VXTL 4QCIA 5L9DL 1T5WB 4BFFA 4BBWA 5IROA 2FYYA 4OI8A 4D0BB 3KPSD 4FQHA 4ORGA 1AG6A 1KXTB 3VXME 2QPFA 4MNQB 4GKSB 4IGBB 4AIZB 4K8RH 1KBKA 3GRBA 1YAZA 4P2OA 4JFDD 3VYPA 1MAKA 2V8LA 4FG2A 2X1PA 1U42A 2FEEL 4HBCL 4RFEA 1I53A 2YGPA 1WD9A 5K9KA 4MAUH 1E3ZA 3IEAA 3RAJH 1C8QA 3MROA 3G5ZB 1OE1A 3BEWA 4FJZA 1M6OB 5TDPA 3SJVB 4F7MA 2AI0L 1GC1C 4JUSA 4B9IA 1OAQH 4UQ2B 5KS9E 1UXSA 4BFIA 2V3FA 8PAZA 3GNMH 1S9YA 2GHWB 2PXYB 4BDVA 5HHXH 2QADD 4KK6D 4FHJA 4JN2A 1EGJH 2P42B 3NQIA 3OR6A 4U49A 5FR3A 4J3TA 3WIIH 3LSOB 4X6DB 1DEEB 4WKZB 1BBDL 1J1PL 1IJNA 2H3NA 4P5RA 5CFHA 4LEBA 2AQNA 3VRJA 3ZKXB 4AQ1A 4BCXA 1KGIA 3T0EA 5F70A 4Q97A 1CLVA 1URLA 3TJEH 4PJ5E 1T03H 1AMXA 1E9QA 4FQXB 4L3AA 1Z5HA 2ZUSA 4DPBX 1W9XA 2HAZA 3D39A 2VDOH 3VGFA 1GAFH 4PLKC 1QRNA 3WEXB 4ZSOE 2D03H 3D5OF 4O9HH 5EU4A 4ZOAA 1INEL 3AITA 2H32H 1SMOA 3NIDB 1EV2E 3S48A 4YGAB 4XNDA 3PWPA 3HRZA 3SQRA 1R5WB 1ZT4A 3HUJA 3KPTA 4C4KT 2ZCLL 1L0PA 4LQFL 3QCTH 1UADC 2JIXD 4XNUL 2OTUA 2WV3A 5EU6E 1MLCB 1X5YA 1N8ZB 1G9NL 2KS0A 1SF5A 3A4AA 1MWAL 1ZXKA 1FYTD 3I3DA 4HX1B 4GP4B 3LHPL 5C6TH 2WQRA 3NQKA 5C0GA 1JPSH 3ZUCA 4JM0A 1NDGB 5EOQH 4XBEH 4Z0BH 1I1AD 3QCVH 2ZXGA 1I7RB 4F8OA 2XG5B 4GUPB 1GZPB 4GG8A 4TQHA 5DJXA 4NQDA 2PO6A 2OJEB 5DYOB 4OZFB 1MJUH 3VQMA 1FG2A 4Z7VF 4FTVE 3S88H 1TLKA 1NFDE 2JQZA 3DXAE 5JIQA 4Q6KA 1TQBB 3HTLX 3BP4B 1ZY9A 5FM5O 5TF1H 2PWGA 1NCTA 1A47A 4KUCD 4QRSB 5E24E 32C2B 1Q94B 3MRRB 4X6CA 1S8DB 2GIMA 4G71B 5D1ZD 2J2ZB 3WO3B 4MVBD 4KZEH 4CVZA 3D85A 1QWUA 1L9RA 1VFAB 2X2JA 4B9FA 4NM4L 5IJCC 3FFOA 4IIZA 4L4VE 1OM3H 2FHCA 4RLDA 2LLGA 3VG9B 1N4XH 3BWSA 2YSSB 2ZG3A 3BLBA 3L7EA 1MRCH 3TLRA 3S98A 1MOEA 1FGNH 3TA3B 3HNVH 2FWSA 3L4ZA 4MMYB 1MFDL 2J3SA 2ZUWA 5IEHB 5IHUL 1SHXA 3ZE0E 3HVNA 5JZ7D 1W2KT 2ZCKL 3K2UH 5D1XD 2DLHA 1F1DA 3SOTA 1H0DA 4L3CA 4TF4A 4IYKA 5J57B 1ET8A 4FI8A 4AEIL 4LPWA 2YAOA 5FF6B 4N0RA 1D9KD 3BGAA 1XR9B 3FMGH 3GUFA 4Z7QF 2NLJA 4OCSL 2HUHA 4IOSA 5LCVL 1E28A 1W0WB 2G30A 4NS0A 4M61B 4WI5A 4YO0B 2NUPA 2VZTA 4ABUA 4UWQB 1ILUA 1YN7A 2EYRA 5T1LD 3AFLA 4F9LA 3OR7A 2EINB 3P4MA 2IAND 3JWOL 4HF5H 4MA3B 2AEQH 3DMMD 1KEGH 1OTUD 3KPRE 5EN2B 4BQCA 5FECB 5GRJL 4UB0H 5E4EB 3VFRA 1Z5YD 2A9NL 2Q5BA 4JQVA 4ZFFA 3U46B 2A3TA 4J8RB 1WF5A 3LNEA 5E0QA 2IDFA 3UZQA 3PWVB 1B9KA 2BOBA 3OC8A 2XVBA 1JNHA 4FFWC 3D0AA 3K6SB 1DL7H 1OPGH 3V0VA 1U93B 3FCUB 4AG4H 1NGYA 4AK2A 3ZQ9A 3WN5A 1TCMA 2DIBA 4F37F 2Z92B 4LP8A 4TOYH 3L6FB 2ZUVA 5CEZH 3ARDA 4MJIE 4LHQB 2WSPA 1ROCA 3BPOC 1IIKA 2VLKA 3MGAA 2IALA 2XQYG 3LPPA 3TVMD 3W0WA 5INCA 5IWLC 1IAMA 3SQOH 3B2VH 2R4SH 1P7KB 1JK9A 1KN4H 3FT1A 3IFOB 4OM0L 4N2LA 3ZE2E 1DVSA 4TMPA 3UC2A 1CGYA 3VFMA 2R15A 4MCYA 4DP8X 2V9RA 3DSNA 3QJZA 1N59B 2YEVB 3SYOA 2H0FA 4D7BA 1J88A 1V3JA 3ZZSA 4Q0XL 3KYOB 3BAIA 3IJSB 2JJTC 1ORQA 1PDKB 2YGQA 4G3YL 1QNZL 1J1OL 3NTCL 4GNKB 5T1KA 1TIUA 1LGVA 1C12B 4QYAA 3LRSA 3GSNB 4U7SA 1DFBH 1SJHB 3MJ7B 2HVKA 1ZLSL 5DJ0A 5FUOH 4DKEL 2HT2D 2VZUA 3PXLA 4MZ2A 2BS8A 4L23A 3VVVA 2BFVL 3ULAB 5IEKB 1IVLA 4BH7B 3EJCA 1Y1DA 3T3PE 4LNRB 1DR9A 3GKZA 5EOTA 4DGIH 3CZLA 1CL7I 1GTFA 5AAWC 3ZTEA 5GGSA 1IMHC 4JO5A 3SCMD 3H6AA 2FQEA 1KIUB 1B3JA 5K1JA 4LKXB 3U0PA 4QRRE 1BPLB 3OJDB 1Q1JL 2BMKA 4IS6A 4IRSB 2DQCH 1NSNL 4L05A 4H8WC 4D8PB 4HA1A 4XCYB 1JN6A 1NOFA 1GL4B 1QQDB 4L8BA 1DVFD 5A2IH 5D6CB 1G7QA 3K8LA 3NJFA 3MV11 4NN6C 2LR4A 2P5EE 4U6YA 4DOHE 3FOLB 2Q8AL 3T5WA 2AJUL 2J1YA 1O7VA 1YPZF 5F1NA 1U58A 2IMNA 4GQ9L 2RJMA 4PJEF 3FSOA 4IRZA 2IG2L 1WWBX 1Z1WA 4X9HA 4OVUA 1EHNA 2V9TA 2A1WL 4K3EL 3JVGA 3PNWB 4N5EC 1TETH 1YVLA 1G1KA 1HEHC 3BX7C 5C0IA 4U1GB 4PRDA 4WSJA 1G9MC 3HRPA 1AANA 3C8KA 4NYLB 4RMRA 3STBA 2E56A 3JV0A 3LZPA 2CRYA 1GZHA 1UGKA 1XGTA 1PAZA 4A67A 4PUBH 1WCQA 4GKOA 1SYVA 2FEDC 1CE6B 2DQGH 4M6ML 4F5CE 5IW6A 2WXIA 4Y9FA 1TYJA 3RFZB 4ZAKD 3P4OA 4XPGL 4HMCA 2DI9A 2KYIA 2WTRA 4IEFB 4PTTB 5D7KD 3WEBA 2UZXB 3BZ5A 3RB7A 1SJEB 5CLZA 4GSRA 4K94L 3DURA 3TIEA 5BNXD 1X5GA 4I13B 3C09B 5C70A 4M5ZH 1T89A 2YARA 3NJJA 1VHPA 3VXSA 4CVWA 1UENA 1U8MB 1NC4B 2EDNA 1YN6B 2AQ3A 1CI5A 2ATPA 3QXUA 4BUQA 4HEMA 1X5MA 3WIHL 5FYJD 3H9SB 5CEYB 5TE7H 1OT4A 2B4CL 1UT9A 2PMZA 4WFFD 3SKMA 1KB5L 3TBSB 1AJ7L 3JV4A 1ZPUA 4D9LH 2D31A 3W57A 4NQEE 5C2BL 4QIRA 5EUOF 4ZBJA 4UQBA 4NI3A 4JHAH 2O5YL 1A22B 4GT7A 4LE8A 1GCFA 2R2CA 3NDYE 5CP7A 4YDKL 5DRWA 2ARWA 2FT6A 4NKIL 1TO5A 4AYEC 2X4RA 4QRBA 3HN8A 2GSIA 4EDXA 1CF1A 3ZKSD 1IVTA 4FC3E 2Q3AA 5E2TL 5BV7C 3K1KC 3WS3A 2XWCA 1A1OB 3CVCA 3IBEA 5FWRA 1BVKA 4U1KA 5J12B 4AL8C 1KGYE 2QHRH 3H3BC 2IQAB 1HXMA 1OCZB 3EO9L 3TASA 5KSVB 3KYAA 3GMRB 4PB0H 3C6LC 2TSAA 4O5LH 3LS4L 4I77H 2WBJA 4KZ0A 