1ZSHA

Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (ip6)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
392
structure length
354
Chain Sequence
b'TRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSSDVAVELPFTLMHPKDIVFEDFARQRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin 1
publication title Nonvisual arrestin oligomerization and cellular localization are regulated by inositol hexakisphosphate binding
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 56
structure length 354
sequence length 392
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1zshA01
1ZSHA 4LL1A 1G4MA 4R7XA 3LH9A 5F0LB 4GEJA 4P2AA 3GC3A 4J2QA 3UGXA 2WTRA 3LH8A 1G4RA 5F0PB 5F0MB 4JQIA 1AYRA 4ZRGA 5F0JB 1JSYA 4GFXA 4R7VA 3UGUA 3P2DA 4GEIA 1SUJA 2FAUA 2WTRB 3LHAA 4LL4A 3GD1C 2R51A 1CF1A
chains in the Genus database with same CATH superfamily
1OF0A 1YN7A 3P4NA 4LBEA 1JHKH 2XTJE 5INDA 3B2MA 1VDGA 3GMQA 4YQXL 3NBNA 3UTZA 4D9RD 4NNXA 1JHTB 1U8JA 4K4KA 4PJGB 4DQOL 5EEXA 1VCBC 1SBBA 1A14H 2G9HB 4ZO7A 3RVUD 4KX8A 1P7KA 2YAEA 3CFBA 4FXGA 3K46A 3QO1A 1JSYA 3CTTA 4TQHA 4W1TA 5ECGA 4I2XE 3ATEA 5GISH 1Q0YH 5IJVA 12E8H 1AZNA 4BFRA 4NM8H 5JOFB 1HHHA 1B6UA 4BQ8A 4B27A 4KTGA 3IE9A 4NC1E 3NEOA 2NY1B 3W9DA 1D5XB 1OL0A 4H40A 4XC1H 1MUJA 4R26L 1QLFB 4JBSA 3UPRB 3T77A 1UWGL 4U1SB 1U3HD 4L9DA 5IUSA 3L16A 2VNCA 1EAOA 1FORH 1QSFA 4L37B 5C0BB 3ESOA 4NUJA 5AW3B 4D94A 2X41A 2QDWA 1P4UA 3UFIA 2WMPA 4ODXA 3V4PH 4WWKD 3BI9X 4RFNB 3VWJB 4NO2A 1EGJL 3V4VL 4XNXL 5D2LE 5C3LD 2C3GA 1TMCB 2XTJD 1O5PA 5DYOB 1JYVA 3CHPA 2YC1B 2OMXB 5HD8D 5TDNA 4AT6A 3CFCH 4TUJB 2E9WA 3NN8B 5BUAA 4DF9A 3FTZA 5DJDA 4ODBD 1MIMH 2VKWA 3WE6A 1LJMA 3B56A 2FX7H 3MV7E 4JZOB 5DGQA 4YNYA 2XA8H 4PJ5D 3HVNA 3QBTB 1R5WA 4GRMB 5AUMB 5AG8A 3EDFA 3HB3D 4OCYL 3T1FA 3L7EA 2ICEB 4OD3H 1ES0A 1XXDC 2GAZA 2YXVA 3QUZD 4E9RA 1ACCA 5JO5B 4J8QA 2PR4H 4JY6A 1MFUA 1E4WH 3MLPA 2Z31D 2E7HA 1OAKH 1PSKH 2AGJL 2D3VA 4J1UB 4YGAB 3M7OA 3JTSB 1AZZC 4X9BA 2CO7B 1GYVA 3R0NA 3TNMB 2QMJA 3W82A 1EXHA 4APQD 4LO9A 5FO9B 1AACA 4FXTA 5IQNA 5IMLB 4H0IA 4BZ2L 4BK8A 3RDTD 2V5YA 1ECYA 5CP7B 5T1LB 4O5LL 1F2QA 5D9SB 3U48A 2B9AA 1F0LA 2E8ZA 3VD2A 4CC1A 2JVUA 4FE9A 3OTTA 5L2JB 4BFFA 2ETWA 4ZD3H 2ALAA 4HEMA 4JRXB 1HH6B 1GTFA 3FC8A 4D7BA 2NXYB 2ODIA 3B4NA 1Y7VA 3L13A 5KSBB 1KJVA 1UUSA 3VRJA 2EDLA 1WFJA 3AREA 3D39D 2MCPH 2UYLA 3C09B 1Z0NA 5I16B 3AG1B 3ZKXC 1MZYA 3BKCL 3V5KB 3PGCA 1QR4A 4P2QE 1LDPL 4F8NA 1M1SA 2C9QA 1BEXA 5MEND 2F19H 2HKFL 1KB5L 2WQXA 3HAEB 1BEYH 3EGXA 4HS6B 3WMPA 2NR6A 5C3IA 5IB3A 1U93A 4JK0D 5KVDL 2XQYA 1AGBA 1JERA 3LMJL 4EI5B 4G43B 3PGFH 4YGVB 1IZJA 4KKBC 1SVZA 4N2LA 1WBYB 4QRTA 4WSJA 1DLHB 5CO1A 3GNML 3WCYA 4MJ5B 2YXWA 2V6HA 4CRPA 5AOKA 1Y0LB 4DUXA 4NNPL 2FGZA 3X14A 4XVTL 4YBQD 43C9A 3BP6B 4OJDH 3FBKA 3RWIB 2HN7B 2BOCB 1JVLA 3VXUE 3CDFA 2DIJA 5G5DB 2K8QA 4N20A 4X6CE 3SJVD 4AGLA 1T2XA 4HU8A 3AQYA 3ETSA 1HS6A 5T33H 4C56D 2KZWA 3HPJB 4OGXL 2WZ6A 3VVWA 2ZCKL 5F9DC 1U8OB 2NY7L 1P7QD 1QFHA 2Y22A 2EKSB 1PCXA 5KSAC 5IGXH 1PGRB 3FL7A 3QEGH 5IB1B 3QDGD 4XBEH 3TEXA 2DQIL 3H4FA 3RFRA 1TCMA 4AQ1B 3HUJE 4QXTB 4OD2A 1S7RB 5T8IA 4J3OC 5E5MB 2A2QT 4JFFA 2KYIA 1KJMA 4X8JA 2J44A 1ZD6A 5C7XH 1TQCC 4N2KA 4JZJC 1DN2A 2QQKL 2XX0A 1IIKA 4GQRA 4OQ1A 5EU4B 1EVUA 3HHMA 4YWGL 3LEYL 4HVBA 3N0PB 1QSEB 3CZSA 1IAOA 4R4FH 3G6AA 4IMLB 1AIZA 2G75A 3BT2H 4XBPA 2A83B 3RWCB 4LF3B 3DHPA 1HX0A 4JX0A 1E5CA 1OTSD 1WEJH 3DRTB 4EDXA 5IQ9A 5AW8B 4UQDA 1ZT4B 5DUMH 1T1WB 2E8YA 3CX2A 2XTJC 1ED3A 4K71C 2QR0A 4AQ8C 3V10A 3VXUD 4PY8J 1KCWA 1VADA 3ARGC 3MUZ1 1Q4NX 1VFBB 1XR8B 2VR6A 4YPGA 1NC2B 2OQJB 4KTEH 2ADGA 4PJ7B 3ZXAC 4FRWA 4M93C 5KBLA 3EJSA 2NY3C 5K1JA 3HB3C 1E8YA 1OAJA 2HT4C 3D50A 3HI1A 2VO5A 1DLFH 4NFDA 4JAMA 3OMIB 2J20A 2XPGB 5AW2B 1E27B 1AFVH 2EDFA 3LNFA 3BDYH 5BV7B 2BSTB 1HHGA 4H26A 2Z31C 5DDHA 3J8F7 1H3PH 2F61A 4A38A 2N56A 4XX1E 2XWZA 4TTDC 3NZUA 3PHQB 2ID5A 4LSPL 3SGDI 5BUPA 3C08H 4JLRA 3QJTB 1G94A 2JCCA 3UAEA 1EX0A 2R0ZH 2JJWA 1QX1A 4PJ8D 5DVPA 2FH8A 4AIOA 1CT8B 5JIMA 2OZ4L 1YEDB 2EO1A 2R51A 4RESB 1K3ZA 3CN4A 5DC2A 5BOZG 3QO0A 1AQDA 1KIRA 4P2OB 4Z8FH 1AAJA 3RDTC 4DO6A 4WI9A 4F7KA 5I73B 1MF2L 4JKNA 1IAIH 4EI0A 5L2KE 4GS7B 4R5TA 3OKNA 5LWYH 2XCMC 2WTRA 4K9EH 4P8QA 2VR7A 4OLZH 3OJMB 1WISA 3X3GH 1FLTX 5CP3H 4BJLA 2FK9A 3KXFB 3HEIB 5C07E 4ZS6D 4MZ2A 3SY0B 4FFYA 3ARFD 5DC0A 2XQ0A 4IJ3B 5I17B 3MRBA 5DMIL 3P0GB 1VGKB 2OMBA 5IK3B 1QA9B 2NZ1A 2X4UA 4AZ8A 4OUUA 5J89A 4N2DA 2R39A 3N43B 2IO5A 3HJ0A 1QFWH 4TSCL 3PV6A 4JFOA 5DUJA 3OAUL 1B3JA 1XGPA 2C3HA 2BH0A 1T21A 2B20A 2X3BA 4GQ9H 5HHNB 3FTGA 4L1DA 4Z3JA 3QI9B 5JUEH 1E6JL 2KLSA 4M61A 2GC7C 3C60D 1IKNA 4G6KL 5ANMA 1NM4A 5SWZB 1SYSB 3TV3H 3DXAA 4E5XG 1MNNA 4L4VA 2AHIA 3Q2WA 3T2QA 1WUZA 3MNDA 4GUCA 2H6OA 4YBQC 1WZ1L 1NCWH 1KXQA 2VR4A 4I77L 1ZXQA 1N6VA 1KYOK 1WGVA 3NVQA 4U1IB 1FSKC 5C9JB 4ZUVA 2X28A 9CGTA 3PDDA 5DYFA 3O6FD 4L4TE 2WUCL 3HA0A 5GGRB 2W95A 3ECBB 4Z78A 1YC8A 2Q3ZA 3HBZA 2CCWA 5C07D 4XCEB 2F7QA 1DDHA 3AU0A 3VXPA 1HHJA 1XZ0A 3HN3A 4XNZC 3PWLA 4A7QA 2ZSVA 3KH4A 4CSPA 3T5WA 4J4PA 3TT3H 4YS4A 2IAMB 3BP4A 3HC2A 4EN3B 2BWDA 