1ZSHA

Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (ip6)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
392
structure length
354
Chain Sequence
TRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSSDVAVELPFTLMHPKDIVFEDFARQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin 1
publication title Nonvisual arrestin oligomerization and cellular localization are regulated by inositol hexakisphosphate binding
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 56
structure length 354
sequence length 392
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA01
5F0PB 1JSYA 4P2AA 3UGUA 3GC3A 2R51A 4GEJA 1ZSHA 3UGXA 1CF1A 1SUJA 5F0JB 3P2DA 4LL1A 3LHAA 4GFXA 5F0MB 2WTRA 3LH9A 1G4RA 4ZRGA 1AYRA 4JQIA 5F0LB 2WTRB 3GD1C 4J2QA 2FAUA 4R7VA 4R7XA 4GEIA 1G4MA 3LH8A 4LL4A
chains in the Genus database with same CATH superfamily
3CFDB 4AEFA 2GYSA 3K74B 5BO0D 2NR6C 3MYZA 3HG1E 3RA7H 3WLBB 4AK2A 2WLMA 4XPAL 3ZYIA 4EVNA 1AZRA 1OK0A 4HS3B 3UG5A 3FUDA 3IKCB 2IF7A 3WS6A 1JN6A 1MLBA 3AB0B 4Z0XB 3QEQA 4PB9L 5TTRA 1TJIL 1L9QA 4GSDH 4F24A 3UG3A 4NQEB 3VXMD 2JMRA 3SYPA 2GUOA 4JY5H 2AXGB 4J2QA 4QJ4B 1NBVL 3C6LA 4EE2A 1ZS8B 1E28B 4ZTPH 1CGVA 3B37A 1EO7A 3FRPG 3BRDA 5IIEA 5IY5B 2P5WA 3DVFA 3A5VA 3Q6FA 4PY7A 4PGBB 2ADYA 5E1AA 3CUPB 4FFZH 1CE1H 3HUJA 3SN6N 4HQQH 2DWDA 4HX1B 2P5EB 4IRSB 3CDZB 2FR4B 1WLHA 5C0BA 2EIKB 2SODB 3MX0B 3ARFA 4WEBH 3RTLA 2CE6A 1NOFA 3QUXD 3QUYB 1AKJD 2GTWA 4AG4L 1XVSA 2JLLA 4XNYL 2RMNA 2X7LB 3LYRA 3QEUB 1CFMA 3UJIL 1F3DJ 2ZP0T 4FFYL 3NZHH 4U0QB 5F7FA 5D2NB 1RJLA 5F1NA 3ZZLA 1ZLWH 4ELKA 3F04A 4AZUA 4JGUA 1KTJA 3L1EA 1BQSA 5ISZB 5AOZA 2WBJC 4O02B 5DR5H 4F1ZA 4LEXH 1RVFH 3BH8A 2WXMA 3UTTD 3UDWC 3AS0A 4CL7A 5JW4Q 1E6JL 4FG2A 4XPHH 4XBGB 3SBRA 4YHOL 3SKOA 1BZ7B 4E0RA 4NUJB 5FYLH 4KZEH 4N8VG 1BW8A 1A21A 1PZAA 1QKZH 3QEGH 3ESVF 5IB1A 1D6EA 5GGTL 3VWJC 2NY4C 3PGFL 2BP0A 3PIQB 2DWTA 1FPTH 1SDYA 2Z65C 5F7AA 1W9XA 2FYYB 3MREB 4JKMA 4N28A 4NXSA 3V7AE 4H8WH 3QYNA 5GSVA 1X5XA 2GSMB 4DP7X 2ZX9A 2WJ5A 1DZBA 2ZPKH 2WWNA 4G8IB 1RZKC 5EU6D 4G72B 1EXUA 2HT2C 2HPOA 1A7BA 2YAPA 2OW7A 3BQVA 2BC4A 5DRZA 3MFFB 3L3HB 4HA1A 2Y3NA 3HG1A 4K3JL 4LPUA 4P5RA 5HGDA 4G1MA 3MLXH 4KTGA 4NPJA 3TCTA 5C0AB 1X3DA 3B9VA 3RFZA 1JCKA 1IE4A 5AW3B 4LGSB 2WLLA 1JYVA 3GDBA 4U1IA 2VL4A 3VM5A 1FH2A 2WXQA 1NPNA 5T3ZE 3SE4A 3KPLB 3D0VA 4TL5A 1A9BA 1QW8A 1IGYA 5D6CA 1A7NH 4L48A 5EEXA 2AXFB 1A9EA 3D1MC 2Y0SA 2ZCLH 3VE0B 3ESUF 3HN3A 5EZOH 1G7HA 3GRWL 4ZXBB 2DICA 3UO1L 1FRGL 3QYMA 4XWOC 2VKWA 4G1EA 1K4CA 3WFEL 3ULVF 1U4FA 2HRPL 4R7XA 4MX7A 3Q43A 1S8DB 3RNQB 4AKOA 1P4LA 3EJJX 4UI2A 1P53A 3OZKA 3PHOA 1OALA 2ORBL 1SEQH 5SWSE 1C5DB 1VADA 2XTJE 4RSYA 4L3CB 2NY1D 5IM7A 4LIQH 2WYZA 4MJ2A 1D9KC 1R4XA 2NY0C 2DWXA 4WW2F 4C58B 5HSFA 1DLFL 1RUQH 5IQNA 1R3LA 1XGPA 3RZCC 4IRZA 5JDSA 3MRDA 3U2JA 2NUTB 3UTQB 3LXCA 3EO1A 3PWJA 3AS1A 3DRQA 2GT9B 1J0HA 1P1ZB 3FAWA 4NO5A 1HWWA 1NWOA 2UXFA 3NJLA 5TQ0L 4BQ8A 1GS7A 4IBQA 2X89A 5IVXB 2CUAA 2PO6C 1H6FA 4L29B 3E8VA 1XCQA 4WU7B 3MBXL 4U1SB 4XXDB 4U6VL 3WS3B 3BFOA 1Q0YL 4P2QD 4M6OL 1PLBA 4LVNC 1T04B 1GL4B 3I75B 1F6AB 3T65A 5I66B 2WLZA 2NNRA 3RDJA 1UYWH 3VO0A 4Q9QH 1P7HL 4WV1A 3GO1H 4JE4B 1NKRA 1XSKA 3CLEH 2KZ1B 4GH7B 4PG2A 4LAQL 2QVIA 3ZPDA 1SLWA 5CEZL 5TDNB 2X6BA 4ZS6C 5F9DC 5KUMA 3TEXA 3EOYG 2VLKE 4PTUA 4ODVH 1MFBH 1S7XB 1BQRA 3Q01A 5CCKH 5CJ8A 1MFDH 2NDFA 1HJBC 2AQPA 1JF1B 2XX0A 2XWEA 3CHPA 1AR1C 5IBUB 4K23L 2VR5A 4YFLF 4I77H 1HL4A 1NGPL 4WTZG 5EO1A 2QKIC 3PWPD 4AK1A 1GSKA 1CGSH 4YUEL 4ZS7L 5IR1B 3FFCE 4CNIA 4BEIA 4JN1H 4J3OF 4V2CB 4GW5A 1YY9C 2Q5BA 3IDIB 3O3BB 1AGFA 4OZHB 2YSSB 1MPAL 2OL3A 3B1TA 4X7EC 3L6FA 1TUPA 4HKJA 4GFXA 1RZFH 3ARPA 4EN3B 1MHEA 2CQVA 5EPMB 2IFFL 2DQTH 1DFBH 3TA3B 3CQQA 5J8OA 5MENE 3UC2A 2ENJA 1UA7A 3IDMA 3V8OA 2VQTA 1HWGB 4APXB 1A7QH 1GS6X 4P4KC 1FL6A 3MA7A 2I9TB 2UZPA 4L4VE 1OP3K 5LNDA 5D1QD 4YDZA 2Y2WA 2RFXA 3A67L 3STBA 1HINH 1I75A 3MA9L 3NCMA 4UNTA 1JPFB 2HSIA 3BT2L 1OT1A 3KVQA 2YO3A 4GIAA 4HK0A 3UTSB 1NFIB 2VDQH 5ABZA 3CDGA 5IV2A 4WKZA 2IDSA 2R2HA 2VABB 1QFHA 2YMXL 3IGAB 5KVEH 3ZL4L 4O02L 1A5FL 3O3DA 1P6WA 1FE8H 1PDKB 2DTML 3LMJL 4F7EA 2TSBA 2V37A 4ZK8A 5L2KD 2V17L 1JI1A 1IQWL 1C1EH 1KGUA 4ZMNA 3LQZA 3HZKB 4C4KO 2W9EH 3DKHA 3OXRB 2IH1B 1KXQE 5DJDB 5DFVC 1PKOA 4NQQA 3MJ8A 2NNFA 4TNEA 2KYIA 4PJGE 1XCWA 4PJDF 1G7MA 1FG2A 3B4NA 4N5EC 1G9HA 4Y89A 5IKCB 2QLYA 1Q9OA 3SODB 1L9TA 3OHMB 2CDGA 2NRDA 4I5BA 3TH4T 4LDCA 1KNOA 1MFNA 3FFOA 2VLKA 5C6WH 3OLDA 4G11A 4OCLC 2A83A 2YD0A 1IQDA 3VGGA 1E40A 4ZUTB 1JP5A 2QADC 1WFJA 1MWAH 3RWIA 4PJIF 4WGKA 3CAFA 5EEYA 3QJTB 4FF9A 4JZJC 4NNPH 1XR9B 5B39G 4MMZB 4S0SD 1E4HA 4N0CD 3FFCA 3DJTA 5E8OB 4C57C 2WVTA 3LXUX 4PJAA 1E4KA 3IM1A 2XZQH 4HUXB 4F7TB 4PP2A 4JY6B 2B5IB 3RPBA 5C8JB 3GHBH 3KPSE 4ERSH 4J8QA 4NZUL 5EN3A 3GBDA 3QJSB 1BWMA 2HLFC 1PX8A 2LU5A 4BRVA 1E9QB 1I9IH 4DTGH 4KVNL 4EXPX 2BZDA 4K7PH 4OJDH 4DO5A 4RA0C 2WP3O 2MPVA 5MENA 4P3DB 2CZNA 2MCAA 5C0GB 5BVJA 3DBXB 3QJFB 4JS7A 4R3SB 3B7UX 5E00B 1QATA 1G7QA 1ASOA 4XC3L 4C54A 5ADOH 4DEWA 5IHBA 2ESVE 2P49B 1E4WH 1E3XA 1Z7JA 3N40P 4X9GA 1SFHA 4XPTL 4UOW1 