1ZSHA

Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (ip6)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
392
structure length
354
Chain Sequence
TRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSSDVAVELPFTLMHPKDIVFEDFARQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonvisual arrestin oligomerization and cellular localization are regulated by inositol hexakisphosphate binding
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords Beta-arrestin 1
total genus 56
structure length 354
sequence length 392
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA01
5F0PB 3LH9A 4GEIA 4GEJA 4LL1A 5F0JB 5F0MB 4ZRGA 1ZSHA 2FAUA 2WTRA 3LHAA 1SUJA 4J2QA 4JQIA 4R7XA 1JSYA 3LH8A 2WTRB 4GFXA 1CF1A 3UGXA 3UGUA 4R7VA 5F0LB 4LL4A 4P2AA 3P2DA 2R51A 3GC3A 1G4MA 1G4RA 3GD1C 1AYRA
chains in the Genus database with same CATH superfamily
4XPAH 3W5MA 3I3EA 1IC4H 5HY9A 1AGBA 1CTNA 3GXNA 4HZAA 1E9QA 1EEQA 1I7RA 4PJ8D 3QR2A 2D31A 3PJSA 3Q1SH 1E65A 4OKVA 5JIHA 4X0NA 3SE8L 3ARBB 4FXGA 2FX7H 3Q2CA 1HAUA 1U30A 3OC5A 3T8VA 2VR3A 4NKOB 2BK8A 4RMSA 4ZUSB 1YG9A 4GG8A 3E2HC 1KEGL 2I9TB 1XV8A 3EZ8A 4YZFE 4AQ1B 4OZFA 4QRUA 2VE6A 4EZJA 3S4SB 4I89A 2BSBA 3CLFL 3ORJA 1QLEH 5C07E 3GUTA 4PD4J 2IV8A 5E4IA 1P2CB 2BNRD 3TBCA 1YEJL 4JFDA 5EC1B 1HSAA 1X5YA 1TZIB 1OTUC 4E9XA 1WPCA 3C09C 3CZSA 5EU6B 2X2HA 3RL1B 4AVHA 4ALAL 4FTVA 3HI6H 3EIFA 4HUNB 2B5IC 3CPUA 3DVGB 4N9OB 5SWZE 3V7AG 2ITCB 4E9WA 3Q7JA 2DQFA 3F00A 1WAEA 1T5XA 4ODTH 3N04A 2AJXH 4I85A 4MBRA 3BDYH 2XN2A 4RQQB 4TVSa 3DJZA 1BQHG 4KNUA 3DC0A 5FO8A 4JFYB 4QEGA 3LXBA 4X7TB 5T1LA 4HETA 5I73B 1GPOL 1T1YB 2Z92B 3RWDB 2CA4A 4XHQA 2JK5B 5BW7A 3QAQA 4AMKH 5DSCB 4GG6B 3HUJA 2W94A 2ARJQ 2XWRA 4Y4KC 1BD2D 1OV8A 2BVUA 2UY6A 1IM3B 5AG8A 5IB3A 1WRFA 1F4HA 3EH3B 3PGFL 1G1OA 3NDZE 1LP9E 1E4JA 2A6KA 2E86A 3B5TA 5ANME 1OZTG 4XNAA 4N0FA 1JWSA 2J6EL 3IDJB 2EDDA 4U3SA 4W9CC 5LGJB 1MEXL 3VI3A 2WP3O 3X12A 1IILE 5KTEL 2E74C 4OR1A 3B9KC 1KNOB 3K6FA 4L8SC 3F3HA 4ONFH 5DD3L 4DKTA 2CO2A 1XSJA 5DQ9A 3FU5A 1KYOK 4XP6L 5TK4A 2ZOUA 4U1NB 4Q9RH 5DRWB 4JAMB 4UILH 1EFXA 1LWJA 5HJ3B 5KYNA 5F7WC 3IAPA 1MRDH 4LSVH 4S1RL 1F13A 4I88A 3ARZA 3EHBD 3AQDA 5EIVA 3U4EB 5GS3A 4XO5A 3LOWA 1IAII 2KLSA 2WKOF 3B9KA 4FJYA 5F7DB 3FUKA 4G7VH 3EYVA 4BM7A 1UZ6E 3ULUE 2BXYA 4KRLB 4ZNEE 1NBYA 1QLEB 1UYWL 3F5WB 1MAJA 1CLOL 1I7TB 1LE9A 2XI9A 5CKGA 3DX4A 4XPHL 1JNNH 3CFDA 2W9DH 4NZTL 1IFGA 5CSBA 4J27A 1K72A 3CVHB 4MD4A 4DAGH 1IC5H 3KEHA 2NY6B 5L2JB 3D34A 1HE8A 2EIMB 3FSOA 2XWTA 4YFLI 4EJ1C 5IVZB 1IMHC 3BWAB 2LVEA 2FUQA 3PP3H 4PG9B 2BCKA 4QCIB 4FP8H 4GS7B 1DJHA 1EHXA 5ICXB 2WM0A 1XXFC 1J8HA 4Z7VA 2QLYA 3GI9L 2CSPA 4AYSA 4JFEB 2UY6B 2GBAA 4HAFA 4HDIA 5J3HD 2IOIA 3F58H 5ABZA 2ICEC 3KPQA 1NICA 4JO4L 2GHWB 5FW8A 1A6TA 5F1IB 5GS1A 3CX2A 4XBEH 5F0MB 3O4LE 4K9JA 3GS7A 2PCFB 5LWYL 1E9OB 3MUUA 3KWUA 4JKNA 3TBTB 1WO2A 3NJLA 1U2HA 1MHEA 3EFDL 3VI3B 3F85A 3X12B 1XF5B 3BP6A 1YMME 5G5DA 3BGFB 2PN5A 2DDQL 5FGCB 2GIYA 4URKA 1KIQB 1VKXB 1GYCA 3JUYA 3DGDA 4JFZH 4CVUA 4N85A 3O0LA 1BIIA 3JYCA 5I0DA 4YPGB 4FZ8H 4X98B 3GUTB 2NY7L 2G2NA 3LRKA 5LGHH 2F61A 4KK6C 1JPFA 4GQ9H 3H8NA 5DU7A 1JDCA 3T0BA 5F7AA 5FUCE 1IEBB 5G4NA 4K7PL 1AOZA 5DFAA 2MTPA 2BW4A 4PJDB 3KL5A 5L2KD 2HPTA 5T5FA 1E4HA 5EA0H 2D03L 3TV3L 3L8QA 4IGBD 4XNMB 3SE4C 2GIMA 4XPGL 3ZU8A 1IBBA 2VMFA 2WZ0A 5ID1A 5AVXB 2C26A 3WFBH 4E42A 2EDQA 1EBAA 5CKAA 5EEYA 4F7EA 2DN7A 1CYWA 3REWA 3PWNA 1IM3A 1IAOB 4DGVL 3GTVA 2FK9A 1JK8B 1GGTA 4FQCH 4EPSA 1SEBA 4TOYH 4NQTA 1HH6A 2PW2A 3BYTA 3IJSA 4FQXC 4G59C 2JCCF 5AW7B 4NZUH 5IHUL 5IVNA 3RX9A 3ESVF 2HVJB 3V10A 4LARL 1RZGA 5B22A 4UT9A 4YHZH 5EUOF 2LT9A 4G7SB 3UP1A 2FX7L 4LL9A 1BEXA 3ASWA 4X9BA 5C08D 4R26L 2X4SB 5JPNC 5TPWL 3H42L 2XN9D 1QEWB 2WKGA 5CCGE 4WU7B 4L5FH 3Q2NA 5A2FA 4G43B 2CHXA 1A8ZA 1IEHA 3HUJF 4FZEL 1CUOA 5E2WL 1CGSH 4AKPA 4KO6A 1JRHH 2ZPKH 4R7DA 4LRIA 3UYPA 4GB9A 5GGRY 4DN4H 4OZIB 2BNQD 3E3QE 4JN2A 3DV4A 1YAZA 5J11B 2A9CA 1WAPA 3LN9A 3PGCB 4C83B 1CIDA 2VDPL 2VXUH 4NN6C 1TZOA 4ONGL 4FAAB 1MI5B 3QQDB 5GGRB 5EF2A 3CXDH 3W9DB 2FYYB 5F44A 3H7BA 4I5BB 5KSBF 1MCRA 1BAWA 1MPAH 2Q2LA 4OD3H 4IKNA 3BAXA 1XF2A 1ZA6A 3HMXL 4M6MH 1DANU 2Y0SA 1BZQK 4JDVA 3KG5A 3QRLA 4JRXB 1RK7A 3TCXA 4QO1A 3REWB 4XNQB 2DQUH 3PAYA 3NIGB 3EDJA 5CSGA 5JHDB 3KPQB 4JFQB 5AW0B 5E0FA 7CGTA 3D3VB 1B9KA 4K94C 2EXWC 4N8PA 2QPSA 1ZJAA 2Z7UA 1YMHB 2Q86A 3D30A 1X5XA 1VCAA 2X5PA 3FB8A 3MV9A 3PWPA 4QLWA 4PJGE 5D2NA 4HOWA 5H35B 2D7PA 4C56E 2F15A 3VFWA 1OANA 3M7OA 3M8OL 1NSNL 3LQZB 2NW2A 1EJOL 1R3LB 2PYFB 4U1HA 3PS6A 4M9OA 1ZVNA 2WLKA 2DH2A 5FYLE 4YHIA 5GGSB 1YQ2A 4FGMA 5B3JE 2NNAB 3NBNA 1OAZL 2H6OA 3QJZA 2JKSA 5DRNB 3MREA 1UKQA 3VSQA 2MNJB 1YEFH 3TBYB 1NCTA 3G6JA 3WJLA 3E7JA 2B8OT 1DSFL 3RY4A 4MD4B 5FGSA 2HYMA 1ZK5A 1EHAA 3CVIL 4G5ZH 4WW2F 4LPXA 4YZWA 1UWXH 1G5GA 1PZ2A 1BD2B 1GGBH 3OPZL 4LLYB 2BP8B 3FO9A 3MOAH 3H3BC 3OKMA 4KK6D 4RNRB 1JPTL 5I18H 4AW7A 4FL4C 4XZUA 4W93A 4M8QB 4NKQB 3RUGF 5DFWH 2ICWA 5H94B 3WJLC 5IESL 3BGAA 3WEXB 3VD9A 4J28A 4YHKL 2F8OA 3CG8A 2R7EA 3S3BB 3AWGA 1JWSB 3IDJA 5A3IC 1NDMA 3OXSB 2Y6TE 2X4NA 1RPUA 4ELMA 