1ZS6A

Structure of human nucleoside-diphosphate kinase 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
152
Chain Sequence
b'TGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase 3
publication title Structure of human nucleoside-diphosphate kinase 3
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 152
sequence length 152
chains with identical sequence B, D
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1zs6A00
3PJ9A 3ETMA 4DI6A 3JS9A 4ANEA 1HIYA 3B6BA 4CP5A 5CAAA 1XIQA 3NGUA 4UOGA 4FKXA 3FBEA 2B8QA 4ANDA 1MN7A 2DXEA 3MPDA 1NSPA 1HLWA 4ENOA 3G2XA 5IOLA 1BUXA 1WKJA 2AZ3A 3PRVA 3ZTSA 1F3FA 2BEFA 5C7PA 1HHQA 3Q86A 1JXVA 1NUEA 1LWXA 3ZTOA 1WKLA 3Q8UA 1XQIA 2DXDA 4F4AA 3B54A 3EMTA 2CWKA 3VGSA 2DY9A 2NCKL 3Q83A 3ENAA 1PKUA 1NSKL 3BH6B 3EJMA 2ZUAA 4W98A 3VVTA 3GPAA 3VGTA 3BBFA 1LEOA 5CABA 4S0MA 1ZS6A 1UCNA 1NDPA 1NHKL 3FCWA 1NLKL 4WBFA 4ANCA 3GP9A 3EICA 4O0NA 1BE4A 2AZ1A 3EE3A 3Q8YA 1B4SA 3ZTPA 2HVEA 3Q89A 1F6TA 3BBCA 3FBFA 3VGUA 1BHNA 3EVOA 3BH7B 4F36A 3DDIA 3L7UA 1NDCA 3NGRA 4HR2A 4UOFA 2HURA 3NGSA 1K44A 3EVMA 3FBBA 3FCVA 3EVWA 1EHWA 4EK2A 1WKKA 2VU5A 3ZTQA 1S57A 3FKBA 4UOHA 1MN9A 1S59A 3ZTRA 3R9LA 4FKYA 1NDKA 1KDNA 1NB2A 3BBBA 3DKDA 1NPKA 1NSQA 4DUTA 3VGVA 1B99A 1S5ZA 5BXIA 2DYAA 3WX8A 2B8PA 1PAEX 2DXFA 1NDLA 3EM1A 4KPCA 4DZ6A 1VYAA 3NGTA 1W7WA 3ELHA 3VVUA 3Q8VA 3FC9A 1NCLA 2BX6A 2HVDA 4C6AA 3FBCA 1U8WA
chains in the Genus database with same CATH superfamily
5LOQA 1LW2B 1HD1A 2DR9A 4I2PB 3QNWB 4EWTA 3X1LB 4WU3A 3HSDA 3NGDA 2COLA 5KT7A 3AD9C 3OFEA 4QWAA 4HI1A 1I51B 2VPXB 5J2PA 2E1CA 1MMDA 4TU9A 5FD1A 2JX2A 2H5EA 1FJEB 4U7UK 2DRBA 2HRYA 1EP4B 1LWCA 2CQIA 3JYTA 4CT8A 3T1HF 1SH2A 1H2VZ 4I69A 3U27A 3GIMA 5ETTA 1ITPA 2WAQD 2UVRA 3ZXWA 5GADI 2GVZB 4A8SA 3IR7B 3H2LA 1KQKA 3WIVA 3J7A1 3GSDA 4NRTA 4DV0J 2A10A 4ZKAA 4OHXA 3EDRB 4KPCA 1HPZB 2VB6A 4FF3A 4J37A 3CMES 2LLZA 2WONB 3ZZPA 5CYMA 3LP2B 4ZLJA 1XTZA 1QDUB 1VQ7S 4I68A 5DM7Q 5J1EB 1DTTB 3M30B 2V8VA 2B4OA 2RKIA 1JX4A 2GA7A 1HNVB 2IBOA 4QW8A 5DG8A 4NLYA 3K7RA 1DQ9A 4PYDA 4DX5A 1M5KC 1J5OA 3G8TA 2HGLA 4HHUA 3C2PA 3FJ2A 1U1LA 5FJ4A 2UUAF 2QA1A 4RBVA 1Q8IA 3KLIB 4LRCA 4NLVA 3K58A 5A2QY 2W25A 1X4GA 3V4IA 4KV8B 2HLTA 3PIPQ 5HP1B 4HHHA 5D3GB 3UI3A 2GJ2A 3SQGA 3AJ1A 3SEOA 1U0SA 5HJYA 4RUBA 3NNCA 2KYZA 1GFWB 4DV3J 1L5UA 2UV8A 2C2RA 4CWBA 4LFCF 2VODA 2ZBQA 4OJGA 3QAUA 1H74A 3BH7B 1MMNA 3NGRA 3QO9B 1H7WA 3HK2A 2DO0A 1N33F 3GJTB 3DYAA 4B3TF 4DR1J 2LP4A 2V2KA 5HJXA 5EHHA 1CJVB 4DQIA 3BBBA 2VA3A 3M8QA 4I64A 2Y1RI 2DBBA 4CM2A 1T3NA 5B7WA 1TL5A 2ZZTA 2UUBF 2B9EA 2W7AA 2AX1A 2QN6B 4IOBA 4ILRA 1R27B 2IVFB 3V6DB 1KFDA 3HHLD 5A8WB 2CDRB 1KVIA 2NYHA 2AYMA 2FYXA 3TVKA 1SQGA 4DG1A 4ZVPB 1C1BB 4FXVA 4EO6A 3FSYA 4LRBA 1OPZA 3PR4A 4K2XA 2W1BA 2DNHA 1U0HA 3ETOA 2UP1A 2DNZA 1FRMA 3LF0A 3C14B 1ZM4A 1LOUA 4A8MP 4RW8B 3VAKA 4IQXA 1T11A 4UT4A 2WBMA 7AT1B 3JSMA 4PG4A 2KRRA 2NPFA 1BXNA 2LQJA 2OP5A 2FHOB 5FLXY 4WK1A 3KDOA 3GCXP 3CCUS 4C0OC 2C3PA 1XMOJ 2FLNA 5J2MB 4N47A 1IKWA 1VC0A 4MIAA 4OI6A 2XMVA 3ZFVA 4ZPTR 2ZH8A 3MFHA 2XEXA 1K9MT 1HMVB 1Z2ZA 3DRRA 3PXGa 2FZGB 2UVUA 3R2DJ 3Q0AA 4ZDNA 1RABB 4B9NA 3GB0A 3EYZA 1FJGJ 2FJBB 1RYSA 1UAWA 2X7IA 4OYAA 2BM1A 3MMBB 3DMJB 5I3UB 1N6QA 3QRPA 2WTFA 3RBDA 2YQ0A 4ZVSB 4O3SA 3N6NA 3G6YA 4JUZA 3R7NB 2VG5B 1S6UA 2EG2A 1RTDA 1S49A 4JI2F 3J7YU 1ZA1B 4XPEA 5HROA 4ZOSA 2LFVA 3PTWA 2PGCA 3QJLA 1T94A 4KGXB 3SMZA 3SV4A 3CSKA 4C3KA 2BKNA 1CBKA 4YB5A 3MUVP 2QV6A 1WF0A 3CDWA 3MR7A 4AQYJ 3QBCA 4RWWA 3UWTA 1U49A 3OXLA 2ZD1B 3H2VE 4RBTA 2EK6A 2O5DA 4LSLB 1KQSR 3I0RB 4YB1P 2RMLA 1NSQA 4JI0F 4MJKA 2XS2A 5DLFA 3VAIA 1UJ6A 2ZH6A 3DRXA 3FUYA 2HZVA 4CLSA 2I1RA 1MSWD 5IT9Y 2ZKTA 2CQ4A 1RXOB 4EBEA 1S6OA 5C42B 1WF2A 2UUCF 1QAIA 3AOAA 4JI7F 3LH2S 2DXEA 1TL3A 1YJNS 2X3DA 4OI1A 2Y9HA 2MGZB 4QYZJ 4QBUA 1LXJA 2AX0A 1YWXA 2Z4PA 4UY85 4GKJF 1OS5A 1VQNS 2MY8A 1HBMA 2YNGA 2NZCA 3MDFA 4DU8A 5JXSA 2DNLA 1S9EB 4DR4J 2ZBPA 1A0OB 1J2VA 3A3PB 4S0MA 2JNJA 1R89A 4TLQA 4ANCA 4A8FA 4KBIA 1E6VB 2J7WA 1SIZA 2VQFJ 1FWPA 1NKEA 1S1TB 2E7VA 4OJ1A 1BHNA 4DLEA 3DLLQ 1OMSA 3HHKA 3O1LA 5DDRC 2DNQA 3QPIA 1SQEA 3K17A 1HQEB 4CRJA 4IG3B 3VAMA 3QT8A 2R8KA 1RAIB 3M8WA 4PQUA 5LM7E 4H54A 4LQ3A 3OFGA 3KHGA 2KG1A 5EX0A 3NCPA 5KOXA 1U8WA 4Y0FA 1EX8A 2CJXB 2QLFB 4C8NA 3PX0A 3R97A 1PC5A 1U1MA 3HFVA 1JKHB 2RQMA 2W01A 3AODA 3RW7A 4M95A 4K0KF 2R42A 2CQ3A 1DARA 2WOMA 1XMQJ 2JVRA 3HLUA 3OR2A 3H5XA 4I7FB 2B56A 1H7XA 2CPDA 2DY9A 3PYEA 1QD1A 3OTBA 4ECQA 2MB0B 3DC2A 3DLHA 4WF9Q 4LF5F 3EGNA 2AZ1A 1RUSA 3SDEA 2C22A 1KTVA 1U1NA 2XNQA 2VG6A 1FK9A 3WZ0A 5I3PA 1F6TA 1QE1B 3PDNA 4N8NA 4NLWA 1YRXA 4R0EA 2HNDA 2MZRA 1FE0A 4P7TA 4ER8A 3PZPA 3MEGB 4UF4A 5H9FJ 4DCJB 1RKIA 4WFNQ 4AFFA 2E1AA 1NDLA 1FNMA 3MMCB 2PI5A 2HQGA 1MU2B 4DUZF 4NEYA 2HG4A 2HQDA 2LEAA 4DPWA 1S48A 4EBDA 4U7UD 5JVHQ 2MKCA 1VI7A 2W2PP 4CTAB 1HLWA 2D1CA 4UUXA 5DS7A 1F3FA 1RHKB 3MAHA 1L3KA 3IGNA 3RB6A 4DV7F 3IBWA 2IYIA 1REVA 2Y0SD 2PN6A 4CLKA 3LQVA 1OY6A 1NK0A 1JMTA 1P9YA 1BQNA 2LXUA 1HL6A 3RAQA 2F40A 3C46A 3GSIA 3I6PA 3Q8YA 4ZJLA 1T3OA 2R2TA 2DH7A 2M5YA 2AYGA 2PDAA 3J7AN 3L7UA 2VFVA 1V3SA 4NA1A 4ED7A 3HSZA 3J7ZT 5CZXA 4F4WA 3UN3A 1YK9A 5E2QA 2GHPA 3ZZRA 2H65B 1CC7A 3U02A 2FTRA 5DGAA 2E29A 3B4MA 2EC0A 2ROGA 1N34F 1ZOTA 3MGJA 1Y5NB 5KFNA 3W7BA 3MTKA 4ZLPA 5EUHA 2F8EX 3BGFA 4B3SJ 1LWXA 4B3MJ 1FRKA 1RTJA 3OTOF 1C4AA 3EMTA 4ZP6A 4FYWB 2RIJA 2MJNA 4OI2A 1ZBTA 1RWNB 4HH1A 4DSKA 1WWHA 3SSSA 3M9NB 1IKYB 1R6VA 2EFPA 2HBRB 4N5SA 3IWLA 1CS4B 1KRPA 4ELVA 8RUCA 3MM5A 3GV7B 3CF5Q 2MDAA 1HKAA 4DPYA 1NDKA 3DHWC 4DUYF 1YGYA 1D9FA 2BACA 3TEGA 2SXLA 2BJEA 3PR5B 1SJ1A 3MR6A 2RQ4A 3KNGA 3HJFA 2VBZA 1R0BG 1GMWD 5HMZA 4ECTA 2KZZA 3DLKA 4YS2A 2BR0A 2XMKA 3C16B 2OPRA 4J9UE 4NYZA 3CJ3A 3UDEA 2AJQA 5M2RA 2CRLA 3BGUA 2FLLA 3VGSA 3BSNA 2GAGC 1CJTA 2EPIA 4DQRA 5EWEA 3P5TL 4DL2A 1SI9A 1VIXA 4DLGA 1TMMA 3J81Y 1NK6A 3FCWA 4TU8A 1NLKL 2QFJA 5A6WA 4H4KA 1KD1T 4ZVGA 1W2IA 4X66J 1WF1A 4MKBA 3GJSB 4RX6A 4ZPWR 3DDIA 1NZ8A 1T02A 3M1VB 3UQSA 2HLUA 2YKPA 1S9FA 2ZHBA 1Q81T 4KHPJ 2C2MB 3WHIA 1SJQA 3CJSA 2YKNA 1V9OA 2HEKA 1MROB 2IJFA 3PVXA 2FJWA 2OH2A 3D0HE 3DU5A 5DO2A 3D6MB 2XYPB 5A0YB 2LU2A 2PEHA 5B0FA 3BGRA 5GMDA 1TVRA 1C2PA 1JLQA 2NSBA 3LW5C 4X4PA 2EI5A 1UEKA 1Z4UA 2G0JA 4DDFA 1F2GA 2G2ZA 1NKBA 2RHQB 3BSCA 1VJQA 1YX2A 2HK3A 2FD2A 2PMZD 1U4BA 3CTRA 5D4LA 3T9NA 1WKJA 1JXVA 4I67A 4OLOA 3ZTOA 4KYZA 1PBAA 1TL7A 2K06A 5J2QA 1U1RA 4OZ3A 4ZJQA 3EJMA 4QU7A 3KMSA 1N5YA 5KFWA 4DPOA 1TV6A 2OPQA 3MFIA 3CPWR 3OXGA 1UL3A 1S99A 3VALA 1WEYA 2NXCA 4F67A 1VQ8S 1YSJA 4NX9A 2BA9A 2QGFB 5ETSA 3AXKA 3LP0B 1NJXA 4R5PA 2QIFA 2VG7B 2W9CA 3I5CA 3NGKA 1FKOA 4G65A 1CULB 4GKKJ 4O4GA 2ALZA 1NZAA 3BDPA 1IR0A 3PX4A 2K7KA 2CJ9A 4DFPA 1FD8A 1X9MA 3FCHA 4NXNF 3CCES 2OMLA 4NCAA 4QR2A 3QGHA 4WP3A 5E3QA 1S7HA 4TVAB 2MQNA 1NUEA 3CT9A 4W4MA 2GVDB 1DJ0A 1SXLA 2YNIA 2AHOB 1CSJA 3K5LA 2W4DA 1TP7A 4WYLA 4YB7A 2ZJRQ 3T3FA 2EFGA 5LSLA 4CIOA 1F3VA 1RWKB 5LXYA 5CABA 1NDPA 2CNOB 6FD1A 3OVSA 4OJ3A 3PEJA 2FVSA 3EE3A 4B9TA 2P8IA 1DQ8A 1KOOA 3JTOA 2NXUA 1JLAA 4KHRA 3CULA 3H2UB 5HK4A 3AB2B 1PAUB 5H9EK 6AT1B 4B3RJ 1SC4B 4OHZA 5D8HB 1FE4A 2CWXA 2MZTA 2JDJA 5KFSA 4DV4J 1RCOB 2GV1A 2B4VA 4IOCQ 2DEIA 4I6YA 3DRPB 3K89A 1EB0A 3NAIA 1L3TA 2J7KA 1RGVA 4DL7A 3TI0A 4J9LA 2PFFB 3VCDA 2DR7A 2LEBA 2DRAA 1LFWA 2XMTA 3NOCA 5L9NA 2XLIA 4MK7A 2YKMA 2HBQB 1VQSA 2YXLA 3VGTA 3W1YC 4WTOB 1X7VA 3HF5A 1DAXA 1YDLA 1UMJA 4QIWD 3TZWA 3VGUA 2CAJA 3IXQA 3KJQB 4FYVB 2V67A 2Z0GA 3F44A 2YNHA 1X5TA 1RT4B 4EYIB 3M7VA 4OJHA 4ZPDA 3ZTRA 3H90A 1FKAF 4FS2A 4KT0C 4KH1B 5J2NA 1Q7LB 3ITHA 1UVIA 1RHMB 1S6QA 5LSRA 4I2QB 1E6YB 1MWQA 2AKWB 5HLFB 3FBCA 2B5JB 3M2VA 2ADCA 2KJWA 2VOOA 3MCMA 1U7LA 5H1SV 4HLBA 2PEBA 1I5OB 1SL0A 4DL6A 3UNGC 1QVGR 4DV6F 3WIUA 1AFJA 1G6BA 3FFIA 1O6XA 3QSYB 4ED5A 1ZH5A 1RT5A 1P9QC 1GXUA 1GAOA 4LVOP 1C0UA 4PYAA 3H59A 1W25A 1WC6A 1T9VA 3IWXA 3PRDA 1S9GB 2XLJA 4JI8J 5LJ3Y 3NBPB 1SCJB 4IUFA 2MZ1A 2RU3A 2IAJB 4ID5A 1WOOA 5C25B 2V4JB 2VDIA 2YKQA 1VRTA 4B08A 4DN0A 2OO4A 1VYAA 5K5MA 1RT2B 3IMQJ 1IJFB 1QJHA 2Y1IA 5IC4B 3D5MA 3D1HA 3PX6A 2JLEA 2EFOA 4K59A 3F73A 3K5NA 2YKAA 1KS2A 2A0FB 4OMFG 2GQQA 3QIPB 3ISZA 2H1YA 1HBOB 3OW2R 3GR1A 4KKOA 2ZOGA 3KKFA 2L08A 5KG2A 1V5VA 4DSLA 4JOUA 2XY7A 2LU1A 3MR2A 3ZZ0A 1WDTA 2ZE2A 3LA0A 1KEKA 1ZPVA 3D2WA 4IFYA 2F9DA 2VKRA 2LVWA 2MLXA 4KAIA 2O3DA 5AT1B 1T8EA 1FCAA 2J0QD 3ISNC 1N0UA 3IA0A 1DHMA 1N5QA 3R7BB 4RL1A 1RYRA 1RWXB 1EETB 4BBYA 1NDCA 4DR3F 3QAEA 2HFZA 2WVFA 1N52B 5KG1A 1KLMB 1K44A 4O3OA 1RWMB 3RG6A 1EP4A 3GIKA 2BKPA 1S6PB 3LAKA 2E5JA 4YDXA 1U8SA 2VBYA 1AT1B 5L9XA 4DL4A 1CC8A 1UZDA 4RW6B 3CC2S 3R8YA 1RA7A 1HIYA 1ZPWX 1WJ9A 3DOKA 2OIHA 1RLDA 3PIOQ 1HI8A 3KTQA 1X4FA 5KFFA 1T05B 2GQCA 1CVJA 2KVIA 3OFFA 3HPOA 1JJ4A 3NP5A 1FDDA 2LA6A 4GO7X 4WE1A 3JQKA 2IM2A 2C2KB 1VQ9S 2VC0A 2N4DA 4RU9A 4IRCA 1IBMJ 4XTTA 3BBFA 5J1EA 2ZH3A 1M5SA 4QOTA 1WORA 1HNXF 4CM0A 2E44A 3R1LA 4PXBA 1UWBA 1X9WA 5CD4H 3AD7C 2DHHA 4ILMA 2DNMA 3N01A 1K47A 4IRKA 4NLOA 3FCVA 4KSEB 3RW6A 2BZ2A 4JYAF 2I2YA 3GMGA 5MLCV 1TL1B 4CO5A 4DR7J 2CPEA 1SJRA 1UP1A 1Y9OA 2Y3YA 2I5JB 1OIAA 4N77A 2K3KA 5A8RB 2FVQA 1Y10A 3U1NA 3G96A 3L95X 4CO2A 3LPEA 2FGOA 1JLCB 1HWIA 4QU6A 3VQSA 3ZZYA 4DI6A 2B4UA 2YWKA 4K4TA 3CD7A 3AOCA 4E2FB 2WBRA 5HQLA 1BY9A 2ZFHA 3JSBA 3GILA 2CUYA 2HHUA 2OUGA 1VK8A 3VV2B 4X62J 4UZBA 3FZBA 4ZVOB 2HVZA 5J1NA 5L39A 5IT9U 4J9NA 1YJ9S 2R7XA 2W2MP 3QQCD 3IBCB 3N9UC 4ITSA 3H4DA 1W26A 5L1JA 5A8WA 2Q6CA 1KQFB 2D9OA 3SSRA 2N3OA 4CLTA 1H73A 3NS7B 3TWZA 4OV6A 1UJ4A 2P9EA 2QL9B 1Q5YA 4HL9A 5C5JA 5KFMA 1VBZA 4DR5F 3RBZA 3UO0A 3CJ4A 2DPJA 1FVSA 5B0GA 1YRUA 1YITS 3EWGA 4OYZA 4KO0B 2C3UA 1KR4A 2L48A 4HI2A 1RHJB 3OQ2A 4C7QA 4NL5A 1VGYA 2VIHA 1P27B 1MG7A 1ICEB 2NUUG 1ZM9A 1X5PA 1U1PA 5HATA 2B43A 4LIRA 2KZMA 1ZETA 1Y4ZB 2B3TB 5KFQA 2IMOA 1N48A 1LQ9A 3MM8B 2GO9A 1TK5A 2KM8B 4DR6F 2DNNA 2DTJA 2O01C 4DWIA 2OPPB 5D0HA 3C6UA 2V9WA 2AIRB 2OFHX 1HMVA 1CJUB 3VAGA 5AJ3F 1YBTA 2A6MA 4USVA 1CPZA 3S6EA 4C48A 4FNHA 2Q6BA 2IYGA 5EGYA 2ZBIA 4L72B 4DV1J 3M6WA 3A8EA 4HHJA 4W92B 3GONA 9ATCB 5B0CA 3QIDA 4FYYB 3W8PA 4C9DA 3MAAB 1G7CB 2RHSB 2E7WA 3DNCA 4DFKA 3CD0A 4AE5A 2C2OB 4G6VB 2A6OA 1NB2A 4HVZA 2GW8A 4PAAA 5KG5A 2BJ1A 5CQGA 2OPSB 2BANA 3OPKA 3PKMA 2DYAA 1IBCB 3ZZOA 1UPMB 5CXTA 3QLHB 4K4YA 2OKQA 2F8MA 5KFZA 2F8HA 2IRXA 2R8HA 5U47A 4QZVB 5K14A 3T1HJ 2J6SA 3I0RA 2HVIA 1IN0A 1UTAA 5BYSA 1HQ2A 4GVBB 4KTQA 2GIFA 2V94A 1FRXA 3RBEA 2K1RB 3KYLA 1EIYB 4CLFA 2HWIA 3GYXB 2A18A 3S1TA 3G4SS 1LWFA 1XR5A 4KGKA 3KLEA 4CQ1A 3ET6A 5AXLA 2WCXA 3DRYA 3SCLE 1GTEA 3Q2TC 3FQKA 1RAGB 3EVOA 2ILYA 