3EJZC 4HFWA 3V52H 4MTMA 2VLLB 5L8LB 5E08H 3PAUA 4OF0A 2NSMA 2VDMB 4E68A 4LVHB 5I8KL 4BFBD 1PF3A 4APQB 3NZUA 2QJDA 3VFPB 4XMKL 1Q0EA 2A4EA 5JW5B 2R29A 4U3XA 3KW8A 4XCYA 4OLYL 4AIXA 1CMOA 4KWUA 3CK0L 3K6IA 1JV2B 4QGYA 5D93C 3OAZH 3NCJH 1CN4A 4Y16B 3CFNA 2MCG1 4GRLA 3RVTD 4D0BB 2Z1KA 1RIUH 1KXQA 1Y18A 2X9YA 1IIIA 3PRZA 4RAHA 2MPAH 4LRNH 1RH8A 2CRMA 4PJGA 2XVGA 1YPZF 5IHHA 1U58A 2FEEI 2ZAHA 3BIKB 5BV7L 4YR6B 5TK2A 2YXVA 3FQRA 5DHYA 4N1HB 2A7BA 2WBWB 1N8ZA 5FA3A 3P9MB 3FT3B 1Q94A 1GYWA 3MJ9L 3WUWG 4PRNB 3ZT7A 1KN2L 4UU9A 4FQXB 1LDSA 1TPXB 1JXKA 5EWIL 4OBRA 1NDTA 4KI5C 3VXQB 3WKML 3SDXA 1YHPA 3GZPA 4KTDH 1TTBA 4OLZH 3ULUE 1QA9A 4JO2L 4ZUSB 3UTOA 2GBUA 4OUOA 3E6HB 5KBKA 3QDJB 3RWGB 3IXAB 4LSTL 2WQUA 1HYSC 3QZWA 3V6ZB 5DEZA 1SBSH 3MRQB 3WFBL 5JO5A 4HUVA 5EA0H 1HQ4B 5DZPA 4GSRA 4NUQA 1ONQA 5ID1A 3PJLA 1A6TB 3KPSA 1IBBA 4OKVA 4AT6B 2ODIA 4NQVA 5HVGB 1MH5A 1TQCC 3D18B 3BVTA 4TVPE 1DLHA 3TN0D 3NMEA 1LQSR 3GTNA 4JUSA 2Y7QA 4MDIA 5DK2A 5KBMA 3S96B 4HVBA 3DROA 4PLKC 5FLUA 5LQBL 3UEZA 3MTRA 1BJ8A 4XVSH 4M43L 5IB5B 1A6VL 3TBVA 4YHYC 1PJ9A 2X9ZA 1J12A 2ESVA 3MV9B 1KCWA 3BAYA 4HC1A 4J3TA 4NO3B 5E99L 1E0OB 4GKNB 3G08B 4JO5A 1UGNA 4AEEA 1A6ZB 2EDYA 1VFAA 2Y5QA 1ZVSB 4GO8A 2HJLB 4YK4C 2K6ZA 4HIIB 4N1CA 3ISYA 4YE4L 4OZGF 2VJ0A 1M7IA 1Q9WB 1GGIL 1HE8A 1CE6A 1ZANL 2WVVB 2ZXBA 2Y72A 2EO1A 3E3QE 5F7DA 4CILA 3D4CA 4TSCH 3QIWA 4BKLB 4KHTH 3GMPB 2IC2A 1RZ8A 2O6DA 1DFXA 3U2SA 4BIKA 3QP3A 3LV3A 3L54A 3ARUA 1WIOA 3LZFH 3H7BA 3C75A 4UT9H 5A2JH 1MF2L 2B3IA 5FOJA 2D0GA 2F53B 1FYTB 2GK0B 2XWBA 3TCXA 7CGTA 4LKXA 4V1DD 1YEGH 5KVFL 2WQVA 2AK1L 4L5FL 5KVDH 4YSCA 4DPCX 2AVFA 5E6YA 4EI0A 5HHNA 3G6AB 25C8H 4N2OA 3E80A 3CX5K 4RRPA 1TG8A 1RP8A 2BNQB 3OVUB 4A7VA 2JXMA 1G5AA 3AW5A 3QE5A 3QQDA 4WTQA 4AQEB 3TPUA 5KBDA 2CKBH 3FT2B 1QI3A 2APWA 2XICA 1CFTA 1TETH 3C60B 4L3EA 4NWTH 4AGQA 4AENB 1BQHG 1G9NL 4GRWH 2WWMC 4Y4FB 4HXAH 1MCHA 3SPVB 3IMWA 4GO6B 4F7CA 4Q9CA 1BVKA 2E9WA 5HI3D 2E7DA 3U0TA 3QRGH 4J6RH 1REIA 3S36X 2ZXGA 2BOBB 3GSNH 2VO5A 3JTSB 5LGJB 4Z7NE 3O3AA 5IQLA 1DVFA 1X5ZA 3ZSTA 3OAUH 3SPIA 5AZEL 3FT4A 1I85A 1RZIB 1JAEA 4LBEB 2ZJSL 1JGIA 4XNMA 3QXAB 5E9DE 3VXPB 4EQ3A 1C8PA 3MLYL 4ZUWA 3FB7A 2I32A 4QHUB 4ENZA 1V55B 5CP7B 1WBZB 35C8L 4P2OB 1WG3A 2VW7A 4X4ZA 4XNQB 1OLZA 2E8ZA 3E0GA 3ARFC 3GMLA 3DX6B 3BP5B 5GGSY 2ZXQA 3ZDWA 3X1BA 1ACZA 4AYDC 2QHRH 4P5TD 4NZ8A 1BQLL 4F33B 5I6MA 2W92A 1LEGA 5D7EA 4GLRH 4B3VA 1KV7A 1OAQL 2H8PA 1P5UB 2IGFL 2W65B 3RWEB 4ODBD 2ED9A 4XX1E 3HI6L 5CJOH 3K6SB 2VDML 1WBXB 1QNZL 2OXHA 4AEIH 4FZEH 4E9TA 5L0QC 5CBEA 4UQ9A 4X80H 3HLAA 1QI4A 3GQFA 3IVKA 1BGXH 1N2RA 1DBJH 2DD8H 3TONA 1SF3A 4A7QA 1J05A 5ITFB 2A74B 4DQAA 3MOQA 1FH5L 2FNBA 2WXHA 4MJ5A 3VSVA 5ITBL 4B95C 1DVTA 3L2LA 4X6DA 3VI3E 3LTVA 3H42H 2HFGH 4EUPG 2WB1A 1C08A 2VDKH 2QTEA 1MNUL 4ODHH 5IEHA 4R26H 5TH2A 3MBWA 5DZJA 3MUGB 2PYEB 2FBRA 2FLMA 1KZQA 1CC3A 4CW1B 4RAUB 1URIA 5DD1H 4XMTA 1FL3A 2VXTH 2B20A 1YEIL 2NYKA 4MXWH 5BMFL 3SDAD 5IW3A 1M2OA 2NNXA 4DW2L 1FO0H 5IT2L 4OM1L 4WI7A 3NTCH 4LKCA 5IMOB 4Z8FH 2CGZA 5EUKB 2ITCA 3VFTA 5GIRB 2Q3XA 3RU8L 3ZKNC 1TO5A 3HS9A 1B6DA 1W0VA 1ZKAA 2X2UA 5B21A 5KSVA 2X6AA 4I89A 3HHSB 1FV1A 1GVIA 3QHZL 3I6GB 3FO2A 4RMUA 1BHGA 1A6AA 2ITFA 2YGQA 4JFWA 4Z6AT 3RFZC 4KKBD 4YHZL 5K9JL 1A4JB 3H9SD 5GJSL 4DIXA 3GM8A 5KYXB 1R46A 3EO0A 1PLGL 3U9UA 2GI7A 4LHQB 5F0PB 3SE4C 2V6HA 3L3JB 2WHVA 2BJMH 2P8MB 3P3TA 4Y5XB 3QJHA 4ZX3A 3TH2T 3P4MA 5HYJB 3MRNA 2JB5H 2G30A 4LQFH 2GSIB 5I19L 5I23A 3E6FA 4LCCA 5I5IA 1I8KA 2AI0L 4QHMB 5E2TL 1O6SA 2XY2A 5F1OB 1F4WH 3IXTA 5T1MB 1O7SA 3DIFA 4ZZFA 4R6UA 3VG9B 3DVNB 3TBWB 3FTGB 5I6LA 1I3UA 1AGBB 3L8QA 2WXFA 3LJ3A 4UUJB 4XMVA 4ODXA 3DMMB 4X4XB 4GMTL 3MV7A 4TYUA 3ZKQD 1IGML 1MHHA 2E7HA 1J86A 3P2DA 3ARYA 4NENB 4PCTA 1CDGA 4O51B 3LN5B 2MCPL 3EBIA 4Z3GA 2BFGA 5D7JD 2OCFD 1CR9H 1CL7H 3FQNA 4GKSB 4GUCA 1IRAY 3IMRA 3FUIA 3C08L 2NY5L 2X4UA 2HVKA 5BZWA 3VA2C 2GABA 4LLQB 4AWJC 4EBQH 2B3RA 2X10A 3SGKA 4PGEA 3CCHA 2R0ZL 3QZOA 3GWJA 2ED6A 1DQDH 3UOAB 1PG7X 1LO2H 3EW3B 2GFBA 1IM9B 3GZQA 3N55A 3Q13A 4MQXD 4FKKA 3OHXA 3HS0B 4X50A 5G2NA 2Y2TA 1VLXA 2UZYB 2XXGA 4YBLC 3HPJA 2DLIA 2YHGA 3V10A 2ADFL 2ICEB 2X4SB 3MROA 3X11B 1S7RA 3R06B 2M83A 4XVTH 5AKTA 5DT1H 3N9GH 3V4PH 3GKWL 2OSLB 3WNOA 3SE9L 4B9IA 2EYRB 4LSVL 4YXKL 4UTAL 3L3IB 1QOKA 5I1HH 4WV1C 4BXSV 5SWSD 4YFLI 5BRQA 3RTQA 4PG2C 4XP4L 4GG6E 3QCTH 1W8OA 2NCEA 4WW2B 1C5BL 4W9GC 2B08A 2FIRT 1P1VA 5EFIB 4D8PB 1LEIA 3NH7H 1EPFA 2Q9OA 4ODTL 4DK6A 2HKAA 3OTTA 4AL8C 1PMYA 2VR6A 4FQLL 5FOBB 3GSWA 3APMA 1GSMA 3OPZH 4QRAA 5IREA 2A6DA 1JRHI 1J0ZA 2UWEF 5AKSA 1DJYA 1U6AH 2OCCB 3O41A 1PYWB 3IMVA 1I9JL 5AUMB 3A3YB 4H88H 3PGDA 3BVDB 4J3VA 4OF8A 3NUKA 2ZG1A 1SVZA 3TBSA 3I6KB 3EFDH 1BZDA 2R4RL 2BERA 3UL4A 1I8MB 1MCOL 2IDCA 5FUCE 3IJYA 4MBRA 4TSBL 1CDHA 4OD3H 4PMFA 2J8OA 2X9XA 3J07A 4ZMWA 3BPLB 3MLUH 3ZXAC 3P0GB 4LASL 4C55A 5JTWA 2Q3AA 3Q5OA 1BQUA 4Y0GA 1ETB1 1OGAB 4B0MB 5B38G 1I1AB 4H25A 2YPLE 4X7FC 4Y4HA 3RY6A 2GAZA 4LE8A 4ZW6A 3X13A 3O6FD 3D34A 2OV0A 2DM7A 3CFUA 4UINL 1U91B 2JQMA 4AMXA 2XWTA 1IMHC 2YA0A 4G71B 4V11A 1PQZB 1VGKB 3Q7JA 1I1FA 