1ZSPA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAAVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zspA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zspA02
1N0NA 1XILA 1BT8A 5A9GA 1JR9A 2P4KA 1AR5A 1EM1A 2QKAA 1I08A 1WB8A 1XDCA 2RCVA 4X9QA 3C3SA 3RN4A 3CEIA 4YIOA 1ZUQA 1ZLZA 1GN2A 1I0HA 3AK1A 2QKCA 3DC5A 1IDSA 4YIPA 1GN6A 1N0JA 4FFKA 1EN4A 3AK3A 1XREA 1PL4A 1JA8A 3MDSA 3K9SA 1QNMA 1LUWA 4GUNA 2AW9A 3OT7A 4BR6A 1MMMA 3LSUA 4JZ2A 1D5NA 2ADQB 1XUQA 3AK2A 5AG2A 3KKYA 1LUVA 1PM9A 1GN4A 2CE4A 1IXBA 1KKCA 1MSDA 1Y67A 4F6EA 2ADPA 1B06A 4E4EA 4C7UA 1VARA 1AR4A 3DC6A 1ZSPA 1VEWA 3TJTA 1EN5A 1MNGA 3QVNA 1AVMA 1IX9A 1P7GA 3C3TA 1GN3A 1AP5A 1AP6A 1EN6A 1MA1A 4JYYA 3IC9A 1SZXA 3EVKA 1BS3A 1BSMA 1ZTEA 4JZGA 1WB7A 3BFRA 2CDYA 2GDSA
chains in the Genus database with same CATH superfamily
3ETQA 5JJEB 1Z5VA 3LDCA 3UCSC 4DK0A 1XQ8A 3EHBB 5IYDO 5JWPA 1SQBH 3C3SA 3ZX6A 2EZPA 3RN4A 2CH7A 3ZHTA 3OTOB 3ZHVA 3ETDA 4RQEA 1FFXB 4LCUC 1FFXA 1YJWV 1R6NA 3ABMC 5IJ9B 5IJ9A 5LMUO 4UCVA 3K5NA 4TV8B 4TV8A 3W7XA 5E1AC 3ABKB 3AK3A 1YSCA 2DYSC 1NH2B 4JYAO 2DJVA 3BAAA 4KP4A 1QBZA 1QNMA 2JJ1G 5J9PC 2LW1A 4DW1A 1IBKB 2QA4V 2OTLV 2KG7B 2KG7A 4YY3B 2P7TC 2A7WA 4NB5A 3ZN0A 4LF8B 2E75B 2F23A 2WLKA 1D5NA 2ZXWB 4CZZA 4N21A 2XOKG 3HKDB 3HKDA 4BIUA 3FB6C 4UVAA 1GM7A 4EKWA 3OEHG 1YTFB 3CCJV 2PY5A 3ZMSA 5LBQA 2JGUA 1F4NA 4ZIBA 5B1BC 2X0LA 1SESA 2QWPB 2UU9O 3T1HO 1YCIA 1BE3H 2WLHA 3HPLC 3CRRA 2VQEO 1K9MW 3ZBHA 4ZOLB 3FKSG 4ZOLA 1K8AW 1AROP 4IGGA 1N34O 4K3AA 3CSXA 3OAAG 1RM1B 5L3GA 4FM1A 4LF7O 2RMKB 1SQFA 3AG7A 3JYCA 1GH6A 2QEXV 2WLLB 4LFCB 2WLLA 3CC4V 3R65A 5IWAO 3O65A 2Y69C 2X7RB 4L8JA 4F6RB 4F6RA 2EILB 4U3FH 4JI2B 4TSFG 1U96A 2YIDA 1XNQB 2OIGA 1I7FA 1FXVA 1Q5OA 2X6BA 5BR8O 2YUAA 1S77D 2B5UA 1OCOC 3RBZA 2Q69A 4U7OA 3CXCU 3L74H 2X6AA 4DR5O 1VF7A 2JIZG 3MDSA 1K3EA 4KHPO 1LUWA 3AG2C 5BXZA 1K7DA 4KUMA 4BR6A 4EB6B 4EB6A 4DV7O 1MMMA 1FPOA 3LSUA 2P5OA 2ZQMA 3TK1A 1XI1A 2GTSA 3OM3B 4H0LB 3K59A 2PGGA 4TUYA 2LO1A 4JI7O 4NKGB 1B06A 1CPYA 1K5SA 1QVGU 2Z5UA 4MVMA 4X64O 1XHXA 3CCRV 3KZIZ 1Q6IA 1SC5B 3RT3C 4QNHB 3J80N 1M57C 4O4LB 3IGAC 2EZOA 4O4LA 4R7CA 4CC6A 1P4RA 2A0LA 3C3TA 2AGAA 1R3IC 1QLEB 2UXBO 1JMKC 2IH1C 1HNWO 1SZXA 1Y66A 3CS5A 2GSMB 1VP7A 3BA9A 3DTUB 5LL6Y 2YSUB 4JASA 3BFRA 5KAFZ 1K33A 4H44B 5LGUA 3IFXA 4QE9A 2EIKB 1NTKH 3SPJA 2PYLA 1D2DA 2Q8VA 3Q4HB 3Q4HA 2GHYA 1COWG 5DEDA 2K1EA 2Q73A 1X59A 2XTAA 1AR1B 2BSKB 3G71V 2BSKA 5CBFA 4ZI7B 4ZI7A 4JGSA 1WPBA 4FFKA 2JEXA 4GKJO 1XREA 2Q7HA 3GWOA 1ENVA 1BQ0A 5LGNA 2VQFB 1NS1A 4QGPA 3ZJZA 1FJGB 4O2BB 4O2BA 2ZIOA 4QE7A 2P6JA 5H2FZ 3JSLA 4JI5B 4QIWF 3MHSC 2AZ2A 4DUYO 5KAIZ 1R6TA 1XUQA 3SPIA 2PTMA 3KDRA 4GZRB 1WA8B 1DK1A 1WA8A 4AI8A 4CS3A 2AHYA 1QHTA 1P7BA 3E8GA 1F51A 3ZRVA 5D5PA 4DV2B 4PDVA 2YC0A 5KHIA 2IJHA 3CE2A 1PKXA 1KB9F 3T4ZA 1XMOB 3SPHA 2PF4E 3OMNB 1M4UA 4UFZA 3T1CA 4DR6O 2PYJA 3ZIAG 3N2GB 3N2GA 4JPRA 1VQ4V 3NR7A 3WB2A 1KP2A 3SGIA 3STLC 4UCTA 3ZEDA 1X4TA 2PI5A 3JD0A 2HEPA 2G38A 4IL6Z 3UQ8A 4MSWC 1J5EB 1EBOA 3H1IH 1O9HA 3ASOB 4I9QA 1BHBA 2HVKC 4K35A 1JR9A 2FB5A 1V9PA 3LSQA 3VBBA 5LGTA 2ETNA 3JAMN 2ZM6O 4FLZA 1HWYA 1KP3A 1PPJH 1GTOA 2BOCC 3KCXA 3L70H 4DV4O 3E89A 3QF7A 3D36C 1H8HG 4GX1A 1SZTA 1U97A 2HLDG 3PJSK 2ZDIA 5HFMA 2QM4A 1YEWA 1US6A 3OD4A 3RGBA 5CA1A 3HB3B 4BW5A 2N04A 4CS4A 4X1YB 4X1YA 1BGYH 3ZRWB 3ZRWA 4K8XA 1PM9A 1VQPV 3RVYA 4J42A 1HR0B 3O9OA 2CAZC 3UM7A 4RQFA 2FYUH 3ZHRA 1XHZA 5B3SB 3JATB 3JATA 1VQNV 3QG5A 3JD3A 5IYCO 1KUQA 4B3MO 1KMIZ 5B1NA 3MAQA 4IIJB 3ZN1A 2XASA 1ZTEA 3ASNB 1NR1A 4LFAB 1B6QA 3AG4C 4PA3A 1AJPA 2GDSA 4X1IB 1E79G 4X1IA 2FMLA 4TQFA 1SRYA 4LF4O 4J80A 4FM2A 3VQVA 3M8AA 5L3EA 4JI1B 3SR2C 1K4CC 3BABA 1ZUQA 4EFBA 3OR7C 2KKWA 4TWKA 2N05A 4I0XA 5KUKA 2WA4A 4B7KA 4I4TB 4YIPA 1AI5A 4I4TA 2DYRB 3RW0A 1AI7A 4G28B 5HFLA 3K5LA 3OGCC 4J7JA 2DMXA 4JF3A 4PI2A 4RAIA 1FAFA 1SF9A 1XMQO 4IYIA 3ZMVA 3WFVA 4DV6B 1N36B 4DRXB 4DRXA 3SJAC 2A79B 2W6IG 2FL4A 2BTQB 2BTQA 3CXHF 2A06H 3TGUH 4LF9B 3UO2A 1QU7A 3K03A 4DV1O 1R3JC 5JH7B 3ZMTA 5JH7A 4K0KB 4X65B 4LH7A 2C2AA 1N33O 5IY5C 4J41A 4FK5C 2IBZH 3LNNA 