2W9EL 1QTSA 2WNGA 4Z76B 4DIXA 4ABVA 3GIZH 4GW4B 5IVXE 3HIZA 4LSTH 1OAJA 4UB0H 1E7VA 3VRLE 2AXFB 4UZGA 4IHOB 3LIZL 3JVGC 4IS6A 1BCIA 3MJ9H 3PP4L 1X9UA 1DN0B 4X8CA 4E9RA 3KPSE 1A1NA 1TJGH 4GSDH 2Z3FA 3AJ7A 2M8XA 3SDDA 4IYKA 2W95A 3QEGL 3QDJB 4DETA 1Q4NX 4L4TD 4WEBH 3X2QB 4G6FD 1A4KA 3C5XA 2VSCA 4AIEA 1CGWA 3EG9A 1HIML 3E9UA 4EOWH 5AALA 2OYPA 3SQOL 1AQKH 3UZQB 4KJQC 1PPIA 2BY2A 2DWYA 3NPSC 4WW1A 3ZTJG 1DDHA 1MWAL 1VA9A 4K7PH 2NYZA 1Q9LA 1JFQH 2YD8A 3ISYA 5B1JA 3TVMB 3W0WE 4JM4L 3BCDA 3MRCB 2VW6A 5EEWA 4M62H 3WI9A 1QFUH 2CGZA 3FQYA 1EHNA 4P23A 4PCYA 1E8XA 2YC1B 2VUKA 4S2SB 3VFRA 4M8QA 4ODBD 3EGDB 1URIA 4ZMLA 3EH2A 1EDQA 3H1ZA 5GS0D 1N3NB 2F5BL 5CEZL 1TQSA 4KPHH 5F71A 1OAUL 1TEYA 3G5WA 4WUUA 3VG0H 4Q9CA 5HDLA 1RUAL 1COBA 4HIHB 2FL5A 1JD7A 3HI5L 5ISZD 2O5NA 5B1JC 1N68A 1HE7A 4PV8B 4BQ8A 4JHAL 1L7TL 5EEZA 3HB3C 1AXTH 3IKCA 2MFNA 2X2IA 4NZUL 5IHUH 3UBXB 5HGDA 4ZYKA 2J55A 2C1PA 1T0MB 2L7EA 4L3FA 3RBGA 1T1ZA 3HNVL 2WMPA 3Q9PA 3B9KD 1IU1A 1G6VK 1QRKA 2UWEB 3L9RB 2Z8SA 1N0XH 2GSIB 2WLMA 4UM8B 1AO7B 2O5YL 4L4JA 4YDZA 4M5TA 4N2EA 3CH8A 5CJOH 2H32A 4YGVB 3P3RA 3UZQA 1WFOA 5GSRB 3TONA 4JFOA 4NO2B 2AEIT 3IF1A 3LEYL 4UNIA 1FORH 1LEKB 3ZDYE 4R9HA 3R8BB 1GGCH 2NY5H 3MRMA 4YR6A 3FQUB 4D9LL 3UTPD 4F80A 4F24A 1DVZA 1KGIA 1Z5HA 2EO7A 2WBJB 3FW6A 1NCBH 4R5VA 4XMUA 2ZP8A 5GIRA 3LN4B 3L4CA 3VXNA 3KL0A 3KLKA 2D7OA 3WKML 4R8WL 4JUSA 4LSUL 4OSUL 3FB5A 3UCQA 4KHXL 2GT9A 1OGAE 3FK3A 4TQPA 3GRWA 5DC4B 5DUML 3RX7A 2R2BB 5F89A 3S35H 3UBFA 4LLVB 4L8CB 6FABL 3D8MA 4QLRA 4OJEH 2FYYA 1JUFA 2UYLA 3CDYA 5I8KL 3RU8L 1UT9A 4EUPB 3QFDB 2AQ1A 4EKJA 2ZG3A 4WNQA 1U4EA 2PPEA 3GMRB 1OPGH 2W5PA 1U41A 2YUXA 2IO5A 4U1MB 3SYCA 4AGMA 1A6TB 5F1IA 5C0FB 1JN6B 1H3GA 2ZXWB 1KPRB 4GRLB 2CLVB 1T20B 4PRPA 2PR9A 1IBYA 4EIBA 1TJHH 1ESOA 2AEQL 2KLRA 4F2FA 2OJZH 5LB1A 1L5GB 4GW1A 1SDDA 5I1AA 1PU0A 3D69A 3DO3A 3SZKC 3VXRA 4DVRL 3DHPA 1WT5A 2CLRB 1CL7L 3EZJB 2BDNL 3FT2A 2RQEA 1BAFH 2D3VA 4P2RD 4XPBH 4R7XA 3AABA 3OV6A 5F3BB 3EJJX 4QHMB 2QFPA 3BAEL 4U7MA 3ILPA 4UQ3B 4XO3A 2WINA 4LCYA 1FHGA 1AFVH 1BF5A 1JHTB 1F58H 2YMXH 2O6FA 3GBDA 4PLJD 4NNYA 1ZLWH 1GA2A 2EIEA 2QVIA 3RWHA 4AC4A 5J6GA 1LE9B 1H0DA 2IDSA 2VQ4A 2XZCL 3LZNA 5B39G 3FU9A 3H7LA 3UP6A 1AQHA 1AQDB 1GZQB 1XAUA 4H0LC 4OIAA 3D2UA 4G7YL 4CSPA 4XVTL 3G08B 4BK4A 3G6DL 1M6UA 2APVA 4AM0B 2EO1A 5L8JB 3VAEA 3C60D 4PTUA 4FNTA 4N8VB 5JPNA 1VFMA 2NXZB 4MXVE 4ZUUA 2YD1A 4MMYA 3RAJH 5EOCL 1TTFA 3D2UD 5E51A 2NDGA 2FWUA 5I74B 5IMMA 4WUKL 2A6KB 2V8LA 1F45A 1QFWM 4TUKH 3MO1B 1T1XA 1XB3A 4FFYA 5JR1H 4N2BA 5H94A 3FRUB 3MLVL 3CFCL 1UA3A 5D72H 3EGSB 4KZEL 4H0GA 3WJJC 2I7OA 3GMPA 4YHYB 1ORQA 2GG1A 1G7JB 2J8UF 3F7PC 2GJJA 5DJYA 1QWNA 3CUPA 3IFOA 4XP9L 1FZJA 4LT7A 4J6RL 1GSKA 3GIZL 4GNKB 5D93B 4YNYA 4ZNEA 3I6SA 3HG4A 1T7XA 3BD3A 3KYMA 4YHML 5FGRA 5D1XD 3LMJL 5SWSB 4PU2A 3G6JE 2ZCLH 1KBGL 1KJ3H 5IWLA 5JPMA 3VD0A 4UUJB 2P5EA 5I6NA 5TDOB 5D4QA 5E00B 1N2RA 3KW7A 1J0JA 3EJSA 1MIEH 1TG8A 4IMKA 4Y4FC 2WN2A 4HWBA 2BOCB 1NDGB 2ZYRA 3QIBA 4PRIB 1L9OA 1ZKAA 1M57B 1P5UA 3HHSB 3NMEA 4JKLA 1MCLA 1AHWC 1LNUA 1O7SA 2UY7B 1HAWA 4ODWB 4AKQA 2ISDA 4HVBA 1V8HA 3KLHD 5LBGA 3C2AH 1TZAA 1UA7A 4HAGA 1VFBB 3MVSA 4R0LA 3UZEC 2ADIB 4CU8A 2I27N 3OZLA 1HTYA 3VXOA 5DD1H 3THML 3QNXA 5ICXA 1RZJH 3G5YA 4XPFL 5HJGA 2NY2D 4LCVA 1M1XB 2R59A 1ADWA 1EZVX 3ZTCC 3V79C 1S9XB 1G1KA 1P7BA 1XTLA 2GYSA 1NL0L 1BVLB 4JDVB 2EO9A 4GQQA 4GSRA 2HFTA 3Q5OA 4KZDH 4JHAH 1L7TH 2DEWX 3OC8A 1KB3A 1QLRA 1WC7A 2WQWA 3EO0B 5DJAB 4J3BA 5B39A 1TVHA 2BY3A 3SOBL 4NDMB 3RWFB 5I1KH 2A1WH 5JXED 5TE6H 3CZNA 3DX2A 1CF8L 3IDXL 3UADA 2ZSWB 4GEJA 4QRPB 5I1AB 4HAKA 7PAZA 3H6JA 3L4WA 1JGVL 5DT1L 4JCWA 1SHWA 2NW2B 2V17H 3BEWA 5E2JA 1HYSC 3HC0A 4LLDA 3DTUB 3GTNA 4K8RH 4G9FD 4UF7C 4OLVL 3FB7B 3BFWA 5DR5H 4BSVB 1AGCA 3VD4A 2AJXL 5INCA 1ZVHA 3MXVH 4X9YA 3Q6GL 3VFVA 3MJGX 4JREB 4E9SA 2C8NA 2J1WA 2W0KA 3P9MA 3B2PA 2Z31B 5D5MB 5FCUH 3GDBA 1D5IH 3BMWA 4R4ND 4X8JA 2I69A 2X4PA 1ZVSB 3PGDA 1OP3K 5DK0A 5CCJA 5D4HA 1AYOA 4G6JH 1FA4A 1WWCA 2NNCA 4I8DA 3KPRB 4OJAA 2AZAA 1IC7H 5ISZB 4EI6B 4ZK8A 3G5XB 4FMVA 3T3PF 1S7VA 4S1DC 3HZKB 3MCKB 1KB5L 4B97A 1XF2B 1J1OH 2W0LA 3C75A 3FONA 4Y2OA 3BN9C 2OS7A 2X0VA 4KK9C 3Q1EA 1NGYA 3GBML 3MR9B 3D12B 3N85H 1AYRA 2YPVH 5EIIB 4PP2A 3O3UN 3VFSB 2UWEF 1F5WA 1KFAL 2FT6A 1CD1A 4MMXC 3EYOB 3EJPA 4LEOA 5DO2C 1A64A 3VACA 2VAAA 2WWOA 1Z3GH 5H4YA 4QRFA 4S1DD 3QJQB 5BW7C 1DJGA 3EH5B 4RLDA 4LPYA 2WXMA 1IKFH 1U93A 1OLLA 4OF8A 2OJZL 3GBNL 4V1DA 5C0BA 4P23C 4BH8A 2ITFA 1L9RA 3M17B 1WYJA 1O5DT 1F1DA 4G7VL 4B41A 1VCBC 2WVUA 4I2XB 3B2MA 4WTQA 5DYOB 1A1NB 2BDNH 2HP4A 1S7XB 2EIKB 2WLIB 4C4KT 5TE7H 1FDLH 4UTBH 1KY7A 1VACA 1KENL 3IGLA 1H3PL 3QEQB 2YXFA 1UWXK 3BLPX 4NRXA 3MLTB 5DJ0A 5IB5B 3EG9B 1G7QA 4BCZA 3GB7A 2FIKB 4QRRB 3WNIA 4EEEA 5KVGE 3MNDA 3ARDC 3L3HB 3QEHA 2NY3B 2J88L 3CLEL 1RZ7H 5GJSH 1LMKA 5EULV 1XCTB 2C9QA 3DETC 4GPVA 5GGVH 1I53A 1V5JA 4FKHA 1D5ZA 2OI9B 2NDFA 2JKJA 2N56A 1FJ1B 2CU9A 2TSBA 3R18A 2BFVH 3BKMH 5EZOH 2FEEL 3AQZA 2ITEA 2Y07L 1UA6H 3C8HA 1AR1C 5H4ZA 4XZUB 4E5XA 2GJ6E 1TETH 1N19A 3ARDA 1B88A 1F2QA 5F9AC 4JQVA 4KH2A 4N0RA 