3U79A 1ZTXE 4MAUH 2NX5B 4YNYA 1UH2A 4KXCA 3FRPA 2CMRH 4QY8B 1NIFA 4LLUB 2WLIA 4KY1L 5ICXB 4Q9RL 5FUOL 3VU1A 1G43A 4RESB 2EXYD 5BW7A 4PUBH 2DQIH 1FCCA 3DWTA 5KANG 3ARGB 3L17A 5FO8B 3RVXD 1BZ9A 1THCA 3C9NA 3AY4C 3ZDXF 4U1KB 1ZVYA 1KGYE 1VSCA 1L3NA 2J3SA 5DVPA 2E4TA 3NZ8B 3QA3B 4PI0A 4FXKA 1AZUA 5DVMA 1MSPA 2F6AA 2FRGP 3OF6D 1OCOB 2NW2A 1JF5A 3BEWB 1HL8A 3REWA 1IEHA 4LF3B 3UTTA 5A43C 2X6MA 1L7TH 2J25A 2X4QB 3I3EA 2NCMA 4YWGL 5JNYA 2G4EA 4PJFE 3E7JA 1ET7A 3AU1B 1KEMH 4G43B 4L4VD 3MLPA 3S88L 2EIMB 1T5WB 4YXHL 2DRUA 1PNCA 1DVSA 1I7UB 1OKEA 2KC0A 1DSFL 4DGYL 5J6HA 1V05A 1NCNA 3BGMA 4N8VA 5DO2C 2LR4A 4FLOA 3C8KB 2GTQA 3QR2A 3VI4E 3GSQB 3RQ3A 2VDNB 3FU7A 4FXTA 1KCVL 3L3OA 5LCVA 3ROLB 3D33A 4WDIA 1E4KC 3V5HA 2ZSVB 4OLWL 3FTSA 2DOCA 1HH6A 2P52A 5CJXA 4RNRA 2B8OT 5HYQB 4G7QB 1KTCA 1ZRUA 4OCRH 5T1LB 1YY8A 2NLJB 5JQ6H 2ARJA 4LPCA 4PJDB 4F37F 3OG4B 4KXAA 5EBWB 2YPLA 2R1YB 2WQSA 3PAYA 5T5FA 5L6YL 4FABH 5IUSA 3ARBB 1WS7A 4IU3B 4LSSH 4JRYD 4G7YL 4KITB 5CR8A 3MPCA 1V27A 2J8UE 4NQDD 5IFJB 1JTOA 2P47B 2F68X 4YHMH 3O11B 5HI4D 1IGIH 3BZEA 3ASWA 2VXQH 2QEJA 4PJIB 1NGZA 2J2ZA 3ABLB 4BZ1A 4GQ9H 4MAYB 3ATAA 4NQCE 1AY1L 2Q7NA 5ADPH 4AV0A 2BM3A 3O9WB 1Q1JH 3TT3L 4MNQD 1UENA 3ZQWA 1G6VK 3VGHA 1IAMA 1JPSH 1YVLA 2BSTA 2Q2LA 4QRBA 3BWUF 1MVUA 4UTBH 2NTSP 3KGTA 3I6SA 4ZUUA 5FHAH 4KTEL 4FA8A 2Z64C 4KQ4H 4E9XA 1OSEA 5KJ4A 4JM4H 3WELA 4GRLC 4E9LA 2XWJB 3NSCA 5IMMB 5AOJA 3ULVL 5F0MB 5CWSA 3TS8A 1N3NA 1T21A 4XP9L 4FQJL 1J5HA 2VRQA 3T77B 5I0WA 5E9NA 2VN7A 1F97A 2ZWYA 3ZMRA 5E1QA 4QTHA 1GPOL 1TOXA 3NCYP 1MJJB 1M56B 3PV7A 4DP0X 1RZJH 4YSPA 1YC8A 1QSFB 4DKDC 1ZLWK 3T5WA 2O5ZL 4FLSA 5JHBA 5E6ID 4FYSA 5F93C 2R51A 2XN9E 2XCMC 2F5AH 3NACH 4LHUG 4AV4A 1JZ3A 1Z3RA 2CO7A 4JM2F 3V0VB 2IQAB 5C08B 3RGVB 3HFML 3VI4A 3OGCA 3LRSB 1RZ7L 5EO9A 5HHME 1ET5A 4A6YB 3UBGA 1MCWM 1A3ZA 1CTMA 4WNQB 4I0CC 1ZGLA 1NBYB 3RURA 5I6NA 3V79C 1IKFL 2XN0A 4J2XA 4GEIA 5BUGA 4PB9H 7TAAA 2WNXA 4KKLC 3VGAC 2V9QA 4HH9A 4JQVA 3ABGA 4YDVA 5F6IC 5IEKB 3B2VL 4R8WL 3S3PA 1G9MH 3PWVA 5SWZD 3SDCA 1NBVH 1T1YA 4U49A 5H94B 1I82A 1CIUA 5FLVA 3BOVA 1S7UA 3UTZB 1M05B 2CXKA 1J0YA 3KM2A 2OAAA 3KW7A 2IWKA 2A9NH 4R2GB 5LDSA 1MCWW 4AKQA 1RJYA 3K2UH 1R6VA 4PS8A 1QR4A 4NJAL 5EUOF 4FHBD 4YFEA 5A40E 1EEZA 2BVPA 4L3FA 4AJ0A 3GBMH 1ZV5A 3TO2B 1KJ2H 3AABA 4NGHL 3O45A 1NFKA 5DEJA 4JFDD 5E56A 3UZQB 5C0IA 1Q0XH 1EO8L 4Z7OF 4WK4B 2Z35B 2P44B 5IVZA 1XF5A 1INEL 1M7DA 4AG4H 1B9KA 2KHAA 5BJTB 5GGVY 5A2LH 4FFYH 3QG7H 3TZVA 2EEAA 3QIWC 2MQ0A 5TDOB 4FNPA 5JORB 4MHHG 1QUNB 1AXTH 3VYPA 1KIUA 5GGQL 3RGBA 1H5BA 1KLGB 3ZW3A 4BYHA 3S7GA 3TM6A 4LLMA 5JIPA 1PX4A 1U4EA 2N3JA 4TVPD 4QT5B 4G8AC 1NAKL 1LK3H 5ACZA 1IGTA 3T0VA 2W9DL 2WKGA 4YHOH 1DQJA 2HMIC 2A77L 3EDEA 3UPRA 4HMEA 1NAMH 4HKXA 3HAEH 4N4YB 4OJAA 4DP8X 5C6TH 4QPEA 5AB0A 3M86A 1U8LA 2YPVA 1WP6A 3JV6B 3P0YL 3VWKB 2X4TB 1ZA3A 4Q4IA 1T4KB 3L5IA 2XN9A 4XMWA 3EFOB 1DN0B 3RX9A 2Z4QB 3MRLA 4FQPA 5HYEA 1EAPA 4MA7H 4OZGB 2WWKO 1YMHA 4Y4KA 4A1RA 2G75A 3ULUC 1AH1A 3EYFB 5KSAD 1EMTL 4IS6B 2ZCKL 3H6JA 3PWLA 4K3JH 1OB1B 4M7ZB 1HILB 2BNRA 4C4BA 2VDNL 3VQ1C 1CVRA 2TAAA 3B2UC 4FZ8L 2B16A 5D4QA 3GK8L 4ZO9A 5L9DL 1FHGA 3B9EA 3V5KA 3OR6A 3SE3C 1YMMB 3OR7A 4CADB 3ZUCA 1RK1B 1DVFC 1NUGA 3FHQA 5JXEA 3UCQA 2R69A 1PW3A 3BQUB 3FU0A 4PRID 3WE6B 4OLUL 3IB4A 2JCWA 2GIMA 5LVEA 3EHBB 2J1WA 2CRYA 4FE9A 3UADA 1RERA 2K7PA 1RPUA 1NCTA 1YECL 3QWNA 1JG9A 3W39A 3SGJA 5I71C 3GRWH 3F85A 3UO1H 4DPAX 2BMKA 4LLWA 5B39A 1JL8A 3ENEA 2HRPH 3QO1B 1AO7E 4RFNC 3VD5A 3EJYD 1MRCL 3D39D 3JV4A 4ZOCA 2Y7SA 1MCIA 2R1XB 5INCA 2Q8BH 2NY3D 3K71A 2C3WA 2Z34A 1WWBX 1HFUA 2H26A 2ORBH 2LU7A 4AH2A 4P23B 2ILLA 1NGXB 5D1XD 4TNVF 3BZ4B 4PJ5E 4PVLA 2UY6A 3GJEB 3MV8B 2VJXA 5DFTA 2NXYC 3E3QC 4F8PA 3NIDE 3RWFB 4HWZA 2V7HB 2X1OA 3O8XA 2VN6A 1I8LA 2PPEA 3X14B 2EP6A 5CINL 3QDMD 2IBGA 3NJHA 1JS4A 4S0TD 3DHJA 3OBAA 1AGEA 3KCPA 3FOMA 1ZT7A 4QRQB 1NLBH 2ZOLA 3DETC 4NZDA 2IMNA 7PCYA 4PIBA 2YXWA 3FO0L 5TQ0H 4U31A 1UXLA 1XH3B 5E9DD 1YAIA 3KG5A 1DZ0A 3K1KC 2FSEA 4XOCA 4FL4B 2XZAH 3NFNB 3PXJA 4U6VH 5AENA 1Q0YH 3BVVA 1OAKL 2X1QA 3GLAA 4M6OH 4K5LA 1BG9A 4M7LT 4AOFA 3W0WB 1I9EA 1KB5B 3MLSL 5DGRA 1QBLL 3L9EA 4UB0H 1GZQB 2NZ9D 5D1ZD 1C8QA 4LAQH 1K4DA 1AYOA 2HTLC 2FT6A 5CEZH 3AAZB 4A6YL 2X28A 3HE7A 2OZ4A 3PJSA 5FW7A 1O7DE 2Z3FA 1WC7B 4FGMA 4K23H 1ZT4A 1RJCA 1CK0L 2C8NA 1E9PB 2D3LA 4XCEB 5K59F 1NGPH 1GYCA 2YZ1A 1GA2A 3D2UB 3QDAA 4G8GA 1A4CA 4I0PD 4YBQC 5C0DA 3WUWA 4B7LA 4UM8A 4ZS7H 4LFHG 4PS4L 4ZYKB 1F1AA 3HG3A 1WA0X 3TWCL 1Y1DA 1T7XA 4FMVA 5J9PB 4ONHB 1X5FA 4DEPB 4P59L 1MPAH 1YYML 5DC0A 2H3NA 3ZRSA 1ZLEA 3T6XA 5KG9B 1VRSA 3GLZA 4I4WA 1EV2E 2FO4B 3HN8A 3NPSB 4IGBD 1EO5A 4OF6A 3HUJF 1BPVA 3CDCA 3N1MC 1YDPA 3V4UL 4X5LA 1PZ2A 1EA9C 4K7PY 2Q3ZA 1AI1L 4X6FB 5CLZA 2NZ1A 1FORL 4P2RE 1UM6H 3MKGA 3MNZB 4K9EC 2ZZUT 1L7IH 2CDFB 3ZL1A 3EBHA 1DQIA 1SZNA 5FO7A 2L04A 3KPQB 3BDYL 3QXDB 4KJQD 4ECNA 4BWWA 4PVBA 5JMRA 3MA9H 4AM0B 3X2QB 1TJXA 1OAYH 5E23A 1XR8A 3SGKC 1ZT1A 3ZE2F 1P2CB 4UOW0 3LEVL 4OCWH 4ZMAT 3HE6A 2YMXH 2I07A 4O02H 1A5FH 4D0CA 3V0EA 3J2PA 1BYOA 1MVYA 4G5ZL 4QYOB 2V17H 1LWHA 4F9PC 2X0WA 