1DF5A 2QM8A 1GMGA 3FD9A 1FYJA 4NXNO 1AR4A 1LNQA 3DC6A 2Q7EA 4JI0O 1UJWB 4DR2B 1NI8A 1NQTA 1B04A 2CTRA 1Y76B 1Y76A 1AJQA 3UT5A 1VF6C 1Q6HA 4LBEC 4W4LA 1VIBA 5L3FA 4JZGA 1Q7YW 4B3SB 1XL6A 3BA8A 2QTSA 1R1BA 3K57A 2UUBO 3CMEV 3RFRA 1A32A 2EX3A 1Q8IA 2BTOA 3E35A 3THOA 2F4VB 1IXMA 1WN7A 3DXRA 3QNEA 4D6TH 4D7SA 3X2QB 4DV3O 1URFA 4FZ1A 1VF5B 5L3CA 1HNXB 3F5WC 2UUAB 5TISZ 4BAYA 2E3CA 3DC5A 2NR5A 2QGNA 1IDSA 3K08A 4BIOA 3JCUZ 1IBKO 1Y6XA 1KECA 3JALB 1OCRB 3JALA 4YY3O 4DR1B 1OCOB 4LF8O 1GAXA 3B8NA 3VQWA 4DUZB 1GRJA 1VQOV 3AG1C 2VWKA 2EINC 3WG7B 5FNVB 5FNVA 2ZCEA 4ZBMA 5BY1A 4B3TO 3AG2B 2HG5C 4Z2WA 2YIBD 3OMAB 1IBMB 2OIEA 2PZSA 5JVDB 1S76D 5JVDA 5J2TB 5J2TA 2K9PA 5CBGA 5IDJA 4WFFA 4X62B 4I50B 4Q20A 4I50A 2QWOB 2LGWA 3CCUV 4OX9B 1YI2V 4Z1VA 3GVMA 4C7UA 1VARA 1K34A 5L3DA 1K92A 4X66O 1F7YA 1L8DA 2Y0IA 1VQ8V 2HR3A 1IX9A 2CK3G 1G6UA 3H1LH 4CH6A 1M57B 4PA9A 1EZVH 2Y48A 4DR7O 1ZAUA 1SERA 2EIMB 1IURA 1K5QA 4JI2O 1NVPB 1Z5WA 2QM7A 2UUCO 2WA3A 5H6RA 2IU0A 1QLNA 1XILA 2WSSG 1PV0A 3JASB 3JASA 3FYIB 1L1FA 4AQYB 4JI6O 4X9QA 5LMUB 3LNMB 3G67A 1KC8W 3BRCA 2D2CB 2AHZA 3JSNA 3J81N 1T5EA 2MW2B 4GX2A 1HDJA 3SYQA 4P30A 4FLYA 2XAHA 3BPZA 1XBLA 3U0ZA 2DWEC 3JD1A 2MK3A 5DN6G 4DV0O 1N32O 1FXKC 3P30A 2Q9LA 2RJZA 5FPOA 3RYCB 3RYCA 2AW9A 4B08A 3WU2Z 2Q67A 1H5WA 1V55B 1D5AA 3K79A 3T1HB 4KXRA 1SQQH 4A5UB 1MSDA 4JV5B 1JFFB 1FD9A 1JFFA 2F95B 1IJGA 4PELA 5D5QA 1KBHA 4J9YB 3J7AU 1SQPH 2HP8A 3HKCB 5CB4B 3HKCA 1VQLV 2Z0AA 1YDXA 3H9VA 1FKAO 3E8FA 3LDEA 1TA8A 2XAJA 4G2KA 3ETEA 1DGSA 1JPXA 3ICXA 4MW3A 5C93A 5KLVH 4LF7B 1JVMA 5JCOC 3BCCH 2ZKOA 1S72V 2W6JG 3N2KB 3N2KA 5IWAB 1M56C 4QPKA 2OWOA 3B09A 4P9PA 4PDMA 4CC5A 3LUTB 2P22C 1CP9A 3E8BA 4ASUG 2E5LO 3OGIB 1AR5A 3CCSV 1V54B 1Q82W 1VQ6V 2FTKA 5BR8B 1K4DC 1XEQA 4OGQB 2HHHB 4GX0A 3OW2U 3SDLA 3G4SV 2QKCA 2VQFO 5IYZB 5IYZA 4DR5B 4PI0A 4LFBB 2XHBA 3ABTA 4JI5O 1GN6A 2XUMA 3D36A 1UFIA 4PHZA 4B3RO 3CYOA 4UVCA 1I5YA 2WLMA 3FB7C 2CGNA 4WF9V 1KQSU 3SYAA 5CN0A 3A0RA 4PA4A 1WP7A 4WFHA 1LR1A 1JNBA 4DV2O 1RSOB 1RSOA 1LUVA 3CX5F 1EFRG 1OCCB 1IXBA 2B9ZA 1XMOO 3K0DA 1RM1C 4OXSA 4CS2A 5EBLC 4X89A 2P67A 4BIZA 3B40A 1VMGA 4JAUA 1Q43A 3VOUA 4PA7A 2F1MA 3QVNA 1MNGA 3VQXA 2OT5A 1S0VA 1J95A 1GN3A 4YXWG 1J5EO 1HP8A 1N8RW 2LW7A 3CJHB 3CJHA 4DW0A 1JJOA 5BMVB 1OCZC 3F7YC 5BMVA 4FLXA 3VQYA 1M5IA 4X1KB 4X1KA 2ILMA 5J2UB 5J2UA 1L0NH 2CUGA 1WAZA 1G4YB 2WLNA 3L75H 2M6YA 1TVKB 1TVKA 1YJNV 4GKKO 1CEZA 4GT1A 2HJFC 5LXTB 5LXTA 4UCSA 3ABLB 2JVDA 1IVSA 1KD1W 2RQ6A 2R72A 2R9RB 2QR4A 3WB0A 2Q0AA 2WWWA 1JQ0A 2ITCC 2X6CA 4UXNA 2NN4A 1WP8A 4JYCA 2RNBA 2Q0OC 2OTJV 2NLJC 1AB3A 1NH2D 4NXMB 1SQVH 2LFRA 4UV8A 5CMUA 2LP7A 3M7MX 4GUNA 1SKVA 4F4LA 4H37A 2OCCB 3A0BZ 2P90A 4FM0A 4KL1A 1BCCH 1HR0O 2EBOA 2GV9A 2ZNIA 1Q6UA 1QLEC 1H2SB 4NR1A 2JEUA 3KKYA 1YTFD 1KKDA 3K06A 3CRMA 2DQ0A 4IT5A 1PNKA 5ITZB 2H3OA 4MVQA 2NNUA 2LGQA 4PD4F 5ITZA 3MD0A 1Y67A 1S5HC 2ADPA 3H1KH 2YEVB 2YEVA 2EIKC 3BEHA 2Q6AA 1P84F 1M1KW 3I55V 2QKSA 5GW7A 5F2VO 3ZHSA 3TXQA 1VF6A 4B7EA 4PJ0Z 1NJIW 5KHGA 4JI1O 3CHXA 1OJHA 4O2AB 3S3XA 4O2AA 5B66Z 4JI8O 1WJZA 4H13B 2JRIA 5A9GA 2Q5ZA 3RYHB 3RYHA 3NXSA 2VS0A 4PA6A 4I9WA 4UVBA 4RO2A 4CH5A 3CEIA 3F5TA 5K1PA 3ZCCA 4UCRA 4DV4B 4IIJA 3AG3B 2EIJB 5KHKA 3STZC 3ZHUA 2WPDG 3CB2A 3TCUA 2E76B 2KB1A 2PI4A 5B5EZ 5LOVB 4DV6O 1N36O 4L87A 4K8ZA 1AJNA 3BY6A 4MW8A 2RN9A 2UXCB 2B1GA 3W7TA 4WFBV 1MOFA 2IU3A 2E74B 3CCLV 4MTXA 3HKBB 3HKBA 1XOUA 4K0KO 4EEQA 4X65O 1MG1A 3ABMB 2YXHA 1GM9A 4TOIA 4DYLA 1E1QG 3AK2A 3BVOA 3E83A 1QVFU 4JI4B 4P2ZA 1HNZO 2VRZA 5EC2C 4DR2O 2EJ7A 3OUSA 2DYSB 3RVZA 3B77A 4GX5A 5LYJB 5B1AC 5LYJA 4B3MB 3B8MA 4YJ2B 4XBFA 1Y4MA 4YJ2A 1E1RG 1O9GA 4DR3B 2QDOA 5BZBA 1ZL8B 3U11A 1ZL8A 4J7ZA 2OCHA 5JJJB 3K58A 4R50A 1IZ3A 3T1YO 4TQDA 2UXDB 4DV5B 4DO2A 4TV9B 4TV9A 1R73A 3IC9A 4LF6O 3JD4A 1BSMA 4YHHB 3SPCA 3HKEB 5LHHA 3HKEA 3SPGA 5B1BB 3K3WA 1SQGA 1GM8A 1BT8A 4LWSB 1HNXO 4U7NA 2ZIMA 1F23A 2UUAO 3CRCA 2ZDIC 4JI3O 1I08A 1WB8A 1XDCA 3CP1A 4MTFA 1FXHA 2F66C 1PNMA 5KHJA 3SYPA 3JAWB 3JAWA 3OTOO 1XMQB 5K1XA 5L3BA 5H6QA 2Y69B 1Q86W 1Q3EA 1SA0B 1SA0A 1IBMO 2IW5A 3D3IA 1PNLA 