1ZSHA

Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (ip6)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
392
structure length
354
Chain Sequence
TRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSSDVAVELPFTLMHPKDIVFEDFARQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonvisual arrestin oligomerization and cellular localization are regulated by inositol hexakisphosphate binding
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords Beta-arrestin 1
total genus 56
structure length 354
sequence length 392
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA01
4GEIA 4J2QA 3UGXA 4GEJA 5F0MB 1ZSHA 2R51A 1SUJA 3LH9A 4ZRGA 3LH8A 4JQIA 1JSYA 2FAUA 1G4MA 2WTRA 2WTRB 4LL4A 4R7XA 4GFXA 5F0LB 1G4RA 1AYRA 3UGUA 3GD1C 1CF1A 3LHAA 4LL1A 3P2DA 4R7VA 5F0JB 5F0PB 4P2AA 3GC3A
chains in the Genus database with same CATH superfamily
4JRXD 3HAEA 3D18A 1HEJC 4D7BA 4TUKH 4B9IA 4FQ1H 4JR9H 2EDJA 4RDBA 4JCLA 4GQPH 2UVEA 1A7PH 4IHBA 3A6CH 2OS7A 3C8KB 2XFXA 1YMHB 2XRAL 3EJRA 4IU2A 2FYYB 5D1QE 1ZOXA 1Q9OA 3L3GA 5SX4I 5C0AE 3RL2A 3Q9PA 1XIWD 4N6RA 3FN9A 1PKQE 2K7PA 4H8VA 3WN6A 3CQPA 4W6YB 1G9MC 1XF3A 1KN2L 5E2JA 3RVTC 1VHPA 2VXVL 4R96A 4Z7UF 1DVXA 3AROA 3DX4A 1J8RA 5CJOH 3ZGIA 2F18A 4G1EB 4GMTH 1BG9A 1QRNE 2VERA 5CEXB 1PLGH 1BFOA 2WXLA 2OTWB 2YGPA 1KZQA 4G7RB 2CPCA 4O02L 4L3ED 4OLZH 3R4DA 4RZCB 2H3KA 5D2LE 4QXTB 4M61A 2CIIA 2H3NA 4UM9B 1WEJL 1NAML 3EZ8A 3NEOA 4HMCA 5KYUA 4KNUA 3M7OA 1B6DA 2UYLB 4WWKB 2Y22A 3VFGH 3QNYB 3SY0B 4N0UE 5LXGH 3D34A 1UACH 2X9YA 3P30L 4ERSH 3MLSL 2JXMB 2EDBA 4YC2C 3QO1B 4G80B 1OQOA 4I89A 4ABUA 1COBA 3AB0B 3IT8D 3N2JA 1FZJB 2YQBA 5F0JB 4MS6A 3K1KC 2W59A 4OIIH 4F2EA 1TZHA 3BT2L 1P1ZA 1VJSA 2VDRH 2WQXA 4Z76A 2CH8A 5K59F 3UL4A 1Z9LA 2ZSWA 3REWA 1WT5A 2X87A 3REVB 3QGVA 4ZNEA 2EUZA 4ZTPL 4ANWA 3P4MB 2NY4C 4ACPA 2WSDA 4OGAC 4MRBA 1W8OA 1ZWIB 1IAOB 2ICWA 2GJRA 1UASA 2EIZA 4CUCA 1SJEB 5BW7C 1K4CB 5FFGA 3L95A 1K4DA 2PYEE 2IANE 3H53A 5JOPD 4ZOAA 2PWHA 1E30A 3BP4A 4XPGH 4MBRA 5KSVA 1TZIA 1AKPA 3ECQA 4PR5A 2ZXBA 3GMPA 3LH9A 1AJ7H 5AOZA 4DP9X 3QO0A 1BPLB 2APVA 3JWDL 4J27A 4TM9A 1S7SB 2ODHA 3HZYB 4OR1A 1QLEL 4G42A 4LPWA 3ARPA 3GIVB 3P77A 1N6UA 5F97E 4RMWA 3TNMA 1FBIL 5FYKH 4K5LA 3BVWA 1JRHI 5C71A 3ULUC 3VB8A 1FDLH 4AV4A 4B97A 4JBSA 4U3SB 1LO4H 4FNSA 4PV9A 3VFSA 4P3CL 5T3ZL 5J13B 4Z9KB 3CXDH 1ZGLA 2PKDA 2MHAA 3CMGA 3MACL 3JV6A 1I9JH 1INQB 3B9EA 3ZTNH 2MQCA 2DQEH 3LZLA 4TVPL 4Q9RH 2ENSA 2BSDA 5EULV 1E6OL 3H9SA 1MN4A 4DHLA 1E5BA 3FZUD 1EHNA 5A7EA 3UPRA 3IS1X 1A6TA 2DWSA 4NHCL 4P05A 3HKZA 2BSEA 4OF5A 5BS0E 3SGDH 3MUUA 3LHAA 5IB3A 2UWEE 4YDJB 2WIIB 4CMHC 3LRSB 2HPOA 2Z31D 2GAZB 3ARBC 5AFAA 3VD7A 2ZWLT 4HKJB 1YUHB 4LCWE 5FA4A 2F53E 1DE4A 1GZPB 3T6VA 4P2RD 1I1CA 1WK0A 4XAKE 3VRLF 4GAJH 1FZMB 1IGTB 2OL3B 3JWNG 3MCYA 4YDIH 3VCLB 1AGEB 3EYVA 5BZWA 4Z7VF 1IBFA 1VLXA 4DAGH 4MRCA 2VLME 1DCEA 1MZZA 4PJ9D 2EE3A 3HPJA 3ETBF 1UCTA 1JNHB 1DBAL 5LBGA 3PL6C 2LABA 5KVGL 3MNZA 4FTVA 1JPFA 5INDB 2DWEB 5E8EA 3LH2L 4NO0D 1G7QB 3LIZA 1NFIA 2MFNA 5LBVA 1HYSC 3QJSB 2Z92A 3GKZA 4PB0L 3UACA 2BX5A 2F8OA 5KVFE 1E5AA 3L3IA 2PF6A 3UCRA 3WSQH 2JIXD 2AQNA 5BV7B 1LEKA 3B2DC 3EBHA 3M46A 3I02B 5DGQA 3Q0HA 1M1XA 3CFBB 2AQQA 1M05A 4OCSL 5FF6A 5EIIB 1ZY9A 3OR7A 1QSED 2W80C 4U1HB 1MLBB 2P8MA 4GT0A 4P4KC 2A73A 3VSVA 2ZXWB 3TO2B 2YKLH 4NN5B 3G6AA 4QKXB 5J1AB 3VFGL 4Y5YC 4P2QD 5LXGL 1PEWA 2QR0B 4YXKH 4AITA 4OT1H 5L8JB 1JYNA 3M17B 5HVHC 3QUXB 1RHHB 5ESAA 4XCFL 2G2NA 3BQUA 1CDIA 3NCCB 5ADOH 4Z8FH 1JD9A 1UXWB 2P8LB 1T89C 5IV2B 3RGVA 1T4KB 2ZUQC 4J4PA 4NM8L 1Y0LA 1UWEH 4JFHD 4LOEA 1LO4L 4JFHE 3WIIH 4KDWA 3QDMD 4M6NH 4KI5E 5TPWH 2WQAA 2FEEI 2H2PC 3P9LB 5JHDE 3SKOA 1G9EA 2XSKA 1Q38A 1KTBA 2DQEL 3EOBB 3UAAA 1BXVA 5D7LE 3ATEA 4Z7WB 4NPJA 3DKHA 1UD4A 4NUGL 2IEPA 3FB7B 2WKOF 1X7SA 1XV8A 3PV6A 2Q86B 4DO4A 5IUCA 4M3KB 1OP4A 4J3SA 3B83A 3HN3A 5D2LB 4BZ2A 5CBAB 5IMMA 2K78A 4XMLL 1CFVH 2EH8H 1L0YA 3CSFA 2DS4A 5D1ZA 1U8JA 2FJFA 4E41E 1QBMH 3W0WB 3HG0A 2UY6A 1YEGH 2W0KA 3IPFA 2FE0A 2NY7H 3GI8H 3IDXH 4Z7AA 5KYUB 1GTNA 2J5LC 3V0VB 4HG4K 4ABWA 1HSAB 3CTTA 5JO5A 5GRJL 4M1CC 1NCDH 3GC3A 1IEAA 3FSWA 5I8OL 2C3VA 4UDTA 1FFOA 1OP5K 2NY1B 3GBDA 3FO1B 1GYWA 5J7CC 1RZ7L 2A9NL 2FWOB 4MQSB 2ADJA 4X5PA 1A7NL 1QBAA 5CBEA 4X6BB 4HC1H 4TPRL 1HZLA 2VLJB 1A6VH 3RDTD 4DQOH 3RZCA 4PJBE 2IH8A 2AEPH 3VFTA 1JP5A 5T5FL 1GC1L 4OAWB 3HE7B 1VESA 3FCSB 1RK0A 1AVAA 2AEWA 1KTLA 4K3DH 1TVHB 4XAWL 3RVVD 3QUKB 4OM0L 5L88L 2PPEA 3GBML 2FECI 1X7QA 2O5YH 3I75A 4A2GA 3OQRA 1MHHA 3QCUL 3CH1A 2FD6H 4F2ME 2KHAA 1FFOB 5D55A 1GGIH 3Q1EA 1P84K 4LSSH 3C5ZB 3MV8D 1OCZB 4G9DA 2X28A 1OARH 1VKXA 3BJ91 3CVHB 1YN6B 4NCDA 3SGJA 3C60D 4GAJL 4M6OL 1U8PA 4A2MA 3F6JA 4V1DE 1FGNH 4Q9RL 4N1HB 4UIKH 2R2HB 3GXDA 3ZIMA 2Y7LA 2DF3A 2V9RA 1M71A 1JHLL 3WJJA 2P4AB 1BD2A 1QTPA 2B4CH 2WYHA 3MAWA 3MGOA 5E8DL 1ADQA 3QUKA 3MUJA 2HG5A 2R4RL 3HFFA 3LKOB 4NC2B 4YQXH 3GSRA 1FGVH 1G4MA 2RD0A 5E2WH 2O5ZH 1J8HB 4X7CC 1P4LA 4ODVH 3MRQB 4XPBH 1WFJA 2H0FA 1XGRB 3WKPA 2HJKB 2YRLA 2CQVA 1SHWA 3OHXB 4AQ1C 3DX8A 4TVSa 2J88H 2Y72A 4Z7WE 3TP4A 1X5ZA 1QBML 1XAKA 3ZL4H 1VEMA 