3CZSA 1ETA1 1HCYA 4N8CL 2D7NA 3O3EB 4YC2B 1MY7A 2UV3A 3PAVA 3BWAA 3WN6A 5K9QG 4N2MA 5EOTA 3TCLB 1NJ9B 1U3NA 4GW1B 3STZB 1MFCH 1T5XB 3LQAC 3CVCA 1IGCH 3SO3B 4G9DA 4Z3IA 3RTQC 5FF6A 2Q20A 4UIMB 3CMGA 2V5RA 2FGWL 4F93B 4JZOB 3WIFB 4AQAB 5EU7E 1ZE3C 1M4KA 1JF6A 1UATA 4FN0A 4JRFA 3TPKA 4HSQA 3RNKB 2Y5TB 1HXYA 2EDEA 2AV1A 2K6YA 2HT3D 4I2XE 5SX5K 4QEGA 2DIAA 5I17B 2BZCA 3KVDD 2WXPA 2P3YA 1JZ2A 5AOMA 1OAXH 3QJOA 4ZAKB 3VXMB 3KPRA 4N22A 2IAND 3TVMA 1EJ6A 3SYAA 3VX1A 3GDCA 1Q9KA 1V7NL 3SJVE 1S7QA 1H8SA 2OJ1A 3AREA 4DGIL 1BIHA 2F54E 2P80D 2P24B 5KWYC 5E7BA 2DBLH 4QWWC 4ABVA 2PKDA 3LS5H 1NC2D 4DNLA 1R34A 5H4YA 1BQHA 3NGBC 5I6KA 3D85D 2WC7A 5B8CA 2CLVB 4UDUA 4MASA 4JFFD 3UPAA 1NCWL 5A1AA 2CDEB 3RY6C 1IKNA 1MIML 4NNXB 2NY4B 4Y1AB 3TNNB 5F8RC 1CLOH 3OG6B 3WHE1 1BX2A 2DQCL 4GNKB 5E7FA 3PPEA 3B6SA 3FRUA 4P2RA 4BFNA 1LD9B 3GSOB 4XC3H 5JZ7C 4JQXA 1SN2A 3SCMD 4F15C 2UWEB 1BCIA 2WZPA 2IAMA 5TE7H 2CD0A 1EBPA 4XPTH 5F9JB 5KVGL 3KXFA 1AC0A 4R7DB 3CFEB 5F97E 2IFGA 1RI8A 2ALAA 1M2VB 4XMKH 5FM8A 2F1BA 4HD5A 1IBDA 4KDTA 1BF5A 4HG4J 5GS2D 3SSGA 4OLYH 5H2BA 2ETWA 2M26A 3W9EA 1WJ3A 2X41A 1IEBA 5EU5B 3ZTEA 4FXKC 3DUSA 3JUZA 1FDLH 1G7LA 2GY5A 4G6ML 1AMXA 1USZA 4JQIL 4MD5A 1OAUL 5A2BA 3QDGE 2XVKA 1T2XA 5DEGB 4NEHB 3HMXH 3FKUS 2XG4A 3GBEA 4KFMA 4A68A 4M1DL 5IB3A 1OV8A 3T3PE 4HOXA 5HVFB 1KB5L 4OZFA 3UAJD 5IQMA 4JRXB 5E5UB 5IZ7A 4NRYA 5SX4I 2I7OA 1T1ZA 3O0RL 5CR1A 3MJ9H 5C0JB 2HJKB 4EUPA 1FVDB 1SFDA 3GZOA 4DPBX 5KYYA 1HI6B 1X5HA 1WBYA 1W72A 2GITA 4G6FB 3U30C 3US9A 4Q6YA 3IE9A 3EOBA 1D9KB 2PCFA 2QZQA 4GAYB 3RBGA 1A9VA 5GXBB 3GNML 1QVOA 1HKLL 4I2XA 2O1AA 4ZW8A 1D7CA 4FQHA 4G9FB 3RZCB 5CUSH 4JO2H 4BHUI 4C8XA 1NFDE 4PS7A 5FM5M 5LGYA 3ZDXB 5J12C 2NYYD 3WBDA 1RFDL 4LNRB 4JNXA 3GS0A 4WJ5B 3SJVA 3HZMA 4BQ6A 2F54A 2DQUL 4KJYB 1XB6A 5EC2A 2ZWZA 2QZ5A 1CGUA 1S9VA 1K2DA 1YCSA 2UX7A 4R7NA 5DRWA 1AQDA 3S97C 1Z6JT 5CLTA 3FK3A 5I16A 1G7IB 2C1PB 3RLSA 4ANVA 5LQBH 1VJSA 1MCDA 3MDJA 3V95A 4L2YA 5B1BB 3VFUA 4JFVA 4M43H 2CBMA 5BV7B 1A6VH 3QFGA 2WNGA 3DX4A 3B9KA 4QNPE 3AWFA 4YDJA 5E99H 3UYPB 3ZHKA 1GHFH 2D03L 4UT6H 1BZOA 1SOKA 4XMLH 2ZKYA 4W70A 4WW1B 3POHA 3ILQC 5I8CA 2NXZC 2B4CL 5DSCB 1EGJA 1GGIH 1RJZA 3E9UA 1AR1B 3KDMB 4U0RC 3SB3A 2Y06H 2YIHA 2NY1C 5TGBB 3P77B 3GMQA 5IVOA 1BFVL 2C3VB 2VC2H 4KRLB 2O26U 1S78C 5IK3A 2KBGA 2TSAA 4JR9L 3NZSA 4EN2A 3EO9L 1BMWA 2AW2A 4BSWB 1KPUA 3HCVA 1SXNA 2ERJB 1MRFL 3QDGA 5DD0L 1RHHB 3DDFA 3NJKA 4WTWA 5FYLE 4JO3L 2ZYHA 4P2QB 3ROOB 3BXNA 5F7MC 1S9WB 4L23A 2E47A 1FL5A 3IU4L 4MB3A 4GSUA 2AK1H 5EIIB 4XBEL 5DC4B 2Y6SD 1OANA 4Z7WA 3MLWL 3PGCB 1G1KA 1R5WB 2ISDA 1ZHNA 1AHWC 2R83A 4G2AA 1A6WL 4GFTB 2CAKA 4PJXE 2FX9H 3CDYA 1TEFA 4NQCD 1S3RA 2LU4A 4I1NB 1A4AA 5L4FA 1DVZA 1U30A 4GYBA 3MXWL 1XGRB 1IVLA 4ZW7A 5DDHB 4TLKA 4NRXB 4ZSOB 1DSYA 4JQVC 2K78A 3E8UL 4N2KA 1BP3B 2NT0A 3V0JA 1HZHH 3ZKXC 2APFA 4H5SB 3EG9A 1BIIB 4NO0A 5AZEH 2BHFA 1F3JA 2AP2A 4PJ9A 2MMXA 1QLRB 2ZJSH 4OQ1A 3NFSL 4FFZA 2HPTA 4ODWA 5AD0A 3MLYH 4G70B 1T3FA 3LNGA 3G3LA 3AZUA 3UJTL 1GZPB 3KJ4C 2C9AA 35C8H 3QVAA 4QAMB 1A1OA 2BVOA 1EVUA 3AG2B 3VFMB 4RFOL 1HE7A 2PWGA 2ZXAA 4E41B 4JO1H 1Y6MR 4U1MB 4PR5B 1W16A 3BVWA 4JM2B 2C7UA 3VG0L 3L4WA 1RZKL 3ASNB 1A0QL 2D7OA 4AJYV 4ZFZA 4JPIA 4W9ZA 1OAQH 3V0GA 3NA4A 2IGFH 5HDRA 1UH4A 5D7SL 4QRRA 3TZVC 1CTNA 2VDMH 1ETJA 4J3SA 3VCLA 5L4MA 1PAMA 1QNZH 4JDVA 3QIBA 1VGEL 1B6UA 4NB7A 4YL9A 5B38A 3EXJA 2VLJE 2DYSB 4JLRB 1H5BC 1TITA 3F7YA 1T7YA 5ITBH 3B3IA 5D1QC 3T2OA 2FWOA 4X6CB 5DJCA 1EDHA 4NFDA 2XYBA 4FLRA 4B9JA 1MNUH 5C9KA 1QABA 4AUJA 5BZXA 5JPNA 2HH0H 1YNKH 4LCWE 4OH2A 5LG6A 3OJVC 4RZCB 5T5NG 1PZUB 4OGXL 3Q6GH 1DUZA 4FNLL 5EUOB 3D69B 3DSNA 1X9RA 1BD2A 5IQ9B 5BMFH 2OMTB 4PJGF 1B0RA 1N19A 1R5VA 1XIWD 5BUAA 1N18A 2NW3B 3IEAA 1NCBL 5D6DA 1ZLSL 3ZT6A 4DOHB 1EFXA 2FH8A 4Z7OB 1SUHA 1UG9A 4Y4KC 4PJXA 1GS8A 4L1SA 3H3KA 1ZHLA 5T1DH 3RU8H 1QSVA 1DBBH 4PJ8A 4X4ME 3BH9B 1IZJA 3TV3L 3QJZA 2AERT 4FTVE 4Y2DD 4MNHB 3L16A 1J0JA 2HTKD 1T20A 4LCUA 1SDAB 4QRTA 4GP4B 4FFTA 5DRNA 4AXWA 4YHZH 3AROA 3SDXF 3W37A 2ED7A 1HHHB 5GJSH 2NSXA 43C9B 2YRBA 2XA3A 1E67A 5F9AC 1PX3A 2EYSA 3WEXB 1XZ0A 4IIQA 2AANA 3ZUNC 3T4AC 2PW1B 1JNJA 4JJOA 3ALPA 3CFJA 3BE1H 1AVAA 5IQOA 4KO5A 2EUXA 4PJ7A 5J1AB 2DQJL 3UBXI 5K9OB 1GJIA 1KC5H 1LL1A 2YGPA 2JK5B 5ENWA 3O4LB 1X5AA 1S7TB 4GP5B 4KUCF 2E74C 2VLRA 2AI0H 2DLGA 3U4EB 1TKWB 5AQ0A 4U1GB 4DZ8B 4M56A 3QISA 3HB3C 2ZOKA 3UGEA 3HOGA 1SYSB 2Y24A 3BSZL 4DERA 2R1WB 2PCYA 4M61A 2VKXA 2APXA 1UWGH 4JFQB 3FHAA 3H4FA 4GAJH 3UTPD 1OZUA 1DBAL 5FGRA 2X1PA 4RWYH 3EFFA 1N5YL 1IGMH 2HLAA 4KNQA 1ZEAH 1AD9B 2XN2A 4WEMB 1Y07A 1AIFA 2MCPH 1E27A 3EGSA 3QUHA 3WSQL 1IVTA 3HS8A 3O8XC 5F3HB 3IGLA 3L9RA 4XNBA 1I8LC 1TFPA 4LEOA 2VLJA 1U8KA 3BYTA 3HC3H 2VITA 3DHUA 3TO4D 4Z77B 2NY5H 3PL6A 3EDFA 4S2SB 4JRLA 1GJWA 3D7PA 5KVEE 3H0TB 3MCKB 3ZE0E 4FYQA 3MNVB 4XNAA 5E4OA 3WEOA 4YZWA 4LCWA 3NIGE 1OQXA 4X5WB 3ZTCC 5GQBA 4WO4D 1SY6H 1UD6A 2DJUA 5IESH 5HP5A 1PU0A 2ADFH 4R90H 2DQDH 4CN4A 5C1MB 5HHPB 5F89B 5BS0A 5F7EL 4WI0B 3IAQA 2WIMA 4GS7B 3UBXB 3GKWH 1AO7D 4X0NA 3ATDA 1QWNA 1ZV9A 2OBGA 2WQXA 3KPMB 4W9CC 3F6JA 4FFVC 3MGTA 