1I94B 4JAAA 4HBNA 5B3SC 4X62O 4J11A 4ZKIA 1VQ7V 4JZ2A 2R70A 2R9IA 2WLJA 1DF4A 2YDEA 5LMNB 4NTXA 5LHGA 2IH3C 2M7WA 4NXNB 3ASNC 3I56V 4LH6A 1YF2A 4WFEA 2FKXA 3KCYA 4GLXA 4Q6GA 2DN9A 3P3PA 1VEWA 4I55B 4I55A 4NTYA 4PDRA 2KSDA 2YXYA 3TJTA 5EZYB 5EZYA 1IBLB 4UV9A 1NTZH 2ITDC 2Q7GA 4NYKA 1UPGA 4X88A 4LF5B 1EN6A 1FS0G 5IE9A 2UUBB 2ODMA 2CH7B 2VWJA 2ZE5A 3E8HA 4AQYO 5JCOA 4FPPA 4R8CA 3H1HH 1BL8A 1M56B 2Q4PA 3CD6V 3WB1A 3AEIA 3DSQA 2DYRC 1N0NA 1MZEA 3P32A 3IAYA 4DV3B 1EZJA 2Y4UA 3K04A 5EIBD 3JD2A 4HZ3A 4LFCO 1ROPA 1XNRB 4DR4B 4G27B 2YICA 3CPWU 1I0HA 4P9OA 1MABG 2QE7G 3CRAA 3W7WA 4QJFB 1XNQO 1B3QA 4B3TB 5B1OA 2ZINA 1JA8A 3K5MA 1G1XB 4RUEA 4GYCB 4O4HB 4O4HA 3RYIB 1SETA 3RYIA 4FIPC 2HFEC 2UXNA 3CRQA 4WFGA 4NTWA 1BQZA 4JV5O 5KA5A 4J7KA 3OE7G 1CXZB 2IJKA 2CTQA 4UUJC 4JYAB 4QPJA 2P4VA 5LP6C 1XL4A 4JTCB 4MVSA 3G6EV 1DTOA 3I5DA 4LR3A 4X66B 3BHPA 2BE3A 3CCQV 2QWRB 4E4EA 4U3JB 4U3JA 2H8PC 4DR7B 4CH3A 3FAVB 3FAVA 2JS5A 2JDIG 4E2LA 3U10A 2UUCB 5LHIA 2CTPA 1MA1A 3X2QC 1FFTB 3W7UA 1Q90D 2UU9B 5CBHA 4MVOA 2Q68A 2QJ1A 3G80A 1BS3A 1TGOA 1OCZB 2VQEB 5KX5B 2ATKC 5KX5A 4JI6B 3L73H 3DGEA 2QTOA 4PDLA 4IHJB 1OCRC 4IHJA 2AZ0A 1AI4A 1N34B 5EC1C 3G6BA 4JAVA 2HHHO 1PD3A 5CB4A 4X8AA 3H1JH 5EBMC 4DXWA 3M99B 3E2EA 1VQ9V 2D3OW 1JOYA 5FLXN 2ZR3A 4RWUA 2CTWA 3WG7C 4LFBO 4DK1A 1YJ9V 5EYPB 5EYPA 2WAMA 1ZLZA 3OEEG 4UCUA 1WNSA 3PN1A 1W2BU 4DV0B 1RPRA 1N32B 4LC1A 3ABKC 3SYCA 1N0JA 4TUYB 1YITV 2XAGA 1ZX3A 1YHQV 2R9AA 2BCCH 2N74A 4MVUA 4XDLA 2LJ2A 1SQXH 5KHHA 5GONB 5GONA 4LP8A 1BZKA 1YXBA 2LQTA 3APOA 2ZXWC 2LFSA 1FJGO 1SS3A 2QWNB 1ORQC 5FL7G 3TETA 4D7TA 3CMAV 2L35A 3OFNG 4KHPB 1I5XA 5GTIZ 3N27A 1WPXA 4PV1B 2EIMC 1PP9H 1GN4A 5JQGB 5JQGA 5KMGB 5KMGA 4DV7B 1KYOF 4FVMA 1KKCA 4HNAB 4HNAA 2YI8A 4HYOA 3A2FA 2Y0PA 4JI7B 1AVMA 3L9DA 4EFEA 3W7SA 4O4JB 1P7GA 4O4JA 4ZHQB 4ZHQA 1G8MA 2IJIA 2DW4A 1R3KC 4YJ3B 4YJ3A 4JYYA 2YXLA 4X64B 4OPAA 5JJNB 3RWRD 5DM6V 2ZE7A 3FB5C 5DECA 4N23A 4FLVA 3T2MA 1VQ5V 1NZ6A 3D3QA 2E5LB 4RUFA 2DWDC 2YS8A 2CDYA 2DOSA 2V7QG 1BMFG 1VQKV 2UXBB 1HNWB 3S3WA 1TAEA 1RFYA 2EILC 4LNUB 3LDDA 1QCEA 4LNUA 3K0GA 3APQA 3JCZA 2OYQA 2HVJC 2RCVA 4GCZA 5H5NA 2ZE8A 2PUSA 1K73W 1QR9A 2WLIB 2WLIA 3SJBC 2YI9A 3JARB 3JARA 3JAKB 2W0XA 3JAKA 2EJRA 1QQCA 1VQMV 4NXMO 1JX9A 4XDKA 5A2QN 2XAFA 3SYOA 3LSSA 4B3RB 1V55C 2DE0X 3AG4B 5IT9N 2GBOA 1H2GA 1W0KG 1P49A 2YIAA 4BWAA 3CCEV 2ARHA 3UO3A 1AI6A 4X20B 4X20A 3L72H 2XT9A 3T4DA 3IJ4A 1JCHA 4NVPA 4FLWA 1NTMH 3FYEB 3OT7A 1K97A 3SJQC 4GKJB 4Z1MG 1KU9A 3OMIB 4MT8A 1H2MA 1ZWIC 5FPRA 1FOUA 2H94A 2ADQB 1H2KA 2YIBA 2AXTZ 3EFFK 3FB8C 4UCOA 5IYBO 1S5LZ 2JS3A 3MHHC 4DUYB 4F6EA 3ABUA 1H38A 5B1AB 1L0LH 4WFAV 1TUEB 3HR0A 4MVZA 1V54C 4FLTA 1NR7A 1GK9A 2DQ3A 4MVRA 3P3NA 3CWBH 3RYFB 3RYFA 3FX7A 4GKKB 3EVKA 2BOBC 1NVPD 1F4MA 5IJ0B 3B2EE 5IJ0A 1WB7A 2P06A 3E22B 5IY5B 3E22A 4DR6B 2A3QA 4CH4A 4MTOA 2XAQA 3B4SA 4LFAO 2P4KA 1TUBB 1TUBA 4FJCC 3D8CA 1GKFA 3KG2A 4YIOA 2UXCO 3A8TA 4ABMA 1S5JA 1GN2A 5CA3A 5CA1B 3QO8A 5C8YB 3QTCA 5C8YA 3EXAA 5KUMA 3ZHQA 2IM9A 4FFBB 4FFBA 4JYBA 3TXSA 2QSAA 4MS2A 2ZM6B 1H8EG 1OCCC 1YIJV 1M90W 1GO3F 3K9SA 4IYHA 3FFQA 3E86A 4JI4O 4J9ZB 5LOVA 1NU1H 4KFMA 4FMTA 1RP3B 1R3LC 1OHHG 5KA6A 4AHCA 4I5SA 4WBNB 4MTGA 4WBNA 1M93A 4DR3O 4UB8Z 3CCVV 3GB7C 3L71H 3SJCC 2O57A 3F7VC 4LF9O 2UXDO 3AG1B 4DV5O 4BW9A 2EINB 1Y74B 1Y74A 1NT2B 4W4KA 4FZ0A 3CCMV 1H2NA 4YHHO 2F43G 3CC2V 2GTAA 3OR6C 4R6ZA 2RDCA 2JK5C 3ABLC 1W59A 1AP5A 1AP6A 1YZBA 1QR8A 4WCEV 2GUZB 2GUZA 2XNDG 2JJ2G 4JI8B 1N4CA 1PL0A 1OZ0A 3ZMZA 2ZNJA 4XDJA 4I0XB 3ASOC 3H01A 2B1IA 2HKOA 4ICGA 3GWKC 4UB6Z 4B3SO 5EIBC 2Y4TA 3ZMUA 1EM1A 2QKAA 3QO5A 5CA0B 1DLBA 5CA0A 1BHAA 4CBCA 2OCCC 2V4DA 5H9CA 2F4VO 1NKDA 3AK1A 1THZA 3ML0A 3QO7A 3OTFA 4J10A 1S3JA 4LF4B 4TT3G 4FLUA 1I94O 2HJDA 1HW7A 1H2LA 2IJJA 2L6LA 4LWSA 1OV9A 1AILA 2ZE6A 1EN4A 1R6KA 5LA6B 5LA6A 4HAMA 1PL4A 2CGOA 1MSWD 3R66A 4O4IB 1YVWA 4O4IA 5LMNO 4DR1O 2ZD9A 1NBMG 5EBWC 3CC7V 2EULA 4DUZO 5EK0A 1HNZB 3ETGA 5AG2A 2F93B 3UKMA 2JGDB 2QWQB 1W0JG 2JGDA 3UT5B 2UXXA 4JTAB 5LP6B 5LP6A 4I7ZB 2CE4A 1JJ2U 1WLEA 3ZS8C 1IBLO 2V1DA 1FXKB 1FXKA 4LF5O 4AILC 3T1YB 1RPOA 1ZSPA 1M9NA 4DV1B 5GTHZ 4OX9O 1EN5A 4LF6B 1MZFA 2Z3YA 2KQXA 3DXRB 2ZT9B 3ZRSA 1N33B 2ZR2A 5E79Z 3A0HZ 3IC7A 4OPHA 1Q81W 3AG3C 2EIJC 2W0FC 1Z2GA 4H33A 3K9AA 4JI0B 2A9HA 3C90A 3OUFA 3ZRXA 4JTDB 1XNRO 4DR4O 3K5OA 4JI3B