2VLJA 1CICC 3HRZC 4WJ5B 2W07B 2Y3NA 1CURA 5HHQB 1J5HA 4O4YL 3GO1H 4ZYKB 1JHKL 1JAEA 1KN4H 4ZO8A 3ZR6A 4FTVE 1DSFH 5KZCB 3SE4C 4HUUB 2D31A 1RJYB 2C3WA 5AKTA 1CG9A 5EULV 3VXRB 5I6XC 2ZZUT 3UZVB 1WFNA 2PCFB 5C0GA 1EVTC 2QL1A 3R0MA 3ZTJH 4PRDA 5D7KE 1MHCB 4JO5A 2RBLA 4R7VA 1KJ2L 1OTSC 1Q9WB 2EDBA 5IF0B 12E8L 4NM8L 4JO2L 4R8WH 2F54D 2FWSA 3QNXB 5A2IH 4RQQA 4EN2A 1CDHA 3UACA 4KO6A 4TM9A 2X89A 3O4OC 4U6XA 5CCHE 5D7IA 2VXTH 4WI0B 5F0PB 5B7MA 3VH8A 3IT8D 2XJKA 1SJEA 5E1HB 2J8UF 5M7QA 4Y8DC 1EO8L 1FBIL 2C9RA 2WO3B 1UACL 2V7HB 4DPRA 5JZ7C 1INEL 3B9VA 4Q6IA 1CFVL 2YBGA 4WO4D 4NGHL 2WWKO 2Y7LA 5DFVC 2J5LC 3RLSA 4OU3A 1E3XA 1HI6B 2PW1A 2BC4B 1JPGB 4B9FA 3IDUA 3C2AH 1TKWA 4KI5F 3LXCA 4AQAB 3K6FA 1LK3H 2R8SH 4XNQA 4EXKA 1F86A 5J9PA 3IEAA 4JHVA 3IBOA 2APXA 2W9DL 2JV6A 2EIJB 4GYBA 5I30L 2V2TB 5D7KD 4IHBA 3HHSB 4XGZB 3K2IA 4OD3L 2IFFL 3QCTH 4FQCH 1T7WA 2H2SD 1F2XK 3QS2A 1E4WL 1I3GH 1ZHNB 1E4HA 2XFXB 2E7LC 2EXTA 3S3PA 3C6SB 4RNRB 2OJEB 1OAKL 3BZ5A 1M7IA 3O9WA 5C0EA 3L1EA 3MRDA 5C09E 4F27A 4UU9A 3ASNB 3O3DB 3VRLF 2HB0A 4MJ4A 2X4OB 4GUQA 4WI3A 1KTKE 2XN9D 1RCYA 5ESQB 4FNSA 5G4MA 3QAZB 3MRCB 3ERXA 2VMJA 1H0DB 2JK5B 2Z34A 5BVJB 3IXTA 1T83C 3UBXI 4JANB 3E6HA 2KQMA 2VXQL 3WNOA 1WFTA 2L4OA 2CM6A 3PUCA 1UZ8A 2FSEB 4M02A 5TDOA 1E2ZA 4MMZC 5DRNB 3V0WL 4AXWB 4B3EA 4ZD3L 1HQ4A 2EIDA 1DEEB 1MNUH 2Q8BH 3OGOE 4XWGL 2E76C 3FB8B 3BOVA 3TN0D 2FLRT 4AENB 4K7PY 2EC9T 5JHAA 1TETH 3JYCA 1EUTA 5CZKA 1K9TA 1HC1A 2H1PH 2A9DA 2BOBB 2BVPB 3LD8C 3WLBB 2PPEA 2F19L 3LEXB 4GRLC 2B15A 1DVFC 3FKUS 2DWDB 1AY1H 5JIDA 3CH1A 4UZGA 2OULB 2WLKA 4KKAC 1VCAA 1TZOA 1WVZA 2J1ZA 2J4WH 1AC6A 3GLDA 4LCUA 4Y1AA 1JG9A 2X4SA 4XOEA 3UO1H 1BBDL 1F4XH 3ASWA 4MJ2A 4XCCH 1GGYA 4MDIB 4YDJA 2GHZA 3MLWL 4PRNA 4YHPB 5CU5A 1I1RA 4GSQA 3T8XB 4A1RA 3C9NB 1CLVA 4HG4J 5IUCA 2BZDA 2W65B 2CNYA 3B7YA 1EANA 3C6LC 5CR8A 1M1XA 5A7BA 4HBQA 4HIHA 4GJTB 1YEFH 2EZ0C 1AHWB 5BRZD 3S5ZA 3P54A 1A7PH 3L3IB 2JQMA 4Q52A 3SDYH 5IVOA 3SDCD 4PRBB 2FLMA 1Q0EA 1YEWA 1RUQL 4NI3A 1V10A 2HVBA 3DGDA 2A99A 2WLMA 1MFAL 4GG8A 4XXWA 3DJRA 3I75B 3KPMB 4ONGL 5F21B 5IT2H 3GC3A 3AM8A 4QHPA 1TTCA 3QEGL 1JI1A 4DUWA 2JKWA 4XBEL 1VFOA 2GYSA 1MI5E 1M7DA 4L3CA 1U2CA 1UB6B 3PGDB 1J88A 1EJ6A 3NCFB 5IW3A 4WI6A 3VFSA 5K5YA 3ZTNL 5KVEL 2J25A 2WXIA 2E7MA 2DY2A 1SY6A 4JQXC 2K6YA 1FYTD 1UCTA 2IDFA 2P5WE 3N1MC 2Z65C 4HWBA 5C7XL 4DP2X 3FUJA 3BESR 3CQFA 5EPMB 4ATWA 2OTUA 2R2EB 4F91B 4GKZA 4BFNA 4Q58C 4KV5E 4R4FL 3F7QA 3DROA 1ZV9A 4FA7B 4WO4C 2B1HH 4LMQE 1EEUA 4TNVF 2C4FU 9PCYA 2HH0H 4ZOEA 4I1NB 3GDBA 4CSZA 1KZYA 3V52L 2I7SA 3EKCA 1GAFH 4HKZB 1R3KB 3AU1B 5E1QA 2CR3A 4F8LA 3N42B 5IFJB 2OI9C 5I6MA 3ZDZE 1RSFA 4WAFA 3CBRA 2XIIA 2YD7A 4TNWK 2VZUA 1U41A 1K8IA 2HJKB 1KTLB 3DC0A 4FLOA 2J6WA 1TEYA 1UEMA 2CRYA 2X0UA 1MLBA 3FT4A 4LAJH 2X6CA 3CPLA 4KTEL 1TITA 4WENB 2XBZA 3WY2A 4XN8A 1QFWM 2COVD 4UT9A 2BNQD 3PWPA 3DTXA 1O75A 1IAKA 1DLFL 1NCNA 1I4FB 3H9ZA 1YNKH 4ANUA 1H5BB 5D55A 3U0TB 5TF1H 4B41A 4RX4D 2NYKA 4I48A 4LASL 4CVXA 5LGHH 3RZWA 4F8TA 4E9XA 5BRPA 4KK8C 1JGUH 2P5WD 2IOOA 1UT9A 2CXKA 1BF5A 3C08L 4KRNA 4PJFE 3UJIH 4L5FH 2R0ZL 4PJGA 4Y2DB 5D1ZI 2K9FB 3QDJD 5A2LH 2G9HA 3CK0H 1SXZA 2DWEB 2EE3A 3PPEA 4G7RB 3S5YA 5LKNA 3VQ2C 5L0QB 2UXTA 1AC0A 1PY9A 2VDKH 1Z1WA 2DLFH 1KDJA 4PJ5A 5JOFA 1VEOA 5LWYL 2FR4B 4I1PA 5FCUL 4N0CC 4HKXA 4K9EL 4X0KB 1W6WA 3IJHB 1D5XA 2DQFB 4OLZL 4AL8H 2DIEA 2NRDA 2WXQA 3QUZA 2B08A 4IRSB 1SLWA 4G8GE 1QLFA 4NPYB 3UPRA 2EDDA 4PB9H 5C0NC 4U1SA 1IFHL 6TAAA 2A6IB 3VVVA 2BFGA 4Z23A 1UWEH 1AP2A 4F15C 5CHNB 3QWRA 4L37A 2OBGA 3LVEA 3CXHJ 5EZJB 1ORSB 3VFMB 4JFUA 1F18A 4IS6B 1OD9A 1FGNH 1T04B 4APQA 4EBQL 2WXLA 3KPNB 3VWJA 3MLSL 4BXVA 1ZLDA 4LSVH 3GBNL 5IB2B 4WUUB 3AMLA 4G9FE 4D2NA 1UJ3C 3MNWB 4JREC 1A1OA 5DYOA 1CO1A 3LYRA 2APBA 1CE1L 2VC2H 2OMXA 4PPTA 3W81A 4TUJA 3NN8A 1BZ8A 1B0IA 5IVNA 4QOKE 1TQUA 4PLJC 3MVSA 3CBJB 4LRIA 2G2PA 4JZOA 4Q89A 4HX1B 1AANA 4ELME 2WN2A 4J3OF 1OTTC 5AUMA 2IC2A 1PVHA 2ICEA 2WIMA 1FQ9C 1PW3A 3D39A 1NMCC 1U8QB 4KBPA 4WSKA 5DU7A 4AQEB 4Z76B 5JO5A 1CBVH 1E0OB 2YAQA 2ATKB 3RKDD 1YEIL 5MENA 4NQVB 3KPRE 2BXZA 1TZIB 3O3UN 1ORQA 4J1UA 1FF5A 3QNFA 4K3JH 1JPTH 3JTSA 5E1AB 3VFRA 2CO7A 3JBG7 4IKJA 3TNMA 3QCVH 5BVPH 4M3JA 3TTYA 3ZTJG 3I6SA 1ZIAA 2UZPA 2BVUA 2LQRA 3TT3L 4RFOH 2WQAA 3FN0H 4Y2OB 3BX7C 3VUAA 5IMLA 4NQSA 1HH9A 4DQAA 2JF1A 4P2YA 5CP7A 5T1LA 3GO1L 2QADD 5D9SA 5ETUA 1KN4L 3TA3B 4G9FD 3U4AA 5TH2B 5EO0B 4YBLC 3HS0B 1M7XA 4WV1C 4JRXA 1HH6A 3OC8A 4IOSA 1QMUA 3SJVA 5KSBA 1J0IA 1FDLH 2MIZA 3G9VA 3KYMB 1K6QL 5CLWA 5HTSA 1QW9A 5E8PB 5F89B 5I16A 5F7DA 4AIZB 5KBPA 5F9JB 3V5KA 2DYPB 3K8MA 1CYXA 1DR9A 3AADB 4DN3L 4R8WL 1Z5HA 3QDGA 2R1WA 2YGVA 3TX4A 1ZLWH 1TQVA 4EI5A 3KPRD 2Z93B 4G43A 2B4CH 2HX8A 4YGVA 1N26A 4UV4L 1RZJL 2PPAA 3RWEB 1DLHA 5J5EA 4MJ5A 4P2RE 3UBXG 2EXYD 1WYJA 1KCSH 1Y0LA 4S1DC 3P4MB 3UXFA 1GJIA 2HFGL 4N5UA 1N5YL 2EVJA 1P9MC 2EVHA 2A9CA 1RVFL 5I6KA 1IGCH 3BP6A 1Q9OB 2X53A 4PH8A 5FYJE 3RI5F 3RWIA 4Z7QB 2WAHA 4KUCD 4W4OC 4OJFL 4BFJA 4N24A 4Y4KD 5AKRA 3GLZA 4TKWA 4X83A 3WFCH 2LFGA 4DWHA 1LK3L 3E6FB 2R8SL 1WS7A 2DMKA 2NT1A 5JW4Q 1YG9A 3ZQWA 3S8WA 