1ZS6A

Structure of human nucleoside-diphosphate kinase 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
152
Chain Sequence
TGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase 3
publication title Structure of human nucleoside-diphosphate kinase 3
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 152
sequence length 152
chains with identical sequence B, D
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1zs6A00
1NPKA 3B54A 1HLWA 3EJMA 5IOLA 1ZS6A 3ZTQA 5BXIA 1K44A 4EK2A 3R9LA 1PKUA 3BBBA 3ETMA 1NSKL 3FBFA 1HHQA 1S57A 2BX6A 1BHNA 4FKYA 2DYAA 2VU5A 4DUTA 4ENOA 1UCNA 1HIYA 2HVEA 1KDNA 3FCVA 5CABA 3ZTSA 1BE4A 3Q8YA 3Q86A 3GP9A 3FKBA 3ZTRA 3MPDA 4FKXA 4ANEA 1NB2A 1NSQA 3FC9A 3NGTA 1VYAA 5CAAA 3ENAA 3EVOA 3DDIA 3EE3A 3EVMA 1LWXA 4HR2A 3L7UA 1NHKL 3PRVA 2HURA 3Q8UA 4CP5A 2DXFA 2CWKA 3FBCA 4WBFA 3VGSA 4ANCA 3WX8A 1MN9A 3VGVA 1NDLA 2DXDA 2DY9A 4KPCA 1B99A 3FCWA 3EMTA 3NGUA 1W7WA 1NDCA 4C6AA 1NUEA 3BH7B 2B8PA 3Q89A 1PAEX 5C7PA 2AZ1A 3GPAA 3FBBA 1NSPA 4O0NA 1BUXA 1B4SA 4ANDA 3ZTPA 4DI6A 2DXEA 1WKLA 3VGTA 3EVWA 4DZ6A 1XIQA 4UOFA 1LEOA 4S0MA 3ELHA 3NGSA 4F36A 1XQIA 1F6TA 1EHWA 1S5ZA 3Q83A 3VGUA 1MN7A 4UOHA 3NGRA 2BEFA 3VVTA 1NCLA 3B6BA 1S59A 1F3FA 1U8WA 3ZTOA 3BBFA 3Q8VA 3DKDA 1JXVA 2B8QA 2HVDA 2AZ3A 3JS9A 3VVUA 3BBCA 1NDPA 4UOGA 3EM1A 2ZUAA 3BH6B 1NLKL 1WKKA 4F4AA 3EICA 3PJ9A 3G2XA 1NDKA 4W98A 3FBEA 1WKJA 2NCKL
chains in the Genus database with same CATH superfamily
1TAUA 4H54A 1VFJA 1K44A 3CCES 5C42B 1EJ7L 2JLFA 5D0GA 4UOCA 3DLBA 1WSRA 3RGIA 4TU8A 3SI8A 3QWUA 5EWGA 4Y2AA 2C22A 4YUDA 1VRTA 4F4WA 3DI6A 3W60A 3UDVA 5B09A 2CJ9A 1ZM3A 3W9HA 5I4MA 2FZGB 3C46A 2DCLA 3TJ9A 5KFTA 3RB4A 4KTQA 1JK9B 4M5HA 2RQ4A 5J1EB 2MKHA 1G4CA 2YNFA 4CO5A 4LFAF 3NCRA 3CTRA 2IVYA 3HT0A 3VVTA 2J0XA 4RBUA 1U47A 4I6AA 9RUBA 4FVCA 4XO0A 3CDUA 4NLXA 1U8WA 3LA0A 3BBFA 1BGXT 1ZYQA 1YITS 4ZIVA 2DNNA 2R8GA 1TL4A 2DISA 4OX6A 2HIYA 1XJWB 1UPPA 3GFHA 1QLNA 2C3UA 1DARA 1KKHA 3JTPA 3L7PA 2YWKA 3HSDA 3CJ8A 4I7FA 3BN7A 2ZE2B 1BXNA 2MLXA 3OPKA 4K2XA 4ZJLA 3GJRB 1X4HA 4B9TA 1XTZA 3QIPB 3MMCA 4NZ7A 3UN3A 2J0WA 4EI2A 3BR8A 1RAEB 3JQMA 1VC5A 1JJ4A 1HR0F 3OUYB 5F9LA 2PFFB 2V67A 2B7BB 3TW0A 3F73A 4BC7A 1Q79A 4CLSA 3MZIA 1RHRB 3FUYA 2EFGA 3BGRA 1JLCB 1D8YA 2AZ1A 1CQMA 3IO1A 3IRXB 1T9XA 1RADB 2YWEA 3TJAA 3T9ZA 1UFLA 2MEWA 1ZTWA 2MY7A 2UVRA 1Z4UA 4ZVQB 1VMBA 1IBKF 1RT5B 1RBOB 4NXNJ 3KLIB 3KUGA 3ZTOA 4DV1J 1S9GB 1E6YB 3DOKB 2VBZA 4ECWA 2IAJA 3HP6A 1B0PA 1RT7A 5IOLA 4FNHA 2ZH8A 4CDIA 4UTGA 1M5KC 4RW8B 1VQ8S 2VODA 2RHSB 4DSIA 3R6LB 2LQ9A 4TN2A 4P2XA 2CNNB 2ZEJA 3NGTA 2R7TA 2K06A 2PMWA 2FJWA 2RJZA 5K8NA 2H54B 4NLQA 3BO4A 3QJJA 4PUOA 3NXZA 1R8BA 2IPOB 4CLUA 4H4MB 3IMQJ 4DV0F 3HCXA 2B3TB 3A8IA 5KG3A 1A6LA 2FUG9 3G9CA 2GHWA 2VFVA 3M2UB 3WC0A 4NLSA 1LXNA 3UN5A 1IR2A 1QD1A 2Z2YB 5I42B 5JMNA 2WOMA 4YR0A 1QVFR 2CQDA 1PCAA 3QRRA 4DV7F 1PSDA 2V8HA 3B78A 3MM9A 4ED5A 1FO1A 4CM2A 1C0TA 1MLAA 3UE2A 3KLFB 1G1XA 1VBKA 1LK5A 3DKDA 2OPPA 4P72A 2C2OB 2LQ5A 3W8PA 3CC4S 5EDWA 3HSZA 2N4CA 1UFWA 1U02A 3IC1A 3PJ9A 4TU7A 2L41A 2MGZA 3V4IA 4IFVA 2GS8A 4TXSA 7FD1A 1X4CA 1VQ5S 4DCOB 2WVDA 1D1UA 3TZYA 4X4PA 3HDSA 4YEAA 2HNZA 1HL6A 1S57A 3OXGA 1RHJB 5HROB 2JLGA 2E66A 4E98A 4X2BA 2XSFA 1IKXB 4USHA 1VLYA 2GC8A 1RK8A 3KLGA 4P10A 3EPIA 3X3UA 5K8MA 3C3LA 2YWHA 1ZM9A 4PAAA 5C2CA 4F0MA 3DNCA 4OHWA 4DJBA 4LFAJ 4HACB 3U27A 3CCRS 4KAIA 4MYUA 4ELUA 2CPZA 5L9XA 5KFCA 3KKFA 3CC7S 1PJ7A 2HFZA 1QUPA 3ZNJ1 4IH6A 1FE0A 4CO2A 3DRXA 2YKAA 5HJXA 5BXIA 3I5BA 4J9RA 3NGKA 2GJFA 2QV6A 2KG0A 1M5OC 1APSA 2W4CA 1FK9B 1HNVA 5E33A 2LKZA 1VQNS 2E7VA 5ETSA 1MWQA 2AWZA 3V81B 2RMLA 4TY8A 4I1TA 3OQ2A 3LWLA 3KHGA 1X9SA 2Q6CA 1REGX 3T5HA 1HR0J 2DXFA 1S7IA 3MEDA 2L9DA 4K4UA 1K0TA 2N3OA 4A46A 2FHJD 5J1EA 2EKYA 1FXRA 1NH7A 2BE7D 1UFKA 4Y2KA 4IG3B 2HQDA 1PJ6A 3MEGB 2VV5A 4IKAA 3WDOA 3T9NA 3CJ0A 1FDAA 1KOHA 4ES1A 2H1YA 4A8XA 1IBKJ 3J81Y 3R5DA 3DMJB 1CJKA 2D1CA 4Y0FA 2BEFA 4ZCIA 1SCJB 1SBRA 1TKTA 3I0RB 1HNWF 4WYLA 2PEBA 4XDCA 2HBRB 4K4SA 2D9PA 4ZCLA 4L73A 1ZM2A 4U7UD 2VQEF 2DHAA 2ZBIA 2J6TA 1GMWD 3VAJA 2C2EA 2AIRB 4I6WA 3N6NA 1KWMA 4Y3CA 2ZBQA 2N7CA 4DL4A 1C0UA 3OFEA 2GGPA 3ADAC 1SQFA 3K0JA 2VG6B 2FB0A 3E01A 5IS2A 4DV0J 3ENQA 4B3SJ 2AEJA 2YTCA 2FVCA 4ED0A 1U8SA 3M8YA 2HHHF 2V9KA 3HHLD 4X84A 2C28A 1AB8A 1Q81T 4ELTA 3OTOF 4ZPAA 2B4PA 1SH3A 3W3SA 3BZQA 3MURP 2WVFA 3ELHA 3KLIA 4DV7J 1NU4A 2W1BA 4K0KF 1AFJA 3J7YU 1E6YA 2PDAA 3P3DA 3THTA 4LF8F 1FEHA 2LYVA 4OLOA 4LVNP 3IM8A 2M3DA 4H4KC 5IC6B 2RE1A 1KQGB 4OHYA 3R5GA 2I5JA 4ZPVR 4RW8A 4R5PB 3AAWB 3ISNC 2GVZA 3OHAA 3DOLA 1L5UA 2QA4G 3OVSA 4C7QA 3TUJC 1HI0P 3S1TA 1I51B 2DD8S 4JI5F 2D7SA 4KH0B 3VGSA 4DR5F 1Q95G 3OTEA 3BM7A 2LA6A 3EZOA 3CCVS 2D3ZA 2QG9B 1FTRA 5H9EK 3MMAA 2MLZA 1FX2A 2ZOGA 3ZTPA 4JI0F 2VONA 4Q43A 2KT5A 4N47A 5ETKA 3PFEA 3RR8A 4PCQA 1S6OA 3KLHA 2PSZA 3EGZA 5HSPA 5KFJA 4CT8A 3FSIA 2MZJA 4OHZA 4F2RA 3MPVA 2M0GB 1VC6A 2R2TA 4N41A 4KGVB 5JJBA 2M7SA 2CJKA 2X7IA 5C25B 1YBTA 4CH1A 4JV0A 1YJWS 1LW0B 2CZ9A 3R5AA 5FJ4A 2Z30B 1J2VA 1D09B 3JAMY 1ZPWX 4DFKA 2AP6A 5KFEA 4E2FB 1FRMA 3CD5A 1RTDB 2HKEA 3L9ZA 4DR3F 2KM8B 1KOOA 2YWGA 3GIKA 1U6BA 4P74A 5KFGA 2HWHA 1OIAA 5L46A 3H4DA 2ZJPQ 3W7BA 4NI2B 2NUUG 5F8IA 2XWXA 1XR6A 1NDCA 3K5PA 3SV3A 4HACA 4X64F 5DS7A 3OV7A 1FFSB 3BYPA 4MK7A 4ZLNA 3G6XA 2HW3A 1XQIA 1H0HB 1MMDA 3MM8A 2UVWA 2OKQA 1EKSA 4J7CA 1HNWJ 3DRRA 2RU9A 2OP5A 5LM7E 3I9ZA 1B70B 3CC2S 3M9NB 1GEHA 2E5JA 1M1HA 2RH3A 2FGCA 1WC0A 2J0SD 2LXUA 2KB2A 2VQEJ 1TL1A 1PC4A 2APOA 3ETMA 4PYDA 1TR0A 4ZVOB 2CNOB 2EFPA 4C8OA 5CYQA 4M5IA 2J7KA 1S1XA 5U47A 5KFLA 5LMNF 4A8WA 5GVQA 1RAGB 1NK6A 3TR5A 3O44A 4BBYA 1O51A 1PYTA 1N6QB 5A8WA 2CWKA 4C11A 3MUTP 4RW4B 1F60B 1RABB 4Z37A 2HNDB 2UU9F 2HHHJ 1S10A 4OZ0A 3OTOJ 4KO0A 3PTWA 2AD9A 1RDRA 1FEEA 2DCUB 4ZP9A 1LEOA 2XBPA 4K0KJ 2IM1A 5I3UA 2J7WA 3ZFVA 4CTAA 4F36A 1KVIA 2WBMA 1HWUA 4ZN1A 1YJUA 2DNPA 4OYWA 2V4QA 2HFOA 1WWHA 2V4JA 4MIAA 3GJTB 3PX0A 1S49A 4JI8F 3PV8A 2WCXA 2L08A 3GFYA 3QQCD 4FYXB 2ZBRA 3QATA 3BQ1A 1CSJA 1H72C 2H5JB 4PG7A 2WSCC 2VG7A 3HJFA 2EFVA 3IG1B 3PHEA 1SKUB 1X0PA 2KHDA 5THWA 4HL9A 4J5OA 3OL9A 3CJ4A 4ENOA 2XQCA 3V6KA 4YDDB 2XMWA 3S01A 2KT2A 2HWIA 2C2RA 2NREA 4CYUA 2Y1LB 1LQ9A 2XHCA 4JI5J 2LEAA 1G2EA 4PXBA 2XMMA 1KLMB 2HFUA 1BQMA 4KGKA 4DR5J 2WONA 3SCLE 4ANCA 1U0SA 1MN9A 4OJ1A 4Y2CA 3TA2A 2YVSA 4GRSA 4KPCA 4OX9F 2IJNA 4QIWD 3HSJA 1HNIB 2BV3A 1S97A 4CLWA 2B7CB 4JI0J 4JYAF 3IS9B 5K8PA 1DTTB 4RLEA 3G82B 2CAJA 2MPUA 3VAGA 4IDKA 4FF3A 4O4GA 3PR5B 4G1QA 3VWSA 3K59A 2FYXA 1UAWA 4JV2A 3GJSB 5ETLA 4ZVRB 4OJHA 4RUBA 3LANA 2CJBA 1R3NA 3P5BP 5AXMA 1C1CB 1VC0A 1O5JA 4JI1F 2IA6A 3OTCA 2MQLA 3IR7B 1UW9A 2RHQB 3OXFA 2VIHA 2V6AA 1BC6A 3FMWA 2KJVA 3HMJG 3ZNUA 3K57A 4NLRA 2Q66A 1RISA 1RWUA 1SJQA 4B9MA 5F0UA 1FRXA 4C0OC 4DR3J 4TY9A 3QLHA 2EC0A 2GMJA 3P49B 4O3SA 4FXDA 3C8YA 4LREA 3NS7B 1U48A 4N76A 3M1VB 4LF9F 1FT8A 4AFFA 1K8AT 1T9UA 3DM2A 1LWEA 5G0RA 2ZC3A 4X64J 1S0MA 1NO8A 3W64A 4DFMA 5GAGU 4DI6A 3AH6A 1CJUB 4KC5A 3H2LA 4P7VA 3GIJA 1M5VC 2EG2A 3CJ2A 1HBUB 2OI2A 2GA7A 2GHVC 2M9KA 1T9VA 5IV4A 4IOCQ 3M2VA 1U45A 1T05B 1GXUA 2Q43A 4WP9A 1JXVA 5B0BA 1DURA 2KN4A 2V69A 2EKNA 4DQRA 3GYXB 2HHVA 4PR6A 1WKJA 1BWVA 3V6DA 5E3RA 1U2RA 3R5BA 1I6JA 2IVFB 1HHQA 2MB0B 2NS1B 4KH1B 2JX2A 2RUSA 2IVMA 3TVYA 5LMNJ 1WTFA 4OMFG 3MR5A 1JKHB 5B7WA 1HARA 4NYOA 1J5OB 3CCQS 4B3MF 2VKRA 1T03A 2UZAA 5AT1B 1JWWA 2UU9J 5DQGA 2MKCA 4LBHA 1BY9A 2JEFA 1FKPA 1HQ2A 1RI7A 1HWKA 3QGPA 2CPIA 2XNQA 3Q22A 3C66A 4LF7F 4USWA 3POTB 2UVVA 2QMUB 3H5XA 3OR1A 4YB5A 1HBOA 1F6TA 2RDDA 2M5YA 3MD1A 4ECSA 5DG9A 4QCLA 1ZH5A 4JI8J 1RE1B 1KN6A 1RTZA 3TA1A 1WDTA 4DPTA 5CCMA 4O3PA 3EM1A 4QQBA 2QT7A 3CW2C 2OPRA 1FVQA 2JEJA 1CEZA 3FBFA 1S6QB 1W2BR 5A8KB 3AB4B 1SC4B 4OYPA 1HW9A 3RU0A 1N6QA 3BDPA 5DJBA 4RW4A 3DHXA 3Q24A 1IQTA 2XGPA 3M05A 2BRLA 4OX9J 2OUGA 3SIPB 2HIQA 2HPUA 4JYAJ 5IM0A 4KSEB 2XG8A 2B6AB 1CULB 1WF0A 3I56S 4J9NA 1U1PA 1N0VC 1RBAA 1UEUA 4OHVA 1R43A 2BQ3A 4G3IA 2R8KA 1VQPS 4ZVTB 4JI1J 5B0AA 4IRCA 4DHVA 2VDHA 2Z2LA 4KR0B 3K5OA 4UOGA 3TANA 1YZ7A 3KHHA 2XZWA 4F2SA 3EXCX 5HVFA 4LMZA 2DIVA 1GQEA 2AMCB 2EW9A 3IA0A 3HHLC 4KKOA 5D6GA 4NCGA 4CH7A 1HWLA 1FDNA 3W2WA 4TNOA 4H4KA 1IKWA 5L9NA 3FSXA 2YKNB 4NA2A 3G6YA 3DHWC 1DY3A 1B3TA 2HURA 3HZGA 1ROFA 4LF9J 3W1YC 1HNIA 4LSZB 4OZJA 1WELA 3RB6A 3MFHA 2LEPA 1WD6A 2BQRA 4NYPA 4U8VA 2RRAA 4QOTA 4URQU 3GYGA 1LK7A 1WSVA 3UNGC 3RBEA 3RAXA 2LQBA 3FRZA 2HVHA 4PQAA 3THVA 2CDRB 4ZLPA 2ZNZA 2IBKA 1S1WA 1C1CA 3VAFA 3MI7X 2YBVA 3M8WA 3MXHP 4F8RA 4HHHA 2YKMB 3OVAA 4IR9A 4C8YA 5CQGA 4MKAA 3MCOA 4OI0A 3D66A 5F8MA 3TRGA 1JLFA 1HBMA 2ZHAA 2K1RA 4QYZK 4GKKF 1RTIB 1NRKA 1Z1ZA 1FRJA 1B0VA 1HMVA 1IVZA 4B3MJ 2JFDA 2M70A 2KFZA 3M1VA 2YPZA 4RJVA 5HANA 1N5QA 1NH8A 3KJQB 5IZHA 2PT0A 4ES2A 1WHWA 2RAQA 4DV6F 3GV5B 4LF7J 5LOQA 2IRXA 3EXYA 2J76E 1J5EF 1U2CA 2ACMA 1XIQA 1FXLA 1HYSB 4K4YA 3CCTA 5IT0A 4TQRA 2YXLA 3NOGA 4RW7A 3VALA 2MQQA 2QLFB 1UVIA 3VGUA 1QY7A 5JXSA 1LWCA 1DRZA 4NLDA 1RU1A 3AD8C 3GCWP 2W4DA 5DG7A 2R2UA 4IOAQ 1L3TA 1VLOA 4MMOA 4FF1A 2OPQA 5E3QA 2VD3A 3N0VA 1V3RA 3MAHA 4HT5A 4A8FA 4Q8EA 2OSQA 3Q8YA 1AROP 2OAUA 4ZK7M 3EVOA 3I87A 2V5HG 3V6HA 1WC6A 4F0HA 1OPZA 1S9EA 1REVB 2KO1A 2IDLA 2AYBA 4CNYA 1JLQB 2DNYA 3OR2B 1C1BA 4NLGA 5KFKA 2Q3PA 2BANB 1EETA 2XNRA 2YY3A 3SQGB 1CJVB 4RBVA 1FX4A 2XYGB 3OSPA 2YNHB 1TUWA 1CVJA 2YQ0A 3D7SB 1TK5A 1XR5A 2WSFC 5H9EJ 1TKZA 4DPWA 2NPFA 1PO6A 3D2WA 3D6FB 4XIUA 4RNNA 1VBXA 1NK8A 3DLEB 5IT9Y 4ZVGA 4C9DA 2YX1A 2FY1A 4ZVSB 2U1AA 3C2PA 2VDIA 3RB0A 2DTJA 3NNHA 4CWBA 1PKUA 4QZVB 2JSXA 2CQIA 2DYAA 2Z8QA 1OQ6A 3DCAA 2FZKB 3CEDA 3A3PB 5DQHA 4Y6IA 4DX6A 2JEIA 3D1QA 2ZBCA 4U6PA 3DLKA 1PG5B 2YKQA 2ZKTA 3QGHA 5FIIA 3LF0A 3WZ0A 4ZJOA 3DLHA 3VGVA 1TUVA 1RAHB 2QLJB 4HYKA 2YNGA 3OTBA 3W63A 3ULHA 3M8SA 3H40A 2J9DA 2B9EA 5DDQC 2BE2A 4ZCKA 4N7TA 5SUHA 1BQXA 2LA4A 3FJ2A 1FNOA 5KG4A 1GXTA 3I4PA 4DOZA 1S0OA 1MN7A 1UZDA 5C5JA 1RJJA 3M9MB 3B6BA 1RWWB 1O8BA 4JV1A 2HS4A 3ILJA 3PJWA 4WFNQ 1UZHA 4ZLLA 2EBEA 2YKPA 2AW0A 2NZ4A 3J80U 2CPXA 2OMLA 4EUVA 1NHVA 3VF0B 4FF4A 3HFKA 2UUBF 4GKKJ 2WAQD 1T0TV 1L3KA 1N5VA 2JJ4D 4DXLA 1UCNA 2CVIA 2EFOA 3TUZC 2CQ1A 3I0SB 1N36F 1SL2A 1TZ0A 1YWXA 3EE3A 1DQ8A 2HQIA 5ETPA 4OI3A 1KQFB 1YTYA 3BO2A 1IKVA 1LWFA 5KFQA 3K89A 4DV6J 1C4AA 3KDOA 2GO8A 2YQ1A 4O3RA 2YX7A 1SB6A 1XNRF 1VOMA 2B8PA 3ILLA 1OS5A 2GQ2A 1B64A 4NCAA 1J5EJ 1QDUB 2PI4A 4DF8A 2F7VA 3FK4A 4M63A 2H65B 3UR3C 1FKAF 3N6MA 3TAPA 5D0EA 4KE5A 4ER8A 3LP1B 3GJQB 3PO4A 2WVCA 1S5ZA 4ZHRB 1FCAA 5D8HB 2FHMA 1N32F 4U7UK 3AA9A 4MH8A 4U7CA 3C15B 3WHIA 4QR0A 1JLAA 3CMAS 1NDPA 