2M26A 4K5OA 3U83A 3C75A 5CINH 3ISWA 1DUZB 4PJDF 1J12A 3S35H 1IU1A 1UT1A 2ENSA 1I75A 4MNGB 1CK0H 2ZUQB 4F2MB 4LVNC 1KXTA 4HPHA 4DPRA 4Z3HA 3LN5B 4HIXL 1OGAE 5ICYA 3DTXA 2NY4B 3ATBA 2GI0A 2YAMA 4NRYB 4YLBA 4LVOC 4G7VH 3SDCB 2FQDA 3CHOA 3OJ2C 4W1TA 1A7NH 4F1ZA 1ZGLM 5LXVA 2IH3B 3DETC 1SQMA 4M6OL 3VQ1C 1BW8A 3EYOA 2K45A 1TZOA 4K7FA 4MMZC 1ZMYA 4JM2B 3BT2H 1X9RA 4PH8A 5E6SB 1RZ8A 4FX5A 5HJ3B 2B8OT 4ZS6C 2Z8SA 4Y5VA 3U2JA 2WNKA 4JFED 1OAXL 3TFKC 1U8OB 1RIHL 4LCIL 2CKBH 3IWUA 4R4FH 2FSEA 3GBML 1UXWB 2R59A 4B7LA 3N1MC 3KXFB 2WBKA 4PWIA 3CVIH 3L4UA 1FJ1A 3QE5A 1T4KB 4HK3N 3MXWL 1I7ZA 4PEEA 3MRCB 2ETWA 5FYKH 3UZEC 2AP2A 3EJRA 2AK1H 4O4YH 4DO6A 2LT9A 2R2HB 1NH6A 3PDOA 5KVGE 5ESQB 2ZX6A 2XWBB 1HJBC 4FQXA 2ZWKA 4JHUA 2QGDA 5AG8A 1KPVA 3UTSE 4UCFA 2FJHA 4LRIA 2JK5B 2ZKWA 2V9QA 4JFWA 2BNRD 5M94B 3AC0A 3SSGA 5E00A 5E99L 4FXKB 5E95B 4P5SA 4N3TA 1TNNA 4TSBH 3FC8A 5JIKA 2GEQA 2RQ8A 2EEXA 2HRGA 2E6PA 2AEPH 2XICA 2IDUA 2NTFA 3LQAC 3U36A 5IZ7A 2Y7MA 3L95B 4NO5B 2CCVA 2R1YA 1QWNA 3FFDB 1TO4A 2FJGB 4ZDHA 1N8ZA 1SDYA 4APQC 2V9UA 1MH5B 3FRUA 3G5XB 1GOGA 5TE4L 1R3IH 3U82B 2XKNB 4F9PA 1WCBA 3T6VA 4HGWA 4LSSL 2IDQA 2VUKA 4KI1A 4LCWA 2RACA 1QEWB 2ICEB 2FO4B 3MNVA 3F6IA 4XPAL 4E41D 5JPMC 1LXMA 4K9EH 1ZOXA 5J8OA 3FCTA 1BQKA 1VGKB 4TVPH 2MQ0A 3VXPA 3F7PC 5DS1A 1BF8A 3HG3A 3L1OL 2IQ9H 1AFVH 4WW1B 5EEZA 1Z5LA 2J2ZA 1AE6H 2FB4L 2BSBA 1TF4A 3FO1B 3SBWC 2WAQA 3LDBC 3IKKA 4ZS7H 1J8HD 1LK3L 1A7PL 1D6VH 1JZGA 1BREA 1KT2A 3IRCA 3K4ZA 4NKDA 2W0FB 5FGCB 2AJXL 3S6CA 1KGUA 3DX6B 3FONA 2WQAA 3MV8E 5BRZE 4AE1A 2DLFL 1FAIL 4KXDA 4RGNC 1LTXA 1NAML 1RZGA 5FA3B 3GTTA 4M29A 3WELA 2DQHL 1U8IA 5ICXA 1XF5B 3NJGA 3MLUH 4I3RH 1SVCP 4HG4J 2F68X 5B38G 2OYPA 3IJHA 1ASOA 3GSRA 2LU7A 1LDPH 3VAEA 4AM0B 3QIWA 3GSQB 2Q86B 2WOBA 1QHQA 3VJ6B 4A7TA 5ICZA 4KDWA 4PLKD 1OD9A 2MPAH 2WKOF 2HFGL 4W9HC 5KWYC 2FX8H 1ZTMA 1C5DB 1H3UA 4HWZB 5B1KA 4FI7A 2ZYSA 3X13B 4N85A 3NA9H 3FUEA 3ILQC 3C6EA 4YSAA 1WBXA 5ADPH 1YEKL 4JFQA 1BM7A 3PLYA 4RMQA 2CZNA 3ARBB 5CJOL 1O0VA 1BVNT 2YK1L 2W65B 4MJHA 3TBTA 3QIBA 4DCQB 3VQ2C 2V33A 2BP0B 1NEZB 1SYSB 5KVDE 1E5YA 2Q0ZX 3JYBA 3GPEA 1YY8B 3TXAA 4XP1L 5DUBA 4NZRH 2ESVD 4KOCA 4WWKC 2IV8A 1AXTL 1L5GB 3AACA 3K6SA 4DN3L 4M1GH 4HLEA 5CCGE 2CIKA 2UXVA 4WO4B 3QXDB 4HIEA 1MHPH 1OP3H 1H8OA 3QH3B 3TF4A 2ITDB 3KMDA 1MNUL 4YMPA 3F12B 4UIMB 1B4TA 2YMXL 1LNUB 3ALPA 3KLQA 1EGJA 1Q9KB 3AW5A 2XBTA 4MCZA 4HJTA 5T5FH 3VGDA 3A47A 3DX8A 4NBXB 4HYTB 2D73A 4UINH 4JL1A 5CIPH 2HG0A 1CL7H 4WI8A 1QSEA 1GGYA 4ERSH 5DRNA 4Z8FH 2XXGA 3ARFA 1D7DA 3FN0L 5LDUA 1CC3A 1NLBL 1NZRA 3CSYB 4PS4H 4WHYG 1AQDB 2BNQE 4M7LH 5F1KC 4CADA 3G04B 5H35A 4JDVB 2FD6L 3ZL1A 4I89A 3LZNA 4MB1A 4YE0A 4YDJA 3SDXF 3WFCL 3MLZH 3PABA 5EEXA 3T0AA 1SJHA 2H32A 1A0QH 3E1ZA 4X8GA 2V2WB 2VW4A 1KCVL 4JM4H 1GPOL 2NPLX 2QHLA 1SQ2N 1M7DA 5D55A 5D5MA 2D3VA 4F57H 6FABH 1TQCC 1KLUB 4BSWA 3QI9A 2ICWA 4IRZL 4YE4L 4FGMA 3C5JA 3PJSB 3A23A 3W5MA 5LGYA 2GTWA 3GPSA 1A9VA 3LYRA 1T20B 1E2WA 2Y5TB 1IZJA 2R83A 4JG9A 4M43L 2OMZB 4Z7WA 5FO7A 2DQDL 2GABA 4YGVA 3UTTB 3V2AR 3U4EA 2BP5M 3V4PL 4ZMVA 1KCSH 2EH8H 4WNSA 2YQ3A 1BQ5A 1GOHA 4JPKL 4Y4KA 3ULUL 3SHSA 3QUXB 5C08D 1CLOL 2QLVB 3AS2A 2OMUB 1HZHL 4Z7NE 4NJ9H 4YSSA 1HHGA 2OMXA 3G6AB 4Y4HB 3THMH 1NIEA 3N0AA 3VNZA 2XVLA 3OWEA 4ETYA 5K1NA 3FSAA 4XNYL 3IMBA 3I85A 4FFWD 4KV5F 5BJTB 4Y9EA 5IHLB 4ALAL 2Y7QA 3RTQC 3LH2L 3EO0A 1OD7A 1F3JA 1YEDB 2W1NA 4YWGH 4N6QA 2H45A 2A9CA 1ZT1A 2CDFB 1ML0A 2E6QA 4PP2B 3DX0A 2Y7NA 3CLFL 5HJGA 5I2IB 4YZFF 1Y0LA 1GIGL 4I2XE 1ZHKA 5D2LF 5D1QA 4NNPL 5GGUA 2AJ3A 1FHGA 2OL3H 5A16A 1VZGA 2A4ZA 4HKXB 1NTDA 2B16A 2GPZA 4JO2L 4OSUL 3SPHA 4I8DA 4RRPA 4LDEB 2QT6A 5IHZB 2OI9B 3MBEB 5BS0E 1AIFA 1A7OH 2OSXA 5AYUL 4P57B 5I15L 3NCJH 4O2CA 2VITB 3RX9A 1ZWIB 1M6UA 1R47A 3VM5A 3L5XH 4XCCH 2BVOB 4XPTL 3SGJA 2APVA 3WMPA 5IM7A 3BKYH 1GHFL 3KPLA 2X09A 1PLGL 4IU3A 2E6JA 1J8RA 2FTAA 1WITA 1WAAE 2NZ9C 2F74A 5DJ8B 3C60B 5HHPB 3T0DA 4HKBA 4ELMF 2VJXA 3ASOB 3WLBB 4D3CH 2DM3A 2FNBA 1RFDL 1F45A 2CGRH 3OHXA 4RGMC 5L6YH 4RGAA 5EA0H 3QGVA 2AKRB 4G6MH 1I1CA 2PXYC 4N22A 4MB4A 3L3GA 4LCCC 3QJUB 1HU8A 1FZJA 1BSIA 2OW7A 3GB7A 3TT1L 4Y9CA 3BWUF 1XFPA 5MENA 3US0A 5EEYA 3HB3B 2A6IB 3B2PA 4AEHH 3P4LA 3RKDC 5JYMA 2LOEA 2O6PA 4Z3FA 3JZYA 3ZTDC 1D5ZB 1EAPB 5DK2A 2D7MA 5GJTL 3T3ME 3ELQA 4R7XA 3IGKA 2CJTA 5E8PB 1AGFB 4B41A 4C47A 4MA7H 3TPKA 4N5ED 4HPYH 4MNGA 3KPQB 4L9LB 2CHWA 5GGQL 4NUJA 4FHBD 4KY1H 4A2EA 1H3PH 1RUAH 2PABA 2FRGP 4RGOL 4KPHH 3DVNB 3HE7C 3D0LB 2X6MA 4PJBA 4OGYL 3NRFA 4ZUUA 2JJSC 2FEDD 3L3HA 5JORB 3PJLA 4R5TA 1OP9A 1AKJA 1T1WA 2CJ3A 