1ZS6A

Structure of human nucleoside-diphosphate kinase 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
152
Chain Sequence
TGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human nucleoside-diphosphate kinase 3
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase 3
total genus 44
structure length 152
sequence length 152
chains with identical sequence B, D
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1zs6A00
2DXDA 3GP9A 4UOFA 3BBFA 5BXIA 1NCLA 1ZS6A 3VGVA 3ZTOA 3Q83A 3EM1A 1B4SA 3VGTA 2ZUAA 3PJ9A 3FBCA 3Q8UA 4DI6A 3FBBA 4FKXA 1K44A 1NDKA 3ZTQA 4F36A 4HR2A 3ZTPA 4ANDA 3R9LA 3ENAA 3MPDA 3EICA 3NGSA 1XQIA 4DZ6A 1JXVA 1UCNA 1WKLA 3EMTA 3GPAA 2AZ1A 1MN9A 2B8QA 5CAAA 2DXFA 4C6AA 3B6BA 1BHNA 2HVDA 3ELHA 3BH7B 1BE4A 1WKJA 1NB2A 3FCWA 4FKYA 4EK2A 3FBFA 4UOHA 2B8PA 1BUXA 1HLWA 1F6TA 1MN7A 5C7PA 1S5ZA 3DDIA 1NDCA 3EVWA 3ZTSA 1NLKL 2DXEA 1HIYA 1VYAA 1NSKL 2HURA 1PKUA 3FBEA 3Q89A 4CP5A 4S0MA 3L7UA 3EE3A 3BBCA 1NDLA 3VVTA 4ANCA 4O0NA 1EHWA 4UOGA 3JS9A 2CWKA 3EVMA 1S57A 2BEFA 3NGUA 1XIQA 1NPKA 1NHKL 3FKBA 1NSQA 3BH6B 5CABA 1HHQA 4KPCA 3PRVA 3EVOA 1NUEA 4W98A 4F4AA 3EJMA 2DY9A 3Q8YA 4ENOA 1KDNA 4WBFA 2VU5A 3NGTA 1W7WA 2DYAA 3FC9A 1NDPA 2BX6A 4DUTA 2HVEA 5IOLA 1B99A 1PAEX 1F3FA 3VVUA 4ANEA 3NGRA 3Q8VA 3BBBA 3B54A 3FCVA 3VGUA 2NCKL 3WX8A 2AZ3A 1U8WA 3ZTRA 3DKDA 3VGSA 1S59A 3ETMA 3G2XA 3Q86A 1WKKA 1NSPA 1LEOA 1LWXA
chains in the Genus database with same CATH superfamily
3CO9A 5HP1A 4WF9Q 1C1BA 1PCAA 3D1HA 4USTA 3H0PA 4NXNJ 5KT3A 3OR2A 3VGVA 3MHYA 1WC6A 3GFZA 1TKTB 1SUQB 2BE9B 2UUWA 2YNGB 4BC7A 3IS9B 1W26A 5E0OA 2GZOA 2B0GA 2ZUGA 2AV5A 2DHSA 1TVRB 2DPIA 3DRPB 3R6GB 3PX0A 1QVGR 1D9AA 1NO8A 3IRXB 4RNHA 4DFKA 2RILA 2CQGA 3M2VA 2UU9F 4DR6J 1R8AA 4OYWA 4DV1F 3R5DA 2JEJA 3K8VA 3BREA 3M1VB 1TFYA 3SDEB 4DS4A 3TAQA 3AOBA 1KONA 1UJ4A 3PEJA 1J5EF 2H9ZA 3H2LA 2E5IA 3LP0A 5T41A 1TU0B 3HPOA 4NYPA 2Y8YA 2JEGA 2MJUA 3CO0P 3W63A 3K0JA 4USKA 1JMTA 3CCQS 1SV5A 4EU0A 1F60B 1JLGA 1JLQB 3B4DA 4F2RA 2RKIB 2XO6A 1HBOB 2NXUA 3I4PA 2V50A 4CM2A 2NREA 1NB2A 1T95A 2ASLA 5F8NA 3DRPA 1DTTA 3I55S 4NL5A 2FLLA 1QVFR 4OYOA 1XMOJ 5DM6Q 1Y5LB 3X1LB 5CD4H 1HNWJ 1AW0A 1M1GA 2LCWA 1S99A 1RHUB 2Y9HA 4H54A 4LSLA 5KFRA 5KFEA 1S5ZA 3DRRB 4TY8A 4TN2A 2K1RA 3JTNA 2VICA 2WONA 3TJ8A 1C1CB 2IRYA 2EG1A 2L9WA 3IGNA 1ACMB 3LP0B 1OQ3A 2EVZA 1FD8A 2NXEA 1FCAA 3E2EA 4NLQA 4AXIA 2J7KA 2J9EA 4OHWA 3KYLA 1IKXB 2K7KA 2UU9J 5ETOA 1UTAA 1JLQA 2CG8A 2G0IA 2CQIA 2DIUA 4PG8A 4ECQA 1L3TA 2LMIA 4G6VB 5ETMA 5A8WB 2RJZA 3MEGB 1ZTWA 4RWWA 4C11A 4YDXA 5A8KA 1RQ0A 3OTDA 2LYVA 3DC2A 3UDLA 3RYLA 1NZAA 1QM9A 2WVDA 3SFGA 1GX6A 4I2QB 1RI7A 1VQLS 4HDHA 3OD2A 2R2UA 1NUEA 4RBVA 4UQTA 3M2UB 1WSVA 5KFNA 2CNOB 2U1AA 4BCAA 2WONB 3Q2SC 2MHEA 3MM6B 4DQQA 1X4DA 2LXUA 1RTIA 5IT4A 3K57A 4JI4F 1REGX 2DYAA 1GTHA 3FC9A 5IQQA 2E5HA 1RTJA 4DUTA 5GAEI 3FSIA 3LP2B 2DR8A 4JI1J 5B0AA 2HS0A 3RUBL 5C24B 1VC6A 4OZLA 3KTQA 2MEWA 2NYIA 3IG1B 5B0CA 4ZP9A 1T9UA 4LREA 1RAJA 2HNYB 5KT4A 3FRZA 3VVUA 2L48A 4WCEQ 1U45A 2DCLA 3F56A 4CH0S 4EEYA 3I5AA 2EC0A 2BM0A 3ILOA 3M9NB 4KV8A 4XIUA 2DEIA 4K4SA 1VMBA 3OSPA 1IKWA 1R27B 2M9KA 1I94F 2XY5A 2QV6A 3ZTRA 2VG6B 2E5LF 2FJVA 3QJLA 3N5FA 1XBWA 1EP4B 2BW2A 1S1VB 2B9XA 4F4ZA 4RZRA 2K7JA 1VQMS 4O3SA 4NEYA 1YZ7A 3ETMA 3KLGA 1T9TA 4J9LA 3CGIA 1UVNA 2A2DA 4DL5A 2M2BA 2GFFA 2JVOA 3U27A 3KK1A 2QLJB 2GC8A 2UVVA 2IJFA 3FQKA 4FXDA 2QJ3A 4Y0FA 4DCPB 4CO2A 4EO8A 4JV5J 1FNXH 1XWLA 5HAOA 1S10A 2RQKA 2XM3A 2A18A 4ED8A 4TXSA 1R0AB 1GMWD 3EM1A 2OELA 2V94A 3HX9A 1KP6A 3VGTA 1D1UA 1SC4B 3K59A 4GKJF 3TUIC 3ENWA 4I67A 2IMOA 2QFJA 1BMQB 2NZ4A 3ENVA 3FBCA 1IM6A 2E1MC 2IM1A 5KFFA 1K44A 1Q95G 2E5JA 4FP9A 1HWUA 3K5MA 2RHQB 4PPZA 1HPZA 1M0SA 1MNEA 2R4FA 1RT5B 2ACYA 1LW2B 1SBRA 2KRRA 2RQ4A 2YY3A 1Q5VA 4U8VA 4F0MA 4FF4A 3G6ES 3Q24A 1FKAF 2LXFA 5IT0A 3OFGA 1JXVA 1N34J 2UXCF 3VZIA 4QZVB 4P73A 3DLEB 4KGVB 2ZH9A 3GIJA 4YR3A 5CYMA 1D8ZA 4P75A 4V19X 2BQUA 3RRHA 5DQGA 4YUDA 3CD6S 1IWGA 1PILA 3CJ2A 3QO9B 5GMKa 2ZBQA 4I56A 2HRYA 2F1FA 1MMNA 3W5XA 1O6XA 3D66A 4A8FA 4PUOA 4WFNQ 4ED6A 5HL7Q 1NHVA 1K0TA 2PMHA 2E44A 2MLYA 3I9ZA 3UD5A 5KFHA 4DOZA 2B9YA 1JJCB 4B9SA 3GG0A 4IO9Q 4C9DA 3T1AA 4AE5A 4ZIVA 3R5JB 3RU0A 3CB4A 2BMBA 3EGNA 4Q45A 2VJUA 5KFYA 2BQRA 2HAIA 2B43A 1RISA 1YDLA 3NLCA 2VDIA 4LRDA 2VFSA 4F3MA 5CYQA 3T41A 4F4WA 3WC0A 2C3PA 4ED2A 2APOA 2H4YB 3BR9A 3GCWP 2E7VA 3THPA 3J81Y 1R6YA 2DK2A 1HBNB 2GJFA 4OZ3A 1TTHB 3LQVA 1RT7A 2RRAA 4RU2A 1VC0A 1T9WA 3K5OA 3W60A 1QSYA 3NBPA 3QIPB 3T6JA 4KT0C 2YNHA 2CIMA 4DXLA 4DSLA 3DI6A 4NYZA 1SH0A 1UZDA 5C2GA 5K8OA 1U1PA 2UXCJ 1TL5A 3IFEA 3CCJS 2IA0A 1MWYA 3A8IA 2KM8B 2CJAA 3VAJA 1NJXA 3BSAA 4OI3A 1RYSA 2DNMA 4MYTA 3HHKA 1S1TB 5L39A 4QWAA 1FXRA 4K0KJ 3RRKA 2FHMA 1GQEA 1LK7A 4ZVHA 3M6UA 1HD0A 3HHLC 5MLCV 5JMNA 3W65A 1E6VB 1WG1A 2PEBA 4ECUA 4DR5J 2IVMA 1O51A 2HQDA 3KLVA 2FYXA 1NSAA 3MPYA 3P8BB 2JLEA 3L09A 4QYRA 1IKXA 1H73A 2IYGA 3BYRA 1WOOA 2JLFA 3I82A 4IG0A 4YR0A 1H7XA 2XCPA 2E9RX 3UDCA 4DR7F 2YNHB 2DISA 2KZMA 2YKNA 3KLHB 4USMA 1RT4B 2BKOA 2CJXB 3H8YA 1VRQC 2D7SA 3SZ2A 4K8RA 5I42A 3QJJA 2HFOA 5A8KB 5C25A 3UR0A 3IR5B 4IQMA 3KHLA 4A8KA 2RUSA 4ZCMA 2UXDF 3PFOA 2XYGB 2HVHA 2YQ3A 4EZ9A 2OPRB 4ZVRB 1N5QA 3QT8A 2QMXA 3S6EA 1S7IA 3FMWA 1H38A 3M2UA 4PG7A 1C4CA 2ROEA 1NSPA 1TL7A 2AQ4A 1YGYA 4U7UD 3GP9A 3HM9A 4USIA 4DV7F 1TUGB 4ELUA 2N82B 3BDEA 2I38A 3T5HA 1G2EA 3MMCB 3W2WA 4CO3A 1G7CB 4D3GA 4Z37A 1XNQF 2HIQA 3C3LA 1B4SA 2QTWA 3LPEA 2P5VA 2XZDB 5AXNA 4NXNF 3W5ZA 3Q22A 4DQRA 3IG1A 1TMJA 2R7UA 1AZSB 4KHMA 1HBMB 1S9GA 1SPBP 5KFUA 1GXTA 2E1AA 1VQKS 1S79A 4R8UA 4LRBA 4DG1B 4KV8B 3DOKA 2GMJA 2CQHA 2BW7A 2JC0A 5KFWA 1FRXA 4OX8A 1RT3B 5CQGA 2OFHX 1I3OB 2HAFA 4RUBA 1GT8A 5F0WA 5F41A 1VRTA 1FWPA 2HMIB 4DSKA 1S1VA 1N88A 4ZCIA 2BM1A 1JQGA 3TA0A 3GPAA 4OZ5A 5LMNF 1DBDA 2EK1A 4QW9A 2ADCA 4Y00A 3CPWR 4M95A 3W2VB 1ZM9A 2JEFA 3B6BA 1GAOA 2VA3A 2R7VA 4TYBA 1HI8A 3AFGA 4FS1A 2CPJA 1B7FA 1WI8A 3R6LB 2ZJPQ 4TLRA 1RCOB 3GJSB 4G1QA 1JXEA 4I6YA 2PA3A 4EK2A 1KSPA 3NNHA 2MKCA 5IWAF 3D5MA 4CZCA 2B8PA 2IYIA 3OFHA 4WIQA 1RT3A 3LTOA 4DFMA 1S1WB 3MM8A 2EKYA 2X1GA 4ZHRA 2YWGA 1VRTB 2QFIA 2MZQA 2ZVIA 4LBHA 3D0GE 3M9MB 3PFEA 5EDWA 2QEXS 4JI5F 2I8EA 1QD1A 1WTBA 1RT1B 1YBUA 2PFDA 3QATA 4PYDA 3FZBA 1M1KT 3POTA 4DSJA 1DQ8A 3P49B 3VAFA 5DQIA 3GIMA 4F50A 5HQ8A 1RT2B 1RGVA 4L75A 3OTEA 4WE1B 3KLEA 3W8GA 3MR7A 1N32F 1KHVA 2BKPA 3W9JA 1MWQA 4L6V3 1BXNA 1TL1A 1IN0A 3MR2A 1HW9A 3EDRB 2WTFA 3D2WA 5IZHA 1U8SA 2LEPA 3C8YA 1KFSA 2V9WA 1EKSA 3D7SB 5C2CA 2Y1RI 3QRPA 2I6WA 4GKJJ 5BYSA 2PE8A 2AJ2A 1U48A 1X60A 3HHDA 4DJBA 2FC9A 3IBCB 4DR1F 2R2RA 5IC4B 4ZP8A 4CLZA 4DR4F 2FY1A 1IXKA 2ZOGA 2W2PP 3OT9A 2BE2A 3M8PA 2OD6A 3T1HF 2EKNA 4KYZA 3OR2B 1NPPA 4JV2A 2YNFB 3GR0A 2I2YA 2OTJS 3C16A 5IXUA 2FY8A 1YRTA 3HHEA 4R5PA 1P9YA 2QL9B 5ETSA 4GC7A 4ETZA 4LF8F 1DURA 3HVTA 1YJNS 1SIZA 3RAQA 1VI7A 4ID5B 4K4TA 3PW0A 5CYQB 4CTAA 1ITPA 1VOMA 4C3MA 1X4FA 3AXKA 5FLXU 1HYSA 2BKNA 2DB1A 4WFZA 2CG4A 2AZ3A 3CDUA 3DU5A 3J7Z5 3RJMB 2HWHA 2C22A 2OPPB 1TK0A 4OYAA 3TAMA 5GADU 1S59A 2FUG9 1KHWA 3WC2A 2MZSA 2QG9B 1MG7A 2OO4A 1SCJB 1OSDA 1NMEB 1URRA 3CDAA 2CYYA 4LFBJ 1HWIA 3C15A 4RW9A 3PNIA 2IC3B 5K14A 2F4FA 4A8YA 3HKZD 2D3UA 2QLBB 5IS2A 4TYAA 2BUNA 1LK5A 2EBGA 4QIWD 5LT5A 3GQCA 3G71S 2D3OR 2BXJA 3NXZA 4PCQA 1KVIA 3B78A 2LKZA 3BKUA 2AJ4A 4G65A 5M2PA 2ZJQQ 1HNIB 1MU2B 1TK8A 1R6VA 4ERDA 1E6VA 5AJ3J 1UW9A 4DR4J 2VFTA 2YNIA 4LR9A 3CCSS 3FEZA 2DNQA 2AYMA 2ZBPA 4PEOA 4H4KA 2BOAA 3MEEB 2E1RA 4F2SA 4ANDA 2V5HG 1VK8A 3TAMB 3J7YU 2HLUA 1RWOB 4QR2A 3RW7A 4P2SA 4LF8J 3NGSA 3VQTA 5DLGA 3ET6B 2DCUB 4ECYA 2J0SD 1NK0A 1UCNA 4IH6A 2GX8A 1CG2A 2RHSB 2VPZB 3UDEA 4JYAJ 9RUBA 1T02A 2GJ2A 2HFUA 2LU2A 3MEGA 2XC9A 2PI5A 1HNVB 1WDTA 3PEHA 3DOLA 1EX8A 3NCQA 4OI2A 5M2UA 2KH9A 2AX0A 2R8IA 3BH7B 3HHLA 3MR3A 3CNQP 5E3RA 1BE4A 1C2PA 4OX7A 4DPUA 4QIVA 2R2SA 2HWTA 2ZEJA 6AT1B 4ELTA 4IOAQ 1ZPWX 3SV3A 1UA0A 4B3RF 1VQSA 4RUHA 1WACA 2CQPA 4OQJA 3PIOQ 3QYYA 1S1UB 3LP1B 1FXDA 4L76A 1AZSA 2C3MA 3AODA 4IFYB 5GMEA 1KC8T 3CJ5A 2BVZA 5F9NA 3M4XA 2CJBA 1YBTA 4FN5A 4DG1A 3DOKB 3VQSA 4ED7A 2Q43A 3L7OA 2W2QP 3OQ2A 2ASJA 3EX7B 2R7OA 4CP5A 4USVA 5D0RA 2CVEA 4XDDA 4DV5J 3PHTA 3KOAA 4YB6A 2YKMB 5AJ3F 4DL3A 4GRSA 2V4QA 1JJ2R 3DDNA 3DRSB 4OFZA 2RAQA 3PJWA 3S1TA 4Y2AA 4AQYF 1RAHB 2OMOA 4PWDA 4RKUC 1Q1KA 3G8TA 2VD3A 3JSMA 1FE4A 2Q66A 1FJ7A 5HO4A 4QPXA 1FE0A 4ATNA 2ROGA 3TUJC 1Z2LA 3UQSA 4F3QA 4X65J 2MDAA 1BQNA 2GIFA 3ITHA 5HI7A 3E01B 4K5SA 2RU3A 2KYZA 4HACB 1R7IA 3AAWB 5F8JA 3KK1B 1JK9B 1JKHB 2EXUA 1XTZA 4KGKA 1OWXA 2DY9A 3AD8C 3D4JA 4PQUB 5BR8F 1FJGF 3BV8A 2N3LA 3TARA 2BX6A 3TQEA 4DUZF 5KFCA 4OJGA 3BJYA 3CC2S 1D8YA 2ZKTA 2HYIB 1X8DA 3HFKA 1ZPVA 4BWMA 4LR7A 3PO5A 4QCLA 1FESA 1TKTA 1WJ9A 1ZA1B 3HVWA 4RBUA 2MQLA 3DMJA 2Z57B 3W8PA 3FDSA 4ID8A 2AWZA 4J9UE 4ANEA 2NSBA 1IUJA 1U6ZA 3BBBA 3BR8A 3Q8VA 1BQNB 1TVRA 3TAPA 4FVMA 4RWXA 1CJVA 1IBMJ 3FCVA 2V67A 4DPOA 2IVYA 2L3MA 1U8WA 2XSFA 4ETXA 4ZJQA 4LFAF 1UAWA 3PX4A 2M52A 4OZ2A 4ZA1A 1URNA 1JKHA 1VQYA 4TY8B 4R0JA 2K1RB 2QN6B 2WZ1A 3Q8RB 2CPEA 3SQGA 2R2TA 1DJ0A 1P8GA 3LANA 4NA3A 3FSYA 4F3OA 1O5JA 4PRFA 2VB6A 1YK9A 5LJ5Y 3LOUA 5KFGA 1QE1B 4JI3F 3E51A 3OL8A 4DQSA 4XDCA 4DZDA 4OJ1A 1U2FA 1NCLA 3UCZP 2ATLA 2Q3PA 3GIRA 5J2QA 1N33F 1JLGB 5H1SV 2BBEA 1D09B 2GIRA 3GTYX 3I4HX 4I6WA 4AL5A 4JI0F 3GYXB 1FTRA 3DCAA 2RDDA 4ZPBA 2DRAA 2ROPA 1LNQA 1DY3A 2B9WA 2C3OA 2AYBA 1Y4ZB 4CTAB 3VAMA 3GFHA 2FC8A 4Q5VA 5MAOA 2DGXA 2Z2LA 2R7WA 5CCMA 3IWLA 4ECTA 2DGSA 3DRRA 3SMZA 4Q0BB 1S7HA 1KOHA 4ED1A 4LFCF 4DBQA 4I0WA 5L46A 4IFVB 2G9OA 2J8AA 5EUHA 2O3DA 1RU2A 5RUBA 4Y2MA 1L3KA 4OI0A 2HZCA 1UJ6A 4NMLA 5L9NA 1RT7B 5CAAA 4CLKA 5E3CA 4ZJOA 3C2PA 2H51B 2I0XA 2HVDA 2WK4A 2EPIA 3GCXP 3M8QB 2VKZG 2ATCB 4OYIA 4USUA 4ZP7A 2CPZA 4Y28C 4ZVSB 3TANA 5DG9A 4P2XA 2CNNB 3M6XA 4W4MA 2HNZB 4QWEA 4OX9J 3I31A 2DGUA 4M5NA 3J7A1 4JI3J 2AF6A 5JUMA 2F7VA 5HBMA 4A8QA 3GIKA 1RTZA 1NH7A 5EWGA 2ZH4A 4Q8EA 4F04B 2K8GA 1GMWA 3KLGB 4A8MP 1UEUA 3ILIA 2CQ1A 4DV6J 4BDPA 2VH7A 4O3QA 3ZTSA 3IBFB 1FT8A 1SJRA 4IFVA 1X4AA 4X4TA 3GYGA 2HGMA 1S49A 4P72A 2UUBJ 1JXLA 1RWKB 2HHPA 3H2UB 4JOUA 5ETTA 1LFWA 2PO4A 4IO1A 3OHBA 2VG5A 1UVJA 5CCLA 1R0AA 3KLFB 3E8OA 3M8QA 4J9QA 1I94J 2HNYA 2M7SA 4LQ9A 1SH3A 2MQPA 3CJ3A 4ZN1A 3CE8A 4RW8A 1TKZB 2AX1A 1HNVA 4FPRA 2V9KA 1WEZA 2VPWB 4BS2A 4M5HA 5K8MA 4ZLJA 3GB0A 2CWXA 2OPRA 2XMJA 5B0FA 2HQIA 4LRFA 3GYNA 3JQKA 1H2VZ 2MKKA 3KG0A 1YKWA 1VQNS 2G0CA 1EP4A 4H4KC 5G4DA 1QUPA 4Q2LA 2PMZD 2JNJA 2HHHF 2YPZA 2VUGA 3TVZA 5DGAA 4F8RA 3NMRA 4ENOA 1OY8A 1QDUB 2POKA 2Y3YA 3IWXA 3I9V9 3NGTA 