1ZSPA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAAVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zspA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zspA02
3LSUA 1ZTEA 3BFRA 3QVNA 1IXBA 2P4KA 2GDSA 1AP6A 1IX9A 4X9QA 3TJTA 1D5NA 1BT8A 4YIPA 4BR6A 4YIOA 1EM1A 2AW9A 1XREA 1MA1A 1QNMA 1BS3A 1N0JA 1XDCA 1SZXA 1XILA 1AR4A 1PM9A 4E4EA 1IDSA 1LUVA 4GUNA 1MMMA 1AP5A 4C7UA 1XUQA 3DC6A 1EN4A 2CE4A 1JA8A 3EVKA 1AVMA 1GN6A 3AK2A 4JYYA 3MDSA 1VEWA 1BSMA 5A9GA 3AK1A 1GN2A 3RN4A 4FFKA 1Y67A 1ZSPA 4JZGA 4F6EA 1EN5A 2ADQB 1B06A 3OT7A 1I0HA 3C3TA 3CEIA 1ZUQA 1KKCA 2QKCA 1P7GA 3K9SA 2CDYA 1GN4A 3C3SA 3KKYA 1GN3A 1WB8A 2QKAA 1PL4A 1VARA 1MSDA 1LUWA 3IC9A 3DC5A 3AK3A 1ZLZA 1MNGA 5AG2A 4JZ2A 1I08A 2RCVA 1EN6A 1WB7A 1JR9A 1N0NA 1AR5A 2ADPA
chains in the Genus database with same CATH superfamily
2WLHA 5KHHA 1EFRG 4TV9A 1W2BU 4PD4F 2PY5A 1IX9A 3CXCU 4X9QA 3T1YB 1ZL8B 2HVJC 1AI7A 3VOUA 2IU3A 3ZMSA 1AI5A 1H2NA 4D7SA 1Z5VA 4MVQA 1NI8A 1XNRB 4LF7B 4XDJA 3A0RA 4H13B 4E4EA 1V55C 5JJEB 1H2GA 2XTAA 3T1CA 3TXSA 4FLZA 2QTOA 2NLJC 5EIBD 1N33O 3CX5F 4LF9B 3LNMB 4UB8Z 1MOFA 1VEWA 5GONB 3JARA 2A7WA 3ABMC 3CCQV 1XMQO 2JGDB 3E22B 4JTCB 4JI1B 2M7WA 4EKWA 1VQLV 1Q90D 3ZMVA 2HLDG 2PYLA 1P7GA 2WA4A 3ETGA 3BEHA 3A8TA 1VF6C 4QE9A 3K59A 1Q8IA 4X1YA 2Q68A 2CH7B 2FL4A 4O4IB 2EINB 4TWKA 4BAYA 5F2VO 3FYIB 1VARA 5CB4A 4N23A 4KL1A 4XBFA 3CD6V 2H8PC 4RUEA 1DK1A 3AG2B 5KX5B 3LDEA 3FB5C 1XEQA 3ZMZA 1QVFU 3CJHA 3J81N 1WA8A 3CS5A 4DW0A 1AROP 2ZNIA 3PJSK 2VQEB 4DV7B 4NXMO 3LSUA 4DV1B 4I55B 3JAWA 3OMAB 2BTOA 4DV2O 4GKKB 4TQDA 3OFNG 1XL4A 5LP6A 4JV5B 5JVDA 4P30A 2YC0A 4I7ZB 1JMKC 2ZIMA 3VQWA 1NKDA 1ZAUA 4JI5B 3ZS8C 1YITV 2PUSA 2ZXWB 4JASA 1NVPB 4NKGB 2UXCO 1CP9A 3QG5A 4DV0B 2A3QA 4LWSB 1RSOA 4PDLA 4DO2A 3MAQA 2YIBD 2BOCC 2AZ0A 5EC2C 1W0JG 4LFAO 2YIAA 3ICXA 3E83A 4JYYA 1Q3EA 1JCHA 5A9GA 2KSDA 3JCUZ 