5HJYA 1WG4A 2AT1B 1F3VA 4PQUA 3M8PA 3CIMA 1I1GA 4CO3A 1KVKA 2VC0A 4DV3F 2W4PA 2QA2A 2NQPA 4MYTA 2HZCA 4X4QA 4B9VA 2IJRA 4B3OA 4FXWA 4AXIA 4NMLA 2VPZB 2L48A 5CXTA 3MR2A 3TP2A 4OZ3A 1SJ1A 5KG6A 4FYWB 4KBIA 4LRAA 1TMJA 3M2RB 4TKTA 3DC2A 1P1LA 4RO0A 2W2PP 5KT2A 1ZETA 1WJ9A 3W2VB 4F67A 2IFXA 2E44A 1F5CA 4EBDA 1DLOA 4DPOA 1JJ2R 4Q8FA 4CCHA 3HJVA 3QNWB 1AZSA 2VKZG 3WC2A 4OYBA 2E1AA 3TOQA 1GX5A 2GMHA 2MSSA 3N5BA 5F8LA 2IY5B 3IN5A 4KB7A 4WKYA 4J9QA 2JC0A 4Q2MA 4MFBA 2R7WA 2WTFA 3A8KA 2C2MB 4OZNA 3FVYA 1ZAWA 2AJ4A 2YWWA 2VHGA 4G1IA 4GKJF 4RW9B 5J1NA 2V4RA 4ATNA 4QW9A 4F4YA 4A4JA 4PPZA 3H8YA 4BWJA 2R8IA 5LMUF 3D6TB 2VA2A 2WVEA 3Q0AA 2VBWA 3QMQA 4FKXA 4N8NA 3W8GA 2XS2A 3SDEA 2FHJA 1NK5A 4ID5B 3RB3A 2VPYB 4MKVA 3T5LA 4QIVA 4IQMA 4DX7A 3L3CA 4FN5A 3NGUA 2CG4A 1PAEX 1S1TA 1RT1A 4EBCA 3H25A 3OBIA 2ASYA 1YGYA 2ZC4A 3H98A 5D4PA 2Y1RI 3IBWA 4Q0BB 3V2UC 2KTQA 1U7LA 4BWMA 2IBOA 1Y5NB 3VVUA 4JP8A 1T8EA 2O5DA 3E3XA 4WK1A 2HLTA 3HXMA 2UUBJ 1CC8A 2Z0GA 4YR2A 2O01C 4KYZA 4CLTA 2BJ3A 4F50A 4LF4F 4NX9A 4ICLA 5BYSA 1YJNS 3FFIB 1OWXA 3GP9A 2ZH2A 1JIHA 3BSCA 3C16A 2OD6A 1GMVA 2V63A 2MSTA 3UVJA 3HHLA 4ZPWR 1XNRJ 2W2OP 4TLRA 2GZOA 5KFSA 3U7JA 4W92B 3QSYB 2BRKA 1U49A 3CT9A 1MNEA 2BJ9A 2GO9A 4P71A 4UOFA 3D0GE 4S0MA 3ICLA 3MM5B 1YRUA 3MM7A 1N32J 1QSSA 1N56A 4BS2A 2MZRA 2B43A 2PIIA 5ETMA 1M90T 2AV5A 4R25A 4PWWA 1RWXB 3UDEA 1ZAVA 1RLDA 2HBQB 3NEKA 2WVBA 1QE1B 5J2MA 1PJ5A 3DYAA 4F4AA 4ECTA 3G2XA 1TP7A 4DV3J 1VQKS 4G65A 4NMXA 4H4OA 3IR6B 1HI1A 2HVEA 4AXJA 3PX6A 2CKWA 4NRUA 4M5MA 1ELOA 3ITHB 4IO1A 1IBMF 3EVMA 1LWXA 3IAM9 1RA7A 1MROB 2XC9A 2KXHA 1L3SA 5CA5A 3MMBB 4USKA 4WFAQ 2BR0A 3KK2A 2DBBA 4NCBA 1HHSA 3NY0A 2C2KB 2CYYA 4WFXA 4OZ5A 1RLCL 4OYOA 1YHQS 1TVRA 3BPDA 4P2MA 5KFUA 3R8YA 1M5HA 3HPOA 4RU9A 2QFJA 3TZZA 2R7UA 3UCUP 1IQZA 4PKDB 1IUJA 4X4VA 2DHSA 4DV2F 3P45B 3BSNA 4ETZA 3JS9A 3OJUA 3G6VA 2VJVA 5MLCV 1YRXA 3N79A 1DTQA 2BJEA 4F7VA 2WB4A 5JUMA 3ZZOA 4GKJJ 3Q8SB 1UMJA 2VC1A 3DLGB 2WBRA 1JLGB 3UW1A 3EGNA 2ZM6F 2LQJA 1TK0A 1IR1A 4PG8A 2Y0BB 1N54B 3A3NB 1HQEA 5LMUJ 1R8CA 2NLWA 1U0HA 3TNVA 1NSQA 4ED7A 2GVDB 1RHKB 2OPSA 2FD2A 4RWWA 3CJRA 5KFWA 1LKZA 4MT1A 1B99A 3PG9A 2ERRA 3MECB 4M1KA 3T6BA 3VAMA 1U24A 4DSLA 1IBCB 2QSFA 1N5YB 1JXEA 1NMEB 4YHHF 3KK3A 2ZVIA 2P6SA 4ITSA 1TFWA 2E9RX 1HNXF 3J80Y 2VOPA 4ZPDA 2HG4A 5JVHQ 3ET6B 1WOOA 3U1MA 1PGZA 1MU2A 3TQ1A 1SKWA 5J2PA 5GADI 2HGLA 2B4UA 4JI7F 2XI3A 1EX8A 3R7SB 2GIQA 3D3CJ 1SPBP 2NCKL 3HHEA 4DSKA 3FQLA 3UI3A 4LF4J 4C4WA 4EK2A 4QIGA 4I67A 1IR0A 4DZDA 2JRSA 5J1PA 4RNOA 1VRTB 2C1EB 3DI6B 3PDNA 2AJ0A 2K3IA 4YQWA 2ZH4A 1NB2A 4J9UE 3WBZA 2FTRA 2XB2D 4KHRA 2X1FA 1URRA 2X51A 4B9NA 3KJVA 1NKCA 2DXDA 2YNFB 4TU9A 4QW8A 4DU8A 4DS4A 4MK8A 2J6UA 1DQAA 3N9UC 4OJ3A 4DR2F 3SFGA 3TUPA 2QSWA 3CDAA 2DNKA 1Y9OA 2FJBB 2O1PA 1FD2A 2IC3A 2XYHB 3H2VE 4C2MA 1A0OB 1SH2A 3Q8VA 5IQQA 5A76A 3OVBA 3PCOB 1KBRA 1XK8A 2K2PA 3BQ2A 1T3OA 1Y0HA 4I7FB 4GVBA 3BR9A 4DFPA 3LALA 2R42A 3H5SA 1S12A 3GG1A 4B08A 4G6VB 3NMRA 2KRBA 3KDNA 3H5UA 4RW6A 1GAOA 3MMCB 3MEEA 3EWGA 3KFWX 2LCWA 2BBEA 4F26A 2ASJA 1X31C 1IBMJ 2VBXA 2Q6BA 4DR1F 2OFHX 3J81j 1YIJS 3MF5A 1S99A 4UUWA 1NHKL 4L74A 3BGRB 2WW4A 5KFRA 4ED8A 3FMBA 4E0DA 1T95A 5HP1A 3IRWP 3DLJA 2O67A 4ZDNA 1Q1KA 2VFSA 4DWIA 3EMTA 3D0HE 3AJ1A 1P27B 1VCTA 4QWDA 4RL1A 3H4BA 4K5SA 4I6YA 2RS8A 1VISA 1RAAB 4A8QA 4CIOA 3VGTA 2QX0A 2Z56B 4LRCA 1GMUA 3BO3A 2BXJA 3H5YA 4LFBF 3J7A1 2BM1A 1ZAXA 1Q8LA 3CJQA 4DV2J 4UY8T 4E8UA 1XWLA 1T9WA 2FLLA 4KHPF 4CO4A 3G8SA 4F3MA 4W98A 5LJ5Y 2ZM6J 1ULRA 1WF2A 3OT9A 4C8MA 3CULA 3RRKA 3IWXA 2G2ZA 3K2YA 3PFOA 4X4UA 4LSLA 4PUOB 3ISND 1BQNA 2ZZTA 3L7UA 3MMBA 3Q2SC 2L9WA 4XDDA 3JYTA 1KQSR 3VCDA 4YS2A 5J2QA 4LBIA 3U02A 4I2QB 2K7KA 1QSLA 2UP1A 2MKYA 3CSKA 4YHHJ 1T9TA 2CWXA 1RHQB 1X4AA 3LOUA 3MM9B 3Q23A 2GAGC 2QMXA 2RVJA 4ZVEA 1C0TB 5EX3A 3TZXA 1RHUB 1RBLA 3G8QA 1TUGB 4CT9A 3U1NA 3J81U 1HNXJ 1SL0A 4DSEA 2L9NA 3OD2A 3I31A 2CQ3A 2HHQA 3SYZA 1CC7A 2MXYA 2MGZB 2DGSA 1W2IA 4KJIA 4WIQA 4JI7J 5GMDA 1MWYA 1X4FA 2HNZB 1Q7LB 5DZ7A 2ZH6A 2E29A 3RBXA 4Q2LA 2AHOB 3AY0A 2W7PA 3N5FA 1P6TA 4IOBA 4ZN3A 1LW2B 3BREA 2GIFA 3BGOP 3H59A 3KLGB 2ABYA 4NXMF 1VRUA 1RAFB 5ETOA 1WORA 1OO0B 1UJ4A 2RKIA 3W66A 4C97A 2MLYA 4CLYA 1UEVA 1LFWA 3AD7C 2VOOA 1CPZA 4DR2J 2FHOB 3AQPA 2ZNYA 3EVWA 3DXBA 2QLBB 3MM6A 2R7XA 4DL3A 1YZ6A 1Q5VA 2YWFA 2ZHOA 1N33F 3O2IA 2UUCF 1UVKA 2IM3A 1UEKA 5K14A 3C6TA 4WP8A 4FBUA 1RWVB 4CM0A 4I2PA 1SIZA 4DMZA 1HNVB 2YH1A 1AUDA 5KG7A 3B8HA 2J5AA 4K2JA 3CDBA 1RSCA 3V6JA 4TY8B 4LVOP 1NZAA 1U25A 2AEFA 2W2NP 3MEDB 4NPOA 2G13A 3JXOA 3R27A 4DR1J 2IRUA 1R0BG 1FJ7A 2KXNB 2F9JA 3DDIA 3OFGA 1HPZA 3RRGA 1NPRA 3WX8A 1NDLA 4NASA 2IJFA 4WTOB 2NXCA 1IN0A 2GV1A 1FI4A 1I5OB 3DGPA 2DGTA 4X66F 1CJKB 2FJEB 4OHXA 4HI2A 3THPA 3HK2A 4O44B 5F8HA 1TKTB 3WIVA 5T41A 4DEZA 4DV5F 4LFBJ 3GU0A 4O23A 3EZ5A 4X65F 2B9YA 3T41A 1V5VA 1T94A 2XMUA 4CO0A 5LXYA 4MTPA 5DG8A 4KHPJ 1JLEA 4ZP7A 2HHPA 1U4BA 2F63A 2KFNA 3W62A 1FE4A 3QZ7A 4TQSA 2DEIA 1C0UB 1HWJA 2GGPB 2E5LF 1P9QC 3JAMU 1KD1T 2NXEA 3HVTA 2LQ8A 2ZFHA 3DRSA 4LF1A 3E01B 1YJ9S 4ZPTR 3DN9A 2R7QA 2MDAA 3CB4A 1FJEB 1SL1A 2DNLA 1S79A 3T5JA 3I9V9 1IKYB 1U1NA 4J9LA 1O6XA 1XMBA 4ZKAA 3SZ2A 2EVZA 2KVQE 5D4LA 3ENVA 4YP3A 1FVSA 1PBUA 3LP0B 4JB8B 5IT4A 4P75A 4PXEA 4K5RA 1RTJA 1HD1A 2BMBA 5A6PA 2I5JB 2E5GA 4CQ1A 5D4NA 1LOUA 2AYGA 2GVZB 5KFOA 3BH6B 4FYYB 3DOLB 4CLZA 4NE9C 4C98A 3B54A 4ED6A 2DR8A 3TARA 2V2QA 1S1VB 1SUQA 2XO6A 4NXMJ 3CJSA 4NA3A 3A1YG 4OYAA 1XMQF 4B3SF 2DB1A 2CFXA 1Q8IA 3HF5A 3AB2B 5LSLA 3MUVP 2KRRA 3QGIA 1V3SA 3MMAB 1A9NB 1VQ6S 3W65A 3C14A 4I2QA 2E1PA 3H0PA 3JSRA 1YRTA 4NOHA 3LW5C 4C6AA 1WOSA 1MW7A 3GPAA 3KLHB 2E1CA 3AXMA 3K5NA 3T6JA 3ETOA 2Y8YA 4NA1A 1N33J 1VQLS 1QVGR 2UUCJ 4UOHA 1EARA 2O3DA 1S6PA 4HEA9 1V3ZA 1KNZA 3CGIA 5B0FA 1ICEB 1HQUA 5E3AA 2UUAF 2HWTA 1VQMS 4P2SA 1ZM4A 1NJZA 2ZUAA 3BYRA 2KJWA 2FVSA 2EK6A 4HT7A 4P6QA 1LW2A 2X3DA 3QSIA 3PW0A 1UWBA 4GO7X 2P5VA 1WDDA 2BJDA 1X4BA 1GFWB 2ACYA 2YPYA 4D3GA 3LP2B 1H73A 5D77A 1IM6A 3L95X 4K4WA 2ZDOA 3LPEA 1X5OA 3N6LA 4OQJA 2DGWA 5DQIA 2XMJA 4X66J 4RPFA 4B9SA 2D41A 2ZDPA 3SCKE 3HLUA 2IYGA 3MM8B 2ZZNA 3HFVA 2RF2A 3DRRB 2ZWPA 4DV5J 1DQ9A 4CZCA 1YSJA 2OIHA 4JI3F 2JC1A 4AL6A 1RZMA 4A8KA 1EIYB 3PRBA 4X65J 3TQEA 3JSMA 1K47A 4RUAA 1KS2A 1TL1B 2MKKA 3CPWR 4C8ZA 5HO4A 1UVMA 4IYQA 2XGQA 3D9BA 4DSJA 2RU3A 2MJNA 3SCJE 5T7LA 1FRKA 5CYQB 1TKXA 4C8NA 1S1XB 1WC3A 3S7RA 1Y5LB 2E5LJ 3NNCA 1JLBB 2QL9B 2L3MA 3OSNA 4RZRA 3ZXWA 5A8WB 5IFMA 4C11B 4QR1A 1RT2A 3DU6A 3NWGA 2CG8A 3FC9A 1XC9A 3PY8A 2LVWA 2M2BA 1VI7A 5EGYA 4KO0B 4YY3F 3T5KA 2V8PA 1SJ4P 3CCJS 3FDSA 3TVZA 4GVLA 4DS5A 3MCSA 2B56A 2VL1A 5A0YA 4C8LA 2Z2ZA 5I3UB 2R3VA 4CTAB 2W7AA 4FS2A 4B9UA 2QO3A 1VIOA 4O44A 1U6FA 1AUSL 2P9GA 1P9YA 4KIAA 1EZZB 3WIUA 2A0FB 2V4JB 4PG5A 1HFEL 1TAQA 2JOQA 3M9OB 3NGRA 5C2GA 2VG7B 4ILMA 4JI6F 4HTIA 5T14A 1N5SA 1FWLA 4FPRA 2CVEA 4EU0A 5KT5A 3PYGA 2V9WA 3D3BJ 4OI2A 1EP4A 3IFEA 5HK4A 4M5JA 4CYUB 5FDLA 2I2YA 5KT3A 1BQMB 3GONA 1S1UA 1QAIA 2WONB 4EO8A 1U2FA 1XMQJ 3DRPB 3Q86A 4LBPA 3K5MA 1IJFB 4WFBQ 2OTJS 3BGUA 3QFWA 3KNAA 3M32A 2VICA 2HAFA 2I0XA 2JVOA 1IKYA 3CCWA 1E6VA 1BD6A 4TVAB 4R8UA 4X4TA 3B82A 3UFCX 1W7WA 4YN3B 2GAHC 3FZ2A 4DF4A 3V4MA 4IDKB 3FBBA 3LP0A 1BUXA 4O4GB 4UUXA 4G1QB 2AX1A 2EI5A 1NJXA 2FC9A 5DM6Q 3IXQA 5F8GA 2UXDF 2G1HA 2W24A 3DU5A 4MIBA 1N4LA 4L6V3 1X9MA 5LT5A 2W9BA 3HX9A 3W61A 3PVXA 2UUAJ 1KTVA 2FLOA 2W25A 3GIMA 2VASA 3ZZTA 3CJ5A 1RKJA 3ZZUA 3UO0A 3OTDA 3B4DA 3ZTQA 1S1VA 3QLHB 1GK8A 5A8RA 4WE1A 1K73T 3TAMB 1S4FA 1UA0A 3QFHA 3GLJA 2DVIA 4PG4A 4DR6F 3R5JB 4LJMA 5CAAA 3MAAA 3DM2B 1LWEB 5G0RB 2AGPA 4CLFA 1UL3A 3M8ZA 1RCOB 3BJYA 2ATLA 3NL0A 3TEGA 4OX8A 5AXNA 5EHHA 4QR2A 2KZZA 2CADA 4ZS6A 3RZAA 4W4MA 2DH9A 2HNYA 3SFUA 5HATA 4ANDA 3TJ8A 3M2VB 4JI3J 2BDPA 1FHTA 1F9EB 2MHEA 1PYSB 3AT1B 2EC2A 4DLEA 2HEKA 2SXLA 3BSOA 2J9DE 5KFFA 6FDRA 3V6DB 4WIIA 3PKYA 3FGVA 1NEEA 2AZ3A 4MK9A 2J7UA 1HNZF 2OO4A 2IMOA 2DNHA 2QN6B 2D3OR 6FD1A 2HQ3A 2QYGA 4YB1P 5D3GA 4N5SA 2M4MA 2G0CA 4BDPA 1X4GA 1T03B 4USJC 2X1AA 1N48A 5D0RA 3G87A 3LP2A 1YJRA 2GNKA 1FKPB 4FDFA 2M52A 2I1RA 3N01A 4YY3J 1U1QA 1P8GA 3FBCA 4OYZA 2GJIA 4PPDA 2W9CA 4AUKA 5M2UA 1TV6B 3GR1A 2R7VA 3OR1B 1YJVA 4NLWA 4Q5VA 1HBOB 2V2ZA 1B4SA 3GG0A 4X4OA 2AF6A 3K5LA 5L39A 2DRAA 2BW2A 3MTJA 1H7WA 2B9WA 5D78A 1R0AA 4EGLA 1WG1A 4JI6J 1S9FA 2XMAA 5BYQA 4ZP6A 2EBGA 3VHQA 3VR1A 2RQKA 3UWTA 2OPRB 3A12A 3P4UB 4M5DA 3ZZYA 5H1SV 3JB9k 4KFBA 3HHKA 2EG1A 1RT4A 3HHDA 4USVA 3IAS9 4KHMA 1JLBA 2V68A 2HHTA 1VHIA 1RHMB 4OI4A 3M4XA 3FEYB 2CQGA 2HYIB 2DT9A 1CS4B 3BKFA 2F4VF 3F0NA 2DO4A 5IM0B 2K3KA 2C2ZB 1VQ7S 3EGVA 2LU1A 2M8HA 1S7HA 1Q4RA 5EX0A 4O0IA 5KTQA 2W2QP 4R0JA 4DL0C 3LPYA 4QYRA 2BOPA 4UF4A 2AQ4A 2UXDJ 2GHPA 2PMZD 5AJ3F 3D67A 3CNQP 1SJ3P 4CO1A 4ZPBA 3MCMA 1ZTTA 1RUSA 2NR0A 1TKDA 2K8GA 5LSRA 2OELA 4GMKA 5CYJA 5E5NA 4CRJA 2H51B 4KKOB 4NCGB 3LAMA 4ZOSA 2HRUA 3W2WB 1QTMA 1IKWB 1M1GA 1RB0A 1RYRA 5KFNA 2QZ8A 1X5SA 3DRPA 3LQVA 1TU0B 4G1PA 2BKOA 4F3OA 1TL7A 4DR6J 1Y7PA 2HRTA 1JB0C 2QL7B 5HBMA 4ZJQA 3ISZA 2HBYB 4QWCA 2CZVC 2FLNA 2XY6A 3D68A 1FKOA 1F2HA 3KK1A 3LGHA 4QWEA 2UVUA 1U09A 5C7PA 5IQ6A 2CQ0A 3CCUS 1U1LA 1MMLA 3C6UA 1MMNA 1S1WB 3AFGA 1LFPA 1YBUA 3G71S 3G86A 5KAKA 3TAQA 2MQMA 1NCLA 2ZH9A 2W8KA 4NEZA 3QAUA 2NPIA 5C24A 2CJAA 2LU2A 1JNZB 3M6WA 1HNZJ 1JLFB 1HBMB 3I96A 1RTHB 3E8OA 2WSEC 4LT6A 2K1RB 3QT6A 4IH5A 5IT9U 1SQEA 2N7YA 2V2VA 1Q5YA 2UUTA 2QGFB 2JHEA 1HMVB 3PJXA 3TAMA 4AQYF 2HSEB 3VAHA 3R3TA 5LJ3Y 2FDNA 1HD0A 2J8SA 2XS7A 2FJAB 3D5MA 3JSYA 2PE8A 3FCHA 2HK2A 1VJQA 4FVMA 1RQ0A 4X62F 2GCFA 1YLXA 2QC3A 4DR4F 1OMSA 1ZZFA 4ECVA 2KHCA 2ASDA 2JLEA 1FFGB 1H38A 3NRBA 1FFWB 5DGBA 5ETTA 4NL5A 1RCXB 2A1BA 3I6PA 2P8IA 3PIPQ 1R8HA 2RQCA 4RW7B 1H2UX 2CPFA 4URGA 3QT8A 4LRDA 1LWCB 1KVJA 1KHWA 5ETNA 2XM3A 4WZQA 4F04B 1ITPA 3D1HA 1TL3A 4U9RA 2AGQA 3MR6A 1S59A 1QJHA 2BW7A 1YDLA 2OSRA 2OPQB 1QTNB 1OPIA 2PC6A 4Z2XA 2VG5A 3EICA 3EGWB 3L7OA 4LF6F 4RNMA 1FRIA 5M2PA 2ATCB 1S9EB 5DLFA 1D9FA 2LP4A 3TZWA 4DPXA 1F2GA 4AYBD 1SV5A 2F4VJ 4O3NA 1TV6A 1FNMA 4I64A 8ATCB 2ZWOA 1JNRB 1C1BB 1QM9A 5EWEA 2MYFA 2IHR1 1EETB 3TWZA 1D8ZA 2YKOA 4LSNA 2Y1JA 5J2NA 5IC4B 1KR4A 2CQCA 2LXIA 3N4WA 3NAHA 3HI9A 4MKBA 3BGFA 1TKZB 4K7QA 4IFYA 5AJ3J 1RU2A 2DK2A 4IG0A 2P9EA 4Q44A 4A8OA 4ETXA 2ZKUA 1CBKA 1VDHA 2V34A 4NLTA 2VH7A 2CPJA 1WEYA 3DFEA 4I69A 5HAOA 4ID8A 2R4FA 4PWDA 1NSAA 4Y2IA 2HZAA 3GSDA 2E5IA 4QPXA 2B5JA 2CJQA 3GB0A 2QEXS 3GE9A 2Y1IA 4WU3A 3DLKB 1K9MT 5E2QA 1PYOB 2PMHA 3D54A 1CS4A 4I56A 4AD6A 2E1MC 3A3OB 2H5IB 3PHTA 2YNGB 1F1BB 1KLNA 2BE2B 5KFIA 2BUNA 1RAJA 1VK8A 