2MNWA 3LEXB 4K94L 2N59A 4ZFOA 1VCAA 4XVTL 4BRVA 2WVSA 4E9YA 1NCTA 1TU2A 3BI9X 5J13C 2NW2B 1AR1C 1I1AD 4ZS7H 2OMUA 5J11B 3PHQA 1CIUA 1MCCA 3LDBC 4TL4A 3ZL2A 4QGYA 5BO1H 5FECB 5TF0A 5DJ6B 3RWGA 1A7NH 5I71C 7TAAA 3MRDA 1ZHNB 4GIAA 5IB1B 1OQXA 1PTZA 4FRWA 4K3GA 5FA3A 2Q10A 2JLPA 4OUOA 1YEEH 2B59B 1IBYA 2K4AA 4LPTA 1MHCB 4TUJA 2C9UA 3K46A 3QE5A 1MFAH 1MIEL 3VG9B 1C5BL 5I1KL 1NCIA 4EAEA 5E08L 5K9JH 4IBUA 3V4VB 2VXSL 2WLHA 4JG5A 4BZ1L 4QRFA 1MEXL 4ZODA 3OKLB 4PHXA 1GMEA 4WGVB 3ZDYB 1QG3A 1K5NB 2EINB 1ZK5A 3KR3H 5DWUH 4YK4C 1AZNA 3LZRA 2HT3D 3PYCA 3SIKA 2VZ3A 2HKFL 4Y2DD 2FECL 1WWCA 1OE3A 2OBGA 4Y2DC 3HS9A 1WYJA 5FK9A 4Z0XA 1ZHKB 1W72H 5AUMB 4MNQD 4GP4B 4XXWC 3WIHH 3NFPB 5CZVL 3OMZA 2CUHA 2PNDA 3SOBH 5I1LB 1FCCA 2AXGB 4KTEH 4K7PL 1INEL 4M7ZB 3TC9A 1M6UA 4PB9L 1FZJA 4OGQC 3RFZC 2CDGB 1N5YL 3N5AA 5MEPB 1E8ZA 2H5UA 3L16A 1AY1L 2IMMA 5SWSE 3QB7C 3T3PB 1WITA 1Q9LB 4LQ1A 4Q58C 3QUGA 1FPTL 4U6TA 3TOPA 1HZHH 1LILA 4YS4A 4XE5B 4YDJA 4NN5C 3KBFA 3L2LA 2RALA 1TQSA 2Z34A 2Q5BA 2KDYA 1D5BA 1LP9A 3CHRA 4PP1D 3VTAA 3NSFA 4L0ZA 2I24N 2ZKHL 3NBNA 3WDJA 3FMGH 4JG1L 1CE6B 3CFEB 2HRLA 2VLJA 3O6MH 4IOSA 1BQ5A 1MQKL 1P4BH 2GIXA 4KROD 4JPSA 4O9HH 4PRHB 5GSRA 5BMFL 3SOTA 4X8GA 1THAA 1HL9A 2GJPA 3QIBD 4NKMA 1OLLA 4HC1L 1JCVA 3WFEH 1XXDC 2PCFB 4X5LA 4JNXA 4HWZB 4P2AA 3KH3A 3L4CA 1E27B 1MCDA 3WKMH 2XTJB 4PJDB 4QUOA 3TNMB 3Q13A 1F2QA 5CLTA 3KPMA 5IM7A 4RFOL 2XZAL 3VXRD 1HKLL 5MERB 4PJ9C 4N2HA 3B9KD 5HPMA 5D70L 3LQAL 2O5YL 4P23D 4BK5A 1UM5H 2DQTH 4ZTEA 2QJDA 4LVNB 4H1LH 3I9GH 2V9QA 3KLAB 2E74C 4NKOB 5GRZA 4GSQA 4JM2D 1MF2H 4JFQB 3WGVB 4JO1H 4LRNH 4F33B 2OMYB 2ZXAA 1VZHA 4YWGH 4BZYA 1ZXQA 2A6KB 3NEEA 1YMMA 2CIKA 1P6WA 4D9QD 1OGSA 3J7HA 4HIPA 1FGNL 3F04A 4X4YA 1GXEA 2VW6A 3D2TA 2PWFA 5TFSL 3QXTA 1CICA 1PCSA 2OULB 5HGHA 3O0RL 4KKPA 4AZ8A 3BEWB 4HMEA 1L0XA 1YQ2A 2FX9H 3AXLA 4BH8A 2XQ0A 3IN0A 4O2CB 3UBXG 2A7BA 2DBLH 4AENB 1ND0B 5DMJB 5IUSA 3VD2A 1QI3A 5MP6H 1WQVT 3L08A 1F11A 4LBEB 4MDIA 5J8OA 2G5BA 4XO4A 2Z3FA 4E0RB 1PG7W 3BGMA 5AZ2H 4HSQA 4HCGA 3T77A 4S10A 4IKKA 1WP6A 3O4LA 3UIYA 1PLBA 4DUWA 4KU1A 2KLRA 3NPSC 2VIRA 1IGIL 1GKOA 1YMMB 2CIKB 3BGFC 1E4XH 5L6YH 4K94H 4LLQA 3V6FB 3RPKA 1DQLH 1FSKC 4KAQH 4ES8A 4J39A 4BQCA 3E3QC 2HVKB 4JMNA 2CUIA 1SRDA 3L3IB 5B7EA 4BBWA 4G7VH 3C8DA 5DK2B 4RZKA 1MCIA 1VGEH 4HWEL 5GGUA 2VABA 4C56D 1AO7E 5E2VH 4BSWA 3PWPE 1CZ8H 3IDIA 3KDMA 5EFIB 1I8KA 1WWAX 2KZBA 4XMVA 4QTHB 4JFOB 2IOIA 5SWSB 2VZSA 3H42L 4OQTH 1QATA 2EKJA 4NIYE 3ZXAC 2YC1B 5I1GL 5DJ0A 1AGDB 3UTTE 1GTFA 5L8KB 4PTTB 3SJVA 4NQCB 1KJ2H 4UDUB 1G5GA 1JZ7A 4QRPB 2OW7A 3UCQA 2EXTA 5T33H 3LKOA 3D05A 4GAAA 4JRYB 5EPMA 1YUHA 3LPWA 1T89A 4HF5L 4CNIB 4PYGA 1E42A 2SEBB 3VI4A 1TITA 4RDQG 4F7PA 1M7UA 3SKMB 5IK3A 3HNSH 3FHQA 4ZQKA 3C09B 1J86A 3QWQB 3T3MB 4YXHH 3G5VB 1KIRB 4XMLH 4R7NA 2BSED 1YNLL 1TZGL 2Y5TB 4L4JA 4NQTA 4O2FB 4P46B 3VXRB 5DA0B 2I60H 4OKVB 5DURB 3QJTB 5AYQA 4PW4A 4PLJD 1A6WL 1YEGL 4NXKA 4AQAA 3LB6D 2XWXA 3QIUC 5C2BH 3KH4A 5CEZE 1ZT4B 3MFFB 5F71A 3WU1A 3IDYB 5C7XH 3KL3A 2ZUSA 4NCC1 4ODUB 3PF2A 1ED3B 4TSCH 6FABH 1X5LA 1CXIA 4F1SA 3SDDD 1H15B 2O6DA 2L7QA 5KJRL 2OMTA 5CJQL 3HNVH 1ZTXE 1MHEA 2NW3B 2OX5A 1HINL 2KH2B 1IEHA 5ECGA 5JOFB 5HHOA 3TO4B 2JJUA 3I2CH 2XWTA 3QFDA 1JS4A 3QWNA 3RA7H 4JRXA 4LVEA 4ZFFA 4GPVA 2DPKA 1E5CA 2CLZA 4BM7A 3MA9H 4OKDA 3CFQA 4FQQB 3TTSA 1IO4C 3D06A 1DQDL 2YJLA 3MLWH 5D96C 3ZDXB 1TENA 4X80H 3ZZ1A 1QSEA 2XN9E 2R0ZH 4KHTL 3WKML 5JW4M 5HP5A 2VDNL 5JPMA 1OPGH 3Q44A 4IBSA 1NLDL 1JZEA 3UYPB 2AQSA 3L3JA 3P11H 5HYJB 3VFVB 3SPVB 3ULSA 3GDCA 4XNMB 1JZFA 1AZVA 5DYOB 5ACZA 2NZ9D 1BZ8A 2WLLA 3FRUB 4P3DA 1ZEAH 3D6GA 1F4XH 1UQSA 4W9FC 2AXWA 1CI5A 3KWWB 1ZXKA 3WXWH 15C8L 1XF1A 4OD1L 1FN4B 2IANB 3L3HB 4HZLB 4RETB 5E2WL 1PQZA 2C1PB 1Q9WB 1JNNH 3ULUD 3C6LA 1E8YA 1NGWA 3K1DA 3ULVE 2IV8A 3WJLA 1MRCH 1EIBA 4KKNA 4NZUH 2RH0A 4HPOL 5EEUA 2Q1EA 4HOWA 5FV2A 4ZYKB 4X99B 1IAIM 2YAMA 3LNGA 1YJDH 1RZKH 3WLWD 3IE9A 1I1AB 1BZ7A 2CCWA 1FL5B 4HH9A 2YPKB 3ZU8A 5KYXB 2GI7A 3EJYD 2X4UB 2YPLE 4RFNB 5ALCH 3BD5A 2ZCKH 3HN5A 1M53A 4NZ8A 3ZKSD 1PF3A 5E7BA 1BZEA 2VRAA 3X11B 1YAZA 4R97C 3GSQB 3STLB 2R23B 5FFLA 2Q87A 2VLRD 1QFWL 5IHZA 1AMYA 1F4YL 1SOQA 3CLFH 4GAFB 5AVWB 4X4XB 4KV5F 3VFOB 2CKBL 5I6XB 5BRZD 3RA7L 1EWHA 4NAMA 3LZNA 3CZSA 2BOLA 2Q7YB 2YD1A 2JCCA 5CZXD 1NCHA 1GZHC 5K9JL 3JWNH 4Q9QH 2ZWYA 4WO4A 3N6YA 1P7KB 3F7RA 3OL2A 3CN4A 3N0AA 3ZR6A 5LCVA 5DJDA 2N0KA 4KDVA 2IC2A 4LDLB 2F7IA 2JMRA 2X4TA 3B3IB 3EJYC 1TEYA 4CBPA 1PKQB 2AQ3A 4W9ZA 1YEWA 4JJ5A 2CBPA 5E8NA 4HCRA 1KJ3H 3VXSB 3AABA 4ANVA 1UXSA 3ABLB 1F1AA 2R4SH 3NT0A 3UTOA 1UKTA 4PRHE 5E23A 1MKFA 5G4MA 4N25A 1NGZB 1PZDA 1FF5A 3SOBL 3W82A 2ZXDA 4Q14A 1AHWC 2RGSA 2C3VB 2VM3A 4UDTB 5CZXC 5KZCB 1ZJAA 5EB9A 4U33A 4J3TA 3B9AA 2VSKB 3EJZC 4QGTA 3IAPA 3TGXA 1JI2A 3RY4A 1U21A 4GP5B 2HT4C 2W91A 2KZWA 3LRLA 5D2NC 4H1LG 4DK3A 5DDHB 1LK3H 4LLQB 3CSTA 2XV3A 3OWEA 3VXNA 4EEEA 4GKSA 1OTTC 4PFEA 4PTTA 3OG6B 5TK4A 3VXQA 3WELA 3L9EA 4TQIA 3VA2C 1ZLWK 4F7MA 4M5YH 4AQ1B 1JZ6A 3RWHA 3EJCA 5D8JH 1GOGA 4PWIA 5IW1A 3ATFA 4J28A 3ECBA 3IPEA 1EZSA 2G2RA 5CHNB 1MPAL 3HCVA 3KPQA 