1ZRUA

Structure of the lactophage p2 receptor binding protein in complex with glycerol
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
263
structure length
253
Chain Sequence
TIKNFTFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Receptor-binding protein of Lactococcus lactis phages: identification and characterization of the saccharide receptor-binding site.
pubmed doi rcsb
source organism Lactococcus lactis phage p2
molecule tags Viral protein
molecule keywords lactophage p2 receptor binding protein
total genus 57
structure length 253
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zruA02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 1zruA01
3DA0A 3U6XA 4HEPA 4IOSA 4L9BA 4RGGA 4L92A 2X53A 3D8MA 4HEMA 1ZRUA 2WZPA 4RGAA 2F0CA 3EJCA 3HG0A 4L99A 2BSEA 4L97A 2BSDA
chains in the Genus database with same CATH superfamily
2ADFH 1RUQH 3CXFA 4AZUA 5KJRL 2HJKA 1F3DJ 3S48A 1PY0A 3IDYB 5KTEL 2ADGB 4GT0A 2IWFA 1RPUA 1OTUD 2R4RL 3QORC 3AQYA 4YR6A 3H85A 3RIKA 4HCFA 3BIBX 3QE5A 3RWCB 1QI3A 3O3EB 4XP4L 4WI9A 1FYTE 4HFWB 2GTWA 1NGQL 5CD5C 4LGPB 3C5SB 4ODUA 3MZTA 4ONHB 3EXJA 3IPEA 1INDL 4PJCB 5AOLA 3PXJA 1JYNA 1RSYA 2PF6A 1CCZA 1KB3A 2ZUQC 5JDJA 5KYUB 1D6VH 4I18A 1SBSL 4WKZB 3ROLB 3P4OA 4NC1C 1U3HB 2VDRH 2DYRB 3MUZ1 4PB9L 4TYUA 4PJHF 4UILH 2K9FB 3ESPA 4PVMA 3WTTA 4Y88A 2ENYA 4LNRA 5ADPL 1CUOA 3T0BA 4OCLC 4BFOA 4CGTA 3KLAB 5LBVA 4NI6A 4AVIA 2E7DA 4ESKA 3HAEG 1AGFB 2OTUB 3SDAD 1U95B 4MD5A 3KJ6H 4ZBJA 1S3KH 2GBAA 1KCRH 4I0KA 4P9HC 1DSWA 5E7BA 4APQC 1U8MA 3Q05A 3UADA 3D69B 5AVVB 4U4BA 1DL7L 5CZXC 2D3VA 5E1QA 2WANA 5D5ME 4OGXH 4BSVB 2Y2YA 2CIKA 3D39B 3IU3A 1M7DA 4GG8B 3QORA 1LM8V 5BPPA 5DR5H 2BSRA 1ODAA 5IMMB 1RZKC 1GGIL 5F71A 1KF9B 2B1AH 3F58H 3T6XA 4Z5RA 2Y36L 3U6RA 4HGKC 4LEBA 2DWDA 3UAFA 3DPBA 4AIZB 3I6KA 4M4RA 4LSTL 3LZOA 1TTFA 2YPVL 5E2TL 1GYVA 1E4KC 2E3VA 2XWBA 2W88A 4XMPL 5B7FA 3KH4A 3MREA 2NY7H 4N2LA 4MNQE 2B3RA 5KBNC 3FCTA 2OMXA 1Y18A 2M83A 3LIZL 1KLGA 4D7BA 4ZUWA 4X80L 1FBIH 4YPGA 4LLDB 2J4WL 3CFEB 4F15B 1UM5H 3VI4B 2EUZA 2EE0A 5ELIA 2J4WH 1G6VK 4M43L 1AJ7L 4KO9A 3QARA 3P2BA 1X9RA 3LY6A 4HKJB 4WQOA 5BRZE 2UY6B 3AM8A 3MLZH 3KPRE 1IAKA 1M2VA 4G1EA 1TNNA 5T33L 4IMLA 1WCBA 4KI5F 3BW9B 1MFEL 4OKVA 4R5VA 4DKFL 2Q20A 3BZFA 1FNLA 3LIUA 4GUQA 1JK8A 1VZGA 3GINA 4PV8B 3SQOL 5IREA 4RQQB 5IQ9A 2H26A 5D4HA 5CEZD 3TTYA 1L6ZA 3V79C 4X5WB 3D12B 4CU8A 3UTZA 1YMHA 1U8NB 3A5VA 3O6LH 1ETZB 5ALBH 4YXHL 4XWOC 4KJQC 5AFAA 3HHMA 2Z8VC 3GF8A 3L9RA 4OD3L 1Z0NA 2J3SA 1IAIH 3VGHA 3V6FB 3HMXA 3PAYA 7PAZA 2KZWA 4QIRA 1CZ8L 4HJIA 3ESVF 4UMSA 1WICA 4OGQC 2E74C 4TNWF 1RJLA 4KQ4H 1I7UB 2D0GA 4PJGA 3PFQA 5DZLA 4OI7A 3QWRA 4U1SA 4ZFOA 4IIQB 4H2CA 4J4PD 1BFOB 1I1AC 4KY1H 3WUWB 2AXWA 2EDFA 4LF3B 4M03A 1UYWL 3DHJA 4XOBA 3V2AR 4EE2A 1L7IH 1KJ2H 3NZUA 1G7QA 2BNQE 3WJLA 5ADOL 3NGBB 5AG8A 4ETYA 5KS9E 1FL6A 4BHUA 4DWHA 4K7PY 2ZG2A 1RZGB 3A3YB 2P5ED 4QRUB 3O45B 4ICXA 3O2VH 3PUUA 5L4MA 3LRSB 4MD4B 4ELDA 3KGUA 1S9VB 1TJGL 2N4IA 3DXAB 5JPNC 2WUBH 3OHXB 1I8KA 4P8QA 4TS6A 1T1ZA 3QJFA 2H7WA 1F41A 2R7EB 3ZE0E 2YIHA 4R7LA 1FGVL 3QQ4A 1P7BA 4UB0H 3OF6A 1U8HB 4IOSA 1QASA 3ZY7A 2R8SH 1K4DA 3PPEA 1QUNA 2ITCB 3D0VA 3BUQA 1XMEB 3WV0A 4HA1A 2WV3A 2X3CA 2NTSP 3W9EA 4WWKB 5IBUG 1BVZA 5C2UB 5BNXD 1DN0A 3DSNA 2VJXA 3IMVA 2W5PA 5CCKH 4AGOA 5CCKL 1NDGA 2ADGA 4PJHE 5FEBA 1QBBA 1WAPA 3QG6A 3CLFH 4K7PX 5IB2A 3EH1A 2V5MA 4JJ5B 4XNXL 1URZA 2P7TA 5AW6B 1KNOA 2GKIA 4NQTA 4GW4A 2YKLL 4BV1A 3VB9A 2OBGA 4M6OL 2HG5A 3R4RA 1FO0H 1WWCA 4HU8A 1B2YA 3A23A 3PWPA 3D25B 6FABH 3MBED 2D4FA 3I2CH 3VXNB 3L2NA 4Y1AB 4DGIH 3P2TA 4JDVA 6FABL 3N41B 4XH2A 4ODBD 2HT2C 1IMHC 1L7TH 2O30A 3WN6A 5FCUL 2IPTH 3WNOA 2ZWYA 4WI5A 2EIDA 2NXZD 1KN2H 5D7SL 2C34A 3P0YH 3X14A 1A7NH 3H0TA 4I88A 3DC0A 2LE9A 1A64A 5I9QC 4JFDE 1BQKA 3RU8L 3P2DA 5KVGE 4LRNL 1JV2A 4X99A 2AJZB 4UBDC 3HMXH 3OQRA 3VG0H 2XPYA 2EE3A 3L08A 4YZFF 4L8CB 3HC3L 1BD2D 3DRQA 2AJSH 4FNSA 5I1EH 2J71A 4GQZA 1Z9OA 1QMUA 4GMSL 3HNSH 4JFYB 4MXQC 2NZ1A 2WLZA 1KLFA 4JM0A 1NCUA 2YXFA 3U7WL 2PYEB 2CD0A 2XA8H 3U7WH 2QHRH 4Z3FA 2VABB 4AV4A 4PJDA 3UTQA 5CD3A 2GJZA 3OMNB 3PAZA 2MQ0A 3GMPB 4HJ0C 3G5YA 1G84A 1WIUA 2XCMC 4KXZH 3H2PA 2IH1B 3D34A 5IQNA 2YHGA 5E9DA 1TVDA 3OX8A 2HRLA 4JGJA 3EJPA 2M26A 1MHPL 3LEVH 2RMNA 5E99L 4QHPA 3RWIA 4IRJA 2BM3A 3T9WA 1MG3C 3B9EA 3O3AA 1SFHA 5CCHE 4DN3H 3V7MA 5D7JB 4QAMB 3MRQB 1QUPA 2QDVA 1UVQA 3BHBA 4JY5L 1I7ZB 2C1PB 4NM8H 5ISZB 5GS0D 3GXUB 3GB7B 4G7SB 4ELME 5C7ZA 3ZTDC 3MV9B 5E2VH 3RDTC 2P80A 1AHWB 3H9YA 4DGIL 1CMOA 5CINH 2V33A 4M6NL 5EEVA 4LFHG 4KXZI 4XODA 2BRRL 4AC4A 3GHBL 4Z7IA 3T4AC 4N25A 5E2WL 3CN0A 2CSPA 4WSKA 3BE1H 4JDEA 3PRZA 4OI9A 5I1KL 4PUBL 2OR9H 4MSWB 25C8L 3JTSB 4OQ1A 5M7QA 1V8HA 4G5ZL 1J8HB 1JXKA 2EAEA 2OMUB 5DYOB 5JW4Q 2EICA 2ATKB 4RIRA 2XQBH 3TEYA 2QVIA 3PG2A 5LAXB 2VERN 2SEBB 3IVKA 3UBGA 5CM1A 1FVEA 3FTGA 3MLTA 4IMKC 3LKOB 2UYLB 4YIQA 3HNSL 2WQSA 2VLMD 4XPBL 4PLOB 1HZHH 4JHAL 3QNXA 2BNUB 4JBSA 1A7RL 2XWEA 4FA6A 3QUKA 3M1BB 4YSUA 2E56A 4NDMA 1EJ8A 1GCYA 4DVRL 4JMNA 4MXWL 2GY7B 2XZCL 4J6RH 3QNZB 3V0VB 3MI6A 1DQLH 3PJSA 4OIIL 1DFBL 4OCXH 