3CDBA 1H72C 4NI2B 4WBFA 1NDPA 2W25A 1KTVA 2CZ9A 5DDQC 2GO9A 2H3EB 1RABB 3I0SA 3KK2A 2HBRB 2FHJD 2R8JA 3QRRA 3T1HJ 3KHGA 2E1PA 3T6BA 3D6TB 5KFDA 1UVKA 2OP5A 3QQCD 3NY0A 4CNZA 2IM3A 1VJWA 2R8HA 2XNRA 2DTJA 2H54B 3PXGa 3BPSP 2YQ1A 1OY6A 5EX3A 1GX5A 1Y10A 2JC1A 4C98A 3TVKA 4PUOB 1ZYQA 4LVNP 4Y6IA 3T5JA 3WX8A 2DH7A 3C6TB 1JLEB 2O67A 4YMEA 2DKOB 2OPQB 2L08A 5BYQA 1F9EB 1T94A 4I2PA 4LVOP 1AROP 2JOQA 1FDBA 1PBUA 4PQAA 2QIFA 2LVWA 1UWBB 2LQ5A 2D41A 3BYPA 1I1GA 3ZZTA 4N7TA 2ZFHA 3QWPA 1RKIA 1JLFA 1LWXA 2XULA 5I4MA 5AT1B 1NKEA 3CWJA 4U96A 5B09A 1FDNA 3QMQA 1N4LA 2OIHA 2WVCA 2HHXA 2VBXA 3LAKA 2G2ZA 1U0HA 3AT1B 3PYFA 1RT6B 2HQCA 4ZVQB 1FD2A 3FBBA 3J80Y 2RRBA 3SCLE 1YX2A 4Y34A 5AXMA 3ZZZA 1S6PB 1DQ9A 3GV5B 3F73A 4B3MJ 1ZBTA 3DRYA 3HI9A 3R9LA 4NLOA 2ZH8A 2VFUA 4AL6A 5J2PA 2OEKA 4X4OA 1QLNA 4X2BA 1Q0NA 5L1JA 2C2KB 4KO0A 3V6JA 1S1XB 1KR4A 4OYPA 4DMZA 1X31C 3UO0A 3OL9A 2XZTB 4PWWA 1SJFA 3ULHA 2Z4PA 2ZBIA 3MFIA 3MAHA 1DHMA 4B02A 2DR9A 5JVHQ 4C6AA 3BN7A 3V6KA 5IFMA 2XLIA 3ELHA 3MMAA 2UV8G 5THWA 1WKJA 4DUZJ 3OTBA 2PMWA 2K06A 1X5TA 4F0KA 4DR6F 2MZJA 3OXLA 2J9DE 3RRGA 1IBKJ 3CDWA 5E33A 3KLHA 1PG5B 2C42A 4DX6A 3IM8A 2E29A 2M70A 2WVFA 2ZD1B 1JNZB 5A2QU 2LDIA 4PG5A 4DN9A 1S77D 1LXNA 3H5SA 4NYOA 3KK3B 1U24A 3EVWA 3M05A 4CT8A 1RKJA 3V81A 3B8HA 3MEKA 4MK7A 1V6HA 5D3GA 4B3OA 2HURA 1Z1ZA 4FF2A 3ZC4A 4KH1B 1S4FA 4L3NA 4E8UA 3ZFVA 2GNKA 3J7ZT 1WD6A 3KJNB 4RW6A 1N5TA 2HK2A 3HSGA 2EC2A 2MKIA 5T7LA 3IC1A 4ES3A 4KHPF 3NG8A 5ETVA 2EG2A 1NK9A 1NPKA 5HANA 4K4WA 1CJUA 2RNEA 4ZPWR 5JVGQ 2FVPA 3AA8A 3BH6B 3T3FA 4R8UB 2YKNB 3PRDA 1CLFA 1N48A 3NAIA 5B0DA 2HQGA 1S97A 3BO3A 2RUGA 1FK9B 3BSNA 3SSRA 1NM2A 4U9RA 4K4YA 2JZ5A 4UUXA 2HHTA 3VTIA 3UD4P 3CIZA 2K2PA 4OHZA 5J2NA 2I9SA 3CF5Q 3MR6A 1RSCA 1TELA 2DH9A 2JJ4D 4LF5F 1M5KC 5BR8J 2CPYA 1FJGJ 2F40A 2VPYB 4B9MA 3U02A 1LWEA 1TL3A 2WVBA 5A6WA 4CH7A 1Y5IB 3EZOA 2ZVSA 3OUYA 4TU8A 2HHVA 2G1DA 4K4XA 2VG5B 4YR2A 1Q86T 3MEEA 3A3NB 2R3VA 4LSZB 1X9WA 2BRLA 4ZVGA 4ZMMA 2IJRA 4QIFA 4LT6A 3HT0A 1FRHA 3MI7X 4G1IA 3T19A 3US5A 4X4UA 1TKZA 4KKOA 2ZH2A 1IR1A 3HSDA 3K5LA 4LF4F 1UVLA 4PYAA 2VOPA 1T3OA 5F3TA 3TJAA 1PYSB 4OZ0A 4PXBA 2W9AA 1UMJA 2CADA 1U1LA 1YBAA 4CLUA 5KT6A 4CO0A 1UVIA 2WOMB 4FXWA 3QZ7A 4AFFA 3G2XA 1NHUA 1WG5A 2COLA 1VJQA 2W4CA 3M8SA 4KIAA 1HWJA 3Q23A 3AB4B 1JJ4A 3G4SS 1UL3A 1SI9A 2G4BA 1HD1A 2DGTA 3GJRB 4HTIA 2LEAA 4NI2A 4A8SA 4OV1A 4B9NA 4FXVA 1CQNA 3A13A 1UVMA 4X4SA 3X3UA 4WTOB 4RW4B 1C1BB 3A1YG 4PXEA 5LL6d 2UUBF 2HPUA 4C8YA 4NEZA 5F3ZA 2KG0A 2YVSA 1N33J 2OUGA 4HT5A 4ED3A 3WX4A 5EHHA 4NXMF 3HO1A 2HNDA 3DLKB 3MCNA 2GMHA 2ZNZA 1TKXA 2DHHA 1FNMA 3BKFA 4K2XA 4QR0A 4RNNA 2XBPA 4DSIA 1UETA 3MR5A 4IOBA 1JLEA 2B4PA 2FLNA 1VQ6S 3MDFA 4ER8A 2AYEA 3KHHA 3CDEA 3MMBB 3PDNA 4DUYF 2YNFA 4ECVA 3TOQA 2CNLB 1R8PA 1X5OA 2HSEB 4U7UK 5AE1A 3P4UB 1U7LA 3POTB 4Q43A 1ZETA 2LA6A 3RR8A 1HBOA 4IRDA 4G3IA 2AZ1A 1RJJA 5E3AA 4YQWA 3VAIA 2P6TA 2DXFA 2JSXA 1S6QB 2GO8A 3HVTB 1Q8BA 3QAUA 5FDLA 2YWHA 4C3KA 4ZPTR 4F0HA 4DX7A 5D15A 1S0MA 2Q6CA 2HGLA 4ILRA 1N5SA 4M1KA 2BANB 2BRKA 7AT1B 4X62J 3ISNC 5CD4A 3DDKA 1KOOA 3V4IB 2HBQB 4QPTA 3PW7A 1WC1A 1HYSB 3QWUA 2KVQE 4URQU 4DU8A 2DNGA 2VASA 1WEYA 3NOGA 4Q2MA 2J9CA 4I69A 3TUZC 1VBYA 4LF7J 3BSOA 1G1XA 1DTTB 4QYZK 4UUWA 1ZA2B 2E7WA 1N34F 2QLFB 4WIIA 3VWSA 4C48A 4USWA 4QWBA 3R1LA 2BE7D 3JSRA 1DZ5A 3F41A 4F4XA 2UVWA 2KDOA 5I3PA 2DVIA 2MZRA 4CYUA 1N0VC 2DXEA 3HFVA 2YX1A 5A0YA 5LXRA 4P9SA 4ES2A 2IC3A 3PACA 5K14B 3J81U 2C2MB 3L7UA 1F2GA 1NJZA 2GQQA 3CD7A 5A8WA 3C16B 4XO0A 2GHPA 1DTQA 2X1BA 2VQEF 2D1CA 1T03A 3OFEA 1S0VA 1DQAA 2QA1A 4OHYA 2GS8A 1FA0A 1AFIA 3WIVA 2R42A 2WW4A 2PFFB 2DD8S 3R27A 2MY7A 4MK8A 3WDOA 4DLEA 4Y65A 2HS3A 2V8DA 3T5KA 1TKDA 2VG7A 3NNCA 3MOJB 1FFGB 2QA4G 1IQZA 1SKWA 5IM0B 3HKWA 1FEHA 2V68A 4C11B 5DS7A 5A6PA 2KTQA 3EVOA 1RA7A 2MQMA 4C2MA 3O5TB 4GKKF 1Y0HA 3M8ZA 5KT2A 2ZD1A 3DLJA 2KFNA 1YWXA 2ZOFA 2WSEC 2KFYA 4O3OA 3NMAA 3SXLA 1V5IB 2H48B 4A8WA 1K9MT 4OZNA 2Z2MA 1F5BA 3J7AN 1VRUB 4MIWA 2BABA 4LIWA 4M5GA 1P6TA 3NRBA 4OI4A 1PJ5A 3MZIA 2U2FA 2RSQA 5C24A 2R7RA 2OPSB 3FSXA 5LMUF 3TW0A 3KKFA 2FPHX 2VG6A 1RWWB 4ZS6A 2XY7A 2XGQA 1RHRB 2YQ0A 4RW4A 3KXDA 5KFSA 5DGBA 3PTWA 3LP1A 3HULA 3NGKA 2VIHA 1BD6A 1T11A 1IWAA 4FYVB 3G82B 5EX0A 1IBCB 5L38A 3C6UA 1IKWB 4ZN3A 1SKUB 3V5RA 4C8MA 3P96A 3PIPQ 4K0KF 2FHOB 4NLUA 5J1EA 2MSSA 1KLNA 3Q86A 3W61A 2ZZNA 1R8BA 4GVBB 2WHOA 3TA1A 5HJYA 2YWWA 2KKHA 3NKYA 1VRUA 3DRSA 4NASA 4UOFA 1I6JA 2DHGA 1X0FA 4IG3A 4MAKA 1ZS6A 2Z58B 2F3JA 1AT1B 5KFMA 2DNPA 2ASDA 4K7QA 1JLAA 2AJ0A 1CJTA 4MJKA 2NXCA 3DOLB 4RJVA 5D77A 2OMLA 4OMFG 1JB0C 3QT7A 1MROB 4DPTA 4JI7F 1J5OB 5B0GA 3U1NA 4DQIA 4CIOA 3PJ9A 4YB1P 3HK2A 2W9CB 1LFPA 1LW2A 1WSRA 4O4RA 4KHPJ 1FX4A 4F36A 3GJQB 3IP0A 3ZTPA 3W62A 1R8HA 3DHXA 3EZUA 2AT1B 4AXJA 3GJTB 4I64A 3IWNC 3MPVA 1OY9A 2LXIA 4KKOB 2Q1LA 2W4PA 1K47A 4WZQA 3AOAA 2OLWA 1VIXA 2JL9A 3DOMB 1XNQJ 1Y3JA 1QAIA 1VGYA 3DYAA 1FEEA 1MN9A 3M2RB 4RW8B 2HWIA 1C0TA 3MUTP 1YJTA 2ZE2B 3FEXB 1K8AT 4DV2J 4IQXA 4I6AA 3DN9A 4CO5A 4CH1A 1C0UB 4ZKAA 1MROA 3H98A 2ERRA 3UFCX 1FWLA 1H2UX 3M8WA 4DV1J 4YY3J 3TEHB 2J6TA 3TWZA 2OEMA 1SH2A 2VKRA 3UVJB 2ADBA 1HL6A 3ITHB 4NLTA 2M8HA 1XN9A 1M5PC 3FBFA 2FGCA 2D9OA 4PWUA 4DL7A 2XMKA 5C7PA 2PN6A 3MURP 3SQGB 5IV3A 2HNDB 1TK5A 1VR6A 3FRYA 4MMOA 2DNLA 2YKPA 5B0EA 2WSCC 4OYMA 5KFJA 4WXWA 3OTOF 5HP1B 1SIWB 1YRXA 1A9NB 4MIAA 1NDLA 3DFEA 2LP4A 4V1Ak 2FTRA 3V6HA 2HHSA 1EHWA 1KRPA 1SUQA 1R43A 5K8NA 3KJVB 2CWKA 1XJWB 3EVMA 2AJFE 3M6WA 2B7BB 3TA2A 4XPEA 4AQYJ 4CCHA 1X5PA 3GFXA 4JUZA 2GQ2A 5IWAJ 2RVJA 3HJVA 4WYWA 1FO1A 3UVJA 1IKVB 2CRLA 1FRIA 2CDQA 2J7UA 3FKBA 2DNRA 5ETRA 1NSQA 2JDJA 3M2VB 2AMCB 4O4GA 3VCDA 2ZHBA 3ZZ0A 1VC5A 4CLWA 3RBZA 2ZH7A 3V4IA 1XERA 2ZDOA 2F9DA 3ZXWA 2Y8WA 3P6YC 4Q0BA 1FXLA 1U1MA 3BQ2A 2BJ9A 2IHR1 2EFVA 1N8RT 2LA4A 2EFGA 2R7TA 3U1MA 2NYHA 4HKQA 3SCJE 2C3YA 2SXLA 2QC3A 4ED0A 1ULRA 4YY3F 3BGOP 4DHVA 5D4LA 3OVAA 2CPDA 2AU0A 1Q7YT 3PY8A 1SQFA 2P9CA 4N77A 1S9EA 3RZAA 1Q78A 2VDHA 2DGOA 4CYUB 5HROB 1Q4RA 1SVDA 2CQCA 3N28A 4JB8B 3SBMA 3ZZOA 5HMZA 2KVIA 4UT4A 4N5SA 2EK6A 3TZXA 2IMWP 4NCBA 1NNDA 4NLPA 5J2QB 2BR0A 2MB0B 1RBAA 3NEKA 1GH8A 2RE1A 1A7GE 3D0IE 1WOPA 2LDYA 4P10A 3P3DA 4O4GB 4NWBA 1ZH5A 4PXDA 1NK4A 2F5GA 4EFAC 2OH2A 1TV6A 1RCXB 2AEFA 1IBMF 2J76E 1FNOA 2KG1A 1WDDA 4RR5A 4UF4A 1LWCB 1FRLA 4WFBQ 4LF6F 2V8VA 1Y11A 4ILLA 1VBXA 1C4AA 2K3IA 5KFQA 3RBDA 1FFSB 4KGZB 1T3NA 4LF7F 1WKKA 3QAEA 1VISA 2XWYA 4WWSA 3MAAA 2BJ7A 1LEOA 3A4TA 5J1NA 2H65B 4N47A 1NK7A 2LQJA 2QYGA 3AQOA 2XB2D 1BQMB 1TL4A 2DJWA 3FVYA 2YKQA 1PBAA 2KI2A 1U0SA 2HFSA 2N7YA 1CS4A 1KLMB 1X4CA 2B6AB 2MQ8A 1T9XA 2VZ9A 4ICLA 4O23A 4RW7A 3OFFA 3SFUA 1V9OA 3PHEA 4GMKA 2C2DA 1RTDB 1M1HA 1X9SA 4PAAA 3H40A 3TP2A 1RAAB 3EGVA 3Q8PB 3L9ZA 3Q0AA 4DWIA 2VQFF 3UN2A 1P1TA 3KK3A 3PX6A 2XMWA 3ILLA 3V81B 1HQUB 1S9GB 1SQGA 5CH7B 2Z56B 3OPKA 4O44A 2HMIA 2X1FA 3R5GA 4ZVUB 4JV1A 4LFBF 1EKRA 1EAYC 4IDKA 1T9VA 3EICA 1R3NA 3KG1A 2JHEA 5BYRA 4JI2F 4KY3A 2DNNA 3I56S 3SYZA 4ECZA 2WB4A 1T05A 2QLWA 2GW8A 3LP2A 2XMAA 1LV5A 2V4JA 5HQMA 5J1EB 3MTJA 1Z4UA 3FQLA 4EWTA 4GVBA 4YOEA 1H98A 2B8QA 4U6PA 2W24A 4C8KA 1B0TA 3LGHA 4KBIA 2K3KA 4YHHJ 1WC3A 1ZTTA 4U95A 2FGOA 3DGPA 3T9ZA 2ZC3A 3CD0A 4NZ6A 1WHXA 4K59A 4DSFA 1QTNB 4DSEA 2R8GA 2L41A 1BUXA 3LPYA 4X4RA 3BM7A 3K2YA 2W2NP 2V6AA 1F6TA 1MN7A 2FJAB 2H5EA 3L7PA 3RGIA 3UI3A 4DFPA 1TUWA 4DCOB 3UCUP 3TI0A 1YI2S 1QTMA 1NAQA 2DH8A 1ZAVA 4OV6A 1TAQA 2YKAA 1NLKL 1RT2A 4KHRA 1T05B 2JFKA 2XY6A 4IYQA 2KJWA 4CLSA 3FZ2A 3O2IA 4NLXA 5HK4A 1F0XA 2AEMA 2CVIA 2EFOA 5KG0A 4CWBA 1V3RA 3U1LA 4XK8C 4MK9A 3M32B 4O0NA 4ZLPA 4DV3J 2OSQA 4B17A 3ZZUA 5E3QA 1U02A 4JI6F 3SV4A 2XYPB 3H5UA 1J5EJ 1RT6A 3AA9A 3GFYA 4MKBA 4CO1A 2BJ8A 2CKWA 4P71A 4JI2J 2ZE2A 4NMXA 5A76A 2W2OP 1N6QA 4NLGA 3T9NA 1ZAWA 1D3WA 1HHSA 1HHQA 1HMVA 5H9EK 3IRXA 3N5BA 2WOMA 3PRVA 2OTLS 1GK8A 1PGZA 1M5HA 4F4AA 4JV5F 4YB7A 3QRQA 3M1VA 2XI3A 4OZ1A 4M5LA 2BJEA 3SDEA 5HLFB 2FJXA 1Q53A 2P9EA 4GO5X 1GTEA 2RS2A 4ZPVR 2W4DA 4ZDNA 1VBKA 1FDAA 2PEHA 4WFAQ 3D3CJ 1FRJA 4Q44A 2XGPA 3RW6A 4MKYA 4XAKA 2KU7A 4BBYA 1IR0A 1PAEX 4R25A 1WOSA 2MGZB 1CVJA 2EWHA 1H3DA 1SC1B 1CULA 1WWHA 1Q79A 1WUUA 4TVAB 4DR2J 2KN4A 3KMQA 2CQ0A 2HGNA 2IBOA 2HRTA 4FNIA 3MMAB 4IOCQ 3V4MA 2B4VA 2X51A 3LW5C 3IR6B 3GILA 3BEGB 4URGA 2R7XA 4IR9A 4YN3B 2NXJA 4FBUA 2OSRA 1OSCA 3MOZA 3DLKA 1MLAA 4X66J 4RPFA 5C5JA 3N79A 2V2QA 2J6UA 1KVKA 4DV2F 2AEJA 1BY9A 4U8YA 1CJKA 4M94A 4KH0B 5DG8A 2LEBA 3I0RB 3DKDA 1WHWA 2JVRA 3FMBA 3ZZPA 1JLBA 5C42B 1P1LA 2MQQA 1NB7A 3QGPA 1OS5A 3TQ1A 4C0OC 2H1YA 3MMJA 4PKDB 3PYEA 2OPPA 2VA2A 4DR5F 2J0QD 1CC7A 3IN5A 1UP1A 5E5NA 2DXDA 2LFVA 2X3DA 5ETNA 3UR3C 1HNIA 3N9UC 1YZ6A 2BANA 3R3TA 4F26A 2JRSA 2YNIB 3PR5B 3MM5B 3K17A 3WHIA 3ZTOA 2XS7A 3HVAA 5K9FA 1JIHA 2KJVA 4GO7X 3K89A 3NGDA 4I68A 3TZZA 1A0OB 1MU2A 3GE9A 1TP7A 5IT9Y 2B56A 1H2TZ 2J0XA 2MKJA 3G96A 4LF9J 1HI0P 3PV8A 5A0YB 1H0HB 3CVKA 5CYJA 3ENAA 3L3CA 3OL7A 1TV6B 1XMOF 5D8HB 1KTQA 3WQPA 1N54B 5HMXA 4D3HA 1DTQB 2FLOA 3K7RA 2DRBA 3EWGA 4E98A 1OJ4A 2PA8D 4HH1A 4LRAA 4X66F 3EMTA 1QSLA 1RTJB 5GAGI 2NUHA 2BDPA 4FYDA 2HEKA 2D69A 3HCXA 1XMBA 3QGIA 2KM8C 4E0DA 4UY8T 3R7BB 3UPFA 5GADI 2RB7A 2ZOMA 3AOCA 5HMYA 4Q8FA 3H25A 1S4EA 2KO1A 3OUYB 4W90B 3M8RA 3CMES 6FD1A 3DHWC 4H4MA 3AXMA 3ZNJ1 4HTJA 1K0VA 5IM0A 4TU7A 3FJ2A 2BZ2A 2YH0A 2BV3A 4Z2XA 1X5SA 2XMVA 2V69A 3M30A 1B7YB 5KG6A 4ZLNA 4CO4A 3ZNUA 5ITHA 4LRCA 3PR4A 1DLOA 2VFVA 5D6GA 5J2MA 4QWCA 4NRTA 2HFNA 2GJIA 1LW0B 1VQOS 2IFXA 3HSJA 2XZWA 4RBTA 1NDCA 1V3SA 3WBZA 1Q81T 3QSIA 4C97A 4LF1A 2MQNA 2Y1LB 2YH1A 3OHAA 1PKUA 4FPIA 4NCAA 2VOOA 3EE3A 1Q5YA 4QQBA 3MEDB 3TEGA 2ZKUA 2N7CA 2LU1A 2ZNYA 1RB0A 4KE5A 4ZPCA 3D0HE 3IRWP 3CCWA 1VIOA 2IBKA 3FUYA 1TR0A 3O1LA 4K5RA 3MXHP 2VBZA 1H74A 1IM4A 4HHHA 2CQ3A 2HQ3A 2I5JB 4DV0J 1RK8A 3PKYA 4B9VA 4MYUA 1IKYA 1YHQS 4X4NA 1WF2A 3IA0A 3CJ8A 4RX6A 3AHPA 4CT9A 5CABA 2ZHAA 1PIEA 2WBMA 5FIIA 3CCLS 4JI5J 1NJIT 1HA1A 1I5OB 5SZTA 2DNOA 4LJMA 1REVA 4UZCA 2D3O1 4LSNA 4DV7J 3AD9C 1LW0A 3CCUS 4W92B 4C8NA 3CCES 3SIPB 2VJVA 3CEDA 4DL0C 5GAGU 2GAGC 4ZCKA 1UEKA 2VU5A 4IG3B 4R0EA 5D0GA 4HHJA 1W7WA 2V8HA 4ALZA 1IBLF 1RAOA 4RNMA 3D28A 2XSJB 1U25A 1VDHA 2RDJA 1XNRJ 3DMJB 5ETLA 2MJNA 2O1PA 2MPUA 2WCXA 1J5OA 3OBIA 4JP8A 1XC9A 2GV1A 3MWBA 1UA1A 3JAMU 4OLOA 4BC9A 2QMWA 3M32A 4B3SF 5E2QA 4PG4A 4ZVEA 4RNOA 1L3VA 3OJSA 1E6YA 1SC3B 3QT6A 4O3NA 4NZ7A 2MZTA 3LO3A 4KFBA 5DDOC 3B54A 2WAQD 2FVRA 2NCKL 3KG4A 3PW5A 1LXJA 1VK3A 2HW3A 3D68A 1EIYB 4Y2CA 3LUYA 1YVFA 3BKTA 4OLPA 5A8RA 3R7SB 5HATA 4C0HA 5LXYA 1U1OA 4IR1A 3A3PB 3C66A 3KDNA 1M90T 