1ZSPA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAAVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zspA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zspA02
3RN4A 1JR9A 1LUVA 3EVKA 1AP6A 1PL4A 4F6EA 1AP5A 1XDCA 1SZXA 1EN6A 1N0NA 1JA8A 1Y67A 1MMMA 4YIPA 4C7UA 1AVMA 1ZSPA 1B06A 1MSDA 2RCVA 1EM1A 2AW9A 1IXBA 1EN5A 3CEIA 1ZUQA 2GDSA 3K9SA 1XUQA 4JZ2A 4E4EA 3DC6A 5AG2A 1MNGA 1GN2A 1GN4A 3AK1A 2ADPA 4YIOA 2QKAA 3AK3A 1EN4A 1I08A 2CDYA 1WB7A 1XREA 1ZLZA 4X9QA 4BR6A 2CE4A 1KKCA 1BS3A 1ZTEA 2QKCA 5A9GA 1AR5A 3TJTA 4JYYA 4JZGA 3QVNA 1I0HA 1PM9A 1XILA 1WB8A 4FFKA 3DC5A 1D5NA 1IDSA 2ADQB 1VEWA 3C3TA 2P4KA 3AK2A 3KKYA 3IC9A 1MA1A 1GN6A 1N0JA 1VARA 1QNMA 1IX9A 3LSUA 1GN3A 3C3SA 3MDSA 1BSMA 1P7GA 1LUWA 3OT7A 1AR4A 3BFRA 4GUNA 1BT8A
chains in the Genus database with same CATH superfamily
4TWKA 4JI0O 1SQPH 2CK3G 5FNVB 5L3EA 1JCHA 1D2DA 3CCSV 2YDEA 3HKBB 2QTOA 1VQ4V 1DF4A 1XI1A 4I0XB 1FD9A 1SKVA 4YIPA 1EZJA 4GCZA 4DV3B 4WFBV 2F4VO 3E2EA 3B09A 2ZE7A 3RYCB 1LNQA 4X66O 3K79A 2Q7EA 2ZQMA 1IBLO 5EZYA 3BY6A 1NH2B 4JI8B 4O2AA 4Z2WA 4JGSA 1Z5VA 1FXKC 1K7DA 3AK3A 5ITZB 4DRXB 2QTSA 3FKSG 3CWBH 1F23A 3TETA 2WLNA 3RBZA 5GONA 4LF6B 5BR8B 5LHGA 4O4JB 1ZWIC 1N33B 2Y0PA 4LFCB 4AQYO 5BY1A 4IYIA 2EIJC 4QGPA 5DECA 4DR1B 1FS0G 2VRZA 2EZOA 1K34A 2VWKA 3JARB 4O2BB 3F7YC 1Q6UA 1N34O 3T1YB 4FLWA 3RVYA 3N2KB 3ZRXA 1NU1H 5KX5B 3K3WA 1VF7A 2IJHA 1V55C 3WB2A 2GUZB 3NR7A 5IDJA 3ABUA 2P90A 1OHHG 1MA1A 1QR8A 1VARA 2X6AA 2EINC 1LUWA 5IE9A 4GUNA 3TGUH 3FYIB 1BHAA 4JV5O 2UXBO 4AHCA 4OXSA 1E79G 2ZDIA 3OMNB 4WFAV 2Y69B 4MVSA 5JH7B 2E76B 1Y67A 1OCCB 2UXBB 4TV9B 1THZA 1Y74A 3OFNG 2RCVA 4OPHA 4KFMA 3WG7C 1CPYA 1FJGO 1CEZA 1IZ3A 3MHHC 3RYHA 3LSSA 3UO2A 1RM1B 1S5HC 3D36A 2CTQA 4X62O 1RSOA 4DUZO 3ABMB 4JI4B 2XUMA 4CH5A 3SGIA 2PGGA 3JALA 2P67A 2XNDG 4PJ0Z 1J5EB 1M9NA 2QKAA 3JAWA 2QM7A 4JI6O 1WPBA 1GM8A 1YZBA 5KAIZ 4O4LA 2P06A 3M7MX 3ZHQA 3ZMTA 2A9HA 5LP6A 4B3RB 3CB2A 4MVRA 1IBMB 1FYJA 3H01A 5LOVB 2OCCC 2Q67A 2FMLA 2K9PA 3ABKB 5EC1C 1IBKO 4JTAB 2BSKB 4FFBB 3JCZA 2UUCB 1D5AA 3CRAA 2JEXA 1R6KA 1YJNV 1EBOA 2YIAA 5LHHA 2BSKA 5IT9N 2Q6AA 3EXAA 1U96A 4UCSA 1BGYH 4JAAA 5H6RA 1VEWA 1P4RA 1SQBH 3ML0A 2OCHA 4TUYB 1Q3EA 3ZCCA 1B3QA 2Z3YA 3RVZA 1GTOA 5LGUA 1V9PA 3VQVA 5IYDO 4XDKA 2N74A 2DYSC 3ABLB 5FPOA 5CBFA 3MDSA 1BSMA 2XT9A 1P7GA 2WPDG 4LCUC 2EIMB 1KC8W 3BFRA 2HJFC 4PELA 3ZMZA 5BR8O 4FLXA 4JTCB 3CCEV 3AG4B 1NQTA 4ZHQB 4DV6B 4ZOLA 4CH6A 5BMVA 2JK5C 4DR3B 4CS3A 1XEQA 3E8HA 2EIJB 2E3CA 4DUYO 4LNUA 4KUMA 2HVKC 2EIKB 2DMXA 1S72V 1N36O 2EJRA 2VQFO 3ZX6A 1EM1A 4LP8A 1JOYA 5JQGB 2CAZC 4DR7B 2P6JA 1YTFD 2OTLV 1H2SB 3HKCB 5DEDA 5AG2A 1MNGA 1NKDA 2LFRA 1WLEA 1GH6A 4MVZA 1KKDA 4DR1O 1KQSU 4X65B 2EJ7A 2YS8A 1I08A 5IJ0A 1Z5WA 3CCVV 4B3SB 3G6EV 1M93A 2QWPB 1HP8A 2HG5C 4TT3G 2IH1C 1KP3A 1VMGA 3X2QC 3CC4V 1YJ9V 5IJ9A 5L3DA 1DGSA 5B1AB 3WG7B 5HFLA 1GAXA 5J2UA 4P9OA 1IXMA 3B8MA 1K4CC 3CYOA 2NNUA 3AG1B 4X66B 4GX0A 2Z5UA 1WA8B 2Q5ZA 4YHHB 3P32A 2RMKB 5A2QN 4MSWC 1GN3A 2W0FC 4NB5A 2DJVA 4J9YB 2QWQB 4DK0A 1WP8A 3DXRA 1R73A 1TGOA 2DQ0A 4B3TB 3EVKA 3JAMN 2AZ2A 4IHJA 1Y76B 3LNNA 4TUYA 2Q73A 2MK3A 3H1JH 2A7WA 4E2LA 5C93A 1AR1B 4UB8Z 1BHBA 4K35A 5LYJB 1M90W 1M4UA 1BE3H 2QKSA 4TOIA 3IGAC 4FM2A 4DR3O 1BQZA 3CXCU 3LUTB 3RFRA 3UQ8A 2DN9A 5LA6B 4XBFA 2NR5A 4DV7B 4X1KA 2VWJA 1JNBA 3UT5B 1FFTB 3CRMA 1U97A 1R1BA 3L9DA 3HPLC 4G2KA 4ZI7A 4DXWA 4U3JA 2YIBA 5EBLC 4DV4O 3JSNA 5KA6A 5JWPA 3U0ZA 2CDYA 2L6LA 4EEQA 2QA4V 5EC2C 4MVUA 5LA6A 2E75B 2HHHO 3HKEB 1ZTEA 3CCRV 1W0KG 3D8CA 4DR6O 1AR5A 2IH3C 4PDVA 2DOSA 1G4YB 5JCOA 1HNWO 4I55B 4MVQA 1XQ8A 3F7VC 3ICXA 5F2VO 3OR6C 2N05A 4JYAB 3CSXA 1YHQV 1RM1C 2ZNJA 4UCOA 3HB3B 4QIWF 4JI6B 2JGDA 1ZAUA 4X64O 1XNQB 1XMOO 1QNMA 4IIJA 5KHGA 4PDMA 3CJHB 4H13B 4NTXA 1HNZO 4MT8A 2X7RB 1YTFB 4JI4O 1N36B 1H2NA 3A0RA 4I4TA 4X1IA 1S76D 1UFIA 1RSOB 4DUYB 3F5TA 4B7EA 1QLEC 4J11A 1PL4A 3J7AU 2EULA 1QLEB 2KB1A 3T2MA 2ZT9B 4QJFB 1HWYA 1H2MA 4DV6O 1FAFA 2JIZG 1IVSA 1M57C 3SJAC 3C90A 3FB8C 4RUEA 5B3SC 4LF7B 3FYEB 3U10A 2UU9B 4K0KO 1R3IC 5CA1B 2RN9A 4JI3O 4AI8A 1Q43A 4Q20A 3AG3B 