3REVA 3Q05A 1IFRA 4XP5H 4XHJC 3TV8A 2WTPA 3BKMH 2J8UB 2P5WA 3SDDA 3EOAA 3ATAA 1YNKL 4N9GB 4NNYB 1E9PA 1EXUB 4ODHL 1GGIL 1VLXA 2ZX5A 3SYCA 7FABL 5AL8A 2JQMA 2IOMA 3SD5A 2VMEA 4KRPC 3RU8H 2VNCA 4TUJB 4WGKA 1QTPA 1WGVA 2RA1A 2UZYB 1B88A 4K3JH 4ZUWB 5DD1H 2X1QA 3CCHB 4WVRA 3IGAA 2K9UA 1BZ9A 3U4KA 3C87A 1YMMA 4ZPTA 3E9TA 2F7PA 3DJRA 4XC3L 4AEFA 2W0LA 3FW6A 5CXPA 4NPKA 1GJUA 1QVOB 3OKYA 2R56L 4FRWA 4JVPA 3ZRFC 5GSRA 2EDFA 1FHNA 1LO5A 3IDYC 5HGHA 1CLZH 2ARJQ 4GUCA 1KTDB 4LGPB 5AG9A 4XP6H 3VFTA 3ZSSA 3M88A 2W9LA 3RURA 3ZL4L 1UD8A 1WVZA 4EZLA 4RNRB 4OR1A 4OUUB 2DQJH 5L2KD 4NHCH 3AXLB 3BP6B 3QJSB 5HHVH 5C0EA 2YLHA 3C6LD 1SFHA 2BC4B 4Z3TA 1HEJC 5I1EL 2EH7H 3MAWA 2A73B 1LE9B 2X4OB 4LIQH 1I85C 3N1FC 2OP4L 4M48H 4L8SA 4MSWA 1YEIH 1DQDL 3TO4A 1JZ6A 3D09A 2GJ6A 1D5RA 1DQLL 3VXRE 2KQNA 1GJWA 5DZOA 4DGWC 1PSKL 1A14L 3U0WL 1JPFB 4OV5B 4ZOCA 2ZX8A 1EZLA 1RZKH 3KH4A 1IRAY 4Z78B 5E4EC 5LNGA 5FHBL 5AZEL 4X6BA 3VNYA 1CFNA 2VC2B 3LRLA 4Z7OF 3SO5A 5MEQB 2H1PH 3V4LA 1UTDA 4NFCA 3NRQA 3DETD 4AYSA 1MUJA 4HOXA 3P73B 3HMXH 3TEXA 1MSPA 1J0YA 3CZFA 1RXLA 3EFDL 4FEMA 4G1EB 4XCEA 4MDIB 1CD8A 1NCOA 4ZS6D 3F65A 3GC3A 4NUPA 4MB5A 3TFKD 1OCWH 2V4LA 1E50A 4NXSA 1M9WA 1J0IA 3T6WA 4L1LA 4FQJH 3VGHA 3HJ0A 2MCAA 1LO0L 1MCHA 3QDJB 1JTTA 3VXMD 4HU2A 3FQUA 3BVDB 4P5TC 4ZQKB 4FQIL 3H55A 4IOIA 4R8WH 1MLBA 5MEOA 4G8IB 2R0ZH 4BZ1H 3MRPA 1EEQA 4HKJA 5LBSL 3NSJA 4C56E 3RAJL 1ECZA 1JWUA 1XIWC 3GZOA 1WA1X 3CFTA 2D3LA 3CFEA 4H1LB 4JREB 4PS7A 3WJMA 3BUYB 2XWDA 5ID0B 1MHHA 4XR8C 3QHFH 5FFOA 3MUZ1 3PFQA 3PF2A 3PUCA 1FSKB 3ARWA 2X4NB 5JOPE 1KZQA 4AKQA 2VQ1A 1NFIB 2IPUK 3OXRB 3Q1EA 1YDPB 4JAMB 4M7JH 2QBWA 1EGJL 2BHZA 3NDZE 4P2QE 1D7FA 4HJ0C 2EUXA 3WL9B 4HEPA 3QWQB 5KBPA 5I8EA 5C9JB 1DQKA 4O51B 3RY5A 2Y7SA 1Q0YH 3BFOA 3MV9A 2GUOA 3SKJH 5IFJA 2X4SA 1NIBA 2DJ4A 2WYZA 3DIDA 3EOYG 4P0DA 3RJQB 3TJEL 3B34A 4APQD 4XH2A 2FHBA 1QBML 1XTLA 3JVFC 4IRSC 2VDOL 1GAFL 5AUMB 3WTSA 1YAIA 1PFOA 2D03L 1KC5H 4O9HL 4FQ2H 3WDJA 3V0JA 3B9KC 3O2WH 7PCYA 4E42A 1G6RH 2CKBA 2ZPKL 3BQUB 5E8OB 3PDGA 1U33A 3V7AE 4Z6AT 2CLVB 4U1SB 2QQQA 1IAII 4PG2A 4X5QA 4FXTA 1BZ7A 2DM4A 4G8EB 4B9JA 1O5DT 3BPNB 2NXZB 3TBVB 4BWUA 5EU6D 2I9TA 1Q0XH 1QO3B 5LGKA 5KW9L 3KW7A 3N06B 1RK7A 4JO4L 1KDIA 2X3AA 4QYOB 1KXVC 2JMRA 4XP4L 5F93C 2DDQL 5LGJA 1JPSL 1L9TA 1WZKA 4L37B 2MCPH 1F3DJ 4Z0BL 1PY9A 3QCVL 5F0MB 3WE6B 5I1GH 4QAMB 1NGWA 3FUFA 4LASL 1V3LA 1OW0A 1LM8V 4RGND 5DUMH 3MX0A 1A02N 4NKOB 5AVYB 3ZKNC 5B4MC 4AYID 1A3ZA 2JKRM 3S88L 5LKNA 1FFRA 1SGKA 3LPWA 4XNZB 2OMTA 3VXTA 5HYSB 1QUNB 3GF8A 5DA0B 3RWJA 5IB1B 1T80A 1U2YA 2YD6A 1BGXH 4AYMC 2QVKA 1RK1A 2GKIA 5HVFB 4BFKA 4HUWB 1ZLWK 5JHDA 3TF7C 2K3TA 5IQLA 4KZEL 4WSGA 1K6QL 4MMXA 5DRZA 5H4YA 4OCXL 3VO0A 5IFHH 3RBSA 2F2HA 3PQYA 1GY2A 3C09C 1OM3L 4XVSH 2EDRA 3CNKA 1N67A 1MRCL 3UYRH 4QTFA 5ETUB 4L4VD 1FGNL 3NIGF 3HNVL 4M6NH 3D30A 3ZSTA 4G9FA 3ILQD 5GS1B 2YA1A 3JZ7A 1N5AA 1XL6A 1XQ4A 4BHUI 3K2UL 3C5ZB 3RY6C 2LHAA 5SWZB 2F8OA 4WJ5A 4W70A 2ADGA 2WZPD 5CHNA 1ZVSA 3FMGL 3OLEA 3K3QA 1TJXA 3PWNA 1BEYL 4UDTB 2N4IA 4KH9A 4WWKD 3ULVH 1SJVA 3DVGB 4FXLA 3WKPA 4YR6B 1RMFH 3LB6C 3G5YB 3LEYL 5FIEA 4AMKH 1MFVA 5I1LB 2BY1A 1EAJA 3UYOD 3HG0A 4U6XB 4HF5L 3DIVA 3RWEB 2AEQL 4OFPA 4QHMA 3D69A 1SEQL 2VLRA 4PP2A 3UJJH 3TU6A 3TZVB 4BE6A 3KPRD 4XCNB 5INDB 5DQ9B 4JY6A 3EOBB 3K6FA 1G9EA 2QSCL 1MXDA 1NCBH 4UT9H 1BBJA 2GBVA 3BVXA 2XY1A 1MQKL 4XN4A 1N10A 1WP6A 2ZUQC 1CXEA 2Q1EA 5AALA 4PLNC 2IPKB 1B0GA 1DL7L 1E6OH 1OPGL 2DB8A 2NY4C 3VACA 2GJRA 5I17A 3SDCC 4TOYL 5CO1A 3GXPA 3S36X 3G9AB 2OMVB 3GSVB 5G5DB 3S97C 3DRTA 4HUXB 3QHZH 5EZOL 4MJID 2VZOA 2YPLA 3W9DA 3MA7A 4X80L 3ZMEA 3D3VB 5IVXF 4TRPH 4PS8A 3SQOL 2R0LH 2R4SL 3AU1A 1S7QB 1KN4L 3B2VL 4JM2C 3HKFA 2IO5A 4MJ5B 1DLFH 2XIIA 1ND0A 1KPUA 4EI5C 3HVDA 1DBMH 2AJYH 4ECNA 4RMTA 2A7BA 3VRLF 1DQTA 4H4NA 4ZPVB 4ILDA 1U8HA 1KJ2H 4R90H 2EVIA 1CXIA 1INDL 5FFGA 3WHXA 5ABDE 1SUHA 1JWSA 4O02B 1DFBL 2UYLA 5DC9B 1HL9A 4XN9A 2RB8A 5FUOL 4NN5B 1FH5L 3N9GL 3DC0A 3VI4F 2X6BA 4U1JB 3RI5F 5I6XB 3P0YL 1FNGA 3CN2A 5HHME 4PJGA 4JFPA 1ZA6A 1L6PA 2DWTA 2B08A 5T5FA 5EIIB 4NN7B 1WJ3A 1CYWA 2X0VA 4DGIL 3EDFA 3ZDXF 1RJLB 5CIPA 3N41B 1HZKA 1J9QA 3UYPA 1A4BA 1W91A 1MJ7L 2VSKB 3QJXA 4OFYA 5JXEC 1MFUA 4KK5C 5JUEL 3RDTB 3FQXA 1N7MH 5K9OA 1XHHA 1T7ZA 5F7KC 4FG6C 4V2CB 1MRDH 5CGYC 3RTQD 2DQCL 3NFPA 5C0AB 1PNDA 2A2QT 4WDIA 1UJTA 5K9QI 3DNKA 3FTGA 1BFTA 3NUKA 3OZ9H 2GVYA 4JG1L 4O2EB 1TKWB 5F1SA 3FN9A 4Z9KB 4X5LA 2J7LA 4H8QA 5F8RC 3WFBH 3KNBA 4KNUA 3FT4A 3QS2A 1WWWX 4FJ6A 1E43A 5A3IC 1SEBA 1JFQH 4DP6X 1PEZA 4UOW0 1C7TA 5HHNB 5IJDC 