4UTAH 3RL1B 4HLEA 3RVTC 5BQ7B 5ID0B 4XP4H 2HAZA 1MJ7H 5IOPA 1OEZW 5HGBB 4NSKB 3OKMA 4NFBA 4PJ5D 3AXLB 2GIYA 3ARXA 3G6DL 1CYWA 4QLRA 4XO3A 3TEWA 2OTUB 1CLZH 2IPUG 1CFNA 4MCZB 5T3XE 3HE7C 2QBWA 1KPVA 4KZCA 4X4YB 1H3GA 3FB8B 4IBLT 2H0EA 3ULUF 1WZAA 3QFJD 1RUPL 4YPJA 2C9UA 5D70H 5AOIA 1QHOA 4R96A 4HBCL 1I9JH 5I18L 2UVEA 3KPOB 3EAKA 1P7QD 2YAFA 4UM9D 5D2LA 3D50A 4HUNB 3S2AA 4Y19E 4I9WE 5DD6A 2EE2A 1KLFB 2R4RH 3KYMB 3RX7A 5BZDB 2BP8A 1MCOH 1XCTA 2YPKB 2F58H 4TSBH 3U48A 4NBYB 5C0CB 3RPKA 1KTRL 2FWUA 4L4TA 5IQ7L 2H5UA 5E4IA 1HVXA 2CHNA 1U8MB 2VW6A 3O2DL 4KRPB 4PSRA 5LAXA 3SD2A 4Z95H 1HDMB 5DMIL 1BYPA 4CUCA 3H4HA 2WLHA 3NCXA 4M48H 5LBSH 2VR7A 4L8BA 4UINH 1ZHKA 1VFBB 5FB8B 1S7SB 3K4AA 2MKWA 1IAKB 4LARL 4U2YA 5EIQA 2J44A 3NJJA 4JFYB 5DMGD 3KHQA 3EYOA 4ZFQA 1E42A 4YX2H 2PTUA 5DVKA 1AS6A 3DV4A 5LNEA 3K7UA 4EVNB 3FFDA 4BH7A 4X2UA 4OZ4B 1RK0A 1RY7B 4YEFA 3KMDA 4Q9RH 4FS0A 1MLBB 2LFEA 3QEQB 5FUOH 1MCBA 5BOZG 2GUOB 3KYKH 5TE4H 3V5DA 4DT2A 1R3KB 3UZVA 3KJ6L 3C6LB 4N0YH 2BWDA 1QLFA 4HF5H 3V6OE 2C3HA 4LCYA 4X6DF 5IIEB 4LMQI 1B2WL 1SBBA 3CPUA 2P5WB 3Q6FB 2QGEA 1NSNL 4PY7B 1UWXH 5I24A 1OWRM 2VAAA 1HH9A 1ZLUH 4RA3A 3HUJB 4HDIA 3PWUB 4LSPH 5I1GL 1XCXA 3GI9L 5CP3H 5GGRA 4WWNA 2JE8A 4GIOA 5C0BB 1H3WM 2XT1B 2ZCHH 2VWEC 3ARFB 3IGFA 3WKNA 1UC6A 1MRDL 3VTAA 1KYOJ 2DQEL 1F4YH 2GTWB 3ECBA 4U3SA 1ZIAA 4YWGH 4W4OC 1T22A 1JXJA 3AITA 1MI5A 5ESAB 4YXHH 4JDZA 3VRLE 1MWAA 4EZLA 4DGYH 5CGYC 1RJLB 5F1NB 5L0QB 2R2BB 4M7JH 1MCKA 4B96A 5GS0L 3ZT5A 1A1MB 3QEHA 3FQTB 3HR5A 3U1SL 4Z7NF 1GR7A 5ESVB 1KJ3L 2LQRA 4MA1B 3BH8B 4PHZA 2WUBL 4HJEA 4JREB 1CICA 3N85L 4OLWH 1DQLL 3VFSB 4L0ZA 4F2MB 5FYJE 1ZVNA 2XUWA 3MUUA 1HESA 2HA1A 3NN8B 4H20H 5KTEL 2Q6WB 1E9OA 3L7EA 1IKNC 1D6EB 1AS7A 3UACA 5KAQG 3ZE1E 4FMFA 3EUUA 1TYEB 5C3LD 4TN9A 2X05A 4HD9A 5GSVB 4EIGB 2VIRA 4KNTA 3OKEA 5IHZB 4G7YH 2X4PB 4ZW3A 3O2WL 4JQXC 1EXUB 5BO1H 2BC4B 5DRZB 5DYFA 2IAMC 1UA3A 3HG1B 3BWZA 3GPSA 4E5XB 4G1MB 5IP4A 1N10A 2ZWLT 4QOKA 5DVOA 3RFZB 3JWDL 1BZ8A 4FG6D 3TT3H 4HGWA 3ERXA 1OSZA 3MLTA 1E5CA 5M7QA 4P5TC 1Q9LB 3FQ2A 3P11L 5MP6L 1MEXL 3LKSB 4Q56A 1GGBL 3D0VB 3T6ZA 3V6OA 1RSYA 4N1EA 3P3RA 1PLCA 1TIUA 3U7YL 2G3NA 3CU7A 2J72A 1V3MA 3NCCB 4FEIA 4GQPH 5J3HC 3L5WB 3ZHDA 1A9EB 4UQBA 2Y5EA 3UYRH 2YBGA 1DJIA 4YN3A 5JR1L 3IU3B 3LEYL 4PP1C 3WXVL 5K5YA 1OAJA 3QORD 3ULVH 3WOVA 1G7HB 4ANXA 3L7FA 2PWDA 3C5ZD 4PVMA 4XP9H 4G1EB 4FQJH 2W0FA 3SHSA 2J6EH 4MX7B 5IFAL 1XF4B 1GPOH 3JWOL 3K6DA 1U8JA 1MXDA 4PRAA 5D7IE 5ERWB 2Y36H 1VADB 2B77A 5IM7B 2A6JA 2O5ZH 3QG6B 4NQED 5DJYA 5CSBA 4YSEA 1LYQA 1A22B 2NNCA 2W38A 1PY4A 3I9GL 4OFPA 5D5ME 4XGZB 1R3LB 1XGPB 2V7NA 3OB0K 5AB1A 4UZSA 5JDSB 4N2LA 1KCKA 5L7XL 4JDTH 1ES0B 1P0SE 3X3FL 4HS6A 3EO1B 1SXSA 4IK7A 2V2TA 1DE4A 4NDMA 3DRQB 4LOFA 3LZLA 1XZWA 4OD1H 2PP7A 1KCSL 3P54A 3ZIYA 5LJYH 2P5ED 1OM3L 2VXUH 1IKFH 4NO5B 2N56A 5CZKA 5EN2A 3VD4A 1YJDC 5CIPH 4DVBB 5T1KA 3B2VH 1A3RH 3QUYD 1NUNB 2XFGB 1XCQB 1I3GH 3FXIC 1HYRC 1TJGH 5AVTB 1J9RA 2JIXA 1IC4L 2IBZX 3IYLW 4C83B 5BUPA 2WINA 3RHWK 2HXAA 3FTYA 2BSCA 4XPFL 1SJHA 4KK6D 3CGTA 4KJPC 1FNGA 4NJAH 4WV1B 3ZQ9A 2WXNA 5T33L 5FYJU 2CO6A 3B9KC 2DQFA 3MLZL 4I7ZC 4EZKA 2PWEA 4I0KA 3CD4A 5G4OA 5ISZD 1MUJA 3QNZA 5HHXH 4LLDB 1QMUA 2ICCA 2YQ3A 4H26A 4MRBA 4NGHH 2QQQA 3HRZB 1D5XB 3BLBA 3BGAA 5IJCC 2W07A 3ZR5A 4JFOB 1IBYA 5HYJE 3MSPA 2H6UA 3EYVA 3LEXA 4L9LA 3MRJA 3T4YB 3W81A 4ANWA 3QQ9D 3U9PL 4ES8A 3R0NA 4J3OH 3OC5A 4K73A 1PZDA 4KKCC 5BNXD 4WU5A 2QSVA 3MCLL 5I75C 2PXYA 1N64H 4HUUA 4UT9A 4GW5B 4L1DA 4DO6A 3L4TA 1N6UA 5JOPD 5ABAA 3D5OF 1GAFH 2LVEA 3FTUA 3MRBA 4DESA 2RB8A 3V6BR 2OL3B 4X8CA 4NPYA 3MNDA 2A77H 1V5JA 3DJZA 5C0AD 2KKQA 1MHEB 1XL6A 4D8OA 1BDYA 5SWSB 3I9IA 1UB5A 5JXAL 3MJ7A 1HL5A 2XTJB 2VXSL 2XY1A 1LE9A 3RUGE 4H2CA 5KJ7E 4GG6F 4NI6A 3ZK0A 1KT2B 2FD6H 1FL6B 3MA7B 2CKBA 5D5MA 2F74A 5D7KD 3UZEA 5CGBA 3UMTA 3FH5A 4KVCH 3GBNL 2LTQB 2I27N 2G0LA 4JY4B 4WUUE 1EMTH 2ZCKH 4GAGH 5CZRA 4WFFD 2GJZA 2CRIA 2VZ3A 4M62H 4HK0B 2WV3A 3CDGB 1G7JA 2R2HB 4FZ8H 3GSNA 3GK8H 2A0LC 2YK1L 3M17A 3O3DB 4F7EB 4N3UA 4Z0BL 3MBED 1E8XA 4RMBA 2L7JA 1BJ1H 2G5BA 1BBJA 2IAAC 3DARA 3LQZB 3BN9C 4IM8A 4X6EA 3RWHA 1H9VA 1S5HA 4PRDA 5E9AA 3GMOA 5GS1A 1Z66A 2PW2B 4W9FC 1J5OL 1P9MA 4FQ1L 1LO4L 1ZGLB 1M7UA 1YECH 1NEZG 1ZGLP 4MB5A 1JUFA 1WITA 1G7MB 5FDWB 1FG2B 4WHTB 4AVJA 3O6FB 4YHKH 2Z7WA 1FI8C 5BOJA 1LE5B 2Z7ZA 1C7SA 3GXFA 4QHKJ 5E51A 1GCFA 1T7ZA 3Q1EA 4TF4A 2MHAB 5E1HB 2CDGB 4MSWA 4TKWA 5CXPA 3TYFB 1H9DA 1SOQA 3BGFC 1KNOB 5IJBC 2VLKB 4OI9A 1KACB 5DQJA 2A83B 1E5AA 4D2NA 1AKPA 3TJHD 1IQDB 1L0QA 4YAQA 5F96H 1E3ZA 1EH9A 3RWIB 1WZLA 3KL5A 3INUL 2BW5A 3QIBC 4PWJA 1A47A 3BPOC 4C56E 3OXSA 1RPQA 3GSRB 5C07A 3L81A 1Z5HA 3TBYA 1DCEA 2A6IA 1IC5L 3FFCB 5CINH 1Y0LA 2YN5A 2X88A 3US0A 2ENQA 4KJWD 2QPUA 1XF2B 5JPNC 4ICWA 4CKQA 4F7KA 2I69A 1T6BX 2H1PH 3LAFA 3ABZA 2OJEA 1UURA 4ZMLA 1XL4A 1EEUA 1UT9A 1VB9A 4JFHD 5IBUG 2DW5A 5CJ5A 4WFEE 2ZYSA 1B0WA 1FO0A 3WYRA 4OU3A 3RVXC 5MENB 1TTCA 4H8WC 5D6DC 2CJUL 3BO8B 5ECJE 5BVJB 1OAKH 3OQ3B 3RUGA 2HVBA 1NDGA 2D0HA 1MW0A 3MLSH 1T0NB 4L4VB 4LP5A 4YSSA 1K72A 4PJ8C 4PJFF 4IRZL 4ENED 2CK0L 