3HPJA 3QXVA 4V1DB 3D07A 2X9ZA 1Z9MA 1U8OA 5FYLL 4RGMB 4FMFA 5E56A 2EKSA 4ZOBA 5D1XE 3QE5A 5IB1A 3QCTL 1T66C 4E9VA 3LIZH 2QTEA 3P73A 4FQ2L 4K0OA 2IV8A 5I1JH 1X5FA 3FQWB 2QSTA 5IVXE 4AQ1A 1OANA 1I3GL 1HKLH 5A2BA 2DB8A 5HYFA 1S7RA 5ERWB 3FHEA 2FJFB 1BAWA 5E5MA 2JIXD 3NPZB 2EDQA 4LNVA 1G7LA 3UDWA 5EU4A 3BGFC 4FQJH 3L7FB 3F83A 4D9LL 2ZX6A 1QSEA 1PS3A 5E99H 2X70B 4IMLA 5AFAA 5LCVA 2A83A 4A37A 4HP5A 5E95B 5EDXA 3RWCA 4CC4C 4LF3A 4OFIA 4UBDC 3ILPB 4WDIB 4ZAKC 2WWMC 3ZT7A 4ELKB 1I8MB 3DRTA 2P47B 1AMXA 4GBXB 1ZT4A 1PD1A 5DC9B 1T1WA 2EUXA 4FKKA 3QIBB 1JD7A 1DQTA 3RKPA 3IRCA 2VDRH 4XP5H 3JV6B 4WK0B 2OQJA 5B39B 1U6AH 4PJ7A 3ASOB 4EEEA 2WCSA 3MCLH 4JFED 1RZ7H 5T3XD 4CKVX 3ARFA 1TETL 3GJFB 4NKDB 4OKVA 4F5CE 4PWHA 2CKBB 3I3DA 1S5IH 4WU7B 2XPGA 5KYWB 5J1SC 5F6IB 4R97B 2BSTA 2GT9A 4YC2B 5FYKU 2FB4H 2LGNA 3PXHA 3ZE1B 2ZT9C 2XKSA 4IU3B 3ULUL 1KFGA 2C9SA 3L9BA 2FWOB 1F4XL 1OY3B 2J3SA 1K5NB 4XCCL 3WDHA 1CT8A 2XG4B 1UVQB 3VX0A 1UKSA 5MEPB 1YEDA 4OJEH 4NP4H 2X4RB 4X6CF 5IM7B 3EO1B 4P2OA 2CR0A 4FFZH 3JWDH 4ZTPL 5L4JA 2NDGA 5SWSE 1Q94B 2VW6A 1YEFL 1KDIA 4ZMXA 3B3IA 4XO3A 5I24A 1A7PL 5ICUA 5D5MB 5CCGE 5GRJH 4XPGL 4DW2H 4PV8A 4TS6A 3MNVB 5GHWL 4F9PA 3KXFA 2NSXA 3O6FA 3SY0A 3HUJF 5I17A 2QGDA 4PEEA 4O2CB 3K6IA 4KKPA 4N25A 4AI7A 5B8CA 1VGKA 3K4DA 5IK3A 4Z7WB 3L3OB 3CXDH 3DK2A 5CKAA 4Z18A 3PFQA 4AE0A 3TYGL 2TSBA 4Z3HA 4OLEA 5GRVL 3BLBA 3UAFA 1WP6A 3STLB 1CDBA 1CDIA 5DS8A 2WBKA 1IVTA 3Q8AA 4I0PD 4BKTC 2XN2A 2CLRA 5DJXB 4FZ8H 3W38A 1R9FA 4HLJA 3I9IA 3NJFA 2YD0A 3EOYG 4G71B 1EHAA 4L9LC 2O6DA 3FUIA 4LCVA 2XRAH 4GEJA 3FO1A 4JFPB 3CHSA 2YAMA 3VE0B 5SWZA 2MTAA 5BW7A 4M3HA 4LLDA 4CMHB 2HH0L 2XN1A 4ZFOL 1IX2A 2AXGB 4H1LH 3RVXD 4CDHA 2YPVH 5GJTH 1GAFL 1DFXA 1BDYA 4JN1H 4NNYA 3O8XC 1BZOA 5C9JA 2WK2A 5FAAA 4R90H 4TSBL 1T03H 3QDHA 5A6MA 2QJDA 3ECBA 5JXEA 4Y1SA 5JXAH 3MGTB 2C7UA 1QBBA 4JCWA 3UC0H 4AMWA 4F7EB 4XCEA 1AHMA 4PRIB 3DOIA 3GI9H 3A6BH 4YE4L 2J8UB 3KPTA 4PW3A 3NJIA 4UTAL 3CLEH 4LSTL 4KQ4H 2OMZA 4M6OH 3IMBA 1DJGA 4OVVA 4NO0B 2BRRL 2IAMA 3DWTA 5TF1L 4EN3A 4UINL 1IMHC 4NQXB 2W07A 4WJ5A 4BGLA 4DPAX 5HHQA 5LGHL 1NAML 4CBPA 3F04A 4ZYKA 2QGCA 5GRZA 4LOUD 3TBSB 3PDOB 4HUUA 2I69A 1BFSA 4KJWC 5JLZB 3ZE2E 2VN5A 4L5FL 3VXRA 2VOTA 3UZVA 2PCFA 4A7SA 5AAPA 4NRXB 3SIKA 2VCOA 5DMKB 1MHCA 3SDDC 3T6QC 1QZ1A 1W0WB 4PRHE 1NPNA 5H37A 1Q9WA 5IF0A 4PJHB 1RAMA 5CILL 5JPNC 3LZPA 2KBGA 3EUUA 2ZNWA 3FOMA 3VTMA 5C97A 3VFOB 4KZ0A 1IKFL 2OMWB 5CWSA 3ALPA 1F4WH 3QNXA 4UTBH 4R7NB 5AWNL 1JXJA 5F97E 1MW2A 4R2GB 5FM5M 4PB9L 1EAPB 2KHAA 2OSLB 1MQ8A 4BK4A 5JW3L 1JPST 2R23A 3IU4H 4WI0A 4DETA 5K9KA 4LHJB 4JMXA 2F53B 5D1XC 4GXVH 2W88A 4LLWB 5L6YL 3FQUB 4WK4B 3OHXB 2IADB 1FGNL 4XMPH 2XN9A 2R29A 1HI6A 4LSVL 2BC4A 1MH5B 1IQWL 3WFHB 1G7HB 3V7MA 1RLWA 2VH5L 3NESA 5CIPB 1IM3B 1MWAL 3SYOA 2XX1A 1UURA 1T1ZB 2P5EE 3S4SB 2N7AA 3ABKB 2GBVA 2P24B 1ZTXH 2WXMA 2CMRH 2OYMA 2I5YH 3TO4C 4OGYL 2MNWA 3QWOB 3HHSA 4XGZA 3VXME 2V17H 3HR6A 2JB5L 5I74C 3T04D 5EEZA 5CINL 1ZRUA 1TT6A 1CBVL 1OK0A 3GSNB 1ZHNA 2B0SH 1G9NH 2XFXA 1T4WA 3JTBA 4HS3A 3RGHA 2DKMA 4LPCA 3C6SA 1KULA 1NCHA 5C8JB 3UMTA 2YD2A 2DYSB 3N44F 4CU8A 2F5AH 1Z32X 3HG3A 2GQHA 3O3DA 3QCVL 4QDGA 5BVPL 2X4OA 4FNTA 6PAZA 1AQMA 4X7EC 3GTNA 5ESQA 4E0RB 4RFOL 3N85L 1DVYA 3MRCA 4N86A 3UJTH 1VEMA 5C0CB 1H0DA 3B34A 5BVJA 1PD0A 4X80H 4U1HA 2Y6SD 4XMLH 4JANA 1NBCA 4F8PA 4OF5A 2OL3H 3JWOC 2PXYD 2FSEA 2JXMB 4HUWB 1JTOA 4AXWA 3VCLB 4KQ3H 1TSRA 1UZ6E 1DEEA 2P5ED 5EU7E 4WFHD 1N67A 2WKOF 2DQHL 5BQ7B 2RTTA 4M1CC 1FDLL 2EDOA 2GSGB 3FB8A 4AENA 3SPHA 1NCCH 5FW6A 2X2UA 1NJ9A 4L2LA 2DKUA 3VXMD 4IRJC 4GQQA 5JHLA 5I8OH 4MQXD 2BOBA 2LT9A 4O02L 3WLBA 1OCWH 3N40F 1U8CB 3VXSE 3LEXA 3I3EA 3EYFB 4G6AC 3KH3A 2MFNA 4PLKD 3V0VB 4W9EC 4JHZA 4FMVA 5KJRH 4XVJL 4S1RH 1NGZB 4Y4FC 4OZ4B 3SCMC 4OZIE 4R4BA 4YHPA 5E4IA 1BVLB 5HP5A 3KWUA 2OV0A 4OD1H 1J5DA 2W65A 5FUCE 1YYLL 3KW7A 4LCYB 2E6QA 1KOAA 3RJQB 4N2CA 1I8UA 1AHWA 4J8RB 3RAJH 4PJXE 5AOJA 1PX4A 3WSQL 4LOUC 1MDTA 4HPHA 1B0RB 3K4AA 3L3IA 3JWNH 5GGTH 4PRBA 1JGIA 4X4MA 3WFCL 2IWEA 4N0YH 4YLCA 5IHHA 4L0PB 1GGIH 2R0LL 1LDSA 4IOIB 4YHYC 5EZOH 1I7TB 2YEQA 4QRRB 1HL4A 4RRPA 3I75A 3KPMA 3H8NA 4PGBA 2QSQA 4JE0A 1QHQA 2P9RA 3H56A 2X4QB 3IDXH 3LRMA 3LIZL 3VYOA 3ESVF 3PGDA 3JYBA 4XO8A 2PCPB 2QSCL 4QR7A 3LRKA 3VXSD 3ZRSA 4U1KB 1TVDA 1CZ8H 3AY4A 1P4LB 4RX4A 2Z35B 4QRSB 4WUKH 3TF4A 4CVWA 3WAJA 2BHFA 2YOCA 1D5RA 3ZKXB 1ODUA 4QLWA 5D2NE 4N0UB 4R84A 4PSPA 5EPMA 1JZFA 1HN1A 1SOQA 1CDUA 4FQJL 4MDRA 5DZVA 4B96A 4PGJA 3T0DA 4GAGH 1L9TA 3ECVA 1INDL 4FDWA 2O93L 1UYWH 4KGLA 4JW3A 4YSTA 1FAIL 1YN6A 4KXAA 4ZUWB 3QDJA 1QUNB 1T89C 2EDXA 3EAKA 5GJSH 4GUOA 1KGUA 3AU1A 3QJOA 1DJHA 1GKOA 4HGWB 3VRIA 5IFJA 1O6TA 2OMVB 4MTMA 2VMCA 2HJKA 1KTLA 3LQAC 4P49A 5EF1A 1BJ1H 1LEGB 4XP5L 1OE2A 2NCEA 5G2NA 2WPGA 2FVNA 3HFFA 4HWNA 1V3LA 1GY2A 4Y5XB 3BUQA 2B16A 1RZ7L 3NJVA 3OPZL 3TT1H 4DP7X 2DH2A 3FQ2A 3RIAF 1EERB 1I4FA 1F4HA 3RGVD 1B2YA 4K3DL 1H5BA 1S5IL 1TJGH 3U0TA 2CZNA 1SEQH 5TK4A 1Q8MA 1KCUH 3II3A 4X6DE 1OM9A 5FUZH 3V0FA 4XE5B 4AV5A 7CGTA 5KSAB 3MRQB 3IM1A 4CJ0A 4LSDA 4AM0B 3OKLB 5F1SA 4TUOB 4M43L 3MGOB 4Y7OC 