3SDLA 2QR4A 2QE7G 4WFGA 3A8TA 1FXVA 4E4EA 1H2KA 3AG7A 2LGWA 1XNRB 5CA1A 4EB6B 1SA0B 4YIOA 2LW7A 1YI2V 1MSWD 1FOUA 2WA3A 1ZLZA 2CH7A 2ARHA 3UCSC 3IJ4A 4KP4A 4GX5A 3ZRVA 1YCIA 3FFQA 3T1HO 3OAAG 5H5NA 2XHBA 3UM7A 1KECA 3AEIA 4B3MB 2UXNA 2IU3A 3OTFA 1OCOB 5BXZA 4I4TB 1X4TA 3DC5A 2HJDA 4MW8A 4IIJB 1Y6XA 5CBHA 5KUKA 1XBLA 3G4SV 2B9ZA 3JD1A 3JD4A 3EHBB 1P7BA 1NJIW 4DK1A 3CRRA 4GKJO 4LH6A 3SPHA 4FIPC 4LC1A 1BCCH 1WJZA 5EIBD 4A5UB 3K5LA 4FK5C 2ZD9A 2WSSG 2PF4E 4MW3A 4DV2O 1AB3A 3QNEA 1AP5A 4J7KA 1YDXA 5CB4A 3CE2A 4LF7O 1GM9A 5EK0A 3P3PA 1VF5B 5GW7A 4I50B 4PA4A 3BRCA 1TUBB 2YUAA 4CBCA 1S5JA 2BTQB 3IFXA 4W4KA 1NVPD 2P7TC 3ASOB 5KHJA 4WCEV 5LP6C 5B66Z 1FXHA 1A32A 1NS1A 5LXTB 4P30A 3QO5A 1R3LC 2V7QG 3FB7C 2XAFA 4F6RA 1M56B 1WP7A 1M56C 4DV0B 1YITV 2WLMA 4YY3O 4UB6Z 2QEXV 4ICGA 4MTFA 1K5QA 5L3BA 1R6TA 4NXNO 4JYAO 1N32O 5LMNO 1HR0B 5JJEB 2ZE5A 1MZFA 2RQ6A 3BEHA 3SPIA 5KMGA 3HKEA 3W7SA 1JFFA 2YEVB 1I0HA 4UXNA 1KD1W 1I5XA 4DR6B 1F7YA 3DXRB 3BHPA 3JD3A 2GTSA 2KG7B 3SYQA 4ZBMA 4RO2A 4ZKIA 5CBGA 5E79Z 4UV8A 1JQ0A 2ZXWC 1W59A 4DV4B 3LSUA 1P49A 4PD4F 4IGGA 1ORQC 3RT3C 5J2UB 4JI2B 1NTZH 5DN6G 2PZSA 3JAKB 2UUBB 3OM3B 3K5OA 3PN1A 3AG4C 2GV9A 3G71V 5KX5A 5FL7G 3JAKA 2ZR3A 1WPXA 3RYIA 1VQPV 4AQYB 1JA8A 2VQFB 4DV1B 2EBOA 2GTAA 1QHTA 2E5LB 2WLJA 2PI4A 2VS0A 1SQQH 4GKKB 3K5NA 3BA8A 1COWG 4LF8B 1LR1A 4HNAA 3APQA 5CN0A 1PKXA 3ZHTA 5ITZA 3TCUA 3RYHB 1KYOF 3EFFK 5JQGA 5FLXN 4B08A 1N32B 2X0LA 3RYFA 1XOUA 1EN4A 3K04A 4D7SA 5KHHA 3BVOA 1IJGA 1K3EA 1H5WA 4WFFA 4Z1MG 2UUAB 4BR6A 4LF4O 4NXMB 3CRQA 4JI5O 1V55B 3SYAA 2QGNA 4YXWG 1I94B 2A0LA 3QO8A 4JYYA 2ZDIC 1PM9A 3L75H 5GONB 3A0HZ 1GMGA 1NTKH 1Q86W 4FLZA 2EINB 5B3SB 5C8YA 5LMUO 1R3KC 3S3WA 2ADQB 3FD9A 2JS5A 3CC2V 4NXNB 3HKCA 3KKYA 5EZYB 2Y69C 4RQEA 3ETGA 2B5UA 4YY3B 2BTOA 2P5OA 2YIBD 3WB1A 4DR5O 2RJZA 3APOA 2LJ2A 4J80A 2XASA 1RPOA 3RN4A 5IYBO 1NR7A 1NVPB 3W7UA 4PA6A 4B7KA 4F6EA 4I0XA 1XDCA 3TK1A 2PUSA 5IY5B 4N21A 2QM8A 1EN6A 3HKDB 4LH7A 4LFBB 1E1QG 5B1NA 3ABMC 2JDIG 3RGBA 4DR2B 2WLHA 3H9VA 3L74H 3JCUZ 4UVBA 5D5PA 1OCRC 5LGNA 2GDSA 4JI7O 2F93B 4JV5B 3ZN1A 2AZ0A 3QF7A 1OJHA 5LMNB 5B1AC 4J7JA 1XL4A 1V54B 5B1BB 3TXSA 3S3XA 3STZC 3KCYA 1Q82W 1WB7A 1Y74B 4W4LA 3ZJZA 2CUGA 3DGEA 1DTOA 1XNRO 3B77A 4JTDB 4R6ZA 2JS3A 3JASA 2XAHA 3AG2B 1YIJV 1MOFA 2QM4A 3AG2C 2BOBC 4FFKA 2BE3A 4PI0A 5B5EZ 1IDSA 3MHSC 2Q8VA 1WAZA 2DWDC 2PI5A 3ABKC 1K9MW 3T4ZA 2Z0AA 1SRYA 5B1OA 1SF9A 2FB5A 2UXCO 4OX9B 2LFSA 5DM6V 5KHIA 4ZIBA 3OTOB 4ABMA 3OT7A 5KA5A 3W7XA 4BIZA 4X62B 5CA3A 4XDJA 3SYCA 1IBLB 1JMKC 4FVMA 4TV9A 5JCOC 1HNZB 4NKGB 4TSFG 4PA9A 4UFZA 5LGTA 1DK1A 5KHKA 5HFMA 4X1IB 1RPRA 2Q9LA 2OYQA 4DYLA 3BCCH 4C7UA 5LBQA 1ZSPA 2W6IG 4DR5B 3CCMV 3K0GA 3L71H 1MSDA 1K8AW 2YXHA 3SYPA 3T1CA 2H3OA 4LFAB 3UO3A 3K06A 4BAYA 1YSCA 1H2LA 2AHYA 2LP7A 2KG7A 4FM0A 4U7NA 3T1HB 4FLYA 1XUQA 1MABG 1KMIZ 4H44B 1L8DA 2E5LO 4BIOA 5KLVH 1H8HG 4L87A 4I55A 2HHHB 2OTJV 1H8EG 2ADPA 4NTWA 1JX9A 1FFXB 3ZMUA 4LF5B 1K5SA 3VQYA 1S3JA 1BZKA 2OT5A 4MVOA 5A9GA 4H37A 4X1YB 2HP8A 3K58A 3UKMA 4O4HB 2KSDA 5FNVA 3D3IA 1AI5A 4U7OA 4F6RB 4I9QA 4HYOA 1HNXB 4DV3O 4N23A 2YC0A 2ZIOA 1PD3A 2FL4A 4U3FH 2JRIA 1PL0A 3IC9A 4YJ3B 3F5WC 1NBMG 3CMAV 3N27A 4KHPO 4DO2A 4PHZA 4MVMA 2ETNA 4MTOA 5EBWC 4B3TO 4NVPA 1SZTA 4CC6A 4UVCA 2IJIA 1AP6A 1B6QA 1QBZA 1CP9A 4XDLA 5GTIZ 3ZHSA 1XNQO 4KXRA 2C2AA 1Y4MA 2GHYA 1L0LH 4PA7A 2CTPA 4LF9O 4JI2O 1FXKA 3G80A 3KDRA 4UCUA 1B06A 3BAAA 3VOUA 1K73W 3H1HH 3ZHUA 3B8NA 2DW4A 2M6YA 4FPPA 4X1YA 1W2BU 4DV5O 2E74B 4JZ2A 2DQ3A 3H1KH 1S77D 1TAEA 2BOCC 1VF6A 1TVKA 1NH2D 2NLJC 1Q7YW 4JAVA 1Y66A 2ZINA 1XREA 3OUFA 2FTKA 3A0BZ 4IHJB 4BW5A 1AI4A 3DSQA 4MTGA 5BZBA 2QKCA 4GKJB 3E22B 4MTXA 3L73H 5IJ0B 2IBZH 4HNAB 4WFHA 4OGQB 4MS2A 1X59A 2PYJA 3IAYA 5C8YB 4DV0O 1ZL8A 3Q4HB 3JYCA 4JASA 3ZRSA 3ZHVA 4GLXA 5IYZB 2F1MA 2YIDA 4CZZA 5JVDB 2LQTA 1L1FA 3JD0A 1KUQA 4LWSA 1Q5OA 4DR4O 1AJQA 2JEUA 1MZEA 4K8ZA 1V54C 5J2TB 2WLLA 3ZRWB 4OPAA 2H94A 4UVAA 3CCJV 4DR7O 2XTAA 4R8CA 2F43G 3LSQA 1SZXA 1XHXA 2Y0IA 2CTWA 4DW1A 4FM1A 1RFYA 1M5IA 4JAUA 5E1AC 3P3NA 1I7FA 2P4VA 3CXHF 1FXKB 4KHPB 3CPWU 