5JIMA 4PJAE 1H5BB 1XCTB 5F9JA 1QHOA 2K8QA 4JY6B 2DEWX 1XEUA 4K3EH 1NMCB 1FVEB 2IAMD 4W9HC 3RTLA 3ZYOA 3E2HB 3U25A 4O2CA 3V7AG 3QWRD 2VDQB 2HFTA 2X2YA 4HIJB 3MGTB 4NJ9L 4JO4H 1T2XA 5C0CB 2P26A 5FHBH 1TG8A 2ZCHL 4DGWC 2ZD0A 1GGBH 1IM3A 3ET9F 3QEQB 5LNEA 5ISZB 3B9DA 5I0WA 5EORL 1UUNA 2F19L 2H2SC 1R46A 2OR7A 2ZOLA 3S5ZA 1A7RL 2X9XA 3MRBA 2RTTA 3EXLA 2V4LA 1A1MA 4XPHL 4FHBD 3VXNB 3MMEB 3DA0A 4OVUA 1I31A 1XZWA 1KLGA 1T4WA 1J5OL 1V55B 3LH8A 3T0DA 4KKBC 1R0AH 3OLDA 2Q8BL 1ZRUA 4FFZL 1JXDA 5HHXH 3UO1H 2F61A 2X6BA 5FYJH 5BZXA 1WD9A 5DD1H 2YGOA 1J1PL 2R9HD 2YD3A 4KWUA 1KEMH 4ZXBB 5ICUA 3D85B 1OL0A 2DM2A 5H35B 3V9CA 1BIHA 5JW5B 3KPRD 1ROCA 5DD0H 4MA3A 3NP3A 3QA3A 2NY3B 5I73B 5CZVH 2DIJA 1BQLH 3U0WH 4LCCA 1U3YA 3O2WH 3DC0A 3DV6B 3EJTA 5DLLA 3UBXB 3K91A 3SJVB 1ET7A 1U3HA 1Q1JH 3EYOB 4PVNA 4KX8A 1X9RA 3QDGB 1XTMA 3TPUA 3VFMB 1ETZB 1G9HA 4HHGA 1Z7JA 4BK4A 2L7EA 4IRSC 5GGSB 2YRBA 3FONB 4L9DA 2OI9B 3WO3B 3QI9D 3NIFF 4OGYH 4WUUD 1I1YA 4D0DB 2XXMB 4UILL 4JZJC 2V0AA 3L1GA 2NY4B 2XWBB 3DX7B 2IPKA 4UU9A 4GRWB 5DQDH 1QFPA 3VWKC 1R24A 2DM3A 4FADA 4BIKA 2QQQA 1MQKH 3WL9A 4YSCA 5DUPL 1YEHH 3LB6C 2CR6A 3EF4A 4Q7DA 3IN2A 1GZQB 2FHBA 3LKQA 3HAEB 1K9TA 3NYKA 4A2DA 4AK1A 4NAJA 1Q9WA 1DQJA 4XI5C 3DTUB 3MSPA 5ANMB 3NFPA 3DHPA 1FZMA 1IGTA 1ZIBA 4NN6C 5SX4H 4PCYA 3WHE1 2PXYB 1I82A 1PZAA 4GW4B 2Q6WA 1NMAL 3H9HB 3GXUB 2V2XA 4IDJH 2IGTA 3QEUB 4ZS6D 1TKWA 2EDTA 2O1AA 5F96L 3A22A 3F7YB 3VTTA 3GLAA 4HWUA 4LDOB 4RWYH 3VRJB 3WEAA 4EKJA 1XBRA 1KULA 4PW3A 3UXFA 1LEGB 4MMZA 4KJWD 1ZVSB 3D85D 1TSHA 4PJIB 5GHWH 4AYEC 2DMKA 4OLWL 4WU5B 3GBNH 3MZGB 5GGTA 4ZYKA 5IESL 3U30B 1T21A 5J12B 2AS5M 5HY9A 3K2UL 3ZKMD 2IH3A 1KEGH 2XVBA 5EUKB 4QEGA 1QRNB 2AGJL 2PTVA 4PRDB 4KI5D 5DLML 4XBMA 1NH6A 1I3GH 2BFVL 1UB5A 1ZV2A 5IFAL 4LEXL 3Q01A 2ICWI 4JFZH 3UTQA 4P3WA 2ATPB 5KBPA 2F68X 4CRPA 2AW2A 2XN9A 3A6CL 3E8VA 1JPTH 3EDKA 5CGBA 4KKZA 1OAYL 4M6AA 4L1BA 1NEZG 1O6SA 4ZOCA 1WWBX 5E8EB 5DJCB 2XZQH 2F7OA 2Z8SA 3AWEA 2YA2A 2NYYD 1WVZA 5M94B 2LU3A 1K2DA 2BFGA 1I1AC 1ZD6A 5HI5D 3JUZA 4NFCA 1L3WA 4FN0A 4M56A 2A73B 4Y5XC 3K5SA 1A6VL 3MRQA 3HE6C 2G60L 3QUZA 1FL6B 2LE9A 2D03H 4KKLD 3NJFA 3RU8H 2PW1B 2ZSVB 1WCBA 1E8XA 4GBXA 4AI7A 3C08H 1IAKB 3AS3A 3U9UB 1CDBA 2WBJC 3LRSA 2ZCHH 4BZ2H 5BOJA 3W37A 3OTTA 3BYTA 3EH5B 2EDQA 5KEZA 3BMWA 4KMTL 4XMTA 5L8LB 4FTDA 4L18A 1RJLA 2VKWA 3DIFB 1I4FB 5CXPA 4DETA 4HFUL 4BFJA 2L0DA 3C9NB 1HVXA 4HJJH 1I3UA 1SHMA 4G6JH 3KLLA 5HVHB 3QHZL 4TSAL 4Y4HB 4NT6A 5EZPA 4KKLC 5KSBA 2XV2A 3G6JE 5JIIA 2YARA 1IC1A 3HI6L 2EE6A 1E4WL 1NSNL 4JM2F 4JLRB 1FV1A 5HI5C 3VD4A 3V2AR 3BT2H 1JTPA 1H3WM 2GC7C 3IU3A 4U1KA 5E94A 1OHQA 4ZAKB 2OXGA 5FDWB 1MCPH 5JW4N 2FEEL 2HA1A 4XX1E 1KYOJ 2BNUB 5K5YA 4WI2A 1AH1A 3O3EA 4PGDB 3QCVH 4JPVH 4OKVA 4X83A 4LMQE 1SXAA 2P5EB 3KPPB 4H13C 4HEME 1CTMA 1QRND 3O2WL 2D3NA 5C9KA 1S3RA 4HIHB 4LASL 1WG3A 3VYPA 4F5CA 2Y06H 4Q0XL 4R84A 5EZOH 3SEPA 2UZIL 4C56E 3CIAA 3OPUA 3K6DA 1ZANH 3M88A 3QIUB 4IQHA 3I75B 1CD8A 3A6BH 3ARYA 1SYVB 3KBEA 1O7DE 1S7UA 4JM2C 1MZYA 4XMKH 1P7QD 3LHPL 5IFJA 5F3HA 5IROA 4OFQA 5IMOB 5FUZH 1OE1A 4G6MH 1EFXB 2OCCB 5LJYH 4AH2A 3MRPA 4GI8A 3FC8A 3G5XA 1D9KC 2L4OA 4C47A 2O4EA 1N18A 4LCWD 4QRQB 5CCKL 5K9OB 2ERJB 1UH2A 1F13A 3MRGA 3BQVA 3VD9A 4HIXL 4ZS6C 4WI0A 1DLHA 1TCRA 3EADA 3KG5A 4ZX5A 3CVBA 2WQWA 3HC3H 4TLTA 3CZNA 3WS6C 4GRMA 1X5KA 1TMQA 2GK0A 4XHJD 2EXWD 2BCKA 5I66A 2HTKD 2WW8A 3QUXD 3SDAA 1KBGL 1NAMH 4PJCA 1GHFL 1MCQA 4WDIA 1Q9KA 2BC4B 2TSBA 2GABA 3FO0H 3BZFB 3C75A 3BUIA 5EU5B 1R3JA 3D07A 3QS3A 4XPAH 2I69A 5BRQA 1NCJA 4DJMA 3BZEA 2NSMA 4NHCH 3WIFA 2LU5A 5DMKA 3GMMB 3NACH 3RI5K 2CCLA 3K2UH 4JGUA 4LLDA 1KLUA 4GFTB 1BD2B 3OVUB 5DCCA 3TIEA 2EUVA 3UZQA 2R15A 4LVHC 5ALBH 3FU3A 1JHTA 2YD5A 5AVYB 1QNIA 2EDDA 2XG5B 5FX3A 4BQ8A 3MJ8B 1FAIL 3GSXB 5I8EB 4ODHH 1KFAH 1RZFH 43CAB 3O0LA 5LXVA 4DP1X 1XR8B 1FP5A 1SOSA 4HQQH 3RDJA 3VXRE 1CL7I 2O5ZL 5KWYC 1RJCA 2OJZL 2PWGA 1C5CL 1NBVL 1IGJB 2A77L 3S36L 3SDCD 2Q6WB 3V4PA 3ISYA 5CN3A 4KUZH 4HIIB 2DIAA 4A7VA 4C59B 32C2B 2Y23A 3H54A 1V7NH 3WN5C 1IQDA 3PXJA 3MV9B 3BP7A 5C0BE 1G43A 5F7MC 2VXTH 2F54E 2BERA 1N6QL 5DC0A 3EGSB 4ELME 1QPKA 1JGLH 1QA9B 2IADA 2HJLB 3MA7A 5JHBA 2DLIA 1KYOK 1WZLA 2BIMA 2BJMH 3GPEA 3WIHA 1G0YR 4J6RH 1J9RA 2F5BL 1A6AA 2HKHL 3U4AA 4YLQT 4LLAA 3IDNB 1N9PA 2XTJD 4YFDB 4M48L 2AERT 4MZIA 1Z3GL 1WIUA 1PL3A 1I3RA 1S3KL 4U7MA 1HHKA 5GRUL 3TIDB 2CDFA 3UBGA 3VFRB 3ME0B 4EDXB 1E7VA 1M7DB 5JLZA 2WQSA 2YUXA 4L9LA 2BVYA 4FYTA 4LAQL 3T0BA 2X4PA 3L1OH 4HFWB 5B4MC 4FG0A 5BV7H 1EPFA 3QDJE 3DVNA 4OZ4B 1OD9A 1OSEA 2EC8A 3MX0A 5DT1H 4JO1L 4LRNL 4Q6KA 5FK9B 5T1KB 2VM4A 4NLHA 3MRHA 5BRZA 1I9RL 3FOMA 3JWOL 5C6WH 1KXQE 3BOVA 3PL6A 5TH2A 1JF1B 3S5LG 5I75B 2AQ1A 4BSWB 4Y19E 3QFJD 4GUOA 3QFJE 4Y16D 2VZOA 1IBBA 1SLVA 5D7LA 5D6CB 3N9GL 1KGUA 3OGCA 4ODTH 2WXPA 1FL5A 2KLSA 3IBOA 3TN0D 3LS5L 2CO7B 4P2OD 5AB1A 1JBJA 3N41B 1N5YH 3THMH 1D5ZB 4D3CL 4HGMA 1AS8A 4G6AC 4XP6H 3QQNA 1T2JA 2AMGA 1LJMA 4G8GB 4G8AC 1WRFA 2E7LA 3RUGB 1XGPA 3RFZA 1SM3H 1AGCA 5H37H 1R19A 1S5HA 2ZUVA 2X4OB 1IRAY 5H2BA 4FEMA 2LTQC 5C0JB 4HJ0C 2CR3A 2XBDA 5B8CB 1UCBH 3KPNA 4F8QA 