chains in the Genus database with same CATH topology
1N0NA 1XILA 1BT8A 5A9GA 1JR9A 2P4KA 1AR5A 1EM1A 2QKAA 1I08A 1WB8A 1XDCA 2RCVA 4X9QA 3C3SA 3RN4A 3CEIA 4YIOA 1ZUQA 1ZLZA 1GN2A 1I0HA 3AK1A 2QKCA 3DC5A 1IDSA 4YIPA 1GN6A 1N0JA 4FFKA 1EN4A 3AK3A 1XREA 1PL4A 1JA8A 3MDSA 3K9SA 1QNMA 1LUWA 4GUNA 2AW9A 3OT7A 4BR6A 1MMMA 3LSUA 4JZ2A 1D5NA 2ADQB 1XUQA 3AK2A 5AG2A 3KDRA 3KKYA 1LUVA 1PM9A 1GN4A 2CE4A 1IXBA 1KKCA 1MSDA 1Y67A 4F6EA 2ADPA 1B06A 4E4EA 4C7UA 1VARA 1AR4A 3DC6A 1ZSPA 1VEWA 3TJTA 1EN5A 1MNGA 3QVNA 1AVMA 1IX9A 1P7GA 3C3TA 1GN3A 1AP5A 1AP6A 1EN6A 1MA1A 4JYYA 3IC9A 1SZXA 3EVKA 1BS3A 1BSMA 1ZTEA 4JZGA 1WB7A 3BFRA 2CDYA 2GDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0N A;  1XIL A;  1BT8 A;  5A9G A;  1JR9 A;  2P4K A;  1AR5 A;  1EM1 A;  2QKA A;  1I08 A;  1WB8 A;  1XDC A;  2RCV A;  4X9Q A;  3C3S A;  3RN4 A;  3CEI A;  4YIO A;  1ZUQ A;  1ZLZ A;  1GN2 A;  1I0H A;  3AK1 A;  2QKC A;  3DC5 A;  1IDS A;  4YIP A;  1GN6 A;  1N0J A;  4FFK A;  1EN4 A;  3AK3 A;  1XRE A;  1PL4 A;  1JA8 A;  3MDS A;  3K9S A;  1QNM A;  1LUW A;  4GUN A;  2AW9 A;  3OT7 A;  4BR6 A;  1MMM A;  3LSU A;  4JZ2 A;  1D5N A;  2ADQ B;  1XUQ A;  3AK2 A;  5AG2 A;  3KKY A;  1LUV A;  1PM9 A;  1GN4 A;  2CE4 A;  1IXB A;  1KKC A;  1MSD A;  1Y67 A;  4F6E A;  2ADP A;  1B06 A;  4E4E A;  4C7U A;  1VAR A;  1AR4 A;  3DC6 A;  1ZSP A;  1VEW A;  3TJT A;  1EN5 A;  1MNG A;  3QVN A;  1AVM A;  1IX9 A;  1P7G A;  3C3T A;  1GN3 A;  1AP5 A;  1AP6 A;  1EN6 A;  1MA1 A;  4JYY A;  3IC9 A;  1SZX A;  3EVK A;  1BS3 A;  1BSM A;  1ZTE A;  4JZG A;  1WB7 A;  3BFR A;  2CDY A;  2GDS A; 
#chains in the Genus database with same CATH topology
 3ETQ A;  5JJE B;  1Z5V A;  3LDC A;  3UCS C;  4DK0 A;  1XQ8 A;  3EHB B;  5IYD O;  5JWP A;  1SQB H;  3C3S A;  3ZX6 A;  2EZP A;  3RN4 A;  2CH7 A;  3ZHT A;  3OTO B;  3ZHV A;  3ETD A;  4RQE A;  1FFX B;  4LCU C;  1FFX A;  1YJW V;  1R6N A;  3ABM C;  5IJ9 B;  5IJ9 A;  5LMU O;  4UCV A;  3K5N A;  4TV8 B;  4TV8 A;  3W7X A;  5E1A C;  3ABK B;  3AK3 A;  1YSC A;  2DYS C;  1NH2 B;  4JYA O;  2DJV A;  3BAA A;  4KP4 A;  1QBZ A;  1QNM A;  2JJ1 G;  5J9P C;  2LW1 A;  4DW1 A;  1IBK B;  2QA4 V;  2OTL V;  2KG7 B;  2KG7 A;  4YY3 B;  2P7T C;  2A7W A;  4NB5 A;  3ZN0 A;  4LF8 B;  2E75 B;  2F23 A;  2WLK A;  1D5N A;  2ZXW B;  4CZZ A;  4N21 A;  2XOK G;  3HKD B;  3HKD A;  4BIU A;  3FB6 C;  4UVA A;  1GM7 A;  4EKW A;  3OEH G;  1YTF B;  3CCJ V;  2PY5 A;  3ZMS A;  5LBQ A;  2JGU A;  1F4N A;  4ZIB A;  5B1B C;  2X0L A;  1SES A;  2QWP B;  2UU9 O;  3T1H O;  1YCI A;  1BE3 H;  2WLH A;  3HPL C;  3CRR A;  2VQE O;  1K9M W;  3ZBH A;  4ZOL B;  3FKS G;  4ZOL A;  1K8A W;  1ARO P;  4IGG A;  1N34 O;  4K3A A;  3CSX A;  3OAA G;  1RM1 B;  5L3G A;  4FM1 A;  4LF7 O;  2RMK B;  1SQF A;  3AG7 A;  3JYC A;  1GH6 A;  2QEX V;  2WLL B;  4LFC B;  2WLL A;  3CC4 V;  3R65 A;  5IWA O;  3O65 A;  2Y69 C;  2X7R B;  4L8J A;  4F6R B;  4F6R A;  2EIL B;  4U3F H;  4JI2 B;  4TSF G;  1U96 A;  2YID A;  1XNQ B;  2OIG A;  1I7F A;  1FXV A;  1Q5O A;  2X6B A;  5BR8 O;  2YUA A;  1S77 D;  2B5U A;  1OCO C;  3RBZ A;  2Q69 A;  4U7O A;  3CXC U;  3L74 H;  2X6A A;  4DR5 O;  1VF7 A;  2JIZ G;  3MDS A;  1K3E A;  4KHP O;  1LUW A;  3AG2 C;  5BXZ A;  1K7D A;  4KUM A;  4BR6 A;  4EB6 B;  4EB6 A;  4DV7 O;  1MMM A;  1FPO A;  3LSU A;  2P5O A;  2ZQM A;  3TK1 A;  1XI1 A;  2GTS A;  3OM3 B;  4H0L B;  3K59 A;  2PGG A;  4TUY A;  2LO1 A;  4JI7 O;  4NKG B;  1B06 A;  1CPY A;  1K5S A;  1QVG U;  2Z5U A;  4MVM A;  4X64 O;  1XHX A;  3CCR V;  3KZI Z;  1Q6I A;  1SC5 B;  3RT3 C;  4QNH B;  3J80 N;  1M57 C;  4O4L B;  3IGA C;  2EZO A;  4O4L A;  4R7C A;  4CC6 A;  1P4R A;  2A0L A;  3C3T A;  2AGA A;  1R3I C;  1QLE B;  2UXB O;  1JMK C;  2IH1 C;  1HNW O;  1SZX A;  1Y66 A;  3CS5 A;  2GSM B;  1VP7 A;  3BA9 A;  3DTU B;  5LL6 Y;  2YSU B;  4JAS A;  