4MNQD 4IGBD 4XMKH 3L3DB 5DZPA 2BINA 1UACH 1JWMB 2WYTA 5GJSL 4N3UA 4AGQA 1EDYA 4OJYA 1CICB 5IB2B 4FCAA 3S0PA 3F05A 2J57A 3S3SA 1R4XA 4YSCA 2Z0UA 5C0CA 4MAYA 4NP4L 4PN6A 5D7SH 5HI3C 1DBJL 2EE2A 2PWEA 2VN5A 1SRDA 3FU3A 1JFHA 3MRGB 4YXHL 5SWSA 4Y5XB 3VI3A 4ETQA 2F15A 1THAA 4LHUD 1TZIB 3SJVD 1U8NB 3L3OA 2NZ9D 5I1AA 2XWJB 3WEOA 3GSOB 3T0EE 5F0LB 1PKQB 2WLJA 4Y5YA 2MRYA 4MXVE 4L3EA 5F7DB 4KKAC 2ZWYA 5FKPB 3T65B 3V6OC 5AZ2L 2KL6A 2WXNA 4HFWA 4Y9BA 2DZEA 4UM9D 3D39E 1GW0A 2PXYD 2H8PB 3EOTL 3QPXH 3O9WC 4P9MH 4I1NB 2EJ1A 2A4CA 3V6FA 1JGDB 3KJ6H 3SO3C 3V0WH 4A55A 2C9VA 4KMTL 1JZ7A 3BE1L 2M2DA 3PWPE 1EZUA 5DZ9A 4M4PA 5EZJA 5CF3A 5GPRA 4EAEA 5JO5A 3CK0L 3RKDD 4JKKA 5FM4A 4IKNA 4PY7A 3RBGA 4G42B 2B20A 5K9JH 4WUUA 3IE9A 1N0XL 1JXGA 1KYOK 1HOCB 4JHAL 3CFMA 3NN8A 2OL3A 5EBGA 1H6EA 4NENB 3VFSA 2IH1A 1DBKH 3V5DA 3LTVA 4QHLA 4GINA 4DEWA 1CFQA 5CKGA 2JTDA 1BVLB 2ZJSH 4DQAA 3HE7D 4GEJA 4JG5A 4NQDE 3IDMA 5FGSA 1ADQH 3V0HA 1EBAA 2ZX7A 3NJNA 2H0EA 3HMWH 2Z93B 1KYDA 5EORH 1INQB 1BVNP 4LSQL 3Q2NA 1XF2B 4Z95H 4JG0L 2X7LB 4KKNA 3MFFA 5E9DA 4PB0L 2CDEB 4XHJD 1IAKA 1PYWB 2ZE0A 4WTWA 4X6CE 3RUGB 2NCMA 1XCTA 3DX9B 3UG5A 4B3VA 3VRIB 1JV2B 3ZXAC 4UDUA 1I9EA 5CS7A 1CK0L 5EZIL 4KRPD 2CDGB 3WD5H 5FGRA 1OE2A 2YEZA 1PF3A 4XB7A 3MLTA 1OF2B 3B2MA 4P3DA 4P06A 3O3DA 1OGAD 2RFXA 4ONHB 1JERA 1EHLH 4NO3A 2Q3XA 4FQ1H 1E3XA 3G6JF 2EXTA 4GAFB 4NUGL 3IE4A 1BV8A 1XH3B 1S7RA 5KSBB 3A5VA 1WDAA 3BT2L 4WU5A 1KDJA 3JV5A 1QMUA 3HS0A 3O4LB 5I1KL 3RVUC 1BOGA 3HBQA 4UOW1 1I9IH 3UTQB 1G9NC 4I18B 1D5BA 1OK8A 2CHNA 2X1WL 5JIDA 1KB9K 2BXYA 3NZ8B 4R4FL 3ZHNA 3BEVA 4ELKA 4KTEL 5ANHA 4NSKB 2WWOA 4A7QA 3CVIL 1XF4B 3RNKA 4L8CA 4LHJB 5BZZA 1WK0A 3A4DA 5G4OA 1QOKA 1IM9D 2COVD 4O4YL 1A1NA 1YYLL 3GXMA 1AO7B 3HC4H 3IJYA 4NLHA 3PGFH 4A68A 3C12A 5ES4B 2GJZB 2UY7A 5L88H 5D6DA 1KGXA 2MQCA 3UTSD 4MLSA 3QUXC 4AWJC 2HJLB 4FKHA 2F08A 5JW3H 1KLGB 5C0JB 3VD0A 2ZWLT 5E8OA 5TPWH 4TSBL 4NHUA 3MRJB 5J56B 3AG3B 5EU7E 5JLZA 1CTMA 2AEPL 1KPRB 1LWRA 5DMKB 3CXDH 2VLKE 3RWIA 5LXGH 2VRKA 3W0WE 2QSVA 4Y4HC 2YD4A 1S5IH 4HUVA 1SN2A 2EVFA 4MA1C 1RJYA 2ENYA 1PZUB 1UJ3A 2QTEA 2CLRB 4LVEA 1R3IL 4OGQC 1HL8A 5D7IF 4JFHD 3SDAA 1VERA 1UB5A 3SZKC 1PL3A 4XVJL 3KYKH 4P5TD 2Y2TA 4QRTB 2DWDB 2QQLH 3IETB 4GRLA 3ZW3A 5LB1A 3IDNA 1UCBH 2WK2A 4HOZA 5HYSA 2E74C 4I3GA 1TVBB 3NIFB 4TVPL 4LBAA 3O6KL 3JWOC 5KUMA 1XIWD 5DDHB 4IIQA 1Y6NR 3PYCA 1BFVL 5M7QA 3KW8A 2IQ9L 1NL0H 1AFVL 3WDHA 4NO0D 2OI9C 1AE6L 1I8LA 3E2HB 5FKAB 2QSTA 1JZJA 2UXFA 1I1FA 2MNJB 3MBEC 3MNMA 4XCFL 5G55A 2X05A 5B8CB 5T1MA 1S7SA 4ZS7L 3IFLH 3IRZA 3U79A 4A7SA 3T6QC 2Y1VA 1RP9A 3MRNA 4YAQB 3D34A 3QWRA 5ETUA 1FNSH 4JY4B 3MV8D 2VABB 5EDSA 4WI0A 3K6DA 4HJ0D 2CLZB 5MEPA 4U3HA 5F3BB 3GM0A 5AAMA 4BQ8A 1OAUH 4JCWA 4IBVA 1IGCH 2XZCH 5FW7A 1LP9B 4OLYH 3AS3A 4N8PA 5IF0B 1KLFA 1LE5B 3MLUL 2D9QB 3UXFA 4ODVL 3B37A 3CVHB 1P1ZB 5AW7B 3FNKA 3OAYK 3L3JB 1LDPL 3GMOA 1CURA 5CEXB 1A7BA 2CRMA 2WGNB 4ABQA 5FCSH 4ANWA 5I1DA 4F7KA 5KS9F 3HMXA 4FLQA 1XGQB 1A6UL 3RNQB 5A2KH 3V6ZB 1N64H 4IRSD 1KIRA 4TQEH 4K71C 4XNQB 3ZHDA 3QZMA 2MPAL 4ZMYA 5FK9A 3GD1C 3MMEA 2O6FA 4YBQC 3PREA 5AOKA 3MJ8B 2WB7A 3MJ9H 2UXGA 3B9KD 4PRAA 4WNJA 4DEPB 1P9MC 1JF5A 3W3BA 1EMTH 3GUTB 4JLRA 3NA9L 4HXAH 1YJDC 4ZZKA 1UD3A 4GAYA 4PJ7A 3QUZC 4BWTA 4ICXA 3ULUE 2XTJB 3RKPA 3UPRB 3QJOA 4N2AA 1S7UA 2FCBA 2DJSA 4BZ1A 1J10A 5A2BA 1N2RB 1U91B 4DFIA 3MRLA 2IPTH 4IK6A 4DERA 1XGPA 4JQIH 4FQCH 4L9LC 3SBPA 1QEXA 2JELH 2PP7A 3KGSA 3QIUC 4FTDA 4EBQH 1JNJA 1J5HA 4L92A 1K8DB 2FO8A 2VDLB 2YAEA 4LLUA 1DJWA 4QJ5B 1DVTA 2C9UA 1EJOL 2R29L 1WEJL 2CQVA 3BJ91 3STLA 2P26A 2W81C 3HCVA 1BFOA 1MCDA 3IN2A 1Q72H 4FNUA 4ZO8A 5B4MD 4WEBL 4AYDC 1XCWA 1TG8A 5HYJA 4PW3A 1MELA 5T5FL 4KBPA 2VM3A 4UINL 3IFPA 2IAMA 2OMYA 3ABZA 4WAFA 5CR8A 2BIOA 2WVVA 3CZKA 4Y8DC 4Z8FL 4TNWK 4MJ4A 4FF9A 3BSZL 2ZWNA 3VWKB 4PS4L 2RGSA 4M7LL 3OQRA 1X5XA 3DV6B 4P9HH 4YEEA 2BNQD 5GS2D 1IAOA 2HYMA 5CJXA 1NC4D 3T8MA 4G70B 4OF5A 4JE0A 2WUBH 3PU7A 5MERA 3H9SD 1JV5B 1FIGL 4PJ8B 4W9DC 1G6RA 1A3LH 5ENWB 1F6AA 4KKRA 3BH4A 1PTZA 3H85A 4FNQA 4JFZH 3L4CA 3BO8A 2JB6A 2Z1PA 3T4AA 5HY9B 2AV7A 4F57L 1XWVA 5BUPA 4BGDA 3FRPB 2BIHA 4KRMB 1P6AB 2PETA 5DI8B 5BQDA 2EIDA 4A6YB 1AHWB 2IDTA 1Q8MA 1KCSL 1CBVH 4U3XA 2EH8L 3LB6D 4Z18A 1LK2A 5KANG 2PCFB 3RZWA 4PJCA 5F7FA 2VE6B 3E3QE 5KSUA 2BOCB 4MRBA 1GZQB 1Q9WA 2DLIA 3H9HB 5ISZA 2JKXA 1PD0A 4NFDA 3HG1A 3CX5K 4MXQC 4TSCH 2LVEA 1YEHL 2F54A 3SKNB 5KBLA 4X4MA 4J4PD 3NACL 3MZGB 2F8XC 2K7QA 2GC7C 3T4YB 1KJ3H 3THML 3C5SA 1JIBA 2XWZA 4HWUA 4X7TA 4U6HA 4BZYA 4BQ6A 2PTTB 3L3DA 2GT9B 5DR5H 3ZHKA 5HI5C 