4Z3TA 3FUEA 6CGTA 4Y2DA 2IG2L 1EXGA 4FI8A 1BM3H 4GB9A 5AVZB 1KTJA 3S35L 3SGKA 1GH7A 2DWEA 2K1MA 1NUNB 4HK0B 1VZHA 3IS0X 4TN9A 4BYHA 2H6UA 4FFZL 1EZLA 1TQCB 3JWDL 4PP1C 4JZJB 1OAUH 1JMZA 2BVQB 2FR4A 1JV5B 2W0LA 4X0KA 3TEUA 2PXYC 3IJHA 1N8ZB 5GRJL 2Y1ZA 5DK3A 4DW2L 3BCDA 2ZX7A 4IRSA 4MNGA 3Q1EA 4WEBL 4HQQH 4NPYA 5LBSL 2A6IA 3MOAL 3SN6N 2P42B 4ESKA 5IEKB 3D09A 4DKFL 4FABL 4K71B 5E4EC 5I75C 5EZJA 2A4CA 3CXDL 3WJLA 3VFMA 4EKJA 4F8OA 1D5MA 2BCKB 3LNHA 3ARGB 1NIAA 1I82A 4PGCB 4H1LG 3EH1A 4IS6A 1UEYA 5EOTA 4OCXL 3QIWC 4KV5F 3QXAB 5KTEH 3KPNA 4XNDA 3QZLA 5HJGA 4M93B 1LO5B 1MCFA 1QYGL 5IB2A 3SD2A 2NY3B 1I3UA 2BP8A 3K91A 2R1XA 2XIDA 3MNWA 3SPVB 5DS1A 4FZ8L 4LRNH 1D7FA 2WCPA 3EBHA 4OLWL 1BX2B 1GSKA 3ZDZF 3C75A 4A39A 3FT1A 2VDQB 4HZAA 3U6XS 1HIML 3UAJA 5MERB 1P6AB 3GMRB 2W9EL 4P9MH 3I9PA 2O5YH 2YPVL 5GJTL 3TFBA 3MV01 1ZHKB 1OLLA 4FC3E 2IWKA 2XWTB 4KJYB 1IC7L 1U8QA 4LQFL 4BCZA 4IIZA 2OW6A 3HBPA 4AQEA 4Z76A 4JDTH 1CU4H 2M26A 2Z91B 2ATKA 5DEJA 1FG9C 2YPKB 1NTDA 4A2GA 4NQVA 1N9PA 4GO9A 5EU7C 1TZIA 5T1MB 4YXHH 5JXAL 3UC0L 1SRDA 2VDPL 1JZHA 3WENA 2N7SA 1S7XB 1M9WA 3CFDB 3CLEL 4Y19E 4MBOA 2FCBA 4KQ4L 4M6OL 1MCQA 4PJFF 1UH4A 2O6CA 1FA4A 4NQCB 4XMKL 1GGBL 4OZFH 5ABAA 3UPAA 3MV7B 2TRYA 2DQDH 3FU5A 3TA3A 3MBEB 4XWOC 1LO0L 3D18B 3K71A 5I0YA 2PO6D 3MJGX 5TH2A 5EO0A 3HS0A 4GAYB 5T5NF 1X9QA 3P02A 4RMSA 1CFNB 1SOKA 5I76B 1BG1A 3F5WB 2WQVA 1EMTL 1MELA 5E8PA 1QLEB 1UZGA 5F89A 5FUCC 3W5MA 1U2YA 3APMA 3MGAA 1RUPL 4KXCA 5F9JA 4U6VL 1JHLL 1LE5B 2DYPA 2Z8RA 4RWHA 3T3PB 15C8H 4TQIA 3ZY7A 4IBWA 2AJZB 1F4WL 2R0KH 4J23A 1L9MA 2ZF9A 3VG9C 3WY1A 4N68A 4Y4HB 4G83A 2WQ8A 2XXMB 2Z93A 3A4AA 5DZNA 3IU4L 1QPXA 2ZCHL 1FSKB 3RWEA 3WO3B 2Z7WA 4Y19D 5C0JB 2WP3O 1WD8A 3HZ3A 4HGKC 2AEIT 4OI7A 1HSBB 4N90E 4WWPA 5EH1A 4PBWD 3SPIA 2QVTA 1ZPUA 4YLQT 3OAZH 3RX5A 5JW4N 4OF3A 1Q9OA 1GGUA 1HXKA 4XNZB 5IJKC 3E1ZA 1NCDH 1BFOB 2XYCA 2WUBH 2BSBA 4OCRL 4TLTA 2GJPA 3GGWB 1WS8A 3E6FA 3QFDB 1CICB 4H0LC 3HRZB 1LM8V 1ZTXL 4V1DA 4F57H 2WXJA 2CMRL 1JK9B 3TZVC 1F6FB 2I5YL 2E9IA 2WCGA 2V17L 4LHQB 4JFEA 2R7EB 4QHNA 5I6XB 1IJ9A 3FQWA 4DP9X 3BT0A 2W0FA 2C1PB 2NY0D 4Y4HD 4AYSA 2B0SL 1G9NL 1ADQA 1X5XA 2X40A 5ERWA 4W4NA 2FJFA 3OZKA 5JOPE 1FZMB 3QUMB 4JKWA 3S2CA 3CSGA 4PUBH 1DBAH 1JF1B 2KI6A 4PBDA 4U2YA 2F5AL 3ZDWA 1CFTB 4KUCF 3GSXB 3HI6L 3E8UL 1NAKL 3IJ9A 2XV6B 4LSRH 1A6PA 4X6CB 5MEQB 3U0WH 2IH1B 1R75A 2FLBT 4HEPG 4N90D 4I9XA 4OCMC 3ROLB 3ILPA 4WDIA 4ELKA 1HAWA 3NABH 4YSPA 4XMLL 3MXVH 3UTSE 2OL3L 1BQSA 3QIBA 3UBFA 4IKKA 1LXMA 5E8EB 2WNXA 3QIUC 4H25A 2ESVE 2WXKA 4NN7B 3T0EC 5D72H 4RIRB 3L48A 3N41F 4K23H 5E70A 2J5LB 1F02I 3JV6A 4TQ8A 5DK0B 1BMWA 3BFQG 5B39A 3HUJB 1TNMA 4NM4L 3UTQB 4IMKC 3ZKNC 4DP5X 3FT2B 1B4RA 3PAYA 4L3ED 3GJFA 4NKDA 2EYSA 3FCGA 1MCHA 4UQAA 2CKBA 3DYOA 2PYEE 3OSKA 5CN3A 5BO0D 4WU7A 1OCWL 4P23D 2BM3A 5KYWA 1NCBL 3MROB 5DFAA 2BY3A 2L04A 4HCFA 3L5WB 5FOBB 3POCA 4UT6A 2H2PD 3BZEB 1AH1A 3JWNG 1J87A 3HC0B 3T2NH 1KWKA 1HWGB 4I0PA 1NANH 2FWOA 2R2HB 1C9SA 4MCNA 1K5NA 5AVXB 4LEEA 3VO0A 2XG4A 1MVUB 1S7QB 3N2JA 4XP1H 5MEPA 1D2PA 1DQKA 1KTRL 4OD1L 3CU1A 4ONFH 3EO1A 3WKML 5DZ9A 2BZCA 5HYSG 4KK9D 3GB7B 5AB0A 1UC6A 3P3RA 2BIIA 3BHBB 1Q94A 3RWJB 3T0WA 2D0FA 3NRFA 2HWZH 1E2VA 1JWUB 3L3DB 2VW4A 3UTSD 1N8OE 3WV0A 5HI4C 5EMYA 4YHZH 2WWOA 4U6YA 5D5MA 5GGTL 5E2TL 2HX9A 4WJG3 4U0RC 3IKKA 3MNVA 3OQRA 1VKXB 5EZOL 4WU5B 3HNTH 5IVXF 5HGBB 5JHMA 3QEUB 4TLUA 3H85A 4OZHE 4O2CA 5BZDB 4F24A 1N3NB 1RSYA 1Z0MA 1J5CA 4Z7WA 1M2VB 4H0GA 4MMZB 2XETA 3C5ZD 1NANI 4JPWL 4P05A 2A9NH 2H1XA 4APXA 3WG7B 2QKSA 3GHPA 3PXJA 4LCCC 1CZ8L 1WIPA 5E2WL 1W72B 3BWUC 3BRFA 2H3KA 2Q86B 3ML9A 1PMYA 2NX5B 5DJXA 3LD8B 4YSSA 5L2KB 3OHMB 3REWB 4HDIB 4GAGL 4GRLB 4JFPA 1DVFB 1TTGA 4UQCA 3GLAA 3LKRB 4CSTA 3VE0A 3NG5A 3W37A 3QHTC 4N9GB 3QJRB 4PU2A 2GBUA 2BW5A 5GJSL 3UEQA 2VDLB 1AYOA 1NMAH 2XNAA 3SQOH 1CD8A 3SHSA 4FS0A 3OKOB 3BZFA 3MREB 2OMTB 3Q8EA 1JCVA 3ABGA 4TLSA 4A2EA 3GXPA 4XB3A 1KELH 3C6LB 3KLAB 3FSVA 4PRIA 5EO9B 4FLQA 5LB1A 2UX6A 4ODWB 4A2DA 5A6IA 1OPGH 3TS8A 4B9GA 3TT1L 1EHLL 5G4NA 2CA3A 4Q0XH 5HHXL 3ZBMA 1L7TL 2ITCB 1T0MB 1QOKA 3ARWA 2YGNA 4NO0A 4IU2B 4YMPA 3MUJA 4DVBB 3SGJC 1U42A 4NQXA 1IBGH 3O4LE 1KCUL 2A73B 5FUZL 3O6KH 4KDWA 3VGGA 3CVIH 1FYHB 2HVKB 2NT0A 3PDOA 2BVEA 2MPAL 4XMWA 1FVCB 3LTVA 5JLZA 4LLQB 5AAWA 4M8QB 2FECI 2JI1A 4AWJC 3MV8E 3OB8A 4N8VG 5M94B 3GSRB 4L4TB 5KANI 4KMTH 1TJHL 3VU2A 1T2QH 1FIGH 4MHHI 1W0WA 3MRRB 5DVOA 1QKZL 1MAMH 4JFQB 2AQ2A 3CFMA 4PJHA 4PLOB 4XCNA 3S6CA 1OAUL 5E6ID 2GCYB 3OMNB 1UWFA 3IFOB 2OMWA 4LARH 4R7NA 2Y1VA 4RETB 4HQQL 2OSLA 1IC0A 2J21A 3MU3A 2ADYA 3N44B 4QY8B 5DJ2B 3QWNA 4IIQC 4FTVB 1GHFH 2OI9B 2F53A 1QR1A 1MY5A 3FQUA 4M7ZC 1JVOA 3OHXA 4Z3FA 1PX8A 4JFYB 1EO7A 3D9AH 4GO6B 1LL1A 5KTEL 1CS6A 4ZFZA 4A66A 4FYTA 5LAXB 1PG7W 2AVFA 3O4LD 3DOSA 3WFHA 2CCVA 3N1GC 1AZCA 3SKNB 5CIPA 2HKAA 1OLZA 1L9SA 1XWVA 3BZ4B 3CIQA 3H53A 3J7HA 5IB5B 5IVZB 3RHWF 3S4SA 4EAEA 2P24A 1HXYB 3IAQA 1L0XA 1DJSA 3N9GH 3QZPA 3SE6A 1LO3L 4Z6AT 3F58L 3WTVA 3QWOA 2O4EA 2WINA 3QUYC 3FB7A 1JZ8A 2WHVA 3FF7A 4UYPA 2J73A 2P5PA 1FGVL 2Y25A 4X6FB 4X5RA 1S9VB 2BXYA 