2KG7B 2XUMA 4BW5A 4DRXA 3OR7C 1N34B 3CCJV 4NR1A 2LO1A 2R9IA 3AG7A 4DR5O 1IJGA 5CA0B 3ZCCA 4IHJA 4KHPB 4J10A 2QWOB 2V4DA 1Y74A 1IXMA 1YJ9V 1NTMH 3RYFA 1SQQH 1L0NH 5E79Z 1KKDA 1SERA 1HNZO 3ETEA 5IWAO 3HKDB 1Y76B 1CPYA 1GO3F 1G4YB 4B7KA 1S0VA 3RYIA 4MW3A 5JCOC 4LF5O 2GTSA 4FLVA 2EIMB 2Y0PA 4FZ0A 3OMNB 4WFHA 1WPXA 5AG2A 2FKXA 4K35A 2Y48A 2E5LB 4JYAO 4CH5A 3ASNC 1YJWV 4W4KA 5DN6G 1WB7A 4I50A 5JH7B 2EIJB 1VQ8V 3AEIA 3K0GA 1SQXH 4RWUA 4BIUA 1HR0O 3K5LA 4O2BA 3BAAA 1IXBA 3ABTA 1YJNV 2HG5C 4IYHA 2F93B 3JALA 3OTOO 1ZL8A 2QWNB 2ZQMA 3H1IH 2WSSG 1K3EA 3STLC 1SA0B 4R7CA 2EIJC 4TOIA 1SETA 3FKSG 5L3CA 4J9YB 3E2EA 2B1IA 4B08A 2Q0OC 1E1QG 3ABLC 5LGUA 1K73W 2YEVB 2DYRB 1XUQA 2Q6AA 3K03A 1JQ0A 3OEHG 3DXRB 2AXTZ 3KCYA 2KQXA 4U3FH 1GN6A 3AK2A 4H44B 4FM0A 3SPIA 5KUKA 2Y0IA 3DSQA 3IJ4A 4X8AA 4FK5C 1BQ0A 1WJZA 2EJRA 4DR7O 3SR2C 4PDMA 1HNXB 2ZR2A 4P2ZA 3KDRA 1IBKO 4JI3B 3ZRXA 3C3TA 1AILA 1FFXA 1WP7A 2D3OW 2EIKC 3DGEA 3T1HO 3K5MA 5EYPA 1M57B 4LF4O 3K9SA 4FM2A 4O4IA 1H2MA 3ZHQA 1PPJH 4JAUA 1WB8A 2JGUA 1YSCA 5FPOA 3JAKA 3Q4HB 4CH3A 4YHHB 2BTQB 3RT3C 5KHGA 1HP8A 2X6BA 2H94A 1NZ6A 2N74A 3CCEV 1EN6A 4AQYO 5IJ0A 3EFFK 5H6RA 1JR9A 1AB3A 3CXHF 1SQGA 1JJOA 5LA6B 5EBLC 4EB6B 4LF6O 1NU1H 2P90A 3E89A 1KU9A 1DLBA 5EBWC 4I9WA 1SQPH 1YIJV 1R73A 4D6TH 5B1NA 3SGIA 2BOBC 4UCVA 3B09A 1J95A 2UXDO 3BVOA 2QM4A 1OCOB 1NTZH 4LWSA 3OR6C 1KMIZ 4BIOA 1K7DA 1NT2B 2Q4PA 1D5AA 2CE4A 1IBLO 4JYCA 2XASA 2PGGA 4G28B 1GN2A 4EFBA 4I5SA 3AG4B 4L8JA 1VP7A 1XL6A 4F6EA 3F5TA 4JI0B 2DW4A 2F95B 5IY5B 1EN5A 4LH6A 4UUJC 5LBQA 2XT9A 4B3TB 1FOUA 4O2AA 2ZE7A 1JX9A 4DV3O 2N04A 5B5EZ 3IGAC 3LSQA 1Y76A 3D36A 1QLEC 3UKMA 4Z1VA 3AG4C 3FAVA 1EZVH 4YY3O 3ETQA 4DR6B 1FXKB 3G71V 2QKAA 3B8NA 1WLEA 5IY5C 2JEUA 2QM7A 1WP8A 2JJ1G 1VQ4V 2NR5A 2OCCC 3TCUA 4BIZA 1NR1A 1P49A 3SJAC 4B3MO 2CGOA 1Q7YW 5L3BA 3THOA 2B5UA 2BCCH 2PI5A 5IYDO 2HVKC 