3M8AA 4G27B 4ZI7B 4RAIA 2YI9A 1IXBA 3PJSK 3BA9A 2CTRA 1ZUQA 4CH4A 2YEVA 1M1KW 3VBBA 1JFFB 4Q6GA 3ZMSA 2GSMB 4L8JA 5L3CA 2HKOA 1AJPA 4I9WA 2QJ1A 1SETA 1YVWA 1PP9H 2VQEO 2QDOA 3K0DA 5CMUA 1F4NA 4JI1B 5L3GA 4GT1A 3KCXA 2ZCEA 3ETQA 1URFA 4FZ1A 4YJ3A 4LFAO 1JPXA 1J5EO 1BS3A 2OIGA 2XAQA 1WN7A 3QG5A 4O4LB 2A79B 1XMOB 3K59A 4QE7A 4U3JB 4O4HA 4D6TH 4K3AA 2YXYA 2ZE6A 2RDCA 3G6BA 1ROPA 2V4DA 3A2FA 4ASUG 1SQVH 2EZPA 2A3QA 4OX9O 4EFEA 1H2GA 2UU9O 1EFRG 2EIKC 3C3SA 1N8RW 1OCOC 4DV2B 3FB6C 3OEEG 4F4LA 3B4SA 4QNHB 4DUZB 2Q0OC 2NN4A 2QWNB 5LOVA 3ASOC 3SPCA 4P2ZA 1VQKV 4H0LB 4K8XA 2ZR2A 2EILB 5IY5C 5J9PC 2WWWA 3JAWB 3W7WA 3ETEA 3BABA 1MMMA 2F66C 1PV0A 1AVMA 2BTQA 1VQ8V 2QWRB 2UXCB 2AW9A 1N34B 5L3FA 3QO7A 5CA0A 2D2CB 4I50A 1UJWB 3D36C 2UXDO 1OCRB 2WLIA 3CRCA 2Y48A 3DC6A 1O9GA 4FMTA 1IBMO 2GBOA 4QPKA 4DR4B 3H1IH 4UCVA 4LNUB 2UXDB 3SR2C 5JJJB 1OCZB 3JATB 4QE9A 2B1IA 2JVDA 2CGOA 1AROP 2R72A 3AG1C 1S5LZ 4ZHQA 1WA8A 3U11A 4JI8O 4LFBO 3LNMB 2DYRB 2UUAO 4GX1A 1N4CA 2V1DA 2ZXWB 4PI2A 4X89A 2DYSB 4JI3B 1K33A 1WB8A 4JI1O 3E22A 2VQEB 1K97A 1AILA 1NTMH 2OCCB 1VQOV 3E89A 1US6A 5LMUB 5IJ9B 1XMQO 3HR0A 4LR3A 5GTHZ 3I56V 2R9RB 1PNMA 3JARA 3OMIB 4O2BA 4PDRA 1YEWA 1N0JA 3OGCC 2AHZA 5KUMA 4DR2O 1KB9F 3OD4A 1JJOA 4RUFA 4JI0B 3JD2A 3E35A 1LUVA 5BMVB 3ASNC 4DV1O 3CCQV 2H8PC 2JGDB 1L0NH 4EFBA 4X64B 3ABLC 3CD6V 1QLNA 2A06H 2YSUB 1TUEB 2EX3A 4KL1A 4CH3A 1P84F 3T1YO 2IJKA 1QVGU 3ZIAG 2ZIMA 3OW2U 2ZNIA 3GVMA 1FKAO 3HKDA 4EKWA 1Q8IA 3ZBHA 4G28B 1H38A 2QSAA 4LFCO 1SQFA 5EYPA 4J10A 1Z2GA 4JPRA 2WLIB 2CGNA 1Q6IA 5CA0B 1Q90D 1SQXH 1QCEA 4AILC 5K1XA 3KG2A 1VQ5V 1QR9A 2N04A 2WA4A 1I94O 2HVJC 4Z1VA 1BQ0A 2M7WA 2Q7HA 2ZE8A 4HBNA 1CXZB 2CE4A 3J80N 3CMEV 4JI5B 1GK9A 1I5YA 5LP6B 4BWAA 5LXTA 4RQFA 2OWOA 2LO1A 4B3SO 1Q81W 4J7ZA 4JZGA 4X1KB 3SJCC 4DV7O 4TQFA 1XILA 3RWRD 3LDCA 1FPOA 1BL8A 2FKXA 2WLKA 3MD0A 2F4VB 3ETDA 1GO3F 4FLUA 5LYJA 1B04A 1NR1A 1NT2B 5CB4B 5EYPB 1W0JG 2ITDC 1E1RG 4I5SA 1VQ9V 1OZ0A 3LDEA 4GKKO 3K5MA 1Y76A 4UV9A 3CC7V 2KQXA 3W7TA 1VQNV 3B40A 2R9IA 2XOKG 1QU7A 3GB7C 1AI6A 2W6JG 1JR9A 4FJCC 4B3RO 4LF9B 1RP3B 4P9PA 4UCTA 3JALB 1VQ7V 5IYZA 1KU9A 3M99B 4PA3A 3T4DA 3I55V 1OCCC 3E8GA 1XMQB 5TISZ 4GYCB 4DRXA 3GWKC 3DTUB 2XAGA 1HR0O 1UPGA 3ZS8C 1MG1A 3JATA 3OGIB 3ZN0A 2EIMC 2IJJA 1VIBA 1OV9A 1FJGB 2HR3A 2MW2B 1NZ6A 2YI8A 2ZM6B 2YICA 1YJWV 1DF5A 2BCCH 1VF6C 1GN2A 4LBEC 4J41A 3J81N 4NTYA 4X8AA 4CC5A 3FB5C 2UUCO 3CP1A 1SA0A 1SQGA 4BW9A 1PNKA 4HZ3A 5FPRA 4J42A 4O4IA 3HKBA 1GRJA 2HFEC 1QQCA 2R9AA 2LW1A 4R7CA 1NI8A 1PNLA 4JYCA 3TJTA 5IWAO 3L72H 1S0VA 3QVNA 2Q0AA 2GUZA 5B1BC 3FAVA 1K92A 5D5QA 2WLLB 4LF5O 5J2TA 3K03A 4O2AB 3N2KA 3JASB 4YJ2A 1GM7A 4FZ0A 2JGUA 5KMGB 1TVKB 1R3JC 5H9CA 3RYCA 3CCUV 3AK2A 1KP2A 4QPJA 2FYUH 4D7TA 3X2QB 1F51A 1GN6A 3SJQC 1G1XB 1WNSA 3LDDA 1IX9A 3RW0A 3E8FA 5LL6Y 1F4MA 1N33O 2K1EA 1ZL8B 4J9ZB 4PDLA 4CS4A 1OCZC 2OIEA 2G38A 3E86A 4BIUA 1IURA 2F23A 2PTMA 5LHIA 1HW7A 3L70H 2Y4TA 1SESA 2Q69A 3K57A 3N2GA 3ZEDA 3VQXA 4TV8A 3SPGA 2W0XA 2DYRC 2D3OW 4GZRB 2AXTZ 3OMAB 2AGAA 4IYHA 4RWUA 3OTOO 3CX5F 3WFVA 1EN5A 2JJ2G 2KKWA 3CS5A 4FLVA 2YXLA 1YF2A 3K9SA 3ABTA 3OUSA 3SPJA 1IBKB 4ZOLB 1G8MA 3RYFB 3AK1A 2XAJA 5EIBC 4I7ZB 4B3MO 3KZIZ 3N2GB 3P30A 3CCLV 4X20A 3H1LH 1VQLV 3JSLA 4FLTA 5EBMC 1PPJH 1DLBA 3ASNB 1BMFG 3UT5A 5IYCO 1ENVA 1HDJA 2IM9A 1GKFA 2ZKOA 2O57A 1TA8A 4IL6Z 3SJBC 4WFEA 3ZRWA 3K9AA 3ZHRA 2X6BA 2LGQA 5IWAB 1FFXA 3I5DA 1AI7A 4WBNA 2B1GA 1JJ2U 4NR1A 4FFBA 4LF4B 4NXMO 1SS3A 3THOA 1J95A 3C3TA 4WF9V 2P4KA 5JH7A 4JI7B 2CH7B 2JJ1G 4H33A 1T5EA 4YJ2B 4WBNB 4K0KB 3R65A 4R50A 4DW0A 3FX7A 3VQWA 3FAVB 3GWOA 5JVDA 2DWEC 4EB6A 4UCRA 4NYKA 1YXBA 1BT8A 2IU0A 2ODMA 4LF8O 1EZVH 4O4IB 2ZM6O 3NXSA 3ZMVA 4X88A 1N0NA 2EILC 4IT5A 4UUJC 3STLC 3D3QA 2HEPA 3CHXA 1R6NA 4PV1B 3RYIB 2Q7GA 3E83A 3TXQA 3CEIA 2UUBO 4CS2A 5K1PA 4YHHO 3OEHG 2DE0X 1AJNA 3E8BA 1G6UA 3OE7G 1QVFU 4LWSB 2ITCC 4JYBA 3OR7C 5H2FZ 1GN4A 2P22C 3CJHA 2WAMA 1HNWB 1K4DC 4LF6O 2PY5A 1VP7A 1M57B 3Q4HA 1XL6A 4TV8B 3O65A 2ATKC 4TQDA 5KAFZ 4X9QA 1XHZA 4JF3A 1KKCA 1ZX3A 3SYOA 1SC5B 3WU2Z 4DV5B 1HNXO 2R70A 3AG3C 3G67A 4GX2A 2Q4PA 2UXXA 3BPZA 2ILMA 2Q68A 2Y4UA 1TUBA 2L35A 1JVMA 1VQ6V 2QWOB 4X65O 3R66A 1VQMV 2F95B 1D5NA 3B2EE 3QTCA 2X6CA 2RNBA 3IC7A 2PYLA 2HLDG 5JJNB 1SERA 4O4JA 1KBHA 1Q6HA 4HAMA 3K08A 3O9OA 5H6QA 3WB0A 3MAQA 1O9HA 1AR4A 2IW5A 4X20B