4KK8C 1WZ1H 4XBEL 4IRJA 4HWEH 2P24A 4BK5A 3FFDA 1ZHKA 1H5BA 1QPKA 3TV8A 4ZFGL 1CXFA 1SMOA 1CL7I 5AKTA 3TJEH 1RZFH 5M94B 2XX1A 2XN1A 1B4LA 1GY2A 2EEAA 3ISRA 4GRMB 4ONHA 5CAYB 3O6LL 3SQBA 2GC4C 3TFKD 2NY2C 3WJMA 3APFA 2V5MA 2QSTA 1RUQL 4NDMA 2NNRA 2ADJB 4OCNC 1EO8H 1R5WA 4A7VA 1H3WM 4LEXH 4OZ4A 3RILA 3ZQWA 2ZUQC 4IRJC 2GSIA 1AXSA 1KBWA 5EZLA 5JQ6L 1HHHB 3TBWB 5AWNH 2EACA 1ILSA 4O9HH 3TO4B 2X3BA 4NKDA 3VXMB 2P5EB 3RL1A 1HHIA 4GQZA 3ZO0A 3NTCH 2FHFA 3FZUD 4XCCL 1I1YA 1JPGB 5AW8B 1TVBB 3UYOD 3KBEA 4K3EL 3L6FB 4KQ4L 4PRHE 2A6JB 4KQ3L 1KCKA 1IGTA 2XX0A 4M1CC 3LH2L 4JKWA 4MVBD 1WZAA 1DQKA 2WSKA 3BUDA 3GSVB 1PLCA 4PRPD 4OIFA 3OZKA 3WFBL 1ZV2A 4FNSA 4S2SA 3VFRB 4I87A 3EF4A 4ANWA 3T4YB 1KPUA 4M5YL 4PMFA 5D8JL 3ZE1E 1DQTA 2DQTL 1JHKL 4M7LH 4AJ0A 5J1AA 4AV4A 5J13B 3ARFD 5DUPL 4MQ7A 1MFCL 3JT2A 2D31B 1KCSL 3VWKD 3M86A 3CN3A 1FO0L 7FABL 2CXKA 1B9ZA 3VDBA 1WBYB 3HG1E 1KIRB 4RGOL 2WWKT 4UANA 3V6OC 2OJ1A 3LTVA 1M2VB 2GTQA 4XPTL 4XCEB 2YLKA 3CHPA 1G0DA 3ELAT 5EZPA 2O72A 1PKQE 1SEQH 4HALA 3T2PA 5LVEA 5F70A 4GOSA 5I1KL 1UJ3C 4AQEA 3BO8B 5EWIL 2G9HA 4ZUTA 1A1MB 1WFJA 1ONQA 1Y18A 3EOTL 4KDVA 1U92B 2EH7L 2P4AB 1CGTA 5CEYA 4PSRA 2IDUA 1MVUA 1QBLH 2P28B 2V3FA 4LHUB 3C8KA 1NMCC 2OBGA 3AM8C 3DBSA 3FSZA 3BX7C 3DDFA 3QW9A 3WFZA 5DZAA 4PP1C 3ZE2B 2WLIA 1CDJA 1OP4A 3SE9H 4JM2F 5EC1A 3F58L 3FF7A 3DX9A 4DN4L 4KVNL 5FYJL 1NWOA 4FKEA 5E8OB 1N59A 4PLJC 3FO2B 3I6GA 4KROD 3H0TA 4TVPH 4X0KA 4YLBA 3EHBB 2DMKA 2XKUA 4PRDB 1QFWL 3D85B 4EXPX 1XGQA 4UMSA 2V9QA 3Q8BA 3B3IA 2MKLC 5AKVA 1N6VA 2AFNA 1D7CA 1Y0LB 2KQNA 2YD5A 4KKBD 4F9LC 4F91B 4RNRA 3P3YA 1L0YA 2BVQB 4RZKA 4Y5XA 5EUOB 3BPCA 3D5OF 4G6JL 3R4RA 3MBWA 2HRGA 5T33L 2DQUL 3K2KA 1NPNA 4PCTA 1NBZB 5FYKH 1Q94A 4Y1AE 3GBMH 3PCYA 1PY9A 1KTRL 4Q58C 2CNZA 4HMEA 4QIRA 1FNFA 1I8MB 2X4SA 2VN6A 3MX0A 1J5OL 3QRGH 3V0VA 4XP1H 2VLLA 1OE3A 3CFNA 2DAVA 1BJ1H 1E3ZA 1QLFB 1XEDA 5CHNA 3R06A 3LZFH 1P1ZA 5D5MF 3TYFB 3VFUB 5C8JB 5KSUA 1WZLA 3O45B 2CM5A 4RIRA 5H2BA 2P52A 3CHXA 1A6VL 1LM8V 1DZ0A 2EILB 1A6PA 2YIHA 1ZAGA 1NOAA 5CJ8A 3L54A 3ME0B 3N50A 5DVLA 5BQDA 3WUWA 5BNXD 4JY6B 2EDJA 2JB6A 3H3PL 4KFMA 1O9ZA 3EGXA 3LRHA 4NZ8A 3B7TA 3DX8B 3GO1H 1XHHA 3VFVB 3TIDA 4QHKI 4K55A 5F9OH 4AKOA 2Q8AL 5DI8A 2YD2A 3PF2A 3CDFA 3RVWC 4HJTA 3AWEA 1C16A 2X4PB 5DA0B 4OJCA 4PGDA 2RCSH 5A2AA 3G5YB 3L1FA 3O41B 3J27A 4M93C 3U1SH 5JO5A 1I8UA 1F6AA 3WIIH 3SCMA 3DXAE 4YHKH 1QSEE 1SZNA 3QHZH 2F58H 5ESQB 3FT4B 5L4MA 2A77L 4KV5F 3BAJA 3LVTA 1YPZE 5ALBL 2KZBA 4ZW5A 3V8OA 1F42A 1XGPA 3IGAA 5EUKB 1K8IA 5L7XH 3K8LA 4X7SL 2K45A 1EK3A 2CPUA 3NEEA 4Y1SA 3V4VB 4IEFA 2AI0L 5I16A 2E46A 3ZK0A 2F1EA 4XCEA 3C6SB 5CEXB 3L5IA 3SJVB 3N5AA 1CE6B 3FO0L 4B5ZA 4PJAF 3T6QC 3EYUL 3CFBA 3BQUD 3MLUH 4H8PA 4HJJL 5I66B 4EMZA 1FG2A 2FX9H 1T7YA 5B7FA 3H2WA 4LEXL 1KIQA 1VKXA 1MRFH 5CU9A 4FABH 5JQ6H 3MRIB 4J3XA 3FTGB 4YLQT 4O9HL 1FL6A 5BO1L 2MIZA 3IJHB 1TZHA 2OP4L 2IADB 1LO0H 1FYTA 4O2FA 2P44B 4AQ8C 3HC3L 3PRZA 4JO5A 3OMIB 4JM4H 1OEZW 1D9KB 3MV9D 1P5UB 3HHSA 3HG2A 5HHNB 3LHPL 1UGKA 1G1YA 3DURA 1BD2A 4LLYA 3WTWA 3RPBA 3OKLB 5GRUL 4L4VE 1WK0A 2K9UA 4HD5A 5IOKA 4XMKH 4M56A 1PY0A 2AC0A 5D4IA 5CLZA 3PIQB 2F5BH 2VR7A 1WFTA 5C0DB 3W9EA 1C16B 3TYGH 2C4XA 5HGHA 3WHXB 3WEXA 1YDPA 3T4YA 1JFHA 4B96A 4PRIE 1XZ0B 4YSPA 4GLRH 3OJDB 4ZTEA 3OR7A 3SDAB 3F65A 4WW2C 5JOEA 5LAXA 4YHOL 1GCYA 5AYQA 2Y22A 2WSPA 5AUMB 3HA0A 2C9PA 1HC1A 5DGQA 2YPKB 2HFFA 4FHKA 4CMMB 3BRGC 4LZKA 2BP3A 3MRQA 4IHOA 2R23A 5I8CB 1MCCA 3KEDA 3ARQA 7PCYA 3ZHNA 1NCDL 2OQJB 3U2SA 2GTWB 5I0WA 4ZOBA 3MBEB 4EUPG 2J8HA 2QTVA 2XQBL 2WQ8A 1SVCP 1FNLA 1DEDA 3M17A 2Y9RT 1MRCH 2W38A 3Q1SL 5DJ6B 3FU8A 2AS5M 2FGWH 2JKRM 1GGIH 2H0FA 1GGCL 4NQCE 4WTXA 3KYKL 5EU6A 1D9KA 2FR4A 4FHJA 4FXKB 1EHLL 1QA9B 1KYOJ 3F83A 3O3BA 5MI0C 4O02B 2Y1AA 3KWTA 4LVOB 4KV5E 2JIXD 1OP3H 4RWYL 4OFIA 1SJHA 2WZAA 1BDYA 3MCLH 1NCWH 1RPQA 1ZD6A 4PTUB 3LXUX 4X6EA 1JXGA 1OGTB 1GXEA 3NIFE 1LEIB 4MDIA 3U7YL 1AHKA 1DUZA 1K3ZA 2GFBA 2UUDK 3DO4A 3HN8A 5ESVB 5FA3B 2GW5A 3PP4H 4XTRD 3SDXB 1YEJH 2P49B 4NP4H 1C08A 2BWDA 3O4LB 4KGJA 4IBTA 1I7ZB 1SJEB 1W72A 3AG1B 3EJZC 5DMIL 1X4XA 4KBPA 3NSDA 4LHUG 1J7VR 1QKZH 4OFYA 2FZ3A 3B2UC 1OSYA 4YDKL 3VQMA 5ID0B 2YEZB 1W0WA 3AMKA 3MACL 5MEOB 4X5PA 3IM1A 3GI8H 3TH2T 1PCSA 2HFGL 5KVEH 1L5GA 4L29B 2ZWZA 3EOAA 4MCZB 1GJIA 3DX7B 3MA7B 2H32B 4OGAD 3CVBA 3MLXL 1SM3H 3BO8A 5E5MA 5F7BA 5BXFB 4XPBL 4KXCA 2HT2C 2NZIA 2DIBA 5TDNA 3BAEH 2APTA 1QWHA 5KSAB 4OF7A 4PJ5E 4X98A 5DJZB 4NPJA 3HI5H 4JX0A 5LQBH 5IBUG 3ZJAA 3ZHLA 4PY7B 2XPYA 3JTTB 1QR4A 1MJUH 3LN4A 1RD6A 2HT4D 3R4DA 4ZRGA 3L45A 3VWKA 3T0EA 4KJQD 4KUZH 5E23A 4O2EA 2E47A 1B0RA 1BVNT 3T2LA 2PXYA 5T1DL 3IJ8A 1QLEL 3K1DA 4TNGA 3RGVB 2Z92A 3RWDA 2ATAA 1J1PL 3PDOB 3LKOB 1M1XA 2R56L 1SEBB 2YA0A 4A04A 2GFBB 1IE4A 2ZKYA 3FU0A 4TUKL 4XO9A 4LOUC 2UZIL 3Q9QA 4MMZA 1YO4A 2ZKHH 4JM2B 4F5CA 1OK0A 3W0WB 1WFMA 4WK2B 3HLKA 3T3MF 4P2QB 1FGVL 3IMVA 3OSVA 4MKMA 5D7JA 1O6SB 2DKMA 2IPTH 4AV0A 4E41A 4L1LA 1G5AA 1NCNA 4HP5A 4P4RB 4GRWH 2XN9E 5FDWA 4FG2A 2ADGA 2YWZA 2AV7B 1PLAA 3PPEA 5CD5C 2QPFA 5T3XE 5G5DB 4KKAD 2LHAA 2F1BA 4J3OC 2G9HB 3TT3L 1PTZA 2WVTA 