4ES2A 2XQCA 2W9BA 1JLEB 1U02A 3GYGA 2WB1D 2UUTA 2D7SA 1FT8A 1K1QA 1S1XB 4NOHA 4TYAA 5E3PA 2YH0A 2AEMA 4YHHF 2UUAJ 5GAGI 1E6VA 3EM1A 2BJ9A 4ICLB 3CD6S 4DF8A 2UVWA 2FHKA 4P2XA 2VQEF 1VMBA 1BC6A 2KT2A 3ZZZA 4DPUA 1PO6A 2C2NA 4LF4F 1GEHA 5D0GA 1FNXH 2CQCA 4WXWA 4C3LA 4NE9C 1HYSB 3BSOA 3RR8A 1IKVB 4LFCJ 1JNZB 2QL7B 3DFEA 3KK3A 1WELA 2DT9A 1N33J 2BE2A 2MQMA 1D9AA 2AMCB 4LR9A 1MLAA 3MPWA 1FF2A 4FF4A 4UTGA 1PSDA 2UUBJ 3FBFA 1RADB 4LF9F 3QGPA 3GQCA 5ETLA 1TKZB 2ZC3A 2AQ4A 1WHVA 2MJUA 1L3VA 1HARA 2FVRA 4HEA9 2DK2A 4EI2A 2YX7A 2MKIA 5LXRA 1NPKA 3E3XA 1H6KX 4G1IA 3OR1B 3VGVA 1RBAA 1RTHA 3A4TA 2HIYA 1U45A 4WCEQ 1V5IB 4L75A 5C2CA 4WFXA 2B7BB 2PD1A 3DXBA 2IC3A 3W2WA 2LYVA 4FP9A 5DETA 4UQGA 1U2CA 2IM3A 2ABYA 5K8PA 3CMQA 2AZ3A 2K8GA 3Q86A 4RW9B 4CZCA 3W2VB 2V34A 2J0SD 2GC8A 2DXDA 5JVGQ 4ZN1A 2W7OA 3P96A 4JV1A 3OUYA 4WJBA 1UKUA 1T03B 5EX3A 2HHHF 5IV3A 3RRHA 2GMJA 2IJNA 3MWBA 3UD3P 1Y5LB 3M8PA 5LL6d 4CO0A 2HW3A 2MYFA 3DCAA 1C1CA 4JI3F 2I8EA 2BW2A 3R5JB 1Q8LA 1TKDA 4O23A 5GADU 1MN9A 4I6WA 5HMWA 2HNZA 2HWHA 3MM9B 3UCGA 3MPUB 1WC5A 2ZDPA 3Q24A 3ELHA 1RT3B 3C6TA 2HVDA 2LKZA 3BR9A 4F0KA 4JI2J 3UDVA 1SUQB 1AZSA 4USTA 1N5SA 1DFDA 3PRVA 2R8IA 1HNZF 4QCLA 3ICLA 1FKPB 4RPFA 5KG3A 5AXMA 3ZZUA 1X4CA 2RAQA 1XERA 4GC7A 4YR2A 4W98A 3OL7A 2QYCA 3KLFB 4JI0J 2KN4A 3GV5B 2XCAA 4NMXA 4O0NA 2M70A 2QFIA 1TK0A 2JC0A 3HVAA 4Y34A 2PIIA 2R7TA 5HBMA 2MLZA 1KP6A 3KLHA 5B0DA 3AA9A 2UUCJ 4F4ZA 4M5HA 3RB4A 2N4CA 3QZ7A 4JI7J 5KFUA 3MM6B 4R25A 4L3KA 4USWA 3ENWA 2MTLA 1RTIB 1HNIB 1KDNA 1PIEA 1DZ5A 1D3WA 3EZUA 1XJWB 3OSNA 2QE5A 2E1PA 4B17A 2XI3A 4GKJJ 1HBUB 3RRKA 3IN5A 1RWOB 1FRHA 3HD2A 4H4KC 2YWWA 1ZYQA 3FEXB 1ELOA 1TZ0A 4ZJOA 3PO4A 3ONQA 3OVBA 5IM0A 4Y2AA 2HQFA 2HFSA 9RUBA 4Q0BA 1PJ6A 1J5EF 1OY9A 2BJ3A 3T5HA 3AB4B 4TY9A 3R7SB 1SKRA 3CB4A 4RUAA 4IO1A 2UXDF 4PUOB 4Y2KA 2UU9F 2J8AA 2HHPA 1B7YB 1WOPA 3Q8SB 2XS5A 4JI4F 4HH0A 2KG0A 2E1RA 4O0IA 4Z7YA 1URNA 2X1BA 4F3OA 3G82B 5KFHA 2CZVC 2ZOMA 2H4YB 3BQ0A 3C8YA 4BDPA 4UOCA 2EKNA 1Q95G 4KRWA 4LJMA 5D4PA 3QJPA 2U1AA 3PYFA 4K50A 4K0KJ 2BUNA 4DUTA 1XBWA 1VISA 3NG8A 3N6MA 3BSAA 3AJ2A 4KGZB 4H4OB 4LBHA 1NJZA 1M5PC 4M5JA 1TELA 2CPXA 4ANDA 3VTIA 1R0CB 1WI8A 1MWZA 4LF5J 4DV3F 3M8ZA 1JLGB 1CLFA 3PEHA 2DNGA 3LANA 2P6SA 2J9EA 1FRJA 3MAQA 3D68A 2BQUA 2FHJD 1UW9A 2GHWA 4V19X 4ZLNA 1VHFA 2JWNA 2B51A 3CXCR 3HMJG 1HQUB 5HN0A 3IG1A 3H5UA 3DGVA 2VJUA 5GAEI 1SV5A 2FZKB 1VFJA 3TVZA 3IR6B 5ETKA 4DUZJ 4DL0C 2JLGA 1KFSA 4JBCA 1RU2A 3HHLC 2JRSA 4MK8A 2YY3A 1S5ZA 2FJDB 4LFAF 1HW9A 4DQSA 4DV7J 3CEDA 2ZH4A 2D9PA 1U2FA 3D3BJ 2IHR1 1QSLA 2V2QA 4H4MB 3OLBA 5L1IA 4NA3A 3FRYA 1JK9B 2ZBCA 5DRKA 3FEYB 2P9GA 3R5AA 3IAS9 1H3DA 3TAPA 3KHRA 3DOLB 3RTVA 1HI0P 2X3GA 1IM6A 3OHBA 4J9QA 2FGCA 4CO4A 2XMMA 2ZZNA 1S97A 4RU2A 3A8JA 3I31A 4NCBA 4DZDA 3EZOA 3MMAB 3SCKE 3R1HA 4XK8C 1AYEA 2P9CA 2LXIA 4JI1J 3MEDA 1N34J 3AQOA 1G1XA 4X4OA 3DLGA 2E9RX 3LTOA 3QMQA 1UVMA 4M5NA 1Z2LA 3VHQA 2L9WA 1B0PA 1QLNA 2J0XA 3OTOJ 2BXJA 1XC9A 4IG0A 4NYPA 1VQYA 5LSOA 1ZM2A 2VPWB 1W7WA 3S8SA 4V1Ak 2A2CA 4RR5A 4ALZA 1NM2A 3TP2A 3VWSA 2DCUB 2ZZMA 3FGVA 5B08A 4QIEA 5J2PB 1YRTA 2XMAA 4FYXB 4USUA 5F41A 4K4UA 3JYTB 3AT1B 1RE1B 1JNRB 2ASJA 3FMWA 4WFYA 3UN5A 2R7OA 2GS8A 2Z2YB 4WBFA 3V81A 2QEXS 3EICA 4ELUA 2DKOB 3MD3A 4ZVRB 3MEEB 2ACMA 3ZTPA 4QWEA 3DM2A 4DUYJ 4X4TA 4C8OA 1OWXA 2C1EB 2LEPA 1IBKF 2JC1A 4LBPA 3PO5A 2RILA 1G2EA 3W64A 3G87A 3THVA 3W5XA 1RT7A 3DOMA 3QWPA 4QIGA 2KT3A 5KFKA 4ZCMA 3TX0A 5CYMB 5KT4A 4TNOA 3A3NB 4A4JA 5BJRA 2RKIB 2GGPA 4KPYA 3MECA 4RUHA 3EGVA 3TA0A 3FSIA 1J5OB 4LMZA 3PW4A 4X64F 2IA0A 3HVWA 2BVZA 4OZ2A 5GMEA 1XWLA 2I0XA 3DHXA 4J5OA 1RAHB 2VQFF 3V4IB 5HAOA 2KT5A 2D41A 2OSQA 3SQGB 2AGPA 2W7PA 2RS8A 2B5JA 2QA4G 2RH3A 4DF4A 1TKTA 3O3LA 4NXMF 4M63A 2OAUA 4M94A 2CPZA 2RDIA 4K2JA 5HQ8A 2DGXA 1F60B 4Q8FA 3PFOA 2EFVA 1X5OA 4MYTA 8AT1B 3NGSA 1Y3KA 3M8QB 2AJ4A 2O1PA 4F25A 1ZAWA 3NCQA 3Q8QB 1IWAA 2VL1A 5E41A 5A8KB 3GYNA 4Y3CA 3M8YA 2R7SA 2ZNYA 3HDSA 1RT6A 1S9GA 4RO0A 3NBPA 4DG1B 2V63A 1SKUB 3BKTA 1ROFA 4UOGA 1S0MA 2HAIA 4WU2A 3CCLS 1YHQS 2DGTA 1U0HB 3FMBA 1SJ4P 1U25A 3UD4P 2IVMA 1P1TA 4K5SA 5C24A 1RT2A 2JJ4D 2RDDA 3BH6B 2V8PA 2IRUA 1KVJA 3TAMB 2HQCA 4ZCLA 2GMHA 2BJ7A 5KG0A 1RWWB 1H0HB 3GP9A 1G4CA 4NCGA 3V6HA 2BRLA 4ECVA 1HBOA 1SH0A 4NXNJ 1PILA 3ZO7A 1NK5A 3K0JA 4ZK7M 3EVMA 1IKWB 2VU5A 3BO3A 1RLCL 4U96A 3AQPA 2X1FA 4PCQA 4W90B 4OZ0A 1KSPA 2XCPA 2M4MA 3TZXA 1YZ7A 3PHTA 3KLVA 2IY5B 5D77A 1EETA 5HANA 4K8RA 1QUVA 2CIMA 3HKWA 1OJ4A 1N6QB 1KLMA 1UVLA 1S0OA 3KK1A 2DR8A 2J76E 5KFYA 4Q44A 3GV8B 1IKXB 1RTDB 3W3SA 2H3EB 5HROB 4RW6A 2NCKL 5GAHU 1FRIA 4FXDA 3MZIA 1NSKL 3HZGA 3UVJB 4RNOA 3EPIA 2RS2A 3F41A 2HVHA 3P4UB 3QZ8A 1S7IA 4OYOA 1TU0B 4X4SA 2UXBF 1Q0NA 4WZQA 2XSJB 4F36A 3QFWA 1VIOA 4P75A 1D9DA 2WZ1A 1VDHA 5AE1A 4CLWA 3MURP 3UCUP 3FKBA 2UZAA 3CJRA 3GZ7A 3CJTA 3KLGA 2R2RA 3T1YF 4M5DB 2MSSA 5IFMA 3BDEA 4ZVFA 1Q8BA 3CJ2A 4ZVHA 3N5BA 3IO1A 2BMBA 2DGWA 1ZZFA 1FO1A 3VAHA 3NWRA 1NJWA 5C7PA 1HBMB 2HRUA 2I5JA 5L38A 4CH0S 2YNGB 2GAHC 4X84A 1NK4A 5IQQA 2W2NP 2CDQA 4O44A 1JLCA 2KI2A 2IM1A 1EKSA 2B4PA 4OX9F 5FDLA 2EK1A 3HFZB 4K4XA 3K8VA 1OYDA 4XAKA 1WHXA 3LOUA 1TKXA 1FTRA 3T1AA 4AT1B 2YX4A 4B3OA 3I82A 1UFKA 4GC6A 2FB0A 1FEEA 3CWJA 2JEGA 2RU9A 1VBXA 3G8QA 2VV5A 4I6AA 3DGPB 4BHQA 4M5KA 4JV0A 3O2IA 3FEZA 3AHPA 1RWUA 2IIHA 2O67A 2DHAA 2J9DA 1VQLS 5E0OA 2J9DE 4DV6J 1NK8A 3DDKA 4C6AA 1F9HA 1BQXA 5B0EA 4F4KA 1HR0F 1DRZA 2E9TA 2WOMB 4TQSA 1BWVA 2YWEA 4RKUC 3H20A 3IRXA 2PC6A 3OR2B 1BWEA 4OYXA 4KO0A 3CMAS 2AGOA 1RACB 2B9WA 4ELTA 4U95A 4WPAA 3D6FB 2DIVA 3NY0A 3BV8A 1S1WA 1JXLA 3CGIA 2FJVA 1U6ZA 1TAUA 3SCIE 3SDEB 1T9YA 1ZS6A 3GTYX 2VG6B 1FK9B 1VC6A 1YJWS 2LMIA 2QMWA 5IT0A 1RT1A 2HNDB 3KUGA 2RF2A 1B70B 2KRBA 1GNKA 4ZHRA 1V3RA 4X65J 2CA9A 1KNZA 1OYEA 4DHVA 2RRAA 3GIRA 2DNYA 4HT7A 3LWMA 3LGNA 2EFNA 4Q2LA 4ED1A 2FUG9 5H9FK 3Q8VA 1RQ0A 2QC3A 3ZC4A 4HTJA 2BQ3A 4P71A 5CAAA 1ZTTA 4URGA 1U47A 3R3TA 2DGQA 3J80U 3BGLA 3CO9A 3ISND 2BM0A 1JJCB 1SL2A 4PABA 3SXLA 2IBKA 4MKAA 3HHEA 4DR3J 1BQNB 4K4VA 4HDGA 2AJ2A 4GRSA 2WHOA 2ZUAA 1RWVB 1OSDA 2IJRA 3NNHA 4BWMA 3QRRA 2HWTA 5L1LA 3RU0A 4GVBA 1EQMA 2YPZA 4UOFA 4KHMA 3O44A 2AW0A 1R8AA 3CC4S 2ZH2A 3H40A 4F3MA 1L3UA 5KFCA 5FIIA 2WVBA 4TN2A 1KKHA 4ZCIA 5D15A 3BYRA 3I55S 3BO4A 4DZ6A 1Q8KA 2M0GB 4OI0A 5CCLA 3M2UA 3KUEA 2CQDA 3DLEA 4EO8A 1RTJB 1LWEA 4DOZA 5CCMA 5ITHA 1HNXJ 1WC1A 1GH8A 4IR9A 2FQQB 4ICLA 4MFBB 1GXTA 3N0VA 3K8WA 1FTCA 2H51B 2BRKA 4DR2F 4JYAJ 1VLOA 2RUSA 4G1QA 3U1MA 2NXNA 2PFDA 4IDKA 3Q8PB 1EAYC 3BZQA 2N7YA 1VQKS 1WSVA 3GWCA 4RW4A 1LK7A 1PJ7A 4OX6A 1IKVA 3BBCA 4QR0A 4G1PA 3MM5B 3CIZA 3JTNA 2YH1A 2P5VA 2BYCA 4ECUA 4XIUA 1DQAA 4UOHA 3TQEA 3D1QA 3D67A 2KB2A 4LIWA 3E8OA 3V2UC 1U6FA 2BJ8A 4FS1A 4WFBQ 3KFWX 3V6KA 2MKJA 3DLKB 4I1TA 1R6YA 2CPHA 3WX4A 4F0HA 1HA1A 2HHVA 1TKZA 2XB2D 2OPRB 4LR8A 3RBXA 2VHGA 3IS9A 2VONA 3OXFA 3WC2A 2E1MC 1JLFA 1FI4A 1CJTB 1F9FA 2HFVA 2ZJPQ 1IUJA 2FLPA 1SL1A 5KFGA 4DR5J 2QX0A 2AEJA 2FPHX 5IXUA 1XNRF 2KL8A 3TVYA 3CUNA 2XSFA 1K1SA 2HHWA 3OLAA 1G3OA 2AJFE 1LEOA 4IQMA 4FF1A 2H48B 2BDPA 2YKOA 3PM9A 2LDYA 1VRUA 3G6ES 4LF2A 2BABA 1KLNA 1S4FA 2MQPA 1XNQF 1V6HA 5KT6A 4RNHA 1TFYA 1QAXA 4E0DA 2YKNB 3C15A 1WG5A 1NNDA 4Q43A 4PG8A 4ZVTB 1KBRA 2RD5C 4A8QA 4RJVA 3RUBL 3BGRB 4DR6J 2ZVIA 1PYSB 1R8BA 1TVRB 1JLQB 1N5VA 3ADAC 2L41A 2VOPA 2OEJA 1WTBA 2MXYA 2FZCB 3W9IA 2JHEA 3R2CJ 3SYZA 1C4CA 3PACA 2V8DA 3CD5A 5JJBA 3MF5A 1TL7B 2LDIA 2DH8A 2RNEA 3THTA 2DGUA 4A8XA 4FXWA 5J2QB 4TQRA 3A8IA 3MM9A 3TZZA 2RE1A 1N5YB 4A46A 3S01A 3BEGB 4MK9A 1TV6B 2HNYA 1LK5A 3HVTA 2QT7A 3VVTA 3BM7A 2B6AA 4IYQA 5D0RA 1SUQA 2J8SA 1DLOB 2AU0A 3BS9A 1WEZA 4U67Q 3T5JA 3W66A 2DITA 3W9HA 4R5PB 3B78A 1RJJA 2F4FA 3VR1A 1RAJA 3GE9A 2BV3A 3GJRB 1WKKA 4M5LA 4DS4A 1QUPA 4CYUA 2V50A 3KG1A 2Q79A 3M2RA 3TA1A 4USMA 2C3YA 2DRDA 3GFXA 3R5DA 3KOAA 3ILOA 3KK2A 4CNZA 3LGHA 1RTZA 1BUXA 3OJUA 3MHYA 3DLBA 3HZEA 1RTIA 2L9NA 2QRRA 2YNIB 2AD9A 3MM7B 1Q4RA 2CVIA 1RHQB 2VDHA 1WKLA 3M9OB 1D8YA 3AH6A 1U48A 3MMJA 2KXFA 2HAFA 1VK3A 2V2VA 4DSJA 2R7QA 2R7WA 2G1DA 2GO8A 5KFPA 1D1UA 2MEWA 1BE4A 3CCZA 1JLAB 4YHHJ 3IR5B 3MXHP 2GFFA 4OYIA 3CJ8A 1UWAA 1UPPA 2R7RA 3FVYA 3RJMB 3D9BA 2VQEJ 2YNFA 2NPIA 4ECZA 2NXEA 2RJZA 3EVWA 4LF4J 4EK2A 4DQPA 1FDBA 4FDFA 4PUOA 3WC0A 3DKDA 1Y11A 3OVAA 4JI6J 3N6LA 1IWGA 1DTQA 3CW2C 1Y3JA 1S10A 1R8PA 1AXQA 3G82A 2DEJA 3N4WA 4O3PA 1Y00A 3NRBA 3DI6A 5F0UA 3MPDA 4AL5A 4LSNB 1U1OA 4WYWA 4ECRA 4LF9J 1RISA 1OPIA 2QYGA 2CJQA 4H4OA 2DGOA 4WFZA 1NHVA 4Y28C 3SSQA 1ULRA 2CQPA 4PWDA 1O8BA 3K2YA 4WZMA 3EGWB 5EWFA 2K7JA 2YNHB 3HFKA 3A8KA 3UR3C 1RI7A 2K3IA 1VS3A 1NAQA 4EUVA 1H2UX 5KFVA 3I0SB 1MNEA 4CLPA 5J2NB 2QSWA 2K2PA 3ITHB 5ETPA 5K8NA 1S6QB 4OZJA 1WC0A 1SVDA 2NSCA 5M2UA 4FBUA 2W24A 3H5YA 4C8ZA 2VFSA 2WVEA 3M2VB 1Q82T 2RUGA 3PRBA 2LXFA 1HNWF 3M6VA 1GT8A 4PKDB 2Q43A 3FBEA 2B8QA 2BOAA 2AJ0A 2HHHJ 1QAJA 4NLUA 2CJKA 3IRWP 4C8MA 4F8RA 2EFQA 2PA8D 4PXDA 4RWXA 4LFBF 1X60A 5DDQC 2IPOB 1RT5B 2MQQA 3IFEA 1IR1A 4JI3J 5CYQB 1GX6A 1K0TA 4RW7A 5IT4A 3K5OA 2HFNA 4H4MA 3ILIA 1C0UB 3GPAA 3LWLA 1WG1A 4TY8A 2F63A 2R7VA 3RAMA 2ZEJA 2JEJA 1VQPS 3W5ZA 5G0RA 1N32F 1HWJA 2DHSA 2ZHOA 2D74B 4X4VA 1XEZA 4DQQA 2JFKA 2CZ9A 1VRTB 4P2FA 1OQ3A 5KFTA 3POTA 4U8YA 4PQAA 5RUBA 2CPYA 2PO4A 1HNZJ 1GX5A 3N79A 1R0AA 1NMEB 2UV8G 3MMAA 3H0PA 5GAGU 4HKQA 4ID8A 1SQFA 2BX6A 2NLWA 3HHLA 3T19A 3TNVA 2AJ1A 2MMYA 2CKWA 1KONA 4PG5A 4KKOB 4F2RA 4QW9A 5F8MA 5E3RA 3Q8RB 3C66A 3NKYA 3MR3A 4PPZA 4CLLA 4IFYB 3N5FA 3BB5A 3MI7X 2J6TA 2J6UA 4OV1A 4PXCA 4XPCA 2PMHA 1N36F 1OQ6A 4RNFA 5IWAF 1JQGA 2ZM6J 3LO3A 5AXKA 3HULA 2RT3A 1N8RT 4AXJA 2IA6A 1NH8A 2O66A 2I38A 1BMQB 4X2BA 1S1UA 1JIHA 3D6HB 1X4AA 2RB7A 4PG6A 1J5EJ 2ZNZA 2HRTA 4YR3A 4ES1A 3MEEA 4OI4A 2MZJA 1CJKA 2JLFA 2N3LA 3DOKB 4RBUA 5EWGA 3OHAA 4NZ6A 4B9LA 4O3QA 2PI4A 3C3LA 1JLBA 2UXDJ 3R6GB 2DNPA 1XN9A 2KFNA 2YQ1A 2UU9J 4C0BA 3I5BA 4WE1B 4J90A 2KYXA 2QLJB 3QSIA 2LQ9A 4JI4J 1M5HA 2OLWA 1R8HA 5T14A 2GJFA 3EXCX 3TW0A 4M5IA 3BPSP 2FJAB 3KJNB 2CZ4A 2E5LF 1LW0A 2DCLA 3UNYA 1UWBB 1Y7PA 4DSEA 3HVRA 3Q23A 2XO7A 1SKWA 2WVDA 1B4SA 1NSAA 2YBVA 2R3VA 2ZUGA 1N88A 4B9SA 3T6JA 5DQGA 3PFEA 5KFJA 2YPYA 4C11B 3G6VA 1TUVA 1SC1B 1RSCA 3QATA 1FJ7A 2B8PA 2XBPA 2ZC4A 3SQOP 1FNOA 3PY8A 3AXMA 2QL5B 5F8GA 4LF7J 4PEOA 3CVKA 1WC4A 2NXJA 3KXDA 4WP8A 4ZVQB 4NLRA 3T41A 4A8KA 2YWGA 3GFHA 3X3UA 2HHTA 5A8KA 1TQLA 1TK8A 2V5HG 4CH1A 3TJAA 5KFDA 2CJYB 1WSRA 3TA2A 1HBNA 3GJQB 2ILZA 2G4BA 2CPJA 2B9XA 1ZZNA 3L3CA 1HFEL 4LFAJ 4ZN3A 4LRFA 5E3CA 3ILJA 2FLOA 4A47A 3RGIA 4HACA 2AGQA 2ZH7A 4IFVA 2LECA 3MPYA 3OT9A 2HS4A 4DFMA 3LP1B 4U9RA 