chains in the Genus database with same CATH topology
3RN4A 1JR9A 1LUVA 3EVKA 1AP6A 1PL4A 4F6EA 1AP5A 1XDCA 1SZXA 1EN6A 1N0NA 1JA8A 1Y67A 1MMMA 4YIPA 4C7UA 3KDRA 1AVMA 1ZSPA 1B06A 1MSDA 2RCVA 1EM1A 2AW9A 1IXBA 1EN5A 3CEIA 1ZUQA 2GDSA 3K9SA 1XUQA 4JZ2A 4E4EA 3DC6A 5AG2A 1MNGA 1GN2A 1GN4A 3AK1A 2ADPA 4YIOA 2QKAA 3AK3A 1EN4A 1I08A 2CDYA 1WB7A 1XREA 1ZLZA 4X9QA 4BR6A 2CE4A 1KKCA 1BS3A 1ZTEA 2QKCA 5A9GA 1AR5A 3TJTA 4JYYA 4JZGA 3QVNA 1I0HA 1PM9A 1XILA 1WB8A 4FFKA 3DC5A 1D5NA 1IDSA 2ADQB 1VEWA 3C3TA 2P4KA 3AK2A 3KKYA 3IC9A 1MA1A 1GN6A 1N0JA 1VARA 1QNMA 1IX9A 3LSUA 1GN3A 3C3SA 3MDSA 1BSMA 1P7GA 1LUWA 3OT7A 1AR4A 3BFRA 4GUNA 1BT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN4 A;  1JR9 A;  1LUV A;  3EVK A;  1AP6 A;  1PL4 A;  4F6E A;  1AP5 A;  1XDC A;  1SZX A;  1EN6 A;  1N0N A;  1JA8 A;  1Y67 A;  1MMM A;  4YIP A;  4C7U A;  1AVM A;  1ZSP A;  1B06 A;  1MSD A;  2RCV A;  1EM1 A;  2AW9 A;  1IXB A;  1EN5 A;  3CEI A;  1ZUQ A;  2GDS A;  3K9S A;  1XUQ A;  4JZ2 A;  4E4E A;  3DC6 A;  5AG2 A;  1MNG A;  1GN2 A;  1GN4 A;  3AK1 A;  2ADP A;  4YIO A;  2QKA A;  3AK3 A;  1EN4 A;  1I08 A;  2CDY A;  1WB7 A;  1XRE A;  1ZLZ A;  4X9Q A;  4BR6 A;  2CE4 A;  1KKC A;  1BS3 A;  1ZTE A;  2QKC A;  5A9G A;  1AR5 A;  3TJT A;  4JYY A;  4JZG A;  3QVN A;  1I0H A;  1PM9 A;  1XIL A;  1WB8 A;  4FFK A;  3DC5 A;  1D5N A;  1IDS A;  2ADQ B;  1VEW A;  3C3T A;  2P4K A;  3AK2 A;  3KKY A;  3IC9 A;  1MA1 A;  1GN6 A;  1N0J A;  1VAR A;  1QNM A;  1IX9 A;  3LSU A;  1GN3 A;  3C3S A;  3MDS A;  1BSM A;  1P7G A;  1LUW A;  3OT7 A;  1AR4 A;  3BFR A;  4GUN A;  1BT8 A; 
#chains in the Genus database with same CATH topology
 4TWK A;  4JI0 O;  1SQP H;  2CK3 G;  5FNV B;  5L3E A;  1JCH A;  1D2D A;  3CCS V;  2YDE A;  3HKB B;  2QTO A;  1VQ4 V;  1DF4 A;  1XI1 A;  4I0X B;  1FD9 A;  1SKV A;  4YIP A;  1EZJ A;  4GCZ A;  4DV3 B;  4WFB V;  2F4V O;  3E2E A;  3B09 A;  2ZE7 A;  3RYC B;  1LNQ A;  4X66 O;  3K79 A;  2Q7E A;  2ZQM A;  1IBL O;  5EZY A;  3BY6 A;  1NH2 B;  4JI8 B;  4O2A A;  4Z2W A;  4JGS A;  1Z5V A;  1FXK C;  1K7D A;  3AK3 A;  5ITZ B;  4DRX B;  2QTS A;  3FKS G;  3CWB H;  1F23 A;  3TET A;  2WLN A;  3RBZ A;  5GON A;  4LF6 B;  5BR8 B;  5LHG A;  4O4J B;  1ZWI C;  1N33 B;  2Y0P A;  4LFC B;  4AQY O;  5BY1 A;  4IYI A;  2EIJ C;  4QGP A;  5DEC A;  4DR1 B;  1FS0 G;  2VRZ A;  2EZO A;  1K34 A;  2VWK A;  3JAR B;  4O2B B;  3F7Y C;  1Q6U A;  1N34 O;  3T1Y B;  4FLW A;  3RVY A;  3N2K B;  3ZRX A;  1NU1 H;  5KX5 B;  3K3W A;  1VF7 A;  2IJH A;  1V55 C;  3WB2 A;  2GUZ B;  3NR7 A;  5IDJ A;  3ABU A;  2P90 A;  1OHH G;  1MA1 A;  1QR8 A;  1VAR A;  2X6A A;  2EIN C;  1LUW A;  5IE9 A;  4GUN A;  3TGU H;  3FYI B;  1BHA A;  4JV5 O;  2UXB O;  4AHC A;  4OXS A;  1E79 G;  2ZDI A;  3OMN B;  4WFA V;  2Y69 B;  4MVS A;  5JH7 B;  2E76 B;  1Y67 A;  1OCC B;  2UXB B;  4TV9 B;  1THZ A;  1Y74 A;  3OFN G;  2RCV A;  4OPH A;  4KFM A;  3WG7 C;  1CPY A;  1FJG O;  1CEZ A;  1IZ3 A;  3MHH C;  3RYH A;  3LSS A;  3UO2 A;  1RM1 B;  1S5H C;  3D36 A;  2CTQ A;  4X62 O;  1RSO A;  4DUZ O;  3ABM B;  4JI4 B;  2XUM A;  4CH5 A;  3SGI A;  2PGG A;  3JAL A;  2P67 A;  2XND G;  4PJ0 Z;  1J5E B;  1M9N A;  2QKA A;  3JAW A;  2QM7 A;  4JI6 O;  1WPB A;  1GM8 A;  1YZB A;  5KAI Z;  4O4L A;  2P06 A;  3M7M X;  3ZHQ A;  3ZMT A;  2A9H A;  5LP6 A;  4B3R B;  3CB2 A;  4MVR A;  1IBM B;  1FYJ A;  3H01 A;  5LOV B;  2OCC C;  2Q67 A;  2FML A;  2K9P A;  3ABK B;  5EC1 C;  1IBK O;  4JTA B;  2BSK B;  4FFB B;  3JCZ A;  2UUC B;  1D5A A;  3CRA A;  2JEX A;  1R6K A;  1YJN V;  1EBO A;  2YIA A;  5LHH A;  2BSK A;  5IT9 N;  2Q6A A;  3EXA A;  1U96 A;  4UCS A;  1BGY H;  4JAA A;  5H6R A;  1VEW A;  1P4R A;  1SQB H;  3ML0 A;  2OCH A;  4TUY B;  1Q3E A;  3ZCC A;  1B3Q A;  2Z3Y A;  3RVZ A;  1GTO A;  5LGU A;  1V9P A;  3VQV A;  5IYD O;  4XDK A;  2N74 A;  