4OZFG 4JDTL 2WXRA 3GSNA 3NSYA 2I25N 1T0OA 1MFEH 3CH8A 3NCWA 1K4CB 5C8JA 4LL9A 1FHNA 4ODVH 4QRFA 1JZ4A 3LSOB 1KBBA 3HCVB 2H9GB 3OXSB 5CUSL 2DKSA 4JY5H 4S2SB 4KO7A 5DR5H 3F85A 3II2A 3RUGE 4E0RA 3BAYA 2B3RA 1PL3A 3ZE2F 1PLBA 2VLKE 1HJCA 5C0CA 2KZBA 1KIQB 1EEYB 4F15B 3RY6C 1A6WL 5KVFH 3CPUA 2BSDA 3BH9B 2D7QA 4HUWA 2JXMA 4RA3A 1JDCA 2AI0H 4ZO9A 1QNIA 3APCA 3VXQB 4JM4H 1B4JH 2DLHA 1HZKA 4OI8A 3NCJH 1C12B 4FCAA 5DXWA 5BQ7A 2HKHL 3FK3A 2H45A 4MAUH 1UJ3B 2NY4D 5EB9A 3DIFB 4JREB 4DPBX 2EUWA 2DPKA 1AS6A 1HJBC 5C09B 3WUWG 4K3EL 1NGXA 1U8CA 15C8L 3ALXA 3NPSC 4AUUA 2R0KL 3EYFA 4LT7A 4PGEB 5F7AA 3V0VA 5DRXA 5GIRB 1MVYA 2OMUB 3QJVB 1AJ7L 5SX5K 5A2CA 2A74B 5CAYB 1NGZA 2V7NB 5AZ2L 5HYJD 1NMCB 4N87A 4OZ4A 5JNYB 5A40E 2QT6A 4FP8L 1F6LL 1TU2A 4WI5A 3UABA 1BVLA 5F7LB 1WIUA 3K2KA 3BSZA 5GS0H 4YDVB 3TBBA 4NHUB 3SQRA 1R34A 5B4MD 4F7CA 1J8HD 1Q38A 4J8RA 3RQ3A 2R4SH 1NCDL 4UT7H 1B0RA 3CUPB 1HCYA 3RY5A 1YRKA 1HILA 4OF0A 3ISYA 4IOIA 5C0AE 1I7TA 4GSDL 3TBCA 4QRRA 3S48A 4B50A 3T6VA 3WXWH 1MFDH 3K0WA 4PRPE 4KJPC 4XH2B 2X4QA 1NCGA 3KDMB 3WIHL 1SY6H 1A25A 2HX7A 4HWBH 4WV1B 3DSFL 1FJ1B 4QCIB 2PCPA 1NCOA 3OB0K 1MCCA 4X4XA 5CXPA 3ZRCC 5AB2A 5CGYD 1TPXC 1P4LA 4BD4A 1K8DB 2Z35A 4QRSA 3RIFF 1ZAGA 4KAQH 4CAGA 2QQNH 4N0UA 1P5UC 4XE0A 4YZFE 1DBAL 5FYLE 3AMKA 3K4ZA 4NSKB 1MXDA 3ZDYB 4LSRL 1UH3A 3U0WL 1UZ6F 2GW5A 4ZUWA 1QUNA 2OCFD 3TTSA 4N2MA 3VYNA 3MDJA 4JHWL 3MXVL 4HGWA 2Q10A 4DGYL 2OMVA 2GG1A 1F6AA 4PJEA 4EIGB 2XBDA 4UT9H 1MI5B 5D72L 4M7LL 2Z7ZA 1KPRB 4K23L 1FL3A 1RXLA 3IB4A 2WBJC 4JJ5B 3FQTB 1NZRA 5EFIA 2VJXA 4FQLL 3VJ6A 4Y5XA 2LLGA 3H7LA 2GJZB 4IHOB 4V33A 4R7DA 3WGUB 2ZP8A 5GGSY 1SYVB 3LKPB 4Y5YC 1HQRB 3CX5J 3TBYB 4DT2A 3C2SA 4OZIF 3TIDB 3DX6B 3LRSB 1UJTA 3IDIB 5E1IA 4K5NA 1G7JB 4TUUA 2Q20A 5KSAA 3MRQA 3T2NL 5EOCJ 4AM0A 5GXBB 3VMNA 4TUOA 3WN5A 3MGOA 4L18A 1J1PL 1QI4A 3O6MH 3Q7JA 4I7ZC 4PJXF 3ZDZB 3GJEB 4XP1L 4OQTL 4HCRL 4OCSH 3B9KC 4HK0A 4ONFL 3VWKC 4POZD 1CGUA 4G7YH 3HZYA 4XI5D 5DTFB 1M57B 3T8VA 4S1SL 1B3IA 3NDZE 4K9EC 1THAA 1VFAB 4UDTB 5H4ZA 3QUKB 4A2FA 4AYGA 3QZNA 4JZJA 1QO3A 2V3DA 2DBLH 4Y2LA 2ADJB 2BVQA 1JV5A 3CFQA 1KV3A 1KPVB 1ND0B 1DQQB 3IPFA 2XVGA 1I1FB 1N8ZA 1MCEA 2EE9A 4BFIB 1H8LA 4OFPA 3EG9B 2Y7NA 1XIWC 2X10A 1DJXA 1Z9PA 4HC1A 4RMWA 4LPTA 5ENWB 3IRZA 3H3KA 5F70A 4U31A 5ACZB 3A0OA 1UT1A 5E0FA 3QUXD 4RGOH 3AAZB 3UTTE 5ADPH 5EA0H 4AQ8A 3MMEA 2BCKA 4JNXA 3DA0A 3ARGA 5LNEA 4O00A 4PGCA 3FO0H 4UYQA 3SO5A 3H0TB 3QXAA 4PY8I 3SKUD 1LO5A 3WS6A 1J5OL 3N06B 4KX7A 2BDNH 1XF5B 3SPVA 5D4HA 1G6RL 1ZGLP 4YVUA 5KANG 2DEYX 1ZJBA 2QFPA 3NFPB 3AG2B 3L2NA 5DEFA 4MHHG 1BX2A 1PKQE 2Y4SA 4B9ZA 4PVMA 4IDLA 2XWRA 4CMMA 5CJBA 4G8GB 1RHHB 3QDMD 3ZE0E 5MERA 3GMRA 3FONB 2FUQA 1ZHKA 4KJYA 2XWTA 4XN7A 5B4MC 1OAXH 3MV9D 3SQOL 2UV3A 1SDAB 2FECL 2YD4A 5D96C 1MHEB 1DVSA 2Z91A 2HXAA 2YPKA 4F93B 4F20A 5FO8B 3UP1A 4Y9CA 2WQSA 3QQ9D 5T1MA 1KELL 1XHHA 3BZDA 4FMKA 1P69B 4WEMB 5HHME 4X6DF 2ZJSH 1S7XA 4FQHB 3CFDA 3Q6GH 1A6VH 1P84K 5A2JH 1OZUA 4JFZL 1A0QH 1YVLA 3H9SB 3NCYS 4BUHA 4MCMA 1O5DT 4L3FA 1T5XB 2Z3FA 4NQCA 1HYRC 3ROOB 3FT3B 4ZOCA 3MODL 5DLLA 4QOKB 4JM2D 5C0DB 2AABH 3MV7A 5HGAB 2DM4A 3K1DA 4OUOA 4Y89A 3MBEA 1PFOA 4QD2E 2IPKB 5I1KH 3VH8G 3D18A 3UBGA 5E24E 1WRFA 4FNUA 1ULVA 3IGKA 1KV7A 2QHRH 3ARXA 3FSOA 2D9CA 2JJSA 4GAYA 4NQDD 2B1AL 4HJEA 1I7ZB 1NINA 4KMTL 5KUKA 5I76A 1T2QL 3F5WA 2HT2D 4AJWA 3HPLB 2D3JA 1GSMA 2AEQH 2EINB 2A9MH 4XRCB 2JLLA 2CAKA 2BLFA 1CGSL 3EDKA 1FE8H 2VR9A 4L1LA 4S0SD 4L9LB 1LE5A 5KVGL 2AJZA 1P4BL 3U4BL 1KEGH 4KRPD 3DDGA 4L5FE 3S5LA 2UVEA 1RZJC 3ZDXE 3ATDA 4Y4HA 1WIOA 4NO5A 1V27A 2GITB 1A4KA 2IIJA 4K7FB 5HHMD 1NFDE 4QYOB 4PCYA 3O8XB 1ZANH 4R96B 1KGCD 3SYPA 3VAEA 5C0JA 1A3ZA 1OHQA 3GD1C 2ZOLB 4P4KD 3D9AL 4MJIE 4FQQB 5J3HD 1PY0A 4LLUB 4ZMPA 2IAAC 2CJUH 4ZQKB 1D6EB 2G5UA 3Q2NA 4UM9D 2NNCA 4Z9KB 4ZW8A 4XO9A 1BFOA 3GSVB 3RPKA 2CRZA 3LKSB 3N41B 4ZI8A 3GGWA 3QFDA 2P45B 5AL0A 3ZU8A 3S9DB 4HJJH 4TLKA 2X6BA 5T5FA 2VN3A 1JK9A 4POZC 4XI5C 25C8L 3BWUF 5AVYB 3SE4A 1DL7L 5DQ9B 1T7VA 3VI3E 1GOFA 2R7EA 4L3EA 1Y18B 2VDNB 4QTFA 3LRHA 5E8DH 1RI8A 2UWEB 2UXVA 2ZUSA 4CGUB 2DJUA 1H8OA 2C1PA 3MACH 4IBYA 4NKMB 4P2RB 4ZPTB 5F6HJ 5DLML 3RX7A 3U79A 3PQYE 3A24A 3WNNA 2PP7A 3SDDB 1NEPA 1MFEL 4NZRH 5MEOB 2CDGB 3LHPH 3PIQB 4P2AA 1O7DC 2X1QA 4HIXH 4OFYD 4XOAA 1FZMA 3LAFA 2ZYIA 3QUMA 3KG5A 3ML8A 1JF1A 3F7YA 3L5HA 3QUXC 4LHUD 4U4IA 3WFEH 1CFTA 1FRGH 1QPPA 3GSXA 5JHDE 5I1LB 2IANE 4JY5L 5AAMC 2F18A 5DR5L 2BNRD 4MD5B 4HMCA 4HXBH 4UZSA 4Y9EA 5MEQA 2CALA 2CU9A 4FI6A 4ONHB 2APTA 3D34A 3OZ9H 4MJID 4KXDA 1OP5K 4OLYH 4BGDA 3O2VH 4TOYH 5EN2B 4W9LC 4WWID 5KVFL 3SSGA 5E8EA 5D1XB 2G0LA 3GQFA 3RTQC 2AI0L 4FLRA 3R18A 4HIIB 4RIRA 3BVNB 3JV5A 1B4JL 5DK0A 1GRWA 3NCJL 1MCIA 2UXGA 3UTQA 1MG2C 3FT2A 4LEOB 4MAUL 5BV7H 3TVMD 1BXXA 4HW6A 4CL7A 4YX2H 5EORH 4LPYA 2ZQKA 4ODTH 2CQVA 5D7LE 3SKMB 2NY2C 3FQRB 2Z8VC 4YHLH 5FM8A 3MROA 4POYA 3K5RA 3ULUC 4MB1A 2H0EA 3FUKA 3TO4B 5FOBA 3KGTA 1NFIB 1OGAD 3FU9A 5IBUG 3RZCC 3BZEA 3C8KB 3HC0A 2X87A 4Y16B 2IDSA 5I74B 1XTLA 5KOVC 4U1NB 4PIBA 1WSST 3KYOB 1X7QB 3A4DA 3VD3A 1S7QA 1BM7A 1OW0C 5D70H 4ANKA 1UOVA 4DAGH 