3CPLA 1CGTA 2F54D 2YKKA 5EU6E 4EI5B 3PNWB 4PJXB 4GIOA 3QDJB 4W9IC 4AH2B 5KJ7E 3WFBH 1O6TA 2ALWA 2DQ6A 3AT8A 4LLYB 2ED6A 3INOA 2B3IA 4BKLA 1KMGA 4M7LL 4NO2A 2Y69B 4WEUD 2APWA 1A8ZA 4XMZA 5CIPA 3QZOA 1KNOB 3C5ZD 4GUPB 2X2UA 4WUUB 4E41D 3K0WA 1AE6H 3LSOA 4X8CA 2HKHH 1WAPA 3RUGA 1IBZA 1UJTA 5ICXB 3WJJC 3PWJA 1QEWB 1KELH 3X1FA 3KPTA 3L95B 1SQMA 2CM5A 4K94C 3RGVD 2Z35B 2GG1A 1AZZC 1CGUA 1FZKB 3HRPA 1C8QA 1P4IH 4HYTB 5GS0H 1MVUA 5I18H 2WINB 5EH1A 4ZSOE 3L9YA 1R3HB 5AEAA 5DD1L 3DUUB 4MJIB 3ULAB 5F3HB 2YK1H 3NCMA 4D9LL 2A0LC 5IG7A 3BMVA 4XX1G 4QJ4B 1N0XL 3F7QA 2EP6A 4Y19A 3PAVA 1EHLL 5F6IB 2DEYX 2R2HA 5D7SL 5AAMC 3SYOA 4XC3L 2X70B 2EDYA 2PXYC 3OKDA 3FQWB 1A6ZA 1AGFB 4JFFA 2IFFH 5D7HA 3JVGA 1IC7H 1RL1A 4K2UL 3VSQA 1UA6L 4FI6A 4G5AA 5E6YA 3VFNA 2BS8A 5MEND 2FATL 5DEJA 5I0XA 5CSZB 1XMWA 1TVBB 4P2OB 4FLRA 3D25A 3SDDC 1HCVA 1C5DA 2X4SB 3SBPA 3KYKL 1XD0A 4ECNA 4ODWA 2IH1B 2ERJC 1RUKH 3ERXA 7PAZA 1CI3M 1R5WB 3VMNA 4XNQA 3BC9A 5ACMA 1N12A 3V4UH 2JJSC 5DF0A 1LNUA 4LKCB 5CZRA 1R4XA 4Y9BA 4A55A 4KKAD 1U3HD 5E8PA 4GB9A 4A7GF 1A9VA 1E43A 1RQ5A 1HYSD 4H8PA 3I2CL 1BJ8A 1SDAB 2Y6TE 1A6ZB 1LMKA 1MH5A 1RJYA 4MYWB 5B1JC 5I8EA 2P49B 3RDTA 4W81A 1QO3A 2WWKT 3WUZA 2N3JA 4N0RA 2VXQA 4LARH 5ESVA 5JXAL 3C12A 3NCXA 1E67A 2E6JA 1D9KB 1KCUL 7FABL 3EG9B 3GXNA 5FYKE 1YPZF 3MA9L 3EO1B 4J6RL 4ZUTA 3TCXA 4OI7A 1U33A 1WCBB 1U8LB 2LV4A 3NCJL 3NJHA 4G59C 2APTA 2DICA 4QRPA 5F7AA 2FJFB 5EC2B 4A6YH 4KX9A 5CMAB 3TH4T 3OX8A 4X6CF 3FFDB 5IMLB 1YYML 1TO4A 4ORZC 3AY4C 4HWNA 4CN1A 3H9SD 1L0QA 1B4RA 4LE8A 1P4IL 3WMSA 4ELKB 1CBVH 5DYFA 3TEXA 3PHSA 4EOWL 1BP3B 1PAMA 3ARVA 4LSPL 1SLUA 1I8IA 3MRIB 3QJQB 3UPAA 2OZ4H 3FO2A 3PFQA 2X12A 4L1HA 2HUHA 4HDIA 4EXPX 4PRIB 5EHFA 3D3VE 1FO0H 4P2RA 4ODVL 5BUGA 5L4MA 4XXDA 3WTYA 4MLIA 2CO7A 3KWTA 2ENJA 2F08A 3SGEH 5H8DA 3BZEB 1TQCB 1Z9SA 4LSVH 5JIKA 4P07A 3O2VL 5EN2B 2ZG1A 1YEFH 4ZFGH 2NY0D 5A7BA 4A39A 4CU6A 1DJSA 4OV5A 1GGTA 5I5JA 4HXAL 4OD2A 1W0WB 3CD4A 5LG6A 3VQLA 3U7WH 5ID0A 2RIKA 1XCQB 4FTVD 4Z7QE 5DI8B 4UIMA 4DCQA 2OMUB 5CR1A 1SN5A 1V27A 5LBSL 3SE9H 1UTDA 4KXDA 2QVIA 4HIQA 4F57H 1DVQA 1OGPA 4JFVA 4OLEA 1V5JA 5K9QI 2CO2A 4HS6B 5CU5A 3KE0A 2IDTA 3U6RA 4AGPA 1EGJL 2NX5E 5FS5A 3MLVL 1E3FA 5FYLL 2P8PB 5IVXE 3QFDB 2ZUQB 1TO5A 3H9HA 2CDFB 2WIMA 3OGCB 3HBZA 1AKJB 3PWPD 4GKZA 1YNTF 3AMLA 4QOKA 2VC2L 1DJHA 1K6QH 5EA0L 4WFGD 3QPXH 3HC3L 3FOLA 1AQKH 1RMFH 2CSPA 1EO8H 1DQML 5CU9A 3WD5H 5SWSD 3RUGE 2HSIA 4NQUA 4PLJC 2IXQA 1U92A 4XXWA 4F7PB 1MH5B 3QSKB 3U0PA 1K72A 2GSIB 1E7UA 5ABZA 5KN5B 2B14A 3AVEA 3NQKA 3RBSA 5IQNA 3SZ6A 3C6SA 3MV8E 4K55A 5I9QB 1XGUA 2EDOA 2YLKA 4MHHG 3AQDA 4E9XA 4Z77A 1MAML 5AG9A 1LLAA 4R0LC 3RTQA 3T2PA 4TS6A 3I9AA 3BH4A 3KWXA 1RD6A 2YPVH 3H6AA 2XX0A 4J3OG 4BCXA 1IIIA 1T0OA 1N0XH 2QTEA 2XICA 3QJUB 5DS1A 1OGAA 1ZK9A 4BV1A 4MBOA 1JPGA 1U2HA 4FYSA 4I1NB 2RHEA 4HQQL 2DRUA 1BMGA 1IC7L 2F5AH 3EYVB 3KPRA 4XNAA 1RLBA 2AK4B 1UEMA 4ALAH 2D73A 5LN4A 2QBWA 3PQYE 4X8JA 4JG9A 4X9IA 2UZIH 4UV7H 4UQDA 1HCYA 2Z1KA 2QMJA 1DL7L 3R8BB 3WIAA 5I1CL 1IAKA 3K6IA 4N8VA 2CJSA 4MJIA 4FNTA 4I4WA 3VFWB 1MCLA 5E2TH 3FQTA 4FF9A 3V4UL 1KB9J 3CMOH 1UENA 4LRIC 4Q2ZA 4JCMA 1Z5LB 5ICXA 1TSRA 2E9BA 4HA1A 2VLJD 3PRZA 3RZCD 4W4OC 4J8RB 3MLVH 1PYWA 2FGZA 2ZPKL 5C6TL 3VXOB 4NNYB 43C9A 4P23C 2B3RA 5I15H 1U95A 3N50A 3U6RB 1KN2H 1I1RA 5GGRB 1D6VL 3FUDA 4UM9D 5DZVA 2Y7NA 2I27N 3U2SA 1TTFA 2ROYA 3HG5A 3LIUA 4DPCX 1KENH 3ATAA 2C3HA 4F37F 1XH2A 3BD4A 3ILQC 4F37K 2ATAA 3AU1B 2GY5A 3BUQA 1MI5A 1QFUL 1BQUA 1ZLSL 3BWZA 1ZTXL 4P23A 2OI9C 1PLAA 1KIPB 3RRQA 1JZ4A 1IGYA 3G6JF 2ZT9C 3QUXA 3GSOA 3C60A 2ATKA 4YVUA 3RWJB 4AZ8B 2WC7A 4YBQD 1ZS8B 3TJHC 1GGIL 2WBJA 3M8OL 3S8FB 4HCRL 4POYA 2LAAA 2YA0A 2Y36L 1I8IB 3MRIA 4PJEE 1XL4A 5FF6B 3MJ7A 4JKLA 4X42A 3EGDA 4JL2A 4QRBA 3SY6A 5IMOA 2BSRA 2X4QA 1MWAB 2JK5B 2VDML 3G5VA 1NCBL 2BO0A 3MLUH 3WFDL 4AL8H 4WHTA 2A74B 5E8DH 3MNMA 4JREB 3LNFA 1BQKA 3RI5F 4R7VA 4EI6A 3REWB 2PETA 2DQDH 2ITCA 2VCOA 1VAHA 3QUZC 4G8FB 4GEIA 5ADPL 3MV9A 3ZPDA 3NSYA 4W68A 4HBCH 3PJNA 2XQYK 1OP5H 1QLEB 3VXTA 5EOQH 1S7VA 5L4FA 2HRPH 3RWDA 2CBMA 1HL8A 4ZMNA 3FTUA 3KJ4B 1YEHL 3R7RA 2P8PA 3G5YA 5J89A 2C1OB 3QNZA 1MG3C 4WTZA 1S8DB 2J8HA 2V5TA 3GS7A 5FB8B 1OE2A 5KW9H 4OZHB 4NI6A 2OR9H 3HPJB 3CVHA 3S34H 2H0PA 4G9FB 5TE4L 3MZTA 2APBA 5CEXA 2F19H 3BIKB 1S7XB 4XB3A 4YL4A 4WUUE 2J12B 4I18C 5EA0H 2Q76A 4AUYA 4IDJL 1MJ8L 2D0GA 5IVZB 1SJXA 2A4EA 4Y7OC 4BHUI 1XD1A 3X11A 4AE1A 1AC6A 5B1CA 4L5FH 2VGLM 2YD6A 1DQVA 2IGFH 1M2VB 1KLGB 1UC6A 3AMKA 4JE4B 4WJ5A 4J5VA 4ZTPH 2EYTA 1J1PH 1ZLUK 4OB5H 1IFHH 3OXSB 5A1AA 1BX2B 1T1WA 1YEDB 3GXIA 3O4LB 2AAVA 4HK0A 1J1OL 1WBYA 2ZNXA 1YDPA 3T0EA 3O6LL 2YBRB 3GMRB 3QNXB 1A3LL 1MRDL 5B8CC 4HCFA 5B3JF 5DK3A 4ADIA 3EGXA 3IFOB 5E9AA 3WY3A 4P4RB 4PJ9B 3GEWB 3KYOA 3NA9L 4MWFB 4JFSA 5F9JB 3QUMA 4NP9A 4WEMB 2I26N 4HZLA 1Q8MA 1GGCL 2BHYA 5DRXB 3D3VD 1DUYA 4B0MM 4ILDA 2AVFA 4R0LA 3WNIA 5JPNB 2KZ1B 3Q3GB 5JYMA 1KBBA 3BX7C 5D2LF 1P7HL 3QXAA 3L3OC 3B8YA 2FIKB 2XLLA 4GRLD 2XU9A 5EZLA 2C9AA 3UDWC 5I1HH 3FHAA 2H1LM 5IGXH 2R1XB 4N9GB 4QRTA 3EHBD 4KH9A 4QR7A 3RIAF 3FU0A 5D72H 5JHMA 3N04A 