2DYS C;  3ABL B;  5FPO A;  5CBF A;  3MDS A;  1BSM A;  2XT9 A;  1P7G A;  2WPD G;  4LCU C;  2EIM B;  1KC8 W;  3BFR A;  2HJF C;  4PEL A;  3ZMZ A;  5BR8 O;  4FLX A;  4JTC B;  3CCE V;  3AG4 B;  1NQT A;  4ZHQ B;  4DV6 B;  4ZOL A;  4CH6 A;  5BMV A;  2JK5 C;  4DR3 B;  4CS3 A;  1XEQ A;  3E8H A;  2EIJ B;  2E3C A;  4DUY O;  4LNU A;  4KUM A;  2HVK C;  2EIK B;  2DMX A;  1S72 V;  1N36 O;  2EJR A;  2VQF O;  3ZX6 A;  1EM1 A;  4LP8 A;  1JOY A;  5JQG B;  2CAZ C;  4DR7 B;  2P6J A;  1YTF D;  2OTL V;  1H2S B;  3HKC B;  5DED A;  5AG2 A;  1MNG A;  1NKD A;  2LFR A;  1WLE A;  1GH6 A;  4MVZ A;  1KKD A;  4DR1 O;  1KQS U;  4X65 B;  2EJ7 A;  2YS8 A;  1I08 A;  5IJ0 A;  1Z5W A;  3CCV V;  4B3S B;  3G6E V;  1M93 A;  2QWP B;  1HP8 A;  2HG5 C;  4TT3 G;  2IH1 C;  1KP3 A;  1VMG A;  3X2Q C;  3CC4 V;  1YJ9 V;  5IJ9 A;  5L3D A;  1DGS A;  5B1A B;  3WG7 B;  5HFL A;  1GAX A;  5J2U A;  4P9O A;  1IXM A;  3B8M A;  1K4C C;  3CYO A;  2NNU A;  3AG1 B;  4X66 B;  4GX0 A;  2Z5U A;  1WA8 B;  2Q5Z A;  4YHH B;  3P32 A;  2RMK B;  5A2Q N;  4MSW C;  1GN3 A;  2W0F C;  4NB5 A;  2DJV A;  4J9Y B;  2QWQ B;  4DK0 A;  1WP8 A;  3DXR A;  1R73 A;  1TGO A;  2DQ0 A;  4B3T B;  3EVK A;  3JAM N;  2AZ2 A;  4IHJ A;  1Y76 B;  3LNN A;  4TUY A;  2Q73 A;  2MK3 A;  3H1J H;  2A7W A;  4E2L A;  5C93 A;  1AR1 B;  4UB8 Z;  1BHB A;  4K35 A;  5LYJ B;  1M90 W;  1M4U A;  1BE3 H;  2QKS A;  4TOI A;  3IGA C;  4FM2 A;  4DR3 O;  1BQZ A;  3CXC U;  3LUT B;  3RFR A;  3UQ8 A;  2DN9 A;  5LA6 B;  4XBF A;  2NR5 A;  4DV7 B;  4X1K A;  2VWJ A;  1JNB A;  3UT5 B;  1FFT B;  3CRM A;  1U97 A;  1R1B A;  3L9D A;  3HPL C;  4G2K A;  4ZI7 A;  4DXW A;  4U3J A;  2YIB A;  5EBL C;  4DV4 O;  3JSN A;  5KA6 A;  5JWP A;  3U0Z A;  2CDY A;  2L6L A;  4EEQ A;  2QA4 V;  5EC2 C;  4MVU A;  5LA6 A;  2E75 B;  2HHH O;  3HKE B;  1ZTE A;  3CCR V;  1W0K G;  3D8C A;  4DR6 O;  1AR5 A;  2IH3 C;  4PDV A;  2DOS A;  1G4Y B;  5JCO A;  1HNW O;  4I55 B;  4MVQ A;  1XQ8 A;  3F7V C;  3ICX A;  5F2V O;  3OR6 C;  2N05 A;  4JYA B;  3CSX A;  1YHQ V;  1RM1 C;  2ZNJ A;  4UCO A;  3HB3 B;  4QIW F;  4JI6 B;  2JGD A;  1ZAU A;  4X64 O;  1XNQ B;  1XMO O;  1QNM A;  4IIJ A;  5KHG A;  4PDM A;  3CJH B;  4H13 B;  4NTX A;  1HNZ O;  4MT8 A;  2X7R B;  1YTF B;  4JI4 O;  1N36 B;  1H2N A;  3A0R A;  4I4T A;  4X1I A;  1S76 D;  1UFI A;  1RSO B;  4DUY B;  3F5T A;  4B7E A;  1QLE C;  4J11 A;  1PL4 A;  3J7A U;  2EUL A;  1QLE B;  2KB1 A;  3T2M A;  2ZT9 B;  4QJF B;  1HWY A;  1H2M A;  4DV6 O;  1FAF A;  2JIZ G;  1IVS A;  1M57 C;  3SJA C;  3C90 A;  3FB8 C;  4RUE A;  5B3S C;  4LF7 B;  3FYE B;  3U10 A;  2UU9 B;  4K0K O;  1R3I C;  5CA1 B;  2RN9 A;  4JI3 O;  4AI8 A;  1Q43 A;  4Q20 A;  3AG3 B;  3SDL A;  2QR4 A;  2QE7 G;  4WFG A;  3A8T A;  1FXV A;  4E4E A;  1H2K A;  3AG7 A;  2LGW A;  1XNR B;  5CA1 A;  4EB6 B;  1SA0 B;  4YIO A;  2LW7 A;  1YI2 V;  1MSW D;  1FOU A;  2WA3 A;  1ZLZ A;  2CH7 A;  2ARH A;  3UCS C;  3IJ4 A;  4KP4 A;  4GX5 A;  3ZRV A;  1YCI A;  3FFQ A;  3T1H O;  3OAA G;  5H5N A;  2XHB A;  3UM7 A;  1KEC A;  3AEI A;  4B3M B;  2UXN A;  2IU3 A;  3OTF A;  1OCO B;  5BXZ A;  4I4T B;  1X4T A;  3DC5 A;  2HJD A;  4MW8 A;  4IIJ B;  1Y6X A;  5CBH A;  5KUK A;  1XBL A;  3G4S V;  2B9Z A;  3JD1 A;  3JD4 A;  3EHB B;  1P7B A;  1NJI W;  4DK1 A;  3CRR A;  4GKJ O;  4LH6 A;  3SPH A;  4FIP C;  4LC1 A;  1BCC H;  1WJZ A;  5EIB D;  4A5U B;  3K5L A;  4FK5 C;  2ZD9 A;  2WSS G;  2PF4 E;  4MW3 A;  4DV2 O;  1AB3 A;  3QNE A;  1AP5 A;  4J7K A;  1YDX A;  5CB4 A;  3CE2 A;  4LF7 O;  1GM9 A;  5EK0 A;  3P3P A;  1VF5 B;  5GW7 A;  4I50 B;  4PA4 A;  3BRC A;  1TUB B;  2YUA A;  4CBC A;  1S5J A;  2BTQ B;  3IFX A;  4W4K A;  1NVP D;  2P7T C;  3ASO B;  5KHJ A;  4WCE V;  5LP6 C;  5B66 Z;  1FXH A;  1A32 A;  1NS1 A;  5LXT B;  4P30 A;  3QO5 A;  1R3L C;  2V7Q G;  3FB7 C;  2XAF A;  4F6R A;  1M56 B;  1WP7 A;  1M56 C;  4DV0 B;  1YIT V;  2WLM A;  4YY3 O;  4UB6 Z;  2QEX V;  4ICG A;  4MTF A;  1K5Q A;  5L3B A;  1R6T A;  4NXN O;  4JYA O;  1N32 O;  5LMN O;  1HR0 B;  5JJE B;  2ZE5 A;  1MZF A;  2RQ6 A;  3BEH A;  3SPI A;  5KMG A;  3HKE A;  3W7S A;  