4Y2MA 3OSPA 3TX8A 1FESA 4NPOA 3OL9A 3TAMA 2FHMA 2CJAA 1B0VA 1GMVA 4QWCA 1GQEA 2EKYA 4KGVB 3FC9A 2QA4S 2HMIA 4Z7CA 3EZ5A 4YOEA 3G9CA 3CJQA 2VJVA 2RQCA 2QLWA 2KFZA 3CJKA 1LW2A 4DPTA 5I4MA 4I2PA 2X1AA 3C6UB 2DIUA 2ZDOA 3TQ1A 5E3AA 1HD0A 1UVNA 1VRQC 1KHWA 4P52A 4D3GA 4OFZA 1UA0A 3QYYA 2VASA 1U1QA 2R2UA 3ILLA 2DPIA 3B4DA 1VLYA 4O4RA 3SBMA 2E66A 1FFSB 4DMZA 3P49B 3ZNJ1 2PSZA 3CCVS 1IKXA 2U2FA 1WEXA 2J9CA 2GX8A 4FPRA 4ZITA 1EHWA 1KN6A 2MKHA 2W4CA 2BANB 2LQ5A 3TO8A 2I6WA 3UVJA 2XI2A 2NZ4A 2GVZA 3I4PA 1JJHA 4KH0B 4X4NA 2H4WB 4B9MA 2DH9A 4DU7A 2WVCA 2DD8S 4I4BA 4YUDA 5F8JA 2EBEA 2XSJA 5K14B 2LQBA 1HPZA 4M1KA 4NEZA 2WONA 2NYIA 2BKOA 2XGQA 3LP2A 1M5OC 1SJ3P 2G2YA 2BEFA 1DTTA 3M30A 2MQLA 4LT6A 5KFOA 4YP3A 2AT1B 1HNVA 4NASA 4M5DA 2XLKA 4KB7A 4WWSA 1IBKJ 1LWFB 2XMWA 2WSEC 2R7UA 5HVGA 3KLEB 4JV5F 2HK2A 1CQMA 2KXHA 2DY1A 3ET6B 3KLIA 4KY3A 2WW4A 2BQRA 4NI2B 4BWJA 2FY1A 3P6YC 4KV8A 2GHVC 4N41A 3PW5A 4JI5F 5HP1A 5D3GA 2OI2A 5D4OA 2W9BB 2XWXA 5GAEU 4M8LA 2HURA 3S7RA 2ZWPA 2C2DA 1X4BA 2XWYA 4X64J 2WW8A 2OEMA 3ZTQA 3QO9A 2G2OA 4GO5X 3R9LA 1RBOB 3EXYA 3CIMA 4XDDA 1D8ZA 2A3JA 2ERRA 2HHXA 1VC5A 4X4UA 3D28A 5F8IA 1CJVA 1IR2A 1BGXT 5LJ5Y 4J9RA 3DRSB 1RZMA 1VOMA 2E5GA 5L1KA 3M05A 4YN3B 2KM8C 3NWGA 4NXMJ 2XNRA 3JB9k 3GFYA 2E5IA 3BN7A 2MPUA 3V6DA 4ED3A 1EZZB 3DGPA 3KK3B 2EW9A 1S76D 1Z1ZA 2DISA 2BE2B 3HX9A 2IM0A 4RUCA 1C1BA 1M5VC 3P5BP 2C2EA 3E2EA 2X1GA 5LMNF 4CT9A 2R8JA 3AFGA 1KHVA 2VFTA 3IC1A 1U09A 4OYWA 1RHUB 4OIXA 3CDAA 3GG1A 2P2CB 3C14A 4WKYA 3HKZD 2RVJA 4RW8A 5E33A 3CDBA 3T6BA 2C28A 5KT5A 1NRKA 3CCMS 1FEHA 4P10A 3PV8A 2CPIA 4BCAA 1C0TB 5HQMA 1RTHB 1YZ6A 3MCOA 3BN4A 2Z2LA 1F5CA 4J9PA 2V9KA 1SIWB 2DXFA 5J2MA 1GMWA 1I6JA 2IC3B 3MPVA 3W2WB 5I3QA 1RAOA 4EU0A 4CI0B 3GG0A 3PW0A 2GQ2A 4P72A 4YB6A 3HO1A 2KKHA 3A1YG 3SCJE 2OTJS 1X0FA 1AUDA 2Z2ZA 3BJYA 4YY3F 1VQ6S 1WTFA 3MMBA 1YBUA 3DMJA 5I3UA 3OUYB 4BS2A 2F4VF 4IKAA 1GMUA 2JL9A 3CC7S 4X4RA 4M5MA 4DL3A 5A6PA 5DLGA 5SZTA 1YBAA 2VG5A 5CA5A 3M8PB 2BE7D 1S0NA 4YEAA 2F65A 3RRGA 2JEFA 2KVQE 4Y2IA 2XY5A 1C1CB 2IMWP 2FVPA 3Q89A 2ZHAA 4P7VA 3FK4A 2HNZB 1M90T 3D0GE 1YI2S 4DV5F 2VA2A 2BW7A 4F04B 4Z2XA 5LMUF 2NS1B 3C6TB 2HGNA 2ZD1A 4LSLA 4U8VA 1RP5A 4PWWA 1NH7A 2CQ2A 4ZPCA 3TJ8A 2CNKB 1AZSB 1Q78A 2Z2MA 4WTYA 4KC5A 3BKFA 2VH7A 3H25A 3KJFB 1N5TA 5C2GA 2VFUA 1WG4A 4YDDB 5C42A 2XS7A 4EZ6A 2C3MA 5BR8F 4QJVA 2UXBJ 4JP8A 4JI1F 2MGZA 4ZP9A 1JXEA 2V8GA 2QMUB 2RSQA 3JAMU 3F56A 2N7CA 4P2SA 1I1GA 2ZOFA 1S9EA 4EGLA 2C2ZB 1H72C 3T1YJ 1YJ7A 5HBMB 4LF8F 1D09B 1TFWA 3KLHB 2W2OP 3OBIA 2RRNA 4MFBA 3V6JA 3KJVB 4MAKA 1QSSA 1S1TA 1KTQA 1A7GE 2IVYA 1TMJA 1U24A 5D4NA 1R43A 3CCRS 1HQEA 4IG3A 3T5KA 4HYKA 5BXIA 1K73T 2WK4A 4DV2F 4ZP8A 2JSXA 5IC6B 1S1VB 1FDNA 3WBZA 3KHLA 1T9TA 5IM0B 1BD6A 2ZH1A 1H2TZ 4OX9J 2FJEB 4FBTA 4Q0BB 2HKEA 5F8LA 3NGUA 4RNNA 3D1OA 4B3TJ 4ZCKA 4UZCA 3E51A 4MTPA 1WHYA 1JKHA 4UQTA 2QLBB 1RBLA 2Y1LB 3W9JA 3B54A 3W8GA 2Z30B 1HHTP 4EFAC 4N76A 5DZ6A 1WHWA 4I7FA 4O3RA 4Q2MA 4DSIA 2HQ3A 1NHKL 2KTQA 5ETVA 2VC1A 1M1KT 3I87A 3J80Y 5GAHI 5D6GA 3MCNA 2NR0A 1ZAXA 4PG7A 5CYJA 1F5BA 5HI7A 5LT5A 3TUJC 4QR1A 1HR0J 4LVNP 1QE1A 3M6UA 1N4LA 4N8OA 4TYBA 4LRDA 4CNYA 1F0XA 4F7VA 2C42A 3R5CA 4K4SA 3HT3A 1B99A 4ED8A 2M8HA 3MEGA 1XR7A 3R5BA 2ZBRA 1ACMB 1SJFA 4CH7A 3GCWP 2LQ8A 2DNKA 2MZSA 2HFOA 2W2QP 3MMCA 2Z57B 1QAYA 2DJWA 4NLPA 1ZM3A 1MU2A 3AJDA 1S12A 2CG8A 4C4WA 2B9YA 3EDQB 3ZNUA 1TUGB 4N7TA 3E01B 4CTAA 1FD2A 5IS2A 3G8SA 2GCFA 4IOAQ 3CCTA 2J5AA 3I32A 2B7CB 3IG1B 2AYBA 1YQHA 1OO0B 5DDOC 3HSJA 1RKJA 1SV5B 5KFBA 3DLJA 2QG9B 2G0CA 5KT3A 1R7IA 2MHEA 2AYEA 4IRDA 2Z56B 4LRAA 3IWNC 4Y2CA 1I94F 1T9UA 2Q1LA 2Y0BB 1FXLA 1DLOA 3D3CJ 4LF6F 4DCOB 1T95A 3WQPA 2P6TA 3UPFA 4HT5A 3UDCA 1IBLF 4A8YA 4F4XA 3HM9A 5B0AA 3CCJS 2D69A 2UXCF 3ETMA 4KE5A 2HZAA 1GK8A 3ENQA 4B9VA 2EC2A 5DJBA 4USIA 2LCWA 6FDRA 2CPFA 5ETQA 5IOLA 3HCXA 4Q8EA 1NO8A 3QRQA 4ETZA 4OQJA 3Q8UA 2RRBA 4F4AA 4NWBA 2WSFC 4CO1A 3LALA 2N82B 5AXNA 2XC9A 3SZ2A 2CVEA 4OZ1A 3N28A 3KDNA 3MEDB 1DBDA 1X5SA 3H8YA 2AWZA 3MM7A 3DLGB 3OV7A 3WDOA 2ZH9A 4ZVEA 1IKYA 3UCZP 4IH6A 3BKUA 2FIUA 1CS4A 4DXLA 4IG0B 3B82A 4Q5VA 2ZVSA 2UVVA 2ROEA 3SFGA 5DQIA 1OSCA 1IVZA 3NXZA 3PYDA 1S77D 1X4HA 2KXNB 5EDWA 4L74A 4R8UB 2KDOA 2XGPA 4DR2J 3PJ9A 1VQMS 1GTHA 5T7LB 1XIQA 2VD3A 4ECWA 3K5PA 3TARA 3OTCA 4N56A 2M9KA 1SC6A 4LSZB 4DV0F 4OYMA 2H5JB 1YKWA 4F4YA 3TUIC 5E7OB 3KG0A 4FVCA 1FFWB 3C16A 4OHVA 4ECSA 4IH7A 2CWKA 1VQ5S 2CNNB 3O6QA 2JH3A 3ENAA 3J7YI 3V81B 4DCPB 4WFAQ 2E5HA 1SB6A 2VBWA 3DM2B 4KFBB 2V4QA 1K0VA 2CJBA 4LSNA 3G86A 5F9LA 2WRMA 2VF3A 2XZDB 2W8LA 1RT7B 3DOMB 4ZPVR 2MKKA 3H5SA 3M1VA 1MMLA 3LPYA 2GGPB 4WP9A 3MECB 1QM9A 2ZITA 5F8NA 3MR5A 3MUMP 4CLZA 2M52A 1MROA 4P73A 1FHTA 1DY3A 5F8HA 2VBXA 2KFYA 1XNRJ 4DSFA 5A0YA 4MMOA 1MWYA 1IXKA 1BQMB 2XZWA 1PC4A 3I0SA 4OHYA 4DR1F 4ENOA 1U26A 2OMOA 2HQIA 1XNQJ 4Y00A 1TKTB 2FJXA 2BJDA 5E5NA 3UN2A 3W65A 4QWDA 2F3JA 3M32B 4WK3A 1RWPB 4LBIA 2BBEA 4WKRA 5HVFA 3D66A 3OTEA 1SKSA 3UW1A 2KHDA 3W62A 2KO1A 5I42B 5CYQA 1F1BB 2M7SA 3MEKA 3OL6A 2J7UA 1M1GA 4R0JA 4HTIA 4LR7A 1S57A 5G4DA 4FKYA 3LP0A 4OI3A 1WDDA 2ATLA 2XG8A 2XYHB 5IQ6A 4CLUA 1RT6B 5A2QU 4K4WA 2VG7A 4NLDA 3VVUA 1CULA 3H7HB 4RLEA 2PA3A 3D0IE 3JXOA 4QIVA 4ERDA 2V69A 5DZ7A 1FFGB 1CG2A 4C8LA 2CQBA 2QLXA 4Q7AA 4X4QA 3AOBA 1XMOF 3D7SB 5C24B 2YWFA 1S79A 3VAJA 1P8GA 1XQIA 2IFXA 2R9LA 4X65F 3UFCX 2Q3PA 2GVDA 3KG4A 3JSYA 1S4EA 2DGVA 4NCGB 3FSXA 2EVZA 1FJGF 2YX1A 2B0GA 1NU4A 2PT0A 2MKSA 3HD1A 4Y6IA 1XR6A 4A8WA 1A9NB 1IM4A 1NXIA 3C19A 3U1LA 4DL5A 1B7FA 5H9EJ 2M8DB 5F0WA 3W61A 4AUKA 3IGVA 3NEKA 2NREA 4UW2A 1EJ7L 1EARA 4J91A 1B64A 3EPGA 2Y8YA 1UA1A 1TUWA 4ZIVA 3KK1B 4AQYF 2NUHA 1LWCB 3DRPA 4FKXA 1X0PA 2Y8WA 3HHDA 1M1HA 3QFHA 1RAFB 1VCTA 4OX8A 5DM6Q 3MTJA 3H98A 1RDRA 1EKRA 5FLXU 2DR5A 3MD1A 3M4XA 4HDHA 1HWKA 1X4DA 4F3QA 4NLGA 2XTJP 3CDUA 1MW7A 4DX6A 5JMNA 3IBFB 2DVIA 2EEYA 1LV5A 1ZAVA 2CNLB 4URQU 1ZA2B 4LQ9A 1ZTWA 2ALYB 5CZVA 2POKA 2YWHA 3I5AA 1AUSL 4ED2A 4DR4F 3KLGB 1UEUA 4UUWA 4ECXA 3AD8C 2YVSA 5DQHA 1RT4A 5KT2A 3BYPA 2OJ3A 5F3ZA 2QA2A 4FYDA 4F26A 4I2QA 1HI1A 4K5RA 1E6YA 1K8AT 3CJ0A 3CDEA 4PZVA 4ZS6A 4ANEA 5HLFA 3T5LA 2CFXA 1IQTA 4YMEA 3H4BA 4C11A 3OJSA 1PGZA 1GXLA 5AE3A 4O44B 4TXSA 3BQ2A 5GVQA 5FDLB 4EBCA 1F2HA 1YG0A 4JV2A 2CQHA 4URSA 1NK7A 3DYAB 1NPPA 1PKUA 1QSYA 1NPRA 2L3MA 3PW2A 3KWMA 1TKXB 4AD6A 4B3OB 1PYTA 4B9UA 4NLQA 1Q1KA 8ATCB 1XMQF 4ED6A 1HNWJ 2KH9A 5M2PA 1SPBP 2BOPA 1SBRA 3NS5A 1UVKA 3PJXA 4WXOA 5BYQA 5T41A 1S59A 4L3NA 4USHA 4EYHB 1WOSA 2IAJA 1HWLA 1YJVA 3I4HX 4LFBJ 1FRLA 1KQGB 3CCSS 5C25A 2GJIA 2CQGA 2V4JA 4J9VA 5THWA 3BQ1A 2DB1A 5J1PA 3IRXB 3GIJA 1B3TA 1NSPA 1FX4A 3LP1A 3JSMB 2M2BA 2F1FA 4WIQA 5ETMA 5CH7B 1N32J 1S1WB 4OL8A 2G9OA 2MQOA 3QT6A 4CLYA 3TJ9A 3J81j 3QIPA 2EBGA 3M8SA 1P1LA 2DGSA 4IR1A 2E7XA 2WB4A 2MQ8A 2Q66A 5KFAA 3GIIA 3NMRA 2XHCA 1RT1B 2CQ1A 2RF2B 5DG9A 4ZIWA 3HSGA 4F02A 2RDJA 1PYOB 4ZHRB 2ACYA 3DRRB 3O5TB 2V2ZA 1NJYA 1PCAA 1PBUA 3L7PA 1RAAB 5JUMA 4KJIA 2KJVA 2OFGX 1TTHB 4LREA 2H5IB 1S6PA 5B09A 4D3HA 3NGTA 4K4ZA 3QGIA 1Q5VA 2F5GA 4MYUA 2XHWA 5DGBA 2HFUA 4B02A 1QTMA 2XM3A 3AA8A 4E98A 4QIFA 1N36J 3D6TB 1F5AA 1UFLA 5IWAJ 5K20B 1VJWA 5BYRA 3FQLA 1Q16B 5HVHA 1T05A 3M8RA 3Q2SC 3U7JA 1T7PA 1RK8A 1CQNA 2EWHA 2DR6A 3V5RA 3P45B 2ZJQQ 4QYRA 5KG6A 2OTLS 1V3ZA 1Q86T 2ROPA 4OX7A 4B3SF 4B3MF 3F0NA 2D3ZA 1VQOS 1O51A 2QZ8A 1N0VC 3CCQS 2JFDA 4J7CA 3BGOP 2C3OA 1TL3B 3JQMA 4C2MA 2Z8QA 3ENVA 2JOQA 4NI2A 1TR0A 1YJRA 2HS0A 4P2MA 3AY0A 4QPXA 3GU0A 1TL1A 4P74A 2MHNA 3NNAA 3M2UB 1PAEX 5A8RA 3DLEB 4C97A 4QYZK 4IO9Q 1LWEB 2GIRA 4ZP7A 2XZTB 4RNMA 2E5LJ 4ETXA 3W60A 3HI9A 2FDNA 3R6LB 2MLYA 4K7QA 4QWBA 4NA2A 4G1QB 3BREA 3VZIA 3RR7A 4IDKB 2LA4A 4DX8H 2ZWOA 3RZAA 3DRSA 1UETA 4RW4B 3THPA 4PQUB 4NLSA 2XMJA 2RQKA 1LFPA 3DN9A 3PJWA 2XULA 1UZHA 4JI6F 1JB0C 1RCXB 5L46A 2KHCA 3US5A 4DX7A 2ZKUA 3MOZA 3VAFA 3BF4A 2ZH5A 1RU1A 3L7OA 3BO2A 1OY8A 3H42A 2DO4A 3RB0A 2W8KA 1N56A 3TANA 2M3DA 4KIAA 3L9ZA 4UY8T 1N54B 4X66F 2W9AA 1REGX 2VUGA 2FVCA 1URRA 3IS9B 2GIQA 2VKZG 1Q53A 1JLFB 3PNIA 4AXIA 4KHPF 4DS5A 1C0TA 1HHQA 5K9FA 1L3SA 4QQBA 7FD1A 1IJEB 3J7Z5 3MM8A 1NKCA 1VQ4S 4J9SA 4XDCA 2OPPA 4ZPBA 5KAKA 1UEVA 1X31C 1VRUB 4CCHA 1CJUA 2AEFA 2J0WA 3CE8A 1J27A 4KGMA 2VPZB 4OZ5A 3MUTP 5K8MA 3NL0A 1QTNB 2JVOA 4FN5A 2F7VA 3C15B 3RB3A 1M0SA 1JWWA 4YFUA 2HYIB 3G71S 5MAOA 1CEZA 4M5GA 1FXDA 1S72S 3MAAA 5ETOA 4C3MA 3DU6A 2YTCA 2V8HA 2H54B 4XO0A 3K59A 1REVB 3FNNA 4DEZA 4F2SA 2OPSA 1VBKA 3NOGA 3UDLA 2IRYA 1WNEA 3J81U 3W63A 4NZ0A 1T9XA 1X9SA 3IM8A 1FX2A 1T0TV 3QLHA 3L09A 3CNQP 4C8YA 3VF0B 4G3IA 4Q45A 1WACA 1X8DA 1NJIT 4ZA1A 5KFIA 4GKKF 2FHJA 2HNYB 3BPDA 4CO3A 2A1BA 3HVTB 2B6AB 1UW4A 3QJJA 4J9KA 1Q79A 2HS3A 1RA6A 5L8RC 4USKA 3EUNA 2K1RA 2DHGA 1AFIA 3HXMA 4ZVUB 2R4FA 3W5YA 5KFEA 4L73A 2D3OR 5DDPC 1T9WA 2FC8A 3O8WA 2HHSA 1VHIA 2VICA 3HP6A 1YLXA 4CYUB 5HMYA 3FBBA 2CXEA 2D3UA 3M2RB 4NYOA 4C8KA 2MZQA 1PJ5A 4KQZA 4AYBD 1AB8A 4C0HA 1JLEA 4L76A 1S1XA 3K5MA 3KK2B 3QGGA 1A6LA 1KOHA 1SC3B 2KU7A 2CADA 4P9SA 3ULHA 4JV5J 1D0EA 2E9ZA 1R8CA 3TRGA 3UE2A 3KJVA 4V19J 4KR0B 3OD2A 2V6AA 2CYYA 3TUZC 1MN7A 1NEEA 2GZOA 4B3RF 4JI5J 2HPUA 2XY6A 2A2DA 1FDAA 2ZM6F 1B0TA 1KC8T 3UR0A 3D54A 1I3OB 2VFRA 4MKYA 4DV4F 5D78A 5IV4A 3PKYA 1HYSA 3TYTA 1S1VA 3TR5A 1LKZA 2FY8A 4FVMA 1JJ2R 5D0EA 1U2RA 2YNFB 1AW0A 3A13A 2D3O1 1RHRB 1VR6A 2G1HA 2DNOA 4MT1A 2ASYA 2MSTA 3P8BB 5A76A 2HIQA 1KVKA 1Y0HA 1YJTA 2OEKA 3NCRA 3JQJA 2APOA 3KNAA 4OYBA 5ETRA 1DTQB 2ATCB 1FWLA 3KMQA 1BLUA 2HBZB 3NMAA 1FVQA 3R27A 2FC9A 2AP6A 5KFRA 4I0WA 3OR1A 3DI6B 5CHCB 2XYGB 4ZMMA 1WD6A 3JS9A 4OLPA 5LMNJ 3LAMA 3B6BA 5K8OA 2PE8A 4CDIA 1NBEB 4L6V3 4E8UA 5EN1A 4EMDA 2ASDA 4Y65A 2XO6A 3ZTSA 1APSA 3CO0P 5DG7A 4RW9A 4F0MA 4A48A 3W2VA 4PWDB 1P6TA 3G6XA 4ED4A 4NZ7A 2MKYA 1FJCA 5B0BA 4IH5A 4Z37A 3PW7A 3CCWA 3DDNA 1AROP 1U6BA 4NLTA 3HHNB 1RB0A 3ZZTA 1T03A 4FZVA 2UUWA 3OL8A 3E01A 3I56S 4LF7F 2CQ0A 1UJ5A 5F9NA 3K57A 3MOJB 4O3NA 4GVLA 2XMUA 2I9SA 5KG7A 2OSRA 5AJ3J 3PYGA 1WUUA 2AV5A 2DHXA 3JAMY 4DBQA 7FDRA 5SUHA 5HSPA 2QSFA 4YY3J 2QTWA 4NRUA 2GMLA 2F4VJ 4JI8F 2IDLA 4FF2A 1UVJA 1HHSA 2CG4A 4DPXA 2V4RA 1RT3A 2OPQB 1TL4A 3LUYA 4PR6A 5IZHA 2ADBA 1R3NA 4RW7B 4I56A 2X51A 3I9V9 4ECYA 2M88A 3GFZA 1O5JA 1FKPA 4TLRA 1FWKA 4USJC 4TY8B 4TU7A 4DV5J 2WSCC 3A3OB 3A12A 3NS6A 3KHHA 4OHWA 1NB7A 2W9CB 3HJVA 1FKOB 1SH3A 3R5GA 5LMUJ 5G0RB 4ES3A 3RAXA 4O4GB 1YTYA 2MY7A 3KLFA 2HVEA 3IM9A 1IQZA 4OZNA 3B8HA 4A8OA 3POTB 1KWMA 2JZ5A 4PWUA 4LUBA 3JSRA 2EXUA 3QWUA 3M9MB 1R0AB 1YIJS 1DURA 1WC3A 4GMKA 3IAM9 2AF6A 5ADZA 5CD4A 3FZ2A 1RAEB 3MM6A 3HHLB 4FPIA 5BR8J 1YVFA 1HNIA 1O0PA 4AL6A 1FXRA 1R31A 2HGMA 4C98A 1NCLA 1FERA 4YQWA 2OGUA 5F3TA 3SI8A 2ASLA 1HBUA 3TEHB 4CP5A 4AL7A 2VPYB 3QT7A 1UFWA 2NQPA 4LF8J 3EGZA 3I96A 1TAQA 3SFUA 4MIBA 3PHEA 1NHUA 2H9ZA 2R8GA 5GMKa 1S0VA 3GLJA 3BR8A 2PMWA 4R8UA 1NK9A 1Q7YT 3P3DA 1H98A 5T7LA 5KOWA 2R2SA 1HW8A 3AAWB 3FDSA 3VQTA 4YR0A 2DNRA 4DV2J 2BE9B 1S1UB 4RZRA 3NLCA 1QVFR 3M6XA 1X4EA 4HR2A 3MCSA 5HL7Q 4BC9A 1IBMF 4OYPA 3L4BC 1VBYA 1CJKB 4ATNA 4KFBA 4PXEA 4F50A 3T9ZA 1JLBB 1H38A 2OD6A 1LXNA 2Y1JA 2YKMB 1XK8A 2V68A 2VZ9A 2L9DA 4DJBA 4FNIA 2GNKA 4DR7F 2YQ3A 2Z58B 3G2XA 1WI6A 3FRZA 4LF1A 4OZLA 2HHQA 2QJ3A 3D4JA 2V0NA 1JLGA 1YJUA 3EX7B 1LW0B 2HBYB 1W2BR 3TUPA 4PPDA 1QY7A 3KUHA 1PG5B 2HZCA 1Y5IB 3DXSX 1BQMA 3SV3A 4EZ9A 4TKTA 4ILLA 1HWUA 4X62F 3NAHA 5HMXA 4PRFA 1HQUA 1XMBA 3I9ZA 4MH8A 5KG4A 2G13A 3TAQA 4MIWA 1EQ0A 3RYLA 3M32A 2OHDA 2F9JA 2OELA 3WX8A 5ETNA 5AE2A 3Q22A 2JEIA 4ED0A 3FFIB 4ZPAA 3PG9A 3HT0A 5I42A 4BC7A 4NLXA 3V4MA 4U6PA 3GR0A 1F9EB 2G0IA 1HBNB 4BLGA 4JB8B 4NMLA 4J9OA 5KFLA 4U7CA 3Q83A 3DOLA 4ID5B 4QPTA 1FA0A 4EEYA 5KTQA 2IDEA 1I94J 1UCNA 3TOQA 4J9MA 4LF6J 4HACB 3PCOB 4IFVB 2OD4A 3IP0A 4ZLLA 1IBLJ 4WIIA 4DFJA 4MKVA 5HO4A 2UXCJ 3OFHA 2QMXA 4DN9A 2QO3A 1U1KA 5KFXA 2HSEB 3OTDA 2HMIB 3TZYA 3LGMA 4DV1F 3JTPA 3UD5A 3QT5A 2EG1A 1AA1B 3SIPB 1LNQA 2ZE2B 4P6QA 3CJKB 2W4PA 3VZHA 3CJ5A