3BFR A;  5KAF Z;  1K33 A;  4H44 B;  5LGU A;  3IFX A;  4QE9 A;  2EIK B;  1NTK H;  3SPJ A;  2PYL A;  1D2D A;  2Q8V A;  3Q4H B;  3Q4H A;  2GHY A;  1COW G;  5DED A;  2K1E A;  2Q73 A;  1X59 A;  2XTA A;  1AR1 B;  2BSK B;  3G71 V;  2BSK A;  5CBF A;  4ZI7 B;  4ZI7 A;  4JGS A;  1WPB A;  4FFK A;  2JEX A;  4GKJ O;  1XRE A;  2Q7H A;  3GWO A;  1ENV A;  1BQ0 A;  5LGN A;  2VQF B;  1NS1 A;  4QGP A;  3ZJZ A;  1FJG B;  4O2B B;  4O2B A;  2ZIO A;  4QE7 A;  2P6J A;  5H2F Z;  3JSL A;  4JI5 B;  4QIW F;  3MHS C;  2AZ2 A;  4DUY O;  5KAI Z;  1R6T A;  1XUQ A;  3SPI A;  2PTM A;  3KDR A;  4GZR B;  1WA8 B;  1DK1 A;  1WA8 A;  4AI8 A;  4CS3 A;  2AHY A;  1QHT A;  1P7B A;  3E8G A;  1F51 A;  3ZRV A;  5D5P A;  4DV2 B;  4PDV A;  2YC0 A;  5KHI A;  2IJH A;  3CE2 A;  1PKX A;  1KB9 F;  3T4Z A;  1XMO B;  3SPH A;  2PF4 E;  3OMN B;  1M4U A;  4UFZ A;  3T1C A;  4DR6 O;  2PYJ A;  3ZIA G;  3N2G B;  3N2G A;  4JPR A;  1VQ4 V;  3NR7 A;  3WB2 A;  1KP2 A;  3SGI A;  3STL C;  4UCT A;  3ZED A;  1X4T A;  2PI5 A;  3JD0 A;  2HEP A;  2G38 A;  4IL6 Z;  3UQ8 A;  4MSW C;  1J5E B;  1EBO A;  3H1I H;  1O9H A;  3ASO B;  4I9Q A;  1BHB A;  2HVK C;  4K35 A;  1JR9 A;  2FB5 A;  1V9P A;  3LSQ A;  3VBB A;  5LGT A;  2ETN A;  3JAM N;  2ZM6 O;  4FLZ A;  1HWY A;  1KP3 A;  1PPJ H;  1GTO A;  2BOC C;  3KCX A;  3L70 H;  4DV4 O;  3E89 A;  3QF7 A;  3D36 C;  1H8H G;  4GX1 A;  1SZT A;  1U97 A;  2HLD G;  3PJS K;  2ZDI A;  5HFM A;  2QM4 A;  1YEW A;  1US6 A;  3OD4 A;  3RGB A;  5CA1 A;  3HB3 B;  4BW5 A;  2N04 A;  4CS4 A;  4X1Y B;  4X1Y A;  1BGY H;  3ZRW B;  3ZRW A;  4K8X A;  1PM9 A;  1VQP V;  3RVY A;  4J42 A;  1HR0 B;  3O9O A;  2CAZ C;  3UM7 A;  4RQF A;  2FYU H;  3ZHR A;  1XHZ A;  5B3S B;  3JAT B;  3JAT A;  1VQN V;  3QG5 A;  3JD3 A;  5IYC O;  1KUQ A;  4B3M O;  1KMI Z;  5B1N A;  3MAQ A;  4IIJ B;  3ZN1 A;  2XAS A;  1ZTE A;  3ASN B;  1NR1 A;  4LFA B;  1B6Q A;  3AG4 C;  4PA3 A;  1AJP A;  2GDS A;  4X1I B;  1E79 G;  4X1I A;  2FML A;  4TQF A;  1SRY A;  4LF4 O;  4J80 A;  4FM2 A;  3VQV A;  3M8A A;  5L3E A;  4JI1 B;  3SR2 C;  1K4C C;  3BAB A;  1ZUQ A;  4EFB A;  3OR7 C;  2KKW A;  4TWK A;  2N05 A;  4I0X A;  5KUK A;  2WA4 A;  4B7K A;  4I4T B;  4YIP A;  1AI5 A;  4I4T A;  2DYR B;  3RW0 A;  1AI7 A;  4G28 B;  5HFL A;  3K5L A;  3OGC C;  4J7J A;  2DMX A;  4JF3 A;  4PI2 A;  4RAI A;  1FAF A;  1SF9 A;  1XMQ O;  4IYI A;  3ZMV A;  3WFV A;  4DV6 B;  1N36 B;  4DRX B;  4DRX A;  3SJA C;  2A79 B;  2W6I G;  2FL4 A;  2BTQ B;  2BTQ A;  3CXH F;  2A06 H;  3TGU H;  4LF9 B;  3UO2 A;  1QU7 A;  3K03 A;  4DV1 O;  1R3J C;  5JH7 B;  3ZMT A;  5JH7 A;  4K0K B;  4X65 B;  4LH7 A;  2C2A A;  1N33 O;  5IY5 C;  4J41 A;  4FK5 C;  2IBZ H;  3LNN A;  1DF5 A;  2QM8 A;  1GMG A;  3FD9 A;  1FYJ A;  4NXN O;  1AR4 A;  1LNQ A;  3DC6 A;  2Q7E A;  4JI0 O;  1UJW B;  4DR2 B;  1NI8 A;  1NQT A;  1B04 A;  2CTR A;  1Y76 B;  1Y76 A;  1AJQ A;  3UT5 A;  1VF6 C;  1Q6H A;  4LBE C;  4W4L A;  1VIB A;  5L3F A;  4JZG A;  1Q7Y W;  4B3S B;  1XL6 A;  3BA8 A;  2QTS A;  1R1B A;  3K57 A;  2UUB O;  3CME V;  3RFR A;  1A32 A;  2EX3 A;  1Q8I A;  2BTO A;  3E35 A;  3THO A;  2F4V B;  1IXM A;  1WN7 A;  3DXR A;  3QNE A;  4D6T H;  4D7S A;  3X2Q B;  4DV3 O;  1URF A;  4FZ1 A;  1VF5 B;  5L3C A;  1HNX B;  3F5W C;  2UUA B;  5TIS Z;  4BAY A;  2E3C A;  3DC5 A;  2NR5 A;  2QGN A;  1IDS A;  3K08 A;  4BIO A;  3JCU Z;  1IBK O;  1Y6X A;  1KEC A;  3JAL B;  1OCR B;  3JAL A;  4YY3 O;  4DR1 B;  1OCO B;  4LF8 O;  1GAX A;  3B8N A;  3VQW A;  4DUZ B;  1GRJ A;  1VQO V;  3AG1 C;  2VWK A;  2EIN C;  3WG7 B;  5FNV B;  5FNV A;  2ZCE A;  4ZBM A;  5BY1 A;  4B3T O;  3AG2 B;  2HG5 C;  4Z2W A;  2YIB D;  3OMA B;  1IBM B;  2OIE A;  2PZS A;  5JVD B;  1S76 D;  5JVD A;  5J2T B;  5J2T A;  2K9P A;  5CBG A;  5IDJ A;  4WFF A;  4X62 B;  4I50 B;  4Q20 A;  4I50 A;  2QWO B;  2LGW A;  3CCU V;  4OX9 B;  1YI2 V;  4Z1V A;  3GVM A;  4C7U A;  1VAR A;  1K34 A;  5L3D A;  1K92 A;  4X66 O;  1F7Y A;  1L8D A;  2Y0I A;  1VQ8 V;  2HR3 A;  1IX9 A;  2CK3 G;  1G6U A;  3H1L H;  4CH6 A;  1M57 B;  4PA9 A;  1EZV H;  2Y48 A;  4DR7 O;  1ZAU A;  1SER A;  