1WHVA 4FBTA 2XS5A 4ZMMA 1UETA 2HK3A 3M7VA 3KHLA 2VB6A 2A2DA 4K4TA 1D3WA 3RBDA 1R8PA 1F9HA 1HI8A 1VQ9S 1UVLA 4IR1A 2KYZA 4QU7A 2XY5A 1UJ6A 1RWKB 4Z7CA 3CJKA 3TO8A 2XMKA 4PZVA 1VJWA 5HLFB 2XSJA 2CXEA 1Q7YT 4I0WA 3DDKA 4OFZA 2Y3YA 2KXFA 3LUYA 3CDWA 2FQQB 3R6GB 2P6TA 1FRLA 2VFUA 3AHPA 4BLGA 4DFJA 4AQYJ 4EWTA 2R8JA 2ROEA 2CNLB 3VV2B 4X62J 1IKVB 2JH3A 1LWFB 1L3VA 1YI2S 4DR4J 2CJXB 4UQGA 4FPIA 2LEBA 2E9TA 1BLUA 1JQGA 1NBEB 3H7HB 2MZSA 4WBFA 3GQCA 4ZVHA 3ILIA 3V5RA 3DOMA 3VAIA 2AU0A 5HQ8A 5GMKa 2H4YB 1IWGA 1PILA 1CLFA 2HQFA 2B9XA 3CD6S 5HN0A 2F5GA 2H4WB 1URNA 2Y9HA 1VBZA 5HI7A 2IYIA 1JLAB 1EHWA 2LECA 3G8TA 1RTHA 2I9SA 4PQUB 3M8PB 3GWCA 2XZDB 4OJGA 5CZXA 4N8OA 1UKUA 3P6YC 3MR3A 3MOJB 4LF6J 4ILLA 3HT3A 4ECUA 1WI8A 4B3OB 2R8HA 4WFYA 2OEJA 4OYIA 2R2SA 2KM8C 3KJNB 3AJ2A 5ITHA 3BF4A 3D6HB 3RG6A 1X0FA 1H2VZ 2HMIB 2KFYA 5C42A 2BZ2A 5CYMB 1VQSA 2MTLA 1SXLA 2G0IA 2XLKA 4MKYA 1DAXA 4DR7F 1NK4A 1U6ZA 3FRYA 1H98A 4N56A 3KUHA 1DLOB 2DHHA 4U95A 3MEKA 3I32A 3CE8A 2HFSA 1AZSB 4NLYA 1KTQA 1QAJA 2OMOA 4ZPCA 2R7RA 3TVKA 1W26A 1C4CA 4MFBB 1NK7A 1R8AA 4KT0C 2VF3A 3UDLA 1VRQC 5KG1A 2DR7A 2IIHA 2GQQA 3RJMB 5D4OA 1RT6B 3PEHA 3BKTA 5H9FK 3SDEB 1LXJA 2BACA 2BX6A 4FKYA 2VU5A 4ECYA 4ZVUB 4AE5A 1GTEA 2DHGA 1BE4A 2KU7A 2CQPA 4C48A 1WOPA 1CJTB 3HFZB 4WXOA 3QWPA 2ZE2A 1S1TB 2ILZA 3MPYA 1EQMA 1RT1B 1FERA 2CQ4A 4URSA 2W8LA 3CJTA 2HFVA 2BOAA 3QIPA 4FNIA 5HMZA 4ED2A 1UW4A 3OUYA 4KGMA 4PRFA 2CRLA 1Q16B 2Z2MA 1JLCA 3CCZA 3Q2TC 5HQLA 4YOEA 3IRXA 4C3KA 2PN6A 4JOUA 1NJYA 4OZ2A 2HVDA 3SXLA 1RT5A 1HW8A 5A6WA 3K17A 3IBFB 3OJSA 1R7IA 4ICLB 3UPFA 4KV8B 1S9GA 4YDXA 1V6HA 3DOKA 3PO5A 1FA0A 3W9IA 2F4FA 5KFAA 3TX8A 5JVGQ 3C16B 3LTOA 3UVJB 4EYIB 2G9OA 2FVPA 3HHLB 2JFKA 4PWUA 2ALYB 2CJYB 2F8HA 4B17A 4HHJA 1FRHA 5IWAF 2IA0A 4IQXA 4HTJA 2DR5A 2HLUA 4RBTA 2C2NA 3IWNC 4X4SA 4Y2MA 5SZTA 3FNNA 2YQ3A 3MM7B 5FLXU 4LQ3A 2C3YA 1U1RA 2AKWB 3R5CA 1OYDA 2POKA 4H4MA 1S0VA 3CCSS 3LO3A 1D9DA 5GADU 3M2UA 4K59A 5HLFA 1FDDA 3I82A 5J2MB 3DYAB 4B02A 3PW4A 3CJ3A 2Z58B 2P9CA 5I42A 1AXQA 3J7Z5 3P5TL 4QBUA 4OZ1A 2VJUA 1X60A 3VAKA 2AJQA 4J9SA 4H4OB 4HDGA 2A3JA 3KMQA 3T1HF 5KFZA 2JNJA 3ZZZA 2RUGA 3KLFA 3PX4A 1XR7A 2FC8A 2QLXA 2GFFA 2KT3A 3RW6A 4FXVA 4DL7A 4DUYF 2LDYA 2DR9A 3EUNA 1SI9A 2QIFA 2MMYA 1VIXA 1N0UA 2ZOMA 4NZ0A 4CH0S 1FNXH 3KK2B 5HROA 1K1SA 3D6MB 4WTYA 1IKXA 4QWBA 4DR7J 2D3O1 2F1FA 4M5KA 5DETA 2XWYA 1TMMA 4USIA 1TVRB 1PBAA 4ZP8A 3RRHA 1JXLA 2DITA 2KKHA 5M2RA 1B7FA 2CPYA 1R0CB 3BSAA 4V1Ak 1SH0A 3R97A 4BHQA 3FEXB 4GO5X 1SKRA 1YQHA 4DQIA 3FQKA 2PA3A 1DTQB 3HO1A 2NSCA 1RAIB 4ED3A 2DHXA 1ZOTA 3EDRB 4LR8A 2PI5A 3EDQB 3OL7A 1Z2ZA 1P1TA 1HQEB 2B0GA 5CD4H 2NXJA 2Z4PA 1U0HB 2X3GA 4YB7A 1UPMB 2OPSB 2HMIA 3O1LA 2BJ1A 2RILA 3JQKA 3BQ0A 5LXRA 2RT3A 4U96A 2QYCA 5CYMA 2AX0A 1FK9A 5RUBA 1N34F 1VQYA 2OEKA 3BDEA 3V81A 3M6XA 2G1DA 3KK3B 2M8DB 4DX8H 3S8SA 2R7SA 1FJGF 1FWKA 5KG2A 3F56A 3SEOA 1YJ7A 1F9FA 4J91A 1TTHB 1BWEA 4DX5A 3UD5A 1X9WA 1S6UA 1R31A 2HBZB 4BCAA 4IG3A 1MU2B 3MDFA 3HULA 4O3OA 3MEGA 5J2PB 2DRBA 3GMGA 2VQFF 3QYYA 3I5AA 5CH7B 4PEOA 3BPSP 2XLIA 3QJPA 3SMZA 2ILYA 2ZBPA 2OTLS 3DMJA 1RT6A 4ZVPB 4Y28C 2IDEA 2FPHX 4LRBA 4HKQA 2C3OA 2NSBA 2ADCA 3ENWA 3HVWA 3I0RA 4LF8J 5CCLA 2IM2A 1R27B 3NLCA 1EAYC 4RNFA 1FTCA 3GZ7A 5B0CA 3FCVA 5BR8F 1YK9A 2ROPA 1CJTA 2LXFA 4HI1A 3KJVB 3ONQA 1XMOF 4LFCF 5IWAJ 3ZC4A 3H90A 4DCJB 3VTIA 3BEGB 3TA0A 3PZPA 4ZVFA 2W7OA 3AD9C 2XLJA 4CI0B 4C3MA 4X4NA 2VG6A 1NSPA 2YH0A 1WUUA 5HMXA 3VQSA 1U1OA 4J9VA 2IC3B 4RKUC 1JX4A 2C3MA 3PEJA 5KG5A 4J9OA 2FIUA 2ZJQQ 2IRYA 5DDPC 3NCQA 1X4EA 1O0PA 1V5IB 2X1BA 3F44A 4LUBA 4GVBB 3OXLA 3BB5A 3GV8B 4DSFA 3T1HJ 2VBYA 4RW6B 4KV8A 3MEEB 3O8WA 5F8NA 3W5XA 4HH0A 1ZS6A 4HHUA 2R9LA 4DUYJ 4WU2A 4USMA 4DG1B 1Y11A 3M30B 4WPAA 9ATCB 3K58A 2UXBF 1Z2LA 3E51A 2DRDA 3TI0A 5HP1B 4R5PA 5KT6A 4UW2A 3ZZPA 3JQJA 1Y5IB 1NK9A 3H2UB 1EQ0A 2DGUA 4Z7YA 1T3NA 3GFXA 2W2MP 3H42A 3Q8RB 2QE5A 2PGCA 4DDFA 2J9CA 5B0GA 3MAQA 4WWSA 1ZBTA 1T11A 2OGUA 2XI2A 4K4VA 4DZ6A 1WEXA 4EZ6A 4J9KA 2A6MA 1YJTA 3PYFA 2XZTB 4NZ6A 2DGQA 1OSDA 1RWMB 2RRBA 4NLUA 2ZOFA 5E41A 1VK3A 5DO2A 2RSQA 5KFBA 3QIDA 3PR4A 3WQPA 5DZ6A 3KG4A 4JUZA 3AOCA 1H74A 1JJHA 4AT1B 2ALZA 5EN1A 5CZVA 4DUZF 4CLPA 4LSLB 2OJ3A 4RR5A 1BQNB 2DR6A 2NUHA 1PC5A 2P2CB 1KEKA 3QPIA 3I4HX 2F9DA 5CABA 5C25A 1WHYA 3HD1A 1LW0A 3JYTB 5CHCB 3NGDA 1N34J 5J2QB 1WEZA 1ZPVA 5HVGA 5DM7Q 1N8RT 6AT1B 1RTDA 4ZCMA 1FJGJ 2EEYA 3AXKA 2ZVSA 2BKPA 1WI6A 3PYDA 2EXUA 4JBCA 2EFNA 4XTTA 4NRTA 4NI2A 2ASLA 1U26A 4P73A 5E7OB 1HA1A 3A4TA 5HVHA 4O3QA 1PIEA 2ZH7A 2FVQA 2VQFJ 3UNYA 1MWZA 3CVKA 3RAQA 2NYHA 4DV4F 1NKBA 2BA9A 3H20A 1OJ4A 2B8QA 4WP3A 3AJDA 3OW2R 3SSQA 3J7YI 2Y0SD 2CPDA 3GR0A 1N52B 2XTJP 3EJMA 5LL6d 1VRUB 2VA3A 2XHWA 3CCLS 4USUA 4FP9A 5BR8J 5DGAA 2RKIB 4J9MA 1KDNA 4CNZA 1XMOJ 1SC3B 4LFCJ 2BQUA 5GAHU 3ZTRA 3KNGA 3KG1A 2FLPA 2XYPB 3NG8A 5FLXY 2CZ4A 3WX4A 2RIJA 5G4DA 2A10A 3MUMP 4ED1A 2BJ8A 3MM6B 1Q53A 3Q89A 3UN2A 3RYLA 1IJEB 2COLA 2HNDA 1H2TZ 5K14B 1WC5A 2DH8A 3C6TB 3FSYA 3HHNB 3NWRA 3US5A 1S0NA 4F25A 3M8QB 4I2PB 5KFPA 2V8VA 1SQGA 4YFUA 2YX4A 1KHVA 2FZCB 2BJ7A 1CG2A 3BS9A 4W90B 4QWAA 4ZIWA 2CA9A 3M6UA 4QU6A 4O0NA 3KYLA 1RACB 4D3HA 3A13A 2BABA 1A7GE 4OI6A 2W01A 2UXBJ 1DJ0A 4M5LA 1HPZB 4ZA1A 1G7CB 3IG1A 5KOWA 3PM9A 1T02A 2VZ9A 1WC4A 2PO4A 3UD3P 3DGPB 1HWIA 3R7BB 3CMES 3MPWA 3J7AN 3FZBA 1FWPA 1Y3JA 4UQTA 3MPUB 2HS0A 4DPYA 1KLMA 2HHXA 4NLPA 5HL7Q 3OL8A 2UXCF 3P8BB 3GSIA 4JI2F 3UCGA 1SJRA 1KONA 1HHTP 4OZLA 2KZMA 4M95A 1JLEB 3KWMA 4IO9Q 1JJCB 2G2OA 3IS9A 1DBDA 1DTTA 3G82A 2MKSA 5DLGA 1RAOA 1HKAA 2Y8WA 2E1RA 4GC6A 1H6KX 4WF9Q 3CO9A 4C3LA 4FYDA 2XO7A 1X5PA 4DUZJ 2UV8G 2DJWA 3HVTB 3FEZA 3DRSB 4DG1A 3UR0A 3M30A 4L72B 1NXIA 1SIWB 2KYXA 3PW7A 2JL9A 4DBQA 4N77A 2E7XA 5DDOC 2QJ3A 3A8EA 3GILA 4K50A 5L1KA 1DFDA 5H9FJ 2CQHA 3S6EA 1U1KA 2LMIA 2AEMA 4OL8A 1RTJB 1S4EA 2OHDA 4ELVA 2ZHBA 1R6VA 3DXSX 3J7ZT 3O5TB 1FF2A 3R1HA 3RAMA 1AFIA 1D0EA 2OLWA 2F8EX 1RYSA 1NB7A 3RBZA 3KUEA 4DV4J 2HQGA 4J37A 4L3NA 1I3OB 1CJUA 4ES3A 2JEGA 4HDHA 3ZZ0A 4LQ9A 4V19X 1HBUA 4X4RA 4M5GA 1NKEA 2QLWA 1NDKA 1T05A 1SUQB 4XPEA 3FBEA 2DIUA 3GV7B 1Y3KA 5KG0A 2W9AA 1B7YB 1IBLF 2BKNA 2LFVA 5KFYA 3JTNA 3F41A 8AT1B 4F4XA 1ACMB 3LGMA 3C14B 2NXUA 3OHBA 1LV5A 1SKSA 2VFRA 1JKHA 3JTOA 1C2PA 2AJ1A 2RQMA 1J5OA 4Y65A 3UD4P 3GFZA 4OYXA 1MSWD 3HSGA 4B9LA 1S6PB 1WC1A 5KFHA 3UCZP 5L1IA 5AXKA 1VQOS 3TYTA 3G6ES 1HQUB 3NGSA 2HHSA 3T1YF 1ZA2B 4EZ9A 3POTA 2JDJA 3MCNA 2Q79A 5MAOA 2CIMA 2WB1D 1UWBB 3O6QA 4LF2A 3E2EA 4P7TA 2HS3A 1NLKL 3VZIA 2A2CA 2HAIA 2MQPA 4I4BA 4OLPA 1OY9A 2CPHA 3I55S 5AE3A 3M8RA 2HQCA 3T19A 4MAKA 2ZZMA 1QSYA 4A8MP 3SCIE 3Q8QB 3QBCA 5D0HA 3K8WA 4I68A 1IM4A 1RA6A 2VPWB 1S6QA 1TFYA 4CP5A 2PD1A 5A8KA 3ZZRA 1F5AA 2MY8A 5B0DA 4DU7A 3PXGa 2FJXA 2RF2B 2XEXA 3CCMS 4EFAC 2UXCJ 3CD0A 2VUGA 3G4SS 1VHFA 3IR5B 4Y34A 3M6VA 4JI2J 3JSMB 3M8QA 2V8DA 3W5ZA 2U2FA 5GAGI 2DNMA 5GAEU 2B6AA 2IMWP 1CULA 1GT8A 4LIWA 2V2KA 1AT1B 5T7LB 1D9AA 5E0OA 3KG0A 4ILRA 1TKXB 4NWBA 2VPXB 3PKMA 3BKUA 3A8JA 3HM9A 2CQBA 2QTWA 1Q78A 1VBYA 3GYNA 1QAXA 1S72S 1HLWA 4GC7A 1RT2B 4L76A 3NAIA 3SV4A 4DQQA 2OD4A 3HD2A 2G0JA 2EPIA 2DH7A 2D69A 4CLLA 4AL7A 5F0WA 3QGGA 5A0YB 3ZO7A 2HZVA 3LGNA 2ZITA 2EFQA 2JVRA 2YKNA 2QA4S 1DHMA 4LRFA 4M5NA 4UY85 3NOCA 3RW7A 2J0QD 5BJRA 2DGOA 5F3TA 2CUYA 3OLBA 4YR3A 4P9SA 1FD8A 1NM2A 2DXEA 2BYCA 4WJBA 1FJCA 4L3KA 5B0EA 2B51A 5KOXA 1DZ5A 4EBEA 1UTAA 3Q83A 5BYRA 5A2QU 3U1LA 4V19J 3KTQA 2CPEA 1EP4B 3IM9A 2E9ZA 2FGOA 2NZCA 4OV1A 1I94F 2RDJA 4K4ZA 2G2YA 1IWAA 2AJFE 5FDLB 3HVRA 1IBLJ 1S1UB 3L4BC 1J27A 1EKRA 2YKMA 3RR7A 5K5MA 4F3QA 2EK1A 3CIZA 1X7VA 7FDRA 3M32B 4JV5F 5GAHI 1E6VB 1FDBA 1N88A 1UVJA 2HVIA 4R8UB 1SVDA 3AOAA 3MPDA 2OFGX 1RTIA 2D9OA 2R2RA 4C0HA 2EWHA 4CLKA 1H3DA 2FJDB 2I38A 1K1QA 4OYMA 2CDQA 4DN0A 1OYEA 2F3JA 3PYEA 4AL5A 4U8YA 5KFVA 3MMJA 4K4XA 2W9BB 2HVZA 4TYAA 4PABA 4DL2A 4RNHA 3T1YJ 3HKZD 4DLGA 2AGOA 2NYIA 4F0KA 4R0EA 3OFHA 2GQCA 3RTVA 3NKYA 1HYSA 2JZ5A 4YB6A 2MQOA 4Y00A 4J90A 2MQ8A 1KSPA 5E3CA 1GX6A 4WE1B 3BBCA 5A8RB 1AW0A 1G3OA 3EZUA 4P2FA 5KFMA 4OIXA 2HGNA 3D0IE 1KC8T 5KFXA 3UDCA 2F40A 3MAAB 3OL6A 3TUIC 1NJWA 4DN9A 2GIRA 3OFFA 5ETRA 3VQTA 4UT4A 1GTHA 5KT4A 3KLVA 2A6OA 3TEHB 4DQSA 3IGNA 2PFDA 3PRVA 2HNYB 4ECQA 4XAKA 2IM0A 4WKRA 1OQ3A 3BV8A 2RDIA 1REVA 4A47A 1GXLA 1RWNB 1PAUB 3NBPB 1XNQF 1JLQA 3OR2A 1XEZA 4RUHA 2DEJA 2BANA 1KFDA 3SQGA 3LH2S 1KQKA 2CNKB 4FYVB 1CJVA 3CUNA 1WF1A 1YG0A 3NP5A 1F3FA 4EEYA 2YNHA 1OSCA 4ZITA 5CD4A 2QL5B 2RD5C 3K8VA 4IH7A 3T1AA 4IUFA 5D3GB 1Q82T 3AODA 1X8DA 2ZJRQ 1TK8A 4EMDA 4EO6A 1NHUA 4JI4F 2HHUA 2DNZA 8RUCA 3R7NB 3DLEA 2VFTA 1TQLA 3QT5A 4ECZA 4QJVA 2W9CB 4XK8C 1GMWA 3QJLA 1B0TA 2E5HA 2V0NA 3R2DJ 3HVAA 1N36J 4PYAA 3CF5Q 2RRNA 1NK0A 1R0AB 3KLEB 3RUBL 1RP5A 4M8LA 4DCPB 4YMEA 2N4DA 5KT7A 2DGVA 3IP0A 2F8MA 4DQPA 3I5CA 1KRPA 5GMEA 4M5DB 2WW8A 1RT3B 1LNQA 3BN4A 2A18A 3VZHA 2J8AA 2MHNA 4KFBB 1I94J 2B4VA 1RT4B 2MKJA 2XY7A 1WG5A 1VR6A 2QFIA 4A8YA 4XPCA 1Y00A 4IRKA 1NPKA 2DKOB 2OEMA 3AOBA 3KJFB 4LIRA 2JWNA 4JV5J 3AA8A 3QO9B 2HGMA 5D15A 1X4DA 1HIYA 2DPIA 1HBNB 1RKIA 3X1LB 1N5TA 3FKBA 4USTA 1XERA 3PACA 1M0SA 5AXLA 4QIEA 3PW5A 2C3PA 4LR7A 3QAEA 5K8OA 5L1JA 4ED4A 2XULA 3I0SA 3P96A 3NMAA 4QPTA 4LR9A 1NUEA 5DDRC 1KFSA 2KL8A 2MZ1A 3D28A 3G96A 1NZ8A 4ZLJA 1OY8A 1U1MA 3MOZA 3PRDA 2G4BA 2ZUGA 1R89A 4MIWA 2H48B 1ZA1B 4B3TF 1T9YA 2GW8A 2UV8A 3LP1A 3KMSA 3R1LA 3SBMA 4ZHRA 4KPYA 4KGZB 5K20B 3D1OA 1XBWA 1Q0NA 1FESA 4NEYA 1TL7B 3C15A 3MFIA 2O66A 3QRPA 2KH9A 3R9LA 5HBMB 3BBBA 1Y4ZB 3DLLQ 3CMQA 4DPUA 3ZTSA 2K7JA 3NNAA 1FKOB 1RGVA 3KK1B 3PNIA 5I3QA 3MGJA 1ZZNA 2QRRA 4OI1A 2KDOA 2YNIB 4K8RA 2HRYA 5F41A 1NNDA 2PEHA 3C6UB 2DY9A 2D74B 2V94A 5F8JA 2X1GA 5AE2A 2ZH1A 2HFNA 1S48A 2NXNA 4HH1A 1AA1B 4WCEQ 2XCPA 1XNQJ 3MD3A 1VQ4S 1QUVA 5C24B 5GAEI 3M2RA 3CXCR 4F4KA 4HVZA 2DNRA 3QRQA 3KXDA 5IXUA 3SSRA 1YVFA 2WK4A 2LDIA 2AYEA 2XCAA 2DGXA 2I8EA 3CWJA 5L1LA 3W2VA 5AE1A 4RU2A 5ETQA 3PIOQ 3MR7A 2ZD1B 2V50A 4JI4J 3CDEA 2HHWA 1G6BA 5HMYA 1S77D 1M1KT 2MZQA 1NSKL 4RX6A 2H5EA 4A8SA 1SJFA 3KOAA 4J9PA 1WACA 1UWAA 1YBAA 4Q45A 3MHYA 1VYAA 4KGXB 2J9EA 1WHXA 4RW9A 3HKWA 2FHKA 4LF5F 5HQMA 4IRDA 3PW2A 1UA1A 3W5YA 4PXDA 3B4MA 4ID5A 5DRKA 3BH7B 3NBPA 4NLVA 5A2QY 3EYZA 3D4JA 1TL3B 3EX7B 1WKLA 3QT7A 1GH8A 1NPPA 4QYZJ 1T7PA 1S76D 4ALZA 2MZTA 3N28A 3MWBA 2VG5B 4B3RF 4KY3A 4C0BA 4MJKA 1RWPB 4ERDA 1TL5A 4Q0BA 2D3UA 3R2CJ 4OX7A 3W9JA 4TLQA 4O4RA 3LWMA 4FS1A 1RWOB 1TELA 3SSSA 2C2DA 1M5PC 1WNEA 2ZH5A 1OY6A 4M94A 2N3LA 1SV5B 2LLZA 3SQOP 4OV6A 5L38A 4DUTA 1SC1B 1MG7A 3IBCB 3BGLA 4ANEA 4LSNB 2GX8A 5J2NB 2WZ1A 2B4OA 3GIRA 3OLAA 3FFIA 4RWXA 4WYWA 3FCWA 4UZBA 4KRWA 1JMTA 4IFYB 3GIIA 3TX0A 3KLEA 2AYMA 3DRYA 2MKIA 4IG0B 1AYEA 4TYBA 3MTKA 3Q8PB 2MJUA 5B08A 1RT3A 3GTYX 3IGVA 5F9NA 1UJ5A 3GCXP 3L09A 4KQZA 4PWDB 1FXDA 4B3TJ 2BVZA 2B5JB 2OH2A 4FF2A 3MM5A 3K7RA 5LSOA 2UUWA 2Z57B 5I3PA 1V9OA 3NS6A 5EWFA 1WTBA 5FD1A 5E3PA 2I6WA 3O3LA 2KG1A 3QO9A 4L75A 3LAKA 2IAJB 2ADBA 1HBNA 2XMVA 2DPJA 1VS3A 1EB0A 1RT7B 1QE1A 1NAQA 1W25A 4PXCA 1BHNA 4U67Q 3EPGA 3DGVA 1F5BA 2R7OA 4NYZA 3CD7A 4PG6A 2C42A 4WXWA 4ECRA 2H3EB 2GMLA 2BM0A 1Q8BA 4EYHB 1SC6A 5ADZA 2KVIA 1L3UA 1BMQB 1QAYA 1X5TA 4ECXA 2GJ2A 3ITHA 4BC9A 1YKWA 2DNQA 5L8RC 1Q8KA 2PA8D 1MROA 2J6SA 1Y10A 5IV3A 7AT1B 2N82B 1M5SA 3CJKB 1UVNA 4F02A 2CQ2A 2XSJB 2WHOA 3NCPA 2H9ZA 2DNGA 4A48A 2M88A 2WOMB 2RB7A 4NXNF 1RXOB 4DL6A 1UP1A 2WRMA 2XMTA 4C8KA 1XN9A 4DV1F 3ILOA 3UQSA 2DY1A 2OPPB 2E7WA 2FJVA 1H7XA 2QA1A 1R6YA 1NJIT 3AQOA 3V4IB 2RNEA 4FZVA 2FVRA 4IFVB 1F0XA 2RS2A 4DL5A 4WFZA 2AJ2A 1K0VA 3T3FA 3CO0P 3DLGA 1JLGA 1KP6A 2MQNA 1GNKA 3DOMB 2DO0A 2YNIA 3ENAA 4LF5J 2F65A 4HR2A 5HMWA 3Q8UA 2Q1LA 3IWLA 5K9FA 2KI2A 2ROGA 3C19A 2V8GA 4UZCA 4P52A 2GVDA 4WZMA 3QZ8A 4Q7AA 1YX2A 3NS5A 2DNOA 3DDNA 3MECA 5KFDA 2BE9B 5ETVA 5EUHA 2QMWA 2ZH3A 3JSBA 4B3RJ 1N5YA 3HZEA 3KHRA 1CQNA 4RUCA 4NLOA 1Q86T 2ZD1A 4HLBA 1VGYA 1WKKA 3ET6A 1IXKA 5F3ZA 2FY8A 4F4ZA 4WK3A 4QIFA