2OSLB 1HEZA 1J86A 2NY4D 5C1MB 4KHXH 1CICA 2YS4A 1J9TA 3DX7B 3PJNA 2GIYA 3SDCD 4G8FB 3VFGH 5AEAA 4OLXL 4YWGL 1DVXA 5TTRA 3OSKA 5I0DA 4PRIA 3PHOB 3TBYB 3MGTB 5D4JA 1COBA 1M7UA 3F01A 4JM2D 4AQZA 2XFXB 1IKOP 2V5YA 4MKMA 5F9OH 3KPNA 4A7GF 4EI5D 4LKCA 5IT2L 3MV7A 4GH7B 1S7WA 4NDMA 1AD9B 3LS5H 2C4XA 4HH9A 2V17L 4N0FB 2KLTA 4AMXA 5D7JB 1KIQA 4DAGH 3DUSA 1A7OL 2AJZA 4FZ8H 1X6LA 3C6SA 5I19H 3U30C 2OXGA 4OD3L 3NCJL 3CZNA 2XWRA 1EQWA 1LHZA 5MI0C 2VL5B 3L5XL 3CSTA 2VC2L 2OXHB 5IJVA 3BKYL 5KYNA 4QMEA 5IG7B 3ZDZE 3DDGA 4KFZC 4L2YA 4G42A 4LLWA 2VXQL 1IKNC 3ROLA 4XMLL 4Z7VB 4JHZA 4ZO7A 5HGAA 4HT1H 4AQ1C 3UABA 1KTCA 4UT9A 5JXED 1UXMA 2COQA 1FSKC 4KK5D 4OI7A 5L6YL 4GXUN 5EA0L 3MLRH 4K3HA 2PCPB 1RL1A 4YX2L 1Y7VA 4G6ML 5J1SC 4FG6D 5CGYD 4WTZG 3OKOA 4K4KA 2P47B 5HP5A 4LCWE 4ES9A 5I9QC 3QDGB 2VLME 4WWID 1BVLA 2YBRA 2EIKB 5IIEA 2H0PA 1PS3A 4YSPA 2NY7H 1MREH 3HRZC 4YDVB 4N8VG 4JN1H 3FHQA 2ZNXA 5IQ9A 2GB2A 5DMYA 2I7OA 4F8NA 5A3ID 4AV4A 2BCKB 3ETBF 2XIDA 5DJYA 3LNGA 3T1FA 3PGDA 3WS6A 3H42H 1TMCB 2NY6B 4XMXA 4S2SB 4F27A 5CBAA 2YMOA 2KZKA 3BQUC 3BZFB 4ZO6A 1KJ2A 4JPSA 3UDWA 3ZYIA 4B3EA 2OX5B 4E5XB 5HXMA 4Z7QB 5CP3H 3EDDA 1H3PL 4QHNA 4WEMB 4OZHA 2X0UA 4PJHB 4KPHL 4ODXA 2OS7A 4J3UA 2VR4A 2MNWA 3EBHA 4OF8A 5HI3D 1P5VB 1N68A 5HHOA 1T1YB 2C9AA 2IBZY 3QQ4A 5IY5B 4X7DC 3ZRCC 1JZIA 2J20A 4PCSA 3LEXB 4WI3A 1CQYA 1MCSA 4W68A 1NBCA 4G8AC 2ZSVA 2EC9U 3KE0A 2AQPA 3FSWA 4NPYA 3BKML 1WA0X 3CFUA 3CFJB 3D08A 4YXLL 5HDRA 4KKAD 5KJRL 3ECWA 4J2QA 3RWHB 3CLWA 1XR8B 1WLHA 4RZCA 4JRLA 1M53A 2PYEA 5DVNA 4JB9H 4FQPA 3RU8L 3O9WD 3SOBH 4CNIA 1THCA 1NKGA 3AAZB 3HFFA 4K3JL 1FFOA 5I0XA 1AZBA 1KTLB 3OKDB 2AZAA 2EICA 4PS3A 3GXUB 4MDJA 3TEUA 2P24A 3S5LB 1PKOA 5BUAA 1A6AA 4IRJA 4PWGA 5KYWA 3IAGC 4LAQH 3WIFA 4P46A 1BQHG 2GITB 1JGLL 3GMLB 4PAZA 1ZHBB 3MLWH 3VXOA 1CQKA 1JGEB 1QA9B 4DTGL 1HQRB 3GI9L 3K71B 5DFTA 3PNRB 3QISA 4LLVB 3L9RB 4L0PB 4XBGA 5BO1L 5I71B 3FB5A 4YQXH 5C0BD 2I24N 3QUGA 1ZDSA 2CBQA 3L3IB 3P77B 4XP6L 1OB1B 2HA1A 2VYRE 5GRYA 3QQDB 1W72B 3RYMA 4R7DA 2O4EA 1X5JA 1O9WA 1TUPA 4G6FB 1LD9A 1VFBA 3EKCA 4JRXA 4R3SB 4Q6IA 3MRMA 4NHCL 3OKLB 1UM5L 3LRHA 2XPZA 4UM8A 4PJFA 3UGUA 3ZKND 4FZEH 4YN3A 2EH7L 2R23A 4I9XA 4BH8B 3RWCA 2XACC 4LIQL 1QSEE 3QULB 1IKFL 5C9KA 1R33A 5ERWA 3UAFA 4M48L 3DGGB 4N0UB 5DEFA 1YEIL 5CLTA 3OGCA 5FB8A 3HLKA 3GK8H 2CO7B 1DN0A 1L0YA 4B9YA 1M9SA 3QXAA 2V5SA 4LSVL 1IGIH 4BEIA 1RUKH 1EAOA 2P46B 3CC5B 5D7LA 3CLEH 3VXRD 4QKTA 1ZLEA 1RZKL 2CR6A 1DVQA 4HCIA 5E7BA 5F7WC 1NCCH 4JFFB 3WN5C 3SIKA 2Z64C 4LCUA 3V0GA 1F6FB 4KKQA 1Z9NA 4DQOH 4DVBB 1OP5K 3ARDC 2H1PL 3JUZA 1F58H 1NINA 5AW3B 5GRXG 3HMXL 4DP1X 2A77H 4FKEA 1JMZA 2BERA 4JPIA 4X5RA 4M02A 1ZS8B 3QUYA 3RVUD 2G5UA 3FB8B 4CC4C 4Z7WE 2BY2A 5HJDA 2QLYA 4L29B 1OCWL 2DLEA 2RQEA 4OZ4A 1EWHA 3QEHB 4FQJL 4QT5A 4PJEB 4WLCA 1BPVA 5LG6A 4HS6B 2VSCA 2BVTA 2ED9A 2JLLA 4POZC 4EIGB 3WO4C 3VB9A 5MHSE 3O6FA 4GRWB 3O6ML 3P9LA 4U1NA 1LMKA 2BSRA 4R8WL 1ADQA 2FH6A 2R0ZL 4BZ1L 2W88A 3WXVH 4Y19B 4PB9H 2IEPA 3SGDI 1MW1A 2H5UA 4C56D 5L4JA 1N0LB 3GLEA 2L7UA 1IL1A 1Z9LA 1MI5A 4I3SH 3RP1A 1M42A 4QPEA 1Z3GL 1Z9SB 3FHAA 4LK4A 1OCCB 3P4NA 3QUXD 4RQQA 3QZBA 1L7TH 1OQXA 1QKZH 1NAKH 3HZ3A 1S6NA 3MREA 4XT1C 3N85H 5I6XC 1WRFA 2Q76B 3HBZA 5L2JA 5TJWK 2EO7A 3I3EA 2VQUA 2Z7YA 3QARA 4NN7C 1FVEA 4Y4HD 1P5UA 1Q0YL 3UBXA 3SKJL 3SPIA 3HHSB 3IK2A 2ATKA 5D1QE 1I1YA 3VA6A 3IJ9A 5JPNA 4L1SA 4WCYH 4G1MA 5IQ7L 4Y2DA 3ZL2A 3BP5A 1KY7A 2EQDA 4MYPA 3SY0B 1G7HB 4LB8A 1L0XA 3RILA 4FXGB 3X1GA 1JGVH 4FQ2L 4O02L 4R9HA 4C83A 1XF1A 1AGDA 2AABL 1AXIB 4AYGA 2QR0A 2ZUXA 3JVGC 3O2WL 3DUUA 5DLMH 4QRQB 2V2XB 1IM3A 1SXCA 4MD4A 2Z3FA 3QEUA 4HAGA 1F2QA 1H9VA 2PN5A 3LIZH 2UXTA 5ACZB 3WUWG 4HK0A 1GZHC 3ULUC 2ADIB 1WIOA 2A83A 1FPTH 4WF7A 1OSZA 3FUDA 1UOKA 5EZLB 2CCLA 4PJAA 5D9SA 3BH9B 3NCFB 3IMSA 3MBED 4YK4C 1MVFA 3QDMB 5BVPH 4JRYB 1DTUA 3GSWB 4MHHI 3VD1A 1UZGA 3B2XA 5F44A 1KG0B 1FBIH 2OZ4L 4H2AA 3CFQA 5I5JA 5I1GL 1HH6A 1G9HA 1X7QA 4NCC1 1FN4B 2BSTA 3QG7H 5DUML 3OKMA 4PJDB 3TNMA 1UYWH 1XO8A 1T89C 4OB5L 4RX4A 1WIUA 5C09B 5TK2A 1HYSC 3IS1X 5BQ7A 5CEZE 4ZUVA 2F0CA 4C58B 5EF2A 1WBYB 1BJ1J 1T83C 3IVKA 5E1AA 1QNIA 1Y1UA 2NZIA 4FYSA 3DV4B 4ZNEE 4TUUA 3PL6B 2VWEE 3LNFA 4PGEB 3MRBA 5I66A 3QJTB 5IFHL 2WKGA 5T5NF 5IB5B 1F4YH 5CSZA 5KYYA 2Q87A 2VH5L 5E94B 4MNGE 4YBQD 4GAGH 3NRPA 2DMGA 3IKCB 3J7HA 1RIUH 5F2FA 2R2EA 1JI1A 2DOCA 1QTSA 2D3JA 3CZGA 3QUZD 4PRNA 4YSRA 5DTFB 1SBSH 4PJBE 4YBLC 5KVGH 2BS9A 3Q8FA 1AIZA 3H0TA 3RGVA 2YD3A 1JYNA 5J06A 3EXLA 4IDJH 4NIKB 5BVJB 1MAJA 1QATA 4MHHG 4MCMA 4P2RD 5DD6A 3O3UN 5AOMA 3FT2A 5BXFA 