4LDCA 4RLDA 5FOJA 4DZBB 1AI1H 4NRYB 3NMEA 2J6EA 3BHBA 3WNIA 5E2UH 3RWJA 2O26U 2V2XB 1EIBA 1JWUA 2H32B 1ZA6B 3IS1X 3L3DA 4FXLA 5DJCB 5E8OA 1ZK9A 2K45A 4PBVC 5IHWA 2CR6A 5FA3B 5C71A 1HAUA 3NA9L 3NCBB 1OAYL 1VKXA 4WU5A 3V0DA 4Y2NA 4U6HB 1T83A 3QEUA 1XL4A 4AJVA 1A3RL 1B88A 3Q8FA 5BZDA 3ARBD 2HT2C 1QBML 3R8BB 4R9HA 1I3RB 1UM5L 1RIHH 4MMZA 2EIZB 3T4YA 1E5BA 5EUOE 3UG4A 1U30A 1UWXH 2C4XA 4AKQA 4LPUA 4GH7B 1OT4A 5CS7A 3WMQA 1N68A 1X6NA 5JPMB 1W72A 1OM3L 4IRJB 2Q86A 2YUZA 1FL5B 2NX5A 1NA8A 3OXRB 5SWSB 1PY4A 5L2KA 2JKSA 4WTWA 3REWA 3KWWB 2YGPA 4NUGH 4DGIH 4LNRA 3FRUB 1DVFA 3RVVC 4QTHB 4A55A 1Q0XH 1YY9D 4D8OA 1DCEA 1DUYB 4P4KC 4N9GA 4GNKB 5BZWB 5D1ZC 5GGQL 4JDEA 4Y4FB 3WXVH 2F9BT 5MI0B 3SCMB 1RU9L 1JZ6A 1ITBB 3GF8A 3OKOA 1CN4A 3QZWA 3MREA 2OMTA 5E6IA 1ZT1B 1T0PB 1XB8A 3QFJE 5IW1A 4L1SA 4UOZA 2WW8A 1A47A 3DX9B 2VZTA 3KLAA 4XPAH 5DD0H 2Y5TB 3S8FB 5EO9A 4P9HH 4ODWA 3MCG1 3JTTB 2SEBA 4G80B 4H20L 1NLBH 3KBEA 1BYPA 2ITCA 2ROXA 1T0MA 2DLTA 4AMXA 4YDLC 3A6CH 4IU2A 4X6EB 4XT1C 1T20B 4DVBA 4YHYB 5ALCH 5BMFH 5F0JB 3WTYA 1XVSA 2HRHA 5AW0B 4RGNB 2VB5A 4PD4J 1F3DJ 1I1AD 2CUAA 2HVKA 3GMMB 2CO1A 3U2JA 1IE5A 5DZOA 1FVCA 2F68X 4LLQA 4YR6B 4M8QA 5H37H 1D5ZB 4G2AA 4OJAA 4L4TA 2NZ9C 1DJIA 4G7SB 4NHCL 4KZCA 3ETBJ 5DRZB 2WVVB 4JQXA 3MRRA 4G7YL 5B1AB 3NYKA 4JFQA 3EW3B 1FIEA 4OZHF 5DS2A 3FRPB 2DBLL 2GCYA 5LLIC 4WHCA 3IFOA 3RL2B 2FHCA 2A5UA 3PNRB 4J3VA 4EQ3A 4PLNC 2BVYA 1QG3A 2BY1A 4H4NA 2OYPA 3UO8B 3Q6FB 1WZLA 3NZHH 1A7NH 2XJLA 2L3BA 1MRCH 3X1NA 4ERSL 1A65A 4QY8A 1MJ8L 2R29H 4LVEA 4RGOL 3MOQA 7FABH 5ADPL 1Q9LB 4I85A 3GT6A 1TTUA 5ADOH 1JNNH 1BQHB 3ZE2B 3HE6D 5IG7B 3FO0L 4JFYA 4RGND 3OC5A 1SXCA 3A23A 2MTPA 3EFOB 2IOMA 2DTMH 1OT1A 4DN4L 5ITBH 5LAXA 4PRHB 2BDNL 1JF5A 4DTGL 1AGCA 4HAKA 4HHGA 4HULB 1VENA 4MSWB 2APFA 5IVZA 5IB5A 4KKLC 3P9MB 1HXYA 4BWWA 4LCIL 4A7UA 4YDNA 2WLYA 2NPLX 4L23A 4MWFB 5GZND 1KPUB 1C16B 1OAXL 4M6MH 4X6FA 5I1AB 4BE6A 2IQAB 3KYNB 3A4FA 5HGDB 3V6OE 1JXFA 4LDEB 1XDTT 2UUDK 3WFDH 1ACYH 1C5BH 2OJ1A 1K4CA 1I75A 4GINA 3FB5B 4NQUA 2V5RA 3LSOA 3NSJA 3KPOB 4K73A 4Z7OE 2X9WA 3HCVA 2H9GA 5B1KA 3OXSA 4WI4A 2QMKA 2MCMA 5HYJA 3Q6GL 1A6VL 3GSWB 1A0QL 3MI6A 4TPRL 2Q7YB 2CK0H 2R2CA 4YK4C 5CM1A 1BIHA 1EEYA 3DHMA 4ZOAA 5E4EB 5I75B 5DUPH 1LMIA 2YAFA 3BH9A 1F58H 3QHZL 4X9FA 4HWUA 2QHRL 3V4VB 3VXQA 5JHLH 3ZKMC 3QIWB 3RIFK 5A3IC 1XTMA 1C12A 4HUMB 1HOCB 4ZODA 4DZ8A 3S3DB 1UJ3A 1IGIH 3DIFA 2AEQL 3IXAB 1BPVA 2A9ML 4KXBA 4P5SA 2J2ZB 4QRUB 2ZYHA 1ZHBB 4NQQA 1ZLVK 3IDYC 3KEHA 1TVBB 4PGEA 3I9GH 1KEGL 2J88H 3B43A 2V37A 5GIRA 1BP3B 2OMUA 3DHUA 4OIFA 2A74A 2V7NA 2XZCL 3DJTA 3MJWA 5JNYA 4MDJB 1AXSB 2BX5A 1CLCA 5EWIH 3U1QA 4P04A 1A9EB 1JUFB 5DQDL 3MN8A 3Q5OA 1I9RH 2UX7A 4NERA 4K8RD 4YDVA 2FJGA 4NHUA 1PZSA 3CDYA 5FM4A 3NZ8B 4N2NA 3MRFB 1FNSL 3BEVB 1QRNB 3X3FH 3DMMB 1JP5A 5DHEA 4P5MB 5IJDC 4LP5A 3NSFA 4HXAH 2AQ1A 4FQ1H 4XVUD 3BKJL 4KZEH 3E8VA 5ACMA 2FSDA 4JRYE 1XQ4A 3ZHKA 5CD5C 3UGUA 3AQXA 1MRDH 2VDOL 2NQ3A 1N12A 1MCNA 4JE4B 1G7PB 2PNDA 1NUFA 3KDMA 4JFDB 2P8MB 4JO8A 3D69B 4FQXC 4N8PA 2PMZA 4HETA 3H6AA 5E00B 3W9EB 2VERN 4K5LA 4YHNB 4WV1A 4OZIB 1JXKA 1FJ1A 3HR5B 4OY9A 4QCIA 3LPWA 5E8DL 5FKAB 4P5KA 2ZX9A 3RUGF 3JUYA 2I85A 2YFOA 4H8QA 1U58A 1G7QB 1K8DA 5FUOH 1KB5B 4HIXL 4X9IA 1G4RA 1ZTXE 1WAAE 1A3LL 4FX5A 1V8HA 2ZYSA 3P4OB 4Q56A 3T8XA 3RURA 3WFEL 4PJXB 2VXVH 3MLRH 4NSKA 1E5AA 5B38G 5J0BA 1A8JH 4L1HA 4L2YA 5LGKA 3D6GA 3GM0A 3BLKA 1ACXA 4K2UH 2X9XA 4UZUA 3D33A 1BXUA 3OZ9L 3WGVB 5CCKL 2CHZA 1R0AH 5E9DD 3R7QA 2IPUK 2YBRB 4FFWC 5F88B 3WHE0 1CGYA 1MI5A 4R4ND 3NGBB 1WTGT 1A9BB 4GP5B 1P9MA 4JJ5A 4YFLI 2NXZC 3FQTA 4KRLB 1ZCRA 3DVNB 4JRYD 4HWEH 1NKGA 3DBSA 2DQGL 4HS8H 2GJZA 5BV7L 1GXEA 4NDMB 5EORL 3LKPA 1XXFC 1HQRA 1GJUA 4OSUH 4ZO6A 2XG5A 3TBYA 4YHLL 1C5DB 1QAWA 3DX6A 3LRSA 4WW2C 2ZP9A 2MCG1 1A4BA 3TZVB 2BP3A 5E6ZA 4GI8A 3V9CA 5ISZE 4GG6B 1G7JA 3NIDE 4JN2B 1NM9A 5EV7A 3M17A 5DVKA 1MFBL 2DWYA 3H7BB 3ESMA 3WEXB 1ONQB 4UILH 3GJEA 4QXWA 4R3SB 2IXQA 2W80C 3ELQA 3JWDC 5D70L 1AXTH 5LGJB 2PWEA 4DAGL 1CJYA 2VAAA 5F7NC 5DTFA 3RWFB 2HRPH 4UDTA 1VFAA 3FFCE 3QUKA 5E2UL 3CG8A 5IROD 4NO3B 1NCIA 3ZHDA 1MREH 4BKLB 3MV9A 3PWJB 1AR1B 2PTUA 4P06A 4BFIA 2CLVB 2OCJA 3EG9A 3RB7A 4TTGA 1MCSA 4CC4A 5ENWA 2BPBA 5AOMA 3D85B 2JLPA 3M1BB 2QKIC 3Q5YA 5ACZA 4QHUA 1K4DB 1T6BX 3OMZA 2A0LC 2HJFA 1RKRA 3QIUB 4XN9A 4KVNL 2WYTA 4WKZB 1RIHL 5E51A 4MAYC 5AEAA 3T0EB 2YK1H 4YZFF 5L8JB 3BJ91 2V5TA 1A4CA 5D71L 3MNMA 3H0TA 3VYPA 3ZL1A 3JWNE 1ETA1 2P8PB 3PWNB 1OALA 4MNQE 2PP8A 3ULVD 4PJ9B 2P44B 3KL0A 4W93A 1BVZA 4R7XA 4RAUB 1OAZH 4PV9B 1MW0A 3NFPA 4XPTL 1JI2A 4XN4A 1Y1UA 2KDGA 1DJZA 1WH0A 4QXGH 3U1PA 4ZS7H 1NL0L 4NUGL 3ZRFC 2J55A 2BZ7A 4JO1H 4N4YB 3EJYD 4HYTB 1RJLB 4NQDA 2GJ6E 2VLMD 2WYIA 3FONA 5EIIB 3DV6B 4UB0H 1ITCA 5KS9E 3WXVL 2XWDA 1B9KA 3FFCD 1AR1D 2HUEA 4QKXB 4K5MA 3QPQD 2HRLA 1EWHA 1HU8A 1OE3A 1CR9H 4QTIH 1MHEA 1E9PB 4M1DH 4PJDE 3M88A 4CNIB 1OCZB 4PG9A 2B9BA 2BSEA 5FO8A 5I82A 4BZ1H 1FFQA 4XPAL 2WXPA 2VL5B 1G87A 2YXMA 4P9HL 1D9KC 3D08A 1OD7A 4AGNA 1T6WA 2X4NB 4FQHA 1ZVNA 5CF3A 1NLBL 2ZUVA 3QRBA 3P3SA 4BELD 3H9SA 4U0RB 3DUUB 1T5XA 3A6CL 