4TLUA 2WHVA 3RX5A 4PRNA 4WHCA 5F72S 3OMZA 2YGQA 2X1XR 5EU5B 3G6DH 2A9AA 3ZE1E 1GOGA 5ETUB 5JPMB 2MPVA 2UV3A 4OFYD 3KW8A 2WYIA 3L3OB 2ICES 3TT3H 3VFVB 3AT0A 3QUMA 1ORQA 4HBQA 4ZMAT 2Q2LA 1ORSA 4FG6D 2Y7LA 1FC1A 1UA6H 1DANT 4V2BA 1M3IA 2XDHA 2ZUXA 2OQJA 2Q76B 4OCWL 5FFLA 1F8TH 1OT4A 4WNQB 3TO4A 1QI4A 2GAZA 5HVGB 1A7PL 3RVTC 4X4YB 1D2OA 5EBMB 3O3BB 1U3ZA 1H5BA 1KTLB 4NXKA 1IM3D 4LPWA 3VFNB 4I13B 5DHEA 3BQVA 4NO2A 4WFHD 4Y2LA 3QS2A 3T3MB 3C08L 2H6OA 3J8F7 4GRLA 1XFPA 1EERB 4WJ5B 1MY5A 1CI3M 2R0ZH 3QDHA 3P9MB 4ODVH 2YOAA 3O4LA 5F6HJ 2BY3A 3SPVA 3WU1A 2A9CA 4WW1A 5B8CB 1JTTA 1WUNT 4G80A 4FADA 5T3XH 5GRUL 1U58A 4NKIH 1EFXB 4ZYKA 4JRYD 5D1QC 3RILA 4IRJD 2F74B 4RAUA 1MZYA 3GSNL 4J1UB 5SX5H 4UOW1 1KCSH 2YBGA 1X4YA 3VGGA 1TTBA 1W6WA 2BJMH 2EE9A 5K33A 1AGBA 4EUPB 2PPFA 3FB8A 3V5DB 5CN2A 2ZOUA 2CR3A 2OYMA 4QCIB 3LH9A 4N9GA 5DK0A 4RGMB 4L4JA 1JGVH 2A9DA 4OM1H 5SWQB 1I3UA 2D9QB 4U1KA 2E7LC 2VLKD 4L3CB 4E41B 3LKRB 3OAUL 2P8MB 4A63A 3W2DH 4MMYA 1YYLH 2NXZC 1GL4B 3PP3K 4HG4K 4GRLC 4LESA 2GBVA 4MAYD 1NCCH 4HW6A 1YEFH 1Z9SB 1EEUA 4IGBA 4CJ0A 3UX9B 3J2PA 4LCCA 4XE0A 1OSZA 2G3NA 4DQAA 4K4KA 3CDZB 2PYFB 3BP7B 3U4KA 1GGTA 4F2EA 1PY9A 4QEGA 4BE6A 4D94A 2XTLA 1UASA 2CRIA 3IGAA 3P77B 1Z7JA 1HCZA 1VACA 3CIAA 3EO1B 4KQ3L 3CVHL 4JL2A 5FO9A 1OK8A 4W70A 4BK5A 1TXKA 3MBEA 4UQ3A 3ZTJH 4IMLB 3OL2A 5D1XA 5I1AA 1U30A 1T22B 3RWHB 2DWTA 1KV7A 2CGRL 3BZFB 2PN5A 5DJ8B 5LWYH 3CE1A 1T0PB 2W1NA 1FF5A 1D5IL 4ZFQA 2WLNA 5HGAA 3WENA 4HJ0D 3BDYL 4YFDB 1GYCA 3ECWA 2CHWA 3QUYC 4RMUA 5EU7E 3UTOA 3HNTL 3ZDXB 5MENA 1DN2A 4O5LH 3UYPA 4Y5YC 3RJOA 3RWIB 2C9QA 3X11A 1AOZA 2YPKA 3P9LA 2W80C 2IANE 4W9GC 3U4EA 4NM4H 4XNMA 4BE5A 1D3CA 3LJ3A 4G43A 1DP0A 4V1DE 5TH2A 1JZ8A 2I7OA 3QXWA 3C60D 2VR4A 3IMSA 3UPRB 2C1PA 1T5WA 1L0QA 4CDHA 2AXGA 4R0LC 3B6SB 1A8JH 4YDIL 4HJSA 2FWSA 4XMVA 3U30B 2VAAA 3NJMA 3B9KB 3NJHA 4KAQL 4R90H 5C3IA 4UT7H 3EOAB 3ARPA 5DEGB 2ADJA 1FPTL 4XP1L 4ERSL 1I8UA 1S9WA 3DVNA 4HJ1A 4KAQH 4R90L 4WW2C 4KHTL 1ZDSA 4UINL 1FL6B 3MXVL 4CUCA 5HDQH 2CK0L 2B3IA 4BJLA 5LQBH 4XMKL 4WWPA 5T1LD 5DFVD 2VUOA 1RI8A 4F80A 3WEXB 1C8QA 1HDMB 2VSKB 2W65A 4MJ6B 5IVXE 1N6QL 2YMTA 3LS4H 3JUYA 1FNGA 2FHBA 3FAXA 2WZPD 1JG9A 1G7JA 4NN7B 3FB5B 5EU4A 1TVBB 1WK0A 1WZLA 3SYPA 1S7RB 1S6NA 3ILEA 2JJVA 2HX9A 3DGGA 4F8PA 4J4PA 4FCAA 5F44A 3U9WA 3GRWH 1HCFX 5AW9B 3WY1A 5CEYB 3Q8EA 4OVUA 4LL9A 3L1EA 1CDYA 3TTSA 4UCFA 5IBLD 4RDBA 5DJAB 2NYYD 4H88L 1EXGA 3B37A 3O8XB 5I82A 2E75C 4YHZL 5FUOH 5JXEC 1XF4A 4LBAA 4JQIH 4RLDA 3P30L 1XWVA 5F8RC 4NQVA 4ZFOL 4YSCA 3QBTB 5FKPB 3GSRB 4KY2A 3B9AA 4GW5B 4P5RA 4YXHH 1HAUA 3BLPX 4NFBA 1WZAA 2QR0A 1KJ3H 1OCRB 2JELH 2LV4A 3HHRB 4XH2B 5BV7B 2F2HA 4OFKA 1A66A 1XH3B 3MZGB 2NUPA 4DVBB 4KK9D 4K3JL 1HOCA 2ICEA 2HG5B 1EGJA 2HJKB 1AI1H 4NC2B 2CGYA 3Q5OA 3VFUB 4NSKA 1JGLL 5E9DD 3S96A 1WF5A 3MUGB 2AI0H 5L2KD 4RGNC 4XB3A 4D3CL 1OK0A 1R5WA 2R0KL 4TSCL 4EO5A 3O2DH 4UT6L 5ID0B 3JBG7 1D5XB 2I69A 1MPAL 1OF0A 3O9WC 3L7FA 4PLKC 1YEEH 3RBSA 4R2GC 4IQHA 3H0TB 2WXPA 1BZ7A 2WNWA 3RIAF 4XBGB 2FZ3A 4E42B 1IIKA 3VXUA 3SDDD 5TDPA 5AKSA 5JQHC 4O58L 3VJ6A 3LS5L 2YQBA 3DDGA 2Z31C 4XVTH 3TP4A 2WBJD 1X5LA 5C0IB 4LLQB 2APWA 1MDAA 3T3PF 4MDIA 1E2WA 1AYOA 3GPSA 3GJFH 2BSBA 4L8DA 4LHUA 4JFYA 3V5KB 5C09A 4M6ML 5IUCA 4UNIA 3V4PL 3QAQA 1BJMA 3QT2A 3MLSL 4WY7H 1F1DA 3KZ8A 4OIAA 4ZFZB 2QJDA 4TQPA 3NEOA 4AYFA 2W07A 2YWYA 3I6SA 1Y7VA 4M9OA 2AK4B 1HH9A 5D2LB 5FUZH 3FONB 2ZX5A 4UNVA 3K2UL 4LKCB 3UTTB 2HN7A 4HUNB 3Q6GL 1WISA 1A3RH 3NG5A 2F7PA 2R0WL 4W4OC 2HYMA 1XAKA 1E9QB 1BBJB 3SKMA 3VXOA 4FFYL 1A1OB 4HZ1A 4K3JH 4BUHA 1QD0A 1ZA6A 3GSUA 4MAYC 1MAJA 3HS0C 1S8DA 4FI7A 1T5XA 3OC5A 1W0VB 2OS7A 4LDOB 2PWEA 2OMUA 1KTRL 4MJHA 43CAB 3D3VB 1YPZA 2FR4B 2ARWA 1S7WA 1OAZH 4HFUH 3KBEA 4AV0A 4WO4A 3FFCB 4F7KA 1RZGA 1HE7A 3EO1A 4BELD 1UACH 2DQTH 3W0WA 3EJUA 2FB4H 5D7SH 2IDFA 2VDMB 2V17L 4F33B 5A2KH 2FB4L 4LSDA 4UTAH 1ONQB 1YO4A 5DSCA 2OW7A 2X1PA 4ZRGA 1A6PA 1SLWA 2R1WB 3AROA 1IEAB 1WH0A 1M1XB 2NSQA 2WQAA 5T33H 1OT1A 3ABLB 4X7SL 4F24A 5C08B 1OP5H 1BZQK 1D5BB 1L6PA 1YECL 3GLDA 5IQ7L 1USZA 5FPIA 2D2CC 3QHFH 3OSVA 5BQ7B 3RNQA 4GG6E 3WS6A 3V0DA 2CLZA 1YY9D 3OKNA 4M7KH 3VWKB 1L5GB 5SWZD 2ZAIA 2QSCH 5CUSH 5HI3D 3VFVA 1U8LA 4N86A 4TPRH 1JV5B 5DVKA 4JG0H 5DRXA 3SPJA 4ODTH 4TPRL 3WFEL 4JFXA 1MIEL 4ZG1A 4Z78A 2BZCA 2CUAA 2KUTA 2D7PA 4F9LC 1IEBA 3ILPA 3B8YA 3R8BB 2OJZL 5F97E 3QDMD 3L2MA 3H6JA 5C92A 1RURH 1WS8A 4UU9B 1GS6X 5JHDE 4K2UL 3DXAD 4F7MA 3P3SA 3ZYOA 2YOCA 3T2NH 4I89A 3JWDL 3HZVA 4PGCA 4Q0XH 4YHIB 2DQHL 3JWDH 1BP3B 2BOBB 1Q9KA 3HC4L 2D7TL 4MJ4A 3L54A 2G4GA 3L3GB 1MFDH 1F4YL 3EYUL 4ISVA 4NJAH 4FA7B 4Z3HA 5GRJL 4CDGC 2P26A 4QHKI 4FA8A 4ZFGL 1VADA 1AYRA 3GMMB 1F18A 3SCMD 5E08H 1BD2B 3QIBA 3H4FA 3WE6B 5ID1A 1IBDA 3MV9E 2V9QA 5KAQG 4LSQL 5EUOE 1LGVA 2NCMA 2AABH 4JG1H 5E51A 5B1JA 5IOPA 3US1A 1NAML 2D7NA 4ZX4A 1AGCA 2BPBA 5F7EL 4S0SD 4F7TA 5MEPA 5F3BA 3VYPA 1YECH 5IQ7H 4KU1A 3FB8B 4GXUM 3DBXB 5HYQA 3EYSL 3C6LB 4L29A 5G55A 3TA3D 3SGDI 1YYML 3BP5B 1PZUB 1UKSA 5F6HI 1CR9L 1QACA 2WLKA 3QIUC 5F1IA 3OKLA 3F7VB 5E9DB 1ZHNA 3KYMB 1LJMA 2Y1AA 2ENPA 1QUNB 4P46A 1ZHKA 4LIQL 