3UYRH 3MV01 4IRJB 3PV6B 2V2XB 3T71A 3HZMA 3V4LA 1DL7H 5GIRA 4FC3E 2RFXB 1XHHA 3C6EA 5E1AA 1TVDA 1XR9B 4CDHA 4QF1A 2FLMA 1A1NB 1N2RA 1JGEA 3ZGHA 2D4DA 4L4VA 5CBAA 1JGDB 2VJ0A 3OV6A 1JJUA 4HCIA 3TONA 3BZ4B 4BWWA 1JZHA 1TR7A 1QBLL 5DUBB 4MA1C 4PTUA 4N2IA 2A4ZA 2AJ3B 1ZVNA 1FNSH 4E36A 2EDHA 4N5ED 9CGTA 4JVPA 1OW0A 3X3FL 2OR9L 4PJHA 3SO5A 3FNKA 4Z7NF 5C6TH 2P47B 1IC0A 1SN2A 2XI9A 1OZTG 1ODAA 2FO1A 4H20L 5DJ2B 4UTBH 1BVLA 1RUPH 3M1BB 3RAJH 1T0PB 1SLWA 3OHXA 3V7AE 3VXRA 3T0VA 2QADC 5C0AB 2QVTA 5EO9A 3APDA 1IB5A 2AJVL 4UQ3B 3R06A 1A4KB 3RIFF 5IEKA 2VQTA 1E6OH 1ETJA 4IEFB 5DD6B 2X70A 3GSRB 1BREA 3QFGA 5D70H 4KJPC 2P52A 5I16B 1JZ8A 1UJ3A 3Q8EA 1WE5A 5E9DE 5F9OH 5GHWL 4Z78A 4XB8A 4NN7B 4IBQA 1FH5H 3AM8C 1QD0A 3DX0A 4IMKC 2BY2A 4X8JB 1NUFA 4X5RA 3RBGA 2DQIL 5CJXA 4N0UA 5C6PB 5I24A 5EF3A 1Q0YH 4FXKB 3QCVL 2W94A 1DJIA 4XBGB 3K4DA 3CUPA 2J5LB 3MNZB 3FZUC 4NKIL 3MV11 3CFEA 3ELQA 4DTGL 5SWZD 1MUJB 2YXMA 4TKWA 4Z7UA 3UMTA 4JFZL 3ARXA 1S7RA 3SDYL 4B7LA 2JELH 5BXFB 5IEKB 1EVTC 2X5PA 3HE6A 4PS4L 3DV6A 3UTSA 1XH3A 5J6GA 5D2NB 1TDQA 1LK2A 5B21A 5DJ8A 4YXKL 3M1CA 4OCYL 5I8OH 4LDEB 1LGVA 3V0VA 2G3NA 4P9MH 4YLBA 1U4FA 2WXGA 4LCWB 1K8DA 1N3NB 2C9SA 4AC2A 2H3XC 4JKNA 4D8PB 4ACTA 2ED7A 1ET8A 2AMUA 2BP8A 4UYPA 2FZ3B 3EF7A 1ONQB 2H2PD 4JL1A 4L3EB 1T0NA 4JKWA 4CU8A 1E4XL 4J3UA 5DJZA 5IJKC 1S9XA 5AW3B 3QXDB 1NBQA 2RQ8A 2XQBH 1E9OA 4PP2B 4OU3A 4YE4H 1A7OH 4NUMA 3X1EA 1KCUH 2DWXA 4WFHE 5GS1C 1NLBH 4U1JA 1ECYA 7FABH 5DJAA 3QORC 3VE0A 1IGYB 3I74A 4KTGA 1JGEB 3R1GH 5J06A 1HESA 4NQXB 1J05A 2WB1A 3HI1B 3LKSA 3MRCA 1Z1WA 1KDIA 4MCYB 1IM9D 3JV4B 4OFIA 2NUTA 4AW4A 5D1XC 4FFYL 4JE0A 4QRUA 3VXUB 2NY3D 2Z7ZA 4AL8C 2PR4L 3BEWA 3CHSA 4OGAD 2J8UB 1KCBA 4N26A 3EH1A 5TFSH 1ZAGA 1DLFL 2BY1A 1SXZA 2OMTB 3U7AA 5DZ9A 2XYBA 1Z9PA 1BQLL 2A6IA 2F8VA 2JCCF 4QRPD 3TO4A 5HHOB 4DK6A 1EDQA 1RURL 2QR0A 3EOYG 1H8OA 2XZZA 3I6GA 4TSBL 3GT6A 4RGOL 5F3BA 1BEYH 4OV5B 1LO0H 5C0NC 4IMLB 4D0CA 1J7VR 2G0KA 3HVNA 3Q5TA 5AVUB 5GS3A 3F58H 4LIQL 3MRKB 4N9OB 1RSYA 1AO7D 2A74C 2QPEB 3F64A 4DQOL 2QTVA 3TBVA 4EBQL 2G3MA 2LLLA 4HULB 1JNJA 2A9CA 2DQCL 3NCBB 2A1WL 3DSNB 4EQ3A 5JIPA 4ONOA 4DKDC 5E9DB 1GW6A 4WJ5B 2AQTA 4R5XA 4LOFA 5LDUA 4AXWA 1IL1B 2EECA 3HE7D 2X53A 1QKZH 3CZEA 4NJ9H 4MAZA 4NQCE 2DLFL 1XF5A 2J44A 4UT7L 4Q56A 2IAMA 1CFSA 3G08B 3FOLB 5C92A 1IGIH 2NT0A 2HN7B 2AEOA 1S9VB 1QZ1A 4B7IA 4HOZA 3V6ZA 4R4BB 4UQ2A 1RU9L 2MOQA 5I8CB 4FKHA 2GEEA 3CU7A 1VFMA 3BGFB 2ADFL 3QUML 5E5LA 4XP9H 4ZUVB 2R59A 2OTPA 3C6SB 4K8RH 1JWMB 1KENL 4M00A 4XVSL 3PWVA 4X98A 4HF5H 3S9DB 3FT2B 2EEFA 3ARDD 4KKCD 4YBLB 4BE5A 3KLQA 2BH0A 2NPLX 4WKXA 3LMJL 4XTRD 2NTFA 4TRPH 5SWSA 3U48A 4JFEA 4KK9D 1JGVL 3QCTL 1GJWA 1QTYT 1YECL 2BDNL 1IFRA 4LPCA 4OLWH 3V6FA 3VX0A 1AZBA 1GCFA 4WI9A 4XBEH 1YY9D 4GP8B 5CGMA 25C8H 4W6WB 3O9WA 3P0YL 3DIVA 1I85A 2L7UA 3KPOA 2WBJB 4L4TA 3WCYA 1X5MA 1FZKA 4NFDA 3CSYA 1UWXH 4GW5B 5CWSB 1HH9A 1U9KA 4LBAA 4EMZA 3TESA 1UZ8A 4PBDA 4Y16C 2IH9A 1NCNA 3EYSH 3UMNA 1HWGB 5EBLB 1TYEB 2DKSA 2ADGA 2YC1A 3NIDE 3AG2B 2XJKA 4FZ8L 4F20A 4KJYB 4Y5XB 2DQDL 4G43A 1OAXH 1U8OA 4WSGA 2VITA 5JW3H 2WUCL 1SJVA 3PXLA 4Z7QF 5AVZB 3AREA 2IG2H 1KB5B 4DEWA 3AFLA 3LNIA 1ZGLP 4GSUA 1AHWB 4WNJA 1FORL 5IBUG 1KJ2A 4KTYA 5IF0B 2I07B 4ZJ9A 3UG4A 3TBVB 3KCPB 4ONHB 1AIFA 2D03L 2G75A 2X1QA 4OCXL 4Z5RB 3TVMC 1P5VA 2RAMA 1I3VA 5LGKA 3NIGB 3QUZB 1GGYA 2JJTA 5CGYD 2W0FB 3NCYS 4J7RA 3W1ZA 5DMYA 1KGYE 3DGDA 3QXAB 2VLRA 1KYUA 3T2LA 1G7LA 3SYAA 1ORQA 2NRDA 4RBPK 3WHE0 2VXVH 1A9EA 4MMZC 3BUYB 3VA6A 1TQBB 2VL5B 1RULH 4OZFH 5EOTA 5AVVB 1V10A 3RUGF 4Q6IC 1CC3A 1N5AB 3VW3L 4YAQA 4NRYA 1KELL 4H40A 4N3TA 5EU6A 1IZJA 4RIRA 1QEXA 1ZEAL 5CJ8A 1KZYA 2G5UA 2JXMA 3ZE0B 4I7ZC 1LO5A 4QD2E 5J56B 5IJKA 2WP3O 1L9TA 1UACL 3P30H 4UM9A 2IPUK 2E0PA 5B1AB 3GQFA 2C9VA 3IDGA 4ATWA 3EG9A 2WMPB 2OYLA 3VYNA 4PJ5E 4XO5A 1N64L 4UZSA 3QARA 4NQDD 4EBQH 5J3HC 1DLFH 2JKXA 2Q2EB 2NXZB 2WOBA 4HK0B 1E9OB 1DEEB 1SOXA 4YNYA 4K15A 2BOBB 2B4CC 2MWCA 4PWJA 5E9DD 3AWGA 3FT4B 1OTUC 3ZE1F 3VE0B 1V3JA 5FO7B 3CPUA 4TSBH 2VXUL 1OOWA 5KVEH 3MLZH 3QZBA 2V2TB 3DSFH 4BK8A 4OF8A 3FU7A 1DDHB 2X88A 1CYXA 1CGVA 1X9LA 2ZZUT 5EBMA 5ALCL 4JRYA 2AJXH 3CZUB 2CE6A 2XZQL 3BLBA 4MD0A 4JDEB 4UI2A 5DHYA 3D0AA 2GY7B 1A4CA 3GO1L 3GJFH 3NESA 3T2OA 2AKRB 4MS8C 4X6DB 1QAWA 4A7GA 3QULA 3SDAC 4I2XB 5D5MA 5EBWA 1J10A 5GSRB 3CN2A 4MQTB 3PV7A 2X1XR 2A5UA 2FWUA 2CMRL 2OTUA 1SFHA 2MCMA 4ZMTA 1KNOA 3MLRL 3DBXA 4BSJA 1K8IA 4DKTA 2HVBA 2X1WL 4B9PA 5ICZB 3HB3C 1MF2L 4G3YL 2Y3NA 5FYKL 5ISZD 4ZK8A 3EHBB 2EC9U 5FA4B 3EOTL 3B7TA 3NZHL 2OSLA 4YO0A 4Z7OF 4HU2A 2MOVA 4HETA 2DQUH 4MGXA 4M43H 1FC1A 3LEVL 5EFIA 4AKOA 4J3VA 4QY8B 4RFOH 1QUNB 4HG4J 5D4IA 5CS7A 2Y9RT 3DO4A 1PD1A 3LN5A 4Y4FC 3MOBL 1SMDA 4AEIH 5D5ME 3VUAA 5DD3H 3VACA 1B3IA 3SPGA 4Q89A 3CQQA 5IQMA 4XB7A 4RVBA 1A6UL 1G6RH 4MKMA 2OZ4L 1IJ9A 4YHKL 4UQ3A 3KPRE 1S5IH 3BEVA 4EOWH 2VDPB 1NIFA 1NGWB 1M3JA 4RH4A 3SCMA 1CK0L 2FB4H 1CCZA 3CDFA 4U6XA 3EO0B 5FGCB 2OJZH 3ZDZF 5DRXA 5EO1B 1A1OA 3TA3D 3K5RA 1YNTA 4CN4A 3O0RH 3PDDA 2YD9A 1KACB 2B2XL 1OB1B 1RUQH 4KAQL 2WHVA 4WGKA 2EZ0C 3V5KA 4Y5XA 3PAZA 1A6WH 