2EIM B;  1IUR A;  1K5Q A;  4JI2 O;  1NVP B;  1Z5W A;  2QM7 A;  2UUC O;  2WA3 A;  5H6R A;  2IU0 A;  1QLN A;  1XIL A;  2WSS G;  1PV0 A;  3JAS B;  3JAS A;  3FYI B;  1L1F A;  4AQY B;  4JI6 O;  4X9Q A;  5LMU B;  3LNM B;  3G67 A;  1KC8 W;  3BRC A;  2D2C B;  2AHZ A;  3JSN A;  3J81 N;  1T5E A;  2MW2 B;  4GX2 A;  1HDJ A;  3SYQ A;  4P30 A;  4FLY A;  2XAH A;  3BPZ A;  1XBL A;  3U0Z A;  2DWE C;  3JD1 A;  2MK3 A;  5DN6 G;  4DV0 O;  1N32 O;  1FXK C;  3P30 A;  2Q9L A;  2RJZ A;  5FPO A;  3RYC B;  3RYC A;  2AW9 A;  4B08 A;  3WU2 Z;  2Q67 A;  1H5W A;  1V55 B;  1D5A A;  3K79 A;  3T1H B;  4KXR A;  1SQQ H;  4A5U B;  1MSD A;  4JV5 B;  1JFF B;  1FD9 A;  1JFF A;  2F95 B;  1IJG A;  4PEL A;  5D5Q A;  1KBH A;  4J9Y B;  3J7A U;  1SQP H;  2HP8 A;  3HKC B;  5CB4 B;  3HKC A;  1VQL V;  2Z0A A;  1YDX A;  3H9V A;  1FKA O;  3E8F A;  3LDE A;  1TA8 A;  2XAJ A;  4G2K A;  3ETE A;  1DGS A;  1JPX A;  3ICX A;  4MW3 A;  5C93 A;  5KLV H;  4LF7 B;  1JVM A;  5JCO C;  3BCC H;  2ZKO A;  1S72 V;  2W6J G;  3N2K B;  3N2K A;  5IWA B;  1M56 C;  4QPK A;  2OWO A;  3B09 A;  4P9P A;  4PDM A;  4CC5 A;  3LUT B;  2P22 C;  1CP9 A;  3E8B A;  4ASU G;  2E5L O;  3OGI B;  1AR5 A;  3CCS V;  1V54 B;  1Q82 W;  1VQ6 V;  2FTK A;  5BR8 B;  1K4D C;  1XEQ A;  4OGQ B;  2HHH B;  4GX0 A;  3OW2 U;  3SDL A;  3G4S V;  2QKC A;  2VQF O;  5IYZ B;  5IYZ A;  4DR5 B;  4PI0 A;  4LFB B;  2XHB A;  3ABT A;  4JI5 O;  1GN6 A;  2XUM A;  3D36 A;  1UFI A;  4PHZ A;  4B3R O;  3CYO A;  4UVC A;  1I5Y A;  2WLM A;  3FB7 C;  2CGN A;  4WF9 V;  1KQS U;  3SYA A;  5CN0 A;  3A0R A;  4PA4 A;  1WP7 A;  4WFH A;  1LR1 A;  1JNB A;  4DV2 O;  1RSO B;  1RSO A;  1LUV A;  3CX5 F;  1EFR G;  1OCC B;  1IXB A;  2B9Z A;  1XMO O;  3K0D A;  1RM1 C;  4OXS A;  4CS2 A;  5EBL C;  4X89 A;  2P67 A;  4BIZ A;  3B40 A;  1VMG A;  4JAU A;  1Q43 A;  3VOU A;  4PA7 A;  2F1M A;  3QVN A;  1MNG A;  3VQX A;  2OT5 A;  1S0V A;  1J95 A;  1GN3 A;  4YXW G;  1J5E O;  1HP8 A;  1N8R W;  2LW7 A;  3CJH B;  3CJH A;  4DW0 A;  1JJO A;  5BMV B;  1OCZ C;  3F7Y C;  5BMV A;  4FLX A;  3VQY A;  1M5I A;  4X1K B;  4X1K A;  2ILM A;  5J2U B;  5J2U A;  1L0N H;  2CUG A;  1WAZ A;  1G4Y B;  2WLN A;  3L75 H;  2M6Y A;  1TVK B;  1TVK A;  1YJN V;  4GKK O;  1CEZ A;  4GT1 A;  2HJF C;  5LXT B;  5LXT A;  4UCS A;  3ABL B;  2JVD A;  1IVS A;  1KD1 W;  2RQ6 A;  2R72 A;  2R9R B;  2QR4 A;  3WB0 A;  2Q0A A;  2WWW A;  1JQ0 A;  2ITC C;  2X6C A;  4UXN A;  2NN4 A;  1WP8 A;  4JYC A;  2RNB A;  2Q0O C;  2OTJ V;  2NLJ C;  1AB3 A;  1NH2 D;  4NXM B;  1SQV H;  2LFR A;  4UV8 A;  5CMU A;  2LP7 A;  3M7M X;  4GUN A;  1SKV A;  4F4L A;  4H37 A;  2OCC B;  3A0B Z;  2P90 A;  4FM0 A;  4KL1 A;  1BCC H;  1HR0 O;  2EBO A;  2GV9 A;  2ZNI A;  1Q6U A;  1QLE C;  1H2S B;  4NR1 A;  2JEU A;  3KKY A;  1YTF D;  1KKD A;  3K06 A;  3CRM A;  2DQ0 A;  4IT5 A;  1PNK A;  5ITZ B;  2H3O A;  4MVQ A;  2NNU A;  2LGQ A;  4PD4 F;  5ITZ A;  3MD0 A;  1Y67 A;  1S5H C;  2ADP A;  3H1K H;  2YEV B;  2YEV A;  2EIK C;  3BEH A;  2Q6A A;  1P84 F;  1M1K W;  3I55 V;  2QKS A;  5GW7 A;  5F2V O;  3ZHS A;  3TXQ A;  1VF6 A;  4B7E A;  4PJ0 Z;  1NJI W;  5KHG A;  4JI1 O;  3CHX A;  1OJH A;  4O2A B;  3S3X A;  4O2A A;  5B66 Z;  4JI8 O;  1WJZ A;  4H13 B;  2JRI A;  5A9G A;  2Q5Z A;  3RYH B;  3RYH A;  3NXS A;  2VS0 A;  4PA6 A;  4I9W A;  4UVB A;  4RO2 A;  4CH5 A;  3CEI A;  3F5T A;  5K1P A;  3ZCC A;  4UCR A;  4DV4 B;  4IIJ A;  3AG3 B;  2EIJ B;  5KHK A;  3STZ C;  3ZHU A;  2WPD G;  3CB2 A;  3TCU A;  2E76 B;  2KB1 A;  2PI4 A;  5B5E Z;  5LOV B;  4DV6 O;  1N36 O;  4L87 A;  4K8Z A;  1AJN A;  3BY6 A;  4MW8 A;  2RN9 A;  2UXC B;  2B1G A;  3W7T A;  4WFB V;  1MOF A;  2IU3 A;  2E74 B;  3CCL V;  4MTX A;  3HKB B;  3HKB A;  1XOU A;  4K0K O;  4EEQ A;  4X65 O;  1MG1 A;  3ABM B;  2YXH A;  1GM9 A;  4TOI A;  4DYL A;  1E1Q G;  3AK2 A;  3BVO A;  3E83 A;  1QVF U;  4JI4 B;  4P2Z A;  1HNZ O;  2VRZ A;  5EC2 C;  4DR2 O;  2EJ7 A;  3OUS A;  2DYS B;  3RVZ A;  3B77 A;  4GX5 A;  5LYJ B;  5B1A C;  5LYJ A;  4B3M B;  3B8M A;  4YJ2 B;  4XBF A;  1Y4M A;  4YJ2 A;  1E1R G;  1O9G A;  4DR3 B;  2QDO