chains in the Genus database with same CATH topology
3PJ9A 3ETMA 4DI6A 3JS9A 4ANEA 1HIYA 3B6BA 4CP5A 5CAAA 1XIQA 3NGUA 4UOGA 4FKXA 3FBEA 2B8QA 4ANDA 1MN7A 2DXEA 3MPDA 1NSPA 1HLWA 4ENOA 3G2XA 5IOLA 1BUXA 1WKJA 2AZ3A 3PRVA 3ZTSA 1F3FA 2BEFA 5C7PA 1HHQA 3Q86A 1JXVA 1NUEA 1LWXA 3ZTOA 1WKLA 3Q8UA 1XQIA 2DXDA 4F4AA 3B54A 3EMTA 2CWKA 3VGSA 2DY9A 2NCKL 3Q83A 3ENAA 1PKUA 1NSKL 3BH6B 3EJMA 2ZUAA 4W98A 3VVTA 3GPAA 3VGTA 3BBFA 1LEOA 5CABA 4S0MA 1ZS6A 1UCNA 1NDPA 1NHKL 3FCWA 1NLKL 4WBFA 4ANCA 3GP9A 3EICA 4O0NA 1BE4A 2AZ1A 3EE3A 3Q8YA 1B4SA 3ZTPA 2HVEA 3Q89A 1F6TA 3BBCA 3FBFA 3VGUA 1BHNA 3EVOA 3BH7B 4F36A 3DDIA 3L7UA 1NDCA 3NGRA 4HR2A 4UOFA 2HURA 3NGSA 1K44A 3EVMA 3FBBA 3FCVA 3EVWA 1EHWA 4EK2A 1WKKA 2VU5A 3ZTQA 1S57A 3FKBA 4UOHA 1MN9A 1S59A 3ZTRA 3R9LA 4FKYA 1NDKA 1KDNA 1NB2A 3BBBA 3DKDA 1NPKA 1NSQA 4DUTA 3VGVA 1B99A 1S5ZA 5BXIA 2DYAA 3WX8A 2B8PA 1PAEX 2DXFA 1NDLA 3EM1A 4KPCA 4DZ6A 1VYAA 3NGTA 1W7WA 3ELHA 3VVUA 3Q8VA 3FC9A 1NCLA 2BX6A 2HVDA 4C6AA 3FBCA 1U8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJ9 A;  3ETM A;  4DI6 A;  3JS9 A;  4ANE A;  1HIY A;  3B6B A;  4CP5 A;  5CAA A;  1XIQ A;  3NGU A;  4UOG A;  4FKX A;  3FBE A;  2B8Q A;  4AND A;  1MN7 A;  2DXE A;  3MPD A;  1NSP A;  1HLW A;  4ENO A;  3G2X A;  5IOL A;  1BUX A;  1WKJ A;  2AZ3 A;  3PRV A;  3ZTS A;  1F3F A;  2BEF A;  5C7P A;  1HHQ A;  3Q86 A;  1JXV A;  1NUE A;  1LWX A;  3ZTO A;  1WKL A;  3Q8U A;  1XQI A;  2DXD A;  4F4A A;  3B54 A;  3EMT A;  2CWK A;  3VGS A;  2DY9 A;  2NCK L;  3Q83 A;  3ENA A;  1PKU A;  1NSK L;  3BH6 B;  3EJM A;  2ZUA A;  4W98 A;  3VVT A;  3GPA A;  3VGT A;  3BBF A;  1LEO A;  5CAB A;  4S0M A;  1ZS6 A;  1UCN A;  1NDP A;  1NHK L;  3FCW A;  1NLK L;  4WBF A;  4ANC A;  3GP9 A;  3EIC A;  4O0N A;  1BE4 A;  2AZ1 A;  3EE3 A;  3Q8Y A;  1B4S A;  3ZTP A;  2HVE A;  3Q89 A;  1F6T A;  3BBC A;  3FBF A;  3VGU A;  1BHN A;  3EVO A;  3BH7 B;  4F36 A;  3DDI A;  3L7U A;  1NDC A;  3NGR A;  4HR2 A;  4UOF A;  2HUR A;  3NGS A;  1K44 A;  3EVM A;  3FBB A;  3FCV A;  3EVW A;  1EHW A;  4EK2 A;  1WKK A;  2VU5 A;  3ZTQ A;  1S57 A;  3FKB A;  4UOH A;  1MN9 A;  1S59 A;  3ZTR A;  3R9L A;  4FKY A;  1NDK A;  1KDN A;  1NB2 A;  3BBB A;  3DKD A;  1NPK A;  1NSQ A;  4DUT A;  3VGV A;  1B99 A;  1S5Z A;  5BXI A;  2DYA A;  3WX8 A;  2B8P A;  1PAE X;  2DXF A;  1NDL A;  3EM1 A;  4KPC A;  4DZ6 A;  1VYA A;  3NGT A;  1W7W A;  3ELH A;  3VVU A;  3Q8V A;  3FC9 A;  1NCL A;  2BX6 A;  2HVD A;  4C6A A;  3FBC A;  1U8W A; 
#chains in the Genus database with same CATH topology
 5LOQ A;  1LW2 B;  1HD1 A;  2DR9 A;  4I2P B;  3QNW B;  4EWT A;  3X1L B;  4WU3 A;  3HSD A;  3NGD A;  2COL A;  5KT7 A;  3AD9 C;  3OFE A;  4QWA A;  4HI1 A;  1I51 B;  2VPX B;  5J2P A;  2E1C A;  1MMD A;  4TU9 A;  5FD1 A;  2JX2 A;  2H5E A;  1FJE B;  4U7U K;  2DRB A;  2HRY A;  1EP4 B;  1LWC A;  2CQI A;  3JYT A;  4CT8 A;  3T1H F;  1SH2 A;  1H2V Z;  4I69 A;  3U27 A;  3GIM A;  5ETT A;  1ITP A;  2WAQ D;  2UVR A;  3ZXW A;  5GAD I;  2GVZ B;  4A8S A;  3IR7 B;  3H2L A;  1KQK A;  3WIV A;  3J7A 1;  3GSD A;  4NRT A;  4DV0 J;  2A10 A;  4ZKA A;  4OHX A;  3EDR B;  4KPC A;  1HPZ B;  2VB6 A;  4FF3 A;  4J37 A;  3CME S;  2LLZ A;  2WON B;  3ZZP A;  5CYM A;  3LP2 B;  4ZLJ A;  1XTZ A;  1QDU B;  1VQ7 S;  4I68 A;  5DM7 Q;  5J1E B;  1DTT B;  3M30 B;  2V8V A;  2B4O A;  2RKI A;  1JX4 A;  2GA7 A;  1HNV B;  2IBO A;  4QW8 A;  5DG8 A;  4NLY A;  3K7R A;  1DQ9 A;  4PYD A;  4DX5 A;  1M5K C;  1J5O A;  3G8T A;  2HGL A;  4HHU A;  3C2P A;  3FJ2 A;  1U1L A;  5FJ4 A;  2UUA F;  2QA1 A;  4RBV A;  1Q8I A;  3KLI B;  4LRC A;  4NLV A;  3K58 A;  5A2Q Y;  2W25 A;  1X4G A;  3V4I A;  4KV8 B;  2HLT A;  3PIP Q;  5HP1 B;  4HHH A;  5D3G B;  3UI3 A;  2GJ2 A;  3SQG A;  3AJ1 A;  3SEO A;  1U0S A;  5HJY A;  4RUB A;  3NNC A;  2KYZ A;  1GFW B;  4DV3 J;  1L5U A;  2UV8 A;  2C2R A;  4CWB A;  4LFC F;  2VOD A;  2ZBQ A;  4OJG A;  3QAU A;  1H74 A;  3BH7 B;  1MMN A;  3NGR A;  3QO9 B;  1H7W A;  3HK2 A;  2DO0 A;  1N33 F;  3GJT B;  3DYA A;  4B3T F;  4DR1 J;  2LP4 A;  2V2K A;  5HJX A;  5EHH A;  1CJV B;  4DQI A;  3BBB A;  2VA3 A;  3M8Q A;  4I64 A;  2Y1R I;  2DBB A;  4CM2 A;  1T3N A;  5B7W A;  1TL5 A;  2ZZT A;  2UUB F;  2B9E A;  2W7A A;  2AX1 A;  2QN6 B;  4IOB A;  4ILR A;  1R27 B;  2IVF B;  3V6D B;  1KFD A;  3HHL D;  5A8W B;  2CDR B;  1KVI A;  2NYH A;  2AYM A;  2FYX A;  3TVK A;  1SQG A;  4DG1 A;  4ZVP B;  1C1B B;  4FXV A;  4EO6 A;  3FSY A;  4LRB A;  1OPZ A;  3PR4 A;  4K2X A;  2W1B A;  2DNH A;  1U0H A;  3ETO A;  2UP1 A;  2DNZ A;  1FRM A;  3LF0 A;  3C14 B;  1ZM4 A;  1LOU A;  4A8M P;  4RW8 B;  3VAK A;  4IQX A;  1T11 A;  4UT4 A;  2WBM A;  7AT1 B;  3JSM A;  4PG4 A;  2KRR A;  2NPF A;  1BXN A;  2LQJ A;  2OP5 A;  2FHO B;  5FLX Y;  4WK1 A;  3KDO A;  3GCX P;  3CCU S;  4C0O C;  2C3P A;  1XMO J;  2FLN A;  5J2M B;  4N47 A;  1IKW A;  1VC0 A;  4MIA A;  4OI6 A;  2XMV A;  3ZFV A;  4ZPT R;  2ZH8 A;  3MFH A;  2XEX A;  1K9M T;  1HMV B;  1Z2Z A;  3DRR A;  3PXG a;  2FZG B;  2UVU A;  3R2D J;  3Q0A A;  4ZDN A;  1RAB B;  4B9N A;  3GB0 A;  3EYZ A;  1FJG J;  2FJB B;  1RYS A;  1UAW A;  2X7I A;  4OYA A;  2BM1 A;  3MMB B;  3DMJ B;  5I3U B;  1N6Q A;  3QRP A;  2WTF A;  3RBD A;  2YQ0 A;  4ZVS B;  4O3S A;  3N6N A;  3G6Y A;  4JUZ A;  3R7N B;  2VG5 B;  1S6U A;  2EG2 A;  1RTD A;  1S49 A;  4JI2 F;  3J7Y U;  1ZA1 B;  4XPE A;  5HRO A;  4ZOS A;  2LFV A;  3PTW A;  2PGC A;  3QJL A;  1T94 A;  4KGX B;  3SMZ A;  3SV4 A;  3CSK A;  4C3K A;  2BKN A;  1CBK A;  4YB5 A;  3MUV P;  2QV6 A;  1WF0 A;  3CDW A;  3MR7 A;  4AQY J;  3QBC A;  4RWW A;  3UWT A;  1U49 A;  3OXL A;  2ZD1 B;  3H2V E;  4RBT A;  2EK6 A;  2O5D A;  4LSL B;  1KQS R;  3I0R B;  4YB1 P;  2RML A;  1NSQ A;  4JI0 F;  4MJK A;  2XS2 A;  5DLF A;  3VAI A;  1UJ6 A;  2ZH6 A;  3DRX A;  3FUY A;  2HZV A;  4CLS A;  2I1R A;  1MSW D;  5IT9 Y;  2ZKT A;  2CQ4 A;  1RXO B;  4EBE A;  1S6O A;  5C42 B;  1WF2 A;  2UUC F;  1QAI A;  3AOA A;  4JI7 F;  3LH2 S;  2DXE A;  1TL3 A;  1YJN S;  2X3D A;  4OI1 A;  2Y9H A;  2MGZ B;  4QYZ J;  4QBU A;  1LXJ A;  2AX0 A;  1YWX A;  2Z4P A;  4UY8 5;  4GKJ F;  1OS5 A;  1VQN S;  2MY8 A;  1HBM A;  2YNG A;  2NZC A;  3MDF A;  4DU8 A;  5JXS A;  2DNL A;  1S9E B;  4DR4 J;  2ZBP A;  1A0O B;  1J2V A;  3A3P B;  4S0M A;  2JNJ A;  1R89 A;  4TLQ A;  4ANC A;  4A8F A;  4KBI A;  1E6V B;  2J7W A;  1SIZ A;  2VQF J;  1FWP A;  1NKE A;  1S1T B;  2E7V A;  4OJ1 A;  1BHN A;  4DLE A;  3DLL Q;  1OMS A;  3HHK A;  3O1L A;  5DDR C;  2DNQ A;  3QPI A;  1SQE A;  3K17 A;  1HQE B;  4CRJ A;  4IG3 B;  3VAM A;  3QT8 A;  2R8K A;  1RAI B;  3M8W A;  4PQU A;  5LM7 E;  4H54 A;  4LQ3 A;  3OFG A;  3KHG A;  2KG1 A;  5EX0 A;  3NCP A;  5KOX A;  1U8W A;  4Y0F A;  1EX8 A;  2CJX B;  2QLF B;  4C8N A;  3PX0 A;  3R97 A;  1PC5 A;  1U1M A;  3HFV A;  1JKH B;  2RQM A;  2W01 A;  3AOD A;  3RW7 A;  4M95 A;  4K0K F;  2R42 A;  2CQ3 A;  1DAR A;  2WOM A;  1XMQ J;  2JVR A;  3HLU A;  3OR2 A;  3H5X A;  4I7F B;  2B56 A;  1H7X A;  2CPD A;  2DY9 A;  3PYE A;  1QD1 A;  3OTB A;  4ECQ A;  2MB0 B;  3DC2 A;  3DLH A;  4WF9 Q;  4LF5 F;  3EGN A;  2AZ1 A;  1RUS A;  3SDE A;  2C22 A;  1KTV A;  1U1N A;  2XNQ A;  2VG6 A;  1FK9 A;  3WZ0 A;  5I3P A;  1F6T A;  1QE1 B;  3PDN A;  4N8N A;  4NLW A;  1YRX A;  4R0E A;  2HND A;  2MZR A;  1FE0 A;  4P7T A;  4ER8 A;  3PZP A;  3MEG B;  4UF4 A;  5H9F J;  4DCJ B;  1RKI A;  4WFN Q;  4AFF A;  2E1A A;  1NDL A;  1FNM A;  3MMC B;  2PI5 A;  2HQG A;  1MU2 B;  4DUZ F;  4NEY A;  2HG4 A;  2HQD A;  2LEA A;  4DPW A;  1S48 A;  4EBD A;  4U7U D;  5JVH Q;  2MKC A;  1VI7 A;  2W2P P;  4CTA B;  1HLW A;  2D1C A;  4UUX A;  5DS7 A;  1F3F A;  1RHK B;  3MAH A;  1L3K A;  3IGN A;  3RB6 A;  4DV7 F;  3IBW A;  2IYI A;  1REV A;  2Y0S D;  2PN6 A;  4CLK A;  3LQV A;  1OY6 A;  1NK0 A;  1JMT A;  1P9Y A;  1BQN A;  2LXU A;  1HL6 A;  3RAQ A;  2F40 A;  3C46 A;  3GSI A;  3I6P A;  3Q8Y A;  4ZJL A;  1T3O A;  2R2T A;  2DH7 A;  2M5Y A;  2AYG A;  2PDA A;  3J7A N;  3L7U A;  2VFV A;  1V3S A;  4NA1 A;  4ED7 A;  3HSZ A;  3J7Z T;  5CZX A;  4F4W A;  3UN3 A;  1YK9 A;  5E2Q A;  2GHP A;  3ZZR A;  2H65 B;  1CC7 A;  3U02 A;  2FTR A;  5DGA A;  2E29 A;  3B4M A;  2EC0 A;  2ROG A;  1N34 F;  1ZOT A;  3MGJ A;  1Y5N B;  5KFN A;  3W7B A;  3MTK A;  4ZLP A;  5EUH A;  2F8E X;  3BGF A;  4B3S J;  1LWX A;  4B3M J;  1FRK A;  1RTJ A;  3OTO F;  1C4A A;  3EMT A;  4ZP6 A;  4FYW B;  2RIJ A;  2MJN A;  4OI2 A;  1ZBT A;  1RWN B;  4HH1 A;  4DSK A;  1WWH A;  3SSS A;  3M9N B;  1IKY B;  1R6V A;  2EFP A;  2HBR B;  4N5S A;  3IWL A;  1CS4 B;  1KRP A;  4ELV A;  8RUC A;  3MM5 A;  3GV7 B;  3CF5 Q;  2MDA A;  1HKA A;  4DPY A;  1NDK A;  3DHW C;  4DUY F;  1YGY A;  1D9F A;  2BAC A;  3TEG A;  2SXL A;  2BJE A;  3PR5 B;  1SJ1 A;  3MR6 A;  2RQ4 A;  3KNG A;  3HJF A;  2VBZ A;  1R0B G;  1GMW D;  5HMZ A;  4ECT A;  2KZZ A;  3DLK A;  4YS2 A;  2BR0 A;  2XMK A;  3C16 B;  2OPR A;  4J9U E;  4NYZ A;  3CJ3 A;  3UDE A;  2AJQ A;  5M2R A;  2CRL A;  3BGU A;  2FLL A;  3VGS A;  3BSN A;  2GAG C;  1CJT A;  2EPI A;  4DQR A;  5EWE A;  3P5T L;  4DL2 A;  1SI9 A;  1VIX A;  4DLG A;  1TMM A;  3J81 Y;  1NK6 A;  3FCW A;  4TU8 A;  1NLK L;  2QFJ A;  5A6W A;  4H4K A;  