1YO4A 2EADA 3M17A 3EYSL 5CILL 4JFQA 3S37X 5LLIC 4OF3A 1CZ8L 2BRQA 1D5MB 3MRGB 4WY7L 3L6FB 2YBGA 5LCVH 4PM1A 4U1GB 3IDMA 4N2OA 1HL5A 1OPOA 3CNKA 1Y07A 5CP7B 1PW3A 2VDPL 3CWGA 1AIFB 2G75B 3I3EA 3VH8G 1SXBA 3O9WB 1G7MB 2ARJB 3TBTA 2HAZA 3HNVL 5T1LD 1MJUL 1BG1A 4OFPA 1LYQA 1UWFA 3I50L 5AB2A 3WD5L 4U6YB 1NAMA 4AEFA 4DH2A 5L88H 2NNRA 4KV5E 4CVZA 1V7MH 2ITDA 2JQMA 1YN7A 3RPIA 1EK3A 1BF8A 1NDGB 1WUZA 3HUJA 3V10A 3QC6X 3T0EB 3MV7B 4MX7B 3DPDA 3QDGD 3S4SG 1KXTB 4Z7OB 1Z32X 2NY5L 1I1FB 3F65A 3RAJL 5D9SA 4N2CA 3VXQB 5LAXA 3AQYA 3NZHH 3UAJC 3V55A 3D2UB 1B0RA 4GI9A 3ESOA 4LHUB 2XT1B 1C5DB 1L6PA 4L4TB 1T20B 4KRPB 1NLDH 2WCPA 3BPOB 5BS0D 4BFIA 5IB5B 4Y4FB 4CC1A 1NBYA 1S4IA 3T4AA 4X6EB 5HVGB 1UADC 5IZ7A 3D85A 5F9OL 4W1TA 3DROA 4FMKA 5EU4A 1H6TA 3RFRA 1WICA 4CVZB 4MQXC 5B3JE 4H5SB 4QJ3B 5HGBB 4NQEB 5HGAB 1JPSH 5C70A 2E3VA 4NERA 4Y88A 5HDBE 1CDUA 3ARGA 4F2MA 1HKFA 3CFCH 1UH3A 3SQBB 1YC7A 4JVUA 3BP7B 3BAJA 4TVPD 2OA9A 2N56A 3WEXA 5DR5L 2J88L 3UP6A 4ZMPA 4DVBA 2GAZA 1MCHA 3QDJD 1NGXA 1F6AB 2VXUH 1TZOA 5KSBE 4XP1H 5ILTH 4WUKL 1D7BA 4L37A 4XNUH 3K71A 4MNHB 4F2FA 5DI8A 4WK0B 4DCQB 3GLEA 4P9HH 2DYPB 4JFXA 1LEIA 4JJOA 1DVFA 1AI1H 1FO0B 3QZWB 2FX8L 3RZCB 3M6DA 3ULUL 2IDUA 4QXUH 1S9YA 4IRSB 3FSAA 4XCYB 5CLYA 3HN8A 1D7FA 4FJZA 1T1XB 2TRYA 3JWDC 3GIZL 3BRGC 4GEJA 5EO0B 1GW0A 1RPUA 2P43B 3VXMB 3DX6A 2F7QA 3OB0H 4BA0A 2EDXA 3H4HA 3AUWB 4PGBB 4B9GA 1F4WH 1P84J 4C57C 4AUUA 4PJHF 2LHAA 2P1YA 2N1KA 4XCEA 1TOXA 4OJCA 3TS8A 1I7RB 1C16B 4LCCC 2R27A 4I5BA 2FO4A 3VGEA 4X80L 1O9VA 3VI3A 1TU2B 2ODIA 1NCOA 1DBMH 1HDMA 2G9HB 3ZLQC 1KCLA 3NEXA 2DMBA 4PIRF 3PP3K 5GGTH 1JV2B 1OK0A 1S78D 1CFNA 4QO1B 3T4YB 5BQ7B 5DSCB 5KYWB 1OARL 1X5GA 2DL2A 5IESH 2QQLL 4Z76B 2PTUA 1Q72H 4RSVA 1NMAH 1CBJA 4Y2DB 5L7XL 2Z8VC 4FMFA 4GY4A 3VRIB 5AB9A 1U8LA 2FWSA 3TEZA 5FM4A 5GRWA 3SE8H 1CXLA 4IYKA 3MI6A 2C34A 4HJTA 1OTSD 3OX8B 1ORSB 1PG7X 1E4HA 1E3XA 3PAUA 3MRRA 3WNNA 4RWYL 4D3CH 1V3KA 2NW2A 1S7QA 3HNTL 1GY1A 4JFFE 1H6FA 5HD8C 3ZE1B 1FGVL 4QLWA 5EUKA 3EUUA 3MGOB 1F58H 4NNPH 1JPGB 3RWEA 5JIDA 2C4XA 3B1UA 4KJQD 1XO8A 1Q90A 3D9AH 1PS3A 4M1CD 2F74B 3CFKB 1URIA 2BVTA 2UWEB 4PJCE 3P40A 4OFVA 1JYWA 1U93A 4I2XE 5BS0B 4YHPA 5JR1H 1XGRA 3QDHA 5DFWH 3T8XB 3KM1A 4KK9C 4KVCL 4FZEL 3C6LC 5H4ZA 3UTTA 4WWKA 5C0GB 3VFWA 4E42A 3L5XL 4GRLA 2NQCA 4WFGE 3DVFA 5DMGD 3BWSA 3LIZL 4NNXA 3L3DA 4XCFH 3V0JA 3FUIA 2D2CC 5E6IB 3VD3A 5E1HB 2WLIB 1FNEA 1HOEA 2QFPA 4JPKH 5ICYA 5IB2B 3JV6B 5CLWA 1H3PL 2AXGA 3V4PH 4OFYD 1XF4B 3IJYA 1X9QA 5HYSA 2BIOA 3SDAD 2YWZA 4OBRA 1YQVH 2VDOL 4IDLA 5FO2A 3QEHB 4JX0A 5DHVH 4AJYV 3QULB 2R0LH 4NI3A 3V9FA 4ZUSA 1E2WA 1OTTD 1ZGLB 4LKXA 3T0AA 1FI8C 2UX6A 4F5CE 5LGHL 3D2UA 1LD9A 1YY9C 5E1QA 4PJXE 3HC0B 2WOYA 3MCKB 5EU6B 4HWBH 1RVFH 1OP9A 1IKFH 3FUHA 4I3RL 3FYIB 3LYRA 4S1DD 1PSKL 4A38A 2AJ3A 2AJUH 2DWDB 2O93L 1AXSB 1PZ5B 4G7QB 3GHEL 4HUXA 5E24E 3G6JB 4J4PC 3C60B 3GTVA 5JORB 5I76A 3MTRA 4G8EA 1P5UC 2AABL 1TETH 1HEZA 4LSVL 4FJYA 5IHHA 3DYMA 1NDGA 4JFED 4WUKH 3FW6A 3QORD 3A6BL 1UHVA 1G1KA 3CFDB 2FX7H 2NLJA 1UXLA 4KK5C 4UT6A 4WAFA 3RX5A 3MRJA 1IQWL 4Y4HC 1DVZA 4NRZA 3DGGB 4RQQB 4UTAL 3BW9B 4JRFA 3FO9A 3SDXF 5EEXA 2LW3A 5I74B 5AW4B 5E6ZA 35C8L 3ZSSA 4LVNC 4PB0H 2VRKA 2XXCB 3DTXB 1UOVA 4JG0L 1CGSL 4W6XB 4PRBA 3MRMA 4HUNB 4YBHA 2XHNA 4H1LA 4BFKA 2ZOOA 2FUTA 5DMIH 1ZT1A 4LLUA 3AXLB 4NZJA 2YRPA 4L9LC 1RHHA 3G5XB 5ESAB 2Q8AH 1BM3H 3ARFD 5DVLA 4OVVA 1YHPA 3ZR5A 4HLZG 4I4WB 4OT1L 2OMZB 2BXZA 3GWJA 1XT5A 1A47A 3UIZA 4L2YA 2IWFA 4QJ5B 5EORH 5CJ5A 2WXHA 2CJUH 2QDWA 1Z66A 3ZE2B 4GMSH 4WI4A 2EIKB 1T1YB 2BZCA 3ES6A 4RAUB 1I7RA 1ZLUH 3W0WE 4YHNB 3RFZB 2CO3A 4G7SB 1KYAA 4KZ0A 1J5OH 3LKPA 5I5RA 1T4KA 3BZFA 4OZHE 3S98A 3P3UA 4D0BA 3MRMB 3KLSA 2DYPA 3B6SB 3HA0A 3HNTH 5MERA 1LEIB 1G7JA 3FB5A 2RJMA 3FJTA 2M1KA 2IQAA 2R4RH 3IFLH 5LGHH 4KJYA 3T0XA 2FYYA 4WF7A 1HFUA 5AAWC 1IM9A 1JN6A 1GSMA 4DO5A 3VB9A 3IAQA 4NZTH 2IO5A 3S3DB 3UP1A 5BW7A 2ADIA 1WHPA 3ORJA 3C09C 4ZFGL 4LCYB 2VJXA 3FQ4A 4MYPA 4PJFE 3QNFA 3ESPA 1PX3A 4RAVB 3WS3A 4F7EB 1ETB1 3CC5B 1KFAL 2HFEA 2HJLA 3MA7B 3US9A 5KS9F 4Y5YB 3T09A 4JAMB 2CUAA 1R75A 2H41A 2OMVB 4IKJA 2DLEA 4NQDA 3SHSA 4XZ4A 5I76B 3V0IA 2YLHA 1VSCA 1DN2A 1FVCB 1NFAA 1F8TH 4PI2A 5CNHA 1UT2A 5CEZL 4QDGA 5EBWB 1GIGL 4JO2H 1VKXB 2JB5H 3UABA 2BSRB 2F5BH 5BV7C 3D7PA 1AO7A 2BS9A 3RZWA 5GS1B 1ZA3A 2IDSA 4KK8D 4TTDD 3G9AB 2HX8A 4TNWK 1N7MH 4X6DE 5CN1A 1O9WA 3RYMA 2VXTL 1O7DC 3ZDZE 1U8NA 1XQ4A 2ARWA 1PY0A 2QGEA 1K2DB 1S7VB 4QOKD 1G6VK 4OM0H 4QOKE 2H1XA 2XQBL 5A6IA 2H0JA 3HE7A 1BW8A 1QTSA 4I9WD 3SBQA 4G5ZL 5B38B 3L2MA 4U3HA 2WN2A 2E7BA 1FFNA 1NAMB 5IW6B 4HEMA 4I0PD 4QIRA 4JUSA 1KCVH 2XOTA 2LQRA 4WI5A 1IV8A 1EDYA 3ML9A 4F9PC 1OWRM 5F9AC 5GZOC 3A4FA 1QYGH 3VU1A 5JW4Q 1S3KH 2P44B 2W60A 1ACCA 2UY6B 3ARBB 3MRRB 3TTYA 1KEGL 5HDWA 1Z9OA 4NM4H 4ZO7A 5F0PB 1SMAA 3U1SL 3P3YA 2F53B 2A3TA 2JH2A 2W88A 1T6VN 1HSAA 3L1OL 4OM1L 5FOJA 1DVSA 3ATBA 3FN3A 3QO0B 4DNLA 5HHVL 1INEH 2W0PA 4XPFH 3X17A 1GCYA 3SKNA 1DBBH 5ITBH 2V9TA 3KHOA 1PSKH 2F74A 3CFKA 3HZVB 3T2NL 1CDYA 2CHWA 2WBXA 2GYSA 2X89D 4FQXD 4BA8A 4JPQA 4HXBH 1YNKL 1QMUA 2ZSWB 1KIUA 4NKDA 