4YJ2B 1F51A 5JH7A 3ASOC 4LNUB 4ZBMA 3UO2A 4L87A 1BQZA 2YXYA 1H5WA 1TUBB 1COWG 1Q5OA 2AHYA 2HKOA 2IH1C 1D5NA 3AG3B 1FFTB 1BT8A 2ZE8A 1JFFA 1BL8A 3L71H 1YTFD 3SYOA 3TGUH 1XNQO 3E8BA 1M1KW 2ZD9A 2OYQA 1I94B 3SJQC 1K5QA 5LYJB 4DR3B 1XHZA 5L3FA 4PELA 3DXRA 4CBCA 3S3XA 4IYIA 4X88A 2PTMA 5BR8B 1MG1A 4MW8A 2L35A 4LC1A 4DR4B 2FYUH 3AK1A 5IDJA 3SJCC 3FYEB 4MVUA 4OGQB 3RN4A 4K0KB 4H37A 3CCMV 4F4LA 4EEQA 2AHZA 3I5DA 3OE7G 1DF4A 3RYCB 2C2AA 3OT7A 5C93A 3UT5A 1BMFG 4JI7O 4U3JB 2UUBO 5JJJB 4JI8O 4MT8A 3IAYA 3U11A 5CA1A 4UCUA 4NTYA 4MTFA 1D2DA 4K8XA 3B77A 3ABKC 2P5OA 5LP6C 1B6QA 2YUAA 1SS3A 5E1AC 4DUYO 3E8FA 3ZHTA 2DWEC 3LDDA 4CC5A 5B1BC 4JI4B 1XHXA 1TVKB 3CMEV 1HW7A 1QR8A 2DMXA 4UVAA 4X66O 4TV8B 4UCOA 2Q0AA 4DR2O 4HZ3A 3PN1A 1E79G 2WLMA 3G6BA 4GKJO 2HJFC 4CS2A 3OD4A 4DK1A 1P4RA 3JCZA 4PA6A 4OXSA 5JWPA 4DUZO 1N32O 5C8YA 1XMQB 1MZEA 1FPOA 3NR7A 1Q82W 1GK9A 2P67A 1PM9A 2HHHO 1LUVA 4AI8A 1AP5A 1V55B 1EN4A 5D5PA 5KMGA 1K92A 3FD9A 2UXBB 2ARHA 3JD3A 3N2GA 4LBEC 1YZBA 5ITZA 2KB1A 3H1HH 5KUMA 2A06H 1ZSPA 1XMOO 2EULA 3ABMB 3VBBA 5IT9N 1K8AW 3QTCA 3K0DA 1S5HC 2QSAA 3CRMA 5D5QA 4X65O 5J2UB 4U7OA 1VF7A 4NXMB 2F4VO 3C3SA 5LXTB 4DV2B 2LW1A 1FS0G 3L70H 5BMVB 2Q7GA 1IBMO 1S5JA 4FLTA 3IC9A 4A5UB 4JI2O 2GSMB 4WBNB 2UXCB 4W4LA 4LNUA 1N0NA 3N27A 4PI0A 2R9RB 1R3JC 1BHBA 4GX0A 1KQSU 3G6EV 1M9NA 4TSFG 5L3DA 3N2KA 4LFAB 5CBGA 1L8DA 3BRCA 1QCEA 4H33A 4ZOLB 4HAMA 3T1YO 1SF9A 1P7BA 3ZN1A 1Q6IA 1GM9A 3I55V 2E76B 2ZM6O 3FFQA 3K3WA 4DR5B 1XDCA 4P9PA 1TGOA 1VQOV 1IURA 3H1KH 3HKBB 1YI2V 1VQPV 4JF3A 3DC6A 3HKEA 3L73H 3W7WA 4FZ1A 3UM7A 1UFIA 3BA8A 4DV6O 1R6TA 4XDLA 3EXAA 4UCSA 5IWAB 4LF9O 3TXQA 2W0FC 5EZYB 5LHHA 2Z0AA 3NXSA 3J7AU 4LF5B 4DW1A 3K79A 3RYCA 3DTUB 1EZJA 4JYAB 4FLYA 1I0HA 2RQ6A 1PV0A 5FNVA 2QKCA 3R66A 4AILC 4FJCC 2CDYA 1HR0B 4DV5O 1SQFA 2Q7HA 4KUMA 1K33A 2HFEC 4MVRA 1LUWA 2WPDG 1ZLZA 1TAEA 4O4JA 