4JFPA 2J56A 3QO0B 2CG9X 3MRRB 4A6YH 3U6RA 3DPBA 3RJQB 5BPPA 3VFVA 5H4ZA 4IIQC 3VI4F 2RH0A 3EZJB 1SOXA 1AGCB 4EN3D 1OK8A 2AS5M 1TZAA 4XCYB 2FX8H 5CJQL 3WNLA 2DQGL 3FUEA 4RCAA 4GI6A 5FK9A 2FBJL 4I18B 3TX4A 2GUYA 2X70A 1A2YA 4GRLB 3JXAA 1OGSA 5I76A 2E5EA 4B7IA 4J8RA 4TULL 1NCAL 2GW5A 1UCTA 4HXBL 5DK0A 4PJGB 3I85A 4PAZA 1DVXA 1UOVA 1H19A 1U58B 3QGVA 4P59H 3WJLC 5B3NA 1T0MB 5A3ID 1XWVA 5DHYB 1NCOA 3FQRB 1YEEL 5CILH 5D7LE 3UTSD 4LCIL 5FA3B 3HPLB 2EH8L 4ABWA 2WQ8A 4XNXL 4RGOL 2J8UF 1CFSA 5EDXA 1OTTD 4WVRA 3V4UH 2O6PA 5LN8A 2P7TB 1GGYA 4RAVA 4BFIA 3WHE0 4FTVD 3F6LA 1FORH 4IJ3C 4RBPH 3VUAA 5KSBA 1INDL 1QA9B 5GZNA 1BOGA 3VFNB 4N9GA 1RP9A 4HBQA 4I48B 3JTBA 2CA3A 2H0JA 4GUPA 1CFQA 5T3ZL 3KL3A 3E9TA 5HI4C 4MLSA 4ZPTA 1AXSA 2ZONA 5JO5B 1P4BH 1NA8A 5DGQA 3LEVH 4U1LB 3OJ2C 2CO2A 4NERA 1ONQB 2V5SA 3H9HA 3RKPA 3KPSB 4HEPG 4QF1A 3RJDA 1BVOA 3CU1A 3DLQR 4OKVB 4NQVB 1CT8B 1MH5B 4LHUD 1L9MA 1XH1A 5D96C 2LGNA 2OL3L 2Y7QB 4MDIB 2YS4A 1YSOA 3DROB 4N8CH 3QUZD 4OCYH 2H2PD 3NA9L 3V4PA 4MXQC 4NNYA 5J06A 3RX5A 3FQUA 1B88A 4TUJB 1YLBB 2FJGA 3BVXA 1PIFA 5JOEA 2DMCA 2Z6FA 2ESVB 4MLIA 4WRLA 3I6LE 4NQXB 3MGAA 4IOFD 4N2AA 2WXOA 2LHAA 4PYGA 3F7QA 5TPWH 2FGWH 1MG3C 1PZBA 2E9JA 4XHJC 5SV4A 4NKIL 2RJMA 2QKSA 1KBGL 3IDGA 4IJTA 5E8PA 4KROD 1M7IB 2V5YA 3OWRA 1CQYA 1CE6B 2EADA 3PWNA 5GZOD 4MVBD 1XBDA 4ELDA 4JANB 2ATKA 4XN9A 1FBIL 2E86A 2V9TA 4JPKH 5AAWC 2O72A 3PHSA 3U2SB 1CXIA 4MXVE 1BVLA 5ANME 4PWGA 2EABA 3QZPA 3DXAE 5LN4A 1F11B 5KSUB 3RE0A 4U3CA 5MI0C 1NBCA 3QPKA 4K4KA 5KN5B 4JFSA 2XFXA 4Y5YA 1NGWB 1KJMA 4E9RA 3H2WA 1ZDSA 3CHOA 4JHAL 3L3GA 5D7LA 4NBZB 1NCWH 4X7SH 4MAZA 5HHNB 1MIMH 4E9QA 2X9WA 4KK9C 4HG4K 1G4MA 5C0EA 2DQCH 3MR9A 4LP4A 1BF8A 4RMQA 3QQDB 3NFPA 3TPUB 3VRIA 5ESQB 1J18A 1F56A 3D9AL 1FIEA 2HN7B 4HWEL 3SYOA 5C9JB 5T3XD 4RX4D 3HZYA 5IW1A 4H1LH 4Y16D 4FQIL 3IBEA 1BVKB 3A24A 2CA4A 4AGPA 1YPZE 5DZAA 3VXUE 4HAFA 1OSPL 3GJFB 4Z7VE 5K1NA 3CE1A 4XN5A 1DVFB 1LO0L 4X7TB 3VW3H 3KLLA 2BHZA 3GM0A 4NKQB 1JFQL 4HU8A 4L18A 2QMKA 4UQIM 3FT4B 4JKWA 4Y19D 3U36A 4I9WD 2VM4A 3GLEA 3P2BA 4KK8D 4XNMB 5F44A 3VGBA 2HWZL 4ZUWB 4JQIH 3QIUA 1KCBA 1XT5A 3K1DA 4TQ8A 4P99A 4TTDD 4XVJH 5I71B 2Q1EA 3T8XA 3QDJD 2Q86A 4M1DH 3GMLB 4LPVA 5IHUL 1KIQA 1GY2A 4FG4A 1KB5H 2V4LA 3EGXA 4OD2A 1ZAGA 1IAOA 4FXGA 3RVWC 2FGZA 4MNGE 1EEQA 1LEGB 2CH8A 3O0RH 2F19H 3PDDA 4QDGA 1UZGA 2H8PB 5HDLA 3T0DA 2J71A 3DTUB 4EXKA 3AG4B 2A9ML 5CSGA 5KSAB 3S36H 3T0EE 1NCUA 2OXHB 2EC9U 5I28A 1UFGA 5CBEB 3HLAB 1F18A 3GNMH 3OZ9H 1HKLH 3RIAK 3IVKB 1N2RB 2X4NB 2JKTM 2AJZA 2J1ZA 3CFCL 3DHPA 4PBWD 3DO7A 2EDBA 4MJ5B 4HKZA 3KYAA 5ANMA 4X6DB 5K39B 4ZG1A 4JN2A 1IFGA 2QQNL 1SDDB 1CICC 1UD3A 3DXAA 1C08B 4QKTA 3TBTA 5D4IA 5IEHB 3MBWB 1OTUD 4EI5D 1AZNA 3EOTL 3MV9D 3TIEA 3B9DA 3WFDH 4UT7L 3RVUC 5AW9B 3EXLA 2EZ0C 2CHXA 4Z7UA 3V9FA 2ICWJ 3Q8BA 3RIFF 5C6PB 3GINA 3BDBA 4D9LL 3P3UA 2RD0A 2VO8A 3G5YA 5HGGS 2AHIA 4LKCB 3U0WL 1FVCA 2A1WH 3BCFA 2AQRA 2ITCB 3CJJA 2AV7A 4QJ3B 2NY3B 3MRMA 3VFTB 1U3HD 3F5WA 1R24A 4GXVH 5JHDE 3GLDA 1W0VB 2VXQA 3FU3A 1F4AA 3QWRD 1OD7A 4GW4A 3FO2B 1A6AB 4JGNA 1A6PA 1KGCE 2D03H 2F53D 3S3CB 5F9WC 3GS4A 1WPCA 4XCCL 4Z7VA 3VD2A 4MA3A 4Z7NB 3Q2CA 3L1OL 3NIDF 3U9UB 5E4EB 3MAWA 3L4UA 1KTDA 5GRVL 2LV4A 1TZHB 3LQAH 4FA7B 4R97C 3V6OC 2BRQA 4R4FH 5D1XC 1SEBB 4UTBA 4HV8A 5AVZB 3ARZA 5EOQH 3QJHB 1BFVH 1KENL 2BNQD 4MA8H 3MRNB 5FYJD 3K6FA 3D48R 1JI2A 3LPOA 3QHTC 3E6FB 4JDEA 4LCCB 2F7RA 4JR9H 3CQFA 4ORZC 3EO9H 4RGNE 2I24N 3C60D 3PDOB 5MHSE 4GJTB 5JA8B 1F02I 1URLA 1MRFH 4NN6B 3BZ5A 3DIFB 4CGUB 3CSGA 4Y4FD 5AL8A 1PD6A 5ECGA 2J88L 3MV8E 4ZFOA 2AK4A 2O6EA 4XOAA 2W60A 2ZD0A 3DYOA 3IU4H 3OJMB 4LK4A 4ODXB 4PB0L 4Q0XH 3MV7B 4XBEH 1ICTA 2MOGA 1PLAA 5GRXG 4A2GA 1EERB 3VFRA 1TQBB 4YBHA 4TMPA 3X1FA 5I1DA 1A6WH 1KCRL 2KLRA 4DP5X 1OGPA 5CU5A 4EQ2A 3KH3A 5D8JL 3FQNB 1SJEA 3L4ZA 2O6FA 2X4UB 1KJVB 2HVKB 4AE0A 5BZWB 4ANUA 5I8OL 3ZDYE 3BAJA 5B7EA 3L1FA 3VI3B 3K72B 4NUMA 4PGEB 4PCYA 5ELIA 2ZNWA 2NZ9C 2Y7LA 4HIPA 4CVXA 4P46B 5D1ZC 4UIKL 1E4XL 1QSEE 5F9OL 3U1PA 3E8UH 3SKJL 3OHXB 1V7ML 1QRNE 3HMWH 3JT0A 2OP4L 1UXWB 3HPJB 4YQXL 1E50A 4CVZA 1HOCA 1S7RB 1VFOA 3DRTA 3PHQB 2ATPB 4BDVA 1ZA6B 4HT1H 3IJHA 4IHOA 1MCCA 4AC2A 3DVGA 4AVHA 4I0PC 1QP1A 1WSST 3F58L 4IGBB 4TUKH 3ZYJA 3G5XA 2E76C 2J73A 3RTQB 3CDFA 3VSTA 3NK3A 3JV0A 4DETA 5IHLB 4RFOH 1KJ2A 5TF0A 3ULUL 3VG0H 1QEWB 3KGUA 1A0QH 4PJCE 3EH2A 2DWSA 2PYED 4O2FA 3ZY7A 2BH0A 1OF2A 5J5EA 2EDMA 1PG7H 1GZHA 2AMGA 1F00I 3GSVA 4FFYA 5D7SH 1XF3B 2P8PB 3WXWH 3O41B 4RDBA 2D7TL 1QO3B 3KYOA 3QUMH 1VGEH 4M93C 4NHCL 5GRUL 5EZIL 4EZJA 3OB8A 3T6VA 4TVPL 2OMZA 4KFZC 3TBSB 3KS0H 1XB8A 4HCRH 4KJQC 3SE8L 1FGVL 4IOSA 5C3IA 4XB8A 4DN4H 1U95A 4GBXA 2PR4L 1JDAA 3JT2A 1NAMA 3NGBB 3HAEA 3SY0A 4OSUL 1L9NA 3K4ZA 2JKXA 3ZHFA 5KEZA 1SLVA 4HMCA 1W80A 4Y4HB 3X13B 5DJXA 2BOCA 3HC4L 5F8QC 3S5YA 3KLDA 1QG3A 2OX5A 1U0QA 3BW9B 1NCBH 3UZEC 2YAOA 2PPCA 4J1UA 4RFEB 1TVBA 2V8LA 3D4ZA 3TYGH 1OP3H 2IBBA 4YNYB 2N4IA 3FRPB 5HYJD 1JZ4A 2J7LA 4QMEA 3WGVB 2WLIB 4K5OA 2BCMA 3TV3H 5EBMA 1EZVY 2K70A 2RALA 1PY0A 3OKNA 4JK0D 5J13C 5FKPB 2HX9A 4ESKA 4QXUL 3WIAA 3T2NL 1JYXA 