1JFF A;  2YEV B;  1I0H A;  4UXN A;  1KD1 W;  1I5X A;  4DR6 B;  1F7Y A;  3DXR B;  3BHP A;  3JD3 A;  2GTS A;  2KG7 B;  3SYQ A;  4ZBM A;  4RO2 A;  4ZKI A;  5CBG A;  5E79 Z;  4UV8 A;  1JQ0 A;  2ZXW C;  1W59 A;  4DV4 B;  3LSU A;  1P49 A;  4PD4 F;  4IGG A;  1ORQ C;  3RT3 C;  5J2U B;  4JI2 B;  1NTZ H;  5DN6 G;  2PZS A;  3JAK B;  2UUB B;  3OM3 B;  3K5O A;  3PN1 A;  3AG4 C;  2GV9 A;  3G71 V;  5KX5 A;  5FL7 G;  3JAK A;  2ZR3 A;  1WPX A;  3RYI A;  1VQP V;  4AQY B;  1JA8 A;  2VQF B;  4DV1 B;  2EBO A;  2GTA A;  1QHT A;  2E5L B;  2WLJ A;  2PI4 A;  2VS0 A;  1SQQ H;  4GKK B;  3K5N A;  3BA8 A;  1COW G;  4LF8 B;  1LR1 A;  4HNA A;  3APQ A;  5CN0 A;  1PKX A;  3ZHT A;  5ITZ A;  3TCU A;  3RYH B;  1KYO F;  3EFF K;  5JQG A;  5FLX N;  4B08 A;  1N32 B;  2X0L A;  3RYF A;  1XOU A;  1EN4 A;  3K04 A;  4D7S A;  5KHH A;  3BVO A;  1IJG A;  1K3E A;  1H5W A;  4WFF A;  4Z1M G;  2UUA B;  4BR6 A;  4LF4 O;  4NXM B;  3CRQ A;  4JI5 O;  1V55 B;  3SYA A;  2QGN A;  4YXW G;  1I94 B;  2A0L A;  3QO8 A;  4JYY A;  2ZDI C;  1PM9 A;  3L75 H;  5GON B;  3A0H Z;  1GMG A;  1NTK H;  1Q86 W;  4FLZ A;  2EIN B;  5B3S B;  5C8Y A;  5LMU O;  1R3K C;  3S3W A;  2ADQ B;  3FD9 A;  2JS5 A;  3CC2 V;  4NXN B;  3HKC A;  3KKY A;  5EZY B;  2Y69 C;  4RQE A;  3ETG A;  2B5U A;  4YY3 B;  2BTO A;  2P5O A;  2YIB D;  3WB1 A;  4DR5 O;  2RJZ A;  3APO A;  2LJ2 A;  4J80 A;  2XAS A;  1RPO A;  3RN4 A;  5IYB O;  1NR7 A;  1NVP B;  3W7U A;  4PA6 A;  4B7K A;  4F6E A;  4I0X A;  1XDC A;  3TK1 A;  2PUS A;  5IY5 B;  4N21 A;  2QM8 A;  1EN6 A;  3HKD B;  4LH7 A;  4LFB B;  1E1Q G;  5B1N A;  3ABM C;  2JDI G;  3RGB A;  4DR2 B;  2WLH A;  3H9V A;  3L74 H;  3JCU Z;  4UVB A;  5D5P A;  1OCR C;  5LGN A;  2GDS A;  4JI7 O;  2F93 B;  4JV5 B;  3ZN1 A;  2AZ0 A;  3QF7 A;  1OJH A;  5LMN B;  5B1A C;  4J7J A;  1XL4 A;  1V54 B;  5B1B B;  3TXS A;  3S3X A;  3STZ C;  3KCY A;  1Q82 W;  1WB7 A;  1Y74 B;  4W4L A;  3ZJZ A;  2CUG A;  3DGE A;  1DTO A;  1XNR O;  3B77 A;  4JTD B;  4R6Z A;  2JS3 A;  3JAS A;  2XAH A;  3AG2 B;  1YIJ V;  1MOF A;  2QM4 A;  3AG2 C;  2BOB C;  4FFK A;  2BE3 A;  4PI0 A;  5B5E Z;  1IDS A;  3MHS C;  2Q8V A;  1WAZ A;  2DWD C;  2PI5 A;  3ABK C;  1K9M W;  3T4Z A;  2Z0A A;  1SRY A;  5B1O A;  1SF9 A;  2FB5 A;  2UXC O;  4OX9 B;  2LFS A;  5DM6 V;  5KHI A;  4ZIB A;  3OTO B;  4ABM A;  3OT7 A;  5KA5 A;  3W7X A;  4BIZ A;  4X62 B;  5CA3 A;  4XDJ A;  3SYC A;  1IBL B;  1JMK C;  4FVM A;  4TV9 A;  5JCO C;  1HNZ B;  4NKG B;  4TSF G;  4PA9 A;  4UFZ A;  5LGT A;  1DK1 A;  5KHK A;  5HFM A;  4X1I B;  1RPR A;  2Q9L A;  2OYQ A;  4DYL A;  3BCC H;  4C7U A;  5LBQ A;  1ZSP A;  2W6I G;  4DR5 B;  3CCM V;  3K0G A;  3L71 H;  1MSD A;  1K8A W;  2YXH A;  3SYP A;  3T1C A;  2H3O A;  4LFA B;  3UO3 A;  3K06 A;  4BAY A;  1YSC A;  1H2L A;  2AHY A;  2LP7 A;  2KG7 A;  4FM0 A;  4U7N A;  3T1H B;  4FLY A;  1XUQ A;  1MAB G;  1KMI Z;  4H44 B;  1L8D A;  2E5L O;  4BIO A;  5KLV H;  1H8H G;  4L87 A;  4I55 A;  2HHH B;  2OTJ V;  1H8E G;  2ADP A;  4NTW A;  1JX9 A;  1FFX B;  3ZMU A;  4LF5 B;  1K5S A;  3VQY A;  1S3J A;  1BZK A;  2OT5 A;  4MVO A;  5A9G A;  4H37 A;  4X1Y B;  2HP8 A;  3K58 A;  3UKM A;  4O4H B;  2KSD A;  5FNV A;  3D3I A;  1AI5 A;  4U7O A;  4F6R B;  4I9Q A;  4HYO A;  1HNX B;  4DV3 O;  4N23 A;  2YC0 A;  2ZIO A;  1PD3 A;  2FL4 A;  4U3F H;  2JRI A;  1PL0 A;  3IC9 A;  4YJ3 B;  3F5W C;  1NBM G;  3CMA V;  3N27 A;  4KHP O;  4DO2 A;  4PHZ A;  4MVM A;  2ETN A;  4MTO A;  5EBW C;  4B3T O;  4NVP A;  1SZT A;  4CC6 A;  4UVC A;  2IJI A;  1AP6 A;  1B6Q A;  1QBZ A;  1CP9 A;  4XDL A;  5GTI Z;  3ZHS A;  1XNQ O;  4KXR A;  2C2A A;  1Y4M A;  2GHY A;  1L0L H;  4PA7 A;  2CTP A;  4LF9 O;  4JI2 O;  1FXK A;  3G80 A;  3KDR A;  4UCU A;  1B06 A;  3BAA A;  3VOU A;  1K73 W;  3H1H H;  3ZHU A;  3B8N A;  2DW4 A;  2M6Y A;  4FPP A;  4X1Y A;  1W2B U;  4DV5 O;  2E74 B;  4JZ2 A;  2DQ3 A;  3H1K H;  1S77 D;  1TAE A;  2BOC C;  1VF6 A;  1TVK A;  1NH2 D;  2NLJ C;  1Q7Y W;  4JAV A;  1Y66 A;  2ZIN A;  1XRE A;  3OUF A;  2FTK A;  3A0B Z;  4IHJ B;  4BW5 A;  1AI4 A;  3DSQ A;  4MTG A;  5BZB A;  2QKC