5A2CA 2Z8WC 1T7XA 2NW3B 4DVBA 2GJZB 3FUMA 3H42L 4QUOA 1EEZA 1AD9A 1SGKA 2Y7MA 4PJ8A 5CIPH 3KR3H 4I1PA 4JQVA 4JRWA 2L0DA 1J1OH 5I1DB 4YVUA 3Q8BA 4HOXA 2BHFA 3ATDA 4E2OA 1ZV9A 1JZ5A 2WCPA 2BW4A 4NQXB 4FFYA 3E6HA 4PG2A 4G6JL 2D7OA 3HZKA 4YBHA 1A9EB 2XT1B 4Z7VF 3AQDA 2WW8A 4NN7C 1MZZA 1QLEL 5FYLE 2OP4H 1CDUA 3ZZLA 1S7XA 1Y6KR 4N0UB 3H3PL 5BZZA 1QBML 3KJ4C 5HYJE 3LAFA 4PUBH 5DMYA 1M57B 3P0YL 1C5CL 3HFMH 5AQ0A 1BMZA 3QWNA 4R3SB 3ALWA 3BEWA 1CVSC 2SEBA 5IVNA 2XRAH 2P5EB 3KH3A 2XBZA 3BWZA 2XN2A 1U8IA 3KYNB 5G5DB 3U30C 1AP2B 1J8HA 1TNMA 3QHFL 4DK5A 5ISZD 1PY4A 2PMZA 3CFNA 5IESL 1CI5A 1A6UL 4HHGA 3FU7A 4RX4A 1ZANH 1ZVSA 2WAQA 3BP6A 5FB8B 1NC4B 4I77H 5H37H 3U4AA 4Q9BA 1PYWB 5F9JA 1NH6A 1P4IH 2X40A 2V5YA 3HBGA 4MXWH 3LXCA 4XE5B 5DUBA 4AXWA 4MHHI 5F1KC 2KT6A 2WLIB 1WITA 3VFOB 2LAAA 4UOQA 1MRCH 4HGWA 2AEPH 1ES0A 2VRAA 4RQQA 1T89C 1ZDQA 2ICWI 5SX5K 3SCMB 2H0EA 5IW1A 2YA1A 2PW1B 1BQRA 1N2RB 1SXNA 1HK6A 3WEAA 5EOQL 3BD5A 5JHLL 5D7EA 3D39E 3FH7A 2X4RA 2PUQT 3ZTEA 1ND0A 1DUZB 3TBYA 4W9LC 3KYKH 2DIBA 3PL6C 1DBAL 2CIIA 1N64L 2WXGA 3UTSB 3IAGC 2XBTA 4Z77B 1KACB 2UXGA 5GRJH 1HSBA 1QPXA 4P5SA 3ETBF 2WTRB 3KLHC 3LDBC 1LO5A 2CHZA 3OR7B 2IGFH 1JE6A 5G4NA 5I1IL 3SDXB 5CGYC 1G7QB 5SX4H 1N5YH 2M8XA 3MRMA 3GMNB 2NXZB 3KNBB 1V27A 3AU0A 1U8OB 4O9HH 1T83C 4ZTOL 2YRLA 4P4KB 1DSFL 4K3HA 1X7QA 4FQXD 3NEEA 3DX3A 4HD9A 2Q9OA 3LNHA 3VI4E 4YSSA 4KVNH 1EAJA 5BQDA 4AL8H 1MIMH 1MUJB 1OO2A 2XQ0A 4O00A 4NBXB 1WBZA 2GBTA 3NZ8A 1QQDA 2VRQA 3VFWB 1XZ0B 3EZ8A 4AKPA 2NW2B 5HY9A 1XV8A 4PJIA 1OB0A 2E7BA 3ATAA 3EH2A 4M1GL 4MZ2A 4I2XE 2A6KA 1AGFA 3UPAA 3QAZC 2BNRB 1TJIH 2O1AA 4WV1C 4HOWA 5EDXA 1E30A 1TJXA 5FO8B 1HQRA 5HGBA 2WQUA 5I73C 1QFWL 1H5BC 3I75A 1K5NB 5IFHL 4NSKB 4YSPA 4MDJB 3HZVB 4LCYB 1J5OL 2FH6A 1G7HB 3A6CL 3VTMA 4LASL 1MXGA 4QHKJ 4TV3A 1LP9B 1ET5A 2OL3B 1NFDB 4RFOL 1WZKA 3TJEH 3F84A 3O9WA 3D05A 5FR3A 4ZO6A 1WAAF 4QXWA 2JH2A 2G9KA 2E27L 4BKLB 3I02A 2ICEC 5F7UA 3CVDA 1CD1B 1MJJA 4JY4A 4P4RA 4O4YL 5E1GA 2DTSA 5E1HB 5I66A 3D4CA 1E8XA 3Q0HA 3VX0A 2OMZB 1HHJA 1K9TA 2A6IB 4QHNB 3FFDB 3X1NA 4MA8L 2ZKHH 3ZTNH 3FCBA 3KBHE 3CHRA 2ZYHA 4TQEL 4GAAA 2H3XC 2Z91B 3ILQC 1ML0A 1UZ6F 5DJ8A 2XKUA 1HEZB 1HTYA 3PHQB 1LWJA 2EYRA 1KXQA 1HE8A 1SY6H 4K23L 3CDZA 3KXFA 4PRHE 1RK1B 1DLHB 2R1XA 4QRPE 4AYMC 3V6OC 2AZAA 3H9SB 3FU5A 2PR9A 2QADD 1IC7L 1DJXA 3FO1B 3ZE2E 3WXWL 4A2LA 5KSBB 1KC5L 4GLRI 5A1AA 1V54B 1UA7A 1XEDA 3W9DB 2WXHA 3M8OH 3TF7C 4AM0A 5KJRH 4EOWH 2EKJA 3UC0H 1P4IL 2YZ8A 1QKZL 4L8CA 3OGOE 2FJGA 4UIMB 1YYCA 4WFHE 3MJ9A 3UEZA 3ZMRA 4YDVA 3NFNA 3IRCA 1V3JA 3NJLA 2EDDA 4AJ0A 4IRZA 3BUYB 4PRIB 1S5HB 2LFGA 4IHOA 3NCJH 4OZFB 2DH2A 4LLWB 1CXEA 1TZIA 3HBPA 3ZRCC 4EZMA 2VABA 5FECB 3KPMB 3W3BA 1FCCA 3ZDZE 4QCIA 5MI0C 3KDPB 3KVQA 3FQUB 1ETB1 2VUYA 3GBDA 1J8SA 4PJIE 1ASPA 5DWUH 3ULUH 4YHYC 3K81A 1X5ZA 3OPUA 4MXVE 3APNA 4A7TA 3OZ9H 3HCVA 5CSZB 4XNYL 2XC8A 3RZCD 1AAJA 2FEJA 2FE0A 3HE7D 4NUPA 4OGAD 5D5MB 3WFBL 4FI8A 1OALA 2XFGB 2VJ8A 1MREH 4CW1A 4HHAB 1LO3L 1NUDA 2OLDA 2H6UA 2K4WA 4U1SB 5FLVA 1T6VN 1MRFH 2I07A 1KIRB 3WIIL 4BRJA 5LNDA 4JDEB 5DHDA 4QNPE 4MCZA 4QRSB 3P69A 4CSSA 3P54A 4ZNEE 4EI6A 2BY1A 3GXPA 1WP6A 4GP5B 4ZS7L 1L5GA 3LV3B 3QYNA 1U6AH 2B7DT 2LT9A 5D1XD 5KBKA 4J8RA 3ET9F 1DEEA 4HSAC 2NY4C 3DUUA 5JMOC 3IYLW 1NCNA 1Q9WB 1MFEH 5IB1A 5LWYL 4JRXB 5C0CD 1ACYH 2G5UA 3HN3A 5IMKA 1K6QL 1UFGA 2IPKB 3BWAA 4MCMA 3WIHA 3TJHD 4XAWL 3SOTA 4DHLA 3E1F1 3GO1H 3IETB 4PJ5B 4DK6A 5HGDA 4K9EL 1JZFA 2B77A 4MJ2A 4XWGH 3Q9QA 4B5ZA 3B8SA 4I0PB 3STLB 4P5TD 4Q6IB 1G87A 4Z7QF 5KBLA 4GUOA 1CC3A 2R56L 3R7QA 2D7QA 1MI5D 1TETL 1LO2H 3CSYA 1I1FB 5E1AB 4IIZA 3HR6A 1J88A 2EVHA 4H20H 4X6CA 5EF1A 3L5IA 1S7VA 4L2YA 5BXFA 1VADB 2GCYA 4YHIA 3EJQA 1WBYA 1QFHA 2Z93A 2HTKD 4U1HA 4UIKL 5I9QB 5D6CA 5F21B 1KNOB 4KTEH 5E03A 1UWEH 4Z0BH 1MCFA 4TKWA 5JIHA 3GMNA 4B50A 1CTNA 2K8MA 4ISVB 1CXIA 4R2GD 4S11A 5AVRB 3HG3A 5ICXA 1INDH 2BK8A 3EO9L 3LIZH 4ONOA 5ERWB 3BGFC 1X7QB 2XU9A 3LN9A 3L16A 3CZFA 4Y8AA 4JHWL 4GAFB 3C60B 4IRZH 3GK8H 1BLIA 1KPRB 3IM1A 4P57A 3HIZA 5LBGA 5E70A 4G9FA 4AEFA 2NY2B 3L7FB 1NWPA 5C0BB 1KCWA 1D7FA 5B39A 5F9WC 3P9MA 3TBSA 3SBQA 2GFBA 1YY8A 5HHMD 2KL6A 2V2XA 5D1QA 1IO4C 1ZHKB 1K4CA 1ZSDB 5IVXA 4JDTL 3UC0L 2QT6A 2MOQA 4PJ8B 2G5BB 4TM9A 3UJTH 3SO3B 4JM2F 2Y24A 3O3DB 2FT6A 3BSHA 1OCWH 5HJ3A 3O6LL 1ZHNB 3KYMA 4TULH 5EZJB 3VM5A 5BUPA 5J06A 4P99A 3JYBA 4KK5D 5DUPL 2AEWA 5FYLH 5J57B 1EEYA 1RJCA 1S7QA 1RZ7L 4MMXB 4GAGL 4L8SA 4MA3B 4U6YB 4TVSa 1XR8B 4AIOA 1OOWA 4WFGE 3OXSA 2BC4A 3AQZA 2BOLA 1TYJA 4GQ9L 3LQAH 2CDFB 4P0DA 3ZE2F 1T5XB 2B9BA 4P9HL 4PJBB 5D7KE 3DURB 3BLBA 5IJKC 3HFFA 5D2NC 3OC8A 4RZKA 5DMIL 2QV4A 4C57C 1FFOB 2WQRA 3W81A 1R6VA 4Y2DB 5ECGA 1X5IA 2XKSA 3TBBA 3G5ZA 3MCYA 1I1AB 4CADB 3QJXA 1ET8A 3HN8A 3MLUL 1AZRA 5FCUH 3TFBA 1D9KC 1GYUA 2DLHA 3HJ0A 1UZ8B 5DZOA 5JLZB 2HMIC 5LCVL 2D03L 4TSAL 4PREA 2ITFA 5E6IC 5FM4A 1IIIA 2FQDA 3CUPB 1RIHH 4YDNA 5B38B 5LCVH 2A9BA 5F96L 1CQYA 1MFVA 3N0AA 3K0WA 3NCBB 3EJYC 5C08D 4JM2C 4YGAB 4PJFB 2JB5L 1AZZC 2XWJB 4GSUA 4P3DA 3DWTA 3OAYK 4KK6C 3RY6C 4FG4A 5AWNL 3FBQA 1BVKB 3RVWD 5HI3C 3VDCA 5IB5A 1KIUB 1U8LB 1MOEA 1BPLB 