5BRZA 1C9SA 3HKZA 3MRIA 3QR0A 4K8RD 4N2GA 1QSEA 3CVIL 2FSDA 3DYMA 2EYTB 5FFGA 4ADIA 2VE6B 1BZ9B 1FNHA 1QRNA 2AGJH 1V54B 2BRRH 3C9NB 3DMMD 4NN7C 4PU2A 1LMKA 1CD9B 3SPHA 4L8DA 4ISVA 4YHNA 2DQJH 4M5YL 5B1KA 1J0KA 3LN4A 3TNMA 4FXKB 5GRJH 2MQGA 4FHKA 1TZIA 5DFAA 3DK2A 3T6QC 1TQWA 4N2EA 1DVQA 4YPGA 3UMNA 4XVOA 4A7TA 1QWUA 4WIQA 1K8DA 1UWYA 2NW2B 2XZZA 2DLFH 1WAEA 4U7SA 4ZI8A 4GG6B 1WZKA 1QPXA 3S3BB 1X9UA 4LPTA 3BSZH 5AW5B 3MHZA 4D9QE 5BV7H 3O6LL 5I26A 3EYQD 5I0XA 1CDCA 5LHDA 4OFKA 4PJCA 5GSRA 1QPPA 3SCMB 3PP4L 1IM9D 4ABUA 2EKSA 1Z9NA 2HT4D 2AEQL 1IUZA 3KNBA 3U6XA 5T1JA 4WUUD 4N8VB 1KPRA 3BSGA 4X83A 5L8KB 3CZFA 2VN5A 3ETBJ 5F0JB 5AYUL 1TU2B 3L3OB 3TBCA 3F12A 1LMIA 2OR8A 4NJ9L 5DQDL 5FO9B 4ZOBA 4WDIB 2IXQA 3V5HB 2YC1A 1QBML 1HH6B 3B7YA 4F3FA 5CHNA 1G1OA 4RNRB 2DM2A 2OA9A 1G94A 5DLML 1NOLA 3O6KH 2V8MA 3LOWA 2X4RB 1YY8B 2YD3A 1I7ZA 2B1AL 2WBXA 1G84A 1YNTF 4YLQT 2ARJB 4AYSA 1I1YB 5AEAA 3P4OB 4WF7A 1DQVA 2YPLB 1UVQA 3CZLA 1K6QL 4NI3A 3L2MA 1Z3GH 1J8HE 1G0YR 5DUMH 5F7EH 4KO7A 4XP1L 1Y6NR 4LESA 5EBLB 4BFFA 3T3PF 4XN4A 3F7PC 3PFUA 5AZ2L 5HYSG 1E7VA 4YVNA 3PYCA 2N01B 3FC8A 3EJRA 4ZX5A 2ENPA 2ICWA 2NY6D 2VH5H 3CFDA 3G6DH 2EEFA 5JW4M 1UJTA 1FFOA 3TEZA 1PZCA 4MZ2A 3WLBA 3UAJC 4C56D 3WNJA 1WCBA 4P57A 2DV6A 4MQ7B 2K0RA 3CZNA 3IKCA 3UJJL 1ROCA 1RUPH 3HNTL 3VXNA 4BWTA 2BSTB 4X5XB 1NFDF 4JRWA 1MVUB 5AW1B 4PYHA 4ZUUB 3BUDA 4HBCH 2E6QA 4OLXL 1HC1A 2AXGA 2MTPA 2CO4A 2H2SC 3ZMNA 4MJIE 1N3NB 1T21B 1WVZA 2W1NA 3GSXA 2AJUL 4PLJD 2B59A 3V7MA 4S1DC 4Y1SA 3WEMA 3WFCH 4WFED 4P5MB 4QTHB 1A3LL 4IRSA 4YDLC 3CDZA 5IQ7H 1F0LA 1J1PL 4J3OG 3FTVA 4PJFB 2ZWSA 2ZXDA 4P3CH 4PMEA 4CSSA 5DMIH 3TT1L 3UXFA 5E8DL 1THAA 1CBVL 5FCSH 1RPKA 3TV8A 4JPVL 4ZD3L 4QNPF 3INOA 3P1VA 4LARH 4YHPA 5GZNC 3QEUA 4S1RL 5HD8D 2XRAL 2ZKHH 1GIGH 3VI4B 3OGCB 5F6HJ 3ASOB 4WWOA 3PF2A 3IAGC 2PPFA 1AJ7L 3S3DB 6PAZA 2EDRA 5HJ3B 4N85A 2MNUA 5DYOA 2Q7AA 3BKML 4OFYA 4XZ4A 3VWJA 15C8L 3U7WL 4LVOB 4QRPE 1KYOK 3BAEL 4O02A 3F6IA 1AANA 1RZGB 4LOEA 1UWEH 4YDVB 5KBLA 3L4VA 3SDCB 4P9HH 1GRWA 1T1YB 2MOVA 2UXVA 3KJ6H 3OPUA 4XBGA 1BM7A 3IFOA 1S7UB 3K6OA 1BZ7A 4NUJA 4ZTEA 3ZKMD 1B2WH 4NCC1 3A6CL 1NSNH 4P05A 4YSDA 5E2WH 1MAML 2J8UB 3STLA 5HPMA 2WSPA 5I1GH 2FYYA 3L45A 4JO4H 2BVPB 1CUOA 1PD1A 2J1KA 3TH3T 3I02A 3HHRB 4XCFH 3O45B 4XOEA 3S5ZA 4F2EA 3NABL 4H8UA 1CBJA 5C0IB 3Q05A 2R0LH 1MRDH 4NQCB 5EC1A 2WO4A 1KGIA 3MFFA 1XF5B 1H3UA 4PJXF 4XCNA 2KDYA 1ETZA 1UXSB 2FJHB 4NYLA 2Y6SC 3OSVA 1NCHA 4HJJL 4J3BA 4AW7A 1ZJAA 2BZ7A 2Y7OA 4JB9L 5DK3A 3BIBX 5GS0H 1JDDA 1ED3B 1I53A 2DKMA 3ARBD 1KIUB 1H5BB 3FSOA 2V5TA 1XB3A 1KJ3H 5L88L 2GB2A 3UGXA 4KAQL 5ACZB 3I50L 2AXFA 1IGTB 1DQLH 3O3UN 4Y5YC 4PJ7F 1DQJB 1IGJA 3IWUA 3VXSA 4FX5A 4MAYD 1MG2C 4HKXB 4ZXBA 3SGDH 1R3HA 4R84A 5KTEH 1TSHA 4LLAA 3C09C 3O9WD 3QRLA 3OC8A 4UV7L 4XI5D 3RNQA 1BMZA 1CFBA 1MLCB 2VXVL 3GXUB 2XN9B 3I6LD 2GJ6E 5JQIB 1L9SA 3MRLB 4L3CA 1HIML 4PFEA 5AVUB 3SD5A 1EAPB 4UDTB 1YMHB 1K5NA 2G75B 3O2WH 4JJ5B 2G9HA 4I3GA 1FGNL 2WXKA 3IJEB 2X44D 4KZ0A 4N2BA 3TJEL 5HHMB 2MNWA 3J8F7 3PWLB 2F7OA 2NUTA 2NT1A 5LCVL 3UTQA 4JG0L 3QZWG 1NEZA 3JWDH 3OR6B 5AAMA 3OR7B 3APDA 2VM3A 1EK3A 1OM9A 1TVHA 3KPNA 1HZLA 1K3IA 1P1ZA 4HP5A 5CEXB 1R47A 1MHCA 3OJDA 4WY7L 4ZJ9A 1QSFD 4XN8A 4B6ZA 4O58H 4NN5C 4FNUA 2YMTA 4WFGE 2CIKA 2AFNA 4OGZA 3U7YH 1JFHA 3M1OA 4HWNA 4L29A 4DN3L 1ITCA 1YUKB 4KVPA 2IQ9L 2H32H 1BJMA 5JR1H 1DQML 1WYJA 2YRPA 3AADB 1DDHB 1QFOA 5C08D 3RGVD 4Z3EA 1RHFA 3HMXA 4Y9CA 3SBPA 2BMKB 1SN5A 1Q72L 2CGRL 3DIVA 4GG8A 4LLWB 2GTZA 4W9HC 4W9JC 5B39B 5I66A 2QELA 2K8QA 2CJTA 3H85A 3W5MA 2J5LC 3O6MH 4HZLA 2JI2A 4FXGC 1ZTXL 5INCB 3RWJB 3UCRA 3K71B 4S0HA 5FYKE 3MJ9A 4AH2B 1KCUH 2H26B 4BZ1L 3MNWA 4MJHA 4DKEL 1B4JL 5TDNA 43CAA 2UY6B 4BELD 5CM1A 5EOCJ 3THML 1TZOA 1QBBA 4K55A 2NY2C 1AE6L 3KLQA 3PREA 3VXUD 3IETA 3WV0A 3LDBB 3O8XB 1H3TA 3IRPX 4WUKL 5L7XH 4FOMA 3QHFH 3RDTA 4R2GD 3FQ4A 4TNWF 4UF7C 3X3FH 2X87A 2YKLH 2XJKA 2OCJA 3HZVB 1AGEB 4HSAC 1OM3H 1ZT7B 4Y2DC 3QXVA 5LDUA 5C86A 4OTXH 2ZOLB 2FNWA 1MQKL 1SPDA 2EDKA 5HDWA 1N6QL 3MRHB 1JZEA 3IDIA 4PGDA 1I31A 1A14L 4P4KA 4JFZL 5DUPH 1LP9E 4KO6A 3SDDA 2FSEB 2JNZA 2Q87A 9CGTA 4CSZA 5IROD 5MEOA 4JMXA 4E42A 4HAGA 2XTSA 5FM5O 1F86A 1IC4H 3TA3A 4DP6X 4L9DA 2G9KA 5F1KC 4RMWA 2F7PA 5T33H 3NQIA 4Q6KA 2W91A 4APXA 1AZVA 5DMKA 2ADIA 3CSYA 1K4DB 5DZVA 3T0ED 4UT6A 5ANHA 4L3AA 1BEYH 3I74A 4AVKA 3C5XA 4MZIA 4NWUH 4TUOA 3PJSB 2DLEA 1NFIA 2XQYK 1OHZA 4R4BB 2CBPA 2VABA 3IGAA 3AG3B 2DMBA 1QZ1A 3FUFA 1PDKA 1W6WA 2OI9B 3VWKD 4CU7A 1JJUA 5C0DB 5I73B 3IJ8A 5FXCH 5BOPA 2R59A 2XNAB 3D52A 4UM8B 5AW7B 1HS6A 2FWLB 1L5GA 2HFFB 2XA8H 3MCLH 4JCMA 2YD2A 1IBGL 4O5LH 4IHBA 2GVYA 3NIGF 2DTSA 3OXRA 5DD5H 2XWDA 5G5DA 4UCFA 1WWCA 3FQXA 2NDGA 5HPOA 5GGSB 2DYPA 4R7LA 2H3NB 1AO7B 4KI5E 5E8NA 1RZJC 4BXVA 2I60H 1HEHC 2HJFB 1YDPB 4R4ND 1LO5A 1YMMD 4XBPB 5ALBH 1FC1A 2XIDA 4H44C 4ZODA 2VXSH 2D3NA 1IKOP 4M4RA 4PJ5B 5DRXB 3BQUD 1X5LA 4HEPA 4NZRL 2BSEA 4B5ZA 4HGKC 1KGCD 1CDJA 3ARTA 1AGDA 3EHBD 3NIDB 4M6MH 4YSRA 5FO7B 4J39A 4WHYG 3NAAL 4B9PA 1EZLA 3FULA 4MMZA 3FU5A 2B1HL 2O5XL 5FYKU 2N7AA 1QR1B 1BVNT 1M1SA 2YRLA 3HE6B 2DJSA 