3ROOA 2NUTB 5ACLA 3FT3A 5BMFL 3LS5H 5ALCL 2I9LB 4QOKA 4W68A 3G6JE 1XF2B 5C0DA 3U6RA 5HGAA 2VITA 5GS1C 4MNQD 2FO8A 2XZAH 2EUZA 4PTUB 2IPKA 4W6WB 1H3GA 3MO1B 2MRYA 2V5MA 2ZG2A 4NJAL 3U7YH 1CGVA 4QWWD 1BD2D 1KUMA 5JQHC 1I7ZA 1XCTB 3GMOB 3FUMA 2EYTA 3UIZA 2Y6TE 3CDGB 4C4KT 3D06A 2ZXAA 2GJ6D 4JQIA 4YSCA 3VACA 4PRAB 3VFUB 3S97C 3I3BA 2PWDA 2Q9OA 2QQLL 3EGSB 3O3AB 3LV3B 5AVTB 2AZAA 3V8CA 1IM9D 3NZHL 1LD9B 1SN2A 1A7NL 3MLYH 4HFUH 3WL9B 2GITA 4I87A 1MRCL 1NC4D 1XCQB 4K7FA 4QT5B 1EA9C 3B5TA 4QYOA 1N0LB 1N7MH 3O8XA 4LOEA 4O51B 5AW1B 4R96A 7FABL 1FLRH 1W9XA 5I6NA 3AACA 1JPFB 5ADOL 3LH8A 4E5XB 1J9TA 5DO2C 2ZOLA 3QK0A 4FQQA 5C92A 4PCKA 1QSFE 2VQ4A 1GS7A 2DTML 4LLUA 3AABA 1R3JB 1CTMA 2LAAA 4ZQKA 2YD8A 1D6EA 2Y5QA 3IDNB 3TCXA 5TK2A 3ZE0F 5EU6D 3PL6D 1MAJA 2BW4A 3GSVA 5JW5B 3E38A 5AW9B 2E47A 4OFQA 3LKSA 5EF3A 4GSUA 3GXTA 4O4YH 5E7BA 2DD8H 1KF9B 1EHNA 2DWXA 2NW3B 2FDBP 3PJLA 3S36H 5BOPA 3ZZSA 4FG4A 1DQDH 1ADQH 5T3ZH 2G2NA 4ZPVB 5DQ9A 5KAQG 1G9NC 4UIKH 3NJMA 5IROC 1Y18A 1FNLA 2A1WH 4G5ZH 2UWEA 1KJ2B 4NKMA 4ZPTA 3KLLA 1OVZA 1G9MH 1OP5H 3SDDA 1RZ8B 5MEOA 1C5BL 1UXWA 1XMEB 3PIQA 1OCOB 4KNTA 3AT9A 5AD0B 1TFPA 2KT6A 1ASOA 5E2JA 3SDAC 3WTXA 1SXNA 3ARDC 1F11B 4ADIA 5I1LA 5FV1L 1GZHC 3NCEB 1PDKB 2YQGA 3RFZA 1V3MA 3L3JB 4RRPM 5EUKA 4ONHA 3M8OH 4WTZG 4S0HA 1QSFD 1XSIA 1ZOXA 3WIFB 5ICYA 5EN2A 3ARYA 3FU8A 3BPCB 4IIQB 4MB4A 5DUPL 4JG0L 5D1XA 3ZTDC 4NZTL 3VD7A 2RGSA 4NCDA 4M7ZB 3K72B 3VD0A 1KZQA 4BUGA 3GJFH 3DVFA 1NDMB 3BVNA 4HIIA 2HFFB 2XVKA 2CKBH 5CJQH 4AYFB 4HH9B 3IAGC 3TBWB 3CAFA 4RMRA 2R59A 1JS4A 3P0VH 4LEOA 1KCVL 2F5BH 3ZDXF 3BQUC 1UH2A 4G11A 4UT6H 1NDGA 3MRMA 3A67L 3ARBA 4KDVA 5FWQA 1NFDF 3FQRA 1YEGH 4IBVA 1C7SA 2KH2B 3I9GL 1S7SA 5F9AC 3MLZH 3EH2A 2YJQA 4PR5A 1C7TA 2CO4A 4B9CA 2O6FA 4BUQA 2AXFB 3C8KA 1W80A 4KWUA 4Y16A 4N6RB 1F1GA 2VR5A 1X7QA 2G3XA 5E9NA 4GRWH 1GY1A 2ESVB 1UOLA 4WWNA 4ZBJA 1W15A 1ZTMA 4XB8A 1OSZB 4NRYA 3JWNC 3VGFA 2NY6C 5FYJU 1D5BB 4YAQB 4XAKE 2H32A 1ZA6A 4M7JH 3X3FL 5DJCA 2WXFA 2ZYRA 3HKZA 2PYEB 3VI3F 5KW9H 2YIHA 1BZQK 3T3ME 4G6MH 1HWWA 4U6HA 3EADA 1MRDL 4KHTH 2D2OA 3L9EA 1CXFA 3IFLH 4FG6D 4ALAH 1I3RA 3NJGA 2EIZA 4LVHB 5ALBH 4KK6D 1TJIH 3AT0A 3DOHA 4WEUD 2VUKA 3WMSA 1BVNP 3WTTA 3LZFL 5DD6B 1RIUH 2HG5B 1XBRA 1RZGA 4Q14A 5I1CL 5JPMA 3UYRH 3WU1A 4N0FB 5FUOL 4IRJA 1L7IH 1NMBH 1FL5A 2ICWI 4X5LA 3D0VB 3OXRA 4XHJD 3EJUA 2DMHA 4X4YB 1XGYH 3KWWA 3VA6A 2NR6D 2VXVL 1DVXA 3WHE1 3MLRL 3K81A 1KCBA 4LVOC 3C12A 4QTHA 5KBDA 4XP9L 3OJDB 3DO3A 1ZK5A 5KJ7E 3FW6A 1DUYA 4K2UL 3T9WA 1FH5H 5BZWA 1I8IB 4F3FB 2I60H 4PG2C 4W9JC 3ZHNA 4Y4FA 4OZHB 1TF4A 3SCMA 2G30A 4YFDB 4NFCA 1QZNA 4ES8A 1NCUA 1P4IL 2A4EA 3PL6C 2YAOA 5C08E 5SX4H 4P5TC 4LU5H 1XSJA 3LKOB 3M46A 4ABVA 3OQ3B 2EKJA 4BA0A 1SBSH 2V2WB 4OV6F 4MS6A 3DX9A 5BS0D 4BWUA 2Y5TA 2Y7OA 4GMTH 3W11D 4HS8L 4GEIA 4GAFB 2WYZA 3W3BA 2A7BA 2EDWA 3L5IA 4JM0A 5LJYH 3F3HA 1KGIA 1EJOH 3PXLA 1F45A 2O5XH 4NKIH 2XZZA 4Q6YA 5D7HA 3VA2C 4X6EA 1T20A 1S7UA 1B9ZA 3NP3A 4FXGC 3SPCA 1AO7B 2HT3D 3HE6A 3TURA 2H3XC 3V0JA 3MUGA 1N70A 3CD4A 1OAQH 1P5VB 1JZJA 2DQJH 4LLVA 5CGMA 2BVTA 4AEHL 2DQTL 2VAJA 3FU0A 4HCIA 4WFFE 1D5ZA 4P59L 3OD3A 4UILL 1AXTL 1TPXB 1A7OH 1T5WB 3P2DA 4JFFD 2WVVA 4XODA 5DRZA 4AC2A 1U3YA 5E5UB 2Y06H 3D7PA 1T3FB 1P5UB 3P2TA 5D7JB 2I7OA 3FRPA 3EXLA 3RL2A 5GZNA 5HYIA 1IU1A 1FCCA 4A7TA 4EZMA 1MREL 3NH7H 3KDPB 2GHWB 2N0KA 3Q6FA 4BZYA 1NDTA 2YPLB 1JWSA 5EUOF 2C9VA 3OG4B 1T89A 2AKRB 2NNRA 3L4XA 1HHKB 4BHUA 3U0PB 2RAMA 3QARA 3S2AA 5I26A 1Q9LA 2JMRA 2Z92B 2OM5A 5CIPH 1BQHA 2ZX5A 5DWUH 3CX5K 4A67A 3PWVB 3V5HB 5TD4A 4OAWB 3MV8B 3T09A 2FBJH 2CNZA 2WBJB 3EFOA 3S35X 3JT0A 4YSDA 1JPSH 3RIKA 4K94H 1MEXH 1WA1X 1SUHA 4PRHA 2K7QA 2WQWA 4YSUA 3CU7A 3V2AR 5ITFB 3EJCA 1ADWA 4MSWA 2YJLA 4ATTA 4QXGL 4ZS7L 3P9MA 4WFFD 3UC2A 5CEZH 3CZFB 3WUZA 3Q1SH 3BAJA 3EFFB 3QHFL 5I71C 1ZIBA 1A1MB 2D3NA 2D73A 2E59A 5HI5D 3OKEB 3GSNH 1SN5A 4UB0L 1DJWA 1KPUA 1C16A 4TVSa 4C4BA 4Z7VE 1ET7A 4G72B 4N2BA 5I1AA 5ANME 2HLAB 2IQAA 4RAHA 1J0YA 1B4LA 4RFEB 4L4VE 4X99B 3U6XA 1CR9L 3V4UH 4L1BA 3NEXA 3B9KB 2LLLA 4M4PA 2LU3A 4NZUL 3VWKB 4YDZA 5JA9A 3IU3B 4AK1A 4BZ1L 4W6XB 4GOSA 3FB5A 2VYRE 4JHBA 4FADA 1LO4H 3KPOA 4KKZA 1HE8A 3FTYA 3VM5A 3IDMA 3AFLA 4OT1H 4PS4L 3LB6D 4HK3J 4JKLA 3D52A 2Q7YA 1HEHC 3G08B 3LN5B 4NXKA 1XIWB 1DTUA 1U8MA 2VQ1B 3FU7B 1I85C 3LS5L 3AREC 3UL4A 3LXAA 3VXTA 1ET8A 3LIUA 4Y8AA 1Z3GL 2RCSH 2XZAL 3LNEA 3TYFB 5EO1A 1ZDSA 4YOKA 1U8HB 4CN6A 3CVHA 1CXLA 4KK5C 1XZWA 4UNIA 3QIWA 5B7EA 4WW2F 4C47A 4V2CB 3SE3C 2BS71 2UZYB 3N55A 4G5AA 1SLXA 3ARSA 1BYOA 3AY2A 5AVUB 2ZKHH 1WD9A 5IQLA 4N2EA 3RX9A 1BWMA 3TO2B 5J57B 4FKEA 5FC9A 4O9HH 5PCYA 3VGDA 1OQXA 2AXHA 3NFSH 2XWJB 4EUPA 3CDZA 2J2ZA 4QRUA 4AIEA 2FHBA 5K69A 1M7UA 4YSOA 4KROC 3ULAB 3DXAD 1PFCA 1S3KH 1YQ2A 4L4VD 4AH2B 4ODSH 5C9KA 1J8KA 2MHAA 3R4RA 1NKOA 2EICA 2EADA 2VLKB 1AZUA 1IBDA 4FZEH 3K7UA 1WICA 3BSZH 4ZZFA 5JIIA 3MR9B 2WLIB 1H3VA 4QYAA 1P7HL 3NACH 5D96B 1WT5C 4ZSOB 2XTLA 4OIAA 5BO1L 5BZZA 1X5JA 3QT2A 4WNQA 5I1DB 1A9EA 3AQZA 2JJTC 3KWVA 5D7IE 1JUFA 4MAZA 4U1JB 2BP0B 1IGFL 3L6FB 2HCZX 2WO4A 3NZ8A 3MRFA 3BEVA 5B3JE 1QRNA 