1G9NC 2VR3A 1PLGL 3P30H 2OXGA 4UT6A 2Q6WA 1OM9A 3SGEH 5IKCB 1AO7E 4TRPH 3NTCL 3PJNA 2E8YA 2VDLL 2IPUK 3D85D 1OGAD 1XZWA 1P5UC 1XIWA 1MNUL 3HAEA 5HGAB 4LIQH 5C86A 2E9JA 2Q87A 2VDKB 2C3VA 3U82B 1RURL 5T5NF 3GTNA 2WBJB 1IILE 1DDHB 1TQSA 3A6BL 2EABA 1E50A 5CEZL 2ICWJ 4G82A 2VDQB 1G9HA 1SDDB 1AR1B 2ARJQ 1ID2A 2ESVA 1H15B 5HPMA 2XWTA 2VXVH 5CP7B 4DGYH 3BP4B 3O6FA 3A24A 2CBTA 5GGSB 4WUUD 3LKQA 5EORH 3VMOA 2G4EA 2FL5B 3BN9C 4X4ME 3T2LA 1UH3A 3WHXA 1AMXA 2BZ7A 4U6TA 1JGEB 1DVFC 2WXMA 1GKOA 2X38A 3OR7A 4KI5C 1HAWA 2Y3AA 2AS5M 4FXKA 3FQXB 4R7VA 1UT1A 1ESOA 3GKWL 1AHKA 2HX7A 2F7RA 2VUKA 1RIHL 5DVNA 3S3DB 2QV2A 5CU5A 1XF2A 5H2BB 1FVCB 2CKBH 1MAMH 3BT0A 4LCWD 4XTRC 4HCRH 1W6LA 2AJSL 4L9LB 1KGCE 4XT1C 2BMKB 5K9QI 3VXUE 1U95A 3D2UD 3MRCA 3VRIA 2VZUA 1T1YA 3UACA 2H0PA 4FXGC 1F02I 1L4IA 2ZKMX 2IAMC 3L45A 5KSAD 4U1LA 3RAJL 4FEMA 4KVCL 3QQ9D 1XGQB 4N9OB 2MCPH 3ZL1A 3ISWA 1CT8A 1FQ9C 3ARFC 3RFZC 3BIKA 4BCYA 2GB2A 2NX5D 4XC3H 1AD9B 2CBOA 4XTRD 3MLYL 1X6LA 1I8LA 3C09B 3GI9L 1AXTL 3JV0A 5E1AA 4DW2L 2ZONA 2NY3C 2FQFA 4HKBB 4FNLH 4HGMA 4XZUB 2X0VA 2F5BL 4X7CC 4V1DB 1IEHA 2EDRA 4KRPC 4LARH 1QP1A 4S2SA 3VQMA 4XNUL 3QDGB 4UM8A 3JTTB 5FDWB 3F6IA 3DRTB 2IVFC 5AB2A 4LKXA 4K94H 2NY0C 2C9VA 4A37A 5IFJB 3UJJL 4FHKA 4RGOH 5I8EB 1R5WB 2OTPA 3F3HA 4U1JB 1BLNB 1TJMA 3RVUD 4O02L 3PWLB 4U3SA 2W60B 4JW3A 1OAQH 1GZQB 3BH8B 5EN3A 1HQ4A 2QL1A 2IH8A 3BZ4A 4NQEA 1OGAB 4XOEA 3WL9B 4E9SA 4YDKH 4D9RD 1JNHA 1HWWA 1QFWI 4Q89A 1B3IA 4D0CB 4PV8A 4M3HA 2AV1B 3HC3H 2D4DA 3DYPA 2GEQA 5FOJA 3LKSB 1MCWM 2WO3B 3M07A 5F3FA 4WFEE 1HINL 5C07A 2MNJB 3SOBL 1B2WL 4RFNB 5D1XB 3VWJD 1E9PB 4NRZB 2W92A 4F2FA 1FLRH 2OR7A 3QFJE 2NSXA 3EOBB 3IJYA 2BVOB 5GS1C 3S3BB 4ZFZA 3WTXA 3SCMA 2Z3FA 4GUCA 4BYHA 5D6DC 3V6OE 1SJXA 4NRXA 3B2XA 4MJ5A 3FRPB 2W59A 3DIFA 3LQZB 4AV5A 2OX5A 5TE6H 1OD7A 3BISA 4HP5A 5AL8A 4DKEH 4EZKA 5IFHH 1GMIA 3PL6A 3QEHB 1TPXC 2B0SH 5EOQH 1HC1A 3D4YA 4PJCF 4HZAA 1E7VA 1PFOA 4GKSA 4PP1C 2L7JA 1URIA 1M53A 3LHPH 1YN6B 3QS3A 3KPSB 2CM5A 1JWSB 1SHSA 1UCTA 4RFOH 4KMTL 3SDDA 2R4SH 1KG0A 1TQBB 2E27H 1BF2A 3FPYA 4BXSV 4DJMA 3QORD 1H3UA 1NJ9A 2Q7AA 2VSDA 3IS1X 5JA8B 1D5ZA 2CO2A 4HT1L 5DRZA 3W57A 4RETB 3VH8G 5C0JA 3MCLH 4U1NA 1WZMA 3DX4A 3BKCL 4F33A 1FN4B 2FECL 2WGNB 1E5CA 4CC4A 1P0SE 1WC7A 4N0YH 2YKKA 1O6TA 2DJUA 2XRAL 1CPUA 4WO4C 4C8XA 1RUMH 2DH3A 3LSOA 1AY1L 1UUSA 3VD4A 1Q9WA 3RYMA 3VRLF 1OTTD 5GHWH 5EO1A 4P9ML 5AAWA 3ZBMA 3VXPA 4NKIL 1M4KA 1PGRB 1AP2A 5IMKB 3UP6A 5E6YA 1VDGA 1JF1A 2QSQA 3BLKA 1ZANL 2VQ4A 3UZEC 3UO1L 3GSVB 5D1ZD 1UWFA 5FOBB 2JCCF 4JHUA 4NQEE 4JRYB 3QFDA 3TX4A 1QWHA 1MF2L 2EJ1A 4LIQE 3E80A 1DVXA 3S35X 3NT0A 3F62A 4W4OA 4NENB 5T1JA 5GGUB 2YN5A 2C9SA 3H53A 2X4OB 2EE2A 3LKPB 3H42H 5F7HA 1MWAB 1T80A 4X5QA 3PQYA 4NQVB 4N0CC 1A3QA 3GT6A 3S4SB 4BM7A 1MG2C 1K8IA 2GSGA 1NFDA 4MAUL 4Z7UE 4CMHB 1AKPA 4FTDA 4HBCL 2PCXA 5D2LE 8FABB 1KDIA 1UWGL 5TE4H 1WPCA 2Y3NA 4D8PA 3R1GL 1G6RA 4JAMA 3TOPA 1BVOA 1PAZA 4UBDD 1QYGL 2TRYA 3IXAB 4K94L 3CDCA 4ZAKC 3DXAE 4ZW5A 1T2JA 4GP4B 2OSWA 5B1AB 4G9DA 4LO9A 2CXGA 3T8XA 3K6DA 2H8PB 1EJ6A 4M29A 2YRZA 1F8TL 4OZHF 2WZPA 3ARBC 4LL4A 3EG9A 3SO5A 1EDQA 5FF6A 5JIIA 5IGXL 2YEQA 4HIIB 1CS6A 4HLJA 3D3VE 4LGSB 32C2A 3GIZH 3TN0B 2OTUA 7PCYA 4OZGF 5EUOF 2OL3H 5AW3B 3ZO9A 5E00A 3VD0A 4LAJH 5I26A 4PG9A 3CZGA 2W9DL 5KSBA 2QVMA 1ZA3A 1AY1H 2VZTA 1VA9A 4PJ7F 4P2RE 1BMWA 3SOBH 1N4XH 3QIBC 4E9WA 1HEZA 5J1SC 2LLNA 2DM2A 2V3EA 3VO0A 3ZO0A 5KBPA 1KTDB 4AQ8A 5I18L 1VCAA 1TZGL 3ZW3A 5DHYA 1YA5A 1MF2H 3II1A 1NCBH 1SXCA 1RVFL 4RGNE 5CWSA 3V9EA 4F92B 5AVZB 4WW2A 1IGIH 5DJYB 3ZT7A 5FC9A 5A7EA 4KDTC 1WZ1L 3ZZSA 3RUGB 3AGVA 3UTPE 1I8AA 3E8UL 3M17A 4OFIA 3L6FA 1RHHB 3WIAA 3RVXD 2OMXB 1JCKA 2P8LA 3MO1A 2DM4A 3R1GH 3MRBA 1G7HA 2NZIA 2TRHA 1YJDH 3TM6A 3NPSB 4I48A 1JI1A 5HDBF 4DP5X 5HHXH 3GSQB 2WLMA 5F6IC 3RWFA 3ZYZA 4NERA 1BZ9B 3WY3A 4XRCA 1ZWIA 2MHAA 5D7LA 4IGBD 3S5LG 2KERA 2VR9A 1XF5B 4N8VG 1FDLH 5AOIA 1H19A 4L0YA 3BKCH 3CH1A 3CFCL 2E7CA 3QJQB 4BINA 1UM6L 2AAAA 2O5NA 4YAQA 3FFCA 2FLMA 3O6FC 5HVHC 1NCJA 5J11C 1N0XL 4FABL 4JFFA 5AENA 3RFRA 4YC2C 1MDTA 1UKQA 3AAZA 4F5CA 2XPGA 3IT8D 4X9GA 3L17A 4BWUA 3H6AA 3DA0A 4YO0B 5ESAA 1MW3A 2ODHA 5GZOC 2MOGA 1IEAA 4NEHB 1W15A 2XZZA 1SEQL 3N91A 1YNKL 3CFKA 1M6UA 1RZJH 3NSJA 1DL7H 4AJYV 2BNRD 4F27A 4ZX3A 4Z8FH 4JFDD 2FSEA 3DX6B 2X6CA 4JO5A 3C5JB 1HIMH 3J07A 1JV5A 3HS0A 5AOZA 4OZHA 4X9YA 4HBCH 3VM7A 2WXRA 2LLGA 4PGDA 1LE5A 2J6EH 1T7VA 3DDFA 3QSKB 5L2KE 1YEJL 1GAFL 1M71A 3ILPB 2Y6TE 5D6CB 2EDYA 5FHBH 3WKPA 2Q0ZX 4U6VH 2CJSA 5C0AE 4ECNA 1KIPA 3DHMA 4F7CB 1E42A 2CK0H 7FABH 4I1RA 3VFNA 3LRSA 4MD4A 1ZLWH 2NY7L 5BO1H 1UM4H 3MBEC 3EUDA 4X0NA 1B0IA 3CAFA 1BF8A 3LPGA 5CGTA 2E9GA 1SJMA 4H0IA 1OE3A 4S1QH 1Y07A 5IF0A 1V7NH 4NGHH 3CXHK 4O2FB 5EFIB 2FNBA 3LZRA 4LCCC 2J5LC 4XVTL 4MMZC 2ITCA 4ANUA 5ADPH 3MOBL 2P5WA 4TUJA 4HIEB 1EO8L 1I9IH 1S9XB 2I26N 1IZKA 5H4ZA 4MNQB 1DN0B 2P24A 3G08B 3O41B 3NH7H 1NDTA 1ACYL 5IOPB 4PJDF 5EZIH 1HHHB 3TO4C 3X3GH 1NLBL 2NNAB 1E6JH 1JVKA 1NEZB 4W9EC 3SGKC 3WHE1 4R84A 1EJOL 2VW6A 1KTBA 4GG8A 3NRPA 2WP3O 5ETUA 5JPMA 4Q9QL 3N43F 5EOCJ 1T04A 2FVNA 4QRTB 2OKMA 