2AMUA 2I07B 4EF3A 1BXXA 2YK1H 1OE1A 5DEFB 4Z0BH 1G9MC 5TE6H 2BCKA 1MCSA 1PPIA 4HUXA 2ZXEB 4HIHA 5FWQA 1S46A 2EIDA 5C8JA 3L13A 4Z7IA 2PETA 3QNXA 4H1LG 3BD3A 3IS0X 3EJSA 3WD5L 2ADJA 1OIOA 3BWAB 5L4JA 5HYIA 4L2LA 3ABMB 3MV8D 4Q89A 4JEGB 4G9DB 3W9DA 4XMPL 4G6JL 5FF6B 3U4AA 4P3DA 3ZKSD 2I26N 2P8LA 4JVPA 5C09E 4LPYA 3LKOA 4K3EL 3FN0L 5E00A 3E38A 3B43A 1N59A 3DUUA 4TPRL 2H3XC 3TESA 5AL0A 1RUML 3N50A 3SOBH 5CD5D 2WAHA 2NQCA 3PY9A 3FO1A 1LJMA 1GZHC 2VLLA 4PRBB 2RIKA 3UERA 4W6YB 2AV1B 3WKQA 1QZNA 2PLTA 3INUH 2F5BL 4APQA 5D72L 4NO2A 3EGDB 3VFPA 1U93A 4N2IA 1MFEL 2R69L 2Z91A 3CFBB 3M8OL 3MXVL 5JW5A 3OX8A 2BVEA 5C2BL 2DS4A 3TVMB 1KYUA 1DBML 4DP4X 2G3ZA 3QPXH 4RGNC 3W0WD 1Q9KB 3MRKA 2XACC 1S7QB 3FUKA 2X4OB 3AREB 3IFLL 5HHOE 4HS8L 5B1AB 4M6NL 4FQCH 4PRPE 2WN3A 1AP2A 2GC4C 1SJMA 2BWIA 2H1XA 2QVFB 4HIQA 4IQHA 4K71C 3FONA 2WVUA 4I3RL 5B8CB 1VCAA 4UDUB 4NM8L 4RBPK 3WTTA 1C5CL 3T6WA 3BIKA 4HW6A 1BX2B 2JKNA 4Y5VB 5LXVA 4DPRA 2CJUH 3P9MA 3PLYA 3ILPA 3B6SB 1NIEA 4P2RB 1PAZA 3CN4A 1A7PL 3D2UD 4FQXA 1MZYA 4IRJB 2WGXA 5E5MA 2YKKA 4K0OA 3JVGA 1U9KA 2IAMB 3LRMA 2I85A 3P30H 2O93L 1N6VA 2CPCA 4IRZH 4YXLL 2CK0H 3EYSL 2OZNA 3VRLF 1N5AB 2ITDB 1WFMA 2VZOA 3QDJA 3IXAA 5J89A 1NWPA 4W93A 5I15L 1JWSB 4A7SA 1VEMA 4B27A 2AEOA 3N1PC 3G7TA 3HHMA 2JCCE 1E8WA 4XPBL 5CJQH 3W9EB 2DQGH 4J4PD 5IBLC 1IEBB 5LBVA 5JW3L 4AT6A 1ML0A 3OKLA 1YYLL 4M8QA 4ODSL 3VM7A 5D71L 3DUSB 4UOJA 2FEJA 1G7LB 3MLRH 3E2HC 3S96A 4MD5B 2R8SL 4B3EA 1CVSC 5H35A 4TULH 1UQSA 4W9KC 1NCAH 5KYNA 4OGQC 2DH2A 5IBTH 4LDEB 2XG4B 2NR6D 4K94L 5IB3B 3ZE2E 5C09A 3ZE1F 1J1XL 4JKPL 4G83A 2N0MA 2QDWA 2YLHA 4J3UA 4ZFGL 3UC0L 1FLRL 3QNYA 1VEOA 3AM8A 1MCEA 3QT2A 3Q5YA 4LCIH 3GIVA 3MV9A 5KJRL 4EUPB 1ZD6A 4XNXH 4NO3A 5KYYB 1WBYB 1W72B 5FHBL 1D5RA 4MDRA 3DTXB 1FQ9C 2PCFB 2OZ4L 1QVOB 3CXFA 4I2XB 4AYBA 4FQHB 1XMWA 2V33A 3AG1B 1INDH 1Q9WA 4PV1C 4A2LA 1TTRA 2P1YA 1RXLA 4OB5L 4LBAA 2R23A 3VFOB 4OAWB 4BKLA 1Q1PA 2R56L 9PCYA 1VESA 1XD1A 1SXBA 3SJVB 3LS4L 2F54B 2D4FA 4UILL 1RUAH 5EC2B 3WCYA 4PRPA 4LMQE 1S9VB 1YEHH 4XMZA 2DEWX 3RWDB 3WL9B 1FYTA 5DRWB 1AQDB 4FG6C 2GK0A 1O5DT 1SY6A 2WSKA 4PRHE 1CZ8L 3C5ZB 3CMOL 3WAKA 3ZZQA 1J8KA 1UCBH 4L0YA 2UZIL 5JIKA 5JUEL 1M6OB 3MMEB 2J57A 4D9QD 3CC5B 4O2EB 4UTAA 3MU3A 4ZAKD 4L8SB 5D7IF 3W2DL 3B9KB 3IDXH 3QORC 1JZHA 1UTDA 3FT2A 5J1TC 5I1EH 1ID2A 2FHCA 3S37L 3BD5A 3PQYE 4XP5L 3WDJA 4WI9A 1ADQH 4ZZKA 4GI8A 5BRPA 4LVEA 4YHIB 5D5MF 1KBGH 4KOCA 5B22A 1JNHB 4MZRA 1ZOXA 3FCUB 3AB0C 4GRWF 4NOFA 1CXHA 2HB0A 2BOBA 1UZ8A 3GMQB 1OAZH 1AQ8A 4XE5B 1FBIH 2NY4D 1DHKA 4LRIA 1H3XA 2JCCA 4Y1AD 4ZPVA 2BY2A 5A2FA 2CK2A 1YNTB 3UBFA 5IK3B 1IC7L 5K33A 5I75B 1KPUB 1RZIA 3LXBA 1QLEB 4ACPA 5DJ2B 1L9OA 2L4OA 3QDGB 5ES4B 5KZCB 2HT2D 4F27A 3QXAA 3VXPA 2YJQA 4L8CA 3T3PB 4GXUN 4IRSC 4QHUA 1J8HD 2EUZA 1FL5B 1S7VA 1WBZA 4P2OA 4M3JA 4UBDC 1FIGL 4JHAH 4XNQA 5TFSL 1NBZB 3WLWC 1JZIA 1KB9J 1WHOA 3FN9A 3HJEA 3SBWA 4HLJA 4XTRD 3DX6A 1AIZA 1ZHNB 3QCUL 5LBSA 4H7VA 2PR9A 5IFHH 2W94A 4KPHH 4CAGA 2YGVA 4IYKA 4U05A 4A7UA 1P5UA 2W65A 4Z18A 4AC4A 3MRFB 4YO0B 5HGAB 4FULA 1II4E 2UUDK 2XSKA 1NFDB 4FQIH 3H56A 4KK6C 1GY1A 3IKKA 2E56A 4OI8A 5E94A 4BQBA 1EJOL 5DS1A 3LH2L 4MYPA 5HY9A 5ITFA 2A74A 4WWKA 4D9RD 1FWXA 5DJ6B 1S4IA 3VD3A 2QQLL 4JRXD 4I13B 4F5CE 3ATEA 4PJ6A 1LO0H 4MJID 4AM0Q 1CDIA 3D3VE 1F3DH 3EG9B 2ROXA 3LPPA 3MUGA 4NO0B 1J88A 4PRHA 4KQ3L 1F3JB 3ORJA 1JWUB 4OBSA 4OCSL 4PJ9B 3ZL2A 1F13A 2AJ3A 2YGOA 4G6FD 5KANI 3H55A 1VZHA 1WA1X 1D9KD 3BHBB 3QQ9C 4GKZA 2NY0D 4ODWB 1MCNA 2E7LC 4PD4J 5B3JE 5CP3A 4XMUA 4G9FD 4MBOA 5M94B 1NUDA 3RZCD 3ZZ1A 2BIPA 2BXZA 1A1OB 2BVOB 1B4TA 2DMHA 4XO8A 5EUKA 4XXCC 4AIZA 3WJMA 2C7UB 1KEGH 5GIRA 3S3SA 4M3KB 3PQYA 3RUGF 2C9VA 3HC0A 2Z93B 3BGFB 1BSIA 5E1GA 4JPIB 2CBOA 2XX1A 4PLNC 4NC0B 1A6UL 2BVTA 1N68A 2H7WA 4OV6F 5I6PA 2JJTC 4NS0A 1A4JA 2PO6D 1SHSA 5LGHL 1PKQE 5LLIC 3QIBB 4XAKE 5KYXA 5B38B 2C4XA 1D5ZB 5I2IB 3DK0A 2RBLA 5C2UB 4OLVL 8FABA 3MBEB 4QRPD 3CFCH 4OY9A 5DO8A 3L3JA 3B3IB 2CM5A 2G60L 2OQJA 2P8MA 4Y5XA 5DJCB 2BVUA 2H3KA 3LCYA 5DJAB 2GSIA 2G5RA 2J4WL 5F71A 1QW9A 1IM3A 2EO7A 5DQ9A 4HUCA 4ZXBC 1DUZB 1PFCA 3GMRB 3GUFA 3DIDA 3ZSSA 5KW9L 3DSNB 4JAMB 1JE6A 4BFGA 1YEJL 2EACA 3DVNA 3TBWA 2JJSA 1J87A 4QD2E 4D9LH 3BAWA 4HWBH 1B0RB 3L3DB 1R5VB 4UUJA 5EO0B 1AR1D 3M88A 1EFXB 4PM1A 1L6PA 3U0WH 1CFVL 5B1CA 3V0WL 1W72L 3EJUA 4PJXB 4BSJA 2CR6A 1J1OL 1ZHLB 3DX0A 3GXNA 3ETTA 3CIQA 2JF1A 2QMJA 4PJ8B 2ADGB 3AUVA 3QXUA 1NC4D 3M1BA 4NKMB 4O51A 3LN5A 1ZSHA 2HLEB 4QRTB 4LCUB 4WHDA 4WGWB 5HDBF 2A73A 4WHCA 1KN4L 5L8JB 5DJZB 4AXWB 4GKSA 1YY9D 3DBSA 5AAMC 4PV8B 1WV7T 1MZZA 4XCCH 5KSBF 2EYSB 1UASA 1U8PA 3G5ZB 1XZ0B 2ZCZA 3NJMA 3L1OH 4EOWL 1I8AA 3K8KA 4BGDA 3X1NA 4F5CA 4XWGL 3A6BL 3D3VA 3TJHC 5JHLL 5ILTH 3C5JA 1IT9L 1YJDL 4YEEA 3U4BL 4Z1PA 1KENH 5ENWB 1IGFH 1M3JA 5ALCL 2ICEA 4DF9A 3QI9A 3AWEA 3N1QC 2JSFA 2FWSA 4YDIL 5F7BA 1NMCC 2J6EA 1DP0A 3J7HA 2J88H 1TLKA 2BSSA 3NT0A 3BN3B 4M61B 4Q52A 1YN7A 2GJ6D 1FNSL 3ARDA 4HGMA 4AE1A 2VR3A 4PB0H 3QCVL 5F7YC 3S4SB 1ZDQA 3EFFB 2NYZA 2B0SH 2HLAB 2AXJA 5HVHB 4PJAE 1OTSD 2CCWA 1AIFB 4U3HA 3C2AL 1E27B 3EGSB 1KCRH 1PKQA