3UCQA 3DMMA 2AK1L 2GI7A 5E9DA 4J4PD 4P5MA 3P4LA 4ZXBC 4NBXB 2Z8WC 1E5ZA 1FH2A 2VLJD 4RZCB 2DD8L 1IAMA 4FHBD 4DSYA 5T3XL 4MA7L 3FMGH 4FQIL 3UGXA 2ITFA 4IKNA 1G7PA 4YDKH 2FL5B 4JFDA 2P8MA 3D69A 3AG3B 3NEEA 3W9EA 3V6BR 2ZP0T 4YHNA 2IMMA 2BO0A 2A1WL 2DI7A 4Z7OF 2HLFD 4G5ZL 4HUVB 2Y5EA 1QASA 3D4CA 2Q1EA 3G5XA 1TQBC 4GXFA 1PIGA 2OCCB 2Z7UA 3F12B 3O0LA 3BUPA 1G7QA 1OB1B 1KB5A 3HBGA 1JBJA 1FPTL 1HINH 3CFKB 3P4OA 1MRFL 5DHVB 2CXGA 1JZ3A 4PJXA 2IOIA 4LIQH 5CKGA 2DYRB 4AV0A 4PYGA 4YIQB 4H8WH 2VE6B 2OA9A 1TCRB 1D6VL 3GI8L 2FQDA 5C0AB 3BMVA 1ETJA 3ZSSA 1UA6H 3TFKD 3QPKA 2GSMB 2YBRA 1NWOA 5IW6B 2DWSA 4PRPB 4JVWA 3W0WE 3BD5A 3H3BC 3AB0C 3OAWA 1FO0H 4FFVD 5D7SL 1CBJA 5J8OA 5DSCB 3WBDA 1A9BA 1NIFA 1MCJA 1SHSA 4BBWA 1P6FA 3VI4B 3QORD 1PLGH 2BWIA 3IFPB 3EDJA 2F8OA 5L88H 1D5IH 3P0VL 4Z3EA 4L8CB 5C7ZA 2F5BL 4GMSH 4NDMA 5E2VL 5DUBB 3UBXB 2GY7B 1AD0B 1UM6H 4JPVH 4YEFA 5KVFE 1E3FA 1C5DA 1PZBA 4V2BA 2ZTBA 3MTRA 3JWOL 1P1ZB 5BXFA 3B2UD 1CDCA 2N3JA 3X1EA 4GG6A 4IBZA 4YHKL 3EUDA 4K7PL 4KDTA 3TV8A 3BVUA 3SY6A 3KPSB 1KENH 5FGBC 3H7BA 4QF1B 2BY0A 1FFRA 1KT2B 4G1MB 1XGUA 4Y1AE 3I2CH 3U9WA 1ZXKA 3OAYK 3R1GL 1G1CA 2DW5A 2HA1A 3D3VB 3HHRB 3O9WD 3RWFA 3V0AC 2CIKA 1DSYA 2WBXA 2ENQA 1DBKL 2UXFA 3DTDA 4HC1H 3AS0A 2JTDA 2YS4A 5INCB 2IGTA 2CSPA 4M7JL 2UY6B 2H1LM 5CBAB 1ANUA 3PWJA 4BKLA 1F97A 2J12B 2CLVA 1EZVY 5D6DA 2RHEA 2XYBA 5GZOC 3TBVA 1U2HA 1ZS8B 2BINA 3P0YH 5D1QC 1Q9KA 3M1BA 4ENEC 3NRPA 4G42A 2ZXGA 3I50H 4KHTL 3QNZB 4AGPA 4HJTA 2RMNA 3QIUA 4ALAL 1UWYA 4WKZA 1WAAF 3STZB 4DKDC 3T0EA 5ALBL 3RTQB 3AZUA 1NGPH 4R0LA 4J6RL 5F9WC 4JMNA 1RZFL 1O9ZA 4NIYE 1VB9A 1AOZA 2P8PA 3JZYA 1FZOB 1RIUL 4AQZA 5CZXC 4ANXA 5A7EA 4PJ9A 2VDQH 1L7IL 5AENA 2WLJA 4RAUA 5C70A 4PV9A 1M6UA 4XPBL 4FEIA 2YRZA 2NY2B 4RMQA 5EBWB 1XGYL 3V6ZB 3D3VD 1IGYB 1UD3A 2YLHA 3HS9A 3FT0A 1CVSC 2LTQC 4Z7UA 4Y1AD 1YMMB 4U1LB 1E3ZA 1FH5L 5CZRA 3U30C 3RZCB 1BD2A 1DQJA 1OEZW 5DI8B 4LVNC 4DERA 1DYZA 3DV6A 2OZ4A 3D5OF 5EIIA 3DLQR 5JW4M 5AALA 5IESL 4PJAE 4D9RE 5CGBA 3UTTB 3HNSH 1S2EA 4ELDA 4N2GA 3BDBA 3FQYA 4LU5L 1E9PA 3PNWB 4CNIA 1MY7A 2NYZA 4AV4A 3IWUA 5A6LA 4FA8A 1XB6A 2EDEA 2NYYC 3O0RH 2VL5A 1NEZG 2FO4B 4GMTL 2KERA 3QNYB 2AMGA 2X4NA 4NWTH 2CBTA 3NIDF 5GS0D 2ZWSA 2QELA 2X4PB 1IQDB 2AK4D 2O5XL 3L3GB 1MCPL 1WA2X 5DK2B 2HLFC 4HGMA 1PZ3A 2NUTA 4AVKA 2I9LA 4U49A 2EO7A 1XF2A 5CN2A 5B7FA 3TP4A 1R5VB 2FZ3B 3PWPE 4JFXB 2ZUXA 3KJ4C 2AANA 1XT5A 2DQJL 5KWYC 4XVSL 1QLEH 4KKNA 4E9TA 3IGLA 1SM3H 4P57B 1YMMD 1F56A 3A5VA 3SZKC 3LXUX 4PHZA 1XCTA 1QBLH 1DQLH 3GMOA 4JVUA 2DTSA 1UB5B 3CDGA 3MPCA 2HPOA 4KMQA 3D4GA 3MKKA 1KEMH 1E28B 2JKNA 2Y06L 5I9QB 1N19A 4RMBA 4PRAA 1JZIA 4DP6X 3EGSA 4GI6A 5HDBE 5J4MA 3GBDA 4DGVH 4X50A 4ZFOB 2GTZB 4K3HA 3RB5A 2CPCA 1DANT 2IEPA 4D3CH 5HHOD 2ZXQA 2HTLD 2AW2A 3LS4H 5D1ZB 4PJ5E 3ZKQD 3SBPA 3ESPA 4FFTA 1IEBB 4QT5A 1XCQA 1LE9B 1UXLA 3IMTA 4OIIH 1EFXB 1J7VR 4O51A 4HF5H 4X98B 4QIRA 3EHBC 2Q2EB 3HG1D 4WVRA 1L0QA 5CLZA 1JPFA 1IILE 3N04A 4E5XA 1NBYA 5DWUL 2P4AB 1AS7A 1A4AA 1OP3H 2FBJL 2HVJB 3AS1A 1JNHB 1JPSL 1R3JA 4K94L 2X38A 1TYEB 1S9WB 3IDNA 3PWPD 5AYQA 1W16A 5T5FH 1IGTB 2D7OA 3DECA 4C83B 5JW5A 5KS9F 5K9OB 1NAMB 5FGCB 4YDLB 1JXDA 4H8VA 3SGJA 4ZK8A 1PCSA 3TWYA 4XZUA 4I1RA 2NW3A 4PJDF 5CGTA 1V7MH 4PHXA 3MJ9L 5EZIH 1GIGH 1U4FA 4TNWF 3ZDXB 3B37A 4ZPVA 5CEXA 2Y7MA 4MMXB 1NFDB 2XUWA 3QUMH 2FNBA 1MCOL 1KJ2A 2FWLB 2RACA 2LHAA 4X8GA 1B6DA 2YA0A 4PV1C 1KTDB 3HZKA 3SO3C 1RZ8A 1WWBX 3D39E 1BOGB 5AD0A 2WJ7A 3G6JF 4HJGB 3W5NA 1LO4L 2JKXA 3NJLA 3QQ4B 2NY1D 4NLHA 1F11A 4QXUL 2AEOA 1WWCA 5MENE 4OT1L 3E3QC 1FI8C 1XGZA 1PDKA 4BDVB 5HVFB 2A9AA 3L3JA 3AVEA 5I8EA 5I5JA 4URKA 1U8NB 1UFGA 3DIDA 4IGBB 4NQEB 4HPYH 2G3ZA 4KNQA 3U36B 1K3IA 3FHAA 3QWRD 4WTQA 5C0BD 3WIFA 4IIQA 1EEQA 4JQVC 4PREB 4PS8A 5J12B 5F7KC 4ZW5A 1Q90A 1XSOA 4OCWH 1SMOA 3VI3B 3K72A 1NDMA 1T6VN 2CO6B 3VWJD 2HFFA 3WKQA 3IE4A 2F1AA 1MWAB 4AYFA 4HH9A 3FOLA 4TVPD 5GRWA 2BJML 4G9DB 3VG0L 4D9QD 2YO3A 3PQYB 3TBWA 3VQMA 2IGFH 2ZKHL 4I88A 2CH8A 3MKGA 3QEQB 3PHOB 3LXBA 3MOBH 4O9HL 4KHXL 4U2ZA 3BSGA 4JRXE 5A2AA 3NAAH 3ZQ9A 2NUPB 1E4XH 3FH5A 4X4ZA 3SJVE 5CSZB 5JHDB 5KSBE 2IANB 3BUYB 3WEOA 5C0RH 1S3KL 4ILDA 4C56E 1OQOA 1MFNA 1QTPA 1WE5A 2NSQA 2XIBA 3CGTA 4ODSL 3RGBA 1JYWA 1JGLH 2XV2A 3IN0A 2AXFA 1WC7B 4MA1C 4ZMLA 1Z3RA 4N6RA 2ED6A 3QDGE 1HDMB 2I07B 2J6EH 5F3FA 3GRWH 2ZWYA 1GCYA 4E68A 1FL6B 2ESVA 4HUKB 3MXWH 3SE9L 4IRZA 4XXWC 1OSZA 3BPNC 3GBEA 1R3IL 1D5BA 3AM8C 43CAB 4YAQA 1XO8A 3G04B 3GDCA 4UV7L 4L8SB 1F8TH 3EBAA 5DCCA 1OOAA 2PYEA 3QR1A 5D7LB 2Y7QA 2VXQA 3HE7C 1F41A 2IPUG 4YK4B 8FABB 1XGQB 5T1LD 2CO2A 5I1IL 3QEQD 1JK8B 2CUMA 1YAZA 1ZLWK 3RY6A 3WD5H 3BFOA 3LN4B 4J3TA 4CKQA 5BS0A 4YN3A 1OARH 4F1SA 1AYRA 1TZHB 1W72H 3ZPDA 2EXWD 3DPDA 3BWZA 4JRXD 1ILSA 4MXWH 4LP4A 4IOSD 4M1GH 1JDAA 2NXYD 4X5QA 2EDKA 4PGDB 4IK7A 1NPUA 3HFML 3FU3A 2AJ3B 4NRZB 5DD6A 4F37F 4O02B 2EDMA 2HG5A 3L4UA 1UM4H 2EH8H 3RVUC 1JYXA 4N0FA 2H0JA 3CIAA 1GYUA 3EH4B 5ABZA 2P8LB 4JO3H 1GPOH 3GXIA 3D0VA 4UM8A 4HD9A 4QRPB 1FFNB 4X7TB 4X4YA 1MVFA 2VDLH 4LIQL 4HCGA 3HW7A 4H8WL 3OJDA 1SMAA 3CFTA 4C8XA 4H44C 4EI5D 3A22A 2B2XH 3APNA 2FATL