A;  4GKJ B;  3E22 B;  4MTX A;  3L73 H;  5IJ0 B;  2IBZ H;  4HNA B;  4WFH A;  4OGQ B;  4MS2 A;  1X59 A;  2PYJ A;  3IAY A;  5C8Y B;  4DV0 O;  1ZL8 A;  3Q4H B;  3JYC A;  4JAS A;  3ZRS A;  3ZHV A;  4GLX A;  5IYZ B;  2F1M A;  2YID A;  4CZZ A;  5JVD B;  2LQT A;  1L1F A;  3JD0 A;  1KUQ A;  4LWS A;  1Q5O A;  4DR4 O;  1AJQ A;  2JEU A;  1MZE A;  4K8Z A;  1V54 C;  5J2T B;  2WLL A;  3ZRW B;  4OPA A;  2H94 A;  4UVA A;  3CCJ V;  4DR7 O;  2XTA A;  4R8C A;  2F43 G;  3LSQ A;  1SZX A;  1XHX A;  2Y0I A;  2CTW A;  4DW1 A;  4FM1 A;  1RFY A;  1M5I A;  4JAU A;  5E1A C;  3P3N A;  1I7F A;  2P4V A;  3CXH F;  1FXK B;  4KHP B;  3CPW U;  3M8A A;  4G27 B;  4ZI7 B;  4RAI A;  2YI9 A;  1IXB A;  3PJS K;  3BA9 A;  2CTR A;  1ZUQ A;  4CH4 A;  2YEV A;  1M1K W;  3VBB A;  1JFF B;  4Q6G A;  3ZMS A;  2GSM B;  4L8J A;  5L3C A;  2HKO A;  1AJP A;  4I9W A;  2QJ1 A;  1SET A;  1YVW A;  1PP9 H;  2VQE O;  2QDO A;  3K0D A;  5CMU A;  1F4N A;  4JI1 B;  5L3G A;  4GT1 A;  3KCX A;  2ZCE A;  3ETQ A;  1URF A;  4FZ1 A;  4YJ3 A;  4LFA O;  1JPX A;  1J5E O;  1BS3 A;  2OIG A;  2XAQ A;  1WN7 A;  3QG5 A;  4O4L B;  2A79 B;  1XMO B;  3K59 A;  4QE7 A;  4U3J B;  4O4H A;  4D6T H;  4K3A A;  2YXY A;  2ZE6 A;  2RDC A;  3G6B A;  1ROP A;  2V4D A;  3A2F A;  4ASU G;  1SQV H;  2EZP A;  2A3Q A;  4OX9 O;  4EFE A;  1H2G A;  2UU9 O;  1EFR G;  2EIK C;  3C3S A;  1N8R W;  1OCO C;  4DV2 B;  3FB6 C;  3OEE G;  4F4L A;  3B4S A;  4QNH B;  4DUZ B;  2Q0O C;  2NN4 A;  2QWN B;  5LOV A;  3ASO C;  3SPC A;  4P2Z A;  1VQK V;  4H0L B;  4K8X A;  2ZR2 A;  2EIL B;  5IY5 C;  5J9P C;  2WWW A;  3JAW B;  3W7W A;  3ETE A;  3BAB A;  1MMM A;  2F66 C;  1PV0 A;  1AVM A;  2BTQ A;  1VQ8 V;  2QWR B;  2UXC B;  2AW9 A;  1N34 B;  5L3F A;  3QO7 A;  5CA0 A;  2D2C B;  4I50 A;  1UJW B;  3D36 C;  2UXD O;  1OCR B;  2WLI A;  3CRC A;  2Y48 A;  3DC6 A;  1O9G A;  4FMT A;  1IBM O;  2GBO A;  4QPK A;  4DR4 B;  3H1I H;  4UCV A;  4LNU B;  2UXD B;  3SR2 C;  5JJJ B;  1OCZ B;  3JAT B;  4QE9 A;  2B1I A;  2JVD A;  2CGO A;  1ARO P;  2R72 A;  3AG1 C;  1S5L Z;  4ZHQ A;  1WA8 A;  3U11 A;  4JI8 O;  4LFB O;  3LNM B;  2DYR B;  2UUA O;  4GX1 A;  1N4C A;  2V1D A;  2ZXW B;  4PI2 A;  4X89 A;  2DYS B;  4JI3 B;  1K33 A;  1WB8 A;  4JI1 O;  3E22 A;  2VQE B;  1K97 A;  1AIL A;  1NTM H;  2OCC B;  1VQO V;  3E89 A;  1US6 A;  5LMU B;  5IJ9 B;  1XMQ O;  3HR0 A;  4LR3 A;  5GTH Z;  3I56 V;  2R9R B;  1PNM A;  3JAR A;  3OMI B;  4O2B A;  4PDR A;  1YEW A;  1N0J A;  3OGC C;  2AHZ A;  5KUM A;  4DR2 O;  1KB9 F;  3OD4 A;  1JJO A;  4RUF A;  4JI0 B;  3JD2 A;  3E35 A;  1LUV A;  5BMV B;  3ASN C;  4DV1 O;  3CCQ V;  2H8P C;  2JGD B;  1L0N H;  4EFB A;  4X64 B;  3ABL C;  3CD6 V;  1QLN A;  2A06 H;  2YSU B;  1TUE B;  2EX3 A;  4KL1 A;  4CH3 A;  1P84 F;  3T1Y O;  2IJK A;  1QVG U;  3ZIA G;  2ZIM A;  3OW2 U;  2ZNI A;  3GVM A;  1FKA O;  3HKD A;  4EKW A;  1Q8I A;  3ZBH A;  4G28 B;  1H38 A;  2QSA A;  4LFC O;  1SQF A;  5EYP A;  4J10 A;  1Z2G A;  4JPR A;  2WLI B;  2CGN A;  1Q6I A;  5CA0 B;  1Q90 D;  1SQX H;  1QCE A;  4AIL C;  5K1X A;  3KG2 A;  1VQ5 V;  1QR9 A;  2N04 A;  2WA4 A;  1I94 O;  2HVJ C;  4Z1V A;  1BQ0 A;  2M7W A;  2Q7H A;  2ZE8 A;  4HBN A;  1CXZ B;  2CE4 A;  3J80 N;  3CME V;  4JI5 B;  1GK9 A;  1I5Y A;  5LP6 B;  4BWA A;  5LXT A;  4RQF A;  2OWO A;  2LO1 A;  4B3S O;  1Q81 W;  4J7Z A;  4JZG A;  4X1K B;  3SJC C;  4DV7 O;  4TQF A;  1XIL A;  3RWR D;  3LDC A;  1FPO A;  1BL8 A;  2FKX A;  2WLK A;  3MD0 A;  2F4V B;  3ETD A;  1GO3 F;  4FLU A;  5LYJ A;  1B04 A;  1NR1 A;  1NT2 B;  5CB4 B;  5EYP B;  1W0J G;  2ITD C;  1E1R G;  4I5S A;  1VQ9 V;  1OZ0 A;  3LDE A;  4GKK O;  3K5M A;  1Y76 A;  4UV9 A;  3CC7 V;  2KQX A;  3W7T A;  1VQN V;  3B40 A;  2R9I A;  2XOK G;  1QU7 A;  3GB7 C;  1AI6 A;  2W6J G;  1JR9 A;  4FJC C;  4B3R O;  4LF9 B;  1RP3 B;  4P9P A;  4UCT A;  3JAL B;  1VQ7 V;  5IYZ A;  1KU9 A;  3M99 B;  4PA3 A;  3T4D A;  3I55 V;  1OCC C;  3E8G A;  1XMQ B;  5TIS Z;  4GYC B;  4DRX A;  3GWK C;  3DTU B;  2XAG A;  1HR0 O;  1UPG A;  3ZS8 C;  1MG1 A;  3JAT A;  3OGI B;  3ZN0 A;  2EIM C;  2IJJ A;  1VIB A;  