3QSYB 3T5LA 3FGVA 3M2RA 3ILJA 1AB8A 1C0TB 2B9EA 4DV0F 3H42A 4H4OB 1LQ9A 1HBUB 2QO3A 5BXIA 5BJRA 3J80U 4J9RA 4IH5A 4OZJA 1BC6A 4M5JA 4EBEA 4UOCA 2GVZB 1FERA 3KFWX 3MM9B 1HQEA 2KT3A 3MCMA 4DL6A 4ZVOB 2CNKB 2ZUAA 4KPYA 4V19J 3W7BA 3DM2A 2DHXA 4OL8A 4P2MA 3W1YC 4A48A 5F8IA 1GXLA 3JSBA 4KFBB 3N6LA 3RB4A 3JQMA 1NU4A 4ECWA 4N56A 4ITSA 1L5UA 3UD3P 1T7PA 1PC5A 3HF5A 2YWKA 2J8SA 2HG4A 2F8HA 4J9SA 3LH2S 4M63A 4TLQA 1S0NA 3MPDA 1LWFA 2C1EB 1DRZA 3I0RA 4WZMA 1U6FA 4WKYA 3HMJG 3H20A 2MSTA 2FVCA 1NPRA 1YRUA 3R2DJ 4H4OA 4C8ZA 4OJHA 4L72B 1B3TA 3MCOA 4NX9A 3BQ1A 1JJHA 1FI4A 1HR0J 4M8LA 3HHNB 3CUNA 4NOHA 2ZM6J 1BHNA 1HQEB 1JLCB 2XS5A 2G13A 4DR1J 2OPSA 1V3ZA 3OVBA 3DGVA 2GGPB 2MKHA 1QY7A 1WELA 4LR8A 2ILYA 4OHVA 1SV5B 1SQEA 2NS1B 1OO0B 2HRUA 2V63A 3FFIB 3C14B 4FKYA 4IG0B 2I1RA 2V0NA 5SUHA 3UCGA 2VG7B 4EMDA 2YWEA 4UOHA 4QBUA 3G6VA 1F2HA 3L95X 1HLWA 2W1BA 2ZWPA 3BO4A 1SKRA 4OIXA 4OYZA 2E9TA 1XK8A 5LJ3Y 1OIAA 3V6DA 4LSLB 5DDPC 3C15B 2V2KA 5AXLA 1VQ5S 3QFHA 1TL7B 1CEZA 4QU6A 3HSZA 1HNXF 1D9DA 1M5SA 2CDRB 3BGRB 2AGPA 1Q8LA 5HVFA 2VQEJ 3BF4A 1JLCA 2XWXA 3DLGB 3HXMA 3MGJA 3EUNA 5F9LA 1NJYA 1W2IA 3EPGA 2LQ9A 2VPXB 1RE1B 3IBWA 3C46A 4J9OA 1PAUB 4CLFA 2NQPA 1WC0A 2VFRA 5CHCB 3GSDA 3HD2A 4J37A 3MM6A 2C28A 2M0GB 2XS2A 1RTIB 4EBCA 2MY8A 1QSSA 2CPXA 3PG9A 4NLYA 1F3VA 4B9LA 4EI2A 3UDVA 2PIIA 3THTA 1KS2A 2CZ4A 4YP3A 3CMAS 3AJ1A 4Z7YA 1RAFB 4J9KA 1UJ5A 3I87A 3D6FB 1S9FA 1T9YA 3SCIE 4C8OA 3W66A 2GCFA 3CJTA 4WFXA 3N4WA 3MD3A 4PR6A 4EZ6A 3QZ8A 3DLGA 3K5PA 4P7TA 4KR0B 2R9LA 3IGVA 2BYCA 2HBYB 2QA2A 4ZVTB 3RB3A 3MD1A 3EZ5A 4NA1A 3NS6A 4QR1A 2ZH3A 2HHQA 4NXMJ 3DNCA 2CPHA 2CJ9A 3GONA 3HDSA 2VF3A 6FDRA 2NXNA 2J0WA 1F9FA 2XO7A 1W2BR 3VGUA 1S76D 1YJRA 5JJBA 4L73A 1BWEA 1YQHA 3UN3A 1FRMA 4JYAF 3PYDA 3TZYA 1MW7A 1PYOB 2C2ZB 1S1WA 3HP6A 5FJ4A 3A12A 1NK5A 5DO2A 3LWMA 1K73T 1MSWD 1NXIA 1GEHA 1V5VA 2OPQA 2A6OA 1SKSA 1EQMA 1RADB 1CC8A 3F0NA 1OYDA 3FK4A 1FJEB 4B3RJ 2PC6A 4K4UA 5DJBA 3DGPB 2NPFA 3KJVA 1T8EA 3OJUA 1U4BA 3M8YA 1NH8A 2M8DB 1Y5NB 2V2VA 2ZZMA 1IKVA 1RP5A 3LGNA 5T14A 5B7WA 5KG4A 1N0UA 4WFYA 1NDKA 1J27A 1ZZNA 1U1KA 1RXOB 2IAJB 3OXGA 4NCGA 2XHCA 2JH3A 5L8RC 3A8EA 1U1RA 1PO6A 2W7OA 4K4ZA 4OJ3A 3TRGA 4ES1A 2ALYB 1X9MA 3R2CJ 2O5DA 2VV5A 4B3TJ 2MMYA 4PQUA 1ZAXA 3GLJA 2XHWA 1RT5A 4LF9F 1U09A 4MKAA 3VAGA 2Y1JA 1VQPS 1N5YB 1RHJB 1IR2A 3OLAA 3QLHB 3QT5A 3QIDA 4J91A 4X65F 4CLLA 3QO9A 4I7FA 5KG5A 3SCKE 3VHQA 4L74A 1EARA 3S01A 2KT2A 4X64F 3S8SA 3H5YA 1W25A 2W7AA 3CJ4A 1UKUA 3D1QA 3MECA 4EGLA 5KG2A 2UXBF 3DLEA 2BJDA 3W9IA 3TX8A 4AYBD 1XNRF 3ADAC 1EQ0A 2R7QA 3PW4A 4YB5A 2HZAA 3D6HB 3VV2B 3VF0B 1CJVB 1LKZA 3LA0A 4PZVA 2J7WA 4LFCJ 2RIJA 5HLFA 1PJ7A 2X7IA 2DO0A 3DM2B 3N6MA 3PRBA 4GKKJ 5EGYA 1X7VA 1EZZB 3HZEA 2F8EX 1L3SA 5J1PA 3H7HB 4TNOA 5IQ6A 4NZ0A 4U67Q 2OKQA 3NNAA 1APSA 4Y3CA 1FKOA 1RHKB 2MGZA 5DG7A 1YSJA 1UEVA 3O8WA 3FBEA 2B4OA 3JTPA 1QE1A 1ELOA 4S0MA 2LLZA 3NWRA 4FYXB 2LQBA 4AL7A 4ECRA 5DRKA 4G1PA 3OVSA 4RLEA 5D3GB 3BDPA 1YJUA 4UOGA 4KB7A 2MYFA 2M5YA 4HHUA 5LMUJ 4ED5A 3PW2A 4X62F 4DS5A 1RZMA 2ZWOA 1NKCA 3IR7B 1S57A 2RT3A 1M5OC 3DU6A 3SQOP 3AH6A 1ZOTA 3KDOA 2HVIA 3W64A 1NHKL 2RQMA 3UE2A 3JTOA 4BWJA 8ATCB 4DDFA 4DV6F 1B70B 3KMSA 1S6OA 2GGPA 2MLZA 1KBRA 2V2ZA 3B82A 3G6XA 5J2NB 4YDDB 1HNWF 4IDKB 2W9BA 3G9CA 2QX0A 5HVGA 4XPCA 3VR1A 3HVRA 2FJEB 2CJKA 4ILMA 4KSEB 4HL9A 2F9JA 2M88A 2DIVA 1U2CA 3TR5A 1HQ2A 1TFWA 3NOCA 3TJ9A 2FZCB 5KG3A 3V6DB 1U1QA 2VL1A 2IIHA 1JWWA 4DPXA 4JI7J 1CS4B 1WHVA 2B6AA 4HI1A 1VQ8S 3M7VA 1HKAA 2CJQA 2ACMA 1ZM4A 4ZLLA 2B5JB 2ZZTA 4ZOSA 4ZVPB 3NCRA 3L4BC 2JLGA 2ZM6F 2Y0SD 5L1LA 3R97A 2CJYB 1UFKA 5HN0A 4TQSA 2Z30B 1XMQJ 1OPIA 2O66A 3E3XA 1RYRA 4USJC 5AE2A 3JYTB 2W9BB 1RWXB 3PJXA 3R5CA 3QGHA 4QYZJ 3MCSA 1RWVB 4CM0A 3MMCA 1FWKA 1X4BA 3ETOA 4GC6A 4LF2A 1ZZFA 5KFKA 2V4JB 3OXFA 2YTCA 3VALA 4A8OA 2RS8A 3EYZA 4JI1F 1SB6A 3KLFA 1SJ4P 2FIUA 3U7JA 3BB5A 4MFBA 2HFZA 4MH8A 2AGOA 4JBCA 4XTTA 2YKOA 2GVDA 3W2WB 3KJQB 3Q8UA 2M3DA 4JI8J 3JSYA 5EN1A 1TKXB 4HVZA 1PYTA 1SL1A 3CTRA 2F63A 3GU0A 3E01A 3ZTQA 2UUCF 4HACA 2AKWB 2VQFJ 3DXBA 4LBPA 2OEJA 2CPIA 1HWLA 3AB2B 5L9XA 1ICEB 1RWPB 2XG8A 2E5LJ 3SSQA 2D74B 1RLCL 2RF2A 2EBEA 2YPYA 4IRCA 5GAEU 4O0IA 3KK2B 4FYYB 1RBLA 1GMUA 3I0SB 5F8GA 5B0BA 1SL0A 1IQTA 1CSJA 4NLVA 2NLWA 4CLTA 5FLXY 2XCAA 3GV8B 1T0TV 2D3ZA 3MMBA 1VQ9S 3DLBA 3M6VA 1OQ6A 4QW8A 4CQ1A 1FTCA 1WEXA 4M5MA 3B4MA 1XMQF 1FKPA 1SJ1A 3PZPA 2AW0A 1UZHA 2QE5A 2JX2A 1XR7A 5H9FJ 4A47A 1REVB 5IV4A 4YHHF 5M2RA 2A1BA 5KG1A 2UUAF 4OI6A 2Y0BB 4RU9A 1M5VC 4O3RA 1BQXA 3C6TA 3HZGA 3D67A 5D78A 4UZBA 1N5VA 5HJXA 3G8SA 4KGXB 2A3JA 3DRXA 1NKBA 4LMZA 2AIRB 4PWDB 2QGFB 3TX0A 4FZVA 2YXLA 4NCGB 1K1SA 2W01A 4IH7A 1MWZA 1VYAA 2GAHC 2H4WB 2XNQA 4UW2A 1KQGB 1JLFB 2RRNA 5D0HA 3QPIA 3GV7B 4JI8F 4FS2A 3VVTA 2C2NA 2CQ4A 4ANCA 2QLXA 2BACA 5KFVA 8RUCA 2E1CA 2UUCJ 1N5YA 2CQDA 3MM5A 1RWUA 1RHMB 2MXYA 2RKIA 4F67A 1KNZA 4DV3F 2CAJA 5F8HA 4ZVFA 1F1BB 2BEFA 4I7FB 1WI6A 4WE1A 3KLEB 2DR7A 2JEIA 1LOUA 2HVZA 2HFVA 4C3LA 1DAXA 2IM0A 2KXFA 2RQCA 1H6KX 1S6PA 1TL1B 4X4QA 2XMMA 1NRKA 3W5YA 1SXLA 1WORA 2CZVC 3FCHA 3M8PB 2AYGA 1JLBB 5C42A 2A6MA 3MM7B 1S72S 1ZM2A 1R0CB 1KDNA 3C19A 4WK1A 2FDNA 2DHAA 4OX9F 3H4BA 5G0RA 4NLSA 1Q8IA 2OD4A 3D6MB 2Z8QA 4EBDA 5EWEA 2BE2B 4ID5A 5KFTA 3OV7A 3BGLA 5ETQA 5I3UB 4FDFA 4A4JA 3CCVS 3H5XA 2WRMA 3CD5A 4N41A 2PT0A 2GQCA 2XYHB 4H4MB 4KC5A 4FF1A 3JXOA 2V8PA 4R5PB 1XEZA 7FDRA 3BZQA 2DR5A 3CULA 1EETB 1HI1A 3M30B 5ADZA 5CA5A 2LECA 1LWFB 4JV0A 2BA9A 4CRJA 3UN5A 2E9ZA 3A8JA 1YJ9S 2XMUA 5AXKA 2BOPA 1WF1A 2J5AA 3EXYA 3GMGA 4LF5J 4NE9C 3I32A 1RACB 4CLYA 3G82A 4WTYA 4HYKA 3ZZRA 3PCOB 3C6UB 2PGCA 3HLUA 4P6QA 5FD1A 4YFUA 4WKRA 1RUSA 2ZJRQ 4DF4A 1IJFB 4N76A 4MTPA 1IVZA 4DLGA 4C4WA 3H59A 3Q8SB 2QZ8A 5T7LB 4Q7AA 9ATCB 3Q83A 3A8KA 2MTLA 1XR5A 2KHCA 2CA9A 1KN6A 2W8KA 4DI6A 1CJUB 1JLAB 4OX6A 1EETA 3GIIA 4ZCLA 4J9MA 5E3PA 2VC1A 4FKXA 4FVCA 2DRDA 2MQOA 5EWFA 2HHUA 3PM9A 4LF6J 4FNHA 1RBOB 2B5JA 1QAXA 3NP5A 3TO8A 1BWVA 1J2VA 1NEEA 1ROFA 2AHOB 3IXQA 4FYWB 3GWCA 5J2MB 1D0EA 2J6SA 2NZCA 3BPDA 4F4KA 1RTHB 4J9VA 1KKHA 2FQQB 3N01A 4DU7A 2IY5B 2HIYA 8AT1B 1Q8KA 3DYAB 3IM9A 3EPIA 1U1NA 3JYTA 2OGUA 2Z2ZA 3BGRA 2VODA 2XSJA 1AUSL 2JWNA 3M9OB 2KZZA 3UNGC 4EO6A 2FZKB 3RR7A 3HHLB 3ET6A 3I5CA 2ABYA 2QMUB 4BLGA 5E41A 2GHVC 1P9QC 3JB9k 1WC4A 4NRUA 2DNHA 2KT5A 1VQ7S 2F4VJ 5KFPA 4AT1B 4KTQA 2H5IB 1B64A 1S1UA 3R5AA 2ALZA 1JNRB 3CJKB 4NLRA 4F02A 5H9EJ 1MMLA 1EB0A 3CCRS 5IT9U 4ECXA 2XEXA 2P9GA 3K8WA 4I1TA 3IMQJ 1GFWB 5K20B 1RTHA 4ELVA 2FD2A 4I2PB 2KXNB 2CPFA 2HBZB 2G2YA 1HW8A 1AUDA 3TUPA 3CC4S 3ZZYA 4IFYA 1X4GA 2QT7A 3IAS9 1XR6A 3UW1A 4NA2A 1HIYA 2UP1A 3Q89A 2ZH6A 4NPOA 4RO0A 2C2RA 3CJSA 2RMLA 5K8PA 3BBCA 4I4BA 1NZ8A 2IPOB 4F25A 3CC7S 3JSMB 3CJQA 1YJ7A 2F65A 5LMNJ 1GXUA 2DPJA 4MIBA 3D54A 5KFBA 3MM9A 3JS9A 3QGGA 3HT3A 2GMLA 2WBRA 3CMQA 4Z7CA 3PVXA 4QJVA 1B0PA 3GR1A 5I3QA 1Y9OA 3SEOA 3ZO7A 3DLLQ 4QIEA 2XLJA 1KVJA 1FRKA 1RU1A 1RWMB 1Y00A 2KXHA 2WB1D 2A2CA 3AD7C 2NPIA 3P5TL 4HI2A 4WP8A 5HMWA 2KRBA 1UFWA 3QBCA 4J9PA 1VLOA 2IRXA 4A8XA 3CIMA 5A8RB 5J2PB 5B08A 2YWFA 3Q8QB 3BN4A 2VBWA 1S9EB 1IBKF 2P2CB 2IJNA 4WK3A 2DNKA 3CSKA 1F5AA 2PSZA 2G1HA 2HVEA 4Y2IA 1B99A 3LAMA 5KFLA 4ZITA 2ZH1A 1IBLJ 1C1CA 1G6BA 2N3OA 4C0BA 2L9NA 1S6QA 5FDLB 4OYBA 5CYMB 2FVQA 2ZBRA 3RBEA 1F3FA 1HBNA 1HARA 2GVZA 3ICLA 3OLBA 2CUYA 2OHDA 3LALA 4DR7J 3GG1A 4KGMA 2IAJA 5HROA 3NGRA 4KQZA 5D4NA 4DV4F 3IAM9 1Z2ZA 3G87A 2HZVA 2G2OA 1WNEA 4JI4J 3D3BJ 1HHTP 1U2RA 2KB2A 1CPZA 3AJDA 1U49A 3OR1A 3WIUA 3IO1A 5KFOA 4WP3A 1WF0A 3RTVA 3G86A 1UPMB 2Z2YB 3HFZB 2GHWA 2JFDA 1QUVA 2P8IA 3NAHA 1YG0A 3QLHA 4I2QA 4YS2A 2DGVA 4GVLA 2W2MP 2P6SA 3RAXA 3LF0A 4DR2F 4IUFA 2LQ8A 1R0BG 1BGXT 1SL2A 4B3MF 4J7CA 4PG6A 1U26A 3MUVP 4DR3J 1OYEA 3H4DA 2UV8A 2FJBB 5G0RB 2IDEA 5U47A 1RTDA 2OJ3A 2QSFA 4WYLA 1L3UA 1Q82T 4B08A 1BQMA 1WG4A 2EFNA 3EGWB 4DN0A 2Y1IA 5I3UA 1P27B 2B7CB 1X4HA 2FB0A 2WVEA 4ICLB 3W9HA 3NBPB 4O44B 5GAHI 3FFIA 2VBYA 4DF8A 1X0PA 1SJQA 2YX4A 2Z0GA 3C14A 3QIPA 4RW7B 5DZ7A 3WZ0A 3CXCR 3DI6B 4WP9A 4QWDA 2A10A 3LWLA 4DL2A 2UVUA 4DCJB 3KNAA 3AQPA 2RU9A 3I5BA 3OR1B 4P2FA 3K58A 3R7NB 3V2UC 3MAQA 3BGUA 3F44A 1FK9A 1RAIB 4TY9A 3AY0A 4BHQA 2J9DA 1UWAA 2C3UA 4ZIWA 5ETKA 1XQIA 4LBIA 2UZAA 4UQGA 1HQUA 1RHQB 3NL0A 4NLWA 3NCPA 1HNZJ 4CDIA 5IC6B 3G6YA 1NK6A 2BJ3A 2G0JA 3JQJA 2DGWA 3GSIA 1F9HA 1VHFA 1KQSR 2VHGA 3QFWA 4DV5F 1AXQA 2HNZA 1VS3A 1LWEB 1TL3B 3T1YF 1NBEB 4X4VA 5F8MA 4J9NA 2B4UA 3SI8A 2CXEA 5HBMB 1KEKA 4ZK7M 3THVA 3PO4A 3QJPA 1AFJA 2PD1A 3O3LA 2A0FB 3I96A 2ZBCA 1RT4A 3DLHA 3S7RA 2NSCA 2B3TB 2F8MA 1FVQA 2XMTA 3DDIA 1RAEB 3W3SA 1PC4A 4HT7A 4AD6A 2YX7A 1O0PA 4K2JA 4X84A 3MUMP 4FF3A 4WU2A 5HVHA 2FZGB 2HHWA 1Q7LB 1MMDA 3SSSA 2N4CA 3BSCA 5HQLA 5KAKA 3TNVA 2DO4A 2V34A 1N32J 3N6NA 2CFXA 1KD1T 1CJTB 3VAHA 3HHLD 2QRRA 1R31A 3RBXA 1N52B 3CT9A 2DGQA 1HMVB 2DEJA 1G3OA 3KJFB 4M5DA 3OTCA 1HFEL 2DNZA 1F5CA 2W9CA 1HBMA 1UW4A 4G1QB 3KLIA 4EUVA 2HLTA 1YJWS 3DXSX 2ILZA 3R5BA 4QOTA 1TQLA 5DDRC 4RUAA 5A2QY 4KPCA 1TZ0A 2E66A 3CJKA 2C2EA 5L1KA 5LSOA 1HNZF 1N6QB 3ISZA 4W98A 5KFZA 3MM8B 4ZHRB 3OTOJ 1K1QA 4ZPAA 2HKEA 4U7CA 5H9FK 1RAGB 2UUAJ 2R8KA 3ISND 1RLDA 2E5GA 3P5BP 1FX2A 3HJFA 4HH0A 1CULB 2DBBA 3FNNA 2FHJA 1B0VA 3I6PA 3KUGA 4USHA 2KHDA 5JXSA 3R1HA 5GMDA 3CJRA 5F8LA 4UTGA 2MHNA 4L3KA 4O3PA 2DY1A 1KFDA 2GVDB 2XI2A 2UUTA 4URSA 5D0EA 3OL6A 2C2OB 2KYXA 3ONQA 1C0UA 3KWMA 4P74A 5E7OB 3W2VA 2VC0A 4P52A 3JAMY 4N8OA 3BGFA 1CJKB 3MPUB 4CLPA 3KHRA 4ZP6A 1S0OA 2ASYA 3TVYA 4DL4A 1N36F 4YEAA 1YTYA 2IA6A 3KLIB 5GAHU 4M5KA 1SJ3P 3BO2A 2F4VF 2O01C 2B51A 2NUUG 2CQBA 2RF2B 4HDGA 4JI0J 1UWBA 2ZC4A 4KJIA 2CQ2A 4HLBA 2X3GA 2ZHOA 2DR6A 4B9UA 2DT9A 5GVQA 1QJHA 1S48A 5ETPA 1PJ6A 4DPYA 1JX4A 4J90A 5KFIA 2QA4S 1FFWB 1NK8A 4M5IA 2NR0A 2AGQA 2XLKA 4F4YA 4WJBA 4WXOA 2IRUA 1U0HB 2ZDPA 3BBFA 4C7QA 1S1TA 2EW9A 2M4MA 4OI1A 1GMVA 4LF4J 4B3SJ 3QNWB 1BLUA 1ZM3A 2Q6BA 3O44A 4KAIA 4OHXA 1WHYA 2EFPA 1R8CA 4DUYJ 4TU9A 1T03B 2FJDB 1I51B 3MECB 2FJWA 5CZXA 4DEZA 1A6LA 5KG7A 3PKMA 2VONA 1TAUA 3HD1A 1Y3KA 5D4PA 3A3OB 4RL1A 1FHTA 5DZ6A 4UY85 4K50A 2AP6A 1PSDA 4HR2A 2MLXA 2YBVA 4ZJLA 4KO0B 1RDRA 1O8BA 1S1XA 2WW8A 1QAJA 1FJCA 1VCTA 1OMSA 2RDIA 3CCZA 3R8YA 2X1AA 1VHIA 4X4PA 5I42B 3RB6A 1FKOB 3AJ2A 3OW2R 3PYGA 5C25B 4DZ6A 3H90A 4ECSA 1IJEB 2MZ1A 4E2FB 5F0UA 1WKLA 2IM2A 1R89A 3VZHA 4DPWA 5LSRA 3OSNA 1N36J 1HNXJ 4DQPA 2IVFB 4ZPDA 1OPZA 1DARA 1EJ7L 1SC6A 2W7PA 5D4OA 3CCTA 1Y7PA 1HWKA 4WU3A 2XQCA 3O6QA 5LM7E 4AUKA 4C8LA 4X64J 2UVRA 1FF2A 1AA1B 2PDAA 3MFHA 5KT7A 1DLOB 3Q2TC 3FCWA 2UXBJ 3FEYB 3GZ7A 1VFJA 1UPPA 2Q79A 3RAMA 2MKYA 2EFQA 4PPDA 3MM7A 3UNYA 2EEYA 2FVSA 2AJQA 2OI2A 3EDQB 1S12A 4Y2KA 4CNYA 4B3OB 2ZH5A 1LWCA 5KFAA 2QSWA 2KL8A 2GIQA 3MEDA 1KWMA 5AE3A 4RNFA 2XTJP 1NSKL 4F7VA 3MAAB 5CXTA 4EYHB 1HR0F 4N8NA 4DX5A 2HHHJ 2D9PA 4RW9B 3CCMS 2FLPA 3K5NA 3BQ0A 5L1IA 4PABA 2I5JA 3H2VE 1N56A 1G4CA 1FDDA 1KLMA 1YLXA 4EYIB 2GA7A 4A46A 3P45B 1FVSA 3NS7B 4IKAA 4RW6B 1KQKA 2KFZA 3NGUA 1XIQA 4J5OA 2V4RA 1CBKA 3EXCX 5DQHA 4LSNB 2BQ3A 1U47A 3UWTA 3NS5A 1D9FA 5CZVA 5DLFA 2BJ1A 2RD5C 4PXCA 3CJ0A 4WPAA 1TMMA 2QYCA 2L9DA 1IKYB 3MF5A 4OYXA 3TZWA 5KT5A 3RB0A 4LIRA 4TQRA 2W8LA 2H5JB 3MTKA 3BS9A 2FHKA 4KRWA 4LUBA 1YITS 2HK3A 3EJMA 1VBZA 1YIJS 3Q8YA 4HEA9 5KOWA 4DR3F 3KUEA 2MKSA 4IRKA 1WC5A 1KQFB 3MPWA 1WTFA 4TKTA 5DM7Q 1YJVA 3KUHA 1NJWA 2OFGX 3DOMA 4NLDA 4JI6J 3LGMA 4P7VA 5IOLA 2IDLA 7FD1A 2DITA 3D1OA 5LSLA 4RUCA 1RT1A 1X4EA 5K5MA 2AD9A 1GNKA 2HQFA 1FKPB 1RA6A 5KFXA 2YNGA 3EGZA 4MFBB 3IS9A 5LOQA 3CW2C 5DETA 1DFDA 1QAYA 1HPZB 2N4DA 4LQ3A 2E7XA 1VQ4S 2DNYA 4B9TA 2UXDJ 4LFAJ 2ZITA 2R7SA 2EI5A 3T1YJ 5KOXA 4QU7A 5KTQA 2QL7B 1H7WA 4M5DB 4DX8H 4FBTA 1U6BA 4DV4J 3D9BA 4B3TF 1E6YB 1S6UA 2RH3A 5HSPA 3VGSA 3VAKA 4MKVA 2AJ1A 1TUVA 4ED4A 2HS4A 1AYEA 1VLYA 2QL5B 4CI0B 4DFJA 2V8GA 4K4VA 1HBUA 2WSFC 3KNGA 3N0VA 3ENQA 4QIGA 1CQMA 1RWNB 3NWGA 3G8QA 1Q16B 2OAUA 4MT1A 3RG6A 3TYTA 3J7YI 2PI4A 3J81j 1UFLA 2YKMA