5CBEA 3TPUA 4KU1A 3QIUD 3ULVL 5BCAA 2EDBA 2DEYX 2NY3B 2NX5B 1P84K 1RMFL 2CIIA 3ARQA 3F04A 4W9JC 4F7PA 5LWYL 4N87A 4N4YB 1WIPA 4AMKL 4YS4A 5J1TC 1XD0A 2NNRA 1S7VB 2YAFA 4IJ3C 4R7NA 3ET9F 3DVFA 4KITB 5JMOC 3AREA 3E3QC 4HVBA 4AYFB 3PPEA 2HKHL 5DMJB 1YMME 4K7PX 3RWDB 3UJJL 5E5MA 3WIAA 5A2FA 2FEEI 3LKQB 1UT2A 2EECA 4OT1L 4RFNB 4XRCA 4IBLT 1O7SA 1NCBL 1N26A 4WO0A 3MJ6A 3WNLA 3IPEA 2J55A 2X89A 3HE6A 3DK0A 4Z3GA 2X4UB 2A9BA 3HC3H 1E2ZA 5DWPA 1ZA3B 4H20H 4ODTH 2CJUL 3KR3H 1GYCA 4I48B 3P3SA 3NG5A 1JNLH 2UX7A 3II2A 3MJ9A 4XX5A 2G4EA 2YN5A 1BHGA 4F33A 4CN6A 4G6JH 3N55A 2F53B 2JLPA 1VCAA 3IM1A 2IGFL 4NJAH 1YZZA 1U95B 1A9EB 2XCMC 2YD2A 3SGKA 4N0CC 1E6JH 1DLFL 4M5SA 2K78A 2NDFA 2KC0A 1DBML 3TJPA 1U3NA 2FUQA 4I18C 2CCWA 5FUCC 3EF4A 4JQIA 1KJ2L 2RTTA 2YZ8A 3M7OA 4CW1A 2V2TA 5F6IC 4CKVX 4D94A 1ZVHA 2GJ6E 5I8CB 2XI9A 1F00I 3BKJH 3P9MA 4LRIC 3FAWA 4OKDA 3SBQA 4J7RA 4RIRA 1GVIA 3MA9H 4BYHA 1KF9B 3HPJA 3W2DL 4JFDB 3PP3K 3FFCA 5BZWA 2PTVA 4XNAA 3RLSA 4MXQD 4KHTH 1KIPB 1CFBA 2R2BA 3GXNA 5KVEL 5J1AA 4FA6A 1D7CA 4R0LA 2C8NA 5CWSA 1UD5A 4XMPH 2A74A 3NJMA 4LLQB 3LRKA 5B7FA 1U3ZA 1JZFA 2DYPA 1QPXA 1H9DA 4BFGA 3MV01 2HKFH 1N7ML 4JFYB 3OPZH 4MD0B 2W9EH 5HI5D 4V1DB 2D7QA 2P80A 1EFXA 4WV1A 2I85A 1CT8B 2VMDA 4HJUA 4LSRH 3V8OA 1FO0B 2AEIT 5KVFH 2OV0A 3C9NA 3GLAA 3V5KA 4AGNA 3OZ9L 4YHKL 3SE4A 4M1DH 4F7CA 1S7XA 4KJYA 3WFBL 2PYFB 2P3YA 2YD0A 5EBWA 1JFQL 3ARSA 3H54A 1NCDL 3CFJA 2DQEH 2P1YA 2J5LB 3LKPB 3JWDL 3ZGHA 5DK0A 4XMKL 1XH2A 3QDJD 2CHZA 2ICCA 1AAJA 4UQ3A 1BJMA 4FQQA 4PWEA 3U1SL 1BMWA 2QVFB 3IF1A 5BO0D 4P2YA 1BLNA 4KXZI 4HS8H 1U3JA 4WK4B 5I1CH 4JM2F 1VKXB 3PV6B 1ZHNB 3SQBA 1S9VA 1YSOA 1UB6B 1PG7X 1YNTA 3F5WA 2GCYB 5E56A 5H8DA 3E9UA 5JOEA 3MV9E 2JIXB 3CSGA 1JGEA 4U2YA 1NCJA 2ENPA 4PRBA 5B8CC 2ZF8A 3IDXH 5DHYB 4ZFOB 3G3LA 4JFOB 1FL6B 1FYTB 4ZSOA 1NPNA 3QPXL 2Z34A 3TWYA 3V0IA 3LZOA 3O3EB 3QIWC 1AZZC 1IBZA 3VFPA 3GMNA 2C26A 4GXFA 3B3IB 3R0MA 2YFNA 4Y1TA 5GZOA 1QRND 3KJ6L 1F42A 3Q01A 4WEEA 4PVNA 2ENJA 3AG1B 2E27H 2C7FA 1K4DA 5J6GA 3ZTJH 5LBVA 1ZLUH 4K8RC 2UWEA 1N6UA 4R3SA 1T3FA 1G43A 1HAWA 3DPDA 4OJFH 3SDXB 2RAMA 1O7DC 2HRLA 3CDFA 3Q9QA 1MCOL 2H6PA 1RZPA 5FYKE 3CJJA 3D0VB 1G84A 3RL1B 4PW4A 5K69A 1MIEL 2EYTB 4X5WA 3QIBC 1G7MB 1MEXH 1T0MA 3NABH 4QHKI 1F90H 2E47A 3SE3A 4MQ7B 3BQUD 2WSKA 3CDZB 1KCRL 3RJDA 4ES8A 1DBKL 3V4UL 1G7IA 4OZGB 3T9WA 2K8MA 1FRGH 3CFBB 5IMMB 3MQIA 2OTWB 3B7TA 4ZUSB 4Z77B 4FE9A 2BW5A 2ZJSL 1MDAA 3BAXA 5TDOB 3W39B 5JMRA 1ADQL 4P4KA 1NFDA 3OKEB 3HMWL 2AK4B 4ODWB 4PBVC 4BUGA 2FWUA 3CVHL 5EORL 3T3MF 1U8JA 2KLSA 1JNNH 4Z95L 5F7NC 3SGDH 5TDNA 1TEGA 2VUYA 4S0SD 4BKTC 5ITFA 2FJFB 3OLDA 3OB8A 5JHDE 1CLYL 3UIZA 4K2UH 3U2IA 4BSVB 3WTYA 1KFGA 3TTYA 4D0CA 3TYFA 2J43A 1QI3A 1MCJA 4UANA 4JFUA 1D9KB 3D87B 2FL5A 3ARFC 4O2FA 1YPZA 1JPTH 3PQYE 4RAUB 3KPPB 4IBZA 1IBFA 4EVNA 2FIKA 3KYNB 1N3NA 4L4TA 4IMKA 4QGTA 4XXCA 5GHWL 4EUPG 4G9FE 5GGTH 2A6JB 5T1LB 4GG6A 1USZA 5C0FA 2LTQB 4GI9A 2L04A 4NZTH 5IOPB 3O45A 4R96A 5FYJH 3DMMB 1TTFA 4NGHL 1EEZA 2N7BA 1RUML 1WA2X 4BQ9A 3F58L 3NZUA 1BVOA 4TVPE 5EBMB 3MRHA 4GXVL 1A9BB 4JKLA 3T2PA 2EKJA 2WYIA 5AVTB 4LMQE 2ZZUT 3TCLA 5D2LB 2NY5H 4FL4B 4IOSD 1U4EA 4I5BA 3KPOB 2Z35B 1V3KA 4JO3H 2BH0A 1FV1B 1TSHA 2YXWA 1OSPH 4AQOA 2H6OA 4TVSa 1XCQA 2APXA 1C5CH 3EZJB 5CP3A 5CSBA 5SWZD 4JY5H 2Y2WA 2VLRE 1J05A 4AXWB 4XXDA 1M4KA 2K6YA 5GIRA 1KN2H 5ANMA 4PIBA 2AXGA 4QKXB 2ZICA 3V4VH 1ZXQA 2GHZA 5IMKA 4OIIH 3SBRA 3KH3A 5A1AA 3QK0A 3S37L 3HC4L 3MTRA 5GS0C 2WXRA 3RWGA 3U48A 5IBUB 1LYQA 2P7TA 2EACA 1FL5B 5EUOA 4ELMB 5JW3L 5CZVH 5TPWL 1II4E 4OKVA 1SOSA 3WNMA 1VJSA 5B38B 1C1EH 4DO4A 3V55A 3CXDL 5EU3B 2YPLE 1ZHLB 4U1HA 1IBHA 1SOKA 4RAVB 4C4BA 1MFBH 2CXKA 1E4XL 1S5IL 1YO4A 4JR9H 5DMIH 4ZYKA 2Z6FA 4JVWA 2AXFB 25C8L 4L8DB 1YEGL 1G7LB 1MW3A 5D1QC 2XX1A 2XKSA 1UOWA 1IUZA 2AV1B 2DWSA 1UWYA 3SCMB 3IXTA 4W6YB 5J9PB 2D4FA 4KNSA 2FBJH 2QTVA 1TCRA 2GBAA 3WV0A 2VLJB 3B9VA 3ISYA 2BDNH 1VIWA 4PCTA 4POZD 4W9KC 3ESMA 3FO2B 3QB7C 4AGMA 2QQLL 2VISB 2I7SA 2XT1B 3HG5A 5L7XH 2EDKA 3FBQA 5IK3B 4HZLB 1UCBL 4G82A 4X6FA 1HNYA 3SGJC 2WOYA 4O00A 2SEBA 1I8KB 4PJGE 2NMSA 3GS0A 1KGCE 2NW3B 5BUGA 1NL0L 5SWQB 3EW3B 1SF3A 3RL2A 1HHIA 1LEGA 3A3YB 2VXTH 5CCHE 4QRRA 5L9DH 3KLAA 3VFUA 3IFLL 3EFFB 4S1SL 4TL4A 4DGUA 3J8F7 3OHXC 3VXQB 1FNSL 4JQXA 3RWFA 3FB7A 3VMNA 3NFNB 1EEUA 4UBDC 1E5CA 2P5EA 1RZJH 4OLYL 3WJLA 4XGZB 5KYXB 4ELDA 2X4QB 1OEZW 4UI2A 4A2LA 4F37K 3R1GH 1D5IH 2Y6TE 1B2WH 3FUKA 4NRZA 4ZAKB 4ENEC 1N8OE 1RJCA 5IW1B 5GRUH 3BPCB 3BIAX 1UQSA 3EG9A 4TQEL 3ASNB 1VACA 2YAQA 3QORB 4JKMA 5C0AD 4KI5E 3WAJA 4POUB 