1PD6A 4BFGA 3D69A 3QEQA 4RZCA 4PJGE 3CZSA 2BNQD 4MX7A 4EVNB 4KJYB 4NKOA 2R15A 3MNWB 2Y36H 4IKJA 4Z7NE 4W9IC 1I82A 1BX2A 4N8CH 4RRPM 2BSSA 4NQCD 4NN5B 1TU2B 3IDGA 3MYJA 1K5NA 4WNJA 4D9RE 3A4DA 5DMIH 3AREB 5L4JA 3AGWA 5F7YC 1DQQB 5DUMH 4XMKH 1QPPA 5D4JA 5E9AA 2WNGA 1CICA 4HWUA 4WO0A 2X2HA 3DOIA 4GG6F 5KJ7E 4PREB 4Y16D 4LZKA 2VN4A 2EXWD 1QVOB 3AG1B 5KZCD 4QF1A 1I3GL 3ECBB 4KROD 1FFOA 5T8IA 3SY0B 2HFTA 5EBLA 5C07B 1KBGH 2I60L 5C0AB 5EO0A 3WL9A 5C8JB 2NY5C 4KKAD 3AB0B 4K3EH 5I1AB 3GNML 3QQNA 2CDEA 3ESNA 2H1LM 4L1SA 3WAKA 4LOUC 1TQWA 2D7MA 5AZEH 5DC2A 3V0WH 4IBLT 2QKIA 5J13C 2PTTA 1WFMA 4G6KH 2EYTA 1A7QL 3C12A 1K6QH 1FFNB 4NQDB 1HHGA 1YEKH 3R7RA 3N6YA 1U8NA 3N1FC 2G2PA 4OKVB 3S5YA 3LPPA 1TLMA 2LFEA 3ZX1A 1H3VA 3EFOA 1TTAA 4YHNB 1EJOH 4A2GA 4C4KT 4PR5B 2ZWNA 4G83A 4H0LC 1DJWA 1S5HA 5SWSA 5C0EA 4MGXA 3FXIC 4AK2A 2Z92A 2P5WE 2WLLB 2MNWA 5CNHA 4MB3A 2JKNA 3ZDYB 3WMPA 3MV7D 1SYVA 1H3WM 4XC1H 4UIMA 4BHUI 3NABL 5J3HC 3LN4B 4D0BB 1L9PA 3QRLA 4GKSB 2DBJA 4OAWB 4F3FA 1VKXA 4LL1A 1XSOA 4H20L 2F53D 3VFTA 2ZUSA 4LARL 2VDMH 4QXVA 5DD5L 2OJEB 3EBHA 4FTVD 1LE9A 4LF3A 1EH9A 3QUHA 5EDSA 5JR1L 4AT6A 5D5MA 3NVQA 4OFVA 5FECA 4Z7OB 3ARRA 3F5WA 1RERA 2DJ4A 1UACL 2VN6A 2C5DC 3P9WB 4HH9B 4MJID 1XH1A 3KS0J 4RBPH 2ZWLT 3RURA 1VPOL 3O8XD 2P8PA 3JV5A 5LB1A 4Z7VB 3T71A 3ZKXB 1YMMA 4JFFB 2NY6C 4RDQF 1OP4A 4N2IA 4JQVC 3CBKB 2DDQH 4KXAA 4BUQA 2A99A 1CK0H 1MFUA 3GTVA 3KXFD 3UAJA 1IVLA 1PKOA 2OMTB 2VAJA 4OLVH 5GGRA 4RMTA 1FL3A 1XEUA 4P2RD 1IM3B 2EDXA 3L9BA 4P2OB 1E5ZA 2ZKYA 1DSYA 3QIUA 5F0LB 5D1QE 1CR9H 2QGCA 2QVKA 1SYSA 5I0DA 3DETD 3OJ2C 3CGTA 3IJEA 1MIEH 2QTEA 3SDAC 3QO0B 3KLKA 2R1YB 5BCAA 1UOVA 4DPRA 4IHBA 5IQOA 4IRJC 1YEHH 1IL1B 1GYWA 1Q38A 2N7SA 2W9EH 2EIZB 1RIUH 3BVNA 4LK4A 5ENWA 1BXVA 1KXTB 5L4FA 3VACA 5F0PB 1XIWB 3U7AA 3SN6N 1P9MA 4KH2A 2GBUA 1K8IB 2GSGB 3A6BH 4U1IB 2I25N 1FE8L 1VEPA 4JFEB 5AKTA 5GJSL 1XB3A 3VFUA 1ZEAL 1JNNH 2IDUA 3EBIA 5B39G 5CZRA 2J44A 5DF0A 3GXNA 4M8RA 2IOMA 2MWCA 5GRYA 1QFPA 4M1DH 4NO2B 1CFNB 5FM5O 1DBAH 1CXKA 1GZPA 2B59A 4PWHA 4M7ZB 4FKKA 4S10A 5DFTA 1UJ3B 3SDCC 1MFDL 4OCSH 2FAUA 4KDWA 3VI3B 1EA9C 3AT9A 5E8NA 2BSDA 4PU2A 2HCZX 5D70L 2PABA 1G0YR 1JV2B 2O5ZH 4PJBF 3TCXA 4BFFA 1CBVL 4W93A 1L9MA 1W72A 2G0LA 1E5UI 3QR2A 4HLZG 4U3SB 4ZXBA 4U2ZA 5F1OB 5E7FA 5I24A 1WEJL 4LLYB 2HKFL 2J6EA 2ZCLL 4DKFH 1Y6MR 4N87A 4ZX6A 4NQCA 2F53B 2EDLA 2WVVA 2Z8RA 5DD0H 4TL5A 3T6WA 4KQ0A 4JO3L 2AV1A 2DPKA 4QRRD 3WFDH 3QDGD 5K9OA 1UKTA 2BNQA 4M7KL 2CLVA 1B0WA 3VD3A 1A3LH 5INCB 2GIYA 3FMGL 3RKDD 2HUEA 5I6XB 2K7QA 5D7LD 2MCPL 4OCNC 2PYEA 5FWQA 4PCTA 3E38A 1NFDE 1AO7A 2KQMA 3PGDB 5TE6L 3MR9B 4F91B 4L8SB 4FDWA 1DFBH 3WNJA 5IP4A 1PD0A 4I48B 1ZV5A 5D71L 3OLIA 1QFOA 2BSSB 3S5LA 1F58L 1HNGA 3BHBB 3OKEB 1A6ZA 2MPAH 4OM0H 3S96B 5HJ3B 3BEVB 4M1CC 1ZVYA 3MNVB 3MV9A 4JFPA 4KKQA 3ABKB 1ZLUH 3E3QE 3ZE1F 1SM3L 2DRUA 4G70B 2A6JA 4KK8D 3RVUC 2EKSA 4GW1A 1NMCC 3MAWA 4S2SB 4I2XB 3IGLA 3G6AA 1QVOA 4NN6C 3VGBA 5EWIH 3I74A 1G7IA 3MLXL 3BPLC 1KLGB 4N6RA 3WLBA 1U36A 4M3KB 5IWLA 3FTWA 2CHDA 2PLTA 4N2HA 4YPGB 4NBYB 4RISL 2RAMA 1N67A 3SE3C 1JVLA 2WVSA 4YX2L 4CKQA 4Y4HB 2EUVA 3QFJD 4TNFA 3AM8C 3LQAC 4JRFA 3IJHA 2N56A 2XLLA 1Y18B 4P5TC 5EUKA 4DETA 5GS0H 5GGVH 3QEUA 5GS0L 2HWZH 4R5XA 1NGYB 4XCFH 4HWBL 1K2DA 1N0LB 3K4AA 3K1DA 5GXBB 2OAAA 4YL9A 1LEGB 4LSPH 1UEMA 2G3ZA 4AWJC 1CL7L 2QPEB 1RD6A 3EUUA 5DDHB 1DE4A 3A6OA 5EA0H 2JI2A 5C7XL 5I18H 1ED3B 1KCVH 2DQGH 1KN4L 4NZTH 2RBLA 3CFDA 2E6PA 3ARDC 4QHMA 1JD9A 5C7XH 3U6RB 5FA4A 2FNWA 2MCMA 3RGBA 3BVVA 2H9GB 3BWUC 1Z6JT 2ALAA 1ASQA 4JS7A 1NOFA 1TFPA 4ZQKA 1D7CA 4OJEH 4Z7OF 1J5IA 1DBJH 3QPKA 4U0QB 2E5EA 4WLCA 3EADA 3WUWG 4PRNB 1F6FB 2DS4A 1S9WB 4DESA 1BZEA 3FQ4A 4JFFD 5C0FA 3GIVB 2C9PA 5F7DA 4OCWH 5SWSD 3BAWA 1TEGA 1NSNH 2JK5B 4XP5H 2Z7YA 4K71B 1TDQA 2KPWA 1WFNA 2XQYK 5DI8A 2ZKHL 2WWKT 1T03L 2VC2B 2D8KA 5AVQB 2A3TA 25C8H 5E4AA 1CGUA 1WEJH 1HI6A 1PU0A 2DQIH 3A4EA 2C4FU 4LU5L 2PWFA 1DJHA 3BMWA 4WW1B 2DQIL 3VG9C 1OGPA 4F9PA 5IMOB 1QEXA 2FH8A 4K5PA 3BIAX 2A74C 2X4TB 5HYSG 4GI9A 3SGJC 1E28B 3OAZK 1YC8A 2DQEH 3MACL 4PV1C 2WIIB 2YO3A 3TBSB 3QISA 3MACH 1M56B 1J5DA 3HTLX 4G8EA 2HVJB 1ZAGA 4MX7B 4MZIA 1KSRA 5ENWB 3N3EA 3VVVA 4AQ1C 4YK4C 3PNWB 3ETBJ 4P04A 4HPYH 1RZ8A 5DZAA 1PJWA 3NIGB 4X9IA 1CDGA 1MHCA 4OCXL 4ODWA 4OJYA 4E9YA 5C6TH 1LHZA 5F1SA 5B1BB 4GG6B 4H26A 1D5MA 4UUJA 4N2MA 2EXWC 2HFGH 5MEQA 3D0VB 5JHLA 4KBPA 3AMKA 5JIQA 1AG0A 3CD4A 4N1EA 1YEGL 2VR5A 4PJAE 4E41A 4YE4H 3ME0B 3FSWA 4PGBA 4XBEH 5TGBA 3BVDB 1FFPB 1C5BH 3ECBA 4N9GB 1TYEB 4QGTA 1II4E 2ZXCA 4KHTH 1WCQA 3H3KA 1X44A 5I28A 5CINL 4GNKB 5CLTA 1TFHA 5IIEA 4U1KB 3GMRA 2J12B 2WKLA 3FHEA 2CBMA 1UXWA 4N90D 4YQXL 4X9BA 4YFLF 2A0LC 4TVPL 1AXIB 4HKZB 4AIXA 2YMXL 3LRLA 4GT7A 3WLWD 5FAAA 3MA7B 4JHWH 4LMQI 4A2HA 2OL3L 1ADQH 2QELA 4YUEH 4HXBH 4AVJA 1KB9J 3GLEA 5FUCE 3AWEA 3M6DA 4YAQB 4MA7H 1X9LA 1X7TA 2GUYA 1KFAH 4HUVA 3GBEA 3MCG1 4OGYL 4TVPD 4JZOB 3BW9A 3NOIA 5T3ZD 3X11B 4MB1A 3QXTA 2OSYA 4F93B 1NLBH 4D0CA 4OV6F 1ES0B 1QAWA 1DQDH 3JWNG 1KTDA 5DLLA 4FC3E 5IR1A 1KCSL 4PR5A 3DV4B 1HH9B 1Y0LB 4G6ML 5CEZE 5AB1A 3ARGC 4AQOA 2AQ3A 1HX0A 