A;  5BZB A;  1ZL8 B;  3U11 A;  1ZL8 A;  4J7Z A;  2OCH A;  5JJJ B;  3K58 A;  4R50 A;  1IZ3 A;  3T1Y O;  4TQD A;  2UXD B;  4DV5 B;  4DO2 A;  4TV9 B;  4TV9 A;  1R73 A;  3IC9 A;  4LF6 O;  3JD4 A;  1BSM A;  4YHH B;  3SPC A;  3HKE B;  5LHH A;  3HKE A;  3SPG A;  5B1B B;  3K3W A;  1SQG A;  1GM8 A;  1BT8 A;  4LWS B;  1HNX O;  4U7N A;  2ZIM A;  1F23 A;  2UUA O;  3CRC A;  2ZDI C;  4JI3 O;  1I08 A;  1WB8 A;  1XDC A;  3CP1 A;  4MTF A;  1FXH A;  2F66 C;  1PNM A;  5KHJ A;  3SYP A;  3JAW B;  3JAW A;  3OTO O;  1XMQ B;  5K1X A;  5L3B A;  5H6Q A;  2Y69 B;  1Q86 W;  1Q3E A;  1SA0 B;  1SA0 A;  1IBM O;  2IW5 A;  3D3I A;  1PNL A;  1I94 B;  4JAA A;  4HBN A;  5B3S C;  4X62 O;  4J11 A;  4ZKI A;  1VQ7 V;  4JZ2 A;  2R70 A;  2R9I A;  2WLJ A;  1DF4 A;  2YDE A;  5LMN B;  4NTX A;  5LHG A;  2IH3 C;  2M7W A;  4NXN B;  3ASN C;  3I56 V;  4LH6 A;  1YF2 A;  4WFE A;  2FKX A;  3KCY A;  4GLX A;  4Q6G A;  2DN9 A;  3P3P A;  1VEW A;  4I55 B;  4I55 A;  4NTY A;  4PDR A;  2KSD A;  2YXY A;  3TJT A;  5EZY B;  5EZY A;  1IBL B;  4UV9 A;  1NTZ H;  2ITD C;  2Q7G A;  4NYK A;  1UPG A;  4X88 A;  4LF5 B;  1EN6 A;  1FS0 G;  5IE9 A;  2UUB B;  2ODM A;  2CH7 B;  2VWJ A;  2ZE5 A;  3E8H A;  4AQY O;  5JCO A;  4FPP A;  4R8C A;  3H1H H;  1BL8 A;  1M56 B;  2Q4P A;  3CD6 V;  3WB1 A;  3AEI A;  3DSQ A;  2DYR C;  1N0N A;  1MZE A;  3P32 A;  3IAY A;  4DV3 B;  1EZJ A;  2Y4U A;  3K04 A;  5EIB D;  3JD2 A;  4HZ3 A;  4LFC O;  1ROP A;  1XNR B;  4DR4 B;  4G27 B;  2YIC A;  3CPW U;  1I0H A;  4P9O A;  1MAB G;  2QE7 G;  3CRA A;  3W7W A;  4QJF B;  1XNQ O;  1B3Q A;  4B3T B;  5B1O A;  2ZIN A;  1JA8 A;  3K5M A;  1G1X B;  4RUE A;  4GYC B;  4O4H B;  4O4H A;  3RYI B;  1SET A;  3RYI A;  4FIP C;  2HFE C;  2UXN A;  3CRQ A;  4WFG A;  4NTW A;  1BQZ A;  4JV5 O;  5KA5 A;  4J7K A;  3OE7 G;  1CXZ B;  2IJK A;  2CTQ A;  4UUJ C;  4JYA B;  4QPJ A;  2P4V A;  5LP6 C;  1XL4 A;  4JTC B;  4MVS A;  3G6E V;  1DTO A;  3I5D A;  4LR3 A;  4X66 B;  3BHP A;  2BE3 A;  3CCQ V;  2QWR B;  4E4E A;  4U3J B;  4U3J A;  2H8P C;  4DR7 B;  4CH3 A;  3FAV B;  3FAV A;  2JS5 A;  2JDI G;  4E2L A;  3U10 A;  2UUC B;  5LHI A;  2CTP A;  1MA1 A;  3X2Q C;  1FFT B;  3W7U A;  1Q90 D;  2UU9 B;  5CBH A;  4MVO A;  2Q68 A;  2QJ1 A;  3G80 A;  1BS3 A;  1TGO A;  1OCZ B;  2VQE B;  5KX5 B;  2ATK C;  5KX5 A;  4JI6 B;  3L73 H;  3DGE A;  2QTO A;  4PDL A;  4IHJ B;  1OCR C;  4IHJ A;  2AZ0 A;  1AI4 A;  1N34 B;  5EC1 C;  3G6B A;  4JAV A;  2HHH O;  1PD3 A;  5CB4 A;  4X8A A;  3H1J H;  5EBM C;  4DXW A;  3M99 B;  3E2E A;  1VQ9 V;  2D3O W;  1JOY A;  5FLX N;  2ZR3 A;  4RWU A;  2CTW A;  3WG7 C;  4LFB O;  4DK1 A;  1YJ9 V;  5EYP B;  5EYP A;  2WAM A;  1ZLZ A;  3OEE G;  4UCU A;  1WNS A;  3PN1 A;  1W2B U;  4DV0 B;  1RPR A;  1N32 B;  4LC1 A;  3ABK C;  3SYC A;  1N0J A;  4TUY B;  1YIT V;  2XAG A;  1ZX3 A;  1YHQ V;  2R9A A;  2BCC H;  2N74 A;  4MVU A;  4XDL A;  2LJ2 A;  1SQX H;  5KHH A;  5GON B;  5GON A;  4LP8 A;  1BZK A;  1YXB A;  2LQT A;  3APO A;  2ZXW C;  2LFS A;  1FJG O;  1SS3 A;  2QWN B;  1ORQ C;  5FL7 G;  3TET A;  4D7T A;  3CMA V;  2L35 A;  3OFN G;  4KHP B;  1I5X A;  5GTI Z;  3N27 A;  1WPX A;  4PV1 B;  2EIM C;  1PP9 H;  1GN4 A;  5JQG B;  5JQG A;  5KMG B;  5KMG A;  4DV7 B;  1KYO F;  4FVM A;  1KKC A;  4HNA B;  4HNA A;  2YI8 A;  4HYO A;  3A2F A;  2Y0P A;  4JI7 B;  1AVM A;  3L9D A;  4EFE A;  3W7S A;  4O4J B;  1P7G A;  4O4J A;  4ZHQ B;  4ZHQ A;  1G8M A;  2IJI A;  2DW4 A;  1R3K C;  4YJ3 B;  4YJ3 A;  4JYY A;  2YXL A;  4X64 B;  4OPA A;  5JJN B;  3RWR D;  5DM6 V;  2ZE7 A;  3FB5 C;  5DEC A;  4N23 A;  4FLV A;  3T2M A;  1VQ5 V;  1NZ6 A;  3D3Q A;  2E5L B;  4RUF A;  2DWD C;  2YS8 A;  2CDY A;  2DOS A;  2V7Q G;  1BMF G;  1VQK V;  2UXB B;  1HNW B;  3S3W A;  1TAE A;  1RFY A;  2EIL C;  4LNU B;  3LDD A;  1QCE A;  4LNU A;  3K0G A;  3APQ A;  3JCZ A;  2OYQ A;  2HVJ C;  2RCV A;  4GCZ A;  5H5N A;  2ZE8 A;  2PUS A;  1K73 W;  1QR9 A;  2WLI B;  2WLI A;  3SJB C;  2YI9 A;  3JAR B;  3JAR A;  3JAK B;  2W0X A;  3JAK A;  2EJR A;  1QQC A;  1VQM V;  4NXM O;  1JX9 A;  4XDK A;  5A2Q N;  2XAF A;  3SYO A;  