3QUXB 3RVTD 2Z31C 2YD4A 3S5LB 3ZPDA 1CQKA 3OKYA 5E00A 1ZTXH 1Z66A 4B7IA 4GKOA 1KG0A 1DQDH 3MJ8B 3QXUA 4P5MA 3MV8B 5IVXA 4MD0A 1OL0A 2JQMA 2NX5E 2WLZA 5DYFA 2DQHH 5CXPA 4GP8B 5GGQL 3IDNA 1TO4A 1GTNA 3ATFA 1L9SA 3MRJA 5B3SB 3S34L 1C12B 2F9BT 1DJSA 1NGQL 2VM9A 3INUH 4K5NA 3WKYA 1Y0LA 1QBMH 3WBDA 3GXDA 4P9HL 4QTIH 2DY2A 2AQTA 1U8KB 4LDEB 5EEUA 2VLKA 1OIOA 1FJ1A 1NFDA 5IV2B 2RD0A 4JY4A 4WI0A 3ILDA 3OKDB 3UC0H 3DBXA 3MV11 3N0AA 3S37X 4U6XB 3C09B 2V9UA 3PIQA 2FWOA 4PBXA 2HN7A 4CKVX 2QQQA 3VGBA 2J4WH 3N0PB 5FM8A 1KULA 3KPRE 4PW9A 4NQDB 3O2WL 5I1LA 3CDZB 5GGUB 4JZNA 3AS0A 1XXDC 2LU5A 1EA9C 1RV6X 2AQPA 4NNXB 4HKZB 3ZN6A 5JW4Q 1F58L 1NIDA 2YMXL 3TV3H 3KCWA 4X4ZA 1W8NA 1WAAA 4HWBH 4NIYE 4GQRA 3WEBA 3ZO9A 2ZXAA 4XPGH 3APDA 1FLRH 5TE6L 3TBBA 9CGTA 2G2RB 4KKPA 1NIBA 5I30L 3Q5YA 4Q56A 1OALA 4OZ4B 4WEMB 3L2NA 1MREH 2B59B 1FG2B 1DUYA 3I6LE 3VFWB 5KAQG 5CMAA 3GNMH 3KW8A 2GI7A 1P2CA 2P80D 2BNRE 1DBML 2X6AA 4JFDD 4NBYB 4F8TA 1XBRA 5DR5L 1KN2H 2E7BA 3SDXF 2X2YA 2WXQA 4Z7OF 3MNZA 2AJSL 3GSXB 5J1SC 5C7ZA 4FKKA 3MODL 1MFVA 4NQDE 4DOHE 3QC6X 2NUTB 4N20A 2VLKB 5IV2A 1MY7A 3S97C 1XBDA 3CAFA 3T6ZA 3RIFK 4JRXE 4GO6B 4WHDA 5GGSY 2Q9OA 1B0RB 2A3TA 2XOTA 4ZMVA 1MSPA 4ENZA 3E8UL 5I17A 1NCHA 1KB5H 2WXJA 4EUPA 2JKXA 1IIKA 4TKWA 1LGVA 4HV8A 4LCWD 5SX5K 4NP4L 4WIQA 2ZOKA 1IBHA 3QG6A 5DHYA 3TZVA 1P5VB 2QT6A 4JRXA 4HKZA 4P59L 2GY5A 3GHEH 1ZLVK 3LAFA 4K15A 3RZCA 3LQAL 5AQ0A 4HKXB 3SBQA 1TZGH 2MHAA 4HS3A 5C08E 5CD3A 5HHQB 2XXFA 2X38A 4NQED 3D07A 4GLRI 3NH7L 4PJ8C 4WHCA 3UCRA 4W68A 1CFQB 2ADJA 1WA0X 2XNAA 1C9SA 1MCWM 5HJ3A 3BH9B 3RWCA 4GRLA 3OR6A 1AKJB 4UAHA 3GBNH 3QWNA 3BOVA 3MYZA 1S9YB 4OD3L 3KXFA 1A7PL 4MYWB 1YEEH 1FH5H 5KSUB 5AOMA 5IROD 1XZWA 3QJRB 1BM3L 1YMMB 4OCMC 1KENH 4TTDC 1MFEL 3WIHH 4IBVA 1H3PH 1TPXC 2K7PA 4POZC 1UCBH 3RY5A 1MCQA 1NL0H 3KZ8A 3RDTD 4H2AA 1WQVT 1BM7A 4WJ5A 1GSMA 3NT0A 3NIDF 3QNYA 4RDQG 1JTPA 3DX8A 4PJ8B 2MWCA 1A66A 4OZIA 5LCVH 2R15A 4LLWA 3ABKB 3FRPB 4U05A 1FC1A 4N1CA 3KPRA 4CBZA 4X6EB 2A1WL 2XUWA 3CVHL 5SX4I 1UXWA 1BIHA 5EUOA 1CF8H 4HIHA 4QGYA 3ULAB 1RP9A 2EEFA 1RUKL 4M4RA 3U7AA 3WOVA 1WZ1L 3INOA 5J06A 1MHCA 2FJFA 3QO0A 3UERA 4OCYL 4HZ1A 3NCYS 2IAMD 3SE3C 2X4UB 4F15B 3WCYA 2J8UB 2Y7NA 3LDBB 1X5HA 3OB0K 2C9AA 3ARUA 5K9OA 2ORBL 4Z8FL 3FQXA 4LLMA 5FKPB 4OCXL 3RWCB 2G0LA 1Q9KB 3WTVA 1SN5A 3QUZB 3AY4A 1NBQA 4NCDA 1RFDH 1Q1JL 3OG6B 4QRBA 3ZZQA 4F93B 5HSFA 5DUBB 3QDGA 4K7FA 5EIQA 4NS0A 1BIIB 2LR4A 2OSXA 4RMQA 5AWNL 2VXTH 1EEUA 3KYMB 1RZPA 5EBGA 5IESH 2XN9B 1TQCB 4OQ1A 3U4AA 5K33A 1ZTXL 2HG5A 1K5NB 2DJ4A 5KJ7E 4HUMB 2JKTM 1XF1A 5HJBA 4YDVA 5IJVA 4XB8A 1CVSC 4IIQA 5F7MC 4AYBA 1YMMA 4L9LB 5K9KB 4NI6A 1MJJB 4P4KB 3PNRB 5E9NA 4D7PA 3AUVA 2X0UA 4PI0A 2V0AA 1HOCA 2NCMA 4F7CB 1IB5A 1FN4A 3B3IB 4XBGB 1YEHH 3TM6A 3N85L 4I1PA 5JZ7C 4MAYD 1ANUA 1XQ4A 2MQGA 2AK4B 1L0PA 3NRQA 2APXA 3MV7D 3OJVC 4FQ2L 2J8UE 4NNPL 3WKPA 3BZFB 5ADOH 4OQTL 1F00I 1S78C 3UJJH 4B95C 1OGTA 1MFBL 4LP8A 4ZW3A 2CIIB 2IGFH 4P8QA 5FYLH 1Z3GL 1RHFA 3H9ZA 4XI5D 1VFBA 5HDWA 3HG1B 3MNWB 2B1OA 5C71A 4GO8A 4Z0XA 4GXUN 3VFMA 2MOQA 4BUQA 1N3NA 2H3XC 4LIQH 4LLQB 4TNVK 2X4QA 3TO2B 5GS0L 4PJBA 1ZV5A 1JMZA 4YSSA 3OZ9H 4XP4L 4HDIB 2ZOKB 2YGQA 3QG6B 5DHYB 1YLBB 3UFIA 3K0WA 4YHNB 5FECA 2C3XA 2J4WL 2AXJA 5B1KA 4D0CB 4ETQA 3P30L 3EO0A 5DJAA 4LMQI 1IGJA 3WEAA 5KSAD 1DQVA 3I6KA 2BFGA 2VDPB 4QF1B 2VDKL 4HKXA 3DRQA 4WTZA 5F9JB 1OW0C 2ZICA 1NFDE 4M62L 3MV7A 2B20A 2BY0A 3MYJB 3U79A 4FFZH 2CCWA 4BE5A 1T0MA 1KDJA 2VIRB 5CEZE 1SLUA 5A7EA 2HUHA 2H8PB 2XWJB 2ZJSH 5AZEH 4FLHA 3ARRA 1E67A 3EAKA 1F3JB 1F4YL 5D70H 3HHMA 4UTCA 5HD8C 4X42A 1P7HL 4XMXA 2A4ZA 1UH4A 2BFVL 2X6VA 5IQNA 1VIWA 3NN8A 1NA8A 4Y4KD 4BZ2H 3US1A 1DVFA 3MMEA 5C0IB 3P4MA 2OSLB 2DI9A 4YFLF 3NCEB 2W07B 2E6PA 4QYOA 2CUAA 1IAIH 1U42A 3F6IA 4WWKD 4B9FA 2YEVB 3KCPA 5HYSA 5E24E 1WFUA 2AP2A 4PTTA 3CV5A 3HNVH 4I18C 3ECUA 4B3EA 4FA7B 4UB0L 5KZCB 1HEHC 4APXB 4KDWA 4Z7IA 3HBGA 4OGXL 3LKNA 2EEDA 3V0WL 4DEPC 4PGDB 3V4UL 1ACZA 3VB8A 3NSYA 1LP9A 3A4EA 1E5AA 1WD8A 2JJVA 4HK3J 1SDYA 4CAGA 5F89B 3II2A 3G08A 3TWCL 4CMHB 1CT8A 2OMTB 5IT2H 5T33H 4Q0XH 4WI9A 5KWYC 4HSAC 4PWHA 2XRAH 3C87A 5EBWA 4QHUB 4XNYH 4TUOA 5HYFA 3QQ3B 3IGAB 3A6BH 5EUKA 3BRFA 1MWAB 3P73B 2G30A 4HIQA 4QJ3B 4DQOH 1KTJA 1TMQA 4RGNC 4Y2NA 3RNQA 1BHGA 4G6MH 1ZHNA 4ZMTA 2VKXA 4ALAC 2JI3A 2H2SC 2H8PA 2XWJA 4XMPL 4N6RB 5FDWB 5I1IL 2DZEA 5CU5A 5K9JL 1J88A 4U1GC 5D7LA 3Q8CA 2ZYSA 3CFBB 3RIAK 3S35L 2EICA 1SMDA 4LSRL 2EABA 3QUXA 5LKNA 3SY0A 1G9NH 2FQFA 5IJBC 4E9TA 3LNIA 4ZMPA 5D1QB 2EECA 2YWYA 1U93B 4D0DB 1HEZA 2OYMA 4A38A 2ZE0A 4EVNA 2EYRA 3V5DB 1OPGL 3LYRA 3MJ8A 3G04A 3NRPA 3KBPA 3BQUB 5E1AA 5F88A 1KG0B 4PJ5A 4EI0A 2C9XA 2LU7A 3KXFD 2MQ3A 1V3LA 3V2AR 1RK0A 2ZXBA 3QSKB 2MCMA 3GIVA 4JFVA 3RWHB 4K94H 1WF5A 5J6GB 3IN2A 4AI7A 3WFCH 4JZJB 3PV6A 1DL7L 1WEJL 3HI1B 3D39E 4YN3A 4HU8A 4OI8A 2BMKB 3C8DA 3N40F 4QJ4B 4POYA 2OYLA 5E6ZA 4DVRH 4G8IA 3O3EA 2CALA 4RCAA 1F4WH 3QHTC 3TESA 4FI6A 3WXVH 1CL7H 5EBLB 4OLWH 4OVVA 3QWRA 3ULUF 4UYQA 4IRJD 4JCLA 1RL1A 1DQQB 2WXNA 2EADA 3PWNB 1IGIL 2VQ1B 2XJKA 4MCMA 4MRCA 5E2UL 2D2OA 5I1GL 5DRXA 4JPVH 