4TQ8A 1CU4H 4URKA 1QLEB 1XXDC 4GIAA 3EGXB 5HYJB 5HYJD 3ULUE 5J12C 4UDTB 3BKYH 3WFHA 1UWGH 2J88L 1JRHH 2YR3A 2YBRA 5HDQL 1SDDA 4TSBL 3LD8C 4IGBC 2XVLA 4WFGD 4K7FB 1AS7A 4UNTA 4HD5A 4QTIL 2HFFB 2X3AA 3CDGA 3MRHA 2V2WB 2QLVB 4RMBA 1R5VA 2VLKE 3MRPB 5EZLA 4X7FC 4IRSB 4NQSA 4Y19E 5EU6D 1FNGB 5MP6L 1H3XA 4XAKD 4N0RA 4XNDA 5C3LD 1IE4A 2PCPB 2YMOA 4QRRA 1A1NA 2BOCA 2NXYD 4P2OD 5LAXA 1I9IL 2GC4C 1PNCA 4X50A 5LXGL 1O7VA 2YPLE 4R8WL 1BJ1H 2OCCB 4G59C 3VGEA 1OY3B 1YQVH 1SJEB 1E5BA 3N06B 3GJFB 3HZ3A 1NEZA 1EBAA 3KJ6L 4Y2OB 3DMMC 4BK8A 1WIPA 5CJQH 4WGVB 1OCCB 1CGSL 5IBTH 4JFEA 3OMIB 2YSTA 3A67L 2UZPA 1IC1A 3WY2A 1N2RA 1HHHA 2AANA 4MLSA 5EO1B 3QC5X 4P48A 1UH4A 1FIGH 2EIZA 3BVNB 4IBYA 4P3CL 4WUUA 3ML9A 5IW6B 4IDJH 1FIGL 4DOHB 1J12A 2P44B 1GGIH 4JRYA 3ZKMC 2UVFA 2DQUL 3BKYL 3FYIB 3VWJA 3D33A 4F5CE 4OM1L 2Y1YA 3REVB 5CEZH 1A02N 3X13B 1N26A 5D4IA 5TPWH 2PNDA 1TSHA 1IZJA 1CLYH 3VUAA 5DLML 1ZS8B 3OAUH 5IEHA 1DYZA 4J28A 3UC2A 3MXVH 3EHBD 3KLSA 5I71B 1JPFA 3JV4A 2NUPB 4OT1H 4XMPH 1WFUA 2KS0A 5CSBA 5A7BA 1HI6B 1KGJA 4NQQA 1Q72L 5A16A 5ANMB 5D7KD 5DS1A 3SSGA 2X87A 4I3GA 3DX7B 4KUCD 3ARTA 2VC2H 1T2QH 4J3BA 4FYRA 4A1RA 3VXQB 3Q6FA 2HA1A 4HH8A 2CUIA 5CJXA 3TURA 1WA0X 3MRNA 1JNHB 3WDIA 4ZMVA 2H45A 3DJRA 3PGDA 1A4CA 1TQVA 3VDBA 1F4WH 3HN5A 3U0TA 2I24N 1CFQB 4V2CB 4QR7A 2XN9B 4Z3TA 1M6OA 2RHEA 3RAJH 1CLZL 3S6CA 4OZGB 5CUSL 2DQCH 4FQLH 3MOAL 3F7LA 4LLMB 4NYLA 3WBDA 4NKMA 1BSIA 1SF5A 1AGBB 2ZZUT 4AUJA 4EUPA 5D8JH 2K1MA 1R5IB 1IAIL 2NW3A 3ME0A 1E2VA 4L4VD 4HUXB 3INUL 2ERJC 4WK4B 3FN0H 3NJXA 4DGUA 4G9FE 2CKBB 4BKLA 3JWNC 4PV9B 2YD7A 1NCAH 4DGVL 2ZP9A 3CK0L 5DJZA 5FHAL 3UAJC 3MGTB 4DOHE 2VLKB 5BS0D 1TCMA 5TE7L 1UM4L 2FYYB 3IJHB 3LH2H 2PXYA 2EINB 4IS6A 2R2EA 2VLRE 1L7IL 2Z6FA 1ACXA 3QNYB 4GIPD 3CH1B 2BLFA 1GXEA 2GSMB 1N0LA 43CAA 3F12A 4YSTA 1KCBA 2NY2D 4IEFA 1ZLDA 5MERB 3GJEB 1RK1A 1I3VA 3NJFA 2GJRA 1ZHLB 2TAAA 1BW8A 1MCKA 5FV2A 4Z3GA 3ZUCA 3H7LA 3P4MB 1OHQA 4OUUB 1P1VA 1OQXA 2VDKH 3RIAK 5CGMA 1YG9A 1QABA 4H88H 1ZJAA 5DJCB 4AMXA 2A6DB 4J39A 3HW7A 4DEPC 1LO0L 2DIAA 4TRPL 3QO0A 2CU9A 4QTFA 5MENB 1PSKL 4M7LH 5EC1A 2WZ0A 4HETA 4P23C 3D07A 3Q8AA 5H37A 3RTQC 4XX1E 4AQZA 3TZVB 2CHNA 1XIWD 3OGCA 1MFMA 3LEYH 3AC0A 1PMYA 1VAHA 4PRPB 4E41E 1LDPL 4OD3H 3KDMB 3INUH 4PRAB 1JDAA 2W0LA 1S7VB 2AQRA 3P0VH 4XAKE 4XB8A 5F1NB 4GI8A 4Q0XL 1SOQA 1QSVA 5A2JH 4C4UA 4GKZA 3GLAA 3NIFF 4LSTH 5CP3A 5BRZA 3KLHD 3BGMB 3F83A 3MV8B 3NSDA 3UIZA 3WO4C 1NKGA 4IU2B 3ASWA 3QUMB 4JPWL 3TVMA 3MV7E 4X9HA 4HKXA 2IG2L 5DRNB 4M7JL 1OAZL 1VCBC 2XACC 1GC1C 3ERXA 1Y1UA 4X80H 1U41A 3OPZH 4XCEB 1WD8A 1K3IA 2ENJA 5DZ9A 5EU4B 4XMXA 3S35H 3T8XB 3KNBA 3WKMH 2PPEA 2XJKA 4QYOB 3FRUA 1C5CH 5DJ2A 4M43H 5IF0B 2HVBA 2EEAA 2AABL 4JG1L 4DPCX 4J3OC 1DQKA 3BDBA 3PPSA 5H4YA 5HI4D 3MA9H 5I1EL 5IMOA 5DJ6B 3PWPD 2NY1B 5DC4B 5HYQB 2N7AA 2QTVA 4X7SH 5D2LF 2X4TA 5BW7A 1S9YA 2IFFH 3NFPA 3GXMA 1Z9LA 3HI6H 1KGXA 1OTSD 3FT3B 3MX0B 3V6ZB 4OY9A 4N3TA 3GKZA 2APXA 4RDQG 1UT2A 3RPKA 5C0DB 4JRLA 5AUMB 1U8PB 5FM8A 4KVCH 3ZKSD 1NBVH 4N8UA 3NZSA 1O7SA 5D8JL 1TCRA 4YN3A 3RZCA 3VFRB 2DYSB 1U9KA 3ZDWA 2I5YL 2QZQA 3BEVA 3WKQA 4KZCA 4BCXA 4JZJB 4G8GE 4Y5XB 3DPBB 2IDQA 4LHQB 5SX4I 5CIPA 2VDRB 2N1KA 4ONGL 1KIQB 2J1WA 4PJ5E 2EKSB 3LHPL 5KJ4A 1I8IB 4Y5VB 4AJWA 3OJDB 1TU2A 4N90E 1IQWH 3U2SA 1AFVH 3WCYA 5LN8A 1UHVA 2P47B 1I1AA 1BQLH 4CADA 2R9HD 3CN4A 3LOWA 4RH4A 3KM1A 5D93B 3QJVB 4R6UA 2E9IA 1EWHA 2P8MA 4ZQTA 4QGYA 5B38A 2WQWA 2FIRT 3STBA 4ZXBC 1I4FA 2YFOA 1FYTA 1EDYA 2QVTA 4IKLA 3DTXA 1QEWA 4XBGA 5JUEL 1I8LC 3W9DA 3TCLA 3V4UH 4IBVA 1NFAA 1KFGA 4QMEA 2WGXA 1WHOA 5C0IA 1QNZH 1UD6A 3PY9A 2WUBL 2OSLB 2TSBA 1ZIAA 4HISA 5D7IE 2K4AA 3E0GA 1KIUA 3H9SA 1L6XA 3CLEL 4XPBH 3NJNA 4LLMA 4LLVA 2YC1A 5T3XL 4CSZA 1GPOH 1PZ2A 3U0PA 4JHZA 5A2LH 4OZIF 1M9SA 3UPCA 3TFKD 4GS7C 4DP7X 1NBVL 3NUKA 4LVOC 3UYRL 2E6JA 3MU3A 1IGTB 4FMVA 3FSVA 2AQPA 3LNFA 3DOHA 4HEPA 4K8RD 4LDLB 2VMFA 3WXVL 3PJLA 5M94B 5KOMC 3KPRD 4QXTA 4OLUL 3OKMB 2HKAA 2MQCA 1RUAL 2QSTA 3DX8B 1E4XL 4LASH 4G71B 4L37B 4P2AA 2KBGA 1UA3A 1KWGA 2ORBL 4LFHD 4ZPTA 5AB0A 5HI5C 1A6ZB 4U33A 5JW4M 5SWSB 5C0EB 2PW1A 1E6OH 1S8DB 2EVIA 2YBRB 3O4LD 5DYFA 5EU3B 2R2EB 2F61A 1OF2B 3SGDH 1IT9H 4W9FC 3VH8A 1NSNL 1U8QA 4LLAA 1IC5L 2PTVA 3PQYE 3QULB 2ZSVB 1NCCL 1P69B 4KUZL 2G60H 1J0JA 2UX6A 1TVHB 4WK2B 4EDXB 1ZGLB 3NDZE 3ULSB 2CXKA 3B1TA 3MRKB 1R3JA 2HRPL 1KXQE 3L4ZA 1PG7H 2QGDA 1MI5B 2XOTA 3JYCA 3ARFD 4UDUA 1P5UA 1T1ZB 4HX1B 4P05A 5DTFB 4KGJA 2WXQA 4P59L 3SE8H 1MUJA 1DBBH 4UZUA 3D4ZA 2CWRA 4NUJA 1SOKA 4FZEL 4HXAH 1VIWA 2C9RA 2FEEI 1YEIH 1R33A 2P8PB 4FFWD 2R29A 3DUSA 1CD0A 3NP3A 4I0PA 4M56A 3FS9A 5KAQF 3O2WH 5HDBE 4APQD 1JERA 1K2DB 4JR9H 1JWMA 4CVWA 1DBKH 2CR6A 5B3NA 3IETA 4DQOL 1G7LB 3QUZC 5DS8B 3QQ3B 5FS5A 4ELMB 1DE4B 3AS0A 3O8XA 4P2RB 4U1GC 1EIBA 3UBFA 2HJLA 4XN1A 4S1DC 1HH6B 3UZVB 1J0ZA 2UXTA 4PWIA 2PYEE 3LN5B 5TGBB 2FX8H 1JZ6A 5EIIB 4PCSA 2VZ1A 4FFWC 2HT4C 5ICXB 3UABA 5JHLH 1B6DA 2XXCB 2Y9RT 4BA8A 4JY5H 3L1GA 1J48A 3CNKA 3DPDA 3I02B 4Z78B 3IKCA 5FHBL 1M05A 2CE6A 1FO0B 4YR6B 2J55A 1KXTA 1QG3A 4Q14A 4PBDA 1P4BL 1PVHA 1SDAB 4YLCA 3Q6FB 1G5GA 1GZQA 