chains in the Genus database with same CATH topology
2DXDA 3GP9A 4UOFA 3BBFA 5BXIA 1NCLA 1ZS6A 3VGVA 3ZTOA 3Q83A 3EM1A 1B4SA 3VGTA 2ZUAA 3PJ9A 3FBCA 3Q8UA 4DI6A 3FBBA 4FKXA 1K44A 1NDKA 3ZTQA 4F36A 4HR2A 3ZTPA 4ANDA 3R9LA 3ENAA 3MPDA 3EICA 3NGSA 1XQIA 4DZ6A 1JXVA 1UCNA 1WKLA 3EMTA 3GPAA 2AZ1A 1MN9A 2B8QA 5CAAA 2DXFA 4C6AA 3B6BA 1BHNA 2HVDA 3ELHA 3BH7B 1BE4A 1WKJA 1NB2A 3FCWA 4FKYA 4EK2A 3FBFA 4UOHA 2B8PA 1BUXA 1HLWA 1F6TA 1MN7A 5C7PA 1S5ZA 3DDIA 1NDCA 3EVWA 3ZTSA 1NLKL 2DXEA 1HIYA 1VYAA 1NSKL 2HURA 1PKUA 3FBEA 3Q89A 4CP5A 4S0MA 3L7UA 3EE3A 3BBCA 1NDLA 3VVTA 4ANCA 4O0NA 1EHWA 4UOGA 3JS9A 2CWKA 3EVMA 1S57A 2BEFA 3NGUA 1XIQA 1NPKA 1NHKL 3FKBA 1NSQA 3BH6B 5CABA 1HHQA 4KPCA 3PRVA 3EVOA 1NUEA 4W98A 4F4AA 3EJMA 2DY9A 3Q8YA 4ENOA 1KDNA 4WBFA 2VU5A 3NGTA 1W7WA 2DYAA 3FC9A 1NDPA 2BX6A 4DUTA 2HVEA 5IOLA 1B99A 1PAEX 1F3FA 3VVUA 4ANEA 3NGRA 3Q8VA 3BBBA 3B54A 3FCVA 3VGUA 2NCKL 3WX8A 2AZ3A 1U8WA 3ZTRA 3DKDA 3VGSA 1S59A 3ETMA 3G2XA 3Q86A 1WKKA 1NSPA 1LEOA 1LWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXD A;  3GP9 A;  4UOF A;  3BBF A;  5BXI A;  1NCL A;  1ZS6 A;  3VGV A;  3ZTO A;  3Q83 A;  3EM1 A;  1B4S A;  3VGT A;  2ZUA A;  3PJ9 A;  3FBC A;  3Q8U A;  4DI6 A;  3FBB A;  4FKX A;  1K44 A;  1NDK A;  3ZTQ A;  4F36 A;  4HR2 A;  3ZTP A;  4AND A;  3R9L A;  3ENA A;  3MPD A;  3EIC A;  3NGS A;  1XQI A;  4DZ6 A;  1JXV A;  1UCN A;  1WKL A;  3EMT A;  3GPA A;  2AZ1 A;  1MN9 A;  2B8Q A;  5CAA A;  2DXF A;  4C6A A;  3B6B A;  1BHN A;  2HVD A;  3ELH A;  3BH7 B;  1BE4 A;  1WKJ A;  1NB2 A;  3FCW A;  4FKY A;  4EK2 A;  3FBF A;  4UOH A;  2B8P A;  1BUX A;  1HLW A;  1F6T A;  1MN7 A;  5C7P A;  1S5Z A;  3DDI A;  1NDC A;  3EVW A;  3ZTS A;  1NLK L;  2DXE A;  1HIY A;  1VYA A;  1NSK L;  2HUR A;  1PKU A;  3FBE A;  3Q89 A;  4CP5 A;  4S0M A;  3L7U A;  3EE3 A;  3BBC A;  1NDL A;  3VVT A;  4ANC A;  4O0N A;  1EHW A;  4UOG A;  3JS9 A;  2CWK A;  3EVM A;  1S57 A;  2BEF A;  3NGU A;  1XIQ A;  1NPK A;  1NHK L;  3FKB A;  1NSQ A;  3BH6 B;  5CAB A;  1HHQ A;  4KPC A;  3PRV A;  3EVO A;  1NUE A;  4W98 A;  4F4A A;  3EJM A;  2DY9 A;  3Q8Y A;  4ENO A;  1KDN A;  4WBF A;  2VU5 A;  3NGT A;  1W7W A;  2DYA A;  3FC9 A;  1NDP A;  2BX6 A;  4DUT A;  2HVE A;  5IOL A;  1B99 A;  1PAE X;  1F3F A;  3VVU A;  4ANE A;  3NGR A;  3Q8V A;  3BBB A;  3B54 A;  3FCV A;  3VGU A;  2NCK L;  3WX8 A;  2AZ3 A;  1U8W A;  3ZTR A;  3DKD A;  3VGS A;  1S59 A;  3ETM A;  3G2X A;  3Q86 A;  1WKK A;  1NSP A;  1LEO A;  1LWX A; 
#chains in the Genus database with same CATH topology
 3CO9 A;  5HP1 A;  4WF9 Q;  1C1B A;  1PCA A;  3D1H A;  4UST A;  3H0P A;  4NXN J;  5KT3 A;  3OR2 A;  3VGV A;  3MHY A;  1WC6 A;  3GFZ A;  1TKT B;  1SUQ B;  2BE9 B;  2UUW A;  2YNG B;  4BC7 A;  3IS9 B;  1W26 A;  5E0O A;  2GZO A;  2B0G A;  2ZUG A;  2AV5 A;  2DHS A;  1TVR B;  2DPI A;  3DRP B;  3R6G B;  3PX0 A;  1QVG R;  1D9A A;  1NO8 A;  3IRX B;  4RNH A;  4DFK A;  2RIL A;  2CQG A;  3M2V A;  2UU9 F;  4DR6 J;  1R8A A;  4OYW A;  4DV1 F;  3R5D A;  2JEJ A;  3K8V A;  3BRE A;  3M1V B;  1TFY A;  3SDE B;  4DS4 A;  3TAQ A;  3AOB A;  1KON A;  1UJ4 A;  3PEJ A;  1J5E F;  2H9Z A;  3H2L A;  2E5I A;  3LP0 A;  5T41 A;  1TU0 B;  3HPO A;  4NYP A;  2Y8Y A;  2JEG A;  2MJU A;  3CO0 P;  3W63 A;  3K0J A;  4USK A;  1JMT A;  3CCQ S;  1SV5 A;  4EU0 A;  1F60 B;  1JLG A;  1JLQ B;  3B4D A;  4F2R A;  2RKI B;  2XO6 A;  1HBO B;  2NXU A;  3I4P A;  2V50 A;  4CM2 A;  2NRE A;  1NB2 A;  1T95 A;  2ASL A;  5F8N A;  3DRP A;  1DTT A;  3I55 S;  4NL5 A;  2FLL A;  1QVF R;  4OYO A;  1XMO J;  5DM6 Q;  1Y5L B;  3X1L B;  5CD4 H;  1HNW J;  1AW0 A;  1M1G A;  2LCW A;  1S99 A;  1RHU B;  2Y9H A;  4H54 A;  4LSL A;  5KFR A;  5KFE A;  1S5Z A;  3DRR B;  4TY8 A;  4TN2 A;  2K1R A;  3JTN A;  2VIC A;  2WON A;  3TJ8 A;  1C1C B;  2IRY A;  2EG1 A;  2L9W A;  3IGN A;  1ACM B;  3LP0 B;  1OQ3 A;  2EVZ A;  1FD8 A;  2NXE A;  1FCA A;  3E2E A;  4NLQ A;  4AXI A;  2J7K A;  2J9E A;  4OHW A;  3KYL A;  1IKX B;  2K7K A;  2UU9 J;  5ETO A;  1UTA A;  1JLQ A;  2CG8 A;  2G0I A;  2CQI A;  2DIU A;  4PG8 A;  4ECQ A;  1L3T A;  2LMI A;  4G6V B;  5ETM A;  5A8W B;  2RJZ A;  3MEG B;  1ZTW A;  4RWW A;  4C11 A;  4YDX A;  5A8K A;  1RQ0 A;  3OTD A;  2LYV A;  3DC2 A;  3UDL A;  3RYL A;  1NZA A;  1QM9 A;  2WVD A;  3SFG A;  1GX6 A;  4I2Q B;  1RI7 A;  1VQL S;  4HDH A;  3OD2 A;  2R2U A;  1NUE A;  4RBV A;  4UQT A;  3M2U B;  1WSV A;  5KFN A;  2CNO B;  2U1A A;  4BCA A;  2WON B;  3Q2S C;  2MHE A;  3MM6 B;  4DQQ A;  1X4D A;  2LXU A;  1RTI A;  5IT4 A;  3K57 A;  4JI4 F;  1REG X;  2DYA A;  1GTH A;  3FC9 A;  5IQQ A;  2E5H A;  1RTJ A;  4DUT A;  5GAE I;  3FSI A;  3LP2 B;  2DR8 A;  4JI1 J;  5B0A A;  2HS0 A;  3RUB L;  5C24 B;  1VC6 A;  4OZL A;  3KTQ A;  2MEW A;  2NYI A;  3IG1 B;  5B0C A;  4ZP9 A;  1T9U A;  4LRE A;  1RAJ A;  2HNY B;  5KT4 A;  3FRZ A;  3VVU A;  2L48 A;  4WCE Q;  1U45 A;  2DCL A;  3F56 A;  4CH0 S;  4EEY A;  3I5A A;  2EC0 A;  2BM0 A;  3ILO A;  3M9N B;  4KV8 A;  4XIU A;  2DEI A;  4K4S A;  1VMB A;  3OSP A;  1IKW A;  1R27 B;  2M9K A;  1I94 F;  2XY5 A;  2QV6 A;  3ZTR A;  2VG6 B;  2E5L F;  2FJV A;  3QJL A;  3N5F A;  1XBW A;  1EP4 B;  2BW2 A;  1S1V B;  2B9X A;  4F4Z A;  4RZR A;  2K7J A;  1VQM S;  4O3S A;  4NEY A;  1YZ7 A;  3ETM A;  3KLG A;  1T9T A;  4J9L A;  3CGI A;  1UVN A;  2A2D A;  4DL5 A;  2M2B A;  2GFF A;  2JVO A;  3U27 A;  3KK1 A;  2QLJ B;  2GC8 A;  2UVV A;  2IJF A;  3FQK A;  4FXD A;  2QJ3 A;  4Y0F A;  4DCP B;  4CO2 A;  4EO8 A;  4JV5 J;  1FNX H;  1XWL A;  5HAO A;  1S10 A;  2RQK A;  2XM3 A;  2A18 A;  4ED8 A;  4TXS A;  1R0A B;  1GMW D;  3EM1 A;  2OEL A;  2V94 A;  3HX9 A;  1KP6 A;  3VGT A;  1D1U A;  1SC4 B;  3K59 A;  4GKJ F;  3TUI C;  3ENW A;  4I67 A;  2IMO A;  2QFJ A;  1BMQ B;  2NZ4 A;  3ENV A;  3FBC A;  1IM6 A;  2E1M C;  2IM1 A;  5KFF A;  1K44 A;  1Q95 G;  2E5J A;  4FP9 A;  1HWU A;  3K5M A;  2RHQ B;  4PPZ A;  1HPZ A;  1M0S A;  1MNE A;  2R4F A;  1RT5 B;  2ACY A;  1LW2 B;  1SBR A;  2KRR A;  2RQ4 A;  2YY3 A;  1Q5V A;  4U8V A;  4F0M A;  4FF4 A;  3G6E S;  3Q24 A;  1FKA F;  2LXF A;  5IT0 A;  3OFG A;  1JXV A;  1N34 J;  2UXC F;  3VZI A;  4QZV B;  4P73 A;  3DLE B;  4KGV B;  2ZH9 A;  3GIJ A;  4YR3 A;  5CYM A;  1D8Z A;  4P75 A;  4V19 X;  2BQU A;  3RRH A;  5DQG A;  4YUD A;  3CD6 S;  1IWG A;  1PIL A;  3CJ2 A;  3QO9 B;  5GMK a;  2ZBQ A;  4I56 A;  2HRY A;  2F1F A;  1MMN A;  3W5X A;  1O6X A;  3D66 A;  4A8F A;  4PUO A;  4WFN Q;  4ED6 A;  5HL7 Q;  1NHV A;  1K0T A;  2PMH A;  2E44 A;  2MLY A;  3I9Z A;  3UD5 A;  5KFH A;  4DOZ A;  2B9Y A;  1JJC B;  4B9S A;  3GG0 A;  4IO9 Q;  4C9D A;  3T1A A;  4AE5 A;  4ZIV A;  3R5J B;  3RU0 A;  3CB4 A;  2BMB A;  3EGN A;  4Q45 A;  2VJU A;  5KFY A;  2BQR A;  2HAI A;  2B43 A;  1RIS A;  1YDL A;  3NLC A;  2VDI A;  4LRD A;  2VFS A;  4F3M A;  5CYQ A;  3T41 A;  4F4W A;  3WC0 A;  2C3P A;  4ED2 A;  2APO A;  2H4Y B;  3BR9 A;  3GCW P;  2E7V A;  3THP A;  3J81 Y;  1R6Y A;  2DK2 A;  1HBN B;  2GJF A;  4OZ3 A;  1TTH B;  3LQV A;  1RT7 A;  2RRA A;  4RU2 A;  1VC0 A;  1T9W A;  3K5O A;  3W60 A;  1QSY A;  3NBP A;  3QIP B;  3T6J A;  4KT0 C;  2YNH A;  2CIM A;  4DXL A;  4DSL A;  3DI6 A;  4NYZ A;  1SH0 A;  1UZD A;  5C2G A;  5K8O A;  1U1P A;  2UXC J;  1TL5 A;  3IFE A;  3CCJ S;  2IA0 A;  1MWY A;  3A8I A;  2KM8 B;  2CJA A;  3VAJ A;  1NJX A;  3BSA A;  4OI3 A;  1RYS A;  2DNM A;  4MYT A;  3HHK A;  1S1T B;  5L39 A;  4QWA A;  1FXR A;  4K0K J;  3RRK A;  2FHM A;  1GQE A;  1LK7 A;  4ZVH A;  3M6U A;  1HD0 A;  3HHL C;  5MLC V;  5JMN A;  3W65 A;  1E6V B;  1WG1 A;  2PEB A;  4ECU A;  4DR5 J;  2IVM A;  1O51 A;  2HQD A;  3KLV A;  2FYX A;  1NSA A;  3MPY A;  3P8B B;  2JLE A;  3L09 A;  4QYR A;  1IKX A;  1H73 A;  2IYG A;  3BYR A;  1WOO A;  2JLF A;  3I82 A;  4IG0 A;  4YR0 A;  1H7X A;  2XCP A;  2E9R X;  3UDC A;  4DR7 F;  2YNH B;  2DIS A;  2KZM A;  2YKN A;  3KLH B;  4USM A;  1RT4 B;  2BKO A;  2CJX B;  3H8Y A;  1VRQ C;  2D7S A;  3SZ2 A;  4K8R A;  5I42 A;  3QJJ A;  2HFO A;  5A8K B;  5C25 A;  3UR0 A;  3IR5 B;  4IQM A;  3KHL A;  4A8K A;  2RUS A;  4ZCM A;  2UXD F;  3PFO A;  2XYG B;  2HVH A;  2YQ3 A;  4EZ9 A;  2OPR B;  4ZVR B;  1N5Q A;  3QT8 A;  2QMX A;  3S6E A;  1S7I A;  3FMW A;  1H38 A;  3M2U A;  4PG7 A;  1C4C A;  2ROE A;  1NSP A;  1TL7 A;  2AQ4 A;  1YGY A;  4U7U D;  3GP9 A;  3HM9 A;  4USI A;  4DV7 F;  1TUG B;  4ELU A;  2N82 B;  3BDE A;  2I38 A;  3T5H A;  1G2E A;  3MMC B;  3W2W A;  4CO3 A;  1G7C B;  4D3G A;  4Z37 A;  1XNQ F;  2HIQ A;  3C3L A;  1B4S A;  2QTW A;  3LPE A;  2P5V A;  2XZD B;  5AXN A;  4NXN F;  3W5Z A;  3Q22 A;  4DQR A;  3IG1 A;  1TMJ A;  2R7U A;  1AZS B;  4KHM A;  1HBM B;  1S9G A;  1SPB P;  5KFU A;  1GXT A;  2E1A A;  1VQK S;  1S79 A;  4R8U A;  4LRB A;  4DG1 B;  4KV8 B;  3DOK A;  2GMJ A;  2CQH A;  2BW7 A;  2JC0 A;  5KFW A;  1FRX A;  4OX8 A;  1RT3 B;  5CQG A;  2OFH X;  1I3O B;  2HAF A;  4RUB A;  1GT8 A;  5F0W A;  5F41 A;  1VRT A;  1FWP A;  2HMI B;  4DSK A;  1S1V A;  1N88 A;  4ZCI A;  2BM1 A;  1JQG A;  3TA0 A;  3GPA A;  4OZ5 A;  5LMN F;  1DBD A;  2EK1 A;  4QW9 A;  2ADC A;  4Y00 A;  3CPW R;  4M95 A;  3W2V B;  1ZM9 A;  2JEF A;  3B6B A;  1GAO A;  2VA3 A;  2R7V A;  4TYB A;  