4CGUB 5MP6H 4AWJC 3L08A 3O3DA 4MNGB 2QMKA 3CFEA 3ARVA 3VXUE 2NY5L 1FV1A 4QXWA 5EU3B 3QO0B 1DQJB 1NBVL 1AY1H 1CXHA 1YMMD 2XZQH 2B1HL 1M9SA 2OV0A 2F53E 1CQYA 3KPPA 3U0PB 2QZQA 2CXGA 5I0YA 4LSUH 1PEZA 4K3GA 4OSUH 3UDWA 2WAHA 4KHXH 3QB7C 3IXTB 3IFNL 3S4SA 3QUZA 2NZ9C 3SQRA 2BSCA 3SDDD 3ZDXE 4XP5H 2FEJA 2NMSA 1YY8A 2BJMH 2FSDA 5IFAH 1UZ8B 2W91A 5FO2A 1SYVB 2AXGA 4F7TB 2C3VA 3FQRA 2HRLA 1NAMA 1PIFA 1D3CA 3N40P 1MH5A 2NXYD 3O3AB 4ZX3A 3HHRB 3KPSD 1UGNA 5D1QD 4PJHF 1QPXA 1CI3M 1EVUA 2QLVB 3HI6L 3IXAA 3IK2A 3MRBB 4HHGA 4P2RB 2OP4H 1FAKT 4GUCA 4UWQB 1HXKA 4DGUA 3I6GB 3HC3H 2ROXA 4W70A 4G8GA 3AXLB 1QTYT 2CIKA 3HI1A 5JIIA 3M88A 4MAUL 3O9WC 5AYUL 3RZCC 2ETWA 4X7EC 3AITA 4OAWB 5DHXB 3WUWG 4I4WA 3FC8A 3VH8B 4PJHE 3GDCA 2H0EA 4PGJA 4ZQKB 3VXNB 2G3NA 4W4OC 3BEVB 3EGDA 4UOW0 3B9DA 4JHZA 3TP4A 1XWVA 3DXAA 2XFGB 4JRXD 3LB6C 1QFOA 1IAOA 3ARYA 1G4MA 1QATA 1F18A 3VDCA 4XOEA 5HBBA 1SMAA 3FQ4A 1K6QL 1MI5E 4R84A 2YK1H 4G8GE 1NUDA 4YHOH 1YECL 5BZDB 4YIQB 3NZSA 3QJUB 3L4YA 5AKRA 5FV1L 1CJYA 3GSUB 3RI5K 1I3GL 1RZIA 4ONFL 1DQMH 4LCCB 5LN8A 1FLTX 2YEZA 3DVIA 3VTTA 1OOWA 5K39B 3ZT6A 3IKCB 1KLFB 1RVFH 4PP2B 1D7FA 3GO1L 3BH9A 3MV8E 4AQEB 3BN9D 4AX3A 2A99A 2WGXA 3ARGA 3V7AE 4YXLH 4XVUC 1IBDA 4BKLA 2ZJSL 5AZEL 1AHWA 4HUKB 4OCWL 4WUKH 4DP9X 2V37A 1DQIA 5A40E 1U8LB 4YPGA 4NUGH 1EIBA 1MJ7H 4OZGB 1U8OB 4X9IA 1E3FA 3M1CA 4D0DA 2WLLA 4OUOA 3NIDB 4OUUA 5LUMA 4GT0A 2ENQA 5H8DA 3BZ5A 3H0TB 5JLZB 1JPEA 2W60B 1WBZA 3D7PA 1I9IH 1DJXA 2PMZA 2EE2A 3ARGC 4JPWH 2ZSVA 3QRBA 1KCWA 4GINA 2AJ3B 3TF4A 4K9EC 5EEXA 1IO4C 4NCC2 1CGYA 3T6VA 3OKLA 4TYUA 3I50H 4IDJL 1J0HA 5L7XL 3KCPB 1R3JA 3DX6B 5HYSB 3NFPB 3GZOA 3MJ9A 2CKBA 3DGGB 5K1NA 3DI3B 3QFGA 5EF0A 5A2JH 3IB4A 2DJSA 5DQDH 1UOLA 5E4EB 5JXAL 3HAEH 4NC1C 5LNEA 1ZLUH 1IJ9A 3GI9H 1VGKA 2FX9L 2V17L 3D85D 1QOKA 3TWCH 1UG9A 2AJVL 3LH8A 2EDHA 4YDLC 1TUPA 4K8RL 4K9EL 4P0DA 4WO4B 1HI6B 4Y16C 4P49A 1B0WA 2C1OB 3U0TB 1MVFA 4NJ9H 4A6YH 5JNYB 2VLRA 3WDIA 1OY3B 4ZXBD 4RA0C 4WFHD 2IH3B 1KEMH 5B8CC 4NO0A 5DA4A 2BNRB 2NY3C 4EI5C 2DDQH 3DRTA 1RZKC 4BQ6A 2DI8A 5C0AB 3SO3C 2VKWA 3QG7H 2CLVA 1JVOA 1M6OA 3ILQC 3IFLL 4B0MM 1RJLB 5C6TL 1F90L 4HCRA 2R2CA 5FO7B 2XA3A 3H9SD 4BK5C 3ARFC 2NY7H 5LGHL 1Z9SA 4QTHB 1OT1A 2OX5A 4CNIA 5LG1A 2J44A 5DJDA 3CHRA 3WO3B 2QFRA 5HGBA 1BVZA 3D0VA 3MJ7B 1P7QA 2J6WA 4MRBA 3I6LD 4LASL 4G6AC 5IQMA 5FB8A 2F53A 4Y8DC 3WIFA 3G6JB 4BFIA 3H85A 4HWUA 1L6PA 1QI4A 4AUJA 1J9SA 3T9WA 4O2CB 5E99L 3PJNA 2OMUA 5D7KE 3SOBH 4XNUH 3RWGB 1SOXA 3ZOAA 1UKSA 4WFED 4Y2DD 1H0DB 4X4ME 4GQPH 2GJ6B 1I3UA 4IRSB 5D1QC 1IKFL 2CIIA 5E08H 1OAXL 4XN5A 2G3ZA 2WWMC 4AQ1C 1TITA 4M1DH 4NENB 2YAHA 2VR4A 1E4XL 4U31A 4L8CA 2VR5A 3GZKA 2UZIH 1SYSA 4EKXA 3WEOA 2VISB 2HTLD 3II1A 2OMVB 3U1QA 5GZOD 2YGNA 3OKEA 3P2TA 4ODUB 1UENA 4PRNB 4ELMF 2Q8BH 2VDNB 1MRCL 3SCMB 2FJGB 3JWDC 5L4JA 3VYNA 4P3CL 1KXHA 3BIKB 2ZUQB 4IRJB 4PJ7B 4PVLA 1JXDA 5DRWA 2C34A 2PPCA 2WBWB 5IBTL 4H1LA 3GMPB 1MG2C 4L29A 4OCLC 4JMXA 3BYYA 4JO8A 4PJEE 2PETA 2PXYC 4L5FL 3D0LB 1IC7L 3FT0A 3ZTEA 3VFGH 2VWEE 3SGDI 1BQRA 1V27A 1QTPA 5CR8A 4WAFA 4XXCC 4J3OF 3TA3D 1A9BB 1XGTA 4ZPVA 3FUFA 2A83A 3VXSB 2DWEA 5DXWA 2ZUTA 4LPWA 1KGCE 1L7IH 4WKZB 4IU3B 4O02L 2Y7QB 3DPBB 1O7DE 3WS6C 4YSAA 3RWGA 4Q97A 1RZFL 1QKZL 1SN0A 4FFYL 1KXQA 1UH3A 1JGDA 3MRRB 2P8PB 5F9WB 1ZDQA 2GSGB 5CLYA 4EDWL 2X40A 4MAUH 5AYUH 3MRKB 2I9LB 4QTIL 3RWJA 1HVXA 1JZ2A 5KOMC 2A6IB 4F7PB 3ZUNC 4C58B 1BZOA 4Y5XB 4X8JB 3QC5X 1MPAL 1A14H 2FAUA 3FQTB 3KDPB 1V3JA 1KLGA 2Y2WA 4M43L 1VESA 1QRNE 3C9NA 2ENSA 2V2XA 3B5HA 1KIUA 1K6QH 2Q7NA 4XXWC 1DVYA 3QNFA 5DHVA 3O9WB 4ZW8A 2WXPA 3QZOA 4KQ3H 5BUPA 4U2ZA 3TWYA 5ILTH 4Y19D 3HRPA 5CP7B 1I3GH 2CMRL 1FVEB 2ICES 2VSDA 1CD8A 1RZ7L 5HHQA 1B4RA 2A74C 1I4FA 3P0VH 1ETZB 2FBJH 1WISA 4OTXL 2FNWA 5JW5B 3UTQB 2CDEB 2VDQL 1AHMA 3MRQB 3M8OH 4TVUA 5I8CA 4W9EC 1UA6L 1M42A 1OVZA 3RE0A 4HULB 3NCJL 4W9GC 1UOVA 4U1JA 3SIKA 1BG1A 1J1PH 2CJTA 5GS1C 3SN6N 1A6AA 4UV4L 4XHJD 5HYQB 4FXKA 3VB9A 4UTAA 1ZLWK 2GEQA 5D7JD 2H45A 3F12A 3NZ8B 1IUZA 3FB7A 4R4NC 4X5RA 3TJEL 2YBRB 2E5EA 4YFDB 2HWZL 3CWGA 4UT6H 4K3DH 2CJUH 3MZGB 2D0GA 3CVIH 3BUIA 3O8XB 3LNHA 3SPJA 2WWKO 5I8EA 2DYSB 4ZD3H 1HX0A 3AUWB 2XG4B 1FUNA 1ZOXA 1W9XA 4F33B 3EOTH 5HHOE 2EH7H 4KUCF 4PWEA 1R75A 2Y7SA 2J5LB 3EDEA 1LJMA 3JV4A 3CZUB 2D0FA 1YSOA 4JPKH 3QJFA 4Q9QH 2NRDA 3N43F 2B4CC 4R90H 1THCA 4KVNH 1UXSA 4OZGF 1KZQA 4GRWB 1TJIL 3A21A 5E6YA 4KROB 4HMDA 5AAMA 2B1AL 2DRUA 3B6SB 4NJ9L 3VFTA 4F3FB 1DCLA 2H5UA 1B3IA 2V2TB 3GSWA 5B3NA 1ND0A 3DSFH 1EERB 5CP3A 1S46A 4HUWB 5IBLC 3FB8B 5SWZB 2ILLA 1OCCB 4J7RA 2YA1A 2G5BA 4DP6X 4CN4A 1MCIA 5ACMA 4I18B 3ZRFC 1WP6A 3OLIA 3JV5A 1QBML 1ACCA 3L3OC 1AI1L 3SGEI 1JHKH 4U1HB 4OGYH 2VE6B 2IANB 3GD1C 5FGBC 5FYLD 5HDRA 3S36X 1BM3H 3U2IA 3WIHL 2M2DA 4OJDH 4ODVH 4PJDE 3HZMB 5B4MC 4JR9L 2UX7A 4CGTA 4EVNB 2Y7OA 5HJDA 2VXSL 2CDGB 4DWHA 4MJIB 1PKQB 4V2CB 2VMDA 1JCKA 1R3KB 1GS7A 3EFOB 1DR9A 4DGYH 4LASH 4YL4A 3TVMA 3IDUA 3WKNA 2AJ3A 2OMYA 1TTAA 3E6HA 4M93B 4G8GB 2XV6B 5C0BE 2B9BA 4V1DE 5FLUA 5D6CA 5F0LB 4QHLA 4X4YB 4E36A 4AM0A 4EZMA 3NJHA 4NWTH 5DI8B 5T1JA 2DWDA 3MUGA 3VWJB 