3LSS A;  4B3R B;  1V55 C;  2DE0 X;  3AG4 B;  5IT9 N;  2GBO A;  1H2G A;  1W0K G;  1P49 A;  2YIA A;  4BWA A;  3CCE V;  2ARH A;  3UO3 A;  1AI6 A;  4X20 B;  4X20 A;  3L72 H;  2XT9 A;  3T4D A;  3IJ4 A;  1JCH A;  4NVP A;  4FLW A;  1NTM H;  3FYE B;  3OT7 A;  1K97 A;  3SJQ C;  4GKJ B;  4Z1M G;  1KU9 A;  3OMI B;  4MT8 A;  1H2M A;  1ZWI C;  5FPR A;  1FOU A;  2H94 A;  2ADQ B;  1H2K A;  2YIB A;  2AXT Z;  3EFF K;  3FB8 C;  4UCO A;  5IYB O;  1S5L Z;  2JS3 A;  3MHH C;  4DUY B;  4F6E A;  3ABU A;  1H38 A;  5B1A B;  1L0L H;  4WFA V;  1TUE B;  3HR0 A;  4MVZ A;  1V54 C;  4FLT A;  1NR7 A;  1GK9 A;  2DQ3 A;  4MVR A;  3P3N A;  3CWB H;  3RYF B;  3RYF A;  3FX7 A;  4GKK B;  3EVK A;  2BOB C;  1NVP D;  1F4M A;  5IJ0 B;  3B2E E;  5IJ0 A;  1WB7 A;  2P06 A;  3E22 B;  5IY5 B;  3E22 A;  4DR6 B;  2A3Q A;  4CH4 A;  4MTO A;  2XAQ A;  3B4S A;  4LFA O;  2P4K A;  1TUB B;  1TUB A;  4FJC C;  3D8C A;  1GKF A;  3KG2 A;  4YIO A;  2UXC O;  3A8T A;  4ABM A;  1S5J A;  1GN2 A;  5CA3 A;  5CA1 B;  3QO8 A;  5C8Y B;  3QTC A;  5C8Y A;  3EXA A;  5KUM A;  3ZHQ A;  2IM9 A;  4FFB B;  4FFB A;  4JYB A;  3TXS A;  2QSA A;  4MS2 A;  2ZM6 B;  1H8E G;  1OCC C;  1YIJ V;  1M90 W;  1GO3 F;  3K9S A;  4IYH A;  3FFQ A;  3E86 A;  4JI4 O;  4J9Z B;  5LOV A;  1NU1 H;  4KFM A;  4FMT A;  1RP3 B;  1R3L C;  1OHH G;  5KA6 A;  4AHC A;  4I5S A;  4WBN B;  4MTG A;  4WBN A;  1M93 A;  4DR3 O;  4UB8 Z;  3CCV V;  3GB7 C;  3L71 H;  3SJC C;  2O57 A;  3F7V C;  4LF9 O;  2UXD O;  3AG1 B;  4DV5 O;  4BW9 A;  2EIN B;  1Y74 B;  1Y74 A;  1NT2 B;  4W4K A;  4FZ0 A;  3CCM V;  1H2N A;  4YHH O;  2F43 G;  3CC2 V;  2GTA A;  3OR6 C;  4R6Z A;  2RDC A;  2JK5 C;  3ABL C;  1W59 A;  1AP5 A;  1AP6 A;  1YZB A;  1QR8 A;  4WCE V;  2GUZ B;  2GUZ A;  2XND G;  2JJ2 G;  4JI8 B;  1N4C A;  1PL0 A;  1OZ0 A;  3ZMZ A;  2ZNJ A;  4XDJ A;  4I0X B;  3ASO C;  3H01 A;  2B1I A;  2HKO A;  4ICG A;  3GWK C;  4UB6 Z;  4B3S O;  5EIB C;  2Y4T A;  3ZMU A;  1EM1 A;  2QKA A;  3QO5 A;  5CA0 B;  1DLB A;  5CA0 A;  1BHA A;  4CBC A;  2OCC C;  2V4D A;  5H9C A;  2F4V O;  1NKD A;  3AK1 A;  1THZ A;  3ML0 A;  3QO7 A;  3OTF A;  4J10 A;  1S3J A;  4LF4 B;  4TT3 G;  4FLU A;  1I94 O;  2HJD A;  1HW7 A;  1H2L A;  2IJJ A;  2L6L A;  4LWS A;  1OV9 A;  1AIL A;  2ZE6 A;  1EN4 A;  1R6K A;  5LA6 B;  5LA6 A;  4HAM A;  1PL4 A;  2CGO A;  1MSW D;  3R66 A;  4O4I B;  1YVW A;  4O4I A;  5LMN O;  4DR1 O;  2ZD9 A;  1NBM G;  5EBW C;  3CC7 V;  2EUL A;  4DUZ O;  5EK0 A;  1HNZ B;  3ETG A;  5AG2 A;  2F93 B;  3UKM A;  2JGD B;  2QWQ B;  1W0J G;  2JGD A;  3UT5 B;  2UXX A;  4JTA B;  5LP6 B;  5LP6 A;  4I7Z B;  2CE4 A;  1JJ2 U;  1WLE A;  3ZS8 C;  1IBL O;  2V1D A;  1FXK B;  1FXK A;  4LF5 O;  4AIL C;  3T1Y B;  1RPO A;  1ZSP A;  1M9N A;  4DV1 B;  5GTH Z;  4OX9 O;  1EN5 A;  4LF6 B;  1MZF A;  2Z3Y A;  2KQX A;  3DXR B;  2ZT9 B;  3ZRS A;  1N33 B;  2ZR2 A;  5E79 Z;  3A0H Z;  3IC7 A;  4OPH A;  1Q81 W;  3AG3 C;  2EIJ C;  2W0F C;  1Z2G A;  4H33 A;  3K9A A;  4JI0 B;  2A9H A;  3C90 A;  3OUF A;  3ZRX A;  4JTD B;  1XNR O;  4DR4 O;  3K5O A;  4JI3 B; 
#chains in the Genus database with same CATH homology
 1N0N A;  1XIL A;  1BT8 A;  5A9G A;  1JR9 A;  2P4K A;  1AR5 A;  1EM1 A;  2QKA A;  1I08 A;  1WB8 A;  1XDC A;  2RCV A;  4X9Q A;  3C3S A;  3RN4 A;  3CEI A;  4YIO A;  1ZUQ A;  1ZLZ A;  1GN2 A;  1I0H A;  3AK1 A;  2QKC A;  3DC5 A;  1IDS A;  4YIP A;  1GN6 A;  1N0J A;  4FFK A;  1EN4 A;  3AK3 A;  1XRE A;  1PL4 A;  1JA8 A;  3MDS A;  3K9S A;  1QNM A;  1LUW A;  4GUN A;  2AW9 A;  3OT7 A;  4BR6 A;  1MMM A;  3LSU A;  4JZ2 A;  1D5N A;  2ADQ B;  1XUQ A;  3AK2 A;  5AG2 A;  3KDR A;  3KKY A;  1LUV A;  1PM9 A;  1GN4 A;  2CE4 A;  1IXB A;  1KKC A;  1MSD A;  1Y67 A;  4F6E A;  2ADP A;  1B06 A;  4E4E A;  4C7U A;  1VAR A;  1AR4 A;  3DC6 A;  1ZSP A;  1VEW A;  3TJT A;  1EN5 A;  1MNG A;  3QVN A;  1AVM A;  1IX9 A;  1P7G A;  3C3T A;  1GN3 A;  1AP5 A;  1AP6 A;  1EN6 A;  1MA1 A;  4JYY A;  3IC9 A;  1SZX A;  3EVK A;  1BS3 A;  1BSM A;  1ZTE A;  4JZG A;  1WB7 A;  3BFR A;  2CDY A;  2GDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...