1HI8 A;  3AFG A;  4FS1 A;  2CPJ A;  1B7F A;  1WI8 A;  3R6L B;  2ZJP Q;  4TLR A;  1RCO B;  3GJS B;  4G1Q A;  1JXE A;  4I6Y A;  2PA3 A;  4EK2 A;  1KSP A;  3NNH A;  2MKC A;  5IWA F;  3D5M A;  4CZC A;  2B8P A;  2IYI A;  3OFH A;  4WIQ A;  1RT3 A;  3LTO A;  4DFM A;  1S1W B;  3MM8 A;  2EKY A;  2X1G A;  4ZHR A;  2YWG A;  1VRT B;  2QFI A;  2MZQ A;  2ZVI A;  4LBH A;  3D0G E;  3M9M B;  3PFE A;  5EDW A;  2QEX S;  4JI5 F;  2I8E A;  1QD1 A;  1WTB A;  1RT1 B;  1YBU A;  2PFD A;  3QAT A;  4PYD A;  3FZB A;  1M1K T;  3POT A;  4DSJ A;  1DQ8 A;  3P49 B;  3VAF A;  5DQI A;  3GIM A;  4F50 A;  5HQ8 A;  1RT2 B;  1RGV A;  4L75 A;  3OTE A;  4WE1 B;  3KLE A;  3W8G A;  3MR7 A;  1N32 F;  1KHV A;  2BKP A;  3W9J A;  1MWQ A;  4L6V 3;  1BXN A;  1TL1 A;  1IN0 A;  3MR2 A;  1HW9 A;  3EDR B;  2WTF A;  3D2W A;  5IZH A;  1U8S A;  2LEP A;  3C8Y A;  1KFS A;  2V9W A;  1EKS A;  3D7S B;  5C2C A;  2Y1R I;  3QRP A;  2I6W A;  4GKJ J;  5BYS A;  2PE8 A;  2AJ2 A;  1U48 A;  1X60 A;  3HHD A;  4DJB A;  2FC9 A;  3IBC B;  4DR1 F;  2R2R A;  5IC4 B;  4ZP8 A;  4CLZ A;  4DR4 F;  2FY1 A;  1IXK A;  2ZOG A;  2W2P P;  3OT9 A;  2BE2 A;  3M8P A;  2OD6 A;  3T1H F;  2EKN A;  4KYZ A;  3OR2 B;  1NPP A;  4JV2 A;  2YNF B;  3GR0 A;  2I2Y A;  2OTJ S;  3C16 A;  5IXU A;  2FY8 A;  1YRT A;  3HHE A;  4R5P A;  1P9Y A;  2QL9 B;  5ETS A;  4GC7 A;  4ETZ A;  4LF8 F;  1DUR A;  3HVT A;  1YJN S;  1SIZ A;  3RAQ A;  1VI7 A;  4ID5 B;  4K4T A;  3PW0 A;  5CYQ B;  4CTA A;  1ITP A;  1VOM A;  4C3M A;  1X4F A;  3AXK A;  5FLX U;  1HYS A;  2BKN A;  2DB1 A;  4WFZ A;  2CG4 A;  2AZ3 A;  3CDU A;  3DU5 A;  3J7Z 5;  3RJM B;  2HWH A;  2C22 A;  2OPP B;  1TK0 A;  4OYA A;  3TAM A;  5GAD U;  1S59 A;  2FUG 9;  1KHW A;  3WC2 A;  2MZS A;  2QG9 B;  1MG7 A;  2OO4 A;  1SCJ B;  1OSD A;  1NME B;  1URR A;  3CDA A;  2CYY A;  4LFB J;  1HWI A;  3C15 A;  4RW9 A;  3PNI A;  2IC3 B;  5K14 A;  2F4F A;  4A8Y A;  3HKZ D;  2D3U A;  2QLB B;  5IS2 A;  4TYA A;  2BUN A;  1LK5 A;  2EBG A;  4QIW D;  5LT5 A;  3GQC A;  3G71 S;  2D3O R;  2BXJ A;  3NXZ A;  4PCQ A;  1KVI A;  3B78 A;  2LKZ A;  3BKU A;  2AJ4 A;  4G65 A;  5M2P A;  2ZJQ Q;  1HNI B;  1MU2 B;  1TK8 A;  1R6V A;  4ERD A;  1E6V A;  5AJ3 J;  1UW9 A;  4DR4 J;  2VFT A;  2YNI A;  4LR9 A;  3CCS S;  3FEZ A;  2DNQ A;  2AYM A;  2ZBP A;  4PEO A;  4H4K A;  2BOA A;  3MEE B;  2E1R A;  4F2S A;  4AND A;  2V5H G;  1VK8 A;  3TAM B;  3J7Y U;  2HLU A;  1RWO B;  4QR2 A;  3RW7 A;  4P2S A;  4LF8 J;  3NGS A;  3VQT A;  5DLG A;  3ET6 B;  2DCU B;  4ECY A;  2J0S D;  1NK0 A;  1UCN A;  4IH6 A;  2GX8 A;  1CG2 A;  2RHS B;  2VPZ B;  3UDE A;  4JYA J;  9RUB A;  1T02 A;  2GJ2 A;  2HFU A;  2LU2 A;  3MEG A;  2XC9 A;  2PI5 A;  1HNV B;  1WDT A;  3PEH A;  3DOL A;  1EX8 A;  3NCQ A;  4OI2 A;  5M2U A;  2KH9 A;  2AX0 A;  2R8I A;  3BH7 B;  3HHL A;  3MR3 A;  3CNQ P;  5E3R A;  1BE4 A;  1C2P A;  4OX7 A;  4DPU A;  4QIV A;  2R2S A;  2HWT A;  2ZEJ A;  6AT1 B;  4ELT A;  4IOA Q;  1ZPW X;  3SV3 A;  1UA0 A;  4B3R F;  1VQS A;  4RUH A;  1WAC A;  2CQP A;  4OQJ A;  3PIO Q;  3QYY A;  1S1U B;  3LP1 B;  1FXD A;  4L76 A;  1AZS A;  2C3M A;  3AOD A;  4IFY B;  5GME A;  1KC8 T;  3CJ5 A;  2BVZ A;  5F9N A;  3M4X A;  2CJB A;  1YBT A;  4FN5 A;  4DG1 A;  3DOK B;  3VQS A;  4ED7 A;  2Q43 A;  3L7O A;  2W2Q P;  3OQ2 A;  2ASJ A;  3EX7 B;  2R7O A;  4CP5 A;  4USV A;  5D0R A;  2CVE A;  4XDD A;  4DV5 J;  3PHT A;  3KOA A;  4YB6 A;  2YKM B;  5AJ3 F;  4DL3 A;  4GRS A;  2V4Q A;  1JJ2 R;  3DDN A;  3DRS B;  4OFZ A;  2RAQ A;  3PJW A;  3S1T A;  4Y2A A;  4AQY F;  1RAH B;  2OMO A;  4PWD A;  4RKU C;  1Q1K A;  3G8T A;  2VD3 A;  3JSM A;  1FE4 A;  2Q66 A;  1FJ7 A;  5HO4 A;  4QPX A;  1FE0 A;  4ATN A;  2ROG A;  3TUJ C;  1Z2L A;  3UQS A;  4F3Q A;  4X65 J;  2MDA A;  1BQN A;  2GIF A;  3ITH A;  5HI7 A;  3E01 B;  4K5S A;  2RU3 A;  2KYZ A;  4HAC B;  1R7I A;  3AAW B;  5F8J A;  3KK1 B;  1JK9 B;  1JKH B;  2EXU A;  1XTZ A;  4KGK A;  1OWX A;  2DY9 A;  3AD8 C;  3D4J A;  4PQU B;  5BR8 F;  1FJG F;  3BV8 A;  2N3L A;  3TAR A;  2BX6 A;  3TQE A;  4DUZ F;  5KFC A;  4OJG A;  3BJY A;  3CC2 S;  1D8Y A;  2ZKT A;  2HYI B;  1X8D A;  3HFK A;  1ZPV A;  4BWM A;  4LR7 A;  3PO5 A;  4QCL A;  1FES A;  1TKT A;  1WJ9 A;  1ZA1 B;  3HVW A;  4RBU A;  2MQL A;  3DMJ A;  2Z57 B;  3W8P A;  3FDS A;  4ID8 A;  2AWZ A;  4J9U E;  4ANE A;  2NSB A;  1IUJ A;  1U6Z A;  3BBB A;  3BR8 A;  3Q8V A;  1BQN B;  1TVR A;  3TAP A;  4FVM A;  4RWX A;  1CJV A;  1IBM J;  3FCV A;  2V67 A;  4DPO A;  2IVY A;  2L3M A;  1U8W A;  2XSF A;  4ETX A;  4ZJQ A;  4LFA F;  1UAW A;  3PX4 A;  2M52 A;  4OZ2 A;  4ZA1 A;  1URN A;  1JKH A;  1VQY A;  4TY8 B;  4R0J A;  2K1R B;  2QN6 B;  2WZ1 A;  3Q8R B;  2CPE A;  3SQG A;  2R2T A;  1DJ0 A;  1P8G A;  3LAN A;  4NA3 A;  3FSY A;  4F3O A;  1O5J A;  4PRF A;  2VB6 A;  1YK9 A;  5LJ5 Y;  3LOU A;  5KFG A;  1QE1 B;  4JI3 F;  3E51 A;  3OL8 A;  4DQS A;  4XDC A;  4DZD A;  4OJ1 A;  1U2F A;  1NCL A;  3UCZ P;  2ATL A;  2Q3P A;  3GIR A;  5J2Q A;  1N33 F;  1JLG B;  5H1S V;  2BBE A;  1D09 B;  2GIR A;  3GTY X;  3I4H X;  4I6W A;  4AL5 A;  4JI0 F;  3GYX B;  1FTR A;  3DCA A;  2RDD A;  4ZPB A;  2DRA A;  2ROP A;  1LNQ A;  1DY3 A;  2B9W A;  2C3O A;  2AYB A;  1Y4Z B;  4CTA B;  3VAM A;  3GFH A;  2FC8 A;  4Q5V A;  5MAO A;  2DGX A;  2Z2L A;  2R7W A;  5CCM A;  3IWL A;  4ECT A;  2DGS A;  3DRR A;  3SMZ A;  4Q0B B;  1S7H A;  1KOH A;  4ED1 A;  4LFC F;  4DBQ A;  4I0W A;  5L46 A;  4IFV B;  2G9O A;  2J8A A;  5EUH A;  2O3D A;  1RU2 A;  5RUB A;  4Y2M A;  1L3K A;  4OI0 A;  2HZC A;  1UJ6 A;  4NML A;  5L9N A;  1RT7 B;  5CAA A;  4CLK A;  5E3C A;  4ZJO A;  3C2P A;  2H51 B;  2I0X A;  2HVD A;  2WK4 A;  2EPI A;  3GCX P;  3M8Q B;  2VKZ G;  2ATC B;  4OYI A;  4USU A;  4ZP7 A;  2CPZ A;  4Y28 C;  4ZVS B;  3TAN A;  5DG9 A;  4P2X A;  2CNN B;  3M6X A;  4W4M A;  2HNZ B;  4QWE A;  4OX9 J;  3I31 A;  2DGU A;  4M5N A;  3J7A 1;  4JI3 J;  2AF6 A;  5JUM A;  2F7V A;  5HBM A;  4A8Q A;  3GIK A;  1RTZ A;  1NH7 A;  5EWG A;  2ZH4 A;  4Q8E A;  4F04 B;  2K8G A;  1GMW A;  3KLG B;  4A8M P;  1UEU A;  3ILI A;  2CQ1 A;  4DV6 J;  4BDP A;  2VH7 A;  4O3Q A;  3ZTS A;  3IBF B;  1FT8 A;  1SJR A;  4IFV A;  1X4A A;  4X4T A;  3GYG A;  2HGM A;  1S49 A;  4P72 A;  2UUB J;  1JXL A;  1RWK B;  2HHP A;  3H2U B;  4JOU A;  5ETT A;  1LFW A;  2PO4 A;  4IO1 A;  3OHB A;  2VG5 A;  1UVJ A;  5CCL A;  1R0A A;  3KLF B;  3E8O A;  3M8Q A;  4J9Q A;  1I94 J;  2HNY A;  2M7S A;  4LQ9 A;  1SH3 A;  2MQP A;  3CJ3 A;  4ZN1 A;  3CE8 A;  4RW8 A;  1TKZ B;  2AX1 A;  1HNV A;  4FPR A;  2V9K A;  1WEZ A;  2VPW B;  4BS2 A;  4M5H A;  5K8M A;  4ZLJ A;  3GB0 A;  2CWX A;  2OPR A;  2XMJ A;  5B0F A;  2HQI A;  4LRF A;  3GYN A;  3JQK A;  1H2V Z;  2MKK A;  3KG0 A;  1YKW A;  1VQN S;  2G0C A;  1EP4 A;  4H4K C;  5G4D A;  1QUP A;  4Q2L A;  2PMZ D;  2JNJ A;  2HHH F;  2YPZ A;  2VUG A;  3TVZ A;  5DGA A;  4F8R A;  3NMR A;  4ENO A;  1OY8 A;  1QDU B;  2POK A;  2Y3Y A;  3IWX A;  3I9V 9;  3NGT A;  3CDB A;  1H72 C;  4NI2 B;  4WBF A;  1NDP A;  2W25 A;  1KTV A;  2CZ9 A;  5DDQ C;  2GO9 A;  2H3E B;  1RAB B;  3I0S A;  3KK2 A;  2HBR B;  2FHJ D;  2R8J A;  3QRR A;  3T1H J;  3KHG A;  2E1P A;  3T6B A;  3D6T B;  5KFD A;  1UVK A;  2OP5 A;  3QQC D;  3NY0 A;  4CNZ A;  2IM3 A;  1VJW A;  2R8H A;  2XNR A;  2DTJ A;  2H54 B;  3PXG a;  3BPS P;  2YQ1 A;  1OY6 A;  5EX3 A;  1GX5 A;  1Y10 A;  2JC1 A;  4C98 A;  3TVK A;  4PUO B;  1ZYQ A;  4LVN P;  4Y6I A;  3T5J A;  3WX8 A;  2DH7 A;  3C6T B;  1JLE B;  2O67 A;  4YME A;  2DKO B;  2OPQ B;  2L08 A;  5BYQ A;  1F9E B;  1T94 A;  4I2P A;  4LVO P;  1ARO P;  2JOQ A;  1FDB A;  1PBU A;  4PQA A;  2QIF A;  2LVW A;  1UWB B;  2LQ5 A;  2D41 A;  3BYP A;  1I1G A;  3ZZT A;  4N7T A;  2ZFH A;  3QWP A;  1RKI A;  1JLF A;  1LWX A;  2XUL A;  5I4M A;  5AT1 B;  1NKE A;  3CWJ A;  4U96 A;  5B09 A;  1FDN A;  3QMQ A;  1N4L A;  2OIH A;  2WVC A;  2HHX A;  2VBX A;  3LAK A;  2G2Z A;  1U0H A;  3AT1 B;  3PYF A;  1RT6 B;  2HQC A;  4ZVQ B;  1FD2 A;  3FBB A;  3J80 Y;  2RRB A;  3SCL E;  1YX2 A;  4Y34 A;  5AXM A;  3ZZZ A;  1S6P B;  1DQ9 A;  3GV5 B;  3F73 A;  4B3M J;  1ZBT A;  3DRY A;  3HI9 A;  3R9L A;  4NLO A;  2ZH8 A;  2VFU A;  4AL6 A;  5J2P A;  2OEK A;  4X4O A;  1QLN A;  4X2B A;  1Q0N A;  5L1J A;  2C2K B;  4KO0 A;  3V6J A;  1S1X B;  1KR4 A;  4OYP A;  4DMZ A;  1X31 C;  3UO0 A;  3OL9 A;  2XZT B;  4PWW A;  1SJF A;  3ULH A;  2Z4P A;  2ZBI A;  3MFI A;  3MAH A;  1DHM A;  4B02 A;  2DR9 A;  5JVH Q;  4C6A A;  3BN7 A;  3V6K A;  5IFM A;  2XLI A;  3ELH A;  3MMA A;  2UV8 G;  5THW A;  1WKJ A;  4DUZ J;  3OTB A;  2PMW A;  2K06 A;  1X5T A;  4F0K A;  4DR6 F;  2MZJ A;  3OXL A;  2J9D E;  3RRG A;  1IBK J;  3CDW A;  5E33 A;  3KLH A;  1PG5 B;  2C42 A;  4DX6 A;  3IM8 A;  2E29 A;  2M70 A;  2WVF A;  2ZD1 B;  1JNZ B;  5A2Q U;  2LDI A;  4PG5 A;  4DN9 A;  1S77 D;  1LXN A;  3H5S A;  4NYO A;  3KK3 B;  1U24 A;  3EVW A;  3M05 A;  4CT8 A;  1RKJ A;  3V81 A;  3B8H A;  3MEK A;  4MK7 A;  1V6H A;  5D3G A;  4B3O A;  2HUR A;  1Z1Z A;  4FF2 A;  3ZC4 A;  4KH1 B;  1S4F A;  4L3N A;  4E8U A;  3ZFV A;  2GNK A;  3J7Z T;  1WD6 A;  3KJN B;  4RW6 A;  1N5T A;  2HK2 A;  3HSG A;  2EC2 A;  2MKI A;  5T7L A;  3IC1 A;  4ES3 A;  4KHP F;  3NG8 A;  5ETV A;  2EG2 A;  1NK9 A;  1NPK A;  5HAN A;  4K4W A;  1CJU A;  2RNE A;  4ZPW R;  5JVG Q;  2FVP A;  3AA8 A;  3BH6 B;  3T3F A;  4R8U B;  2YKN B;  3PRD A;  1CLF A;  1N48 A;  3NAI A;  5B0D A;  2HQG A;  1S97 A;  3BO3 A;  2RUG A;  1FK9 B;  3BSN A;  3SSR A;  1NM2 A;  4U9R A;  4K4Y A;  2JZ5 A;  4UUX A;  2HHT A;  3VTI A;  3UD4 P;  3CIZ A;  2K2P A;  4OHZ A;  5J2N A;  2I9S A;  3CF5 Q;  3MR6 A;  1RSC A;  1TEL A;  2DH9 A;  2JJ4 D;  4LF5 F;  1M5K C;  5BR8 J;  2CPY A;  1FJG J;  2F40 A;  2VPY B;  4B9M A;  3U02 A;  1LWE A;  1TL3 A;  2WVB A;  5A6W A;  4CH7 A;  1Y5I B;  3EZO A;  2ZVS A;  3OUY A;  4TU8 A;  2HHV A;  2G1D A;  4K4X A;  2VG5 B;  4YR2 A;  1Q86 T;  3MEE A;  3A3N B;  2R3V A;  4LSZ B;  1X9W A;  2BRL A;  4ZVG A;  4ZMM A;  2IJR A;  4QIF A;  4LT6 A;  3HT0 A;  1FRH A;  3MI7 X;  4G1I A;  3T19 A;  3US5 A;  4X4U A;  1TKZ A;  4KKO A;  2ZH2 A;  1IR1 A;  3HSD A;  3K5L A;  4LF4 F;  1UVL A;  4PYA A;  2VOP A;  1T3O A;  5F3T A;  3TJA A;  1PYS B;  4OZ0 A;  4PXB A;  2W9A A;  1UMJ A;  2CAD A;  1U1L A;  1YBA A;  4CLU A;  5KT6 A;  4CO0 A;  1UVI A;  2WOM B;  4FXW A;  3QZ7 A;  4AFF A;  3G2X A;  1NHU A;  1WG5 A;  2COL A;  1VJQ A;  2W4C A;  3M8S A;  4KIA A;  1HWJ A;  3Q23 A;  3AB4 B;  1JJ4 A;  3G4S S;  1UL3 A;  1SI9 A;  2G4B A;  1HD1 A;  2DGT A;  3GJR B;  4HTI A;  2LEA A;  