3WFDL 4ZW7A 4AV5A 1T66D 3WTYA 3CQQA 3Q6FB 1VEMA 1BPVA 5JQHC 2NTSP 3B1UA 5CINH 3B8SA 1UWFA 3NIFB 3O4OB 1JHLH 3GJEA 3WENA 4J4PD 2EH8L 4RFNC 3ARDB 3V6FB 2IDFA 2NW3B 4MB1A 4XX5A 1XD0A 4GXFA 1JYVA 5E5LA 4LCCA 3QQ4B 1RULH 2SEBA 5F9OL 1LVEA 1PQZB 1FVEA 3MKKA 4CL7A 1P5UC 3KYAA 5L0QC 3MODH 4E41B 1FFTB 3D3VA 1Q1JH 3MRPA 4UINL 2ZZUT 2Z34A 3K6DA 4KTEL 1AR1B 2EXSA 1BQHB 1NOFA 2RCSL 1UADC 3PHAA 2VXQL 3MUY1 4LVHC 1BLNA 3PHQB 4RWHA 2CR0A 2QL1A 1TOXA 1XGRA 2AV7A 3NK4A 4ODXB 2OKMA 4R2GD 4UYPA 2JF1A 4OLXH 4PJIB 4PY8J 1KDIA 2V5SA 2HLAB 4L4TA 3R7RA 5BZWB 2IH9A 1MCDA 2OCJA 3VGEA 3IMSA 1ET8A 4YDVB 5IJVB 5KN5B 3C60C 2BNUA 5LN4A 4AW4A 3W3BA 2X12A 2XPGA 3GSQB 4X4XA 4XN8A 4Z77B 5KYXB 4KTGA 3FU7A 3AXLA 4P5MB 5D1ZI 3HG3A 3GB7B 1I85C 4F92B 4OQTH 1MFBH 2FTAA 2Z1PA 4HHAA 4POZD 2J57A 3PUUA 2YRPA 3A22A 2R9HD 5DUMH 3EYUH 3MLUL 4G7RB 2CO1A 2DL2A 2ROYA 1PYWB 3VGAC 6FABH 2AVFA 1ODAA 1RHHB 5EZIH 4IOSA 1UUNA 2CO6B 3C5ZB 4XOAA 1JMXA 1Q9OA 4HG4J 4UTBA 1A7PH 1SJMA 3MOBH 4LSQH 4LF3A 4P2QE 3D25A 2J1KA 2NX5A 3JV4B 4NZRL 4N22A 2MCAA 3ARFA 4N4YB 4W9JC 2C3GA 1MFEH 2OMXB 1LO0L 5EBMA 3UYRL 3KPRD 2IFFL 2NT0A 3RNQB 3CFKB 3BSZH 3MGTA 4M3KB 4AGNA 1OSZA 5J7CC 4BZ1H 5KSBB 2FJHB 2OTWA 2WNKA 3KPMA 3GPEA 1U58A 2H6PB 2FBJL 2WLYA 2WNWA 4OTXH 3UAJA 3HMWL 1T6WA 5EN2A 2AXFA 3CPLA 1RKRA 4CKQA 4G1MB 3JT0A 2KT6A 1F56A 3JWDL 3TF7C 4WI4A 5ETUA 3HN5A 1HT6A 3JWOH 4UIMA 2A77H 2J1XA 3EJTA 5MEND 3BQVA 1OD9A 3LQMA 5AFAA 3GIVB 2Y69B 3CFMA 2XZCH 3VD3A 1CLVA 5IREA 1JYXA 4C83A 4PTTB 1YEDB 4XR8C 1ITCA 2FD6L 2V33A 2WUCH 3MCYA 4AVKA 3TJHC 5E5UB 4NQEA 3GJFK 4FX5A 3FO0H 4TQIA 3U25A 5K5YA 5EOTA 3FTWA 4R97B 1TFHA 1J9RA 3VO0A 2IBBA 2R29A 3RAJL 2Z7ZA 3OGCA 5EOCH 4XRCB 3GXMA 3ZZSA 2UZYB 5IT2L 4X7DC 3UAAA 1E6JL 4P06A 3VD2A 4NI3A 4QRSA 3I74A 3QCTH 3H3KA 1ACYH 4QCIA 2VDLB 2EKSA 1XH3B 2FJFB 5DRZB 1L9TA 2J72A 3QUYB 1AS6A 4HU2A 5T5FL 1I1AB 1U8JA 3CFEB 4BFBD 3AADB 2RQ8A 4LRNL 5F9JA 1TJIH 5CNHA 4RWYH 4WTZG 5EO1A 3SSGA 3LHPH 5I8OL 2IQAB 3DK2A 3BD4A 1OAKH 3EDKA 2QSCL 4K07A 5KSAC 4JFFB 3D87B 1P6AB 4BWTA 4LSRH 1I1FA 5F3FA 5ACZA 4U1NA 4JRFA 5ICZB 4R97C 4JRYA 2BVYA 4J1UA 1JZ4A 2EDXA 5J12B 2VDQB 2JCCB 4YSEA 5FYLL 2QR0A 4PRAA 4QRTA 3TTYA 3QZPA 3U4EA 5AB1A 2HLFD 1NPUA 3MCG1 4OGYL 2A83B 4ORGA 1SGKA 3ZRCC 4QDGA 1V7NH 1XSOA 2Q20A 3OAWA 4Q74A 2W60A 3FUHA 2DQCH 4B9IA 5CBEB 1HYRC 4HF5H 2Y2YA 5T3ZE 2NYKA 3LY6A 4R2GB 5HHPB 1T22A 2BP0B 4F2MB 1ZT4A 3VU2A 5JIPA 4DGYL 3GI8L 1AG0A 4JW3A 2CRMA 3QPXL 5F96L 1KOAA 3FAWA 5BS0B 1T4WA 3L3DB 2AQ2A 1U8NA 1KZYA 1NLDL 4F5CE 2HTKC 5KS9A 1E8YA 3HBQA 3V4VL 3EBGA 3I3DA 3H53A 1WWBX 2RACA 5AZUA 4BFEA 5I6XC 2XQBH 1Q9WB 1Q1PA 3GEWB 3VWJA 5ECJE 3NQIA 4JFHE 4GG6A 3T77A 3QORB 1WG3A 1AGFA 1U8JB 3BPNC 4OZHB 2Y5EA 2FGWL 3FPYA 3GSUA 5CINL 1J8HD 4ZX5A 2FUTA 4ZZFA 1WICA 4YIQA 1EHLH 3D4GA 3IJYB 4EZKA 1JHLL 5A1AA 1C5BL 3T0XA 2NXZC 4HLZH 1IAIL 4KGLA 4JPIB 1NCWL 1VSCA 5K39A 1E9OA 3ESMA 3PFUA 4HKBB 5I6OA 1XGPB 3B56A 3CSFA 4NO5A 4LHUD 1QACA 3Q43A 3US9A 2CDFB 5A3ID 2CRYA 4XP5L 1CE6A 2VRKA 2ZCKL 1LE5B 1OCRB 2QKIC 2JLPA 3KLAA 5KVDE 1OOAA 1AKJD 2P46B 2FECL 4FNPA 5JIQA 3B7SA 1FL5B 4WWOA 1P4IL 4G8EA 2ZKHL 1KACB 1SVBA 4OLXL 3A67L 1QMUA 4Q89A 1U8OA 2OZ4A 4Z23A 4Q0XL 2RAMA 1TVBA 2BZCA 2NY1B 4HS6A 4JRYE 4OLVH 4HXBL 2LE9A 4QYOB 5C0BD 4NRXB 1J1XL 1DVQA 3PWLB 4ZO6A 3N9GL 4GIPD 1FGVH 3QIWC 4LQFH 4PIBA 4W81A 3FCGA 4TPRL 3RUGE 3EO9L 3UG3A 5I76A 3WD5L 1CVRA 2WXIA 2QKIA 4A2HA 2WD0A 1MAMH 2FCBA 4QMEA 5JXEA 3MLWH 2P8MB 1EFXD 2HFGH 5KVEL 3BKCH 3MRJB 4LOVA 5KYYA 4NHUA 4ZPTA 5F7EH 3ZLQC 4LPUA 4I48B 1DYZA 1V3KA 2XTJE 4P5RA 4ANVA 1CTOA 4YC2B 3W39A 4L1HA 3STZB 4R96B 3HG5A 1UJ3A 5JHAA 3SYQA 4XCYA 4UQEA 3CBRA 3FYIB 4QXTA 2L8AA 2NR6A 1CK0L 4NQSA 4D7BA 4TQHA 2X28A 2Z35A 2AK4D 2K1MA 5EU3A 1FCGA 1GJUA 5FM5O 2HSIA 4RESB 3KNBB 2VW7A 1F3RB 3RDTA 1XGYL 2VOTA 3CZLA 4OT1H 1GC1L 2OL3A 3JTBA 1T03H 3T65A 3L9EA 1FFNB 2FT8A 3U0PA 1E3XA 4HX1A 5EBMB 1AO7E 4LK4A 4PREB 1KTLB 5C6WH 2BP5M 3T2OA 1QHPA 1IQDB 1DL7H 2XVGA 3CFTA 3NIDE 3PHOA 4MA7H 1Y1UA 4N9GA 2AXWA 2J2ZA 4NUGL 3VI4F 4RRPA 3RB7A 4JLRB 3MUZ1 3PREA 5TE7L 2Z9TA 1XCQB 1FZOB 2ZAGA 3IF1B 3G5VB 1AIZA 2OJEB 5C0AD 3JWDH 3UTZB 3UZVA 5EG6C 3MAWA 4MZRA 4ETYA 4ZS7H 5I76B 3G6AB 1JZ6A 4H8HA 1DBAL 2ATKA 5MP6L 1SUHA 2QHLA 3PWUB 2R8SH 1ET7A 2JB6B 1FE8H 3MBED 1MCPL 2EC9T 3GWJA 4GXUM 4H20L 2AV1A 5K69A 4DKEH 3LIZA 4JZJA 4EZLA 1NGZA 3D51A 4ZI8A 2E7MA 5CLWA 5IKCA 5C09B 4QT5B 1UM4L 2ADIA 2JJUA 5DQDL 1ES0B 1ZGLA 3TT3H 1CTMA 3I9PA 2WHVA 4GI8A 5ID1B 4N2HA 1GTFA 2UY7A 4P5TC 4ZO9A 1AD0A 3HS0A 5EZOL 1PG7L 4YWGL 4B60A 1HESA 4S10A 2H1LM 3V6OA 1HQ4A 5IFAL 4MD5B 2IDCA 4HPYL 5GGTL 4K9EH 2Q87A 2LABA 4N0CC 1CYGA 1JL8A 3TT1L 4PJCE 1MWAA 3P73A 4W6XB 1Z1WA 4K5PA 1G7LA 2AJSH 4JQXC 2Z35B 2FJGA 2PTUA 5BCAA 4KY2A 1F11A 3HS0C 3QQ4A 3QYMA 4PJ9D 4N6RA 5A2IH 3LN5A 2AEWA 2Z6FA 3ECBB 4JG5A 4G9FA 4X6BA 3KH3A 4YE0A 4JREC 4P9HH 3OAYK 3QG7L 1PD1A 2AQQA 4XVSL 4ADGA 3VFOB 2VDOB 2H9GB 3T2QA 2LLLA 4FQXD 3O8XC 4QTFA 2YEQA 3VYOA 1D9KD 5JDSA 3LZQA 1MXDA 4X6DA 4XWGL 5JW4R 1BOYA 4NXSA 3VXTA 5E8NB 3VFPB 1DFBH 3G04B 5BRZE 3AT0A 5AB9A 3KD4A 4TQ8A 5INDA 1I8IA 2R9HC 4HUVA 4Y1AA 5EPMA 3N1MC 