chains in the Genus database with same CATH topology
1NPKA 3B54A 1HLWA 3EJMA 5IOLA 1ZS6A 3ZTQA 5BXIA 1K44A 4EK2A 3R9LA 1PKUA 3BBBA 3ETMA 1NSKL 3FBFA 1HHQA 1S57A 2BX6A 1BHNA 4FKYA 2DYAA 2VU5A 4DUTA 4ENOA 1UCNA 1HIYA 2HVEA 1KDNA 3FCVA 5CABA 3ZTSA 1BE4A 3Q8YA 3Q86A 3GP9A 3FKBA 3ZTRA 3MPDA 4FKXA 4ANEA 1NB2A 1NSQA 3FC9A 3NGTA 1VYAA 5CAAA 3ENAA 3EVOA 3DDIA 3EE3A 3EVMA 1LWXA 4HR2A 3L7UA 1NHKL 3PRVA 2HURA 3Q8UA 4CP5A 2DXFA 2CWKA 3FBCA 4WBFA 3VGSA 4ANCA 3WX8A 1MN9A 3VGVA 1NDLA 2DXDA 2DY9A 4KPCA 1B99A 3FCWA 3EMTA 3NGUA 1W7WA 1NDCA 4C6AA 1NUEA 3BH7B 2B8PA 3Q89A 1PAEX 5C7PA 2AZ1A 3GPAA 3FBBA 1NSPA 4O0NA 1BUXA 1B4SA 4ANDA 3ZTPA 4DI6A 2DXEA 1WKLA 3VGTA 3EVWA 4DZ6A 1XIQA 4UOFA 1LEOA 4S0MA 3ELHA 3NGSA 4F36A 1XQIA 1F6TA 1EHWA 1S5ZA 3Q83A 3VGUA 1MN7A 4UOHA 3NGRA 2BEFA 3VVTA 1NCLA 3B6BA 1S59A 1F3FA 1U8WA 3ZTOA 3BBFA 3Q8VA 3DKDA 1JXVA 2B8QA 2HVDA 2AZ3A 3JS9A 3VVUA 3BBCA 1NDPA 4UOGA 3EM1A 2ZUAA 3BH6B 1NLKL 1WKKA 4F4AA 3EICA 3PJ9A 3G2XA 1NDKA 4W98A 3FBEA 1WKJA 2NCKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPK A;  3B54 A;  1HLW A;  3EJM A;  5IOL A;  1ZS6 A;  3ZTQ A;  5BXI A;  1K44 A;  4EK2 A;  3R9L A;  1PKU A;  3BBB A;  3ETM A;  1NSK L;  3FBF A;  1HHQ A;  1S57 A;  2BX6 A;  1BHN A;  4FKY A;  2DYA A;  2VU5 A;  4DUT A;  4ENO A;  1UCN A;  1HIY A;  2HVE A;  1KDN A;  3FCV A;  5CAB A;  3ZTS A;  1BE4 A;  3Q8Y A;  3Q86 A;  3GP9 A;  3FKB A;  3ZTR A;  3MPD A;  4FKX A;  4ANE A;  1NB2 A;  1NSQ A;  3FC9 A;  3NGT A;  1VYA A;  5CAA A;  3ENA A;  3EVO A;  3DDI A;  3EE3 A;  3EVM A;  1LWX A;  4HR2 A;  3L7U A;  1NHK L;  3PRV A;  2HUR A;  3Q8U A;  4CP5 A;  2DXF A;  2CWK A;  3FBC A;  4WBF A;  3VGS A;  4ANC A;  3WX8 A;  1MN9 A;  3VGV A;  1NDL A;  2DXD A;  2DY9 A;  4KPC A;  1B99 A;  3FCW A;  3EMT A;  3NGU A;  1W7W A;  1NDC A;  4C6A A;  1NUE A;  3BH7 B;  2B8P A;  3Q89 A;  1PAE X;  5C7P A;  2AZ1 A;  3GPA A;  3FBB A;  1NSP A;  4O0N A;  1BUX A;  1B4S A;  4AND A;  3ZTP A;  4DI6 A;  2DXE A;  1WKL A;  3VGT A;  3EVW A;  4DZ6 A;  1XIQ A;  4UOF A;  1LEO A;  4S0M A;  3ELH A;  3NGS A;  4F36 A;  1XQI A;  1F6T A;  1EHW A;  1S5Z A;  3Q83 A;  3VGU A;  1MN7 A;  4UOH A;  3NGR A;  2BEF A;  3VVT A;  1NCL A;  3B6B A;  1S59 A;  1F3F A;  1U8W A;  3ZTO A;  3BBF A;  3Q8V A;  3DKD A;  1JXV A;  2B8Q A;  2HVD A;  2AZ3 A;  3JS9 A;  3VVU A;  3BBC A;  1NDP A;  4UOG A;  3EM1 A;  2ZUA A;  3BH6 B;  1NLK L;  1WKK A;  4F4A A;  3EIC A;  3PJ9 A;  3G2X A;  1NDK A;  4W98 A;  3FBE A;  1WKJ A;  2NCK L; 
#chains in the Genus database with same CATH topology
 1TAU A;  4H54 A;  1VFJ A;  1K44 A;  3CCE S;  5C42 B;  1EJ7 L;  2JLF A;  5D0G A;  4UOC A;  3DLB A;  1WSR A;  3RGI A;  4TU8 A;  3SI8 A;  3QWU A;  5EWG A;  4Y2A A;  2C22 A;  4YUD A;  1VRT A;  4F4W A;  3DI6 A;  3W60 A;  3UDV A;  5B09 A;  2CJ9 A;  1ZM3 A;  3W9H A;  5I4M A;  2FZG B;  3C46 A;  2DCL A;  3TJ9 A;  5KFT A;  3RB4 A;  4KTQ A;  1JK9 B;  4M5H A;  2RQ4 A;  5J1E B;  2MKH A;  1G4C A;  2YNF A;  4CO5 A;  4LFA F;  3NCR A;  3CTR A;  2IVY A;  3HT0 A;  3VVT A;  2J0X A;  4RBU A;  1U47 A;  4I6A A;  9RUB A;  4FVC A;  4XO0 A;  3CDU A;  4NLX A;  1U8W A;  3LA0 A;  3BBF A;  1BGX T;  1ZYQ A;  1YIT S;  4ZIV A;  2DNN A;  2R8G A;  1TL4 A;  2DIS A;  4OX6 A;  2HIY A;  1XJW B;  1UPP A;  3GFH A;  1QLN A;  2C3U A;  1DAR A;  1KKH A;  3JTP A;  3L7P A;  2YWK A;  3HSD A;  3CJ8 A;  4I7F A;  3BN7 A;  2ZE2 B;  1BXN A;  2MLX A;  3OPK A;  4K2X A;  4ZJL A;  3GJR B;  1X4H A;  4B9T A;  1XTZ A;  3QIP B;  3MMC A;  4NZ7 A;  3UN3 A;  2J0W A;  4EI2 A;  3BR8 A;  1RAE B;  3JQM A;  1VC5 A;  1JJ4 A;  1HR0 F;  3OUY B;  5F9L A;  2PFF B;  2V67 A;  2B7B B;  3TW0 A;  3F73 A;  4BC7 A;  1Q79 A;  4CLS A;  3MZI A;  1RHR B;  3FUY A;  2EFG A;  3BGR A;  1JLC B;  1D8Y A;  2AZ1 A;  1CQM A;  3IO1 A;  3IRX B;  1T9X A;  1RAD B;  2YWE A;  3TJA A;  3T9Z A;  1UFL A;  2MEW A;  1ZTW A;  2MY7 A;  2UVR A;  1Z4U A;  4ZVQ B;  1VMB A;  1IBK F;  1RT5 B;  1RBO B;  4NXN J;  3KLI B;  3KUG A;  3ZTO A;  4DV1 J;  1S9G B;  1E6Y B;  3DOK B;  2VBZ A;  4ECW A;  2IAJ A;  3HP6 A;  1B0P A;  1RT7 A;  5IOL A;  4FNH A;  2ZH8 A;  4CDI A;  4UTG A;  1M5K C;  4RW8 B;  1VQ8 S;  2VOD A;  2RHS B;  4DSI A;  3R6L B;  2LQ9 A;  4TN2 A;  4P2X A;  2CNN B;  2ZEJ A;  3NGT A;  2R7T A;  2K06 A;  2PMW A;  2FJW A;  2RJZ A;  5K8N A;  2H54 B;  4NLQ A;  3BO4 A;  3QJJ A;  4PUO A;  3NXZ A;  1R8B A;  2IPO B;  4CLU A;  4H4M B;  3IMQ J;  4DV0 F;  3HCX A;  2B3T B;  3A8I A;  5KG3 A;  1A6L A;  2FUG 9;  3G9C A;  2GHW A;  2VFV A;  3M2U B;  3WC0 A;  4NLS A;  1LXN A;  3UN5 A;  1IR2 A;  1QD1 A;  2Z2Y B;  5I42 B;  5JMN A;  2WOM A;  4YR0 A;  1QVF R;  2CQD A;  1PCA A;  3QRR A;  4DV7 F;  1PSD A;  2V8H A;  3B78 A;  3MM9 A;  4ED5 A;  1FO1 A;  4CM2 A;  1C0T A;  1MLA A;  3UE2 A;  3KLF B;  1G1X A;  1VBK A;  1LK5 A;  3DKD A;  2OPP A;  4P72 A;  2C2O B;  2LQ5 A;  3W8P A;  3CC4 S;  5EDW A;  3HSZ A;  2N4C A;  1UFW A;  1U02 A;  3IC1 A;  3PJ9 A;  4TU7 A;  2L41 A;  2MGZ A;  3V4I A;  4IFV A;  2GS8 A;  4TXS A;  7FD1 A;  1X4C A;  1VQ5 S;  4DCO B;  2WVD A;  1D1U A;  3TZY A;  4X4P A;  3HDS A;  4YEA A;  2HNZ A;  1HL6 A;  1S57 A;  3OXG A;  1RHJ B;  5HRO B;  2JLG A;  2E66 A;  4E98 A;  4X2B A;  2XSF A;  1IKX B;  4USH A;  1VLY A;  2GC8 A;  1RK8 A;  3KLG A;  4P10 A;  3EPI A;  3X3U A;  5K8M A;  3C3L A;  2YWH A;  1ZM9 A;  4PAA A;  5C2C A;  4F0M A;  3DNC A;  4OHW A;  4DJB A;  4LFA J;  4HAC B;  3U27 A;  3CCR S;  4KAI A;  4MYU A;  4ELU A;  2CPZ A;  5L9X A;  5KFC A;  3KKF A;  3CC7 S;  1PJ7 A;  2HFZ A;  1QUP A;  3ZNJ 1;  4IH6 A;  1FE0 A;  4CO2 A;  3DRX A;  2YKA A;  5HJX A;  5BXI A;  3I5B A;  4J9R A;  3NGK A;  2GJF A;  2QV6 A;  2KG0 A;  1M5O C;  1APS A;  2W4C A;  1FK9 B;  1HNV A;  5E33 A;  2LKZ A;  1VQN S;  2E7V A;  5ETS A;  1MWQ A;  2AWZ A;  3V81 B;  2RML A;  4TY8 A;  4I1T A;  3OQ2 A;  3LWL A;  3KHG A;  1X9S A;  2Q6C A;  1REG X;  3T5H A;  1HR0 J;  2DXF A;  1S7I A;  3MED A;  2L9D A;  4K4U A;  1K0T A;  2N3O A;  4A46 A;  2FHJ D;  5J1E A;  2EKY A;  1FXR A;  1NH7 A;  2BE7 D;  1UFK A;  4Y2K A;  4IG3 B;  2HQD A;  1PJ6 A;  3MEG B;  2VV5 A;  4IKA A;  3WDO A;  3T9N A;  3CJ0 A;  1FDA A;  1KOH A;  4ES1 A;  2H1Y A;  4A8X A;  1IBK J;  3J81 Y;  3R5D A;  3DMJ B;  1CJK A;  2D1C A;  4Y0F A;  2BEF A;  4ZCI A;  1SCJ B;  1SBR A;  1TKT A;  3I0R B;  1HNW F;  4WYL A;  2PEB A;  4XDC A;  2HBR B;  4K4S A;  2D9P A;  4ZCL A;  4L73 A;  1ZM2 A;  4U7U D;  2VQE F;  2DHA A;  2ZBI A;  2J6T A;  1GMW D;  3VAJ A;  2C2E A;  2AIR B;  4I6W A;  3N6N A;  1KWM A;  4Y3C A;  2ZBQ A;  2N7C A;  4DL4 A;  1C0U A;  3OFE A;  2GGP A;  3ADA C;  1SQF A;  3K0J A;  2VG6 B;  2FB0 A;  3E01 A;  5IS2 A;  4DV0 J;  3ENQ A;  4B3S J;  2AEJ A;  2YTC A;  2FVC A;  4ED0 A;  1U8S A;  3M8Y A;  2HHH F;  2V9K A;  3HHL D;  4X84 A;  2C28 A;  1AB8 A;  1Q81 T;  4ELT A;  3OTO F;  4ZPA A;  2B4P A;  1SH3 A;  3W3S A;  3BZQ A;  3MUR P;  2WVF A;  3ELH A;  3KLI A;  4DV7 J;  1NU4 A;  2W1B A;  4K0K F;  1AFJ A;  3J7Y U;  1E6Y A;  2PDA A;  3P3D A;  3THT A;  4LF8 F;  1FEH A;  2LYV A;  4OLO A;  4LVN P;  3IM8 A;  2M3D A;  4H4K C;  5IC6 B;  2RE1 A;  1KQG B;  4OHY A;  3R5G A;  2I5J A;  4ZPV R;  4RW8 A;  4R5P B;  3AAW B;  3ISN C;  2GVZ A;  3OHA A;  3DOL A;  1L5U A;  2QA4 G;  3OVS A;  4C7Q A;  3TUJ C;  1HI0 P;  3S1T A;  1I51 B;  2DD8 S;  4JI5 F;  2D7S A;  4KH0 B;  3VGS A;  4DR5 F;  1Q95 G;  3OTE A;  3BM7 A;  2LA6 A;  3EZO A;  3CCV S;  2D3Z A;  2QG9 B;  1FTR A;  5H9E K;  3MMA A;  2MLZ A;  1FX2 A;  2ZOG A;  3ZTP A;  4JI0 F;  2VON A;  4Q43 A;  2KT5 A;  4N47 A;  5ETK A;  3PFE A;  3RR8 A;  4PCQ A;  1S6O A;  3KLH A;  2PSZ A;  3EGZ A;  5HSP A;  5KFJ A;  4CT8 A;  3FSI A;  2MZJ A;  4OHZ A;  4F2R A;  3MPV A;  2M0G B;  1VC6 A;  2R2T A;  4N41 A;  4KGV B;  5JJB A;  2M7S A;  2CJK A;  2X7I A;  5C25 B;  1YBT A;  4CH1 A;  4JV0 A;  1YJW S;  1LW0 B;  2CZ9 A;  3R5A A;  5FJ4 A;  2Z30 B;  1J2V A;  1D09 B;  3JAM Y;  1ZPW X;  4DFK A;  2AP6 A;  5KFE A;  4E2F B;  1FRM A;  3CD5 A;  1RTD B;  2HKE A;  3L9Z A;  4DR3 F;  2KM8 B;  1KOO A;  2YWG A;  3GIK A;  1U6B A;  4P74 A;  5KFG A;  2HWH A;  1OIA A;  5L46 A;  3H4D A;  2ZJP Q;  3W7B A;  4NI2 B;  2NUU G;  5F8I A;  2XWX A;  1XR6 A;  1NDC A;  3K5P A;  3SV3 A;  4HAC A;  4X64 F;  5DS7 A;  3OV7 A;  1FFS B;  3BYP A;  4MK7 A;  4ZLN A;  3G6X A;  2HW3 A;  1XQI A;  1H0H B;  1MMD A;  3MM8 A;  2UVW A;  2OKQ A;  1EKS A;  4J7C A;  1HNW J;  3DRR A;  2RU9 A;  2OP5 A;  5LM7 E;  3I9Z A;  1B70 B;  3CC2 S;  3M9N B;  1GEH A;  2E5J A;  1M1H A;  2RH3 A;  2FGC A;  1WC0 A;  2J0S D;  2LXU A;  2KB2 A;  2VQE J;  1TL1 A;  1PC4 A;  2APO A;  3ETM A;  4PYD A;  1TR0 A;  4ZVO B;  2CNO B;  2EFP A;  4C8O A;  5CYQ A;  4M5I A;  2J7K A;  1S1X A;  5U47 A;  5KFL A;  5LMN F;  4A8W A;  5GVQ A;  1RAG B;  1NK6 A;  3TR5 A;  3O44 A;  4BBY A;  1O51 A;  1PYT A;  1N6Q B;  5A8W A;  2CWK A;  4C11 A;  3MUT P;  4RW4 B;  1F60 B;  1RAB B;  4Z37 A;  2HND B;  2UU9 F;  2HHH J;  1S10 A;  4OZ0 A;  3OTO J;  4KO0 A;  3PTW A;  2AD9 A;  1RDR A;  1FEE A;  2DCU B;  4ZP9 A;  1LEO A;  2XBP A;  4K0K J;  2IM1 A;  5I3U A;  2J7W A;  3ZFV A;  4CTA A;  4F36 A;  1KVI A;  2WBM A;  1HWU A;  4ZN1 A;  1YJU A;  2DNP A;  4OYW A;  2V4Q A;  