4NI2 A;  4A8S A;  4OV1 A;  4B9N A;  4FXV A;  1CQN A;  3A13 A;  1UVM A;  4X4S A;  3X3U A;  4WTO B;  4RW4 B;  1C1B B;  3A1Y G;  4PXE A;  5LL6 d;  2UUB F;  2HPU A;  4C8Y A;  4NEZ A;  5F3Z A;  2KG0 A;  2YVS A;  1N33 J;  2OUG A;  4HT5 A;  4ED3 A;  3WX4 A;  5EHH A;  4NXM F;  3HO1 A;  2HND A;  3DLK B;  3MCN A;  2GMH A;  2ZNZ A;  1TKX A;  2DHH A;  1FNM A;  3BKF A;  4K2X A;  4QR0 A;  4RNN A;  2XBP A;  4DSI A;  1UET A;  3MR5 A;  4IOB A;  1JLE A;  2B4P A;  2FLN A;  1VQ6 S;  3MDF A;  4ER8 A;  2AYE A;  3KHH A;  3CDE A;  3MMB B;  3PDN A;  4DUY F;  2YNF A;  4ECV A;  3TOQ A;  2CNL B;  1R8P A;  1X5O A;  2HSE B;  4U7U K;  5AE1 A;  3P4U B;  1U7L A;  3POT B;  4Q43 A;  1ZET A;  2LA6 A;  3RR8 A;  1HBO A;  4IRD A;  4G3I A;  2AZ1 A;  1RJJ A;  5E3A A;  4YQW A;  3VAI A;  2P6T A;  2DXF A;  2JSX A;  1S6Q B;  2GO8 A;  3HVT B;  1Q8B A;  3QAU A;  5FDL A;  2YWH A;  4C3K A;  4ZPT R;  4F0H A;  4DX7 A;  5D15 A;  1S0M A;  2Q6C A;  2HGL A;  4ILR A;  1N5S A;  4M1K A;  2BAN B;  2BRK A;  7AT1 B;  4X62 J;  3ISN C;  5CD4 A;  3DDK A;  1KOO A;  3V4I B;  2HBQ B;  4QPT A;  3PW7 A;  1WC1 A;  1HYS B;  3QWU A;  2KVQ E;  4URQ U;  4DU8 A;  2DNG A;  2VAS A;  1WEY A;  3NOG A;  4Q2M A;  2J9C A;  4I69 A;  3TUZ C;  1VBY A;  4LF7 J;  3BSO A;  1G1X A;  1DTT B;  4QYZ K;  4UUW A;  1ZA2 B;  2E7W A;  1N34 F;  2QLF B;  4WII A;  3VWS A;  4C48 A;  4USW A;  4QWB A;  3R1L A;  2BE7 D;  3JSR A;  1DZ5 A;  3F41 A;  4F4X A;  2UVW A;  2KDO A;  5I3P A;  2DVI A;  2MZR A;  4CYU A;  1N0V C;  2DXE A;  3HFV A;  2YX1 A;  5A0Y A;  5LXR A;  4P9S A;  4ES2 A;  2IC3 A;  3PAC A;  5K14 B;  3J81 U;  2C2M B;  3L7U A;  1F2G A;  1NJZ A;  2GQQ A;  3CD7 A;  5A8W A;  3C16 B;  4XO0 A;  2GHP A;  1DTQ A;  2X1B A;  2VQE F;  2D1C A;  1T03 A;  3OFE A;  1S0V A;  1DQA A;  2QA1 A;  4OHY A;  2GS8 A;  1FA0 A;  1AFI A;  3WIV A;  2R42 A;  2WW4 A;  2PFF B;  2DD8 S;  3R27 A;  2MY7 A;  4MK8 A;  3WDO A;  4DLE A;  4Y65 A;  2HS3 A;  2V8D A;  3T5K A;  1TKD A;  2VG7 A;  3NNC A;  3MOJ B;  1FFG B;  2QA4 G;  1IQZ A;  1SKW A;  5IM0 B;  3HKW A;  1FEH A;  2V68 A;  4C11 B;  5DS7 A;  5A6P A;  2KTQ A;  3EVO A;  1RA7 A;  2MQM A;  4C2M A;  3O5T B;  4GKK F;  1Y0H A;  3M8Z A;  5KT2 A;  2ZD1 A;  3DLJ A;  2KFN A;  1YWX A;  2ZOF A;  2WSE C;  2KFY A;  4O3O A;  3NMA A;  3SXL A;  1V5I B;  2H48 B;  4A8W A;  1K9M T;  4OZN A;  2Z2M A;  1F5B A;  3J7A N;  1VRU B;  4MIW A;  2BAB A;  4LIW A;  4M5G A;  1P6T A;  3NRB A;  4OI4 A;  1PJ5 A;  3MZI A;  2U2F A;  2RSQ A;  5C24 A;  2R7R A;  2OPS B;  3FSX A;  5LMU F;  3TW0 A;  3KKF A;  2FPH X;  2VG6 A;  1RWW B;  4ZS6 A;  2XY7 A;  2XGQ A;  1RHR B;  2YQ0 A;  4RW4 A;  3KXD A;  5KFS A;  5DGB A;  3PTW A;  3LP1 A;  3HUL A;  3NGK A;  2VIH A;  1BD6 A;  1T11 A;  1IWA A;  4FYV B;  3G82 B;  5EX0 A;  1IBC B;  5L38 A;  3C6U A;  1IKW B;  4ZN3 A;  1SKU B;  3V5R A;  4C8M A;  3P96 A;  3PIP Q;  4K0K F;  2FHO B;  4NLU A;  5J1E A;  2MSS A;  1KLN A;  3Q86 A;  3W61 A;  2ZZN A;  1R8B A;  4GVB B;  2WHO A;  3TA1 A;  5HJY A;  2YWW A;  2KKH A;  3NKY A;  1VRU A;  3DRS A;  4NAS A;  4UOF A;  1I6J A;  2DHG A;  1X0F A;  4IG3 A;  4MAK A;  1ZS6 A;  2Z58 B;  2F3J A;  1AT1 B;  5KFM A;  2DNP A;  2ASD A;  4K7Q A;  1JLA A;  2AJ0 A;  1CJT A;  4MJK A;  2NXC A;  3DOL B;  4RJV A;  5D77 A;  2OML A;  4OMF G;  1JB0 C;  3QT7 A;  1MRO B;  4DPT A;  4JI7 F;  1J5O B;  5B0G A;  3U1N A;  4DQI A;  4CIO A;  3PJ9 A;  4YB1 P;  3HK2 A;  2W9C B;  1LFP A;  1LW2 A;  1WSR A;  4O4R A;  4KHP J;  1FX4 A;  4F36 A;  3GJQ B;  3IP0 A;  3ZTP A;  3W62 A;  1R8H A;  3DHX A;  3EZU A;  2AT1 B;  4AXJ A;  3GJT B;  4I64 A;  3IWN C;  3MPV A;  1OY9 A;  2LXI A;  4KKO B;  2Q1L A;  2W4P A;  1K47 A;  4WZQ A;  3AOA A;  2OLW A;  1VIX A;  2JL9 A;  3DOM B;  1XNQ J;  1Y3J A;  1QAI A;  1VGY A;  3DYA A;  1FEE A;  1MN9 A;  3M2R B;  4RW8 B;  2HWI A;  1C0T A;  3MUT P;  1YJT A;  2ZE2 B;  3FEX B;  1K8A T;  4DV2 J;  4IQX A;  4I6A A;  3DN9 A;  4CO5 A;  4CH1 A;  1C0U B;  4ZKA A;  1MRO A;  3H98 A;  2ERR A;  3UFC X;  1FWL A;  1H2U X;  3M8W A;  4DV1 J;  4YY3 J;  3TEH B;  2J6T A;  3TWZ A;  2OEM A;  1SH2 A;  2VKR A;  3UVJ B;  2ADB A;  1HL6 A;  3ITH B;  4NLT A;  2M8H A;  1XN9 A;  1M5P C;  3FBF A;  2FGC A;  2D9O A;  4PWU A;  4DL7 A;  2XMK A;  5C7P A;  2PN6 A;  3MUR P;  3SQG B;  5IV3 A;  2HND B;  1TK5 A;  1VR6 A;  3FRY A;  4MMO A;  2DNL A;  2YKP A;  5B0E A;  2WSC C;  4OYM A;  5KFJ A;  4WXW A;  3OTO F;  5HP1 B;  1SIW B;  1YRX A;  1A9N B;  4MIA A;  1NDL A;  3DFE A;  2LP4 A;  4V1A k;  2FTR A;  3V6H A;  2HHS A;  1EHW A;  1KRP A;  1SUQ A;  1R43 A;  5K8N A;  3KJV B;  2CWK A;  1XJW B;  3EVM A;  2AJF E;  3M6W A;  2B7B B;  3TA2 A;  4XPE A;  4AQY J;  4CCH A;  1X5P A;  3GFX A;  4JUZ A;  2GQ2 A;  5IWA J;  2RVJ A;  3HJV A;  4WYW A;  1FO1 A;  3UVJ A;  1IKV B;  2CRL A;  1FRI A;  2CDQ A;  2J7U A;  3FKB A;  2DNR A;  5ETR A;  1NSQ A;  2JDJ A;  3M2V B;  2AMC B;  4O4G A;  3VCD A;  2ZHB A;  3ZZ0 A;  1VC5 A;  4CLW A;  3RBZ A;  2ZH7 A;  3V4I A;  1XER A;  2ZDO A;  2F9D A;  3ZXW A;  2Y8W A;  3P6Y C;  4Q0B A;  1FXL A;  1U1M A;  3BQ2 A;  2BJ9 A;  2IHR 1;  2EFV A;  1N8R T;  2LA4 A;  2EFG A;  2R7T A;  3U1M A;  2NYH A;  4HKQ A;  3SCJ E;  2C3Y A;  2SXL A;  2QC3 A;  4ED0 A;  1ULR A;  4YY3 F;  3BGO P;  4DHV A;  5D4L A;  3OVA A;  2CPD A;  2AU0 A;  1Q7Y T;  3PY8 A;  1SQF A;  2P9C A;  4N77 A;  1S9E A;  3RZA A;  1Q78 A;  2VDH A;  2DGO A;  4CYU B;  5HRO B;  1Q4R A;  1SVD A;  2CQC A;  3N28 A;  4JB8 B;  3SBM A;  3ZZO A;  5HMZ A;  2KVI A;  4UT4 A;  4N5S A;  2EK6 A;  3TZX A;  2IMW P;  4NCB A;  1NND A;  4NLP A;  5J2Q B;  2BR0 A;  2MB0 B;  1RBA A;  3NEK A;  1GH8 A;  2RE1 A;  1A7G E;  3D0I E;  1WOP A;  2LDY A;  4P10 A;  3P3D A;  4O4G B;  4NWB A;  1ZH5 A;  4PXD A;  1NK4 A;  2F5G A;  4EFA C;  2OH2 A;  1TV6 A;  1RCX B;  2AEF A;  1IBM F;  2J76 E;  1FNO A;  2KG1 A;  1WDD A;  4RR5 A;  4UF4 A;  1LWC B;  1FRL A;  4WFB Q;  4LF6 F;  2V8V A;  1Y11 A;  4ILL A;  1VBX A;  1C4A A;  2K3I A;  5KFQ A;  3RBD A;  1FFS B;  4KGZ B;  1T3N A;  4LF7 F;  1WKK A;  3QAE A;  1VIS A;  2XWY A;  4WWS A;  3MAA A;  2BJ7 A;  1LEO A;  3A4T A;  5J1N A;  2H65 B;  4N47 A;  1NK7 A;  2LQJ A;  2QYG A;  3AQO A;  2XB2 D;  1BQM B;  1TL4 A;  2DJW A;  3FVY A;  2YKQ A;  1PBA A;  2KI2 A;  1U0S A;  2HFS A;  2N7Y A;  1CS4 A;  1KLM B;  1X4C A;  2B6A B;  2MQ8 A;  1T9X A;  2VZ9 A;  4ICL A;  4O23 A;  4RW7 A;  3OFF A;  3SFU A;  1V9O A;  3PHE A;  4GMK A;  2C2D A;  1RTD B;  1M1H A;  1X9S A;  4PAA A;  3H40 A;  3TP2 A;  1RAA B;  3EGV A;  3Q8P B;  3L9Z A;  3Q0A A;  4DWI A;  2VQF F;  3UN2 A;  1P1T A;  3KK3 A;  3PX6 A;  2XMW A;  3ILL A;  3V81 B;  1HQU B;  1S9G B;  1SQG A;  5CH7 B;  2Z56 B;  3OPK A;  4O44 A;  2HMI A;  2X1F A;  3R5G A;  4ZVU B;  4JV1 A;  4LFB F;  1EKR A;  1EAY C;  4IDK A;  1T9V A;  3EIC A;  1R3N A;  3KG1 A;  2JHE A;  5BYR A;  4JI2 F;  4KY3 A;  2DNN A;  3I56 S;  3SYZ A;  4ECZ A;  2WB4 A;  1T05 A;  2QLW A;  2GW8 A;  3LP2 A;  2XMA A;  1LV5 A;  2V4J A;  5HQM A;  5J1E B;  3MTJ A;  1Z4U A;  3FQL A;  4EWT A;  4GVB A;  4YOE A;  1H98 A;  2B8Q A;  4U6P A;  2W24 A;  4C8K A;  1B0T A;  3LGH A;  4KBI A;  2K3K A;  4YHH J;  1WC3 A;  1ZTT A;  4U95 A;  2FGO A;  3DGP A;  3T9Z A;  2ZC3 A;  3CD0 A;  4NZ6 A;  1WHX A;  4K59 A;  4DSF A;  1QTN B;  4DSE A;  2R8G A;  2L41 A;  1BUX A;  3LPY A;  4X4R A;  3BM7 A;  3K2Y A;  2W2N P;  2V6A A;  1F6T A;  1MN7 A;  2FJA B;  2H5E A;  3L7P A;  3RGI A;  3UI3 A;  4DFP A;  1TUW A;  4DCO B;  3UCU P;  3TI0 A;  1YI2 S;  1QTM A;  1NAQ A;  2DH8 A;  1ZAV A;  4OV6 A;  1TAQ A;  2YKA A;  1NLK L;  1RT2 A;  4KHR A;  1T05 B;  2JFK A;  2XY6 A;  4IYQ A;  2KJW A;  4CLS A;  3FZ2 A;  3O2I A;  4NLX A;  5HK4 A;  1F0X A;  2AEM A;  2CVI A;  2EFO A;  5KG0 A;  4CWB A;  1V3R A;  3U1L A;  4XK8 C;  4MK9 A;  3M32 B;  4O0N A;  4ZLP A;  4DV3 J;  2OSQ A;  4B17 A;  3ZZU A;  5E3Q A;  1U02 A;  4JI6 F;  3SV4 A;  2XYP B;  3H5U A;  1J5E J;  1RT6 A;  3AA9 A;  3GFY A;  4MKB A;  4CO1 A;  2BJ8 A;  2CKW A;  4P71 A;  4JI2 J;  2ZE2 A;  4NMX A;  5A76 A;  2W2O P;  1N6Q A;  4NLG A;  3T9N A;  1ZAW A;  1D3W A;  1HHS A;  1HHQ A;  1HMV A;  5H9E K;  3IRX A;  3N5B A;  2WOM A;  3PRV A;  2OTL S;  1GK8 A;  1PGZ A;  1M5H A;  4F4A A;  4JV5 F;  4YB7 A;  3QRQ A;  3M1V A;  2XI3 A;  4OZ1 A;  4M5L A;  2BJE A;  3SDE A;  5HLF B;  2FJX A;  1Q53 A;  2P9E A;  4GO5 X;  1GTE A;  2RS2 A;  4ZPV R;  2W4D A;  4ZDN A;  1VBK A;  1FDA A;  2PEH A;  4WFA Q;  3D3C J;  1FRJ A;  4Q44 A;  2XGP A;  3RW6 A;  4MKY A;  4XAK A;  2KU7 A;  4BBY A;  1IR0 A;  1PAE X;  4R25 A;  1WOS A;  2MGZ B;  1CVJ A;  2EWH A;  1H3D A;  1SC1 B;  1CUL A;  1WWH A;  1Q79 A;  1WUU A;  4TVA B;  4DR2 J;  2KN4 A;  3KMQ A;  2CQ0 A;  2HGN A;  2IBO A;  2HRT A;  4FNI A;  3MMA B;  4IOC Q;  3V4M A;  2B4V A;  2X51 A;  3LW5 C;  3IR6 B;  3GIL A;  3BEG B;  4URG A;  2R7X A;  4IR9 A;  4YN3 B;  2NXJ A;  4FBU A;  2OSR A;  1OSC A;  3MOZ A;  3DLK A;  1MLA A;  4X66 J;  4RPF A;  5C5J A;  3N79 A;  2V2Q A;  2J6U A;  1KVK A;  4DV2 F;  2AEJ A;  1BY9 A;  4U8Y A;  1CJK A;  4M94 A;  4KH0 B;  5DG8 A;  2LEB A;  3I0R B;  3DKD A;  1WHW A;  2JVR A;  3FMB A;  3ZZP A;  1JLB A;  5C42 B;  1P1L A;  2MQQ A;  1NB7 A;  3QGP A;  1OS5 A;  3TQ1 A;  4C0O C;  2H1Y A;  3MMJ A;  4PKD B;  3PYE A;  2OPP A;  2VA2 A;  4DR5 F;  2J0Q D;  1CC7 A;  3IN5 A;  1UP1 A;  5E5N A;  2DXD A;  2LFV A;  2X3D A;  5ETN A;  3UR3 C;  1HNI A;  3N9U C;  1YZ6 A;  2BAN A;  3R3T A;  4F26 A;  2JRS A;  2YNI B;  3PR5 B;  3MM5 B;  3K17 A;  3WHI A;  3ZTO A;  2XS7 A;  3HVA A;  5K9F A;  1JIH A;  2KJV A;  4GO7 X;  3K89 A;  3NGD A;  4I68 A;  3TZZ A;  1A0O B;  1MU2 A;  3GE9 A;  1TP7 A;  5IT9 Y;  2B56 A;  1H2T Z;  2J0X A;  2MKJ A;  3G96 A;  4LF9 J;  1HI0 P;  3PV8 A;  5A0Y B;  1H0H B;  3CVK A;  5CYJ A;  3ENA A;  3L3C A;  3OL7 A;  1TV6 B;  1XMO F;  5D8H B;  1KTQ A;  3WQP A;  1N54 B;  5HMX A;  4D3H A;  1DTQ B;  2FLO A;  3K7R A;  2DRB A;  3EWG A;  4E98 A;  1OJ4 A;  2PA8 D;  4HH1 A;  4LRA A;  4X66 F;  3EMT A;  1QSL A;  1RTJ B;  5GAG I;  2NUH A;  2BDP A;  4FYD A;  2HEK A;  2D69 A;  3HCX A;  1XMB A;  3QGI A;  2KM8 C;  4E0D A;  4UY8 T;  3R7B B;  3UPF A;  5GAD I;  2RB7 A;  2ZOM A;  3AOC A;  5HMY A;  4Q8F A;  3H25 A;  1S4E A;  2KO1 A;  3OUY B;  4W90 B;  3M8R A;  3CME S;  6FD1 A;  3DHW C;  4H4M A;  3AXM A;  3ZNJ 1;  4HTJ A;  1K0V A;  5IM0 A;  4TU7 A;  3FJ2 A;  2BZ2 A;  2YH0 A;  2BV3 A;  4Z2X A;  1X5S A;  2XMV A;  2V69 A;  3M30 A;  1B7Y B;  5KG6 A;  4ZLN A;  4CO4 A;  3ZNU A;  5ITH A;  4LRC A;  3PR4 A;  1DLO A;  2VFV A;  5D6G A;  5J2M A;  4QWC