4HS6B 2F53B 4JHWH 3WIFB 4BFIB 4BGLA 5E8OA 5CWSA 3FMGH 3BAIA 2FE0A 3QEUB 2ZF8A 1T21B 1OD7A 3ZY7A 4ZBJA 1QPPA 1NLBH 1RZ8A 2YO3A 4X6FA 4BFKA 1GYAA 2DQIH 3M07A 1CF1A 4PWJA 1HWGB 1FNHA 1I3RA 2BOBA 4RAHA 1I82A 4KKCC 2OXGB 1N64H 1DJIA 1T1YA 2OMWA 2XZAL 1MREL 4HGWA 4CADA 4IIQC 4IGBB 4K8RD 3V4VH 4XPAL 1M05B 3L3KB 1D6VH 2YMTA 2DLHA 3QT2A 4Q6IA 4Z7QF 1E2ZA 5JPMC 3EGSA 2Z8WC 4HPOL 4KKAC 5ITBH 4HYTB 5C3LD 3CFIC 3RIKA 2QHRL 1RZIB 3TZVB 5HYEA 1XMWA 1JVKA 4X8GA 1I9IL 3MTRA 1KN4H 4G9DB 3OXSA 2K8MA 1OCZB 5LCVL 4HBCH 3QIBC 1H8LA 1JOIA 3DV6B 1SEQL 4WQOA 3BT2L 1MW0A 2J56A 1SOQA 4HC1A 4Y2LA 3BW9A 3WLBA 4FQ1H 3HAEG 5DJYB 4AQ1A 4RAVB 4AZUA 3GUFA 2OI9C 3PJLA 5E1IA 3AFLA 1ED3A 1G9HA 2G4GA 4HEMA 5H35A 3ELQA 4LOUD 3HBPA 1QBLL 4M5SA 4Y9EA 2BVOB 2TRHA 3SE9L 4C55A 3SPVB 3GHEL 2JNZA 3BPOB 3ZDXB 3VXRD 3ZKXB 2ZSVB 1WJ3A 4UNUA 3KHOA 2AW2A 4HXBH 4MXQC 1HCFX 5IJCC 5KBDA 4UQ2A 5SWSD 1INDL 4RZCB 2ZIDA 3DURB 1UB5B 4PBWD 3DUSA 1N12A 5B4MD 4HH9A 3RGBA 1N8ZB 5TH2B 2GITA 3S4SG 1UCTA 3DHMA 4TNWK 2F8XC 1H8OA 3COOA 4XRCA 1N0LA 1LWHA 4H1LH 2W65A 3VQLA 4XMTA 5EOCJ 1ZLDA 2RJMA 4Y7MA 1QX1A 1EAQA 1DLHB 1E4KA 2F19L 2VT0A 4LLQA 3TBVA 5DVKA 2P8LA 5E70A 3OJDA 3DGCR 2MOVA 3ARBA 4OJYA 4G3YH 5AOIA 3OMZA 3BWUC 4ILDA 4WNQB 3ZE1B 2Y25A 3X14A 2EXTA 2BIIA 1JPST 4FQ2H 3DHUA 4NNPH 4XP1L 5ADOL 1WZMA 1ZV9A 2C3WA 2M83A 4E9VA 4QRUB 2XVBA 1IGCL 3PE9A 4FL4B 5F1OB 1DLFH 2FH6A 1OAXH 4KKQA 3NJGA 2XN0A 2CCVA 4IQHA 3HZYB 4J5VA 4M1DL 3AROA 4LKCA 1N18A 3NSCA 5FGCE 1KTCA 3JYBA 2A74B 2NSQA 3LNDA 4XXWA 3C6LC 5MEQB 2V5TA 3FO1B 3CBKB 3NCCB 3GSQA 1MCNA 1SFHA 4DAGL 1H9DA 1K4DA 4DK6A 2CJUL 1JS4A 2ZWYA 2EYTB 4PJ5B 3KE0A 1MW2A 4FFZL 4MB5A 3O6FA 2GAZB 4PR5B 3LRSA 4HJSA 1B0GB 1F41A 2XWBA 1F4YH 3T71A 2BO0A 3VSUA 4E42B 5DD6B 1BWWA 3VQ1C 2VQ1A 4P46B 4H88H 4PJ7E 2P3YA 1KT2B 4YK4C 1PG7H 4YWGH 4JY5H 1E5UI 4ZUVA 4PCKA 3TO4C 1NKRA 3QXVA 3G5XA 3T77B 1CFSB 4NPKA 2XPZA 5ALBH 1DLHA 2FX8H 5DMGC 3V6FA 4R83A 5KZCD 5EU6D 1G6RA 3UTSA 1OB1A 3O2DA 4WDIA 2YFOA 1SY6A 2K4AA 3CCHA 4QAWA 25C8L 5IMLB 1EEZB 4WWKB 2J5LC 2RB8A 2XC8A 1EXUA 2X9WA 3V0VB 3QI9B 2DBLH 4OGXH 4OZFG 1JZEA 3WGUB 2R4RL 5FYJD 3NSFA 2P47B 3I3BA 1B0IA 4N90D 1IJNA 1NUGA 2BSRA 1XR8A 4KKLC 1OP5H 5J6SA 3QYCA 3N1FC 1VADA 3LRLA 3QH3B 2FVNA 3W38A 2FWSA 5TDNB 2J2ZB 5IQ7H 1XGTB 4GO9A 4WSKA 4PGCB 4XP4H 2EDEA 3B7YA 3FN3A 3K6NA 3UG5A 1DFBL 1KV7A 4K7PX 1RK1B 1PKOA 1E40A 3P30H 1T66C 2BNUB 4K73A 1PX3A 3QP3A 4DQOL 3L5JA 1HL8A 2APWA 4PB0H 2GBVA 2OMUB 1XD1A 1ECZA 1M7UA 3F7YB 3OMAB 3QUYC 2XWCA 4YUEH 3V55A 3L1EA 5DS2A 6TAAA 1V7ML 5CN1A 1JGLL 2VDKB 3OHXA 1PZUB 1S7TA 4PRDA 4WGVB 4IOSD 3MRCA 3ULVD 4TUJB 4ZMQA 1IL1B 5I6KA 4U1LA 3U30C 1ZA3A 2GJ6A 3JXAA 3GKZA 5AW2B 3IFPA 3SODB 4J23A 2XSKA 4G6KH 3HPJB 4IRZA 1W0VA 2H26A 3NCJH 1X9RA 4KMQA 3GMMA 3TPUB 3B43A 4KFZC 3ZSSA 1OARH 2EH8H 4AG4H 4AZ8B 3DECA 3OHXC 3CZFA 2NR6D 3IDMB 4A39A 4FADA 2YPLD 3FL7A 5CIPB 5ITBL 4ETQB 1DDTA 3ZR6A 3IU4H 3TU6A 3SE6A 2A6DA 4P46D 2X88A 1WEJH 3WJMB 1DVFD 2XA8L 4YFEA 1AP2A 4UT6L 1NMAL 2YKLH 3AC0A 3ARXA 3L7EB 3BAKA 5I9QB 4LPVA 4N8CH 4NM4L 1S9WB 3GMNB 1NCDH 2I32A 1KCVH 1KB5A 4EUPH 2IANA 1XGRB 1BFTA 4YNYB 4FQ1L 3WLBB 5HPMA 4IKKA 1G87A 1PS3A 1JSYA 2ICEA 5HYJB 5JHMA 1T5WB 1J05A 5I1GH 4AEIL 1HL9A 4NLAA 4CRPA 2WQAA 1P4LA 4DKAA 4ANXA 5JLZA 3AGVA 1I1YB 4BFNA 5JHLA 3BLBA 5CILL 1GGIL 5F7KC 5AL8A 5IVXB 2RHEA 3VU1A 5BQ7A 4OI9A 2WTPA 1TTCA 4NKDB 3VXMA 3SKUD 3QDHA 1ID2A 2B1HH 5C07A 4L9LA 5K9KA 1XSKA 3FTVA 1GC1C 3GSVA 3D1MC 1I1AC 4L3ED 4JY6A 3ARED 2ZG1A 3FPXA 1YVLA 1Q0XL 2HRPL 2VXUL 3T8MA 3D9AH 3QEHB 3D6GA 2VM4A 4ONGH 5D96C 5AVQB 2PW1A 3QZWB 5IEHA 2A4EA 2RIKA 1JDDA 4IDLA 3AXIA 2BJML 3ZDZB 4AE1A 3DUSB 4Y5VB 1MFMA 5EZIL 3VSTA 1EO7A 5AD0B 3ML8A 1NCAH 5D7JC 4YEEA 3TZVD 1E2WA 1YDPB 2HXAA 4PJXB 4OFPA 4JGNA 5J11C 4HV8B 5DMIH 3NOIA 3WNPA 5LBSL 3VXUD 2HN7B 4BSWA 2I25N 2OR9H 2X42A 1BXXA 1QSVA 3OX8B 1LO5A 1QFPA 4FNQA 4K23L 4NUJA 1GR7A 1S9KC 5JHDA 3VGAB 1MG3C 2V2XB 3U36A 4A2LA 2X4UA 4YHNA 1WIPA 5ACLA 1WUZA 2AXHA 3U0WH 3MRFA 1JXFA 3U6RB 1QSEB 4DEPB 1P1VA 3CXHJ 5T3XD 5LXGH 3N91A 5C0FA 3KMDA 4BRJA 4X6DE 4I13B 5D2LE 1INEH 3SDAC 1A8JH 2DTML 1S2EA 4HIEA 3E6FA 1BXUA 1ILUA 3PU7A 3WXVL 1UH2A 4PG2C 3ARTA 3S8GB 4P2OC 5JORB 3W11D 1NM9A 2X4TA 4DH2A 3HR6A 4OQTA 2I85A 1G7HB 1IGIH 2JELH 5D9SA 4ZTOL 3WFDH 4F9LA 2EEXA 4G9FE 4UU9B 3DTXB 4PBDA 3E0GA 5FAAA 3SGJC 5ETUB 1U8LA 3LKSB 1UQSA 4GW5B 2BRQA 4ZAKC 2OJEA 4ODSH 1OAZH 2NNAA 4YJZL 3IDGA 2Y1YA 2NCEA 9PCYA 4QRPE 1CBJA 2O61B 1X9LA 4W9LC 3X1GA 3BVNA 4D8PB 1RVFL 4X5WA 3RHWF 4M48L 3RIAF 2WUBL 3HR5A 4MKTA 2JV6A 2XV0A 4KUZL 3IFNH 3U7WL 2IANE 1OGSA 5KTEH 3QJTB 1W0YT 4QOKA 3MOAL 4P2OB 3VH8A 4NUMA 3Q8EA 3OLGA 4DK3A 4HG4K 1VFAB 4BZ1A 1HL4A 5GZNC 2VCOA 1I7RB 3KPTA 3HS8A 3T4AA 4IMKC 2YA2A 4YXHH 4AQ8A 1TQBB 4K71C 2HKFH 3S7GA 4PJHA 1KGUA 4B6ZA 5KVGL 3OKEB 3HFMH 4XT1C 2FX8L 3SPHA 2Y2TA 3PWVA 1DQJA 3QISA 3UOAB 2QADB 3DO7B 4XCNA 4L0YA 3RVXD 4KY1H 4P5TB 4WENB 2IVFC 5TF0A 5J8OA 3ZRSA 2X70B 3IBEA 2R4SH 2Q7AA 4L3EA 1G7HA 3L9RA 4YSOA 2WZPA 4L1SA 1LK2B 3RGHA 3IMTA 3CU7A 3HE6D 1T0NB 4LSSL 3WMPA 4XVJH 2K78A 2V3DA 2HTLC 4IBLT 2Q0ZX 3MU3A 4YGVA 2Y7QA 1J0KA 