1G6RB 1EANA 1JRHL 1REIA 3LRMA 2V3EA 3PGFH 1EXHA 2K0RA 2D0FA 4PP2A 2VDRL 5T1LB 4HKXA 3RY6A 1OALA 1M1SA 1DN0A 3SKUD 4FQQA 3IMWA 3S97C 4WHDA 2ICWB 1IQWH 1NDMB 4B60A 1EJOL 1MJJB 5D1XD 1IFGA 2QZQA 5K33A 2UUDH 1JPTL 2W38A 2CDEB 3DHJA 3MRLA 2ETWA 5AW6B 1Z3RA 3CPLB 4GG8B 4FQ2H 1DJXA 5FA3B 1A2YA 3FCBA 5D2NA 3IJSB 4MNQE 2EIEA 3VFOA 4M93C 3ME0A 4EDXA 4U7KA 3V8CA 4RMBA 5C0RH 4RFEB 2PUQT 4POZD 4XP5H 3M86A 3P3TA 4Z7NB 4BH7A 1F6LL 1JPST 1S9WA 1A7OL 1AHKA 3INUL 3QZLA 5FGBC 5K69A 1SBSL 2VDRB 1QLEH 5F7BA 4L5FL 4FCAA 4P49A 5AOJA 3HZKB 5IB3B 3T0EC 5TGBA 4EZJA 3FOMB 3WNLA 1OTSC 3L1FA 4JHWL 4LDCA 5BOPA 1H8NA 4FQLL 5DMGC 4BDVA 2YOAA 2BW4A 1B9ZA 3FT1A 1AXTL 1QVOB 4HU8A 4PGCB 5I30H 3O41B 1CFTA 3HG1E 4DFHA 1ITCA 2BNRB 1UA6H 4N90E 2O6FA 4OF7A 3WKNA 3VMOA 3MACH 3CFNA 5ICYB 4YIQA 4NZDA 4Z0XB 4Y19B 3L3OA 3SE8L 3FTSA 3H9ZA 4GKZB 2K70A 2VR4A 1MNNA 1AS6A 3B7UX 2MPVA 4Z95H 1I53A 3VQ2C 1NCBH 2ADIB 4UDUA 3P77B 3BKMH 3ZBMA 5DS8A 4OF0A 2OMNA 1XWVA 1JYXA 2J1XA 2W65A 3BXNB 4KVNH 5KAQF 1OAUL 3PE9A 4KGLA 2GSIA 3IXTB 2HJFB 3S36X 4N2GA 5FGCE 3STZA 1LO3H 5DUJA 3S36H 2AI0H 4ZW3A 5EC1B 5ESQA 3QYNA 5C1MB 3AJ7A 3TA3C 1YEFL 1BQHB 4EN3A 5JMRA 1UOKA 4HUUA 5J9PA 3ULVH 4YEEA 1RZKL 4HLZH 1J0HA 2Y2YA 2YPVA 2VLLB 1GMIA 1KTKE 3QQDA 4G7VL 4CJ0A 3WJLC 4GQRA 1IM3B 2XKSA 2N0MA 3RIFK 3FO0L 32C2A 4F1ZA 5C0BD 4Y1SA 2VLRE 1SEBB 5EOCL 1JFHA 2PYFB 3IGFA 1PIFA 3KCWA 2VAAB 3PWPA 2Q3AA 1UM4H 4H0LC 2GKIA 1RXLA 5AVRB 1J5IA 2N7AA 1HILB 1PAZA 3BN3B 4JPKL 5ANME 1WFNA 1F4YH 5F88B 5KBNC 3RVXC 2QPUA 4CA4A 3OR6B 1TCMA 3FPXA 4LARL 3APNA 4YPGB 1FFNB 4Y5VB 5IW6A 1R9FA 2DDQL 3J07A 1HE7A 3JTTB 5I26A 5CWSA 3X14B 1GHFH 4L8SC 1EZLA 5KBKA 1HQ4B 5AB0A 2VLMD 3WNJA 1OHZA 1KT2B 2ZOWA 3FFCD 3QP3A 2LU4A 1GOFA 4TN9A 5AYUH 1ZMYA 1R5VB 3QVAA 1L9MA 1DDTA 5TDOA 2OMZA 2EVHA 3N06B 4KUCD 3UDWA 3W11D 4F33A 1JI1A 1E9PA 4MJ4A 4D94A 3JV4A 4HSCX 3MU3A 3G5ZB 5IJVB 3BESR 2F58L 2ROXA 5HJDA 5LGJB 4F27A 1MLBA 2P8MB 1YA5A 3HS0C 1PDKB 3G6JA 1XGZA 1JV5B 3L3GB 4TUOB 3NSDA 4DT2A 3FQYA 4ZW5A 2JVUA 4RMRA 3ALPA 2EXSA 3D3VA 2O72A 4P5MB 3VGDA 5C07A 5I5MA 5JDSB 4KY1H 5T5NG 2TRHA 3UO8B 4AEEA 5JQ6L 3MYZA 5KBLA 2FSEA 3VU2A 2YRZA 2HX7A 3S2AA 2QLYA 5LWYH 3PDGA 3FUJA 5CIPH 4APQD 1JF6A 2GTQA 5DDHA 3QUYA 3H9YA 4HOMA 1DSWA 3V5DB 2ZUTA 3WHXB 2YEVB 2Y07H 4GG6E 1GZQA 1D6EB 1TQWA 2CMRH 4NRXA 1LE9B 3W11C 1OP3K 2ADYA 2ESVD 3TZVC 2P80D 4IS6A 4LF3A 3OHXC 4QRRE 3O8XD 4HJIA 5LBSA 1MELA 3U0TA 1I75A 2EDKA 3AREC 3CVCA 2VN3A 4U05A 3VM5A 5MEQB 1L9QA 4HUMB 4ZMXA 3SKMA 3EGDB 1RZ7H 1XBDA 2VR3A 3IK2A 3N55A 2GJZB 5SX5K 4UNVA 1T2QL 1YMHA 3K80A 5KVDH 2D7TH 5C0DA 1AFVH 3GXMA 4HH9B 3MUHL 3WE1A 2A6DB 2VDNH 1BGXL 3AZUA 1ULVA 1UM4L 2BVEA 1CGWA 1I1YB 1TVHA 3TFKC 2AJYH 1NDTA 3T4AC 3BDYL 5L2KD 3WKQA 4HHAA 1QW8A 5FO7A 1JTTA 4X0NA 2EXYD 3N41F 3U6XA 1CFSB 2WZ5A 4LEOB 3HR5B 3DMMA 2OYPA 3VFTB 2BVQA 3NIGE 1QSFA 1UJ3B 1BZ9A 3OJ2C 4N6QA 4L23A 4NZRH 3GI9H 1XR8A 3GBMH 2R2EA 1DCLA 4PW9A 2CDEA 3DO7B 4HBQA 3D30A 1KXVA 3SYCA 2BNRA 4FL4B 4OSUH 2NNAA 3NH7L 4LVOC 4LNRA 4LSQH 2VT0A 4LGSB 1R3IL 1A65A 1TZAA 2EZ0D 2QVFB 3T65B 4PLKC 4GQZA 4LOVA 4AVIA 4PGEA 1CD0A 4JB9L 1R3KA 2EIJB 3U83A 2CZNA 1XTLA 4CSTA 1UCBL 3BZ4A 3TYGH 5TDOB 2F58H 1Q94A 2LVEA 3HB3D 5ITFA 1YJDL 1UYWH 1UD3A 3KXFD 3SDYH 4L29A 2DQCH 5CP3H 2XWCA 5HJBA 1AGCB 1G94A 3MREA 5D6DA 4N8VG 3N44B 3SDXA 1EH9A 3UZEA 3MLUL 1CUOA 4AL8L 1M9SA 3PWLB 5IB1A 2PTTB 4P9ML 1CLOL 5GZNA 1FFPA 3WLBB 1HH6A 2H9GA 3S7GA 3D50A 1KWKA 2EIZB 3KBPA 4XT1C 4AOFA 5A6LA 3D4GA 4YHIB 1NGQH 1MCKA 4P48A 5HBBA 4HBCL 2J6EL 4NP4H 3KMDA 4PG2C 3KPLB 2TSAA 1BEXA 5F1NB 2WKGA 3OKOA 4F91B 1S46A 1SEBA 4N1CA 4HLEA 2QPSA 5HDBB 3C8HA 4XHQA 1QPPA 4MB3A 5BRZB 4YPJA 4I1PA 5IOPB 3UTZA 3ZUCA 2UXGA 2G0LA 3PREA 3WFCL 3MREB 1SJHB 5KS9E 3MBEC 4ZAKC 3UYPA 1NCCL 2XIIA 8FABB 1K4DB 5A2JH 5J0BA 5J5EA 1AGEA 1MVFA 3CAFA 3UTSE 1D6VH 4A37A 5ACLA 4QWWC 2R56L 3JXAA 3DK2A 1SVBA 3QCTH 2NSQA 1G7PA 4U1SA 4MCMA 4HPHA 2A6DA 4XN9A 2DBJA 2ZYSA 3DETD 5FLVA 1M57B 4PY7A 1NCWH 4PB9H 5ID1A 4ZXBD 4AVKA 1MCPL 2W07A 3O4LE 1CLCA 4JO3H 3KPRB 2W9EL 4L8SA 2XTLA 2R2EB 2ZP8A 3RWDB 2MQGA 5IHZB 2F1BA 3WY1A 2X6AA 2BVOA 4M5ZH 4I2XA 5D5MB 5GJSL 1YNKH 1BIIA 5EOQL 2IQ9H 2PWDA 2FT7A 4FHKA 5D8JL 2XXFA 3PG2A 3FBKA 3O41A 3P9MB 3TVMA 1E6JL 1ZHKA 2VXQL 1BPVA 3QZPA 1M7IA 4HXAH 3RTQB 2PPDA 5IJCC 3EO9H 2DJSA 2NX5B 4J3WA 4HS8H 2JE8A 1ZA3B 3V4VH 2JB5L 4NWTL 2MCPH 1NCDL 1F1GA 2P5WB 2VNCA 4N2MA 5B1KA 5C0CD 5ID0B 1QWNA 2D9CA 1PGRB 4JDTH 1Z0NA 1MCJA 1XGYL 2AZAA 2NZIA 3TPUB 4ELMF 3LKPB 2VN4A 3TXAA 2YQ2A 2WN3A 3K74B 3R0NA 5DJCA 3IGLA 1U8CA 3BZ5A 4JHVA 1MCFA 4DEUA 1FYTA 1JTOA 2B9AA 1CPUA 3Q2VA 3U9UA 2DMGA 5K93A 4YK4B 5HHMD 2ZG2A 3TBTB 3LEYL 5I5IA 5JQHC 3NSJA 3GMQB 1QRKA 4IIQA 4ODSH 3WNKA 4PJBA 5KW9L 3D3VB 5FUCE 4I0PC 1THCA 4PV8A 3W9EB 1TJXA 3GSOB 1B0RB 3OC8A 3QRGL 3TEUA 2BP0A 5KVMC 1QSFE 2KPWA 3UTPE 1J1OH 2CAKA 4G11A 1O5DT 3Q6FB 5F7YC 4BSVB 3DV4A 4U1IB 3UBXI 5CCGE 2VERN 2DLHA 1FVDB 5FGBA 4AQ8C 2G2RB 4XH2A 3GI9L 4OW6A 4U1GC 1A14L 4I0PA 1CQKA 3LQZA 2WVVB 2CHZA 5E6UB 3UYOD 3LZQA 1W6LA 5DTFB 4M8UA 4QYOB 3GI8L 4L3CA 2DBLL 2A6KA 3QG7H 4IK7A 3S4SB 1EFXA 1UT1A 2E7HA 1NPJA 1Q1JL 2B15A 4J1UA 4JZOA 5IB4B 5MEOB 1O0VA 3KLAA 4NKOA 2DM7A 1MWAH 1LWRA 1IBGH 3MQIA 5IV2A 1PMYA 3VXMA 4MB1A 4YFEA 4CKVX 1URZA 2D3JA 3VXOA 5M7QA 4UOW0 4XODA 5JPNA 5DZPA 5KUKA 1H5BA 1C1EL 5L6YL 2GK0B 5IOKA 4KITB 4LFHG 1FNLA 4FZEH 4BFEA 4P04A 4HIHA 1DVTA 4JR9L 2CNYA 5JORA 4FQIH 1W8NA 5AW7B 1AC0A 1TYJA 4V33A 4IKNA 3CH1B 3IWVA 3W2DL 2J5WA 1WBYB 3C5JB 3IETB 3AUVA 4BUQA 1I3RB 3K4AA 3PPSA 2DWTA 1HHIA 2QV2A 4GH7B 2EE2A 3RIKA 5TK2A 5D1XA 2YQGA 3WV0A 2JB6B 1QWUA 3NN8A 4AYBA 5F7EH 1SBBA 1A4AA 1FL3A 1AD9A 1N67A 4NGHL 4WHYG 3T8VA 2ICEB 2Q3XA 4K3JL 4MJ6B 4QHUB 4G8FA 4YSQA 2Y7QA 2CXGA 3VMPA 3C6LD 3BT0A 1RZPA 1QBLH 1XZ0B 2R0LL 1WFMA 4UWQB 4KHXH 5HJ3A 4LAQH 1HT6A 4CNIA 2Q8BH 4X4KA 4OZGB 2Y1VA 1HSBA 4DGVL 1TLKA 3MN8A 2WVTA 1FCGA 2XNAA 4NO0A 2BNQE 3K2KA 1I8MA 2XIDA 3G5YB 1L7IH 4R2GD 1QLRA 4TNVK 3F12B 5H37G 1G7IB 3NVQA 4L0PB 4LCCB 3HE7C 2VDNB 4GS7C 1NCAH 1AKJA 4YHPB 1U30A 5CINL 4M03A 3S37H 4O58H 3V95A 3PJSA 4U0QB 3OMIB 5JW5A 1C08B 1OAKL 2Z8WC 2AJSH 3FUFA 1E6JH 3M8OH 4LZKA 3CCHA 5D1XE 3VXSE 1CMOA 5LAXB 2NQ3A 3OAYH 4X0KB 5E0QA 1BV8A 2OJEA 1DFBH 4ISVA 2BOCA 3UX9B 2E76C 3K6FA 1U92B 4Z0BH 3S5LB 4TVPE 5KYNA 2FT8A 4OLVL 3G5ZA 4YQXL 2YD2A 4QTHA 3ZL1A 1NPNA 1HCZA 1T0MA 2J73A 1FNEB 1WDAA 2AJXL 1S7TA 1MFEL 1NM9A 1QABA 1TJHL 3GMNA 4PRPD 5HPOA 1JDCA 1ZT7B 4UTAH 1RZIA 2E8ZA 5DJ0B 1JPEA 4AGNA 3NGBB 3DI2B 1MWAA 2JK5A 2X4QB 3FQRA 2R8SH 1SVCP 3Q2LA 4JG0H 4NPKA 4JZOB 4LIQH 2GUOB 5FCSH 4JQVC 3ULVL 2ZTBA 2VMEA 2J6EA 5TE7L 3F01A 2A9ML 3UJIL 2GCYB 5C2BL 5K1JA 1IKOP 2V7HA 3P0GB 5G4NA 2G60H 3JWDH 5D1QD 5DGRA 4XWGH 1ERNA 5C09B 2OLDA 1NBZB 2BIQA 3MC0A 1CFNB 4QO1A 5KYWA 2ED8A 5IEHB 3U4BH 2XTJE 2XKUA 1T0NB 2GHWB 2GJ6A 4EVNB 3WBDA 1FDLL 1VFAA 2CNZA 2HKFH 5FR3A 2EXWC 4OJYA 2X6CA 4U4BA 3KGSA 3DJ9A 2CLZB 3HG1A 2HFGH 3MTXA 3WIHL 4HFUH 2DDQH 5FW8A 2VDOH 5HSFA 3CFDA 1MHEB 2OX5B 5IBLC 2NW3A 2CRYA 1BXAA 5AW8B 2HH0L 1G6RL 2QPFA 4X6CE 1QLFB 2I5YL 4D9LH 4PAZA 1A3ZA 5E1IA 1B2YA 4H8HA 2EVJA 1LDSA 2Q2LA 3WMPA 4Z3HA 3V52L 2E5EA 3STZB 4FFYH 3VFVA 4IIQC 3GM8A 3CDCA 3QJZA 4ZX4A 3UGEA 4MMZB 4X7TB 3WN5B 4W70A 4GO9A 3J8F7 3P54A 3VI3B 2MRYA 1R17A 3X1BA 4K5PA 4YUEH 4S11A 5K39A 3NZ8A 4NQCD 1CLYL 3BPOC 3CFCL 1PZUB 3W0WD 2NLJB 4Y4KD 1B2WL 4L4TD 4YDIL 4JRXB 2G4EA 1Y18A 1QR4A 3FT0A 4I48A 4Y9FA 4UQEA 5B7MA 4BFOA 1ZV9A 4JDVB 4PRHA 3FH7A 1EBPA 1RURH 4KRLB 3H7BB 5CJBA 4ZUWA 3IFOA 5JW4R 1NFIB 4WVRA 3QIWB 4KY1L 3FCUB 3CVHL 3MKGA 1IBGL 2JFCA 4JFDE 1N19A 1NIAA 4NN6B 3P9WB 1AMXA 4NBYB 4UOQA 1D6EA 3O3DB 3IFNL 2VL4A 4LSTH 2HRPL 4POUB 2J1WA 4JANB 2R8SL 3GSUB 3QNZB 3F05A 4KO9A 1AYRA 4FOMA 5JW3L 2EC9T 3G04A 3PUCA 1IGJA 1E50A 3UAEA 1BQSA 1FJ1A 3TWCH 2JJVA 3FFCE 3Q6GL 2A83A 2ZKHH 4PLKD 3LN4B 4U1KB 3V4PB 1CTOA 1F4HA 4PJ7F 5FM5M 1FHGA 1QKZL 4ODWB 5FO9B 3QUYD 2PW1A 3I9GL 4UINH 5FYJD 5DZLA 1HQRA 4MA8L 2Z4QA 4A66A 3O8XA 1PU0A 5HJ3B 2IADB 1FAKT 2E9JA 1XCWA 3WS3B 4F7EA 4UUJA 2E75C 3CZFB 4P5KB 1RUPL 4Q8BA 4PN6A 3ZHFA 1WFTA 4WUUA 1AQHA 4PSPA 3BHBA 2XC8A 4DESA 3APMA 3T3ME 3MNWB 3UJTL 4WSJA 3HMWL 4X4ZA 5FOBB 3CLWA 4TVPH 3R18A 1WTGT 3O2DL 1RUML 3EBAA 4Z0BL 3JZYA 3MBEA 5MEOA 3CN3A 2XWRA 5E2UH 2IFGA 3F6IA 3C5JA 4LSPH 1MVUB 2JV6A 4E9RA 1HEHC 1KBVA 3EHBC 3JSSA 5MP6L 2OK0H 3DMMD 2QEJA 4GXFA 5AWNL 1J0YA 1E28A 2IGLA 2J1YA 3P4OA 2K1MA 1RIHH 4G72B 1NC2B 2J2ZA 2LVCA 3IRZA 1T3FB 4HXBL 4BH8B 3VG0H 4LP4A 3HCVB 4N5EC 4XVOA 1CT8B 4G8IA 1EAPB 3KYNB 4NQSB 5G2NA 1EZVX 5E00B 5F0MB 5GGUB 3TJPA 3WNPA 4P46D 2EYRA 1IT9H 2W0FA 2XWJB 2EYTB 5CO1A 5BCAA 4OZFG 3MRPB 1ZLEA 3X13B 3L54A 1AHMA 2J25A 5INCA 4WWNA 1CICD 4HJSA 1SFDA 3ZT7A 3NFNA 4KVPA 2CBQA 1KJ2B 1NWPA 4PJEA 4ZXBC 1F02I 3FFDA 4U6VH 5CCKH 3MV8B 4S1QL 1GYAA 3T77B 4JN1H 4TV3A 2V17L 4A2LA 4FFTA 1XGPB 5FWRA 4B0MB 2HJFA 1T3FA 1T5KA 3GTTA 1MFMA 3BIAX 4RRPG 4NYLB 1JIBA 3BAXA 4H25A 4AENA 2HH0H 2OXGB 5FDWA 3OJDB 2CPUA 4B9FA 1HH9B 5FHAH 4LIQE 3S5YA 2NUPA 5BJTB 4G80A 5DT1L 4FXLA 4F9LA 1H0DA 1L0PA 2VN6A 3O4OB 4R4FL 3QCUH 1MREL 2XFXB 4IU2B 3SPIA 4AWJC 5H94B 3GMQA 3JYBA 1EMTL 3RWIA 3EO1A 4XGZA 3ZZQA 1BDYA 4LPUA 2V3FA 1WBZA 4P2CG 1Q0YL 4XPHH 2JKLA 1GYUA 5ES4B 1HQRB 3CU1A 5CM1A 1LP9F 3FTVA 3CK0L 1SDDA 5I28A 3IU4L 4NQDB 1AP2A 4B27A 3RNKA 1XFPA 1AXSA 1PZ5A 4HJUA 1QA9A 5KVEL 3I3DA 3VG9C 1NUDA 1PZCA 3HBGA 3T9WA 4N0UB 3ZZSA 1TPXC 4OJFH 2DI7A 4FEIA 3GS0A 2H45A 3G5WA 4XN5A 5IJDC 3OZKA 3I9IA 4YZFE 1JUFA 3DECA 2UZXB 1XB8A 5AWNH 2QGCA 2ZF8A 4KH2A 1W8EA 1QLRB 2JKWA 2ZYHA 1GAFL 1FSKB 3D0VA 3QC5X 3PQYA 5GGQL 1BVKB 4ZI8A 3FCSA 2QSTA 1LL1A 3FTWA 3H4FA 2BCMA 4A6YB 2Z64C 2B9BA 2O6EA 4XC1L 5BZDB 4MAUH 1TTRA 3RJQB 4TUKL 1VFOA 3APFA 3MCG1 2Y24A 3V79C 3HZ3A 4F57L 4IOFC 4EIBA 3ZHKA 4F3FB 2WMPA 4OCMC 2GEQA 5BO1L 4FFYA 4YDVB 2XVKA 2OM5A 3L4XA 4WTWA 5DRNA 1CFMA 3VGBA 1WAAE 2DTMH 3ZKMC 2X09A 1H3PH 3ZYJA 5HY9B 3Q9QA 4G6KL 4M48H 4PJGE 4IRZH 5CJOL 4P2QE 3P11L 1WCQA 2XG5A 3WJMA 1QRNA 4X8XA 1QFWH 2WAQA 4Y8DC 4IOIA 5KSVB 1FG9C 3OF6D 5I18L 1J12A 1MJUH 3HI1A 2ZJSH 3NAAL 3AACA 4FE9A 1XIWB 5HHPB 3U7YH 4CU7A 4FNLL 4Q9BA 1QSEB 1KOAA 3MLWL 4ODXA 1ZWIA 2XTSA 1N8ZB 3N85L 3L48A 5EO1A 3IMBA 4LLWB 4M62L 1WTLA 4QRRD 1WIOA 3RHWK 4I1RA 2OYKA 2NCMA 3ISWA 4PWKA 5E95B 3L4VA