1KD1 T;  4ZVG A;  1W2I A;  4X66 J;  1WF1 A;  4MKB A;  3GJS B;  4RX6 A;  4ZPW R;  3DDI A;  1NZ8 A;  1T02 A;  3M1V B;  3UQS A;  2HLU A;  2YKP A;  1S9F A;  2ZHB A;  1Q81 T;  4KHP J;  2C2M B;  3WHI A;  1SJQ A;  3CJS A;  2YKN A;  1V9O A;  2HEK A;  1MRO B;  2IJF A;  3PVX A;  2FJW A;  2OH2 A;  3D0H E;  3DU5 A;  5DO2 A;  3D6M B;  2XYP B;  5A0Y B;  2LU2 A;  2PEH A;  5B0F A;  3BGR A;  5GMD A;  1TVR A;  1C2P A;  1JLQ A;  2NSB A;  3LW5 C;  4X4P A;  2EI5 A;  1UEK A;  1Z4U A;  2G0J A;  4DDF A;  1F2G A;  2G2Z A;  1NKB A;  2RHQ B;  3BSC A;  1VJQ A;  1YX2 A;  2HK3 A;  2FD2 A;  2PMZ D;  1U4B A;  3CTR A;  5D4L A;  3T9N A;  1WKJ A;  1JXV A;  4I67 A;  4OLO A;  3ZTO A;  4KYZ A;  1PBA A;  1TL7 A;  2K06 A;  5J2Q A;  1U1R A;  4OZ3 A;  4ZJQ A;  3EJM A;  4QU7 A;  3KMS A;  1N5Y A;  5KFW A;  4DPO A;  1TV6 A;  2OPQ A;  3MFI A;  3CPW R;  3OXG A;  1UL3 A;  1S99 A;  3VAL A;  1WEY A;  2NXC A;  4F67 A;  1VQ8 S;  1YSJ A;  4NX9 A;  2BA9 A;  2QGF B;  5ETS A;  3AXK A;  3LP0 B;  1NJX A;  4R5P A;  2QIF A;  2VG7 B;  2W9C A;  3I5C A;  3NGK A;  1FKO A;  4G65 A;  1CUL B;  4GKK J;  4O4G A;  2ALZ A;  1NZA A;  3BDP A;  1IR0 A;  3PX4 A;  2K7K A;  2CJ9 A;  4DFP A;  1FD8 A;  1X9M A;  3FCH A;  4NXN F;  3CCE S;  2OML A;  4NCA A;  4QR2 A;  3QGH A;  4WP3 A;  5E3Q A;  1S7H A;  4TVA B;  2MQN A;  1NUE A;  3CT9 A;  4W4M A;  2GVD B;  1DJ0 A;  1SXL A;  2YNI A;  2AHO B;  1CSJ A;  3K5L A;  2W4D A;  1TP7 A;  4WYL A;  4YB7 A;  2ZJR Q;  3T3F A;  2EFG A;  5LSL A;  4CIO A;  1F3V A;  1RWK B;  5LXY A;  5CAB A;  1NDP A;  2CNO B;  6FD1 A;  3OVS A;  4OJ3 A;  3PEJ A;  2FVS A;  3EE3 A;  4B9T A;  2P8I A;  1DQ8 A;  1KOO A;  3JTO A;  2NXU A;  1JLA A;  4KHR A;  3CUL A;  3H2U B;  5HK4 A;  3AB2 B;  1PAU B;  5H9E K;  6AT1 B;  4B3R J;  1SC4 B;  4OHZ A;  5D8H B;  1FE4 A;  2CWX A;  2MZT A;  2JDJ A;  5KFS A;  4DV4 J;  1RCO B;  2GV1 A;  2B4V A;  4IOC Q;  2DEI A;  4I6Y A;  3DRP B;  3K89 A;  1EB0 A;  3NAI A;  1L3T A;  2J7K A;  1RGV A;  4DL7 A;  3TI0 A;  4J9L A;  2PFF B;  3VCD A;  2DR7 A;  2LEB A;  2DRA A;  1LFW A;  2XMT A;  3NOC A;  5L9N A;  2XLI A;  4MK7 A;  2YKM A;  2HBQ B;  1VQS A;  2YXL A;  3VGT A;  3W1Y C;  4WTO B;  1X7V A;  3HF5 A;  1DAX A;  1YDL A;  1UMJ A;  4QIW D;  3TZW A;  3VGU A;  2CAJ A;  3IXQ A;  3KJQ B;  4FYV B;  2V67 A;  2Z0G A;  3F44 A;  2YNH A;  1X5T A;  1RT4 B;  4EYI B;  3M7V A;  4OJH A;  4ZPD A;  3ZTR A;  3H90 A;  1FKA F;  4FS2 A;  4KT0 C;  4KH1 B;  5J2N A;  1Q7L B;  3ITH A;  1UVI A;  1RHM B;  1S6Q A;  5LSR A;  4I2Q B;  1E6Y B;  1MWQ A;  2AKW B;  5HLF B;  3FBC A;  2B5J B;  3M2V A;  2ADC A;  2KJW A;  2VOO A;  3MCM A;  1U7L A;  5H1S V;  4HLB A;  2PEB A;  1I5O B;  1SL0 A;  4DL6 A;  3UNG C;  1QVG R;  4DV6 F;  3WIU A;  1AFJ A;  1G6B A;  3FFI A;  1O6X A;  3QSY B;  4ED5 A;  1ZH5 A;  1RT5 A;  1P9Q C;  1GXU A;  1GAO A;  4LVO P;  1C0U A;  4PYA A;  3H59 A;  1W25 A;  1WC6 A;  1T9V A;  3IWX A;  3PRD A;  1S9G B;  2XLJ A;  4JI8 J;  5LJ3 Y;  3NBP B;  1SCJ B;  4IUF A;  2MZ1 A;  2RU3 A;  2IAJ B;  4ID5 A;  1WOO A;  5C25 B;  2V4J B;  2VDI A;  2YKQ A;  1VRT A;  4B08 A;  4DN0 A;  2OO4 A;  1VYA A;  5K5M A;  1RT2 B;  3IMQ J;  1IJF B;  1QJH A;  2Y1I A;  5IC4 B;  3D5M A;  3D1H A;  3PX6 A;  2JLE A;  2EFO A;  4K59 A;  3F73 A;  3K5N A;  2YKA A;  1KS2 A;  2A0F B;  4OMF G;  2GQQ A;  3QIP B;  3ISZ A;  2H1Y A;  1HBO B;  3OW2 R;  3GR1 A;  4KKO A;  2ZOG A;  3KKF A;  2L08 A;  5KG2 A;  1V5V A;  4DSL A;  4JOU A;  2XY7 A;  2LU1 A;  3MR2 A;  3ZZ0 A;  1WDT A;  2ZE2 A;  3LA0 A;  1KEK A;  1ZPV A;  3D2W A;  4IFY A;  2F9D A;  2VKR A;  2LVW A;  2MLX A;  4KAI A;  2O3D A;  5AT1 B;  1T8E A;  1FCA A;  2J0Q D;  3ISN C;  1N0U A;  3IA0 A;  1DHM A;  1N5Q A;  3R7B B;  4RL1 A;  1RYR A;  1RWX B;  1EET B;  4BBY A;  1NDC A;  4DR3 F;  3QAE A;  2HFZ A;  2WVF A;  1N52 B;  5KG1 A;  1KLM B;  1K44 A;  4O3O A;  1RWM B;  3RG6 A;  1EP4 A;  3GIK A;  2BKP A;  1S6P B;  3LAK A;  2E5J A;  4YDX A;  1U8S A;  2VBY A;  1AT1 B;  5L9X A;  4DL4 A;  1CC8 A;  1UZD A;  4RW6 B;  3CC2 S;  3R8Y A;  1RA7 A;  1HIY A;  1ZPW X;  1WJ9 A;  3DOK A;  2OIH A;  1RLD A;  3PIO Q;  1HI8 A;  3KTQ A;  1X4F A;  5KFF A;  1T05 B;  2GQC A;  1CVJ A;  2KVI A;  3OFF A;  3HPO A;  1JJ4 A;  3NP5 A;  1FDD A;  2LA6 A;  4GO7 X;  4WE1 A;  3JQK A;  2IM2 A;  2C2K B;  1VQ9 S;  2VC0 A;  2N4D A;  4RU9 A;  4IRC A;  1IBM J;  4XTT A;  3BBF A;  5J1E A;  2ZH3 A;  1M5S A;  4QOT A;  1WOR A;  1HNX F;  4CM0 A;  2E44 A;  3R1L A;  4PXB A;  1UWB A;  1X9W A;  5CD4 H;  3AD7 C;  2DHH A;  4ILM A;  2DNM A;  3N01 A;  1K47 A;  4IRK A;  4NLO A;  3FCV A;  4KSE B;  3RW6 A;  2BZ2 A;  4JYA F;  2I2Y A;  3GMG A;  5MLC V;  1TL1 B;  4CO5 A;  4DR7 J;  2CPE A;  1SJR A;  1UP1 A;  1Y9O A;  2Y3Y A;  2I5J B;  1OIA A;  4N77 A;  2K3K A;  5A8R B;  2FVQ A;  1Y10 A;  3U1N A;  3G96 A;  3L95 X;  4CO2 A;  3LPE A;  2FGO A;  1JLC B;  1HWI A;  4QU6 A;  3VQS A;  3ZZY A;  4DI6 A;  2B4U A;  2YWK A;  4K4T A;  3CD7 A;  3AOC A;  4E2F B;  2WBR A;  5HQL A;  1BY9 A;  2ZFH A;  3JSB A;  3GIL A;  2CUY A;  2HHU A;  2OUG A;  1VK8 A;  3VV2 B;  4X62 J;  4UZB A;  3FZB A;  4ZVO B;  2HVZ A;  5J1N A;  5L39 A;  5IT9 U;  4J9N A;  1YJ9 S;  2R7X A;  2W2M P;  3QQC D;  3IBC B;  3N9U C;  4ITS A;  3H4D A;  1W26 A;  5L1J A;  5A8W A;  2Q6C A;  1KQF B;  2D9O A;  3SSR A;  2N3O A;  4CLT A;  1H73 A;  3NS7 B;  3TWZ A;  4OV6 A;  1UJ4 A;  2P9E A;  2QL9 B;  1Q5Y A;  4HL9 A;  5C5J A;  5KFM A;  1VBZ A;  4DR5 F;  3RBZ A;  3UO0 A;  3CJ4 A;  2DPJ A;  1FVS A;  5B0G A;  1YRU A;  1YIT S;  3EWG A;  4OYZ A;  4KO0 B;  2C3U A;  1KR4 A;  2L48 A;  4HI2 A;  1RHJ B;  3OQ2 A;  4C7Q A;  4NL5 A;  1VGY A;  2VIH A;  1P27 B;  1MG7 A;  1ICE B;  2NUU G;  1ZM9 A;  1X5P A;  1U1P A;  5HAT A;  2B43 A;  4LIR A;  2KZM A;  1ZET A;  1Y4Z B;  2B3T B;  5KFQ A;  2IMO A;  1N48 A;  1LQ9 A;  3MM8 B;  2GO9 A;  1TK5 A;  2KM8 B;  4DR6 F;  2DNN A;  2DTJ A;  2O01 C;  4DWI A;  2OPP B;  5D0H A;  3C6U A;  2V9W A;  2AIR B;  2OFH X;  1HMV A;  1CJU B;  3VAG A;  5AJ3 F;  1YBT A;  2A6M A;  4USV A;  1CPZ A;  3S6E A;  4C48 A;  4FNH A;  2Q6B A;  2IYG A;  5EGY A;  2ZBI A;  4L72 B;  4DV1 J;  3M6W A;  3A8E A;  4HHJ A;  4W92 B;  3GON A;  9ATC B;  5B0C A;  3QID A;  4FYY B;  3W8P A;  4C9D A;  3MAA B;  1G7C B;  2RHS B;  2E7W A;  3DNC A;  4DFK A;  3CD0 A;  4AE5 A;  2C2O B;  4G6V B;  2A6O A;  1NB2 A;  4HVZ A;  2GW8 A;  4PAA A;  5KG5 A;  2BJ1 A;  5CQG A;  2OPS B;  2BAN A;  3OPK A;  3PKM A;  2DYA A;  1IBC B;  3ZZO A;  1UPM B;  5CXT A;  3QLH B;  4K4Y A;  2OKQ A;  2F8M A;  5KFZ A;  2F8H A;  2IRX A;  2R8H A;  5U47 A;  4QZV B;  5K14 A;  3T1H J;  2J6S A;  3I0R A;  2HVI A;  1IN0 A;  1UTA A;  5BYS A;  1HQ2 A;  4GVB B;  4KTQ A;  2GIF A;  2V94 A;  1FRX A;  3RBE A;  2K1R B;  3KYL A;  1EIY B;  4CLF A;  2HWI A;  3GYX B;  2A18 A;  3S1T A;  3G4S S;  1LWF A;  1XR5 A;  4KGK A;  3KLE A;  4CQ1 A;  3ET6 A;  5AXL A;  2WCX A;  3DRY A;  3SCL E;  1GTE A;  3Q2T C;  3FQK A;  1RAG B;  3EVO A;  2ILY A;  4ES2 A;  2XQC A;  2W9B A;  1JLE B;  1U02 A;  3GYG A;  2WB1 D;  2UUT A;  2D7S A;  1FT8 A;  1K1Q A;  1S1X B;  4NOH A;  4TYA A;  5E3P A;  2YH0 A;  2AEM A;  4YHH F;  2UUA J;  5GAG I;  1E6V A;  3EM1 A;  2BJ9 A;  4ICL B;  3CD6 S;  4DF8 A;  2UVW A;  2FHK A;  4P2X A;  2VQE F;  1VMB A;  1BC6 A;  2KT2 A;  3ZZZ A;  4DPU A;  1PO6 A;  2C2N A;  4LF4 F;  1GEH A;  5D0G A;  1FNX H;  2CQC A;  4WXW A;  4C3L A;  4NE9 C;  1HYS B;  3BSO A;  3RR8 A;  1IKV B;  4LFC J;  1JNZ B;  2QL7 B;  3DFE A;  3KK3 A;  1WEL A;  2DT9 A;  1N33 J;  2BE2 A;  2MQM A;  1D9A A;  2AMC B;  4LR9 A;  1MLA A;  3MPW A;  1FF2 A;  4FF4 A;  4UTG A;  1PSD A;  2UUB J;  3FBF A;  1RAD B;  4LF9 F;  3QGP A;  3GQC A;  5ETL A;  1TKZ B;  2ZC3 A;  2AQ4 A;  1WHV A;  2MJU A;  1L3V A;  1HAR A;  2FVR A;  4HEA 9;  2DK2 A;  4EI2 A;  2YX7 A;  2MKI A;  5LXR A;  1NPK A;  3E3X A;  1H6K X;  4G1I A;  3OR1 B;  3VGV A;  1RBA A;  1RTH A;  3A4T A;  2HIY A;  1U45 A;  4WCE Q;  1V5I B;  4L75 A;  5C2C A;  4WFX A;  2B7B B;  2PD1 A;  3DXB A;  2IC3 A;  3W2W A;  2LYV A;  4FP9 A;  5DET A;  4UQG A;  1U2C A;  2IM3 A;  2ABY A;  5K8P A;  3CMQ A;  2AZ3 A;  2K8G A;  3Q86 A;  4RW9 B;  4CZC A;  3W2V B;  2V34 A;  2J0S D;  2GC8 A;  2DXD A;  5JVG Q;  4ZN1 A;  2W7O A;  3P96 A;  4JV1 A;  3OUY A;  4WJB A;  1UKU A;  1T03 B;  5EX3 A;  2HHH F;  5IV3 A;  3RRH A;  2GMJ A;  2IJN A;  3MWB A;  3UD3 P;  1Y5L B;  3M8P A;  5LL6 d;  4CO0 A;  2HW3 A;  2MYF A;  3DCA A;  1C1C A;  4JI3 F;  2I8E A;  2BW2 A;  3R5J B;  1Q8L A;  1TKD A;  4O23 A;  5GAD U;  1MN9 A;  4I6W A;  5HMW A;  2HNZ A;  2HWH A;  3MM9 B;  3UCG A;  3MPU B;  1WC5 A;  2ZDP A;  3Q24 A;  3ELH A;  1RT3 B;  3C6T A;  2HVD A;  2LKZ A;  3BR9 A;  4F0K A;  4JI2 J;  3UDV A;  1SUQ B;  1AZS A;  4UST A;  1N5S A;  1DFD A;  3PRV A;  2R8I A;  1HNZ F;  4QCL A;  3ICL A;  1FKP B;  4RPF A;  5KG3 A;  5AXM A;  3ZZU A;  1X4C A;  2RAQ A;  1XER A;  4GC7 A;  4YR2 A;  4W98 A;  3OL7 A;  2QYC A;  3KLF B;  4JI0 J;  2KN4 A;  3GV5 B;  2XCA A;  4NMX A;  4O0N A;  2M70 A;  2QFI A;  1TK0 A;  2JC0 A;  3HVA A;  4Y34 A;  2PII A;  2R7T A;  5HBM A;  2MLZ A;  1KP6 A;  3KLH A;  5B0D A;  3AA9 A;  2UUC J;  4F4Z A;  4M5H A;  3RB4 A;  2N4C A;  3QZ7 A;  4JI7 J;  5KFU A;  3MM6 B;  4R25 A;  4L3K A;  4USW A;  3ENW A;  2MTL A;  1RTI B;  1HNI B;  1KDN A;  1PIE A;  1DZ5 A;  1D3W A;  3EZU A;  1XJW B;  3OSN A;  2QE5 A;  2E1P A;  4B17 A;  2XI3 A;  4GKJ J;  1HBU B;  3RRK A;  3IN5 A;  1RWO B;  1FRH A;  3HD2 A;  4H4K C;  2YWW A;  1ZYQ A;  3FEX B;  1ELO A;  1TZ0 A;  4ZJO A;  3PO4 A;  3ONQ A;  3OVB A;  5IM0 A;  4Y2A A;  2HQF A;  2HFS A;  9RUB A;  4Q0B A;  1PJ6 A;  1J5E F;  1OY9 A;  2BJ3 A;  3T5H A;  3AB4 B;  4TY9 A;  3R7S B;  1SKR A;  3CB4 A;  4RUA A;  4IO1 A;  2UXD F;  4PUO B;  4Y2K A;  2UU9 F;  2J8A A;  2HHP A;  1B7Y B;  1WOP A;  3Q8S B;  2XS5 A;  4JI4 F;  4HH0 A;  2KG0 A;  2E1R A;  4O0I A;  4Z7Y A;  1URN A;  2X1B A;  4F3O A;  3G82 B;  5KFH A;  2CZV C;  2ZOM A;  2H4Y B;  3BQ0 A;  3C8Y A;  4BDP A;  4UOC A;  2EKN A;  1Q95 G;  4KRW A;  4LJM A;  5D4P A;  3QJP A;  2U1A A;  3PYF A;  4K50 A;  4K0K J;  2BUN A;  4DUT A;  1XBW A;  1VIS A;  3NG8 A;  3N6M A;  3BSA A;  3AJ2 A;  4KGZ B;  4H4O B;  4LBH A;  1NJZ A;  1M5P C;  4M5J A;  1TEL A;  2CPX A;  4AND A;  3VTI A;  1R0C B;  1WI8 A;  1MWZ A;  4LF5 J;  4DV3 F;  3M8Z A;  1JLG B;  1CLF A;  3PEH A;  2DNG A;  3LAN A;  2P6S A;  2J9E A;  1FRJ A;  3MAQ A;  3D68 A;  2BQU A;  2FHJ D;  1UW9 A;  2GHW A;  4V19 X;  4ZLN A;  1VHF A;  2JWN A;  2B51 A;  3CXC R;  3HMJ G;  1HQU B;  5HN0 A;  3IG1 A;  3H5U A;  