A;  4NRT A;  2HFN A;  2GJI A;  1LW0 B;  1VQO S;  2IFX A;  3HSJ A;  2XZW A;  4RBT A;  1NDC A;  1V3S A;  3WBZ A;  1Q81 T;  3QSI A;  4C97 A;  4LF1 A;  2MQN A;  2Y1L B;  2YH1 A;  3OHA A;  1PKU A;  4FPI A;  4NCA A;  2VOO A;  3EE3 A;  1Q5Y A;  4QQB A;  3MED B;  3TEG A;  2ZKU A;  2N7C A;  2LU1 A;  2ZNY A;  1RB0 A;  4KE5 A;  4ZPC A;  3D0H E;  3IRW P;  3CCW A;  1VIO A;  2IBK A;  3FUY A;  1TR0 A;  3O1L A;  4K5R A;  3MXH P;  2VBZ A;  1H74 A;  1IM4 A;  4HHH A;  2CQ3 A;  2HQ3 A;  2I5J B;  4DV0 J;  1RK8 A;  3PKY A;  4B9V A;  4MYU A;  1IKY A;  1YHQ S;  4X4N A;  1WF2 A;  3IA0 A;  3CJ8 A;  4RX6 A;  3AHP A;  4CT9 A;  5CAB A;  2ZHA A;  1PIE A;  2WBM A;  5FII A;  3CCL S;  4JI5 J;  1NJI T;  1HA1 A;  1I5O B;  5SZT A;  2DNO A;  4LJM A;  1REV A;  4UZC A;  2D3O 1;  4LSN A;  4DV7 J;  3AD9 C;  1LW0 A;  3CCU S;  4W92 B;  4C8N A;  3CCE S;  3SIP B;  2VJV A;  3CED A;  4DL0 C;  5GAG U;  2GAG C;  4ZCK A;  1UEK A;  2VU5 A;  4IG3 B;  4R0E A;  5D0G A;  4HHJ A;  1W7W A;  2V8H A;  4ALZ A;  1IBL F;  1RAO A;  4RNM A;  3D28 A;  2XSJ B;  1U25 A;  1VDH A;  2RDJ A;  1XNR J;  3DMJ B;  5ETL A;  2MJN A;  2O1P A;  2MPU A;  2WCX A;  1J5O A;  3OBI A;  4JP8 A;  1XC9 A;  2GV1 A;  3MWB A;  1UA1 A;  3JAM U;  4OLO A;  4BC9 A;  2QMW A;  3M32 A;  4B3S F;  5E2Q A;  4PG4 A;  4ZVE A;  4RNO A;  1L3V A;  3OJS A;  1E6Y A;  1SC3 B;  3QT6 A;  4O3N A;  4NZ7 A;  2MZT A;  3LO3 A;  4KFB A;  5DDO C;  3B54 A;  2WAQ D;  2FVR A;  2NCK L;  3KG4 A;  3PW5 A;  1LXJ A;  1VK3 A;  2HW3 A;  3D68 A;  1EIY B;  4Y2C A;  3LUY A;  1YVF A;  3BKT A;  4OLP A;  5A8R A;  3R7S B;  5HAT A;  4C0H A;  5LXY A;  1U1O A;  4IR1 A;  3A3P B;  3C66 A;  3KDN A;  1M90 T;  3QSY B;  3T5L A;  3FGV A;  3M2R A;  3ILJ A;  1AB8 A;  1C0T B;  2B9E A;  4DV0 F;  3H42 A;  4H4O B;  1LQ9 A;  1HBU B;  2QO3 A;  5BXI A;  5BJR A;  3J80 U;  4J9R A;  4IH5 A;  4OZJ A;  1BC6 A;  4M5J A;  4EBE A;  4UOC A;  2GVZ B;  1FER A;  3KFW X;  3MM9 B;  1HQE A;  2KT3 A;  3MCM A;  4DL6 A;  4ZVO B;  2CNK B;  2ZUA A;  4KPY A;  4V19 J;  3W7B A;  3DM2 A;  2DHX A;  4OL8 A;  4P2M A;  3W1Y C;  4A48 A;  5F8I A;  1GXL A;  3JSB A;  4KFB B;  3N6L A;  3RB4 A;  3JQM A;  1NU4 A;  4ECW A;  4N56 A;  4ITS A;  1L5U A;  3UD3 P;  1T7P A;  1PC5 A;  3HF5 A;  2YWK A;  2J8S A;  2HG4 A;  2F8H A;  4J9S A;  3LH2 S;  4M63 A;  4TLQ A;  1S0N A;  3MPD A;  1LWF A;  2C1E B;  1DRZ A;  3I0R A;  4WZM A;  1U6F A;  4WKY A;  3HMJ G;  3H20 A;  2MST A;  2FVC A;  1NPR A;  1YRU A;  3R2D J;  4H4O A;  4C8Z A;  4OJH A;  4L72 B;  1B3T A;  3MCO A;  4NX9 A;  3BQ1 A;  1JJH A;  1FI4 A;  1HR0 J;  4M8L A;  3HHN B;  3CUN A;  4NOH A;  2ZM6 J;  1BHN A;  1HQE B;  1JLC B;  2XS5 A;  2G13 A;  4DR1 J;  2OPS A;  1V3Z A;  3OVB A;  3DGV A;  2GGP B;  2MKH A;  1QY7 A;  1WEL A;  4LR8 A;  2ILY A;  4OHV A;  1SV5 B;  1SQE A;  2NS1 B;  1OO0 B;  2HRU A;  2V63 A;  3FFI B;  3C14 B;  4FKY A;  4IG0 B;  2I1R A;  2V0N A;  5SUH A;  3UCG A;  2VG7 B;  4EMD A;  2YWE A;  4UOH A;  4QBU A;  3G6V A;  1F2H A;  3L95 X;  1HLW A;  2W1B A;  2ZWP A;  3BO4 A;  1SKR A;  4OIX A;  4OYZ A;  2E9T A;  1XK8 A;  5LJ3 Y;  1OIA A;  3V6D A;  4LSL B;  5DDP C;  3C15 B;  2V2K A;  5AXL A;  1VQ5 S;  3QFH A;  1TL7 B;  1CEZ A;  4QU6 A;  3HSZ A;  1HNX F;  1D9D A;  1M5S A;  2CDR B;  3BGR B;  2AGP A;  1Q8L A;  5HVF A;  2VQE J;  3BF4 A;  1JLC A;  2XWX A;  3DLG B;  3HXM A;  3MGJ A;  3EUN A;  5F9L A;  1NJY A;  1W2I A;  3EPG A;  2LQ9 A;  2VPX B;  1RE1 B;  3IBW A;  3C46 A;  4J9O A;  1PAU B;  4CLF A;  2NQP A;  1WC0 A;  2VFR A;  5CHC B;  3GSD A;  3HD2 A;  4J37 A;  3MM6 A;  2C28 A;  2M0G B;  2XS2 A;  1RTI B;  4EBC A;  2MY8 A;  1QSS A;  2CPX A;  3PG9 A;  4NLY A;  1F3V A;  4B9L A;  4EI2 A;  3UDV A;  2PII A;  3THT A;  1KS2 A;  2CZ4 A;  4YP3 A;  3CMA S;  3AJ1 A;  4Z7Y A;  1RAF B;  4J9K A;  1UJ5 A;  3I87 A;  3D6F B;  1S9F A;  1T9Y A;  3SCI E;  4C8O A;  3W66 A;  2GCF A;  3CJT A;  4WFX A;  3N4W A;  3MD3 A;  4PR6 A;  4EZ6 A;  3QZ8 A;  3DLG A;  3K5P A;  4P7T A;  4KR0 B;  2R9L A;  3IGV A;  2BYC A;  2HBY B;  2QA2 A;  4ZVT B;  3RB3 A;  3MD1 A;  3EZ5 A;  4NA1 A;  3NS6 A;  4QR1 A;  2ZH3 A;  2HHQ A;  4NXM J;  3DNC A;  2CPH A;  2CJ9 A;  3GON A;  3HDS A;  2VF3 A;  6FDR A;  2NXN A;  2J0W A;  1F9F A;  2XO7 A;  1W2B R;  3VGU A;  1S76 D;  1YJR A;  5JJB A;  4L73 A;  1BWE A;  1YQH A;  3UN3 A;  1FRM A;  4JYA F;  3PYD A;  3TZY A;  1MW7 A;  1PYO B;  2C2Z B;  1S1W A;  3HP6 A;  5FJ4 A;  3A12 A;  1NK5 A;  5DO2 A;  3LWM A;  1K73 T;  1MSW D;  1NXI A;  1GEH A;  1V5V A;  2OPQ A;  2A6O A;  1SKS A;  1EQM A;  1RAD B;  1CC8 A;  3F0N A;  1OYD A;  3FK4 A;  1FJE B;  4B3R J;  2PC6 A;  4K4U A;  5DJB A;  3DGP B;  2NPF A;  3KJV A;  1T8E A;  3OJU A;  1U4B A;  3M8Y A;  1NH8 A;  2M8D B;  1Y5N B;  2V2V A;  2ZZM A;  1IKV A;  1RP5 A;  3LGN A;  5T14 A;  5B7W A;  5KG4 A;  1N0U A;  4WFY A;  1NDK A;  1J27 A;  1ZZN A;  1U1K A;  1RXO B;  2IAJ B;  3OXG A;  4NCG A;  2XHC A;  2JH3 A;  5L8R C;  3A8E A;  1U1R A;  1PO6 A;  2W7O A;  4K4Z A;  4OJ3 A;  3TRG A;  4ES1 A;  2ALY B;  1X9M A;  3R2C J;  2O5D A;  2VV5 A;  4B3T J;  2MMY A;  4PQU A;  1ZAX A;  3GLJ A;  2XHW A;  1RT5 A;  4LF9 F;  1U09 A;  4MKA A;  3VAG A;  2Y1J A;  1VQP S;  1N5Y B;  1RHJ B;  1IR2 A;  3OLA A;  3QLH B;  3QT5 A;  3QID A;  4J91 A;  4X65 F;  4CLL A;  3QO9 A;  4I7F A;  5KG5 A;  3SCK E;  3VHQ A;  4L74 A;  1EAR A;  3S01 A;  2KT2 A;  4X64 F;  3S8S A;  3H5Y A;  1W25 A;  2W7A A;  3CJ4 A;  1UKU A;  3D1Q A;  3MEC A;  4EGL A;  5KG2 A;  2UXB F;  3DLE A;  2BJD A;  3W9I A;  3TX8 A;  4AYB D;  1XNR F;  3ADA C;  1EQ0 A;  2R7Q A;  3PW4 A;  4YB5 A;  2HZA A;  3D6H B;  3VV2 B;  3VF0 B;  1CJV B;  1LKZ A;  3LA0 A;  4PZV A;  2J7W A;  4LFC J;  2RIJ A;  5HLF A;  1PJ7 A;  2X7I A;  2DO0 A;  3DM2 B;  3N6M A;  3PRB A;  4GKK J;  5EGY A;  1X7V A;  1EZZ B;  3HZE A;  2F8E X;  1L3S A;  5J1P A;  3H7H B;  4TNO A;  5IQ6 A;  4NZ0 A;  4U67 Q;  2OKQ A;  3NNA A;  1APS A;  4Y3C A;  1FKO A;  1RHK B;  2MGZ A;  5DG7 A;  1YSJ A;  1UEV A;  3O8W A;  3FBE A;  2B4O A;  3JTP A;  1QE1 A;  1ELO A;  4S0M A;  2LLZ A;  3NWR A;  4FYX B;  2LQB A;  4AL7 A;  4ECR A;  5DRK A;  4G1P A;  3OVS A;  4RLE A;  5D3G B;  3BDP A;  1YJU A;  4UOG A;  4KB7 A;  2MYF A;  2M5Y A;  4HHU A;  5LMU J;  4ED5 A;  3PW2 A;  4X62 F;  4DS5 A;  1RZM A;  2ZWO A;  1NKC A;  3IR7 B;  1S57 A;  2RT3 A;  1M5O C;  3DU6 A;  3SQO P;  3AH6 A;  1ZOT A;  3KDO A;  2HVI A;  3W64 A;  1NHK L;  2RQM A;  3UE2 A;  3JTO A;  4BWJ A;  8ATC B;  4DDF A;  4DV6 F;  1B70 B;  3KMS A;  1S6O A;  2GGP A;  2MLZ A;  1KBR A;  2V2Z A;  3B82 A;  3G6X A;  5J2N B;  4YDD B;  1HNW F;  4IDK B;  2W9B A;  3G9C A;  2QX0 A;  5HVG A;  4XPC A;  3VR1 A;  3HVR A;  2FJE B;  2CJK A;  4ILM A;  4KSE B;  4HL9 A;  2F9J A;  2M88 A;  2DIV A;  1U2C A;  3TR5 A;  1HQ2 A;  1TFW A;  3NOC A;  3TJ9 A;  2FZC B;  5KG3 A;  3V6D B;  1U1Q A;  2VL1 A;  2IIH A;  1JWW A;  4DPX A;  4JI7 J;  1CS4 B;  1WHV A;  2B6A A;  4HI1 A;  1VQ8 S;  3M7V A;  1HKA A;  2CJQ A;  2ACM A;  1ZM4 A;  4ZLL A;  2B5J B;  2ZZT A;  4ZOS A;  4ZVP B;  3NCR A;  3L4B C;  2JLG A;  2ZM6 F;  2Y0S D;  5L1L A;  3R97 A;  2CJY B;  1UFK A;  5HN0 A;  4TQS A;  2Z30 B;  1XMQ J;  1OPI A;  2O66 A;  3E3X A;  1RYR A;  4USJ C;  5AE2 A;  3JYT B;  2W9B B;  1RWX B;  3PJX A;  3R5C A;  3QGH A;  4QYZ J;  3MCS A;  1RWV B;  4CM0 A;  3MMC A;  1FWK A;  1X4B A;  3ETO A;  4GC6 A;  4LF2 A;  1ZZF A;  5KFK A;  2V4J B;  3OXF A;  2YTC A;  3VAL A;  4A8O A;  2RS8 A;  3EYZ A;  4JI1 F;  1SB6 A;  3KLF A;  1SJ4 P;  2FIU A;  3U7J A;  3BB5 A;  4MFB A;  2HFZ A;  4MH8 A;  2AGO A;  4JBC A;  4XTT A;  2YKO A;  2GVD A;  3W2W B;  3KJQ B;  3Q8U A;  2M3D A;  4JI8 J;  3JSY A;  5EN1 A;  1TKX B;  4HVZ A;  1PYT A;  1SL1 A;  3CTR A;  2F63 A;  3GU0 A;  3E01 A;  3ZTQ A;  2UUC F;  4HAC A;  2AKW B;  2VQF J;  3DXB A;  4LBP A;  2OEJ A;  2CPI A;  1HWL A;  3AB2 B;  5L9X A;  1ICE B;  1RWP B;  2XG8 A;  2E5L J;  3SSQ A;  2D74 B;  1RLC L;  2RF2 A;  2EBE A;  2YPY A;  4IRC A;  5GAE U;  4O0I A;  3KK2 B;  4FYY B;  1RBL A;  1GMU A;  3I0S B;  5F8G A;  5B0B A;  1SL0 A;  1IQT A;  1CSJ A;  4NLV A;  2NLW A;  4CLT A;  5FLX Y;  2XCA A;  3GV8 B;  1T0T V;  2D3Z A;  3MMB A;  1VQ9 S;  3DLB A;  3M6V A;  1OQ6 A;  4QW8 A;  4CQ1 A;  1FTC A;  1WEX A;  4M5M A;  3B4M A;  1XMQ F;  1FKP A;  1SJ1 A;  3PZP A;  2AW0 A;  1UZH A;  2QE5 A;  2JX2 A;  1XR7 A;  5H9F J;  4A47 A;  1REV B;  5IV4 A;  4YHH F;  5M2R A;  2A1B A;  5KG1 A;  2UUA F;  4OI6 A;  2Y0B B;  4RU9 A;  1M5V C;  4O3R A;  1BQX A;  3C6T A;  3HZG A;  3D67 A;  5D78 A;  4UZB A;  1N5V A;  5HJX A;  3G8S A;  4KGX B;  2A3J A;  3DRX A;  1NKB A;  4LMZ A;  2AIR B;  4PWD B;  2QGF B;  3TX0 A;  4FZV A;  2YXL A;  4NCG B;  1K1S A;  2W01 A;  4IH7 A;  1MWZ A;  1VYA A;  2GAH C;  2H4W B;  2XNQ A;  4UW2 A;  1KQG B;  1JLF B;  2RRN A;  5D0H A;  3QPI A;  3GV7 B;  4JI8 F;  4FS2 A;  3VVT A;  2C2N A;  2CQ4 A;  4ANC A;  2QLX A;  2BAC A;  5KFV A;  8RUC A;  2E1C A;  2UUC J;  1N5Y A;  2CQD A;  3MM5 A;  1RWU A;  1RHM B;  2MXY A;  2RKI A;  4F67 A;  1KNZ A;  4DV3 F;  2CAJ A;  5F8H A;  4ZVF A;  1F1B B;  2BEF A;  4I7F B;  1WI6 A;  4WE1 A;  3KLE B;  2DR7 A;  2JEI A;  1LOU A;  2HVZ A;  2HFV A;  4C3L A;  1DAX A;  2IM0 A;  2KXF A;  2RQC A;  1H6K X;  1S6P A;  1TL1 B;  4X4Q A;  2XMM A;  1NRK A;  3W5Y A;  1SXL A;  1WOR A;  2CZV C;  3FCH A;  3M8P B;  2AYG A;  1JLB B;  5C42 A;  2A6M A;  3MM7 B;  1S72 S;  1ZM2 A;  1R0C B;  1KDN A;  3C19 A;  4WK1 A;  2FDN A;  2DHA A;  4OX9 F;  3H4B A;  5G0R A;  4NLS A;  1Q8I A;  2OD4 A;  3D6M B;  2Z8Q A;  4EBD A;  5EWE A;  2BE2 B;  4ID5 A;  5KFT A;  3OV7 A;  3BGL A;  5ETQ A;  5I3U B;  4FDF A;  4A4J A;  3CCV S;  3H5X A;  2WRM A;  3CD5 A;  4N41 A;  2PT0 A;  2GQC A;  2XYH B;  4H4M B;  4KC5 A;  4FF1 A;  3JXO A;  2V8P A;  4R5P B;  1XEZ A;  7FDR A;  3BZQ A;  2DR5 A;  3CUL A;  1EET B;  1HI1 A;  3M30 B;  5ADZ A;  5CA5 A;  2LEC A;  1LWF B;  4JV0 A;  2BA9 A;  4CRJ A;  3UN5 A;  2E9Z A;  3A8J A;  1YJ9 S;  2XMU A;  5AXK A;  2BOP A;  1WF1 A;  2J5A A;  3EXY A;  3GMG A;  4LF5 J;  4NE9 C;  3I32 A;  1RAC B;  4CLY A;  3G82 A;  4WTY A;  4HYK A;  3ZZR A;  3PCO B;  3C6U B;  2PGC A;  3HLU A;  4P6Q A;  5FD1 A;  4YFU A;  4WKR A;  1RUS A;  2ZJR Q;  4DF4 A;  1IJF B;  4N76 A;  4MTP A;  1IVZ A;  4DLG A;  4C4W A;  3H59 A;  3Q8S B;  2QZ8 A;  5T7L B;  4Q7A A;  9ATC B;  3Q83 A;  3A8K A;  2MTL A;  1XR5 A;  2KHC A;  2CA9 A;  1KN6 A;  2W8K A;  4DI6 A;  1CJU B;  1JLA B;  4OX6 A;  1EET A;  3GII A;  4ZCL A;  4J9M A;  5E3P A;  2VC1 A;  4FKX A;  4FVC A;  2DRD A;  2MQO A;  5EWF A;  