1XB3A 3FU9A 3MJ9L 1WH0A 3X3FH 3L4WA 3EDJA 3CBJB 3ZQWA 1EMTL 4P23A 3GTVA 2XWEA 2YD1A 3D4CA 5E6ZA 2XHNA 4JPWL 1AS7A 5C0CE 4HU8A 2JI1A 5KEZA 3U6RA 4S0HA 4HUUB 3ULUD 1BBDH 1J1PH 5SWSE 3VI3E 4PW9A 4J5VA 1Q9OB 1AR1C 5HGDB 2WJ5A 2WP3T 4W9LC 3KL3A 2X10A 5FOBB 2IPTL 2J72A 4N6RB 4JQIL 4CA4A 1FGVH 5SX4I 4KJWC 4L3EE 1VZIA 4GRMB 1IGYB 1C08A 4PGBB 5C86A 3QJFB 3VWJA 3DARA 4B7IA 5E8NB 1FNEB 1AGEA 1INEH 1Z32X 4M03A 4M4RB 3R19A 1CO1A 1SZNA 5CN1A 4HJGA 1T6WA 4N2NA 1I3RA 4ZW6A 1Q72L 2XXFA 1XB6A 3LQMA 1HYSD 3VXSD 4FD0A 4JZOB 3K80A 2FR4A 3FCSB 1BF2A 3X11B 4WUUE 1MWAH 4LGRB 1Y6MR 4GS7B 1ONQA 3FQTA 1CDIA 1JXJA 1AS6A 3MRFB 1ODAA 4GW4B 1BX2A 3KPSA 1NBQA 1B4LA 1VENA 1YEJL 2R0KH 4HQQH 1OIOA 5E8DH 1ETZB 5DEJA 2A0LC 2JKSA 1A3LL 2GC4C 4JHVA 5E1IA 2J12B 4LBEB 4LOUC 4HFUL 2BSSA 2Q7AA 2ARJA 2BM3A 3LIZA 4AT6B 1WWAX 3GIVA 1IC4H 1KTRL 5PAZA 3V52L 3II1A 1J5DA 4I0CC 5DVOA 3GBDA 5D2NB 2GTZA 2YPKB 2H3KA 3DOSA 1K8IB 1X7TA 3B9EA 4CU7A 3VH8A 3AU0A 4L0ZA 5AW1B 2OSYA 5F1IB 5DJZA 1HHHB 1H5BB 1NC2B 4X6EA 3BHBA 2VR9A 4L8SC 5LAPA 4E2OA 3MRKA 1BQSA 2XN0A 3ZHLA 2YWZA 1MFDH 3BC9A 4PREB 5KN5A 4HV8A 5CGMA 4ODUB 4QXTA 1P7QA 2WKOA 5IHUH 1LEKA 4TQPA 2XRAH 1S4IA 2ZXAA 5F7MC 4JS7A 4AEIH 1VDGA 1X9QA 2XN9B 4L3FA 3QNZA 1QFUH 1KJ3L 3R06A 4N86A 3QVAA 4W4OA 3HZVA 4MGXA 1P4LA 5DR5L 5DFVC 3S4SB 2WCPA 3NBNA 1HILB 2Z31B 4GB9A 4G9DA 4ONGH 4KHXL 4K07A 3RZCB 1TPXB 3DI3B 1W6LA 2VERN 4MD5B 1MVYA 2PP8A 3HEIB 2Z4QB 1O9ZA 2J8UF 3LPFA 3WNIA 2EKSA 4UV7H 4HIHA 43CAA 4EUPH 3B43A 2VZ1A 4UNUA 1HQ4B 2A9NH 1CXFA 3ARGA 2EUZA 4N0CD 1TZAA 1QFWM 2CJSA 3O4LD 5F9OL 3BRFA 3F7RA 1CE1H 4HAFA 2VKWA 3ZKQD 2NT0A 1FYHB 2A9ML 1BOYA 2JJUA 3EJYC 1EANA 3HZKA 3LS5L 5DSCA 4APXB 2ADYA 2F8VA 3DLQR 1E5BA 3KEDA 4B27A 1CIDA 4FZ8L 2VDQB 4XX1E 1DVZA 3SE8L 3GHEH 1PGRB 3FB6A 4NRXB 4CMHC 1I1AA 2J1ZA 5CMAA 1YC7A 2XXCB 2G3NA 4M62L 4E41B 4GMTL 1EJ8A 2ROYA 4R4BB 4Y16A 4PG9B 3QYCA 1AO7D 4EIBA 2GFBA 5C92A 4YH6A 4OM0H 3T0WA 3F2LA 1DJGA 3DHPA 1NEUA 4HT1L 2VM4A 2YQ2A 4LLMA 4D9RE 2EYTA 4AEEA 1ED3A 1A25A 3HPLB 3P0VL 4G3YH 5D1ZA 3MLRL 3NH7H 1J1OH 5GQBA 2Y0SA 5EV7A 4OF7A 3T1WA 1WAPA 4GLRH 4Q89A 1HXYB 5DEGB 1MCRA 1SPDA 1U30A 1U8CB 2FLBT 3K81A 5HHQB 2A6KA 4AM0Q 1D2OA 2OYLA 1NCUA 4LCWD 4P49A 1ZLSH 1QSVA 4IJTA 3C2AL 4U4BA 3TYGL 1JD7A 1EVTC 2GK0A 1RHHB 3BVNB 4ODWA 3HC2A 3CZJA 3NIGB 4JN1L 5EIQA 2CAKA 4BINA 4PG2C 3KS0J 5KG9B 2WXPA 5D1XA 1AHKA 3E80A 1WPCA 3VXNA 3D18A 1AI1L 4KMLB 5PCYA 5G2NA 4GO9A 4FXGC 3MRDA 3BH8A 2Y5EA 4LIQE 5FA4A 4DESA 2AC0A 3FTWA 1Q1JH 1R5IA 2QPSA 3EGDA 5GRVK 2WNGA 2EIZA 3X12A 4HZAA 2QVIA 1TSRA 4W9GC 3EJZC 1SM3L 2H2PC 2IANA 4KFMA 5GRWA 1OW0C 5ABAA 4OZIA 1JE6A 1FL3B 1CLCA 2R1WB 2Q8AH 1FH2A 3JUYA 4M3HA 4OCMC 5IQMA 1EZSA 4P8QA 2UV3A 4GQ9H 1TVHA 5F0JB 1EVUA 4E68A 3I6GA 2ITCA 3QZNA 5FDYA 3UEQA 3U0TB 1LWHA 1AG0A 1J0KA 4M5TA 4K3EH 5CN2A 4KGJA 4MMXC 5G4MA 3QIWD 2ZXEB 3SOBL 3LKOB 4QRPA 3CFKB 4N24A 3KHQA 1RV6X 5CKAA 1Z3RA 2PWHA 2ZKHH 2CO6B 3MCKB 3Q06A 2HJKB 4K8RD 1EUUA 1M71B 4PJ7E 3TESA 1I8MA 1UWFA 4M6MH 5ESVB 1P6WA 5DFWH 3HN5A 4LLYA 1B90A 3TVMA 2P8PA 4K9EC 1MHCA 2ZSWA 4MXVF 4XPGH 1K4CA 4GQPH 3HNTL 2LU5A 2Y07H 3QIBD 4MASA 3GRGA 4RMBA 1MY5A 4GMSL 4M3JA 2OYKA 5IVXB 1R19A 1X3DA 15C8H 4GW1A 3D2UB 4KH2A 4K94H 1TYRA 2VN7A 4ATTA 3UBFA 2VDMB 1OWRM 2JCCA 3T8VA 3HUJF 43C9B 1AGCA 4AIOA 3ALWA 4P05A 3WIHH 3T2LA 3EBIA 1ID5I 2ZOLA 1ZHLA 5GZNA 4G80B 5HYJE 1BWWA 1KB5H 3JV6A 2H2SC 1AJ7H 1OHZA 1LILA 1PZDA 4YHPA 2MWCA 4MQSB 3B1TA 4R7LA 4LPYA 3SKOA 3VI4B 1GXEA 4YDKH 2NY3C 4NKIH 3BP7A 5AOLA 3PWJB 5F1OB 2FBRA 3ARFD 1HHJA 3GK8L 4U1IA 2V7HB 1MVUA 2EDXA 1F0LA 1IGIL 1N70A 4BFOA 3FO0L 2FQGA 3QAZC 3ZDXB 3BWAA 4LF3B 3SE6A 4FMVA 1JHTA 2N56A 3AB0C 4KKBC 8CGTA 5DQJB 1NCCL 2X1XR 1NCWH 3GDCA 4M7ZB 4N2FA 4ESKA 1YQVH 1HCVA 4HZLA 5C08B 2YJQA 1U8KB 1CBJA 1HL4A 4NT6B 4DQOL 5J5EA 5JW5A 3EO9H 4BK5A 4NQCB 1DVFA 3LX9A 3HC0B 3DJ9A 1F58L 3S9DB 3O2DH 4X6CF 2VOTA 4W6WB 2A77L 3C08H 5KVMC 3KLLA 4X9FA 2D9CA 2QMKA 3L9EA 5B1BB 3L1EA 3RPKA 2EVHA 1Q4NX 5GRVL 1HSBB 4Q7DA 3EYSH 3ZE1E 2ADJA 5IR1B 2BP8B 4RBPH 4LFHD 4Q2ZB 1X7SA 3QPKA 5TH2A 3EJUA 1U8PA 4A66A 4DZ8A 1CUOA 4PJCE 4Q9CA 3OSVA 2X88A 3H6JA 5FDWB 1F3DH 3BAEL 5MHSD 3TEWA 1TJGH 2ZUTA 4DZBB 4TPRL 3WXVL 3AADB 3GMPB 3LZQA 3GWJA 3HG1E 2AITA 3I75B 1KJVA 2F54E 3KWWB 4X4ME 5GSVB 4AW4A 3W9EB 2Y06H 2YBGA 2HG5A 3FOMB 5A6MA 3WUWA 1XZ0A 5GS0D 5DJDB 1SNRA 2YD7A 5SX4H 5JOFB 3F7VA 3PIQB 3VFOB 1RIHH 3PXJA 4LCIH 3TCTA 1L7TL 4UQAA 5DS2A 5TGBA 4AKPA 1QKZL 1NAKL 4DUXA 4XXWA 4QTHB 3W1ZA 5F7BA 1D5MB 1C9SA 1NANH 1GYWA 1UHVA 2APTA 2NW2A 3B3BA 3O41B 4E9RA 1ZGLA 2MCMA 5CJ8A 4S1DC 5GGTA 1ULVA 