3DGV A;  2VJU A;  5GAE I;  1SV5 A;  2FZK B;  1VFJ A;  3TVZ A;  3IR6 B;  5ETK A;  4DUZ J;  4DL0 C;  2JLG A;  1KFS A;  4JBC A;  1RU2 A;  3HHL C;  2JRS A;  4MK8 A;  2YY3 A;  1S5Z A;  2FJD B;  4LFA F;  1HW9 A;  4DQS A;  4DV7 J;  3CED A;  2ZH4 A;  2D9P A;  1U2F A;  3D3B J;  2IHR 1;  1QSL A;  2V2Q A;  4H4M B;  3OLB A;  5L1I A;  4NA3 A;  3FRY A;  1JK9 B;  2ZBC A;  5DRK A;  3FEY B;  2P9G A;  3R5A A;  3IAS 9;  1H3D A;  3TAP A;  3KHR A;  3DOL B;  3RTV A;  1HI0 P;  2X3G A;  1IM6 A;  3OHB A;  4J9Q A;  2FGC A;  4CO4 A;  2XMM A;  2ZZN A;  1S97 A;  4RU2 A;  3A8J A;  3I31 A;  4NCB A;  4DZD A;  3EZO A;  3MMA B;  3SCK E;  3R1H A;  4XK8 C;  1AYE A;  2P9C A;  2LXI A;  4JI1 J;  3MED A;  1N34 J;  3AQO A;  1G1X A;  4X4O A;  3DLG A;  2E9R X;  3LTO A;  3QMQ A;  1UVM A;  4M5N A;  1Z2L A;  3VHQ A;  2L9W A;  1B0P A;  1QLN A;  2J0X A;  3OTO J;  2BXJ A;  1XC9 A;  4IG0 A;  4NYP A;  1VQY A;  5LSO A;  1ZM2 A;  2VPW B;  1W7W A;  3S8S A;  4V1A k;  2A2C A;  4RR5 A;  4ALZ A;  1NM2 A;  3TP2 A;  3VWS A;  2DCU B;  2ZZM A;  3FGV A;  5B08 A;  4QIE A;  5J2P B;  1YRT A;  2XMA A;  4FYX B;  4USU A;  5F41 A;  4K4U A;  3JYT B;  3AT1 B;  1RE1 B;  1JNR B;  2ASJ A;  3FMW A;  4WFY A;  3UN5 A;  2R7O A;  2GS8 A;  2Z2Y B;  4WBF A;  3V81 A;  2QEX S;  3EIC A;  4ELU A;  2DKO B;  3MD3 A;  4ZVR B;  3MEE B;  2ACM A;  3ZTP A;  4QWE A;  3DM2 A;  4DUY J;  4X4T A;  4C8O A;  1OWX A;  2C1E B;  2LEP A;  1IBK F;  2JC1 A;  4LBP A;  3PO5 A;  2RIL A;  1G2E A;  3W64 A;  3G87 A;  3THV A;  3W5X A;  1RT7 A;  3DOM A;  3QWP A;  4QIG A;  2KT3 A;  5KFK A;  4ZCM A;  3TX0 A;  5CYM B;  5KT4 A;  4TNO A;  3A3N B;  4A4J A;  5BJR A;  2RKI B;  2GGP A;  4KPY A;  3MEC A;  4RUH A;  3EGV A;  3TA0 A;  3FSI A;  1J5O B;  4LMZ A;  3PW4 A;  4X64 F;  2IA0 A;  3HVW A;  2BVZ A;  4OZ2 A;  5GME A;  1XWL A;  2I0X A;  3DHX A;  4J5O A;  1RAH B;  2VQF F;  3V4I B;  5HAO A;  2KT5 A;  2D41 A;  2OSQ A;  3SQG B;  2AGP A;  2W7P A;  2RS8 A;  2B5J A;  2QA4 G;  2RH3 A;  4DF4 A;  1TKT A;  3O3L A;  4NXM F;  4M63 A;  2OAU A;  4M94 A;  2CPZ A;  2RDI A;  4K2J A;  5HQ8 A;  2DGX A;  1F60 B;  4Q8F A;  3PFO A;  2EFV A;  1X5O A;  4MYT A;  8AT1 B;  3NGS A;  1Y3K A;  3M8Q B;  2AJ4 A;  2O1P A;  4F25 A;  1ZAW A;  3NCQ A;  3Q8Q B;  1IWA A;  2VL1 A;  5E41 A;  5A8K B;  3GYN A;  4Y3C A;  3M8Y A;  2R7S A;  2ZNY A;  3HDS A;  1RT6 A;  1S9G A;  4RO0 A;  3NBP A;  4DG1 B;  2V63 A;  1SKU B;  3BKT A;  1ROF A;  4UOG A;  1S0M A;  2HAI A;  4WU2 A;  3CCL S;  1YHQ S;  2DGT A;  1U0H B;  3FMB A;  1SJ4 P;  1U25 A;  3UD4 P;  2IVM A;  1P1T A;  4K5S A;  5C24 A;  1RT2 A;  2JJ4 D;  2RDD A;  3BH6 B;  2V8P A;  2IRU A;  1KVJ A;  3TAM B;  2HQC A;  4ZCL A;  2GMH A;  2BJ7 A;  5KG0 A;  1RWW B;  1H0H B;  3GP9 A;  1G4C A;  4NCG A;  3V6H A;  2BRL A;  4ECV A;  1HBO A;  1SH0 A;  4NXN J;  1PIL A;  3ZO7 A;  1NK5 A;  3K0J A;  4ZK7 M;  3EVM A;  1IKW B;  2VU5 A;  3BO3 A;  1RLC L;  4U96 A;  3AQP A;  2X1F A;  4PCQ A;  4W90 B;  4OZ0 A;  1KSP A;  2XCP A;  2M4M A;  3TZX A;  1YZ7 A;  3PHT A;  3KLV A;  2IY5 B;  5D77 A;  1EET A;  5HAN A;  4K8R A;  1QUV A;  2CIM A;  3HKW A;  1OJ4 A;  1N6Q B;  1KLM A;  1UVL A;  1S0O A;  3KK1 A;  2DR8 A;  2J76 E;  5KFY A;  4Q44 A;  3GV8 B;  1IKX B;  1RTD B;  3W3S A;  2H3E B;  5HRO B;  4RW6 A;  2NCK L;  5GAH U;  1FRI A;  4FXD A;  3MZI A;  1NSK L;  3HZG A;  3UVJ B;  4RNO A;  3EPI A;  2RS2 A;  3F41 A;  2HVH A;  3P4U B;  3QZ8 A;  1S7I A;  4OYO A;  1TU0 B;  4X4S A;  2UXB F;  1Q0N A;  4WZQ A;  2XSJ B;  4F36 A;  3QFW A;  1VIO A;  4P75 A;  1D9D A;  2WZ1 A;  1VDH A;  5AE1 A;  4CLW A;  3MUR P;  3UCU P;  3FKB A;  2UZA A;  3CJR A;  3GZ7 A;  3CJT A;  3KLG A;  2R2R A;  3T1Y F;  4M5D B;  2MSS A;  5IFM A;  3BDE A;  4ZVF A;  1Q8B A;  3CJ2 A;  4ZVH A;  3N5B A;  3IO1 A;  2BMB A;  2DGW A;  1ZZF A;  1FO1 A;  3VAH A;  3NWR A;  1NJW A;  5C7P A;  1HBM B;  2HRU A;  2I5J A;  5L38 A;  4CH0 S;  2YNG B;  2GAH C;  4X84 A;  1NK4 A;  5IQQ A;  2W2N P;  2CDQ A;  4O44 A;  1JLC A;  2KI2 A;  2IM1 A;  1EKS A;  2B4P A;  4OX9 F;  5FDL A;  2EK1 A;  3HFZ B;  4K4X A;  3K8V A;  1OYD A;  4XAK A;  1WHX A;  3LOU A;  1TKX A;  1FTR A;  3T1A A;  4AT1 B;  2YX4 A;  4B3O A;  3I82 A;  1UFK A;  4GC6 A;  2FB0 A;  1FEE A;  3CWJ A;  2JEG A;  2RU9 A;  1VBX A;  3G8Q A;  2VV5 A;  4I6A A;  3DGP B;  4BHQ A;  4M5K A;  4JV0 A;  3O2I A;  3FEZ A;  3AHP A;  1RWU A;  2IIH A;  2O67 A;  2DHA A;  2J9D A;  1VQL S;  5E0O A;  2J9D E;  4DV6 J;  1NK8 A;  3DDK A;  4C6A A;  1F9H A;  1BQX A;  5B0E A;  4F4K A;  1HR0 F;  1DRZ A;  2E9T A;  2WOM B;  4TQS A;  1BWV A;  2YWE A;  4RKU C;  3H20 A;  3IRX A;  2PC6 A;  3OR2 B;  1BWE A;  4OYX A;  4KO0 A;  3CMA S;  2AGO A;  1RAC B;  2B9W A;  4ELT A;  4U95 A;  4WPA A;  3D6F B;  2DIV A;  3NY0 A;  3BV8 A;  1S1W A;  1JXL A;  3CGI A;  2FJV A;  1U6Z A;  1TAU A;  3SCI E;  3SDE B;  1T9Y A;  1ZS6 A;  3GTY X;  2VG6 B;  1FK9 B;  1VC6 A;  1YJW S;  2LMI A;  2QMW A;  5IT0 A;  1RT1 A;  2HND B;  3KUG A;  2RF2 A;  1B70 B;  2KRB A;  1GNK A;  4ZHR A;  1V3R A;  4X65 J;  2CA9 A;  1KNZ A;  1OYE A;  4DHV A;  2RRA A;  3GIR A;  2DNY A;  4HT7 A;  3LWM A;  3LGN A;  2EFN A;  4Q2L A;  4ED1 A;  2FUG 9;  5H9F K;  3Q8V A;  1RQ0 A;  2QC3 A;  3ZC4 A;  4HTJ A;  2BQ3 A;  4P71 A;  5CAA A;  1ZTT A;  4URG A;  1U47 A;  3R3T A;  2DGQ A;  3J80 U;  3BGL A;  3CO9 A;  3ISN D;  2BM0 A;  1JJC B;  1SL2 A;  4PAB A;  3SXL A;  2IBK A;  4MKA A;  3HHE A;  4DR3 J;  1BQN B;  4K4V A;  4HDG A;  2AJ2 A;  4GRS A;  2WHO A;  2ZUA A;  1RWV B;  1OSD A;  2IJR A;  3NNH A;  4BWM A;  3QRR A;  2HWT A;  5L1L A;  3RU0 A;  4GVB A;  1EQM A;  2YPZ A;  4UOF A;  4KHM A;  3O44 A;  2AW0 A;  1R8A A;  3CC4 S;  2ZH2 A;  3H40 A;  4F3M A;  1L3U A;  5KFC A;  5FII A;  2WVB A;  4TN2 A;  1KKH A;  4ZCI A;  5D15 A;  3BYR A;  3I55 S;  3BO4 A;  4DZ6 A;  1Q8K A;  2M0G B;  4OI0 A;  5CCL A;  3M2U A;  3KUE A;  2CQD A;  3DLE A;  4EO8 A;  1RTJ B;  1LWE A;  4DOZ A;  5CCM A;  5ITH A;  1HNX J;  1WC1 A;  1GH8 A;  4IR9 A;  2FQQ B;  4ICL A;  4MFB B;  1GXT A;  3N0V A;  3K8W A;  1FTC A;  2H51 B;  2BRK A;  4DR2 F;  4JYA J;  1VLO A;  2RUS A;  4G1Q A;  3U1M A;  2NXN A;  2PFD A;  4IDK A;  3Q8P B;  1EAY C;  3BZQ A;  2N7Y A;  1VQK S;  1WSV A;  3GWC A;  4RW4 A;  1LK7 A;  1PJ7 A;  4OX6 A;  1IKV A;  3BBC A;  4QR0 A;  4G1P A;  3MM5 B;  3CIZ A;  3JTN A;  2YH1 A;  2P5V A;  2BYC A;  4ECU A;  4XIU A;  1DQA A;  4UOH A;  3TQE A;  3D1Q A;  3D67 A;  2KB2 A;  4LIW A;  3E8O A;  3V2U C;  1U6F A;  2BJ8 A;  4FS1 A;  4WFB Q;  3KFW X;  3V6K A;  2MKJ A;  3DLK B;  4I1T A;  1R6Y A;  2CPH A;  3WX4 A;  4F0H A;  1HA1 A;  2HHV A;  1TKZ A;  2XB2 D;  2OPR B;  4LR8 A;  3RBX A;  2VHG A;  3IS9 A;  2VON A;  3OXF A;  3WC2 A;  2E1M C;  1JLF A;  1FI4 A;  1CJT B;  1F9F A;  2HFV A;  2ZJP Q;  1IUJ A;  2FLP A;  1SL1 A;  5KFG A;  4DR5 J;  2QX0 A;  2AEJ A;  2FPH X;  5IXU A;  1XNR F;  2KL8 A;  3TVY A;  3CUN A;  2XSF A;  1K1S A;  2HHW A;  3OLA A;  1G3O A;  2AJF E;  1LEO A;  4IQM A;  4FF1 A;  2H48 B;  2BDP A;  2YKO A;  3PM9 A;  2LDY A;  1VRU A;  3G6E S;  4LF2 A;  2BAB A;  1KLN A;  1S4F A;  2MQP A;  1XNQ F;  1V6H A;  5KT6 A;  4RNH A;  1TFY A;  1QAX A;  4E0D A;  2YKN B;  3C15 A;  1WG5 A;  1NND A;  4Q43 A;  4PG8 A;  4ZVT B;  1KBR A;  2RD5 C;  4A8Q A;  4RJV A;  3RUB L;  3BGR B;  4DR6 J;  2ZVI A;  1PYS B;  1R8B A;  1TVR B;  1JLQ B;  1N5V A;  3ADA C;  2L41 A;  2VOP A;  2OEJ A;  1WTB A;  2MXY A;  2FZC B;  3W9I A;  2JHE A;  3R2C J;  3SYZ A;  1C4C A;  3PAC A;  2V8D A;  3CD5 A;  5JJB A;  3MF5 A;  1TL7 B;  2LDI A;  2DH8 A;  2RNE A;  3THT A;  2DGU A;  4A8X A;  4FXW A;  5J2Q B;  4TQR A;  3A8I A;  3MM9 A;  3TZZ A;  2RE1 A;  1N5Y B;  4A46 A;  3S01 A;  3BEG B;  4MK9 A;  1TV6 B;  2HNY A;  1LK5 A;  3HVT A;  2QT7 A;  3VVT A;  3BM7 A;  2B6A A;  4IYQ A;  5D0R A;  1SUQ A;  2J8S A;  1DLO B;  2AU0 A;  3BS9 A;  1WEZ A;  4U67 Q;  3T5J A;  3W66 A;  2DIT A;  3W9H A;  4R5P B;  3B78 A;  1RJJ A;  2F4F A;  3VR1 A;  1RAJ A;  3GE9 A;  2BV3 A;  3GJR B;  1WKK A;  4M5L A;  4DS4 A;  1QUP A;  4CYU A;  2V50 A;  3KG1 A;  2Q79 A;  3M2R A;  3TA1 A;  4USM A;  2C3Y A;  2DRD A;  3GFX A;  3R5D A;  3KOA A;  3ILO A;  3KK2 A;  4CNZ A;  3LGH A;  1RTZ A;  1BUX A;  3OJU A;  3MHY A;  3DLB A;  3HZE A;  1RTI A;  2L9N A;  2QRR A;  2YNI B;  2AD9 A;  3MM7 B;  1Q4R A;  2CVI A;  1RHQ B;  2VDH A;  1WKL A;  3M9O B;  1D8Y A;  3AH6 A;  1U48 A;  3MMJ A;  2KXF A;  2HAF A;  1VK3 A;  2V2V A;  4DSJ A;  2R7Q A;  2R7W A;  2G1D A;  2GO8 A;  5KFP A;  1D1U A;  2MEW A;  1BE4 A;  3CCZ A;  1JLA B;  4YHH J;  3IR5 B;  3MXH P;  2GFF A;  4OYI A;  3CJ8 A;  1UWA A;  1UPP A;  2R7R A;  3FVY A;  3RJM B;  3D9B A;  2VQE J;  2YNF A;  2NPI A;  4ECZ A;  2NXE A;  2RJZ A;  3EVW A;  4LF4 J;  4EK2 A;  4DQP A;  1FDB A;  4FDF A;  4PUO A;  3WC0 A;  3DKD A;  1Y11 A;  3OVA A;  4JI6 J;  3N6L A;  1IWG A;  1DTQ A;  3CW2 C;  1Y3J A;  1S10 A;  1R8P A;  1AXQ A;  3G82 A;  2DEJ A;  3N4W A;  4O3P A;  1Y00 A;  3NRB A;  3DI6 A;  5F0U A;  3MPD A;  4AL5 A;  4LSN B;  1U1O A;  4WYW A;  4ECR A;  4LF9 J;  1RIS A;  1OPI A;  2QYG A;  2CJQ A;  4H4O A;  2DGO A;  4WFZ A;  1NHV A;  4Y28 C;  3SSQ A;  1ULR A;  2CQP A;  4PWD A;  1O8B A;  3K2Y A;  4WZM A;  3EGW B;  5EWF A;  2K7J A;  2YNH B;  3HFK A;  3A8K A;  3UR3 C;  1RI7 A;  2K3I A;  1VS3 A;  1NAQ A;  4EUV A;  1H2U X;  5KFV A;  3I0S B;  1MNE A;  4CLP A;  5J2N B;  2QSW A;  2K2P A;  3ITH B;  5ETP A;  5K8N A;  1S6Q B;  4OZJ A;  1WC0 A;  1SVD A;  2NSC A;  5M2U A;  4FBU A;  2W24 A;  3H5Y A;  4C8Z A;  2VFS A;  2WVE A;  3M2V B;  1Q82 T;  2RUG A;  3PRB A;  2LXF A;  1HNW F;  3M6V A;  1GT8 A;  4PKD B;  2Q43 A;  3FBE A;  2B8Q A;  2BOA A;  2AJ0 A;  2HHH J;  1QAJ A;  4NLU A;  2CJK A;  3IRW P;  4C8M A;  4F8R A;  2EFQ A;  2PA8 D;  4PXD A;  4RWX A;  4LFB F;  1X60 A;  5DDQ C;  2IPO B;  1RT5 B;  2MQQ A;  3IFE A;  1IR1 A;  4JI3 J;  5CYQ B;  1GX6 A;  1K0T A;  4RW7 A;  5IT4 A;  3K5O A;  2HFN A;  4H4M A;  3ILI A;  1C0U B;  3GPA A;  3LWL A;  1WG1 A;  4TY8 A;  2F63 A;  2R7V A;  3RAM A;  2ZEJ A;  2JEJ A;  1VQP S;  3W5Z A;  5G0R A;  1N32 F;  1HWJ A;  2DHS A;  2ZHO A;  2D74 B;  4X4V A;  1XEZ A;  4DQQ A;  2JFK A;  2CZ9 A;  1VRT B;  4P2F A;  1OQ3 A;  5KFT A;  3POT A;  4U8Y A;  4PQA A;  5RUB A;  2CPY A;  2PO4 A;  1HNZ J;  1GX5 A;  3N79 A;  1R0A A;  1NME B;  2UV8 G;  3MMA A;  3H0P A;  5GAG U;  4HKQ A;  4ID8 A;  1SQF A;  2BX6 A;  2NLW A;  3HHL A;  3T19 A;  3TNV A;  2AJ1 A;  2MMY A;  2CKW A;  1KON A;  4PG5 A;  4KKO B;  4F2R A;  4QW9 A;  5F8M A;  5E3R A;  3Q8R B;  3C66 A;  3NKY A;  3MR3 A;  4PPZ A;  4CLL A;  4IFY B;  3N5F A;  3BB5 A;  3MI7 X;  2J6T A;  2J6U A;  4OV1 A;  4PXC A;  4XPC A;  2PMH A;  1N36 F;  1OQ6 A;  4RNF A;  5IWA F;  1JQG A;  2ZM6 J;  3LO3 A;  5AXK A;  3HUL A;  2RT3 A;  1N8R T;  4AXJ A;  2IA6 A;  1NH8 A;  2O66 A;  2I38 A;  1BMQ B;  4X2B A;  1S1U A;  1JIH A;  3D6H B;  1X4A A;  2RB7 A;  4PG6 A;  1J5E J;  2ZNZ A;  2HRT A;  4YR3 A;  4ES1 A;  3MEE A;  4OI4 A;  2MZJ A;  1CJK A;  2JLF A;  2N3L A;  3DOK B;  4RBU A;  5EWG A;  3OHA A;  4NZ6 A;  4B9L A;  4O3Q A;  2PI4 A;  3C3L A;  1JLB A;  2UXD J;  3R6G B;  2DNP A;  1XN9 A;  2KFN A;  2YQ1 A;  2UU9 J;  4C0B A;  3I5B A;  4WE1 B;  4J90 A;  2KYX A;  2QLJ B;  3QSI A;  2LQ9 A;  4JI4 J;  1M5H A;  2OLW A;  1R8H A;  5T14 A;  2GJF A;  3EXC X;  3TW0 A;  4M5I A;  3BPS P;  2FJA B;  3KJN B;  2CZ4 A;  2E5L F;  1LW0 A;  2DCL A;  3UNY A;  1UWB B;  1Y7P A;  4DSE A;  3HVR A;  3Q23 A;  2XO7 A;  1SKW A;  2WVD A;  1B4S A;  1NSA A;  2YBV A;  2R3V A;  2ZUG A;  1N88 A;  4B9S A;  3T6J A;  5DQG A;  3PFE A;  5KFJ A;  2YPY A;  4C11 B;  3G6V A;  1TUV A;  1SC1 B;  1RSC A;  3QAT A;  1FJ7 A;  2B8P A;  2XBP A;  2ZC4 A;  3SQO P;  1FNO A;  3PY8 A;  3AXM A;  2QL5 B;  5F8G A;  4LF7 J;  4PEO A;  3CVK A;  1WC4 A;  2NXJ A;  3KXD A;  4WP8 A;  4ZVQ B;  4NLR A;  3T41 A;  4A8K A;  2YWG A;  3GFH A;  3X3U A;  2HHT A;  5A8K A;  1TQL A;  1TK8 A;  2V5H G;  4CH1 A;  3TJA A;  5KFD A;  2CJY B;  1WSR A;  3TA2 A;  1HBN A;  3GJQ B;  2ILZ A;  2G4B A;  2CPJ A;  2B9X A;  1ZZN A;  3L3C A;  1HFE L;  4LFA J;  4ZN3 A;  4LRF A;  5E3C A;  3ILJ A;  2FLO A;  4A47 A;  3RGI A;  4HAC A;  2AGQ A;  2ZH7 A;  4IFV A;  2LEC A;  3MPY A;  3OT9 A;  2HS4 A;  4DFM A;  3LP1 B;  4U9R A;  4Y2M A;  3OSP A;  3TX8 A;  1FES A;  4NPO A;  3OL9 A;  3TAM A;  2FHM A;  2CJA A;  1B0V A;  1GMV A;  4QWC A;  1GQE A;  2EKY A;  4KGV B;  3FC9 A;  2QA4 S;  2HMI A;  4Z7C A;  3EZ5 A;  4YOE A;  3G9C A;  3CJQ A;  2VJV A;  2RQC A;  2QLW A;  2KFZ A;  3CJK A;  1LW2 A;  4DPT A;  5I4M A;  4I2P A;  2X1A A;  3C6U B;  2DIU A;  2ZDO A;  3TQ1 A;  5E3A A;  1HD0 A;  1UVN A;  1VRQ C;  1KHW A;  4P52 A;  4D3G A;  4OFZ A;  1UA0 A;  3QYY A;  2VAS A;  1U1Q A;  2R2U A;  3ILL A;  2DPI A;  3B4D A;  1VLY A;  4O4R A;  3SBM A;  2E66 A;  1FFS B;  4DMZ A;  3P49 B;  3ZNJ 1;  2PSZ A;  3CCV S;  1IKX A;  2U2F A;  1WEX A;  2J9C A;  2GX8 A;  4FPR A;  4ZIT A;  1EHW A;  1KN6 A;  2MKH A;  2W4C A;  2BAN B;  2LQ5 A;  3TO8 A;  2I6W A;  3UVJ A;  2XI2 A;  2NZ4 A;  2GVZ A;  3I4P A;  1JJH A;  4KH0 B;  4X4N A;  2H4W B;  4B9M A;  2DH9 A;  4DU7 A;  2WVC A;  2DD8 S;  4I4B A;  4YUD A;  5F8J A;  2EBE A;  2XSJ A;  5K14 B;  2LQB A;  1HPZ A;  4M1K A;  4NEZ A;  2WON A;  2NYI A;  2BKO A;  2XGQ A;  3LP2 A;  1M5O C;  1SJ3 P;  2G2Y A;  2BEF A;  1DTT A;  3M30 A;  2MQL A;  4LT6 A;  5KFO A;  4YP3 A;  2AT1 B;  1HNV A;  4NAS A;  4M5D A;  2XLK A;  4KB7 A;  4WWS A;  1IBK J;  1LWF B;  2XMW A;  2WSE C;  2R7U A;  5HVG A;  3KLE B;  4JV5 F;  2HK2 A;  1CQM A;  2KXH A;  2DY1 A;  3ET6 B;  3KLI A;  4KY3 A;  2WW4 A;  2BQR A;  4NI2 B;  4BWJ A;  2FY1 A;  3P6Y C;  4KV8 A;  2GHV C;  4N41 A;  3PW5 A;  4JI5 F;  5HP1 A;  5D3G A;  2OI2 A;  5D4O A;  2W9B B;  2XWX A;  5GAE U;  4M8L A;  2HUR A;  3S7R A;  2ZWP A;  2C2D A;  1X4B A;  2XWY A;  4X64 J;  2WW8 A;  2OEM A;  3ZTQ A;  3QO9 A;  2G2O A;  4GO5 X;  3R9L A;  1RBO B;  3EXY A;  3CIM A;  4XDD A;  1D8Z A;  2A3J A;  2ERR A;  2HHX A;  1VC5 A;  4X4U A;  3D28 A;  5F8I A;  1CJV A;  1IR2 A;  1BGX T;  5LJ5 Y;  4J9R A;  3DRS B;  1RZM A;  1VOM A;  2E5G A;  5L1K A;  3M05 A;  4YN3 B;  2KM8 C;  3NWG A;  4NXM J;  2XNR A;  3JB9 k;  3GFY A;  2E5I A;  3BN7 A;  2MPU A;  3V6D A;  4ED3 A;  1EZZ B;  3DGP A;  3KK3 B;  2EW9 A;  1S76 D;  1Z1Z A;  2DIS A;  2BE2 B;  3HX9 A;  2IM0 A;  4RUC A;  1C1B A;  1M5V C;  3P5B P;  2C2E A;  3E2E A;  2X1G A;  5LMN F;  4CT9 A;  2R8J A;  3AFG A;  1KHV A;  2VFT A;  3IC1 A;  1U09 A;  4OYW A;  1RHU B;  4OIX A;  3CDA A;  3GG1 A;  2P2C B;  3C14 A;  4WKY A;  3HKZ D;  2RVJ A;  4RW8 A;  5E33 A;  3CDB A;  3T6B A;  2C28 A;  5KT5 A;  1NRK A;  3CCM S;  1FEH A;  4P10 A;  3PV8 A;  2CPI A;  4BCA A;  1C0T B;  5HQM A;  1RTH B;  1YZ6 A;  3MCO A;  3BN4 A;  2Z2L A;  1F5C A;  4J9P A;  2V9K A;  1SIW B;  2DXF A;  5J2M A;  1GMW A;  1I6J A;  2IC3 B;  3MPV A;  3W2W B;  5I3Q A;  1RAO A;  4EU0 A;  4CI0 B;  3GG0 A;  3PW0 A;  2GQ2 A;  4P72 A;  4YB6 A;  3HO1 A;  2KKH A;  3A1Y G;  3SCJ E;  2OTJ S;  1X0F A;  1AUD A;  2Z2Z A;  3BJY A;  4YY3 F;  1VQ6 S;  1WTF A;  3MMB A;  1YBU A;  3DMJ A;  5I3U A;  3OUY B;  4BS2 A;  2F4V F;  4IKA A;  1GMU A;  2JL9 A;  3CC7 S;  4X4R A;  4M5M A;  4DL3 A;  5A6P A;  5DLG A;  5SZT A;  1YBA A;  2VG5 A;  5CA5 A;  3M8P B;  2BE7 D;  1S0N A;  4YEA A;  2F65 A;  3RRG A;  2JEF A;  2KVQ E;  4Y2I A;  2XY5 A;  1C1C B;  2IMW P;  2FVP A;  3Q89 A;  2ZHA A;  4P7V A;  3FK4 A;  2HNZ B;  1M90 T;  3D0G E;  1YI2 S;  4DV5 F;  2VA2 A;  2BW7 A;  4F04 B;  4Z2X A;  5LMU F;  2NS1 B;  3C6T B;  2HGN A;  2ZD1 A;  4LSL A;  4U8V A;  1RP5 A;  4PWW A;  1NH7 A;  2CQ2 A;  4ZPC A;  3TJ8 A;  2CNK B;  1AZS B;  1Q78 A;  2Z2M A;  4WTY A;  4KC5 A;  3BKF A;  2VH7 A;  3H25 A;  3KJF B;  1N5T A;  5C2G A;  2VFU A;  1WG4 A;  4YDD B;  5C42 A;  2XS7 A;  4EZ6 A;  2C3M A;  5BR8 F;  4QJV A;  2UXB J;  4JP8 A;  4JI1 F;  2MGZ A;  4ZP9 A;  1JXE A;  2V8G A;  2QMU B;  2RSQ A;  3JAM U;  3F56 A;  2N7C A;  4P2S A;  1I1G A;  2ZOF A;  1S9E A;  4EGL A;  2C2Z B;  1H72 C;  3T1Y J;  1YJ7 A;  5HBM B;  4LF8 F;  1D09 B;  1TFW A;  3KLH B;  2W2O P;  3OBI A;  2RRN A;  4MFB A;  3V6J A;  3KJV B;  4MAK A;  1QSS A;  1S1T A;  1KTQ A;  1A7G E;  2IVY A;  1TMJ A;  1U24 A;  5D4N A;  1R43 A;  3CCR S;  1HQE A;  4IG3 A;  3T5K A;  4HYK A;  5BXI A;  1K73 T;  2WK4 A;  4DV2 F;  4ZP8 A;  2JSX A;  5IC6 B;  1S1V B;  1FDN A;  3WBZ A;  3KHL A;  1T9T A;  5IM0 B;  1BD6 A;  2ZH1 A;  1H2T Z;  4OX9 J;  2FJE B;  4FBT A;  4Q0B B;  2HKE A;  5F8L A;  3NGU A;  4RNN A;  3D1O A;  4B3T J;  4ZCK A;  4UZC A;  3E51 A;  4MTP A;  1WHY A;  1JKH A;  4UQT A;  2QLB B;  1RBL A;  2Y1L B;  3W9J A;  3B54 A;  3W8G A;  2Z30 B;  1HHT P;  4EFA C;  4N76 A;  5DZ6 A;  1WHW A;  4I7F A;  4O3R A;  4Q2M A;  4DSI A;  2HQ3 A;  1NHK L;  2KTQ A;  5ETV A;  2VC1 A;  1M1K T;  3I87 A;  3J80 Y;  5GAH I;  5D6G A;  3MCN A;  2NR0 A;  1ZAX A;  4PG7 A;  5CYJ A;  1F5B A;  5HI7 A;  5LT5 A;  3TUJ C;  4QR1 A;  1HR0 J;  4LVN P;  1QE1 A;  3M6U A;  1N4L A;  4N8O A;  4TYB A;  4LRD A;  4CNY A;  1F0X A;  4F7V A;  2C42 A;  3R5C A;  4K4S A;  3HT3 A;  1B99 A;  4ED8 A;  2M8H A;  3MEG A;  1XR7 A;  3R5B A;  2ZBR A;  1ACM B;  1SJF A;  4CH7 A;  3GCW P;  2LQ8 A;  2DNK A;  2MZS A;  2HFO A;  2W2Q P;  3MMC A;  2Z57 B;  1QAY A;  2DJW A;  4NLP A;  1ZM3 A;  1MU2 A;  3AJD A;  1S12 A;  2CG8 A;  4C4W A;  2B9Y A;  3EDQ B;  3ZNU A;  1TUG B;  4N7T A;  3E01 B;  4CTA A;  1FD2 A;  5IS2 A;  3G8S A;  2GCF A;  4IOA Q;  3CCT A;  2J5A A;  3I32 A;  2B7C B;  3IG1 B;  2AYB A;  1YQH A;  1OO0 B;  5DDO C;  3HSJ A;  1RKJ A;  1SV5 B;  5KFB A;  3DLJ A;  2QG9 B;  2G0C A;  5KT3 A;  1R7I A;  2MHE A;  2AYE A;  4IRD A;  2Z56 B;  4LRA A;  3IWN C;  4Y2C A;  1I94 F;  1T9U A;  2Q1L A;  2Y0B B;  1FXL A;  1DLO A;  3D3C J;  4LF6 F;  4DCO B;  1T95 A;  3WQP A;  2P6T A;  3UPF A;  4HT5 A;  3UDC A;  1IBL F;  4A8Y A;  4F4X A;  3HM9 A;  5B0A A;  3CCJ S;  2D69 A;  2UXC F;  3ETM A;  4KE5 A;  2HZA A;  1GK8 A;  3ENQ A;  4B9V A;  2EC2 A;  5DJB A;  4USI A;  2LCW A;  6FDR A;  2CPF A;  5ETQ A;  5IOL A;  3HCX A;  4Q8E A;  1NO8 A;  3QRQ A;  4ETZ A;  4OQJ A;  3Q8U A;  2RRB A;  4F4A A;  4NWB A;  2WSF C;  4CO1 A;  3LAL A;  2N82 B;  5AXN A;  2XC9 A;  3SZ2 A;  2CVE A;  4OZ1 A;  3N28 A;  3KDN A;  3MED B;  1DBD A;  1X5S A;  3H8Y A;  2AWZ A;  3MM7 A;  3DLG B;  3OV7 A;  3WDO A;  2ZH9 A;  4ZVE A;  1IKY A;  3UCZ P;  4IH6 A;  3BKU A;  2FIU A;  1CS4 A;  4DXL A;  4IG0 B;  3B82 A;  4Q5V A;  2ZVS A;  2UVV A;  2ROE A;  3SFG A;  5DQI A;  1OSC A;  1IVZ A;  3NXZ A;  3PYD A;  1S77 D;  1X4H A;  2KXN B;  5EDW A;  4L74 A;  4R8U B;  2KDO A;  2XGP A;  4DR2 J;  3PJ9 A;  1VQM S;  1GTH A;  5T7L B;  1XIQ A;  2VD3 A;  4ECW A;  3K5P A;  3TAR A;  3OTC A;  4N56 A;  2M9K A;  1SC6 A;  4LSZ B;  4DV0 F;  4OYM A;  2H5J B;  1YKW A;  4F4Y A;  3TUI C;  5E7O B;  3KG0 A;  4FVC A;  1FFW B;  3C16 A;  4OHV A;  4ECS A;  4IH7 A;  2CWK A;  1VQ5 S;  2CNN B;  3O6Q A;  2JH3 A;  3ENA A;  3J7Y I;  3V81 B;  4DCP B;  4WFA Q;  2E5H A;  1SB6 A;  2VBW A;  3DM2 B;  4KFB B;  2V4Q A;  1K0V A;  2CJB A;  4LSN A;  3G86 A;  5F9L A;  2WRM A;  2VF3 A;  2XZD B;  2W8L A;  1RT7 B;  3DOM B;  4ZPV R;  2MKK A;  3H5S A;  3M1V A;  1MML A;  3LPY A;  2GGP B;  4WP9 A;  3MEC B;  1QM9 A;  2ZIT A;  5F8N A;  3MR5 A;  3MUM P;  4CLZ A;  2M52 A;  1MRO A;  4P73 A;  1FHT A;  1DY3 A;  5F8H A;  2VBX A;  2KFY A;  1XNR J;  4DSF A;  5A0Y A;  4MMO A;  1MWY A;  1IXK A;  1BQM B;  2XZW A;  1PC4 A;  3I0S A;  4OHY A;  4DR1 F;  4ENO A;  1U26 A;  2OMO A;  2HQI A;  1XNQ J;  4Y00 A;  1TKT B;  2FJX A;  2BJD A;  5E5N A;  3UN2 A;  3W65 A;  4QWD A;  2F3J A;  3M32 B;  4WK3 A;  1RWP B;  4LBI A;  2BBE A;  4WKR A;  5HVF A;  3D66 A;  3OTE A;  1SKS A;  3UW1 A;  2KHD A;  3W62 A;  2KO1 A;  5I42 B;  5CYQ A;  1F1B B;  2M7S A;  3MEK A;  3OL6 A;  2J7U A;  1M1G A;  4R0J A;  4HTI A;  4LR7 A;  1S57 A;  5G4D A;  4FKY A;  3LP0 A;  4OI3 A;  1WDD A;  2ATL A;  2XG8 A;  2XYH B;  5IQ6 A;  4CLU A;  1RT6 B;  5A2Q U;  4K4W A;  2VG7 A;  4NLD A;  3VVU A;  1CUL A;  3H7H B;  4RLE A;  2PA3 A;  3D0I E;  3JXO A;  4QIV A;  4ERD A;  2V69 A;  5DZ7 A;  1FFG B;  1CG2 A;  4C8L A;  2CQB A;  2QLX A;  4Q7A A;  4X4Q A;  3AOB A;  1XMO F;  3D7S B;  5C24 B;  2YWF A;  1S79 A;  3VAJ A;  1P8G A;  1XQI A;  2IFX A;  2R9L A;  4X65 F;  3UFC X;  2Q3P A;  2GVD A;  3KG4 A;  3JSY A;  1S4E A;  2DGV A;  4NCG B;  3FSX A;  2EVZ A;  1FJG F;  2YX1 A;  2B0G A;  1NU4 A;  2PT0 A;  2MKS A;  3HD1 A;  4Y6I A;  1XR6 A;  4A8W A;  1A9N B;  1IM4 A;  1NXI A;  3C19 A;  3U1L A;  4DL5 A;  1B7F A;  5H9E J;  2M8D B;  5F0W A;  3W61 A;  4AUK A;  3IGV A;  3NEK A;  2NRE A;  4UW2 A;  1EJ7 L;  1EAR A;  4J91 A;  1B64 A;  3EPG A;  2Y8Y A;  1UA1 A;  1TUW A;  4ZIV A;  3KK1 B;  4AQY F;  2NUH A;  1LWC B;  3DRP A;  4FKX A;  1X0P A;  2Y8W A;  3HHD A;  1M1H A;  3QFH A;  1RAF B;  1VCT A;  4OX8 A;  5DM6 Q;  3MTJ A;  3H98 A;  1RDR A;  1EKR A;  5FLX U;  2DR5 A;  3MD1 A;  3M4X A;  4HDH A;  1HWK A;  1X4D A;  4F3Q A;  4NLG A;  2XTJ P;  3CDU A;  1MW7 A;  4DX6 A;  5JMN A;  3IBF B;  2DVI A;  2EEY A;  1LV5 A;  1ZAV A;  2CNL B;  4URQ U;  1ZA2 B;  