2HFO A;  1WWH A;  2V4J A;  4MIA A;  3GJT B;  3PX0 A;  1S49 A;  4JI8 F;  3PV8 A;  2WCX A;  2L08 A;  3GFY A;  3QQC D;  4FYX B;  2ZBR A;  3QAT A;  3BQ1 A;  1CSJ A;  1H72 C;  2H5J B;  4PG7 A;  2WSC C;  2VG7 A;  3HJF A;  2EFV A;  3IG1 B;  3PHE A;  1SKU B;  1X0P A;  2KHD A;  5THW A;  4HL9 A;  4J5O A;  3OL9 A;  3CJ4 A;  4ENO A;  2XQC A;  3V6K A;  4YDD B;  2XMW A;  3S01 A;  2KT2 A;  2HWI A;  2C2R A;  2NRE A;  4CYU A;  2Y1L B;  1LQ9 A;  2XHC A;  4JI5 J;  2LEA A;  1G2E A;  4PXB A;  2XMM A;  1KLM B;  2HFU A;  1BQM A;  4KGK A;  4DR5 J;  2WON A;  3SCL E;  4ANC A;  1U0S A;  1MN9 A;  4OJ1 A;  4Y2C A;  3TA2 A;  2YVS A;  4GRS A;  4KPC A;  4OX9 F;  2IJN A;  4QIW D;  3HSJ A;  1HNI B;  2BV3 A;  1S97 A;  4CLW A;  2B7C B;  4JI0 J;  4JYA F;  3IS9 B;  5K8P A;  1DTT B;  4RLE A;  3G82 B;  2CAJ A;  2MPU A;  3VAG A;  4IDK A;  4FF3 A;  4O4G A;  3PR5 B;  4G1Q A;  3VWS A;  3K59 A;  2FYX A;  1UAW A;  4JV2 A;  3GJS B;  5ETL A;  4ZVR B;  4OJH A;  4RUB A;  3LAN A;  2CJB A;  1R3N A;  3P5B P;  5AXM A;  1C1C B;  1VC0 A;  1O5J A;  4JI1 F;  2IA6 A;  3OTC A;  2MQL A;  3IR7 B;  1UW9 A;  2RHQ B;  3OXF A;  2VIH A;  2V6A A;  1BC6 A;  3FMW A;  2KJV A;  3HMJ G;  3ZNU A;  3K57 A;  4NLR A;  2Q66 A;  1RIS A;  1RWU A;  1SJQ A;  4B9M A;  5F0U A;  1FRX A;  4C0O C;  4DR3 J;  4TY9 A;  3QLH A;  2EC0 A;  2GMJ A;  3P49 B;  4O3S A;  4FXD A;  3C8Y A;  4LRE A;  3NS7 B;  1U48 A;  4N76 A;  3M1V B;  4LF9 F;  1FT8 A;  4AFF A;  1K8A T;  1T9U A;  3DM2 A;  1LWE A;  5G0R A;  2ZC3 A;  4X64 J;  1S0M A;  1NO8 A;  3W64 A;  4DFM A;  5GAG U;  4DI6 A;  3AH6 A;  1CJU B;  4KC5 A;  3H2L A;  4P7V A;  3GIJ A;  1M5V C;  2EG2 A;  3CJ2 A;  1HBU B;  2OI2 A;  2GA7 A;  2GHV C;  2M9K A;  1T9V A;  5IV4 A;  4IOC Q;  3M2V A;  1U45 A;  1T05 B;  1GXU A;  2Q43 A;  4WP9 A;  1JXV A;  5B0B A;  1DUR A;  2KN4 A;  2V69 A;  2EKN A;  4DQR A;  3GYX B;  2HHV A;  4PR6 A;  1WKJ A;  1BWV A;  3V6D A;  5E3R A;  1U2R A;  3R5B A;  1I6J A;  2IVF B;  1HHQ A;  2MB0 B;  2NS1 B;  4KH1 B;  2JX2 A;  2RUS A;  2IVM A;  3TVY A;  5LMN J;  1WTF A;  4OMF G;  3MR5 A;  1JKH B;  5B7W A;  1HAR A;  4NYO A;  1J5O B;  3CCQ S;  4B3M F;  2VKR A;  1T03 A;  2UZA A;  5AT1 B;  1JWW A;  2UU9 J;  5DQG A;  2MKC A;  4LBH A;  1BY9 A;  2JEF A;  1FKP A;  1HQ2 A;  1RI7 A;  1HWK A;  3QGP A;  2CPI A;  2XNQ A;  3Q22 A;  3C66 A;  4LF7 F;  4USW A;  3POT B;  2UVV A;  2QMU B;  3H5X A;  3OR1 A;  4YB5 A;  1HBO A;  1F6T A;  2RDD A;  2M5Y A;  3MD1 A;  4ECS A;  5DG9 A;  4QCL A;  1ZH5 A;  4JI8 J;  1RE1 B;  1KN6 A;  1RTZ A;  3TA1 A;  1WDT A;  4DPT A;  5CCM A;  4O3P A;  3EM1 A;  4QQB A;  2QT7 A;  3CW2 C;  2OPR A;  1FVQ A;  2JEJ A;  1CEZ A;  3FBF A;  1S6Q B;  1W2B R;  5A8K B;  3AB4 B;  1SC4 B;  4OYP A;  1HW9 A;  3RU0 A;  1N6Q A;  3BDP A;  5DJB A;  4RW4 A;  3DHX A;  3Q24 A;  1IQT A;  2XGP A;  3M05 A;  2BRL A;  4OX9 J;  2OUG A;  3SIP B;  2HIQ A;  2HPU A;  4JYA J;  5IM0 A;  4KSE B;  2XG8 A;  2B6A B;  1CUL B;  1WF0 A;  3I56 S;  4J9N A;  1U1P A;  1N0V C;  1RBA A;  1UEU A;  4OHV A;  1R43 A;  2BQ3 A;  4G3I A;  2R8K A;  1VQP S;  4ZVT B;  4JI1 J;  5B0A A;  4IRC A;  4DHV A;  2VDH A;  2Z2L A;  4KR0 B;  3K5O A;  4UOG A;  3TAN A;  1YZ7 A;  3KHH A;  2XZW A;  4F2S A;  3EXC X;  5HVF A;  4LMZ A;  2DIV A;  1GQE A;  2AMC B;  2EW9 A;  3IA0 A;  3HHL C;  4KKO A;  5D6G A;  4NCG A;  4CH7 A;  1HWL A;  1FDN A;  3W2W A;  4TNO A;  4H4K A;  1IKW A;  5L9N A;  3FSX A;  2YKN B;  4NA2 A;  3G6Y A;  3DHW C;  1DY3 A;  1B3T A;  2HUR A;  3HZG A;  1ROF A;  4LF9 J;  3W1Y C;  1HNI A;  4LSZ B;  4OZJ A;  1WEL A;  3RB6 A;  3MFH A;  2LEP A;  1WD6 A;  2BQR A;  4NYP A;  4U8V A;  2RRA A;  4QOT A;  4URQ U;  3GYG A;  1LK7 A;  1WSV A;  3UNG C;  3RBE A;  3RAX A;  2LQB A;  3FRZ A;  2HVH A;  4PQA A;  3THV A;  2CDR B;  4ZLP A;  2ZNZ A;  2IBK A;  1S1W A;  1C1C A;  3VAF A;  3MI7 X;  2YBV A;  3M8W A;  3MXH P;  4F8R A;  4HHH A;  2YKM B;  3OVA A;  4IR9 A;  4C8Y A;  5CQG A;  4MKA A;  3MCO A;  4OI0 A;  3D66 A;  5F8M A;  3TRG A;  1JLF A;  1HBM A;  2ZHA A;  2K1R A;  4QYZ K;  4GKK F;  1RTI B;  1NRK A;  1Z1Z A;  1FRJ A;  1B0V A;  1HMV A;  1IVZ A;  4B3M J;  2JFD A;  2M70 A;  2KFZ A;  3M1V A;  2YPZ A;  4RJV A;  5HAN A;  1N5Q A;  1NH8 A;  3KJQ B;  5IZH A;  2PT0 A;  4ES2 A;  1WHW A;  2RAQ A;  4DV6 F;  3GV5 B;  4LF7 J;  5LOQ A;  2IRX A;  3EXY A;  2J76 E;  1J5E F;  1U2C A;  2ACM A;  1XIQ A;  1FXL A;  1HYS B;  4K4Y A;  3CCT A;  5IT0 A;  4TQR A;  2YXL A;  3NOG A;  4RW7 A;  3VAL A;  2MQQ A;  2QLF B;  1UVI A;  3VGU A;  1QY7 A;  5JXS A;  1LWC A;  1DRZ A;  4NLD A;  1RU1 A;  3AD8 C;  3GCW P;  2W4D A;  5DG7 A;  2R2U A;  4IOA Q;  1L3T A;  1VLO A;  4MMO A;  4FF1 A;  2OPQ A;  5E3Q A;  2VD3 A;  3N0V A;  1V3R A;  3MAH A;  4HT5 A;  4A8F A;  4Q8E A;  2OSQ A;  3Q8Y A;  1ARO P;  2OAU A;  4ZK7 M;  3EVO A;  3I87 A;  2V5H G;  3V6H A;  1WC6 A;  4F0H A;  1OPZ A;  1S9E A;  1REV B;  2KO1 A;  2IDL A;  2AYB A;  4CNY A;  1JLQ B;  2DNY A;  3OR2 B;  1C1B A;  4NLG A;  5KFK A;  2Q3P A;  2BAN B;  1EET A;  2XNR A;  2YY3 A;  3SQG B;  1CJV B;  4RBV A;  1FX4 A;  2XYG B;  3OSP A;  2YNH B;  1TUW A;  1CVJ A;  2YQ0 A;  3D7S B;  1TK5 A;  1XR5 A;  2WSF C;  5H9E J;  1TKZ A;  4DPW A;  2NPF A;  1PO6 A;  3D2W A;  3D6F B;  4XIU A;  4RNN A;  1VBX A;  1NK8 A;  3DLE B;  5IT9 Y;  4ZVG A;  4C9D A;  2YX1 A;  2FY1 A;  4ZVS B;  2U1A A;  3C2P A;  2VDI A;  3RB0 A;  2DTJ A;  3NNH A;  4CWB A;  1PKU A;  4QZV B;  2JSX A;  2CQI A;  2DYA A;  2Z8Q A;  1OQ6 A;  3DCA A;  2FZK B;  3CED A;  3A3P B;  5DQH A;  4Y6I A;  4DX6 A;  2JEI A;  3D1Q A;  2ZBC A;  4U6P A;  3DLK A;  1PG5 B;  2YKQ A;  2ZKT A;  3QGH A;  5FII A;  3LF0 A;  3WZ0 A;  4ZJO A;  3DLH A;  3VGV A;  1TUV A;  1RAH B;  2QLJ B;  4HYK A;  2YNG A;  3OTB A;  3W63 A;  3ULH A;  3M8S A;  3H40 A;  2J9D A;  2B9E A;  5DDQ C;  2BE2 A;  4ZCK A;  4N7T A;  5SUH A;  1BQX A;  2LA4 A;  3FJ2 A;  1FNO A;  5KG4 A;  1GXT A;  3I4P A;  4DOZ A;  1S0O A;  1MN7 A;  1UZD A;  5C5J A;  1RJJ A;  3M9M B;  3B6B A;  1RWW B;  1O8B A;  4JV1 A;  2HS4 A;  3ILJ A;  3PJW A;  4WFN Q;  1UZH A;  4ZLL A;  2EBE A;  2YKP A;  2AW0 A;  2NZ4 A;  3J80 U;  2CPX A;  2OML A;  4EUV A;  1NHV A;  3VF0 B;  4FF4 A;  3HFK A;  2UUB F;  4GKK J;  2WAQ D;  1T0T V;  1L3K A;  1N5V A;  2JJ4 D;  4DXL A;  1UCN A;  2CVI A;  2EFO A;  3TUZ C;  2CQ1 A;  3I0S B;  1N36 F;  1SL2 A;  1TZ0 A;  1YWX A;  3EE3 A;  1DQ8 A;  2HQI A;  5ETP A;  4OI3 A;  1KQF B;  1YTY A;  3BO2 A;  1IKV A;  1LWF A;  5KFQ A;  3K89 A;  4DV6 J;  1C4A A;  3KDO A;  2GO8 A;  2YQ1 A;  4O3R A;  2YX7 A;  1SB6 A;  1XNR F;  1VOM A;  2B8P A;  3ILL A;  1OS5 A;  2GQ2 A;  1B64 A;  4NCA A;  1J5E J;  1QDU B;  2PI4 A;  4DF8 A;  2F7V A;  3FK4 A;  4M63 A;  2H65 B;  3UR3 C;  1FKA F;  3N6M A;  3TAP A;  5D0E A;  4KE5 A;  4ER8 A;  3LP1 B;  3GJQ B;  3PO4 A;  2WVC A;  1S5Z A;  4ZHR B;  1FCA A;  5D8H B;  2FHM A;  1N32 F;  4U7U K;  3AA9 A;  4MH8 A;  4U7C A;  3C15 B;  3WHI A;  4QR0 A;  1JLA A;  3CMA S;  1NDP A;  5HJY A;  1WG4 A;  2AT1 B;  1F3V A;  4PQU A;  3M8P A;  3CIM A;  1I1G A;  4CO3 A;  1KVK A;  2VC0 A;  4DV3 F;  2W4P A;  2QA2 A;  2NQP A;  4MYT A;  2HZC A;  4X4Q A;  4B9V A;  2IJR A;  4B3O A;  4FXW A;  4AXI A;  4NML A;  2VPZ B;  2L48 A;  5CXT A;  3MR2 A;  3TP2 A;  4OZ3 A;  1SJ1 A;  5KG6 A;  4FYW B;  4KBI A;  4LRA A;  1TMJ A;  3M2R B;  4TKT A;  3DC2 A;  1P1L A;  4RO0 A;  2W2P P;  5KT2 A;  1ZET A;  1WJ9 A;  3W2V B;  4F67 A;  2IFX A;  2E44 A;  1F5C A;  4EBD A;  1DLO A;  4DPO A;  1JJ2 R;  4Q8F A;  4CCH A;  3HJV A;  3QNW B;  1AZS A;  2VKZ G;  3WC2 A;  4OYB A;  2E1A A;  3TOQ A;  1GX5 A;  2GMH A;  2MSS A;  3N5B A;  5F8L A;  2IY5 B;  3IN5 A;  4KB7 A;  4WKY A;  4J9Q A;  2JC0 A;  4Q2M A;  4MFB A;  2R7W A;  2WTF A;  3A8K A;  2C2M B;  4OZN A;  3FVY A;  1ZAW A;  2AJ4 A;  2YWW A;  2VHG A;  4G1I A;  4GKJ F;  4RW9 B;  5J1N A;  2V4R A;  4ATN A;  4QW9 A;  4F4Y A;  4A4J A;  4PPZ A;  3H8Y A;  4BWJ A;  2R8I A;  5LMU F;  3D6T B;  2VA2 A;  2WVE A;  3Q0A A;  2VBW A;  3QMQ A;  4FKX A;  4N8N A;  3W8G A;  2XS2 A;  3SDE A;  2FHJ A;  1NK5 A;  4ID5 B;  3RB3 A;  2VPY B;  4MKV A;  3T5L A;  4QIV A;  4IQM A;  4DX7 A;  3L3C A;  4FN5 A;  3NGU A;  2CG4 A;  1PAE X;  1S1T A;  1RT1 A;  4EBC A;  3H25 A;  3OBI A;  2ASY A;  1YGY A;  2ZC4 A;  3H98 A;  5D4P A;  2Y1R I;  3IBW A;  4Q0B B;  3V2U C;  2KTQ A;  1U7L A;  4BWM A;  2IBO A;  1Y5N B;  3VVU A;  4JP8 A;  1T8E A;  2O5D A;  3E3X A;  4WK1 A;  2HLT A;  3HXM A;  2UUB J;  1CC8 A;  2Z0G A;  4YR2 A;  2O01 C;  4KYZ A;  4CLT A;  2BJ3 A;  4F50 A;  4LF4 F;  4NX9 A;  4ICL A;  5BYS A;  1YJN S;  3FFI B;  1OWX A;  3GP9 A;  2ZH2 A;  1JIH A;  3BSC A;  3C16 A;  2OD6 A;  1GMV A;  2V63 A;  2MST A;  3UVJ A;  3HHL A;  4ZPW R;  1XNR J;  2W2O P;  4TLR A;  2GZO A;  5KFS A;  3U7J A;  4W92 B;  3QSY B;  2BRK A;  1U49 A;  3CT9 A;  1MNE A;  2BJ9 A;  2GO9 A;  4P71 A;  4UOF A;  3D0G E;  4S0M A;  3ICL A;  3MM5 B;  1YRU A;  3MM7 A;  1N32 J;  1QSS A;  1N56 A;  4BS2 A;  2MZR A;  2B43 A;  2PII A;  5ETM A;  1M90 T;  2AV5 A;  4R25 A;  4PWW A;  1RWX B;  3UDE A;  1ZAV A;  1RLD A;  2HBQ B;  3NEK A;  2WVB A;  1QE1 B;  5J2M A;  1PJ5 A;  3DYA A;  4F4A A;  4ECT A;  3G2X A;  1TP7 A;  4DV3 J;  1VQK S;  4G65 A;  4NMX A;  4H4O A;  3IR6 B;  1HI1 A;  2HVE A;  4AXJ A;  3PX6 A;  2CKW A;  4NRU A;  4M5M A;  1ELO A;  3ITH B;  4IO1 A;  1IBM F;  3EVM A;  1LWX A;  3IAM 9;  1RA7 A;  1MRO B;  2XC9 A;  2KXH A;  1L3S A;  5CA5 A;  3MMB B;  4USK A;  4WFA Q;  2BR0 A;  3KK2 A;  2DBB A;  4NCB A;  1HHS A;  3NY0 A;  2C2K B;  2CYY A;  4WFX A;  4OZ5 A;  1RLC L;  4OYO A;  1YHQ S;  1TVR A;  3BPD A;  4P2M A;  5KFU A;  3R8Y A;  1M5H A;  3HPO A;  4RU9 A;  2QFJ A;  3TZZ A;  2R7U A;  3UCU P;  1IQZ A;  4PKD B;  1IUJ A;  4X4V A;  2DHS A;  4DV2 F;  3P45 B;  3BSN A;  4ETZ A;  3JS9 A;  3OJU A;  3G6V A;  2VJV A;  5MLC V;  1YRX A;  3N79 A;  1DTQ A;  2BJE A;  4F7V A;  2WB4 A;  5JUM A;  3ZZO A;  4GKJ J;  3Q8S B;  1UMJ A;  2VC1 A;  3DLG B;  2WBR A;  1JLG B;  3UW1 A;  3EGN A;  2ZM6 F;  2LQJ A;  1TK0 A;  1IR1 A;  4PG8 A;  2Y0B B;  1N54 B;  3A3N B;  1HQE A;  5LMU J;  1R8C A;  2NLW A;  1U0H A;  3TNV A;  1NSQ A;  4ED7 A;  2GVD B;  1RHK B;  2OPS A;  2FD2 A;  4RWW A;  3CJR A;  5KFW A;  1LKZ A;  4MT1 A;  1B99 A;  3PG9 A;  2ERR A;  3MEC B;  4M1K A;  3T6B A;  3VAM A;  1U24 A;  4DSL A;  1IBC B;  2QSF A;  1N5Y B;  1JXE A;  1NME B;  4YHH F;  3KK3 A;  2ZVI A;  2P6S A;  4ITS A;  1TFW A;  2E9R X;  1HNX F;  3J80 Y;  2VOP A;  4ZPD A;  2HG4 A;  5JVH Q;  3ET6 B;  1WOO A;  3U1M A;  1PGZ A;  1MU2 A;  3TQ1 A;  1SKW A;  