1R3HB 4AGQA 4XX1G 5KYXB 3GGWA 2D0HA 3H3PH 4Y4KA 4JUSA 4FNRA 1KGIA 1VFMA 2EXYD 3LTVA 4XHJD 5BS0A 3TWYA 1TEYA 3OF6D 4IOSD 3GUTA 2JVUA 1XD1A 3PABA 5I5RA 2KZBA 1J7VR 2YK1H 3IU4L 1QLRB 2WXIA 2DZEA 2R1XB 2YD8A 4XNAA 4JK0D 3HMWH 5JOPE 3G04B 2P80D 1J8HD 3EYQD 1QO3A 4EEEA 4K23H 3L3IA 3VXRE 1AGCB 1JXJA 2GY5A 3ALXA 3VXTA 5C8JA 4PPTA 2Z91A 3APMA 3UZQB 4F20A 4PP1D 2PO6C 3WE6A 4ZTEA 3B5GA 3F64A 3L4TA 4X6DB 5IM7B 4N2GA 5ES4B 3ULVD 1J8HE 2PPCA 3CV5A 3VU2A 5ACMA 3QDGE 5AOJA 4FQIL 3OX8B 2XVKA 3H55A 3HI5H 2CJTA 4QAWA 4HUVB 1F6AB 4XZUA 4FQIH 3ETSA 3TASA 3QEHA 1DQLL 1KBBA 3HBQA 1E4WL 4OIIH 5C6PB 4DP0X 2DKSA 3FYEB 4FQ1L 5SV4A 4HWNA 5L0QC 1IGCH 3T0VA 2JKWA 5L88H 2WSKA 3SYOA 2XTJB 3F85A 5GJTL 3BRFA 1GH7A 1FZJB 1GY1A 1YJDL 4NQXA 2HLAA 4DZBA 2HRHA 4S1RL 5BUGA 1PG7X 2AQ2A 5F0MB 1H3PL 1W8OA 2R4RH 3V0FA 4OI8A 3VFPB 2X9WA 2X9YA 1LK3L 4PWFA 3BYTA 3KYAA 4XXCC 3WJLC 2VO8A 4Z7QB 4UZGA 1MH5B 2EIJB 3LS4L 4IBTA 4MSWA 3ALPA 5HHOD 2CUHA 3VGAC 2PETA 4ZW8A 2UUDH 3EKCA 5CZVL 5FGRA 2AXFB 3GIZL 3GJEA 4TLTA 1GGCH 2HFFA 3CDGB 4YS4A 3FUKA 4PJEA 1OW0A 2XI9A 1SBSH 2I60H 3QI9B 4XPAL 5A2BA 1DJIA 1IFRA 3K6SB 4Z0XA 1G7IB 1OARH 4XPTH 4CN1A 1L9OA 2X2IA 4M02A 5I75C 1OARL 2VJ0A 4XPTL 4J7RA 5FO7A 4Z76B 3DGCR 4M93B 3LZFH 2FIKB 5KSUA 1L3WA 2D3JA 2VDNB 2AJ3A 4B9CA 3MRIA 4PRPA 4OH2A 1KYAA 2R1WA 3JWOH 3HE6B 1JPSH 3N44B 4LCIL 4ONFL 4G8FB 1IX2A 4OV5B 2YLKA 4GUPB 1OAYH 2FBRA 5AEAA 4EN3D 1Z5YD 1M1SA 4JZOA 3IPBA 1SEBA 3I3EA 4JFED 2J5WA 1EAQA 1NIFA 5IVXF 4NQED 1FH2A 4XO9A 4LHUG 4ELKB 3QQ9C 5HBBA 5AZUA 2X9ZA 1QLFB 5I6PA 4FZ8H 4XPFL 3T0WA 2YD3A 3OBAA 5F0JB 1ORQB 3AFLA 3U0WL 4JN1H 5D5MF 1GAFH 1XGPB 1SUHA 1SXAA 3B7YA 2NXYB 3QUMH 1ZVNA 5E9DE 3MV8D 3U46A 1U8CB 5TPWL 3TS8A 2A77L 4UU9A 3T1WA 4GAJL 5E8PB 4L1LA 4Y7MA 4QYOA 5DJ2B 4ZUVA 4OT1L 4F7MB 2VN7A 4CN6A 2OMYB 5CMAB 4RMWA 1RK0B 2VDQH 2K3HA 3L4UA 1FORL 3P73B 4LP8A 4O4YH 1OZUA 1NEPA 4YHLH 5EULV 1JWUA 5JR1H 5JYLA 2XJLA 4QTIH 2JKIS 2GJ6B 1GZPB 2B59B 4IOFD 3FB7B 3ARYA 3PU7A 4H1LA 4HF5L 1D6EB 1XT5A 4R4FL 3TONA 4NUJB 3QPQD 3EO0A 2WQVA 5F7KC 1BGXH 3D5OF 2FWOA 1MFCH 3MRPA 3O4LB 4NZUL 5EZLB 3DUSB 5A16B 2UWEA 2NRDA 4ODHL 3KGTA 4G1MA 1NICA 3K4ZA 3GMQB 5ILTL 3V0EA 3WEBA 2JLLA 1ZLEA 5CR1A 1EEQA 1WBZB 2BINA 2B1OA 1GC1L 1MVUA 3SQOH 1XCWA 4MVBD 2DQFB 4O2EA 5AVSB 3EH5B 5C71A 2WZAA 5FCSH 1EUTA 3ATBA 3FFCD 5FFOA 3ESOA 4LVHB 5DT1H 1O5DT 2CJ3A 3N1GC 3S4SA 2UY7B 2VMDA 2XSKA 3U0TB 1JMZA 5KUMA 2YAOA 4H5SB 1MWAH 3H54A 4AKOA 4JMXA 5ESVB 1QSFA 3D9AH 2YUZA 3RPIB 3WFCH 1UD3A 1JBJA 3IKCB 4PS7A 2J8UE 3MFGB 1VJSA 1CDBA 2WY3B 3GC3A 4PRPE 4Q6KA 4WU7B 5CJOH 1NIEA 3X12A 4JB9H 4PCYA 4WHYG 5JW4N 1JRHL 4OF8A 1WT5C 3SDYH 4ZW6A 4ACPA 3MJGX 3T8VA 3DRTA 3ZTJG 3BKJH 4PFEA 4U7KA 4PVBA 3D87B 1HKLH 3OLEA 5ESQA 3ZKNC 4AQAA 3UP1A 3MNVA 1JF5A 2CDGA 4QDGA 2JKXA 7FABL 3K2KA 1N8OE 3UZEA 4KXCA 1V05A 4C54A 5EB9A 2BSEA 5EHFA 5KVFE 2XWBB 3UG5A 4IU3A 5DMJB 3ABGA 3O4OC 1UM5L 4TQIA 2WKGA 1OGAA 2FJFB 3MA7A 1ZA3B 3WS3A 1EO7A 2APVA 3GZKA 4KROB 5T3XD 3UYOD 2K45A 3DRQB 1J11A 2OZNA 4FLRA 2OSLA 4GQQA 4WUKH 5T5FH 1HILA 4TLSA 3ZGIA 1G9EA 2LTQB 3ULUD 4NNXB 3KEDA 4CL7A 3KWWA 2J8UA 4ZAKA 3NH7L 4U0RB 4EZJA 3JV6A 4HS6A 2X1OA 2BP5M 2X4SB 1NBYB 3DUHA 1ZPLA 3MCKB 3CZLA 4D7PA 2Q3XA 3AQXA 4LPXA 1OLLA 3TA4D 4YBQD 1YEHL 4OGXL 2KMWA 5F2FA 3NPZB 5TQ2L 4AEHL 5DD6A 1HOEA 3IDMA 1OF2A 2GEEA 1VEMA 3B9KA 1JCVA 1WD9A 4AG4H 1U8QB 4MQ7B 3TIDB 3DVNB 2ED7A 1HL5A 3U6XS 4M7LT 3HE6C 1J05A 2VE6B 4RRPA 1E43A 3FUDA 3ARGD 1MCPL 1H8SA 2GIXA 4LCWE 3H7BA 1RCYA 1CF1A 3PHOA 4KJPD 4WHDA 5JIPA 5KW9H 5EU3A 1UWEL 4Z0BL 3MRLB 4FNUA 4IOFC 1SVCP 5I8CA 5JXAH 2R0KH 1BQLL 1YNLH 3F6JA 1E90A 5EG6C 1P7QA 1PPIA 3QI9A 3QIWD 2Z34A 4HDIB 4KY1L 5LGJB 3HE7B 3JT2A 1CG9B 4X8JA 5TQ0H 2O5ZL 2X53A 4Y9FA 4HWZA 1T2QL 3PWJB 5E24E 3NBNA 3NDYE 2D03H 2FUTA 4RX4D 3HCVB 3HE6D 4H8WL 4DAGL 5KSBE 4HJJL 3OXRB 4L97A 5KSUB 1JYWA 4UTAL 5LVEA 3GSVA 4Q4EA 3NA9H 1GTNA 2VDPB 5F7LB 3VG0L 1A1NB 3DJZA 1WYJA 4FNPA 4XNQA 4WUKL 1WGVA 1S7TB 4C59B 1WRFA 3UDWA 2Z4TA 4DO5A 2IAND 4WHTA 3B3BA 5H35A 1S7UB 3IFLH 1J0IA 4PRID 5DWPA 4E36A 1Q0XH 1F56A 4G7VH 4JFQA 3EJJX 4YNYA 5FXCH 3VNZA 2O93L 2HJFA 4WI0B 3K91A 3ARVA 2RALA 2VMCA 1LMKA 2FECI 3UBXG 4N0CD 1CLVA 3SKJH 3DROB 4KC3B 4X98B 1WFIA 4PJIB 4R96B 5AVWB 2AK1L 4J8QA 1LQBC 1TF4A 4CNIB 2X2YA 4WWNA 1OT2A 2X4PB 4QLWA 4UZSA 2OZ4H 3R8QA 1ZLSL 4GW4B 1BX2B 1FAKT 2OJZH 4PQXA 1RZPA 3WKNA 3RA7H 4N2BA 2XPZA 3SEPA 5JW4R 3CHQA 4D8PB 3U2SB 3JWDC 4FNQA 5C09D 5IQLA 3VI4F 4KQ4L 1ZEAH 4H26B 1S78C 4WTXA 4UAOC 1YUHA 1ZS8A 1OOAA 3FN3A 1BM3H 1PLCA 4MBRA 2FJHB 3SZ6A 2DTMH 3WIHL 2R59A 1L9NA 4TNWK 5K93A 5K69A 1UB5A 2Q7YB 1L0XA 2I27N 1QLEH 2Z1KA 5HJDA 4BDVB 4PJEE 3GS4A 4HT1H 2JIXB 1VPOH 4QO1A 3CFJA 2P48B 2VZSA 2Z93B 2C4XA 4I18B 5E6RB 1MFAL 1A7NL 2UXFA 4AKQA 1PG7L 2J1KA 4FCHA 3MLVH 2WQ8A 4LVNC 2EIKB 4LU5H 3DECA 2UY6A 1KPUA 2WAHA 4GQPH 4JGUA 4NKDA 4BGDA 4YZFE 4KVNL 5B8CA 1IBZA 1BXUA 4M48L 1ZSDA 3UFIA 4QRRE 2NUTB 4JM2D 4Z7WA 4GP8B 2UY7A 2WXFA 1C16A 3WNMA 2IBGA 2RJMA 4HJGB 3EFOB 3IFLL 2ZOTA 5IMLB 3NFPB 4AYFB 1PSKH 4M7LL 4ZFFB 4A04A 3LEXA 4JY6A 1QSFD 2NNRA 3UTZB 1SLUA 2EADA 3POHA 4HAGA 3DX9A 5AYUL 4LEXL 3UTTA 3JZYA 