4LQ9 A;  1ZTW A;  2ALY B;  5CZV A;  2POK A;  2YWH A;  3I5A A;  1AUS L;  4ED2 A;  4DR4 F;  3KLG B;  1UEU A;  4UUW A;  4ECX A;  3AD8 C;  2YVS A;  5DQH A;  1RT4 A;  5KT2 A;  3BYP A;  2OJ3 A;  5F3Z A;  2QA2 A;  4FYD A;  4F26 A;  4I2Q A;  1HI1 A;  4K5R A;  1E6Y A;  1K8A T;  3CJ0 A;  3CDE A;  4PZV A;  4ZS6 A;  4ANE A;  5HLF A;  3T5L A;  2CFX A;  1IQT A;  4YME A;  3H4B A;  4C11 A;  3OJS A;  1PGZ A;  1GXL A;  5AE3 A;  4O44 B;  4TXS A;  3BQ2 A;  5GVQ A;  5FDL B;  4EBC A;  1F2H A;  1YG0 A;  4JV2 A;  2CQH A;  4URS A;  1NK7 A;  3DYA B;  1NPP A;  1PKU A;  1QSY A;  1NPR A;  2L3M A;  3PW2 A;  3KWM A;  1TKX B;  4AD6 A;  4B3O B;  1PYT A;  4B9U A;  4NLQ A;  1Q1K A;  8ATC B;  1XMQ F;  4ED6 A;  1HNW J;  2KH9 A;  5M2P A;  1SPB P;  2BOP A;  1SBR A;  3NS5 A;  1UVK A;  3PJX A;  4WXO A;  5BYQ A;  5T41 A;  1S59 A;  4L3N A;  4USH A;  4EYH B;  1WOS A;  2IAJ A;  1HWL A;  1YJV A;  3I4H X;  4LFB J;  1FRL A;  1KQG B;  3CCS S;  5C25 A;  2GJI A;  2CQG A;  2V4J A;  4J9V A;  5THW A;  3BQ1 A;  2DB1 A;  5J1P A;  3IRX B;  3GIJ A;  1B3T A;  1NSP A;  1FX4 A;  3LP1 A;  3JSM B;  2M2B A;  2F1F A;  4WIQ A;  5ETM A;  5CH7 B;  1N32 J;  1S1W B;  4OL8 A;  2G9O A;  2MQO A;  3QT6 A;  4CLY A;  3TJ9 A;  3J81 j;  3QIP A;  2EBG A;  3M8S A;  1P1L A;  2DGS A;  4IR1 A;  2E7X A;  2WB4 A;  2MQ8 A;  2Q66 A;  5KFA A;  3GII A;  3NMR A;  2XHC A;  1RT1 B;  2CQ1 A;  2RF2 B;  5DG9 A;  4ZIW A;  3HSG A;  4F02 A;  2RDJ A;  1PYO B;  4ZHR B;  2ACY A;  3DRR B;  3O5T B;  2V2Z A;  1NJY A;  1PCA A;  1PBU A;  3L7P A;  1RAA B;  5JUM A;  4KJI A;  2KJV A;  2OFG X;  1TTH B;  4LRE A;  2H5I B;  1S6P A;  5B09 A;  4D3H A;  3NGT A;  4K4Z A;  3QGI A;  1Q5V A;  2F5G A;  4MYU A;  2XHW A;  5DGB A;  2HFU A;  4B02 A;  1QTM A;  2XM3 A;  3AA8 A;  4E98 A;  4QIF A;  1N36 J;  3D6T B;  1F5A A;  1UFL A;  5IWA J;  5K20 B;  1VJW A;  5BYR A;  3FQL A;  1Q16 B;  5HVH A;  1T05 A;  3M8R A;  3Q2S C;  3U7J A;  1T7P A;  1RK8 A;  1CQN A;  2EWH A;  2DR6 A;  3V5R A;  3P45 B;  2ZJQ Q;  4QYR A;  5KG6 A;  2OTL S;  1V3Z A;  1Q86 T;  2ROP A;  4OX7 A;  4B3S F;  4B3M F;  3F0N A;  2D3Z A;  1VQO S;  1O51 A;  2QZ8 A;  1N0V C;  3CCQ S;  2JFD A;  4J7C A;  3BGO P;  2C3O A;  1TL3 B;  3JQM A;  4C2M A;  2Z8Q A;  3ENV A;  2JOQ A;  4NI2 A;  1TR0 A;  1YJR A;  2HS0 A;  4P2M A;  3AY0 A;  4QPX A;  3GU0 A;  1TL1 A;  4P74 A;  2MHN A;  3NNA A;  3M2U B;  1PAE X;  5A8R A;  3DLE B;  4C97 A;  4QYZ K;  4IO9 Q;  1LWE B;  2GIR A;  4ZP7 A;  2XZT B;  4RNM A;  2E5L J;  4ETX A;  3W60 A;  3HI9 A;  2FDN A;  3R6L B;  2MLY A;  4K7Q A;  4QWB A;  4NA2 A;  4G1Q B;  3BRE A;  3VZI A;  3RR7 A;  4IDK B;  2LA4 A;  4DX8 H;  2ZWO A;  3RZA A;  3DRS A;  1UET A;  4RW4 B;  3THP A;  4PQU B;  4NLS A;  2XMJ A;  2RQK A;  1LFP A;  3DN9 A;  3PJW A;  2XUL A;  1UZH A;  4JI6 F;  1JB0 C;  1RCX B;  5L46 A;  2KHC A;  3US5 A;  4DX7 A;  2ZKU A;  3MOZ A;  3VAF A;  3BF4 A;  2ZH5 A;  1RU1 A;  3L7O A;  3BO2 A;  1OY8 A;  3H42 A;  2DO4 A;  3RB0 A;  2W8K A;  1N56 A;  3TAN A;  2M3D A;  4KIA A;  3L9Z A;  4UY8 T;  1N54 B;  4X66 F;  2W9A A;  1REG X;  2VUG A;  2FVC A;  1URR A;  3IS9 B;  2GIQ A;  2VKZ G;  1Q53 A;  1JLF B;  3PNI A;  4AXI A;  4KHP F;  4DS5 A;  1C0T A;  1HHQ A;  5K9F A;  1L3S A;  4QQB A;  7FD1 A;  1IJE B;  3J7Z 5;  3MM8 A;  1NKC A;  1VQ4 S;  4J9S A;  4XDC A;  2OPP A;  4ZPB A;  5KAK A;  1UEV A;  1X31 C;  1VRU B;  4CCH A;  1CJU A;  2AEF A;  2J0W A;  3CE8 A;  1J27 A;  4KGM A;  2VPZ B;  4OZ5 A;  3MUT P;  5K8M A;  3NL0 A;  1QTN B;  2JVO A;  4FN5 A;  2F7V A;  3C15 B;  3RB3 A;  1M0S A;  1JWW A;  4YFU A;  2HYI B;  3G71 S;  5MAO A;  1CEZ A;  4M5G A;  1FXD A;  1S72 S;  3MAA A;  5ETO A;  4C3M A;  3DU6 A;  2YTC A;  2V8H A;  2H54 B;  4XO0 A;  3K59 A;  1REV B;  3FNN A;  4DEZ A;  4F2S A;  2OPS A;  1VBK A;  3NOG A;  3UDL A;  2IRY A;  1WNE A;  3J81 U;  3W63 A;  4NZ0 A;  1T9X A;  1X9S A;  3IM8 A;  1FX2 A;  1T0T V;  3QLH A;  3L09 A;  3CNQ P;  4C8Y A;  3VF0 B;  4G3I A;  4Q45 A;  1WAC A;  1X8D A;  1NJI T;  4ZA1 A;  5KFI A;  4GKK F;  2FHJ A;  2HNY B;  3BPD A;  4CO3 A;  2A1B A;  3HVT B;  2B6A B;  1UW4 A;  3QJJ A;  4J9K A;  1Q79 A;  2HS3 A;  1RA6 A;  5L8R C;  4USK A;  3EUN A;  2K1R A;  2DHG A;  1AFI A;  3HXM A;  4ZVU B;  2R4F A;  3W5Y A;  5KFE A;  4L73 A;  2D3O R;  5DDP C;  1T9W A;  2FC8 A;  3O8W A;  2HHS A;  1VHI A;  2VIC A;  3HP6 A;  1YLX A;  4CYU B;  5HMY A;  3FBB A;  2CXE A;  2D3U A;  3M2R B;  4NYO A;  4C8K A;  2MZQ A;  1PJ5 A;  4KQZ A;  4AYB D;  1AB8 A;  4C0H A;  1JLE A;  4L76 A;  1S1X A;  3K5M A;  3KK2 B;  3QGG A;  1A6L A;  1KOH A;  1SC3 B;  2KU7 A;  2CAD A;  4P9S A;  3ULH A;  4JV5 J;  1D0E A;  2E9Z A;  1R8C A;  3TRG A;  3UE2 A;  3KJV A;  4V19 J;  4KR0 B;  3OD2 A;  2V6A A;  2CYY A;  3TUZ C;  1MN7 A;  1NEE A;  2GZO A;  4B3R F;  4JI5 J;  2HPU A;  2XY6 A;  2A2D A;  1FDA A;  2ZM6 F;  1B0T A;  1KC8 T;  3UR0 A;  3D54 A;  1I3O B;  2VFR A;  4MKY A;  4DV4 F;  5D78 A;  5IV4 A;  3PKY A;  1HYS A;  3TYT A;  1S1V A;  3TR5 A;  1LKZ A;  2FY8 A;  4FVM A;  1JJ2 R;  5D0E A;  1U2R A;  2YNF B;  1AW0 A;  3A13 A;  2D3O 1;  1RHR B;  1VR6 A;  2G1H A;  2DNO A;  4MT1 A;  2ASY A;  2MST A;  3P8B B;  5A76 A;  2HIQ A;  1KVK A;  1Y0H A;  1YJT A;  2OEK A;  3NCR A;  3JQJ A;  2APO A;  3KNA A;  4OYB A;  5ETR A;  1DTQ B;  2ATC B;  1FWL A;  3KMQ A;  1BLU A;  2HBZ B;  3NMA A;  1FVQ A;  3R27 A;  2FC9 A;  2AP6 A;  5KFR A;  4I0W A;  3OR1 A;  3DI6 B;  5CHC B;  2XYG B;  4ZMM A;  1WD6 A;  3JS9 A;  4OLP A;  5LMN J;  3LAM A;  3B6B A;  5K8O A;  2PE8 A;  4CDI A;  1NBE B;  4L6V 3;  4E8U A;  5EN1 A;  4EMD A;  2ASD A;  4Y65 A;  2XO6 A;  3ZTS A;  1APS A;  3CO0 P;  5DG7 A;  4RW9 A;  4F0M A;  4A48 A;  3W2V A;  4PWD B;  1P6T A;  3G6X A;  4ED4 A;  4NZ7 A;  2MKY A;  1FJC A;  5B0B A;  4IH5 A;  4Z37 A;  3PW7 A;  3CCW A;  3DDN A;  1ARO P;  1U6B A;  4NLT A;  3HHN B;  1RB0 A;  3ZZT A;  1T03 A;  4FZV A;  2UUW A;  3OL8 A;  3E01 A;  3I56 S;  4LF7 F;  2CQ0 A;  1UJ5 A;  5F9N A;  3K57 A;  3MOJ B;  4O3N A;  4GVL A;  2XMU A;  2I9S A;  5KG7 A;  2OSR A;  5AJ3 J;  3PYG A;  1WUU A;  2AV5 A;  2DHX A;  3JAM Y;  4DBQ A;  7FDR A;  5SUH A;  5HSP A;  2QSF A;  4YY3 J;  2QTW A;  4NRU A;  2GML A;  2F4V J;  4JI8 F;  2IDL A;  4FF2 A;  1UVJ A;  1HHS A;  2CG4 A;  4DPX A;  2V4R A;  1RT3 A;  2OPQ B;  1TL4 A;  3LUY A;  4PR6 A;  5IZH A;  2ADB A;  1R3N A;  4RW7 B;  4I56 A;  2X51 A;  3I9V 9;  4ECY A;  2M88 A;  3GFZ A;  1O5J A;  1FKP A;  4TLR A;  1FWK A;  4USJ C;  4TY8 B;  4TU7 A;  4DV5 J;  2WSC C;  3A3O B;  3A12 A;  3NS6 A;  3KHH A;  4OHW A;  1NB7 A;  2W9C B;  3HJV A;  1FKO B;  1SH3 A;  3R5G A;  5LMU J;  5G0R B;  4ES3 A;  3RAX A;  4O4G B;  1YTY A;  2MY7 A;  3KLF A;  2HVE A;  3IM9 A;  1IQZ A;  4OZN A;  3B8H A;  4A8O A;  3POT B;  1KWM A;  2JZ5 A;  4PWU A;  4LUB A;  3JSR A;  2EXU A;  3QWU A;  3M9M B;  1R0A B;  1YIJ S;  1DUR A;  1WC3 A;  4GMK A;  3IAM 9;  2AF6 A;  5ADZ A;  5CD4 A;  3FZ2 A;  1RAE B;  3MM6 A;  3HHL B;  4FPI A;  5BR8 J;  1YVF A;  1HNI A;  1O0P A;  4AL6 A;  1FXR A;  1R31 A;  2HGM A;  4C98 A;  1NCL A;  1FER A;  4YQW A;  2OGU A;  5F3T A;  3SI8 A;  2ASL A;  1HBU A;  3TEH B;  4CP5 A;  4AL7 A;  2VPY B;  3QT7 A;  1UFW A;  2NQP A;  4LF8 J;  3EGZ A;  3I96 A;  1TAQ A;  3SFU A;  4MIB A;  3PHE A;  1NHU A;  2H9Z A;  2R8G A;  5GMK a;  1S0V A;  3GLJ A;  3BR8 A;  2PMW A;  4R8U A;  1NK9 A;  1Q7Y T;  3P3D A;  1H98 A;  5T7L A;  5KOW A;  2R2S A;  1HW8 A;  3AAW B;  3FDS A;  3VQT A;  4YR0 A;  2DNR A;  4DV2 J;  2BE9 B;  1S1U B;  4RZR A;  3NLC A;  1QVF R;  3M6X A;  1X4E A;  4HR2 A;  3MCS A;  5HL7 Q;  4BC9 A;  1IBM F;  4OYP A;  3L4B C;  1VBY A;  1CJK B;  4ATN A;  4KFB A;  4PXE A;  4F50 A;  3T9Z A;  1JLB B;  1H38 A;  2OD6 A;  1LXN A;  2Y1J A;  2YKM B;  1XK8 A;  2V68 A;  2VZ9 A;  2L9D A;  4DJB A;  4FNI A;  2GNK A;  4DR7 F;  2YQ3 A;  2Z58 B;  3G2X A;  1WI6 A;  3FRZ A;  4LF1 A;  4OZL A;  2HHQ A;  2QJ3 A;  3D4J A;  2V0N A;  1JLG A;  1YJU A;  3EX7 B;  1LW0 B;  2HBY B;  1W2B R;  3TUP A;  4PPD A;  1QY7 A;  3KUH A;  1PG5 B;  2HZC A;  1Y5I B;  3DXS X;  1BQM A;  3SV3 A;  4EZ9 A;  4TKT A;  4ILL A;  1HWU A;  4X62 F;  3NAH A;  5HMX A;  4PRF A;  1HQU A;  1XMB A;  3I9Z A;  4MH8 A;  5KG4 A;  2G13 A;  3TAQ A;  4MIW A;  1EQ0 A;  3RYL A;  3M32 A;  2OHD A;  2F9J A;  2OEL A;  3WX8 A;  5ETN A;  5AE2 A;  3Q22 A;  2JEI A;  4ED0 A;  3FFI B;  4ZPA A;  3PG9 A;  3HT0 A;  5I42 A;  4BC7 A;  4NLX A;  3V4M A;  4U6P A;  3GR0 A;  1F9E B;  2G0I A;  1HBN B;  4BLG A;  4JB8 B;  4NML A;  4J9O A;  5KFL A;  4U7C A;  3Q83 A;  3DOL A;  4ID5 B;  4QPT A;  1FA0 A;  4EEY A;  5KTQ A;  2IDE A;  1I94 J;  1UCN A;  3TOQ A;  4J9M A;  4LF6 J;  4HAC B;  3PCO B;  4IFV B;  2OD4 A;  3IP0 A;  4ZLL A;  1IBL J;  4WII A;  4DFJ A;  4MKV A;  5HO4 A;  2UXC J;  3OFH A;  2QMX A;  4DN9 A;  2QO3 A;  1U1K A;  5KFX A;  2HSE B;  3OTD A;  2HMI B;  3TZY A;  3LGM A;  4DV1 F;  3JTP A;  3UD5 A;  3QT5 A;  2EG1 A;  1AA1 B;  3SIP B;  1LNQ A;  2ZE2 B;  4P6Q A;  3CJK B;  2W4P A;  3VZH A;  3CJ5 A; 
#chains in the Genus database with same CATH homology
 3PJ9 A;  3ETM A;  4DI6 A;  3JS9 A;  4ANE A;  1HIY A;  3B6B A;  4CP5 A;  5CAA A;  1XIQ A;  3NGU A;  4UOG A;  4FKX A;  3FBE A;  2B8Q A;  4AND A;  1MN7 A;  2DXE A;  3MPD A;  1NSP A;  1HLW A;  4ENO A;  3G2X A;  5IOL A;  1BUX A;  1WKJ A;  2AZ3 A;  3PRV A;  3ZTS A;  1F3F A;  2BEF A;  5C7P A;  1HHQ A;  3Q86 A;  1JXV A;  1NUE A;  1LWX A;  3ZTO A;  1WKL A;  3Q8U A;  1XQI A;  2DXD A;  4F4A A;  3B54 A;  3EMT A;  2CWK A;  3VGS A;  2DY9 A;  2NCK L;  3Q83 A;  3ENA A;  1PKU A;  1NSK L;  3BH6 B;  3EJM A;  2ZUA A;  4W98 A;  3VVT A;  3GPA A;  3VGT A;  3BBF A;  1LEO A;  5CAB A;  4S0M A;  1ZS6 A;  1UCN A;  1NDP A;  1NHK L;  3FCW A;  1NLK L;  4WBF A;  4ANC A;  3GP9 A;  3EIC A;  4O0N A;  1BE4 A;  2AZ1 A;  3EE3 A;  3Q8Y A;  1B4S A;  3ZTP A;  2HVE A;  3Q89 A;  1F6T A;  3BBC A;  3FBF A;  3VGU A;  1BHN A;  3EVO A;  3BH7 B;  4F36 A;  3DDI A;  3L7U A;  1NDC A;  3NGR A;  4HR2 A;  4UOF A;  2HUR A;  3NGS A;  1K44 A;  3EVM A;  3FBB A;  3FCV A;  3EVW A;  1EHW A;  4EK2 A;  1WKK A;  2VU5 A;  3ZTQ A;  1S57 A;  3FKB A;  4UOH A;  1MN9 A;  1S59 A;  3ZTR A;  3R9L A;  4FKY A;  1NDK A;  1KDN A;  1NB2 A;  3BBB A;  3DKD A;  1NPK A;  1NSQ A;  4DUT A;  3VGV A;  1B99 A;  1S5Z A;  5BXI A;  2DYA A;  3WX8 A;  2B8P A;  1PAE X;  2DXF A;  1NDL A;  3EM1 A;  4KPC A;  4DZ6 A;  1VYA A;  3NGT A;  1W7W A;  3ELH A;  3VVU A;  3Q8V A;  3FC9 A;  1NCL A;  2BX6 A;  2HVD A;  4C6A A;  3FBC A;  1U8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...