5J2P A;  5GAD I;  2HGL A;  2B4U A;  4JI7 F;  2XI3 A;  1EX8 A;  3R7S B;  2GIQ A;  3D3C J;  1SPB P;  2NCK L;  3HHE A;  4DSK A;  3FQL A;  3UI3 A;  4LF4 J;  4C4W A;  4EK2 A;  4QIG A;  4I67 A;  1IR0 A;  4DZD A;  2JRS A;  5J1P A;  4RNO A;  1VRT B;  2C1E B;  3DI6 B;  3PDN A;  2AJ0 A;  2K3I A;  4YQW A;  2ZH4 A;  1NB2 A;  4J9U E;  3WBZ A;  2FTR A;  2XB2 D;  4KHR A;  2X1F A;  1URR A;  2X51 A;  4B9N A;  3KJV A;  1NKC A;  2DXD A;  2YNF B;  4TU9 A;  4QW8 A;  4DU8 A;  4DS4 A;  4MK8 A;  2J6U A;  1DQA A;  3N9U C;  4OJ3 A;  4DR2 F;  3SFG A;  3TUP A;  2QSW A;  3CDA A;  2DNK A;  1Y9O A;  2FJB B;  2O1P A;  1FD2 A;  2IC3 A;  2XYH B;  3H2V E;  4C2M A;  1A0O B;  1SH2 A;  3Q8V A;  5IQQ A;  5A76 A;  3OVB A;  3PCO B;  1KBR A;  1XK8 A;  2K2P A;  3BQ2 A;  1T3O A;  1Y0H A;  4I7F B;  4GVB A;  3BR9 A;  4DFP A;  3LAL A;  2R42 A;  3H5S A;  1S12 A;  3GG1 A;  4B08 A;  4G6V B;  3NMR A;  2KRB A;  3KDN A;  3H5U A;  4RW6 A;  1GAO A;  3MMC B;  3MEE A;  3EWG A;  3KFW X;  2LCW A;  2BBE A;  4F26 A;  2ASJ A;  1X31 C;  1IBM J;  2VBX A;  2Q6B A;  4DR1 F;  2OFH X;  3J81 j;  1YIJ S;  3MF5 A;  1S99 A;  4UUW A;  1NHK L;  4L74 A;  3BGR B;  2WW4 A;  5KFR A;  4ED8 A;  3FMB A;  4E0D A;  1T95 A;  5HP1 A;  3IRW P;  3DLJ A;  2O67 A;  4ZDN A;  1Q1K A;  2VFS A;  4DWI A;  3EMT A;  3D0H E;  3AJ1 A;  1P27 B;  1VCT A;  4QWD A;  4RL1 A;  3H4B A;  4K5S A;  4I6Y A;  2RS8 A;  1VIS A;  1RAA B;  4A8Q A;  4CIO A;  3VGT A;  2QX0 A;  2Z56 B;  4LRC A;  1GMU A;  3BO3 A;  2BXJ A;  3H5Y A;  4LFB F;  3J7A 1;  2BM1 A;  1ZAX A;  1Q8L A;  3CJQ A;  4DV2 J;  4UY8 T;  4E8U A;  1XWL A;  1T9W A;  2FLL A;  4KHP F;  4CO4 A;  3G8S A;  4F3M A;  4W98 A;  5LJ5 Y;  2ZM6 J;  1ULR A;  1WF2 A;  3OT9 A;  4C8M A;  3CUL A;  3RRK A;  3IWX A;  2G2Z A;  3K2Y A;  3PFO A;  4X4U A;  4LSL A;  4PUO B;  3ISN D;  1BQN A;  2ZZT A;  3L7U A;  3MMB A;  3Q2S C;  2L9W A;  4XDD A;  3JYT A;  1KQS R;  3VCD A;  4YS2 A;  5J2Q A;  4LBI A;  3U02 A;  4I2Q B;  2K7K A;  1QSL A;  2UP1 A;  2MKY A;  3CSK A;  4YHH J;  1T9T A;  2CWX A;  1RHQ B;  1X4A A;  3LOU A;  3MM9 B;  3Q23 A;  2GAG C;  2QMX A;  2RVJ A;  4ZVE A;  1C0T B;  5EX3 A;  3TZX A;  1RHU B;  1RBL A;  3G8Q A;  1TUG B;  4CT9 A;  3U1N A;  3J81 U;  1HNX J;  1SL0 A;  4DSE A;  2L9N A;  3OD2 A;  3I31 A;  2CQ3 A;  2HHQ A;  3SYZ A;  1CC7 A;  2MXY A;  2MGZ B;  2DGS A;  1W2I A;  4KJI A;  4WIQ A;  4JI7 J;  5GMD A;  1MWY A;  1X4F A;  2HNZ B;  1Q7L B;  5DZ7 A;  2ZH6 A;  2E29 A;  3RBX A;  4Q2L A;  2AHO B;  3AY0 A;  2W7P A;  3N5F A;  1P6T A;  4IOB A;  4ZN3 A;  1LW2 B;  3BRE A;  2GIF A;  3BGO P;  3H59 A;  3KLG B;  2ABY A;  4NXM F;  1VRU A;  1RAF B;  5ETO A;  1WOR A;  1OO0 B;  1UJ4 A;  2RKI A;  3W66 A;  4C97 A;  2MLY A;  4CLY A;  1UEV A;  1LFW A;  3AD7 C;  2VOO A;  1CPZ A;  4DR2 J;  2FHO B;  3AQP A;  2ZNY A;  3EVW A;  3DXB A;  2QLB B;  3MM6 A;  2R7X A;  4DL3 A;  1YZ6 A;  1Q5V A;  2YWF A;  2ZHO A;  1N33 F;  3O2I A;  2UUC F;  1UVK A;  2IM3 A;  1UEK A;  5K14 A;  3C6T A;  4WP8 A;  4FBU A;  1RWV B;  4CM0 A;  4I2P A;  1SIZ A;  4DMZ A;  1HNV B;  2YH1 A;  1AUD A;  5KG7 A;  3B8H A;  2J5A A;  4K2J A;  3CDB A;  1RSC A;  3V6J A;  4TY8 B;  4LVO P;  1NZA A;  1U25 A;  2AEF A;  2W2N P;  3MED B;  4NPO A;  2G13 A;  3JXO A;  3R27 A;  4DR1 J;  2IRU A;  1R0B G;  1FJ7 A;  2KXN B;  2F9J A;  3DDI A;  3OFG A;  1HPZ A;  3RRG A;  1NPR A;  3WX8 A;  1NDL A;  4NAS A;  2IJF A;  4WTO B;  2NXC A;  1IN0 A;  2GV1 A;  1FI4 A;  1I5O B;  3DGP A;  2DGT A;  4X66 F;  1CJK B;  2FJE B;  4OHX A;  4HI2 A;  3THP A;  3HK2 A;  4O44 B;  5F8H A;  1TKT B;  3WIV A;  5T41 A;  4DEZ A;  4DV5 F;  4LFB J;  3GU0 A;  4O23 A;  3EZ5 A;  4X65 F;  2B9Y A;  3T41 A;  1V5V A;  1T94 A;  2XMU A;  4CO0 A;  5LXY A;  4MTP A;  5DG8 A;  4KHP J;  1JLE A;  4ZP7 A;  2HHP A;  1U4B A;  2F63 A;  2KFN A;  3W62 A;  1FE4 A;  3QZ7 A;  4TQS A;  2DEI A;  1C0U B;  1HWJ A;  2GGP B;  2E5L F;  1P9Q C;  3JAM U;  1KD1 T;  2NXE A;  3HVT A;  2LQ8 A;  2ZFH A;  3DRS A;  4LF1 A;  3E01 B;  1YJ9 S;  4ZPT R;  3DN9 A;  2R7Q A;  2MDA A;  3CB4 A;  1FJE B;  1SL1 A;  2DNL A;  1S79 A;  3T5J A;  3I9V 9;  1IKY B;  1U1N A;  4J9L A;  1O6X A;  1XMB A;  4ZKA A;  3SZ2 A;  2EVZ A;  2KVQ E;  5D4L A;  3ENV A;  4YP3 A;  1FVS A;  1PBU A;  3LP0 B;  4JB8 B;  5IT4 A;  4P75 A;  4PXE A;  4K5R A;  1RTJ A;  1HD1 A;  2BMB A;  5A6P A;  2I5J B;  2E5G A;  4CQ1 A;  5D4N A;  1LOU A;  2AYG A;  2GVZ B;  5KFO A;  3BH6 B;  4FYY B;  3DOL B;  4CLZ A;  4NE9 C;  4C98 A;  3B54 A;  4ED6 A;  2DR8 A;  3TAR A;  2V2Q A;  1S1V B;  1SUQ A;  2XO6 A;  4NXM J;  3CJS A;  4NA3 A;  3A1Y G;  4OYA A;  1XMQ F;  4B3S F;  2DB1 A;  2CFX A;  1Q8I A;  3HF5 A;  3AB2 B;  5LSL A;  3MUV P;  2KRR A;  3QGI A;  1V3S A;  3MMA B;  1A9N B;  1VQ6 S;  3W65 A;  3C14 A;  4I2Q A;  2E1P A;  3H0P A;  3JSR A;  1YRT A;  4NOH A;  3LW5 C;  4C6A A;  1WOS A;  1MW7 A;  3GPA A;  3KLH B;  2E1C A;  3AXM A;  3K5N A;  3T6J A;  3ETO A;  2Y8Y A;  4NA1 A;  1N33 J;  1VQL S;  1QVG R;  2UUC J;  4UOH A;  1EAR A;  2O3D A;  1S6P A;  4HEA 9;  1V3Z A;  1KNZ A;  3CGI A;  5B0F A;  1ICE B;  1HQU A;  5E3A A;  2UUA F;  2HWT A;  1VQM S;  4P2S A;  1ZM4 A;  1NJZ A;  2ZUA A;  3BYR A;  2KJW A;  2FVS A;  2EK6 A;  4HT7 A;  4P6Q A;  1LW2 A;  2X3D A;  3QSI A;  3PW0 A;  1UWB A;  4GO7 X;  2P5V A;  1WDD A;  2BJD A;  1X4B A;  1GFW B;  2ACY A;  2YPY A;  4D3G A;  3LP2 B;  1H73 A;  5D77 A;  1IM6 A;  3L95 X;  4K4W A;  2ZDO A;  3LPE A;  1X5O A;  3N6L A;  4OQJ A;  2DGW A;  5DQI A;  2XMJ A;  4X66 J;  4RPF A;  4B9S A;  2D41 A;  2ZDP A;  3SCK E;  3HLU A;  2IYG A;  3MM8 B;  2ZZN A;  3HFV A;  2RF2 A;  3DRR B;  2ZWP A;  4DV5 J;  1DQ9 A;  4CZC A;  1YSJ A;  2OIH A;  4JI3 F;  2JC1 A;  4AL6 A;  1RZM A;  4A8K A;  1EIY B;  3PRB A;  4X65 J;  3TQE A;  3JSM A;  1K47 A;  4RUA A;  1KS2 A;  1TL1 B;  2MKK A;  3CPW R;  4C8Z A;  5HO4 A;  1UVM A;  4IYQ A;  2XGQ A;  3D9B A;  4DSJ A;  2RU3 A;  2MJN A;  3SCJ E;  5T7L A;  1FRK A;  5CYQ B;  1TKX A;  4C8N A;  1S1X B;  1WC3 A;  3S7R A;  1Y5L B;  2E5L J;  3NNC A;  1JLB B;  2QL9 B;  2L3M A;  3OSN A;  4RZR A;  3ZXW A;  5A8W B;  5IFM A;  4C11 B;  4QR1 A;  1RT2 A;  3DU6 A;  3NWG A;  2CG8 A;  3FC9 A;  1XC9 A;  3PY8 A;  2LVW A;  2M2B A;  1VI7 A;  5EGY A;  4KO0 B;  4YY3 F;  3T5K A;  2V8P A;  1SJ4 P;  3CCJ S;  3FDS A;  3TVZ A;  4GVL A;  4DS5 A;  3MCS A;  2B56 A;  2VL1 A;  5A0Y A;  4C8L A;  2Z2Z A;  5I3U B;  2R3V A;  4CTA B;  2W7A A;  4FS2 A;  4B9U A;  2QO3 A;  1VIO A;  4O44 A;  1U6F A;  1AUS L;  2P9G A;  1P9Y A;  4KIA A;  1EZZ B;  3WIU A;  2A0F B;  2V4J B;  4PG5 A;  1HFE L;  1TAQ A;  2JOQ A;  3M9O B;  3NGR A;  5C2G A;  2VG7 B;  4ILM A;  4JI6 F;  4HTI A;  5T14 A;  1N5S A;  1FWL A;  4FPR A;  2CVE A;  4EU0 A;  5KT5 A;  3PYG A;  2V9W A;  3D3B J;  4OI2 A;  1EP4 A;  3IFE A;  5HK4 A;  4M5J A;  4CYU B;  5FDL A;  2I2Y A;  5KT3 A;  1BQM B;  3GON A;  1S1U A;  1QAI A;  2WON B;  4EO8 A;  1U2F A;  1XMQ J;  3DRP B;  3Q86 A;  4LBP A;  3K5M A;  1IJF B;  4WFB Q;  2OTJ S;  3BGU A;  3QFW A;  3KNA A;  3M32 A;  2VIC A;  2HAF A;  2I0X A;  2JVO A;  1IKY A;  3CCW A;  1E6V A;  1BD6 A;  4TVA B;  4R8U A;  4X4T A;  3B82 A;  3UFC X;  1W7W A;  4YN3 B;  2GAH C;  3FZ2 A;  4DF4 A;  3V4M A;  4IDK B;  3FBB A;  3LP0 A;  1BUX A;  4O4G B;  4UUX A;  4G1Q B;  2AX1 A;  2EI5 A;  1NJX A;  2FC9 A;  5DM6 Q;  3IXQ A;  5F8G A;  2UXD F;  2G1H A;  2W24 A;  3DU5 A;  4MIB A;  1N4L A;  4L6V 3;  1X9M A;  5LT5 A;  2W9B A;  3HX9 A;  3W61 A;  3PVX A;  2UUA J;  1KTV A;  2FLO A;  2W25 A;  3GIM A;  2VAS A;  3ZZT A;  3CJ5 A;  1RKJ A;  3ZZU A;  3UO0 A;  3OTD A;  3B4D A;  3ZTQ A;  1S1V A;  3QLH B;  1GK8 A;  5A8R A;  4WE1 A;  1K73 T;  3TAM B;  1S4F A;  1UA0 A;  3QFH A;  3GLJ A;  2DVI A;  4PG4 A;  4DR6 F;  3R5J B;  4LJM A;  5CAA A;  3MAA A;  3DM2 B;  1LWE B;  5G0R B;  2AGP A;  4CLF A;  1UL3 A;  3M8Z A;  1RCO B;  3BJY A;  2ATL A;  3NL0 A;  3TEG A;  4OX8 A;  5AXN A;  5EHH A;  4QR2 A;  2KZZ A;  2CAD A;  4ZS6 A;  3RZA A;  4W4M A;  2DH9 A;  2HNY A;  3SFU A;  5HAT A;  4AND A;  3TJ8 A;  3M2V B;  4JI3 J;  2BDP A;  1FHT A;  1F9E B;  2MHE A;  1PYS B;  3AT1 B;  2EC2 A;  4DLE A;  2HEK A;  2SXL A;  3BSO A;  2J9D E;  5KFF A;  6FDR A;  3V6D B;  4WII A;  3PKY A;  3FGV A;  1NEE A;  2AZ3 A;  4MK9 A;  2J7U A;  1HNZ F;  2OO4 A;  2IMO A;  2DNH A;  2QN6 B;  2D3O R;  6FD1 A;  2HQ3 A;  2QYG A;  4YB1 P;  5D3G A;  4N5S A;  2M4M A;  2G0C A;  4BDP A;  1X4G A;  1T03 B;  4USJ C;  2X1A A;  1N48 A;  5D0R A;  3G87 A;  3LP2 A;  1YJR A;  2GNK A;  1FKP B;  4FDF A;  2M52 A;  2I1R A;  3N01 A;  4YY3 J;  1U1Q A;  1P8G A;  3FBC A;  4OYZ A;  2GJI A;  4PPD A;  2W9C A;  4AUK A;  5M2U A;  1TV6 B;  3GR1 A;  2R7V A;  3OR1 B;  1YJV A;  4NLW A;  4Q5V A;  1HBO B;  2V2Z A;  1B4S A;  3GG0 A;  4X4O A;  2AF6 A;  3K5L A;  5L39 A;  2DRA A;  2BW2 A;  3MTJ A;  1H7W A;  2B9W A;  5D78 A;  1R0A A;  4EGL A;  1WG1 A;  4JI6 J;  1S9F A;  2XMA A;  5BYQ A;  4ZP6 A;  2EBG A;  3VHQ A;  3VR1 A;  2RQK A;  3UWT A;  2OPR B;  3A12 A;  3P4U B;  4M5D A;  3ZZY A;  5H1S V;  3JB9 k;  4KFB A;  3HHK A;  2EG1 A;  1RT4 A;  3HHD A;  4USV A;  3IAS 9;  4KHM A;  1JLB A;  2V68 A;  2HHT A;  1VHI A;  1RHM B;  4OI4 A;  3M4X A;  3FEY B;  2CQG A;  2HYI B;  2DT9 A;  1CS4 B;  3BKF A;  2F4V F;  3F0N A;  2DO4 A;  5IM0 B;  2K3K A;  2C2Z B;  1VQ7 S;  3EGV A;  2LU1 A;  2M8H A;  1S7H A;  1Q4R A;  5EX0 A;  4O0I A;  5KTQ A;  2W2Q P;  4R0J A;  4DL0 C;  3LPY A;  4QYR A;  2BOP A;  4UF4 A;  2AQ4 A;  2UXD J;  2GHP A;  2PMZ D;  5AJ3 F;  3D67 A;  3CNQ P;  1SJ3 P;  4CO1 A;  4ZPB A;  3MCM A;  1ZTT A;  1RUS A;  2NR0 A;  1TKD A;  2K8G A;  5LSR A;  2OEL A;  4GMK A;  5CYJ A;  5E5N A;  4CRJ A;  2H51 B;  4KKO B;  4NCG B;  3LAM A;  4ZOS A;  2HRU A;  3W2W B;  1QTM A;  1IKW B;  1M1G A;  1RB0 A;  1RYR A;  5KFN A;  2QZ8 A;  1X5S A;  3DRP A;  3LQV A;  1TU0 B;  4G1P A;  2BKO A;  4F3O A;  1TL7 A;  4DR6 J;  1Y7P A;  2HRT A;  1JB0 C;  2QL7 B;  5HBM A;  4ZJQ A;  3ISZ A;  2HBY B;  4QWC A;  2CZV C;  2FLN A;  2XY6 A;  3D68 A;  1FKO A;  1F2H A;  3KK1 A;  3LGH A;  4QWE A;  2UVU A;  1U09 A;  5C7P A;  5IQ6 A;  2CQ0 A;  3CCU S;  1U1L A;  1MML A;  3C6U A;  1MMN A;  1S1W B;  3AFG A;  1LFP A;  1YBU A;  3G71 S;  3G86 A;  5KAK A;  3TAQ A;  2MQM A;  1NCL A;  2ZH9 A;  2W8K A;  4NEZ A;  3QAU A;  2NPI A;  5C24 A;  2CJA A;  2LU2 A;  1JNZ B;  3M6W A;  1HNZ J;  1JLF B;  1HBM B;  3I96 A;  1RTH B;  3E8O A;  2WSE C;  4LT6 A;  2K1R B;  3QT6 A;  4IH5 A;  5IT9 U;  1SQE A;  2N7Y A;  2V2V A;  1Q5Y A;  2UUT A;  2QGF B;  2JHE A;  1HMV B;  3PJX A;  3TAM A;  4AQY