1OV9 A;  1FJG B;  2HR3 A;  2MW2 B;  1NZ6 A;  2YI8 A;  2ZM6 B;  2YIC A;  1YJW V;  1DF5 A;  2BCC H;  1VF6 C;  1GN2 A;  4LBE C;  4J41 A;  3J81 N;  4NTY A;  4X8A A;  4CC5 A;  3FB5 C;  2UUC O;  3CP1 A;  1SA0 A;  1SQG A;  4BW9 A;  1PNK A;  4HZ3 A;  5FPR A;  4J42 A;  4O4I A;  3HKB A;  1GRJ A;  2HFE C;  1QQC A;  2R9A A;  2LW1 A;  4R7C A;  1NI8 A;  1PNL A;  4JYC A;  3TJT A;  5IWA O;  3L72 H;  1S0V A;  3QVN A;  2Q0A A;  2GUZ A;  5B1B C;  3FAV A;  1K92 A;  5D5Q A;  2WLL B;  4LF5 O;  5J2T A;  3K03 A;  4O2A B;  3N2K A;  3JAS B;  4YJ2 A;  1GM7 A;  4FZ0 A;  2JGU A;  5KMG B;  1TVK B;  1R3J C;  5H9C A;  3RYC A;  3CCU V;  3AK2 A;  1KP2 A;  4QPJ A;  2FYU H;  4D7T A;  3X2Q B;  1F51 A;  1GN6 A;  3SJQ C;  1G1X B;  1WNS A;  3LDD A;  1IX9 A;  3RW0 A;  3E8F A;  5LL6 Y;  1F4M A;  1N33 O;  2K1E A;  1ZL8 B;  4J9Z B;  4PDL A;  4CS4 A;  1OCZ C;  2OIE A;  2G38 A;  3E86 A;  4BIU A;  1IUR A;  2F23 A;  2PTM A;  5LHI A;  1HW7 A;  3L70 H;  2Y4T A;  1SES A;  2Q69 A;  3K57 A;  3N2G A;  3ZED A;  3VQX A;  4TV8 A;  3SPG A;  2W0X A;  2DYR C;  2D3O W;  4GZR B;  2AXT Z;  3OMA B;  2AGA A;  4IYH A;  4RWU A;  3OTO O;  3CX5 F;  3WFV A;  1EN5 A;  2JJ2 G;  2KKW A;  3CS5 A;  4FLV A;  2YXL A;  1YF2 A;  3K9S A;  3ABT A;  3OUS A;  3SPJ A;  1IBK B;  4ZOL B;  1G8M A;  3RYF B;  3AK1 A;  2XAJ A;  5EIB C;  4I7Z B;  4B3M O;  3KZI Z;  3N2G B;  3P30 A;  3CCL V;  4X20 A;  3H1L H;  1VQL V;  3JSL A;  4FLT A;  5EBM C;  1PPJ H;  1DLB A;  3ASN B;  1BMF G;  3UT5 A;  5IYC O;  1ENV A;  1HDJ A;  2IM9 A;  1GKF A;  2ZKO A;  2O57 A;  1TA8 A;  4IL6 Z;  3SJB C;  4WFE A;  3ZRW A;  3K9A A;  3ZHR A;  2X6B A;  2LGQ A;  5IWA B;  1FFX A;  3I5D A;  1AI7 A;  4WBN A;  2B1G A;  1JJ2 U;  4NR1 A;  4FFB A;  4LF4 B;  4NXM O;  1SS3 A;  3THO A;  1J95 A;  3C3T A;  4WF9 V;  2P4K A;  5JH7 A;  4JI7 B;  2CH7 B;  2JJ1 G;  4H33 A;  1T5E A;  4YJ2 B;  4WBN B;  4K0K B;  3R65 A;  4R50 A;  4DW0 A;  3FX7 A;  3VQW A;  3FAV B;  3GWO A;  5JVD A;  2DWE C;  4EB6 A;  4UCR A;  4NYK A;  1YXB A;  1BT8 A;  2IU0 A;  2ODM A;  4LF8 O;  1EZV H;  4O4I B;  2ZM6 O;  3NXS A;  3ZMV A;  4X88 A;  1N0N A;  2EIL C;  4IT5 A;  4UUJ C;  3STL C;  3D3Q A;  2HEP A;  3CHX A;  1R6N A;  4PV1 B;  3RYI B;  2Q7G A;  3E83 A;  3TXQ A;  3CEI A;  2UUB O;  4CS2 A;  5K1P A;  4YHH O;  3OEH G;  2DE0 X;  1AJN A;  3E8B A;  1G6U A;  3OE7 G;  1QVF U;  4LWS B;  2ITC C;  4JYB A;  3OR7 C;  5H2F Z;  1GN4 A;  2P22 C;  3CJH A;  2WAM A;  1HNW B;  1K4D C;  4LF6 O;  2PY5 A;  1VP7 A;  1M57 B;  3Q4H A;  1XL6 A;  4TV8 B;  3O65 A;  2ATK C;  4TQD A;  5KAF Z;  4X9Q A;  1XHZ A;  4JF3 A;  1KKC A;  1ZX3 A;  3SYO A;  1SC5 B;  3WU2 Z;  4DV5 B;  1HNX O;  2R70 A;  3AG3 C;  3G67 A;  4GX2 A;  2Q4P A;  2UXX A;  3BPZ A;  2ILM A;  2Q68 A;  2Y4U A;  1TUB A;  2L35 A;  1JVM A;  1VQ6 V;  2QWO B;  4X65 O;  3R66 A;  1VQM V;  2F95 B;  1D5N A;  3B2E E;  3QTC A;  2X6C A;  2RNB A;  3IC7 A;  2PYL A;  2HLD G;  5JJN B;  1SER A;  4O4J A;  1KBH A;  1Q6H A;  4HAM A;  3K08 A;  3O9O A;  5H6Q A;  3WB0 A;  3MAQ A;  1O9H A;  1AR4 A;  2IW5 A;  4X20 B; 
#chains in the Genus database with same CATH homology
 3RN4 A;  1JR9 A;  1LUV A;  3EVK A;  1AP6 A;  1PL4 A;  4F6E A;  1AP5 A;  1XDC A;  1SZX A;  1EN6 A;  1N0N A;  1JA8 A;  1Y67 A;  1MMM A;  4YIP A;  4C7U A;  3KDR A;  1AVM A;  1ZSP A;  1B06 A;  1MSD A;  2RCV A;  1EM1 A;  2AW9 A;  1IXB A;  1EN5 A;  3CEI A;  1ZUQ A;  2GDS A;  3K9S A;  1XUQ A;  4JZ2 A;  4E4E A;  3DC6 A;  5AG2 A;  1MNG A;  1GN2 A;  1GN4 A;  3AK1 A;  2ADP A;  4YIO A;  2QKA A;  3AK3 A;  1EN4 A;  1I08 A;  2CDY A;  1WB7 A;  1XRE A;  1ZLZ A;  4X9Q A;  4BR6 A;  2CE4 A;  1KKC A;  1BS3 A;  1ZTE A;  2QKC A;  5A9G A;  1AR5 A;  3TJT A;  4JYY A;  4JZG A;  3QVN A;  1I0H A;  1PM9 A;  1XIL A;  1WB8 A;  4FFK A;  3DC5 A;  1D5N A;  1IDS A;  2ADQ B;  1VEW A;  3C3T A;  2P4K A;  3AK2 A;  3KKY A;  3IC9 A;  1MA1 A;  1GN6 A;  1N0J A;  1VAR A;  1QNM A;  1IX9 A;  3LSU A;  1GN3 A;  3C3S A;  3MDS A;  1BSM A;  1P7G A;  1LUW A;  3OT7 A;  1AR4 A;  3BFR A;  4GUN A;  1BT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...