4ZX4A 1HH9B 2CALA 1GCYA 3N1QC 4PRIE 1CD9B 3ILPA 3QXVA 1OOWA 4LSUL 1A5FL 4OCYH 5DS8A 3ZR6A 3FPYA 5EC2A 5C0NC 1FI8C 3PAZA 1YYMH 1CFMA 3MV7E 2FZ3B 1GKOA 1G7JA 2OA9A 4OVVA 4QHUA 3R8BB 1TNMA 3DROB 3D7PA 3ULVE 4J3VA 4KI5C 4M7KL 1JK8B 4WHDA 5E99H 1USQA 1DQMH 1GYVA 5KYUB 2MQGA 1TR7A 2CK2A 2CBOA 5EEVA 3COOA 1C16B 3PY9A 4CVXB 2YR3A 4PMEA 4HULB 1FF5A 1Z9PA 2C1OB 4MAYC 4NN6B 4P07A 1KSRA 1WAAA 2ICES 4FLHA 3FJTA 3QCUH 1E9OA 2XBZA 5E1HB 1K5NB 1MIMH 4ZW5A 2C3GA 3V4VA 2Q7NA 4AQ8C 3L3OC 3LKSA 5B39A 4B50A 1KACB 5BVPL 1A21A 3QFGA 4Y5YC 3UAAA 2B5IC 2DYRB 3NCXA 2IXQB 4LSSH 4XOAA 2XVKA 1VCBC 2F1AA 1I8IB 4GW5A 5JXAL 4ZUTB 5FCUH 1K85A 4WJG3 4UBDD 1A4JA 4IMLA 5T3ZD 1AXSA 5MEND 4LEEA 2WIIB 1JD9A 3Q2CA 5CEZD 3L1OH 4HBQA 2NCEA 1WTLA 4DSYA 4HAKA 4MQTB 1AP2A 2ZUYA 3O0RL 2FB4H 4CN1A 1VGEL 4ENED 1Q38A 1ZDQA 1P2CA 1MWOA 1QLFA 2HPOA 3LKRB 1F4YL 3QPQC 3QUMB 1A7PH 3G6JB 4YDLC 4I0KA 2AJXH 3TBWA 4HS3B 4AQAA 2AQ1A 1L9MA 2DLFH 1RIUL 4JFEA 2G9KA 4FS0A 2ZOOA 3QQ3A 1KELH 3CDGB 2YD5A 1WBZB 1NAMH 4OZHE 2R1XB 2DQHH 3KL0A 4KXBA 4HD9A 3PWUB 1YA5A 4X0KB 1T7XA 1AR1D 1B4JL 1TU2A 4XVUC 5A2LH 4IK7A 4IDJL 3GRWH 4C57C 4ZFOL 1AKJD 5K39A 4BFNA 2DI7A 4KJWD 4OLUL 2ZP9A 3DIFA 5CGBA 4OZFG 2P5WD 5E1QA 3BPLC 4WNQB 2PYEE 2HFGH 2BY3A 1HILA 5B3JF 1IGJA 1TZHB 5E2JA 5BV7B 3ULUF 2BNRA 2Q7YB 1IFHL 4NZ8A 1RLBA 5E8EA 1UURA 1TZGL 1YMMD 2LFGA 3QDAA 3VMPA 1HQ4A 1HESA 3BUIA 2P8MB 5IB4B 5IMLA 3FU0A 1XD1A 3C6LB 5B7MA 2VN3A 2X6UA 1RZQA 4LSPL 3HAEB 4CGTA 1NWOA 2NNCA 4DN3H 2N59A 3S35X 4H20L 3VE0B 1K5WA 7PAZA 3HS0C 4ODTL 1DE4A 2KUTA 1CCZA 3EYVB 5CD3B 4YPGB 1DQJA 4J12A 2LTQC 5ESAB 4WZ9A 1JF1B 2DW5A 5F89B 4QI3A 1T5KA 2A0LD 2YMXH 2CNYA 4LOUD 5D7IB 4QRUB 2EEBA 4AZ8A 2MEJB 3I9IA 3GXDA 1I7UB 4LVOB 3ABGA 4LAJH 1XF3B 4JRXE 1FZMA 3T77B 2E7MA 2V3DA 2J1WA 1MFCH 1E6JL 3OV6A 3PGCB 3D25A 3P30H 3UTOA 3OG4B 5GGSY 4U1MB 1KBVA 3FN0H 4FL4C 4MMZB 3MUGA 3KCPB 2IMMA 3MRIB 1RK0B 5FYLH 4PRPA 1QR1B 4ZNCD 1J8HA 3WFCH 2CM6A 3QDHA 4G6FD 5D7LE 4AV0A 5D6DC 3ZX1A 2JTYA 1QSFD 1WSST 3BGMA 3FS9A 1L7IL 1KCVH 3VXMB 4RISH 1GPOH 1GW6A 1SXZA 3T09A 2P45B 3AQXA 2X4PB 2ICWI 5ILTL 3ZIYA 1TTAA 2WQXA 3WHE0 3QJVB 4HSQA 4YE4H 4JDZB 1CFSB 1K2DA 5H37G 5C0DB 5KG9A 4XMPL 1CXHA 5FHAL 1QW8A 4AKOA 1S7TA 5HDLA 3IS0X 3TV3L 4K73A 1FDLH 3FU7B 1MWAA 2DQDH 3ARUA 4A7VA 2JVUA 2K4WA 5DFVD 3V4PH 1UJ3C 4RMUA 4FI6A 4MQXC 4JFFD 2DIEA 4UQIM 4TUOA 3GMQA 5KS9B 4EN3C 3RPIA 3SDAC 3D8MA 4DKTA 5KVFL 2JKLA 2OR9L 4CKQA 3KDMA 4X4YB 3LQZB 4AENA 1T6BX 3BWUC 3GINA 2QGBA 1FL3A 4GRLC 3WGUB 4LEOB 1HXKA 3N5AA 5F3HB 5F97E 3VCLB 3T0BA 1A4KA 3NYKA 1F8TL 5FO9A 4QOKA 2HKAA 2DQEL 4IIQC 3S5YA 3MCG1 3EJYD 4N8CL 4APQB 4XNYH 1OHQA 4XN7A 3O8XB 3ROOA 3IXAA 1MI5E 1I8LC 2W94A 4PJ5B 2VDNH 4ALAH 2ESVA 1JAEA 2I9LA 2C1PB 2VT0A 1ITCA 3AUWB 3W81A 1G94A 3L5WA 2BNUB 4Q9RL 2CBMA 3B6SB 4HS8L 5I1CL 3FAXA 4JJ5A 5JPMB 4JFXA 5F9WC 1WFJA 3CLFH 5KJ7E 1Y6KR 1E0OB 5EIVA 1YYCA 1GIGH 1BD2A 5AAMC 1RZKC 4RWHA 1V3MA 2MOGA 4AMWA 1DDHA 2YPVH 2AERT 1T1XB 1JOIA 3BISA 4AC4A 4NXKA 3MV9D 3UOAB 4YHZH 3ABKB 3HR5A 1D5XB 3IDXL 4L99A 5EU6B 1ZVYA 3HA0A 3FQRB 6PCYA 3D33A 2QKIA 1T0NA 2VMFA 5LGHH 2O61B 3LDBB 3GS4A 1M7IA 5F71A 5LQBL 5AYUH 1NBZB 3VSVA 5I5RA 3BAYA 1NPJA 3VGGA 4KK8C 2E27L 3ZDZF 3K4AA 3QJQB 4V33A 3HJEA 1PLGH 2NSMA 1IGTA 4OJFL 3BQVA 4EUPA 4Y1AA 2CO4A 4FTVB 3NJVA 2X4TB 4ZW7A 5I74C 2XPYA 4P2CG 1SLXA 3UCRA 3ZIMA 3KGTA 3DXAB 4PJAE 1P0SE 4QLRA 5FYKD 5J89A 1RFDH 1FZKA 1Q1PA 3QORC 1O6SB 1MEXL 2MHAA 4OAWA 3NABL 4ZMZA 2WWKO 1J5CA 3GBNH 1F90L 3APFA 4ZW3A 4K3DH 1XZWA 2XZQH 3US1A 4HHGA 1T1ZA 3RGBA 3DBXA 5IMOA 3OMNB 1FAKT 1SMDA 1PLAA 3OKNA 4L4VB 3EJZD 3OXSB 2YIHA 2EZ0C 1FVDA 2H2PD 3BVWA 3ZYOA 3FXIC 4RRPG 2NTSP 3DSFH 3NJXA 4B97A 5E2VL 1JNNL 3BZ4A 3O3AB 2FH8A 5HVGB 4MJ6B 2CUHA 4Q14A 5GJTH 3CUPA 3QDMD 2IPUG 4JRYD 3QO1A 2BVPA 4DETA 2IAMC 5DLLA 5D72H 5JIPA 1GGCL 5DD0L 1JPTL 2WNXA 3F7QA 3OKKA 3MYJA 5GGQH 3OX8B 1LJMA 4JJHA 4WWKB 5L0QB 3PQYD 2WMPB 2VR7A 1PZ5B 4KQ4L 4M93C 5C09D 4PR5B 3ARXA 4G6KH 5GGTL 3C2SA 4G9FD 4NZTL 4X5PA 4LL4A 5FYJL 4P99A 3SKUD 5AENA 4YJZL 1ZLDA 3OHMB 2RCSH 3K6OA 9CGTA 1IEBB 1AC0A 3PHAA 4GS7C 2GAZA 2IFFL 3ISRA 3KPRB 1YUHA 4J3SA 2JKJA 5FAAA 3STZB 5IWLA 1N6VA 5BZDB 4TVPD 4K0OA 2Y9RT 5AW5B 1FG9C 2HFFA 5C8JB 2MCG1 1U92A 3I6LE 3TN0A 2NY5L 4RGGA 3S96A 2VB5A 4KY2A 5BW7A 3LPGA 2JJTA 1K9TA 4JO3L 1Z6JT 4AI7A 4HC1H 1OSPL 3ECUA 3ATEA 3BI9X 1C5CL 2ZONA 4LLAA 2C7UA 4WFGE 4AE0A 4AH2B 1R3KA 2C3XA 2OQJA 2H2SD 3FDWA 4XN1A 4MJIB 5D2NC 3DO7B 4QUOA 1I9JH 3ZO0A 2NY3D 5KOVC 2ERJB 1W0VA 1H5BC 1DEDA 5AOJA 1PZCA 1F11B 1IC5L 3Q0HA 2G75B 4M8QB 3D12B 5DT1H 4G7RB 3V0EA </