F;  2HSE B;  3VAH A;  3R3T A;  5LJ3 Y;  2FDN A;  1HD0 A;  2J8S A;  2XS7 A;  2FJA B;  3D5M A;  3JSY A;  2PE8 A;  3FCH A;  2HK2 A;  1VJQ A;  4FVM A;  1RQ0 A;  4X62 F;  2GCF A;  1YLX A;  2QC3 A;  4DR4 F;  1OMS A;  1ZZF A;  4ECV A;  2KHC A;  2ASD A;  2JLE A;  1FFG B;  1H38 A;  3NRB A;  1FFW B;  5DGB A;  5ETT A;  4NL5 A;  1RCX B;  2A1B A;  3I6P A;  2P8I A;  3PIP Q;  1R8H A;  2RQC A;  4RW7 B;  1H2U X;  2CPF A;  4URG A;  3QT8 A;  4LRD A;  1LWC B;  1KVJ A;  1KHW A;  5ETN A;  2XM3 A;  4WZQ A;  4F04 B;  1ITP A;  3D1H A;  1TL3 A;  4U9R A;  2AGQ A;  3MR6 A;  1S59 A;  1QJH A;  2BW7 A;  1YDL A;  2OSR A;  2OPQ B;  1QTN B;  1OPI A;  2PC6 A;  4Z2X A;  2VG5 A;  3EIC A;  3EGW B;  3L7O A;  4LF6 F;  4RNM A;  1FRI A;  5M2P A;  2ATC B;  1S9E B;  5DLF A;  1D9F A;  2LP4 A;  3TZW A;  4DPX A;  1F2G A;  4AYB D;  1SV5 A;  2F4V J;  4O3N A;  1TV6 A;  1FNM A;  4I64 A;  8ATC B;  2ZWO A;  1JNR B;  1C1B B;  1QM9 A;  5EWE A;  2MYF A;  2IHR 1;  1EET B;  3TWZ A;  1D8Z A;  2YKO A;  4LSN A;  2Y1J A;  5J2N A;  5IC4 B;  1KR4 A;  2CQC A;  2LXI A;  3N4W A;  3NAH A;  3HI9 A;  4MKB A;  3BGF A;  1TKZ B;  4K7Q A;  4IFY A;  5AJ3 J;  1RU2 A;  2DK2 A;  4IG0 A;  2P9E A;  4Q44 A;  4A8O A;  4ETX A;  2ZKU A;  1CBK A;  1VDH A;  2V34 A;  4NLT A;  2VH7 A;  2CPJ A;  1WEY A;  3DFE A;  4I69 A;  5HAO A;  4ID8 A;  2R4F A;  4PWD A;  1NSA A;  4Y2I A;  2HZA A;  3GSD A;  2E5I A;  4QPX A;  2B5J A;  2CJQ A;  3GB0 A;  2QEX S;  3GE9 A;  2Y1I A;  4WU3 A;  3DLK B;  1K9M T;  5E2Q A;  1PYO B;  2PMH A;  3D54 A;  1CS4 A;  4I56 A;  4AD6 A;  2E1M C;  3A3O B;  2H5I B;  3PHT A;  2YNG B;  1F1B B;  1KLN A;  2BE2 B;  5KFI A;  2BUN A;  1RAJ A;  1VK8 A;  1WHV A;  4FBT A;  2XS5 A;  4ZMM A;  1UET A;  2HK3 A;  3M7V A;  3KHL A;  2VB6 A;  2A2D A;  4K4T A;  1D3W A;  3RBD A;  1R8P A;  1F9H A;  1HI8 A;  1VQ9 S;  1UVL A;  4IR1 A;  2KYZ A;  4QU7 A;  2XY5 A;  1UJ6 A;  1RWK B;  4Z7C A;  3CJK A;  3TO8 A;  2XMK A;  4PZV A;  1VJW A;  5HLF B;  2XSJ A;  2CXE A;  1Q7Y T;  4I0W A;  3DDK A;  4OFZ A;  2Y3Y A;  2KXF A;  3LUY A;  3CDW A;  2FQQ B;  3R6G B;  2P6T A;  1FRL A;  2VFU A;  3AHP A;  4BLG A;  4DFJ A;  4AQY J;  4EWT A;  2R8J A;  2ROE A;  2CNL B;  3VV2 B;  4X62 J;  1IKV B;  2JH3 A;  1LWF B;  1L3V A;  1YI2 S;  4DR4 J;  2CJX B;  4UQG A;  4FPI A;  2LEB A;  2E9T A;  1BLU A;  1JQG A;  1NBE B;  3H7H B;  2MZS A;  4WBF A;  3GQC A;  4ZVH A;  3ILI A;  3V5R A;  3DOM A;  3VAI A;  2AU0 A;  5HQ8 A;  5GMK a;  2H4Y B;  1IWG A;  1PIL A;  1CLF A;  2HQF A;  2B9X A;  3CD6 S;  5HN0 A;  2F5G A;  2H4W B;  1URN A;  2Y9H A;  1VBZ A;  5HI7 A;  2IYI A;  1JLA B;  1EHW A;  2LEC A;  3G8T A;  1RTH A;  2I9S A;  4PQU B;  3M8P B;  3GWC A;  2XZD B;  4OJG A;  5CZX A;  4N8O A;  1UKU A;  3P6Y C;  3MR3 A;  3MOJ B;  4LF6 J;  4ILL A;  3HT3 A;  4ECU A;  1WI8 A;  4B3O B;  2R8H A;  4WFY A;  2OEJ A;  4OYI A;  2R2S A;  2KM8 C;  3KJN B;  3AJ2 A;  5ITH A;  3BF4 A;  3D6H B;  3RG6 A;  1X0F A;  1H2V Z;  2HMI B;  2KFY A;  5C42 A;  2BZ2 A;  5CYM B;  1VQS A;  2MTL A;  1SXL A;  2G0I A;  2XLK A;  4MKY A;  1DAX A;  4DR7 F;  1NK4 A;  1U6Z A;  3FRY A;  1H98 A;  4N56 A;  3KUH A;  1DLO B;  2DHH A;  4U95 A;  3MEK A;  3I32 A;  3CE8 A;  2HFS A;  1AZS B;  4NLY A;  1KTQ A;  1QAJ A;  2OMO A;  4ZPC A;  2R7R A;  3TVK A;  1W26 A;  1C4C A;  4MFB B;  1NK7 A;  1R8A A;  4KT0 C;  2VF3 A;  3UDL A;  1VRQ C;  5KG1 A;  2DR7 A;  2IIH A;  2GQQ A;  3RJM B;  5D4O A;  1RT6 B;  3PEH A;  3BKT A;  5H9F K;  3SDE B;  1LXJ A;  2BAC A;  2BX6 A;  4FKY A;  2VU5 A;  4ECY A;  4ZVU B;  4AE5 A;  1GTE A;  2DHG A;  1BE4 A;  2KU7 A;  2CQP A;  4C48 A;  1WOP A;  1CJT B;  3HFZ B;  4WXO A;  3QWP A;  2ZE2 A;  1S1T B;  2ILZ A;  3MPY A;  1EQM A;  1RT1 B;  1FER A;  2CQ4 A;  4URS A;  2W8L A;  3CJT A;  2HFV A;  2BOA A;  3QIP A;  4FNI A;  5HMZ A;  4ED2 A;  1UW4 A;  3OUY A;  4KGM A;  4PRF A;  2CRL A;  1Q16 B;  2Z2M A;  1JLC A;  3CCZ A;  3Q2T C;  5HQL A;  4YOE A;  3IRX A;  4C3K A;  2PN6 A;  4JOU A;  1NJY A;  4OZ2 A;  2HVD A;  3SXL A;  1RT5 A;  1HW8 A;  5A6W A;  3K17 A;  3IBF B;  3OJS A;  1R7I A;  4ICL B;  3UPF A;  4KV8 B;  1S9G A;  4YDX A;  1V6H A;  3DOK A;  3PO5 A;  1FA0 A;  3W9I A;  2F4F A;  5KFA A;  3TX8 A;  5JVG Q;  3C16 B;  3LTO A;  3UVJ B;  4EYI B;  2G9O A;  2FVP A;  3HHL B;  2JFK A;  4PWU A;  2ALY B;  2CJY B;  2F8H A;  4B17 A;  4HHJ A;  1FRH A;  5IWA F;  2IA0 A;  4IQX A;  4HTJ A;  2DR5 A;  2HLU A;  4RBT A;  2C2N A;  3IWN C;  4X4S A;  4Y2M A;  5SZT A;  3FNN A;  2YQ3 A;  3MM7 B;  5FLX U;  4LQ3 A;  2C3Y A;  1U1R A;  2AKW B;  3R5C A;  1OYD A;  2POK A;  4H4M A;  1S0V A;  3CCS S;  3LO3 A;  1D9D A;  5GAD U;  3M2U A;  4K59 A;  5HLF A;  1FDD A;  3I82 A;  5J2M B;  3DYA B;  4B02 A;  3PW4 A;  3CJ3 A;  2Z58 B;  2P9C A;  5I42 A;  1AXQ A;  3J7Z 5;  3P5T L;  4QBU A;  4OZ1 A;  2VJU A;  1X60 A;  3VAK A;  2AJQ A;  4J9S A;  4H4O B;  4HDG A;  2A3J A;  3KMQ A;  3T1H F;  5KFZ A;  2JNJ A;  3ZZZ A;  2RUG A;  3KLF A;  3PX4 A;  1XR7 A;  2FC8 A;  2QLX A;  2GFF A;  2KT3 A;  3RW6 A;  4FXV A;  4DL7 A;  4DUY F;  2LDY A;  2DR9 A;  3EUN A;  1SI9 A;  2QIF A;  2MMY A;  1VIX A;  1N0U A;  2ZOM A;  4NZ0 A;  4CH0 S;  1FNX H;  3KK2 B;  5HRO A;  1K1S A;  3D6M B;  4WTY A;  1IKX A;  4QWB A;  4DR7 J;  2D3O 1;  2F1F A;  4M5K A;  5DET A;  2XWY A;  1TMM A;  4USI A;  1TVR B;  1PBA A;  4ZP8 A;  3RRH A;  1JXL A;  2DIT A;  2KKH A;  5M2R A;  1B7F A;  2CPY A;  1R0C B;  3BSA A;  4V1A k;  1SH0 A;  3R97 A;  4BHQ A;  3FEX B;  4GO5 X;  1SKR A;  1YQH A;  4DQI A;  3FQK A;  2PA3 A;  1DTQ B;  3HO1 A;  2NSC A;  1RAI B;  4ED3 A;  2DHX A;  1ZOT A;  3EDR B;  4LR8 A;  2PI5 A;  3EDQ B;  3OL7 A;  1Z2Z A;  1P1T A;  1HQE B;  2B0G A;  5CD4 H;  2NXJ A;  2Z4P A;  1U0H B;  2X3G A;  4YB7 A;  1UPM B;  2OPS B;  2HMI A;  3O1L A;  2BJ1 A;  2RIL A;  3JQK A;  3BQ0 A;  5LXR A;  2RT3 A;  4U96 A;  2QYC A;  5CYM A;  2AX0 A;  1FK9 A;  5RUB A;  1N34 F;  1VQY A;  2OEK A;  3BDE A;  3V81 A;  3M6X A;  2G1D A;  3KK3 B;  2M8D B;  4DX8 H;  3S8S A;  2R7S A;  1FJG F;  1FWK A;  5KG2 A;  3F56 A;  3SEO A;  1YJ7 A;  1F9F A;  4J91 A;  1TTH B;  1BWE A;  4DX5 A;  3UD5 A;  1X9W A;  1S6U A;  1R31 A;  2HBZ B;  4BCA A;  4IG3 A;  1MU2 B;  3MDF A;  3HUL A;  4O3O A;  3MEG A;  5J2P B;  2DRB A;  3GMG A;  2VQF F;  3QYY A;  3I5A A;  5CH7 B;  4PEO A;  3BPS P;  2XLI A;  3QJP A;  3SMZ A;  2ILY A;  2ZBP A;  2OTL S;  3DMJ A;  1RT6 A;  4ZVP B;  4Y28 C;  2IDE A;  2FPH X;  4LRB A;  4HKQ A;  2C3O A;  2NSB A;  2ADC A;  3ENW A;  3HVW A;  3I0R A;  4LF8 J;  5CCL A;  2IM2 A;  1R27 B;  3NLC A;  1EAY C;  4RNF A;  1FTC A;  3GZ7 A;  5B0C A;  3FCV A;  5BR8 F;  1YK9 A;  2ROP A;  1CJT A;  2LXF A;  4HI1 A;  3KJV B;  3ONQ A;  1XMO F;  4LFC F;  5IWA J;  3ZC4 A;  3H90 A;  4DCJ B;  3VTI A;  3BEG B;  3TA0 A;  3PZP A;  4ZVF A;  2W7O A;  3AD9 C;  2XLJ A;  4CI0 B;  4C3M A;  4X4N A;  2VG6 A;  1NSP A;  2YH0 A;  1WUU A;  5HMX A;  3VQS A;  1U1O A;  4J9V A;  2IC3 B;  4RKU C;  1JX4 A;  2C3M A;  3PEJ A;  5KG5 A;  4J9O A;  2FIU A;  2ZJQ Q;  2IRY A;  5DDP C;  3NCQ A;  1X4E A;  1O0P A;  1V5I B;  2X1B A;  3F44 A;  4LUB A;  4GVB B;  3OXL A;  3BB5 A;  3GV8 B;  4DSF A;  3T1H J;  2VBY A;  4RW6 B;  4KV8 A;  3MEE B;  3O8W A;  5F8N A;  3W5X A;  4HH0 A;  1ZS6 A;  4HHU A;  2R9L A;  4DUY J;  4WU2 A;  4USM A;  4DG1 B;  1Y11 A;  3M30 B;  4WPA A;  9ATC B;  3K58 A;  2UXB F;  1Z2L A;  3E51 A;  2DRD A;  3TI0 A;  5HP1 B;  4R5P A;  5KT6 A;  4UW2 A;  3ZZP A;  3JQJ A;  1Y5I B;  1NK9 A;  3H2U B;  1EQ0 A;  2DGU A;  4Z7Y A;  1T3N A;  3GFX A;  2W2M P;  3H42 A;  3Q8R B;  2QE5 A;  2PGC A;  4DDF A;  2J9C A;  5B0G A;  3MAQ A;  4WWS A;  1ZBT A;  1T11 A;  2OGU A;  2XI2 A;  4K4V A;  4DZ6 A;  1WEX A;  4EZ6 A;  4J9K A;  2A6M A;  1YJT A;  3PYF A;  2XZT B;  4NZ6 A;  2DGQ A;  1OSD A;  1RWM B;  2RRB A;  4NLU A;  2ZOF A;  5E41 A;  1VK3 A;  5DO2 A;  2RSQ A;  5KFB A;  3QID A;  3PR4 A;  3WQP A;  5DZ6 A;  3KG4 A;  4JUZ A;  3AOC A;  1H74 A;  1JJH A;  4AT1 B;  2ALZ A;  5EN1 A;  5CZV A;  4DUZ F;  4CLP A;  4LSL B;  2OJ3 A;  4RR5 A;  1BQN B;  2DR6 A;  2NUH A;  1PC5 A;  2P2C B;  1KEK A;  3QPI A;  3I4H X;  2F9D A;  5CAB A;  5C25 A;  1WHY A;  3HD1 A;  1LW0 A;  3JYT B;  5CHC B;  3NGD A;  1N34 J;  5J2Q B;  1WEZ A;  1ZPV A;  5HVG A;  5DM7 Q;  1N8R T;  6AT1 B;  1RTD A;  4ZCM A;  1FJG J;  2EEY A;  3AXK A;  2ZVS A;  2BKP A;  1WI6 A;  3PYD A;  2EXU A;  4JBC A;  2EFN A;  4XTT A;  4NRT A;  4NI2 A;  2ASL A;  1U26 A;  4P73 A;  5E7O B;  1HA1 A;  3A4T A;  5HVH A;  4O3Q A;  1PIE A;  2ZH7 A;  2FVQ A;  2VQF J;  3UNY A;  1MWZ A;  3CVK A;  3RAQ A;  2NYH A;  4DV4 F;  1NKB A;  2BA9 A;  3H20 A;  1OJ4 A;  2B8Q A;  4WP3 A;  3AJD A;  3OW2 R;  3SSQ A;  3J7Y I;  2Y0S D;  2CPD A;  3GR0 A;  1N52 B;  2XTJ P;  3EJM A;  5LL6 d;  1VRU B;  2VA3 A;  2XHW A;  3CCL S;  4USU A;  4FP9 A;  5BR8 J;  5DGA A;  2RKI B;  4J9M A;  1KDN A;  4CNZ A;  1XMO J;  1SC3 B;  4LFC J;  2BQU A;  5GAH U;  3ZTR A;  3KNG A;  3KG1 A;  2FLP A;  2XYP B;  3NG8 A;  5FLX Y;  2CZ4 A;  3WX4 A;  2RIJ A;  5G4D A;  2A10 A;  3MUM P;  4ED1 A;  2BJ8 A;  3MM6 B;  1Q53 A;  3Q89 A;  3UN2 A;  3RYL A;  1IJE B;  2COL A;  2HND A;  1H2T Z;  5K14 B;  1WC5 A;  2DH8 A;  3C6T B;  3FSY A;  3HHN B;  3NWR A;  3US5 A;  1S0N A;  4F25 A;  3M8Q B;  4I2P B;  5KFP A;  2V8V A;  1SQG A;  4YFU A;  2YX4 A;  1KHV A;  2FZC B;  2BJ7 A;  1CG2 A;  3BS9 A;  4W90 B;  4QWA A;  4ZIW A;  2CA9 A;  3M6U A;  4QU6 A;  4O0N A;  3KYL A;  1RAC B;  4D3H A;  3A13 A;  2BAB A;  1A7G E;  4OI6 A;  2W01 A;  2UXB J;  1DJ0 A;  4M5L A;  1HPZ B;  4ZA1 A;  1G7C B;  3IG1 A;  5KOW A;  3PM9 A;  1T02 A;  2VZ9 A;  1WC4 A;  2PO4 A;  3UD3 P;  3DGP B;  1HWI A;  3R7B B;  3CME S;  3MPW A;  3J7A N;  3FZB A;  1FWP A;  1Y3J A;  4UQT A;  3MPU B;  2HS0 A;  4DPY A;  1KLM A;  2HHX A;  4NLP A;  5HL7 Q;  3OL8 A;  2UXC F;  3P8B B;  3GSI A;  4JI2 F;  3UCG A;  1SJR A;  1KON A;  1HHT P;  4OZL A;  2KZM A;  4M95 A;  1JLE B;  3KWM A;  4IO9 Q;  1JJC B;  2G2O A;  3IS9 A;  1DBD A;  1DTT A;  3G82 A;  2MKS A;  5DLG A;  1RAO A;  1HKA A;  2Y8W A;  2E1R A;  4GC6 A;  1H6K X;  4WF9 Q;  3CO9 A;  4C3L A;  4FYD A;  2XO7 A;  1X5P A;  4DUZ J;  2UV8 G;  2DJW A;  3HVT B;  3FEZ A;  3DRS B;  4DG1 A;  3UR0 A;  3M30 A;  4L72 B;  1NXI A;  1SIW B;  2KYX A;  3PW7 A;  2JL9 A;  4DBQ A;  4N77 A;  2E7X A;  5DDO C;  2QJ3 A;  3A8E A;  3GIL A;  4K50 A;  5L1K A;  1DFD A;  5H9F J;  2CQH A;  3S6E A;  1U1K A;  2LMI A;  2AEM A;  4OL8 A;  1RTJ B;  1S4E A;  2OHD A;  4ELV A;  2ZHB A;  1R6V A;  3DXS X;  3J7Z T;  3O5T B;  1FF2 A;  3R1H A;  3RAM A;  