2HHU A;  3PM9 A;  4LF6 J;  4FNH A;  1RBO B;  2B5J A;  1QAX A;  3NP5 A;  3TO8 A;  1BWV A;  1J2V A;  1NEE A;  1ROF A;  2AHO B;  3IXQ A;  4FYW B;  3GWC A;  5J2M B;  1D0E A;  2J6S A;  2NZC A;  3BPD A;  4F4K A;  1RTH B;  4J9V A;  1KKH A;  2FQQ B;  3N01 A;  4DU7 A;  2IY5 B;  2HIY A;  8AT1 B;  1Q8K A;  3DYA B;  3IM9 A;  3EPI A;  1U1N A;  3JYT A;  2OGU A;  2Z2Z A;  3BGR A;  2VOD A;  2XSJ A;  1AUS L;  2JWN A;  3M9O B;  2KZZ A;  3UNG C;  4EO6 A;  2FZK B;  3RR7 A;  3HHL B;  3ET6 A;  3I5C A;  2ABY A;  2QMU B;  4BLG A;  5E41 A;  2GHV C;  1P9Q C;  3JB9 k;  1WC4 A;  4NRU A;  2DNH A;  2KT5 A;  1VQ7 S;  2F4V J;  5KFP A;  4AT1 B;  4KTQ A;  2H5I B;  1B64 A;  1S1U A;  3R5A A;  2ALZ A;  1JNR B;  3CJK B;  4NLR A;  4F02 A;  5H9E J;  1MML A;  1EB0 A;  3CCR S;  5IT9 U;  4ECX A;  2XEX A;  2P9G A;  3K8W A;  4I1T A;  3IMQ J;  1GFW B;  5K20 B;  1RTH A;  4ELV A;  2FD2 A;  4I2P B;  2KXN B;  2CPF A;  2HBZ B;  2G2Y A;  1HW8 A;  1AUD A;  3TUP A;  3CC4 S;  3ZZY A;  4IFY A;  1X4G A;  2QT7 A;  3IAS 9;  1XR6 A;  3UW1 A;  4NA2 A;  1HIY A;  2UP1 A;  3Q89 A;  2ZH6 A;  4NPO A;  4RO0 A;  2C2R A;  3CJS A;  2RML A;  5K8P A;  3BBC A;  4I4B A;  1NZ8 A;  2IPO B;  4F25 A;  3CC7 S;  3JSM B;  3CJQ A;  1YJ7 A;  2F65 A;  5LMN J;  1GXU A;  2DPJ A;  4MIB A;  3D54 A;  5KFB A;  3MM9 A;  3JS9 A;  3QGG A;  3HT3 A;  2GML A;  2WBR A;  3CMQ A;  4Z7C A;  3PVX A;  4QJV A;  1B0P A;  3GR1 A;  5I3Q A;  1Y9O A;  3SEO A;  3ZO7 A;  3DLL Q;  4QIE A;  2XLJ A;  1KVJ A;  1FRK A;  1RU1 A;  1RWM B;  1Y00 A;  2KXH A;  2WB1 D;  2A2C A;  3AD7 C;  2NPI A;  3P5T L;  4HI2 A;  4WP8 A;  5HMW A;  2KRB A;  1UFW A;  3QBC A;  4J9P A;  1VLO A;  2IRX A;  4A8X A;  3CIM A;  5A8R B;  5J2P B;  5B08 A;  2YWF A;  3Q8Q B;  3BN4 A;  2VBW A;  1S9E B;  1IBK F;  2P2C B;  2IJN A;  4WK3 A;  2DNK A;  3CSK A;  1F5A A;  2PSZ A;  2G1H A;  2HVE A;  4Y2I A;  1B99 A;  3LAM A;  5KFL A;  4ZIT A;  2ZH1 A;  1IBL J;  1C1C A;  1G6B A;  2N3O A;  4C0B A;  2L9N A;  1S6Q A;  5FDL B;  4OYB A;  5CYM B;  2FVQ A;  2ZBR A;  3RBE A;  1F3F A;  1HBN A;  1HAR A;  2GVZ A;  3ICL A;  3OLB A;  2CUY A;  2OHD A;  3LAL A;  4DR7 J;  3GG1 A;  4KGM A;  2IAJ A;  5HRO A;  3NGR A;  4KQZ A;  5D4N A;  4DV4 F;  3IAM 9;  1Z2Z A;  3G87 A;  2HZV A;  2G2O A;  1WNE A;  4JI4 J;  3D3B J;  1HHT P;  1U2R A;  2KB2 A;  1CPZ A;  3AJD A;  1U49 A;  3OR1 A;  3WIU A;  3IO1 A;  5KFO A;  4WP3 A;  1WF0 A;  3RTV A;  3G86 A;  1UPM B;  2Z2Y B;  3HFZ B;  2GHW A;  2JFD A;  1QUV A;  2P8I A;  3NAH A;  1YG0 A;  3QLH A;  4I2Q A;  4YS2 A;  2DGV A;  4GVL A;  2W2M P;  2P6S A;  3RAX A;  3LF0 A;  4DR2 F;  4IUF A;  2LQ8 A;  1R0B G;  1BGX T;  1SL2 A;  4B3M F;  4J7C A;  4PG6 A;  1U26 A;  3MUV P;  4DR3 J;  1OYE A;  3H4D A;  2UV8 A;  2FJB B;  5G0R B;  2IDE A;  5U47 A;  1RTD A;  2OJ3 A;  2QSF A;  4WYL A;  1L3U A;  1Q82 T;  4B08 A;  1BQM A;  1WG4 A;  2EFN A;  3EGW B;  4DN0 A;  2Y1I A;  5I3U A;  1P27 B;  2B7C B;  1X4H A;  2FB0 A;  2WVE A;  4ICL B;  3W9H A;  3NBP B;  4O44 B;  5GAH I;  3FFI A;  2VBY A;  4DF8 A;  1X0P A;  1SJQ A;  2YX4 A;  2Z0G A;  3C14 A;  3QIP A;  4RW7 B;  5DZ7 A;  3WZ0 A;  3CXC R;  3DI6 B;  4WP9 A;  4QWD A;  2A10 A;  3LWL A;  4DL2 A;  2UVU A;  4DCJ B;  3KNA A;  3AQP A;  2RU9 A;  3I5B A;  3OR1 B;  4P2F A;  3K58 A;  3R7N B;  3V2U C;  3MAQ A;  3BGU A;  3F44 A;  1FK9 A;  1RAI B;  4TY9 A;  3AY0 A;  4BHQ A;  2J9D A;  1UWA A;  2C3U A;  4ZIW A;  5ETK A;  1XQI A;  4LBI A;  2UZA A;  4UQG A;  1HQU A;  1RHQ B;  3NL0 A;  4NLW A;  3NCP A;  1HNZ J;  4CDI A;  5IC6 B;  3G6Y A;  1NK6 A;  2BJ3 A;  2G0J A;  3JQJ A;  2DGW A;  3GSI A;  1F9H A;  1VHF A;  1KQS R;  2VHG A;  3QFW A;  4DV5 F;  1AXQ A;  2HNZ A;  1VS3 A;  1LWE B;  1TL3 B;  3T1Y F;  1NBE B;  4X4V A;  5F8M A;  4J9N A;  2B4U A;  3SI8 A;  2CXE A;  5HBM B;  1KEK A;  4ZK7 M;  3THV A;  3PO4 A;  3QJP A;  1AFJ A;  2PD1 A;  3O3L A;  2A0F B;  3I96 A;  2ZBC A;  1RT4 A;  3DLH A;  3S7R A;  2NSC A;  2B3T B;  2F8M A;  1FVQ A;  2XMT A;  3DDI A;  1RAE B;  3W3S A;  1PC4 A;  4HT7 A;  4AD6 A;  2YX7 A;  1O0P A;  4K2J A;  4X84 A;  3MUM P;  4FF3 A;  4WU2 A;  5HVH A;  2FZG B;  2HHW A;  1Q7L B;  1MMD A;  3SSS A;  2N4C A;  3BSC A;  5HQL A;  5KAK A;  3TNV A;  2DO4 A;  2V34 A;  1N32 J;  3N6N A;  2CFX A;  1KD1 T;  1CJT B;  3VAH A;  3HHL D;  2QRR A;  1R31 A;  3RBX A;  1N52 B;  3CT9 A;  2DGQ A;  1HMV B;  2DEJ A;  1G3O A;  3KJF B;  4M5D A;  3OTC A;  1HFE L;  2DNZ A;  1F5C A;  2W9C A;  1HBM A;  1UW4 A;  4G1Q B;  3KLI A;  4EUV A;  2HLT A;  1YJW S;  3DXS X;  2ILZ A;  3R5B A;  4QOT A;  1TQL A;  5DDR C;  4RUA A;  5A2Q Y;  4KPC A;  1TZ0 A;  2E66 A;  3CJK A;  2C2E A;  5L1K A;  5LSO A;  1HNZ F;  1N6Q B;  3ISZ A;  4W98 A;  5KFZ A;  3MM8 B;  4ZHR B;  3OTO J;  1K1Q A;  4ZPA A;  2HKE A;  4U7C A;  5H9F K;  1RAG B;  2UUA J;  2R8K A;  3ISN D;  1RLD A;  2E5G A;  3P5B P;  1FX2 A;  3HJF A;  4HH0 A;  1CUL B;  2DBB A;  3FNN A;  2FHJ A;  1B0V A;  3I6P A;  3KUG A;  4USH A;  2KHD A;  5JXS A;  3R1H A;  5GMD A;  3CJR A;  5F8L A;  4UTG A;  2MHN A;  4L3K A;  4O3P A;  2DY1 A;  1KFD A;  2GVD B;  2XI2 A;  2UUT A;  4URS A;  5D0E A;  3OL6 A;  2C2O B;  2KYX A;  3ONQ A;  1C0U A;  3KWM A;  4P74 A;  5E7O B;  3W2V A;  2VC0 A;  4P52 A;  3JAM Y;  4N8O A;  3BGF A;  1CJK B;  3MPU B;  4CLP A;  3KHR A;  4ZP6 A;  1S0O A;  2ASY A;  3TVY A;  4DL4 A;  1N36 F;  4YEA A;  1YTY A;  2IA6 A;  3KLI B;  5GAH U;  4M5K A;  1SJ3 P;  3BO2 A;  2F4V F;  2O01 C;  2B51 A;  2NUU G;  2CQB A;  2RF2 B;  4HDG A;  4JI0 J;  1UWB A;  2ZC4 A;  4KJI A;  2CQ2 A;  4HLB A;  2X3G A;  2ZHO A;  2DR6 A;  4B9U A;  2DT9 A;  5GVQ A;  1QJH A;  1S48 A;  5ETP A;  1PJ6 A;  4DPY A;  1JX4 A;  4J90 A;  5KFI A;  2QA4 S;  1FFW B;  1NK8 A;  4M5I A;  2NR0 A;  2AGQ A;  2XLK A;  4F4Y A;  4WJB A;  4WXO A;  2IRU A;  1U0H B;  2ZDP A;  3BBF A;  4C7Q A;  1S1T A;  2EW9 A;  2M4M A;  4OI1 A;  1GMV A;  4LF4 J;  4B3S J;  3QNW B;  1BLU A;  1ZM3 A;  2Q6B A;  3O44 A;  4KAI A;  4OHX A;  1WHY A;  2EFP A;  1R8C A;  4DUY J;  4TU9 A;  1T03 B;  2FJD B;  1I51 B;  3MEC B;  2FJW A;  5CZX A;  4DEZ A;  1A6L A;  5KG7 A;  3PKM A;  2VON A;  1TAU A;  3HD1 A;  1Y3K A;  5D4P A;  3A3O B;  4RL1 A;  1FHT A;  5DZ6 A;  4UY8 5;  4K50 A;  2AP6 A;  1PSD A;  4HR2 A;  2MLX A;  2YBV A;  4ZJL A;  4KO0 B;  1RDR A;  1O8B A;  1S1X A;  2WW8 A;  1QAJ A;  1FJC A;  1VCT A;  1OMS A;  2RDI A;  3CCZ A;  3R8Y A;  2X1A A;  1VHI A;  4X4P A;  5I42 B;  3RB6 A;  1FKO B;  3AJ2 A;  3OW2 R;  3PYG A;  5C25 B;  4DZ6 A;  3H90 A;  4ECS A;  1IJE B;  2MZ1 A;  4E2F B;  5F0U A;  1WKL A;  2IM2 A;  1R89 A;  3VZH A;  4DPW A;  5LSR A;  3OSN A;  1N36 J;  1HNX J;  4DQP A;  2IVF B;  4ZPD A;  1OPZ A;  1DAR A;  1EJ7 L;  1SC6 A;  2W7P A;  5D4O A;  3CCT A;  1Y7P A;  1HWK A;  4WU3 A;  2XQC A;  3O6Q A;  5LM7 E;  4AUK A;  4C8L A;  4X64 J;  2UVR A;  1FF2 A;  1AA1 B;  2PDA A;  3MFH A;  5KT7 A;  1DLO B;  3Q2T C;  3FCW A;  2UXB J;  3FEY B;  3GZ7 A;  1VFJ A;  1UPP A;  2Q79 A;  3RAM A;  2MKY A;  2EFQ A;  4PPD A;  3MM7 A;  3UNY A;  2EEY A;  2FVS A;  2AJQ A;  2OI2 A;  3EDQ B;  1S12 A;  4Y2K A;  4CNY A;  4B3O B;  2ZH5 A;  1LWC A;  5KFA A;  2QSW A;  2KL8 A;  2GIQ A;  3MED A;  1KWM A;  5AE3 A;  4RNF A;  2XTJ P;  1NSK L;  4F7V A;  3MAA B;  5CXT A;  4EYH B;  1HR0 F;  4N8N A;  4DX5 A;  2HHH J;  2D9P A;  4RW9 B;  3CCM S;  2FLP A;  3K5N A;  3BQ0 A;  5L1I A;  4PAB A;  2I5J A;  3H2V E;  1N56 A;  1G4C A;  1FDD A;  1KLM A;  1YLX A;  4EYI B;  2GA7 A;  4A46 A;  3P45 B;  1FVS A;  3NS7 B;  4IKA A;  4RW6 B;  1KQK A;  2KFZ A;  3NGU A;  1XIQ A;  4J5O A;  2V4R A;  1CBK A;  3EXC X;  5DQH A;  4LSN B;  2BQ3 A;  1U47 A;  3UWT A;  3NS5 A;  1D9F A;  5CZV A;  5DLF A;  2BJ1 A;  2RD5 C;  4PXC A;  3CJ0 A;  4WPA A;  1TMM A;  2QYC A;  2L9D A;  1IKY B;  3MF5 A;  4OYX A;  3TZW A;  5KT5 A;  3RB0 A;  4LIR A;  4TQR A;  2W8L A;  2H5J B;  3MTK A;  3BS9 A;  2FHK A;  4KRW A;  4LUB A;  1YIT S;  2HK3 A;  3EJM A;  1VBZ A;  1YIJ S;  3Q8Y A;  4HEA 9;  5KOW A;  4DR3 F;  3KUE A;  2MKS A;  4IRK A;  1WC5 A;  1KQF B;  3MPW A;  1WTF A;  4TKT A;  5DM7 Q;  1YJV A;  3KUH A;  1NJW A;  2OFG X;  3DOM A;  4NLD A;  4JI6 J;  3LGM A;  4P7V A;  5IOL A;  2IDL A;  7FD1 A;  2DIT A;  3D1O A;  5LSL A;  4RUC A;  1RT1 A;  1X4E A;  5K5M A;  2AD9 A;  1GNK A;  2HQF A;  1FKP B;  1RA6 A;  5KFX A;  2YNG A;  3EGZ A;  4MFB B;  3IS9 A;  5LOQ A;  3CW2 C;  5DET A;  1DFD A;  1QAY A;  1HPZ B;  2N4D A;  4LQ3 A;  2E7X A;  1VQ4 S;  2DNY A;  4B9T A;  2UXD J;  4LFA J;  2ZIT A;  2R7S A;  2EI5 A;  3T1Y J;  5KOX A;  4QU7 A;  5KTQ A;  2QL7 B;  1H7W A;  4M5D B;  4DX8 H;  4FBT A;  1U6B A;  4DV4 J;  3D9B A;  4B3T F;  1E6Y B;  1S6U A;  2RH3 A;  5HSP A;  3VGS A;  3VAK A;  4MKV A;  2AJ1 A;  1TUV A;  4ED4 A;  2HS4 A;  1AYE A;  1VLY A;  2QL5 B;  4CI0 B;  4DFJ A;  2V8G A;  4K4V A;  1HBU A;  2WSF C;  3KNG A;  3N0V A;  3ENQ A;  4QIG A;  1CQM A;  1RWN B;  3NWG A;  3G8Q A;  1Q16 B;  2OAU A;  4MT1 A;  3RG6 A;  3TYT A;  3J7Y I;  2PI4 A;  3J81 j;  1UFL A;  2YKM A; 
#chains in the Genus database with same CATH homology
 2DXD A;  3GP9 A;  4UOF A;  3BBF A;  5BXI A;  1NCL A;  1ZS6 A;  3VGV A;  3ZTO A;  3Q83 A;  3EM1 A;  1B4S A;  3VGT A;  2ZUA A;  3PJ9 A;  3FBC A;  3Q8U A;  4DI6 A;  3FBB A;  4FKX A;  1K44 A;  1NDK A;  3ZTQ A;  4F36 A;  4HR2 A;  3ZTP A;  4AND A;  3R9L A;  3ENA A;  3MPD A;  3EIC A;  3NGS A;  1XQI A;  4DZ6 A;  1JXV A;  1UCN A;  1WKL A;  3EMT A;  3GPA A;  2AZ1 A;  1MN9 A;  2B8Q A;  5CAA A;  2DXF A;  4C6A A;  3B6B A;  1BHN A;  2HVD A;  3ELH A;  3BH7 B;  1BE4 A;  1WKJ A;  1NB2 A;  3FCW A;  4FKY A;  4EK2 A;  3FBF A;  4UOH A;  2B8P A;  1BUX A;  1HLW A;  1F6T A;  1MN7 A;  5C7P A;  1S5Z A;  3DDI A;  1NDC A;  3EVW A;  3ZTS A;  1NLK L;  2DXE A;  1HIY A;  1VYA A;  1NSK L;  2HUR A;  1PKU A;  3FBE A;  3Q89 A;  4CP5 A;  4S0M A;  3L7U A;  3EE3 A;  3BBC A;  1NDL A;  3VVT A;  4ANC A;  4O0N A;  1EHW A;  4UOG A;  3JS9 A;  2CWK A;  3EVM A;  1S57 A;  2BEF A;  3NGU A;  1XIQ A;  1NPK A;  1NHK L;  3FKB A;  1NSQ A;  3BH6 B;  5CAB A;  1HHQ A;  4KPC A;  3PRV A;  3EVO A;  1NUE A;  4W98 A;  4F4A A;  3EJM A;  2DY9 A;  3Q8Y A;  4ENO A;  1KDN A;  4WBF A;  2VU5 A;  3NGT A;  1W7W A;  2DYA A;  3FC9 A;  1NDP A;  2BX6 A;  4DUT A;  2HVE A;  5IOL A;  1B99 A;  1PAE X;  1F3F A;  3VVU A;  4ANE A;  3NGR A;  3Q8V A;  3BBB A;  3B54 A;  3FCV A;  3VGU A;  2NCK L;  3WX8 A;  2AZ3 A;  1U8W A;  3ZTR A;  3DKD A;  3VGS A;  1S59 A;  3ETM A;  3G2X A;  3Q86 A;  1WKK A;  1NSP A;  1LEO A;  1LWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...