4UU9A 2DQCL 4B9PA 2H2PC 2FR4B 1IEBA 1L6ZA 4NZRH 2BERA 4A6YL 3EYFB 3L95B 3BP7B 1IC0A 3RZCD 4HK0A 1KEML 1R34A 1JPFB 1SJHB 1JFQL 3IVKA 4MZ2A 1Q9LB 4K5MA 4ESKA 3O3BB 1NLDH 2KDGA 1LNUB 1BV8A 4HZLB 5EU7C 3W39B 2PYED 1RJCA 4NZJA 4G8IB 3ESNA 5FHBH 4YSDA 5IEKB 4RISH 4KNQA 2QPEB 5DD6A 2A0LC 2CO6A 3OQ3B 4F7PA 5KOVC 1HNFA 5FS5A 1HS6A 3UO1L 1FPTH 4HUUB 1ROWA 5DVNA 2YN5A 2DYRB 1T7VA 5I23A 4N0UA 1S9XA 4NNXA 3RZCB 3KPOA 5BOJA 3QXTA 3PNWA 2YRBA 3IRPX 2W1NA 4JFPB 1AZRA 3GJEB 4CVZA 4EF3A 1ZMYA 5E8DH 3PAZA 1NCJA 4DKFL 1QBAA 5L6YL 1FZJB 3CSTA 2XA8H 1IAKA 2WVVB 3A4DA 1N0XL 4ZFOL 1LE5A 3F84A 1CD9B 3RP1A 5DEGB 5GISL 4YGAB 4HMCA 4MASA 1UWGL 2F7QA 3K74B 1LEGB 1YRKA 4JN1H 4CW1B 4MJJA 3PHQA 4QJ5B 1A4KB 5HYQA 1AR1D 3CN4A 3N2JA 1HHKA 4NQVA 4M7ZC 5F93C 4LFHG 5BXFA 2IADA 2XXCB 4FE9A 4L3CB 2B4CH 2WWMD 4LU5H 3GSXA 4P3CH 4HJ1A 5EF3A 4JVUA 3HVNA 1AC6A 3KBHE 3DETD 4OD1H 4WUUE 4JJ5B 4ANUA 4AEEA 1CLCA 5CFHA 2X1WL 3QUML 1IM3D 4FF9A 1AQDA 4Q2ZA 3WKMH 1I9JL 1J9CT 3AW5A 5EORL 1PFCA 1BFSA 1LP9B 5EU4B 1DSWA 5C6TH 3O2VH 4Z7WF 1F90H 3FTYA 5GRJH 2CRIA 4U1LB 1BVKB 3AWFA 3IBOA 2ZUYA 3BZEB 4I1RA 1V55B 3RU8H 2DQEH 2R69H 2RBLA 4KKLD 2CJ3A 4KDTA 1W0VB 2CHNA 4AUYA 5F8QC 1KLGB 4EIGB 5DEZA 1PZ5B 4JFHD 5CBAA 2D9CA 5E56A 2H2SD 1O6SA 1W72L 4IBZA 5IM7A 3S3JA 4N0FB 1BYOA 3DOSB 2OZ4H 4EI5D 1YMHA 3NH7H 1EJ6A 3FFDB 3T09A 4KMLB 1K8IB 4I18A 3T0EB 4KAQL 3O6FD 3H9SA 3WE6A 5FR3A 4JRYB 4TRPL 3C5JB 2G75A 2VXVL 3GSWB 4NT6A 4KI5F 4PS4H 1INEL 2X9YA 3QNZB 1E4XH 2OTUA 4WI6A 3LHAA 3QA3A 2BSRB 2B16A 4Z7NE 3N06B 3PL6C 1EV2E 4BWUA 5DEGA 4ELME 2ID5A 3LEVH 4PJFF 4H4NA 3L81A 4FXLA 1UHVA 4U1JB 4X80L 4ZS7L 5FCSH 4DP7X 5C0CD 4NPYA 5ILTL 1RUPH 3PYCA 1TYRA 3T3PB 1YYLH 5TDPB 2DPKA 1TZIA 5T1KA 3F7YA 2FQEA 4ORZC 2JE8A 5HHOB 2V7NB 4H1LG 4TNWF 5ECGA 3P0VL 3GSRA 4PB9L 1ES0A 2X53A 4PJFE 2VDQH 3MFFA 3FB6B 3KYNA 1GIGL 2X6UA 2ED7A 1SBSH 3CVHH 1S9VB 4OFKA 4U6XA 3GZPA 2E75C 1BMZA 3FRPG 5DEFB 4GJTB 3BEVA 3SKOB 2VH5H 3VFSA 4ZX4A 3AS1A 4MD5A 3BUTA 3NFNA 2OSYA 3TT1H 5KBPA 1UVQA 4XB3A 3V6OE 3OAUL 4QRRE 2NXYC 4JFWA 5FM5M 4FLOA 1S7RB 1L7IL 1HILA 1UURA 1C5DA 1M53A 5JO5B 3FCSA 1X44A 4PH8A 4PJAA 4QWWC 5D72L 4Y89A 3WYRA 3BH8B 3HKZA 3SDDC 4MGXA 3RVVD 2EIJB 2IG2H 2DB8A 3TIEA 4P05A 2Z93B 1HCZA 3BDYL 3HFML 1HCVA 4JPSA 3U1PA 4DESA 1S7QA 2CO7A 4CVZB 1RFDL 1DVFC 2BS9A 3O0RL 2AJYL 4ISVA 1PBYA 5IFJB 3WY3A 3KPNA 4AIZB 1NC2D 2P5PA 4Z7UB 1YY8B 4KU1A 4M7LT 2YJLA 5T1KD 4R3SA 3PGFH 3TNNB 4I2XA 4M43H 3VG9C 3FT3B 4UQ3A 5DO8A 1A9BA 1JZ8A 5F21B 4BD4A 3VXSD 4QTHA 4EN3A 2ZKXA 1E50A 2G5RA 1FFPA 4EDXA 3BQUA 5SV4A 1D6EA 5IR1A 1FIGL 2EYTA 4DFHA 4XC1L 1CDBA 5DD3H 3F7LA 3T8XB 1ZGLB 1XGQB 3OMNB 4TLTA 2IWEA 3B83A 3EJQA 1ZEAH 4X0KB 2XWBB 1B0GA 1GKOA 4WJKB 1MRDL 1Z3RA 2I9LA 3QWOB 4UOW1 3ZZ1A 1DQLL 1RIVL 4UOJA 5DD1L 1CGXA 1YEKL 2UXFA 3BIAX 2BHZA 3AG4B 2Q10A 1ZJBA 4M4RB 4W9ZA 4BXSV 4ODVL 5I26A 3TBVB 5ISZA 5GS0H 3DTDA 4UV4H 2H6UA 3JWNC 3QDMD 3T08A 2JIXA 2VXSH 5BVJB 4PGEA 3FFOA 3QIBD 4JQIA 3TIEB 2VZTA 1Z5YD 2CD0A 1NGYB 2UXVA 3ALWA 4TNVF 1DBAH 3R8QA 5BMFH 2ZXQA 5LAXB 3Q01A 1FE8L 4GXVL 3PWVB 3DO7A 3ZQXA 4JFSA 2QQLH 4UV7L 1DEEB 4PSPA 2LW3A 1AZVA 3BZ4A 3HAEA 3K1KC 1YUHA 1UM4H 5F1NB 3IDXH 1BQUA 5I15L 3GHPA 4Z7OE 4WWNA 3KDMA 1H6TA 2ENYA 2PWEA 4L48A 5CFAA 2ZTBA 3NJMA 3BFQG 3MNVA 1PNDA 4NC0B 1TT6A 4IU2A 2NUPB 2ICWI 5GZNA 4N2KA 2WLHA 1M71B 2VL5A 1LO4H 1CDIA 4HIXL 1EAPB 1TZHB 4XWOC 3EFDH 1FL3B 3ZE0B 1PFOA 3DSFL 5KYYB 2EVJA 4KWUA 5LGKA 3FBQA 3QZLA 4YDNA 2O61A 3FTXA 3GSRB 4PVBA 5FA4B 3ATDA 3QUMH 3ZTJH 5BJTA 5IROC 4WWKC 1KGYE 1NMBH 3RKDC 1FNGA 1USZA 2EKSB 4QI3A 2KKQA 3W9EB 2IBZX 4OKDA 3WHE0 5JQIB 1JV2A 1TNMA 2WC7A 2XVKA 3O8XD 3T1WA 2R7EB 4MNQD 3QQ3A 3IS0X 4GP5B 1IGFL 5KS9E 4G3YL 4GMSL 1FYTD 2YQBA 4HFWB 2X89A 3VGDA 1KPRA 4JHWL 2DWTA 3X11B 5CBAB 3PWJA 4GRMA 2YSSA 4ONHB 2IV9A 4N25A 3TLRA 1OM9A 2ARWA 3MRFB 4X7FC 4OI7A 1J86A 2OZNA 2YBGA 2GCYB 4PYGA 4FFVC 3VJ6B 1NCCH 4IBWA 4LNVA 2QVMA 1L0XA 4KAQH 2DQIL 4MTMA 4P3WA 5SWQA 5IB2A 3S9DB 3ALPA 4JAMA 3AQXA 4ORGB 5FO7A 3S5ZA 4DGVH 2AITA 1EFQA 1MHHA 2WLLB 1NANH 1A3LH 4JE0A 5J56B 4P5TD 5INDB 1MVUB 2AEPH 1TYEB 3EYVB 3EO1A 1R5VA 5C3IA 3MTXA 5LJYH 1UUSA 2NQ3A 3BRDA 2H4EA 3A3YB 3QEQA 4K2UL 4GBXC 3H9SE 3RG1C 1CXLA 3B9AA 2IFFH 2YZ1A 1HHGB 1RULL 3P9LB 3K0YA 3F5WA 1CE1L 3L3DA 4MQSB 4WFFD 3WDHA 4RA3A 2CGRH 5B8CA 2RGSA 4R26H 3N42B 5SWSE 3GRWH 1ZT4B 2H3KA 2CKBB 5F7LB 4B3VA 2UXGA 2XG4A 1ZCRA 4A55A 2YUZA 4MXQD 2VSKB 1B2YA 1ZS2A 4OLWL 5T1LB 2D7QA 3BISA 2CBQA 5BJTB 3QXAB 3ZBMA 4M00A 1MFAH 3E8VA 4WHYH 5E9DA 5CGMA 1DBJH 3C6LA 4K4KA 3DBXB 5DF0A 3EJUA 1NFKA 2R83A 4BFGA 3KYOA 1IKNC 2KI6A 2N3JA 3FQ1A 5AYTA 1YN6B 4G80B 2E76C 4G9FB 4NQEE 4ZYKB 2IMNA 2BLFA 2XZQL 3FOMA 3CIAA 4HFWA 1EXUB 2A6DB 3B5GA 2I26N 3QJHA 2IQAA 5C0CB 2R51A 1U91A 2MMXA 4FEMA 3CLWA 3IJEA 3HB3D 3MKGA 5FFLA 3DUUB 2HA1A 1J9QA 4LHQB 4TUUA 1UT1A 3FKUS 1BMWA 4ZOCA 3H6AA 1NUNB 2BRRH 4N2CA 5GRZA 5AVZB 1NGXB 4H5SB 3GSNH 1U8MA 2OR8A 1H15B 2XV2A 3B37A 3F6LA 4K8RC 3ZMEA 4IOFC 3LEXB 1OWWA 4IIZA 3BP7A 1QRNA 3C6EA 4XXDA 4D0BB 1V7MH 3EYSH 1QHOA 43C9A 1HINL 1GZHA 3DJ9A 2D7NA 1THAA 1MLBB 1UOWA 1KJ2H 2B2XL 5KEZA 4M5YH 1RIVH 4G8FB