1AFI A;  1D0E A;  2OLW A;  2F8E X;  1RYS A;  1NB7 A;  3RBZ A;  3KUE A;  4DV4 J;  2HQG A;  4J37 A;  4L3N A;  1I3O B;  1CJU A;  4ES3 A;  2JEG A;  4HDH A;  3ZZ0 A;  4LQ9 A;  4V19 X;  1HBU A;  4X4R A;  4M5G A;  1NKE A;  2QLW A;  1NDK A;  1T05 A;  1SUQ B;  4XPE A;  3FBE A;  2DIU A;  3GV7 B;  1Y3K A;  5KG0 A;  2W9A A;  1B7Y B;  1IBL F;  2BKN A;  2LFV A;  5KFY A;  3JTN A;  3F41 A;  8AT1 B;  4F4X A;  1ACM B;  3LGM A;  3C14 B;  2NXU A;  3OHB A;  1LV5 A;  1SKS A;  2VFR A;  1JKH A;  3JTO A;  1C2P A;  2AJ1 A;  2RQM A;  1J5O A;  4Y65 A;  3UD4 P;  3GFZ A;  4OYX A;  1MSW D;  3HSG A;  4B9L A;  1S6P B;  1WC1 A;  5KFH A;  3UCZ P;  5L1I A;  5AXK A;  1VQO S;  3TYT A;  3G6E S;  1HQU B;  3NGS A;  2HHS A;  3T1Y F;  1ZA2 B;  4EZ9 A;  3POT A;  2JDJ A;  3MCN A;  2Q79 A;  5MAO A;  2CIM A;  2WB1 D;  1UWB B;  3O6Q A;  4LF2 A;  3E2E A;  4P7T A;  2HS3 A;  1NLK L;  3VZI A;  2A2C A;  2HAI A;  2MQP A;  4I4B A;  4OLP A;  1OY9 A;  2CPH A;  3I55 S;  5AE3 A;  3M8R A;  2HQC A;  3T19 A;  4MAK A;  2ZZM A;  1QSY A;  4A8M P;  3SCI E;  3Q8Q B;  3QBC A;  5D0H A;  3K8W A;  4I68 A;  1IM4 A;  1RA6 A;  2VPW B;  1S6Q A;  1TFY A;  4CP5 A;  2PD1 A;  5A8K A;  3ZZR A;  1F5A A;  2MY8 A;  5B0D A;  4DU7 A;  3PXG a;  2FJX A;  2RF2 B;  2XEX A;  3CCM S;  4EFA C;  2UXC J;  3CD0 A;  2VUG A;  3G4S S;  1VHF A;  3IR5 B;  4Y34 A;  3M6V A;  4JI2 J;  3JSM B;  3M8Q A;  2V8D A;  3W5Z A;  2U2F A;  5GAG I;  2DNM A;  5GAE U;  2B6A A;  2IMW P;  1CUL A;  1GT8 A;  4LIW A;  2V2K A;  1AT1 B;  5T7L B;  1D9A A;  5E0O A;  3KG0 A;  4ILR A;  1TKX B;  4NWB A;  2VPX B;  3PKM A;  3BKU A;  3A8J A;  3HM9 A;  2CQB A;  2QTW A;  1Q78 A;  1VBY A;  3GYN A;  1QAX A;  1S72 S;  1HLW A;  4GC7 A;  1RT2 B;  4L76 A;  3NAI A;  3SV4 A;  4DQQ A;  2OD4 A;  3HD2 A;  2G0J A;  2EPI A;  2DH7 A;  2D69 A;  4CLL A;  4AL7 A;  5F0W A;  3QGG A;  5A0Y B;  3ZO7 A;  2HZV A;  3LGN A;  2ZIT A;  2EFQ A;  2JVR A;  2YKN A;  2QA4 S;  1DHM A;  4LRF A;  4M5N A;  4UY8 5;  3NOC A;  3RW7 A;  2J0Q D;  5BJR A;  2DGO A;  5F3T A;  2CUY A;  3OLB A;  4YR3 A;  4P9S A;  1FD8 A;  1NM2 A;  2DXE A;  2BYC A;  4WJB A;  1FJC A;  4L3K A;  5B0E A;  2B51 A;  5KOX A;  1DZ5 A;  4EBE A;  1UTA A;  3Q83 A;  5BYR A;  5A2Q U;  3U1L A;  4V19 J;  3KTQ A;  2CPE A;  1EP4 B;  3IM9 A;  2E9Z A;  2FGO A;  2NZC A;  4OV1 A;  1I94 F;  2RDJ A;  4K4Z A;  2G2Y A;  1IWA A;  2AJF E;  5FDL B;  3HVR A;  1IBL J;  1S1U B;  3L4B C;  1J27 A;  1EKR A;  2YKM A;  3RR7 A;  5K5M A;  4F3Q A;  2EK1 A;  3CIZ A;  1X7V A;  7FDR A;  3M32 B;  4JV5 F;  5GAH I;  1E6V B;  1FDB A;  1N88 A;  1UVJ A;  2HVI A;  4R8U B;  1SVD A;  3AOA A;  3MPD A;  2OFG X;  1RTI A;  2D9O A;  2R2R A;  4C0H A;  2EWH A;  4CLK A;  1H3D A;  2FJD B;  2I38 A;  1K1Q A;  4OYM A;  2CDQ A;  4DN0 A;  1OYE A;  2F3J A;  3PYE A;  4AL5 A;  4U8Y A;  5KFV A;  3MMJ A;  4K4X A;  2W9B B;  2HVZ A;  4TYA A;  4PAB A;  4DL2 A;  4RNH A;  3T1Y J;  3HKZ D;  4DLG A;  2AGO A;  2NYI A;  4F0K A;  4R0E A;  3OFH A;  2GQC A;  3RTV A;  3NKY A;  1HYS A;  2JZ5 A;  4YB6 A;  2MQO A;  4Y00 A;  4J90 A;  2MQ8 A;  1KSP A;  5E3C A;  1GX6 A;  4WE1 B;  3BBC A;  5A8R B;  1AW0 A;  1G3O A;  3EZU A;  4P2F A;  5KFM A;  4OIX A;  2HGN A;  3D0I E;  1KC8 T;  5KFX A;  3UDC A;  2F40 A;  3MAA B;  3OL6 A;  3TUI C;  1NJW A;  4DN9 A;  2GIR A;  3OFF A;  5ETR A;  3VQT A;  4UT4 A;  1GTH A;  5KT4 A;  3KLV A;  2A6O A;  3TEH B;  4DQS A;  3IGN A;  2PFD A;  3PRV A;  2HNY B;  4ECQ A;  4XAK A;  2IM0 A;  4WKR A;  1OQ3 A;  3BV8 A;  2RDI A;  1REV A;  4A47 A;  1GXL A;  1RWN B;  1PAU B;  3NBP B;  1XNQ F;  1JLQ A;  3OR2 A;  1XEZ A;  4RUH A;  2DEJ A;  2BAN A;  1KFD A;  3SQG A;  3LH2 S;  1KQK A;  2CNK B;  4FYV B;  1CJV A;  3CUN A;  1WF1 A;  1YG0 A;  3NP5 A;  1F3F A;  4EEY A;  2YNH A;  1OSC A;  4ZIT A;  5CD4 A;  2QL5 B;  2RD5 C;  3K8V A;  4IH7 A;  3T1A A;  4IUF A;  5D3G B;  1Q82 T;  3AOD A;  1X8D A;  2ZJR Q;  1TK8 A;  4EMD A;  4EO6 A;  1NHU A;  4JI4 F;  2HHU A;  2DNZ A;  8RUC A;  3R7N B;  3DLE A;  2VFT A;  1TQL A;  3QT5 A;  4ECZ A;  4QJV A;  2W9C B;  4XK8 C;  1GMW A;  3QJL A;  1B0T A;  2E5H A;  2V0N A;  3R2D J;  3HVA A;  1N36 J;  4PYA A;  3CF5 Q;  2RRN A;  1NK0 A;  1R0A B;  3KLE B;  3RUB L;  1RP5 A;  4M8L A;  4DCP B;  4YME A;  2N4D A;  5KT7 A;  2DGV A;  3IP0 A;  2F8M A;  4DQP A;  3I5C A;  1KRP A;  5GME A;  4M5D B;  2WW8 A;  1RT3 B;  1LNQ A;  3BN4 A;  2A18 A;  3VZH A;  2J8A A;  2MHN A;  4KFB B;  1I94 J;  2B4V A;  1RT4 B;  2MKJ A;  2XY7 A;  1WG5 A;  1VR6 A;  2QFI A;  4A8Y A;  4XPC A;  1Y00 A;  4IRK A;  1NPK A;  2DKO B;  2OEM A;  3AOB A;  3KJF B;  4LIR A;  2JWN A;  4JV5 J;  3AA8 A;  3QO9 B;  2HGM A;  5D15 A;  1X4D A;  1HIY A;  2DPI A;  1HBN B;  1RKI A;  3X1L B;  1N5T A;  3FKB A;  4UST A;  1XER A;  3PAC A;  1M0S A;  5AXL A;  4QIE A;  3PW5 A;  2C3P A;  4LR7 A;  3QAE A;  5K8O A;  5L1J A;  4ED4 A;  2XUL A;  3I0S A;  3P96 A;  3NMA A;  4QPT A;  4LR9 A;  1NUE A;  5DDR C;  1KFS A;  2KL8 A;  2MZ1 A;  3D28 A;  3G96 A;  1NZ8 A;  4ZLJ A;  1OY8 A;  1U1M A;  3MOZ A;  3PRD A;  2G4B A;  2ZUG A;  1R89 A;  4MIW A;  2H48 B;  1ZA1 B;  4B3T F;  1T9Y A;  2GW8 A;  2UV8 A;  3LP1 A;  3KMS A;  3R1L A;  3SBM A;  4ZHR A;  4KPY A;  4KGZ B;  5K20 B;  3D1O A;  1XBW A;  1Q0N A;  1FES A;  4NEY A;  1TL7 B;  3C15 A;  3MFI A;  2O66 A;  3QRP A;  2KH9 A;  3R9L A;  5HBM B;  3BBB A;  1Y4Z B;  3DLL Q;  3CMQ A;  4DPU A;  3ZTS A;  2K7J A;  3NNA A;  1FKO B;  1RGV A;  3KK1 B;  3PNI A;  5I3Q A;  3MGJ A;  1ZZN A;  2QRR A;  4OI1 A;  2KDO A;  2YNI B;  4K8R A;  2HRY A;  5F41 A;  1NND A;  2PEH A;  3C6U B;  2DY9 A;  2D74 B;  2V94 A;  5F8J A;  2X1G A;  5AE2 A;  2ZH1 A;  2HFN A;  1S48 A;  2NXN A;  4HH1 A;  1AA1 B;  4WCE Q;  2XCP A;  1XNQ J;  3MD3 A;  1VQ4 S;  1QUV A;  5C24 B;  5GAE I;  3M2R A;  3CXC R;  4F4K A;  4HVZ A;  2DNR A;  3QRQ A;  3KXD A;  5IXU A;  3SSR A;  1YVF A;  2WK4 A;  2LDI A;  2AYE A;  2XCA A;  2DGX A;  2I8E A;  3CWJ A;  5L1L A;  3W2V A;  5AE1 A;  4RU2 A;  5ETQ A;  3PIO Q;  3MR7 A;  2ZD1 B;  2V50 A;  4JI4 J;  3CDE A;  2HHW A;  1G6B A;  5HMY A;  1S77 D;  1M1K T;  2MZQ A;  1NSK L;  4RX6 A;  2H5E A;  4A8S A;  1SJF A;  3KOA A;  4J9P A;  1WAC A;  1UWA A;  1YBA A;  4Q45 A;  3MHY A;  1VYA A;  4KGX B;  2J9E A;  1WHX A;  4RW9 A;  3HKW A;  2FHK A;  4LF5 F;  5HQM A;  4IRD A;  3PW2 A;  1UA1 A;  3W5Y A;  4PXD A;  3B4M A;  4ID5 A;  5DRK A;  3BH7 B;  3NBP A;  4NLV A;  5A2Q Y;  3EYZ A;  3D4J A;  1TL3 B;  3EX7 B;  1WKL A;  3QT7 A;  1GH8 A;  1NPP A;  4QYZ J;  1T7P A;  1S76 D;  4ALZ A;  2MZT A;  3N28 A;  3MWB A;  2VG5 B;  4B3R F;  4KY3 A;  4C0B A;  4MJK A;  1RWP B;  4ERD A;  1TL5 A;  4Q0B A;  2D3U A;  3R2C J;  4OX7 A;  3W9J A;  4TLQ A;  4O4R A;  3LWM A;  4FS1 A;  1RWO B;  1TEL A;  3SSS A;  2C2D A;  1M5P C;  1WNE A;  2ZH5 A;  1OY6 A;  4M94 A;  2N3L A;  1SV5 B;  2LLZ A;  3SQO P;  4OV6 A;  5L38 A;  4DUT A;  1SC1 B;  1MG7 A;  3IBC B;  3BGL A;  4ANE A;  4LSN B;  2GX8 A;  5J2N B;  2WZ1 A;  2B4O A;  3GIR A;  3OLA A;  3FFI A;  4RWX A;  4WYW A;  3FCW A;  4UZB A;  4KRW A;  1JMT A;  4IFY B;  3GII A;  3TX0 A;  3KLE A;  2AYM A;  3DRY A;  2MKI A;  4IG0 B;  1AYE A;  4TYB A;  3MTK A;  3Q8P B;  2MJU A;  5B08 A;  1RT3 A;  3GTY X;  3IGV A;  5F9N A;  1UJ5 A;  3GCX P;  3L09 A;  4KQZ A;  4PWD B;  1FXD A;  4B3T J;  2BVZ A;  2B5J B;  2OH2 A;  4FF2 A;  3MM5 A;  3K7R A;  5LSO A;  2UUW A;  2Z57 B;  5I3P A;  1V9O A;  3NS6 A;  5EWF A;  1WTB A;  5FD1 A;  5E3P A;  2I6W A;  3O3L A;  2KG1 A;  3QO9 A;  4L75 A;  3LAK A;  2IAJ B;  2ADB A;  1HBN A;  2XMV A;  2DPJ A;  1VS3 A;  1EB0 A;  1RT7 B;  1QE1 A;  1NAQ A;  1W25 A;  4PXC A;  1BHN A;  4U67 Q;  3EPG A;  3DGV A;  1F5B A;  2R7O A;  4NYZ A;  3CD7 A;  4PG6 A;  2C42 A;  4WXW A;  4ECR A;  2H3E B;  2GML A;  2BM0 A;  1Q8B A;  4EYH B;  1SC6 A;  5ADZ A;  2KVI A;  1L3U A;  1BMQ B;  1QAY A;  1X5T A;  4ECX A;  2GJ2 A;  3ITH A;  4BC9 A;  1YKW A;  2DNQ A;  5L8R C;  1Q8K A;  2PA8 D;  1MRO A;  2J6S A;  1Y10 A;  5IV3 A;  7AT1 B;  2N82 B;  1M5S A;  3CJK B;  1UVN A;  4F02 A;  2CQ2 A;  2XSJ B;  2WHO A;  3NCP A;  2H9Z A;  2DNG A;  4A48 A;  2M88 A;  2WOM B;  2RB7 A;  4NXN F;  1RXO B;  4DL6 A;  1UP1 A;  2WRM A;  2XMT A;  4C8K A;  1XN9 A;  4DV1 F;  3ILO A;  3UQS A;  2DY1 A;  2OPP B;  2E7W A;  2FJV A;  1H7X A;  2QA1 A;  1R6Y A;  1NJI T;  3AQO A;  3V4I B;  2RNE A;  4FZV A;  2FVR A;  4IFV B;  1F0X A;  2RS2 A;  4DL5 A;  4WFZ A;  2AJ2 A;  1K0V A;  3T3F A;  3CO0 P;  3DLG A;  1JLG A;  1KP6 A;  2MQN A;  1GNK A;  3DOM B;  2DO0 A;  2YNI A;  3ENA A;  4LF5 J;  2F65 A;  4HR2 A;  5HMW A;  3Q8U A;  2Q1L A;  3IWL A;  5K9F A;  2KI2 A;  2ROG A;  3C19 A;  2V8G A;  4UZC A;  4P52 A;  2GVD A;  4WZM A;  3QZ8 A;  4Q7A A;  1YX2 A;  3NS5 A;  2DNO A;  3DDN A;  3MEC A;  5KFD A;  2BE9 B;  5ETV A;  5EUH A;  2QMW A;  2ZH3 A;  3JSB A;  4B3R J;  1N5Y A;  3HZE A;  3KHR A;  1CQN A;  4RUC A;  4NLO A;  1Q86 T;  2ZD1 A;  4HLB A;  1VGY A;  1WKK A;  3ET6 A;  1IXK A;  5F3Z A;  2FY8 A;  4F4Z A;  4WK3 A;  4QIF A; 
#chains in the Genus database with same CATH homology
 1NPK A;  3B54 A;  1HLW A;  3EJM A;  5IOL A;  1ZS6 A;  3ZTQ A;  5BXI A;  1K44 A;  4EK2 A;  3R9L A;  1PKU A;  3BBB A;  3ETM A;  1NSK L;  3FBF A;  1HHQ A;  1S57 A;  2BX6 A;  1BHN A;  4FKY A;  2DYA A;  2VU5 A;  4DUT A;  4ENO A;  1UCN A;  1HIY A;  2HVE A;  1KDN A;  3FCV A;  5CAB A;  3ZTS A;  1BE4 A;  3Q8Y A;  3Q86 A;  3GP9 A;  3FKB A;  3ZTR A;  3MPD A;  4FKX A;  4ANE A;  1NB2 A;  1NSQ A;  3FC9 A;  3NGT A;  1VYA A;  5CAA A;  3ENA A;  3EVO A;  3DDI A;  3EE3 A;  3EVM A;  1LWX A;  4HR2 A;  3L7U A;  1NHK L;  3PRV A;  2HUR A;  3Q8U A;  4CP5 A;  2DXF A;  2CWK A;  3FBC A;  4WBF A;  3VGS A;  4ANC A;  3WX8 A;  1MN9 A;  3VGV A;  1NDL A;  2DXD A;  2DY9 A;  4KPC A;  1B99 A;  3FCW A;  3EMT A;  3NGU A;  1W7W A;  1NDC A;  4C6A A;  1NUE A;  3BH7 B;  2B8P A;  3Q89 A;  1PAE X;  5C7P A;  2AZ1 A;  3GPA A;  3FBB A;  1NSP A;  4O0N A;  1BUX A;  1B4S A;  4AND A;  3ZTP A;  4DI6 A;  2DXE A;  1WKL A;  3VGT A;  3EVW A;  4DZ6 A;  1XIQ A;  4UOF A;  1LEO A;  4S0M A;  3ELH A;  3NGS A;  4F36 A;  1XQI A;  1F6T A;  1EHW A;  1S5Z A;  3Q83 A;  3VGU A;  1MN7 A;  4UOH A;  3NGR A;  2BEF A;  3VVT A;  1NCL A;  3B6B A;  1S59 A;  1F3F A;  1U8W A;  3ZTO A;  3BBF A;  3Q8V A;  3DKD A;  1JXV A;  2B8Q A;  2HVD A;  2AZ3 A;  3JS9 A;  3VVU A;  3BBC A;  1NDP A;  4UOG A;  3EM1 A;  2ZUA A;  3BH6 B;  1NLK L;  1WKK A;  4F4A A;  3EIC A;  3PJ9 A;  3G2X A;  1NDK A;  4W98 A;  3FBE A;  1WKJ A;  2NCK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...