2FUQA 2GJPA 3U0PB 1AD0B 4MCYA 1EEYB 1S7QB 1XMWA 1MHPH 2FHCA 3IU3B 3BZDA 4BFIA 5AD0A 4KV5E 3GMPA 2EDHA 2ZPKH 3U1QA 1O7DE 4PHXA 1OTTC 2DYPB 4X6BA 2MH4A 3WSQL 1J5OH 3ZKND 4ONGH 3SDDB 3U6XA 4CRPA 4KRNA 5CHNA 1TZIB 3B9VA 3G5XA 2DQDH 4PV9A 1L9QA 3E2HB 1GGYA 2CIKB 2QQKL 5CD5D 5EWIL 2D7TH 1UXLA 4LCUB 4UV4H 3WNKA 5JXAL 2AJVL 2DMBA 1XH0A 2IBZX 3OJDA 3U9PL 1N10A 4XO8A 3KPSA 4HOMA 5BS0E 3GRBA 3FCTB 2WBXA 4XRCB 1RY7B 1IM9A 4L3EA 5GGTH 1BVNP 1F42A 3Q2NA 1FNEA 1FYTD 3GSNA 1WO2A 4W9ZA 4H8WH 4NHUB 4O51B 1CYXA 2Y4SA 2XZQL 1XGYH 4EN3C 5JIMA 3ISYA 1FZOA 1TZ8A 2V2WA 5AAMC 1O75A 3QZWA 4NRYA 1SJHA 5KSAA 4AM0Q 2H6PB 3UJIH 4YFEA 3QDJD 4MKMA 4RFEB 4PYGA 4UDUB 5DTFA 1E4JA 1UZ8A 2J8OA 3QWQB 5DYOA 5JLZA 1NCDH 2E76C 4RMVA 3AW5A 4NIKB 4JO3H 3RGVC 3VXMB 1B4JH 2WZ5A 1B4JL 3S7GA 3VW3H 3ES6B 1LE5B 1DZBA 3APCA 2WLLA 4Y4HC 2HVKB 3EJZD 4M8UA 1EXUA 1QSFE 1NEUA 3HPLB 3RQ3A 1HH6A 5H94B 4MQ7A 1JF1B 2Z7UA 3TIDA 2HPOA 1HVXA 1EANA 3L7EB 3VFGL 5EBGA 2X1WL 3HRZA 1W72H 4I5BB 4H8HA 4NLAA 4OIFA 1WZ1H 3ARWA 4Z7UF 5JO5A 3KR3L 5MEND 1IGCL 2KKQA 1N3NB 3QG6B 4NI3A 2QVFB 2VYRE 3U48A 4KZ0A 3E2HC 4TUKH 3HLAB 5EEWA 3IK2A 4FTVE 1I1FA 1CG9A 4PI0A 1N64H 4X8JB 4ZOAA 3OZ9L 1DDHA 5BZWB 5A2AA 1RAMA 4YOKA 4Z3IA 1A2YA 4EBQH 5GS1A 4QWWC 1WLHA 4PJFE 3GMOB 2DLEA 1U42A 2QDWA 3S2CA 2RCSH 1T7WA 4ZXBB 2G60L 4QT5B 5I1CH 2VMJA 1O0VA 3KPRB 4Y16C 2IV8A 1T03H 3RKDC 5BOPA 2B4CH 2WJ7A 4EKJA 4JHBA 4Q2ZB 1E3FA 5HHMB 5DJXA 1DSFH 3MFFB 4ZT1A 2XVBA 4TVPE 1JNLH 2XQBL 3PYCA 2PO6D 5I76A 4B53A 2FO1A 1T1YB 4HWBH 4LQ1A 4YDJA 3FRUB 3K2IA 2OM5A 3SD2A 2Q8BH 2BP3A 3NCEB 1DJYA 4Y5XC 4P46B 3HNTH 1NCHA 3PWUB 4KMLB 5AOMA 1SVZA 4KK8C 1OAYL 2XV2A 5IG7A 1MELA 3I6GB 4XN2A 5TK4A 2AQ1A 2XZCH 3ENEA 3A67H 3KPPB 3LZNA 3VWJC 4BGLA 2N59A 4PW3A 2X5PA 1QFUH 3VI3E 2XTJD 3M88A 3EGSA 4N26A 4NWTH 4WAFA 2J6WA 5ID0A 3G7TA 3QUXC 3VDAA 2V9RA 2BS71 4X2UA 4NOFA 2DLFL 2J43A 4DP6X 3BYYA 1AC6A 2VISB 1I7ZA 1GZHC 1RK7A 4PRBB 3DARA 3KD4A 2OA9A 4NFCA 5FK9A 1QRND 2P8LB 1MFNA 3AUVA 5E0FA 2CDEB 5TFSH 5BVJA 5CIPB 1RJYA 1WJ3A 2C9AA 2E6QA 1RZKH 3OKDB 1U3HD 3MGTA 1H3GA 1R3HA 1TKWB 5IGXH 5I0YA 3TEZA 1C12A 3NFSL 4LKXB 3RTLA 1KGWA 5EO0B 5JW3L 2LR4A 4M8VA 3T65B 5CLYA 4P59H 2V7HB 4HSQA 3SE8L 5JW3H 4GRMA 3TCTA 1U8KA 4WRLA 1QOKA 2Q86B 4E9XA 1OGTA 2NY6D 4HXBL 4FZEH 4HXAL 1NWOA 1M9WA 4MWFB 1PNDA 5E8OB 2X88A 1N4XL 5JMRA 4PJFA 1INEL 1LILA 3M8OL 1YZZA 3B56A 3QXAA 5T3ZE 3MCKA 4UT9A 3OMAB 5IBLC 4ZPVA 2M1KA 3IN2A 1ITCA 3UPRA 5JYMA 1FC2D 2Y7OA 1G43A 4GEIA 4F8OA 3HE7C 4OGAC 4MJ5B 5HYFA 2OCJA 4GY4A 4M5ZH 5AW0B 2J56A 1KGCD 1SLXA 2AJYL 2VM9A 4IDJL 3TZVA 4P23B 2X4RB 2JKJA 4OAWA 5I1GH 1YEGH 3TA3B 1CFTA 4Z7NF 5A2IH 3EDFA 2X6UA 2NR6C 1S5IH 1XDTT 8PAZA 1R0AH 2YSSA 4WJKB 3AT8A 4PJGF 2MSPA 2F1BA 3F7QA 3NSYA 3DIFB 3DIVA 3DVIA 3LQZA 1X5GA 3OKOA 5DWUL 5FYKL 2Y23A 4UINH 1LK3H 3LXAA 4R9HA 1GGBH 4B9IA 5HPMB 3D08A 1N6QH 4AYBA 1BIHA 4GKOA 4YQXH 1A7OL 4IK6A 2BP0A 1TVHA 5CILH 1EO5A 3WTVA 4HIHB 1NLDH 3BESR 1OD9A 3L4XA 3O9WD 43C9A 4B5EA 4JO4H 3KE0A 4R7XA 3DNKA 4LT7A 3RX8A 3TO2A 3VFMA 5DGQA 3CCHB 1IAIM 1XF2B 3S37H 2JJTC 1IC7H 4MQXC 3N43B 3JTSA 2OXHA 2OMWB 1XQ4A 1S9VA 5HDOA 1YNTA 3FSOA 2B8OT 1GS7A 2YEZB 4GO6B 1VFUA 1VFOA 2LGNA 4KK5C 3U9UB 1RVFH 4U1IA 4UM9D 1UCBL 3KPNA 1UJTA 4O5LL 3Q1EA 1YNKH 5DS8A 2ZP8A 3GM8A 5JOEA 2BJML 5GISL 1UADC 1IGIL 1PW3A 3O4OB 2PWHA 1MCEA 1AOHA 1MW1A 5D2NA 5T3ZH 1LP9A 4GJTB 1F1GA 3BWSA 4L92A 3O11A 2JELL 2XN9E 1UB5B 2UZXB 1A3RL 1FNFA 2ROXA 3VD5A 4FFZA 2VDPL 3AABA 3L3OA 2WYTA 1MFBL 4HIJB 3AREC 2YN3A 1SUJA 2L7EA 2YD4A 5DVMA 2YLHA 3BAEH 3QEQB 3LPFA 5IIEB 3SD5A 3QFJB 1A9BB 2CA3A 4NNYA 3PS6A 1PKQE 2WNXA 2WTPA 4DP4X 5KBMA 4OCMC 3SGJA 4ZMOA 5GQBA 3F01A 5SWSE 3W39A 4XP6L 3TBTB 3N5AA 4TSCH 2G9HA 2VKXA 1CYGA 1W0WB 2CRYA 3P73A 3RL1B 2HAZA 1ZOXA 3FUHA 5TDPB 3MC0A 3W11D 1KBGL 1KELH 1DQIA 2IGTA 1IGYA 1OLZA 3FBKA 3GUTB 2DBLL 4LVHC 1C16B 3EDDA 4I85A 1RUPL 1TZHB 5SWZA 2OMNA 4ZFFA 4MS8D 1H0DA 2A83A 1AGEA 2WZ6A 3TF4A 3FUEA 5I71C 1DO5A 1LO4H 4DK3A 2Y2WA 2BS9A 3O81A 1EGJH 4ICWA 4WGKA 1INEH 2YA0A 3MMEB 3OR6B 4ZMTA 2IALB 1TUPA 1P84J 3V4PH 1ZV2A 4NP9A 3KPPA 1D7DA 5HGGS 5IR1B 3MJ9L 2J5LB 1Q0XL 3T77B 2CRMA 2BVPA 2B16A 4FYTA 2EDOA 3CSBA 4WWID 2PXYD 4S1SH 3MKKA 1SN5A 2RA1A 5FGBA 3IFNL 4LP5A 2DWXA 5GRWA 3P9LB 2X9XA 1OZTG 3VGFA 2X0WA 4I2XA 3TV3H 1S2EA 1FSKC 4YHNA 4BQ6A 1A1OA 4B27A 2W07B 2J6EL 1EZSA 3H7BB 2ADFL 3LNDA 4E9RA 1F3JA 3RPIA 1R0AL 3F58L 4JJOA 4J3WA 4LVEA 3IDMB 1FGNH 1LK2B 2GABA 5JOFB 1Z1WA 1LNUA 5T1MB 3HKFA 1P5VB 4PJXF 2QFPA 3RVTD 4LCUA 4TNGA 4J2QA 4QHUB 4EI5B 3T0EA 3JXAA 2JQAA 3EYFB 3RGVA 3Q2CA 5D7HA 2APSA 2VQ1A 2VXTL 3BGAA 1UWXH 3VE0A 1KJVA 1VRSA 4L3CA 1KELL 4L8BB 4EJ1C 3L13A 4RMRA 4MMYB 2WLYA 3MV01 3IKKA 5JDSA 4ADGA 3T09A 4YWGH 2ICWA 4YHPA 5FW8A 4JO2L 5DVPA 1RP9A 5DHMC 5C0ND 3QEUB 3CIQA 3PGFH 4QD2E 5DVOA 2NQCA 1SXSA 1REIA 5GS2H 1U93A 3CQQA 2BXZA 1A25A 2JTYA 4N2AA 2VH5L 4NHCL 3UTTE 4XX5A 5DRXB 4IMKA 4NT6B 1B9ZA 5HYEA 1P4LA 1N3NA 1CLZH 3CFKB 1UH2A 2MMXA 4Y4FA 4HMCA 5DJDA 2VL4A 1P7QD 3D0LA 1O9VA 5IW6A 2H2SC 3MJ7B 5B3JE 3U4EB 4YDLC 5D1ZA 5FOBA 4OFPA 5DFWH 4YO0A 2NYZA 5ESAB 3HG1D 4YHOL 3SKOB 4JFWA 3SYAA 3BUPA 3SYQA