4ZHQA 1PP9H 3K58A 5KHKA 2CTRA 4HNAB 3ASNB 4TV8A 1SKVA 4RQEA 4JAAA 3O9OA 1NJIW 5DECA 4WCEV 3K5OA 2QR4A 3C90A 4DV7O 2Q67A 2QWPB 1ZTEA 2ITDC 2VQFB 2P4KA 2FMLA 4FFBB 3ML0A 3OUFA 4YXWG 1FD9A 4JV5O 2L6LA 3T2MA 3HKCB 4X1KA 1FYJA 2QWRB 3CCRV 1IBKB 3CCUV 1J5EO 5B1AC 2BSKB 1T5EA 3FB6C 3ABLB 4J41A 3JD4A 4YJ3B 3T1HB 1JA8A 4LF4B 2X7RB 4NVPA 5B1OA 1Q6HA 3E8GA 4U7NA 4LFBB 3U10A 3VQYA 2F1MA 3K08A 1W59A 4ABMA 2JJ2G 2MW2B 4KP4A 4J7JA 4ZIBA 2YIBA 1Q43A 4B7EA 2RDCA 1G8MA 4PHZA 1GKFA 1QVGU 4AQYB 5FL7G 1JJ2U 1ZUQA 5J2UA 1N4CA 4LFCO 4OX9O 4X20B 3MHSC 2Q8VA 1VQ6V 3R65A 4X1IB 3STZC 2EIKB 3ZHUA 4DXWA 5LMNO 5GONA 1M90W 2Q5ZA 2DOSA 4LF6B 1VF6A 4NXNO 3UO3A 3K9AA 4F6RB 5JQGB 2JGDA 2UUCB 4ICGA 3E22A 3JSNA 2VWJA 1F23A 3UQ8A 1FXVA 4EFEA 2X6CA 1KD1W 2DYSB 2YDEA 1OCZC 1H8EG 2K9PA 2DE0X 5FLXN 3QO5A 4WBNA 2E5LO 4LF8O 2UXDB 4B3SO 4N21A 1BGYH 2CH7A 1AR5A 2ODMA 3ETDA 5LHGA 1JNBA 2ADPA 5IYZB 1N36O 4WF9V 1NBMG 1V54C 1I5XA 2JDIG 1P84F 1KYOF 2ZCEA 4X62B 2DYSC 3ZHVA 2K1EA 2LP7A 1AJQA 3ZJZA 3SDLA 2GDSA 5KX5A 4IIJB 4ZOLA 2JK5C 4HYOA 2Q7EA 2WWWA 3WB2A 1XREA 2X0LA 5B3SC 3CHXA 2CAZC 1VQ9V 1PD3A 4UCRA 1M5IA 1SZXA 4I55A 3FB7C 3HKBA 4JYBA 1SQBH 2WLJA 4X89A 2QM8A 1OCCC 4TUYB 3BCCH 3CPWU 2Y69B 3EVKA 1I7FA 3JATB 4JTAB 1YTFB 4YY3B 2QEXV 3JASB 2IJIA 4UXNA 4FFKA 2QWQB 4Q6GA 1XBLA 1XQ8A 4B3MB 2XAGA 1HNXO 2Y69C 4O4HB 2ZKOA 4J7KA 2XHBA 3JD2A 4Z2WA 2YICA 1GM8A 1BZKA 2WLLB 1OJHA 1FJGO 2KG7A 3BABA 5H2FZ 2G38A 1Y66A 4ASUG 1QLEB 5CA0A 2VWKA 2HJDA 3MD0A 3W7TA 5K1PA 4TV9B 5JCOA 2OCCB 2LW7A 2E3CA 1GMGA 4O4LB 4DYLA 4TQFA 5HFMA 4GLXA 1K4DC 3K06A 4HNAA 3CCLV 4GX5A 5EK0A 5KA5A 5KAIZ 2Z3YA 3CCVV 3CRRA 3HKDA 2CTWA 1S5LZ 3VQXA 2R9AA 1SESA 1U96A 3ASOB 2XNDG 1G6UA 2ZDIA 4R8CA 1YF2A 3RGBA 2JS3A 4ZI7B 2P6JA 5EBMC 3LNNA 4PA9A 1PNMA 1EM1A 1MA1A 3WU2Z 3TETA 4GT1A 3JARB 4MTGA 3CC4V 3T4ZA 1H2SB 3CWBH 3ZHSA 4GUNA 4PA4A 2BSKA 2OWOA 2ZIOA 3QO8A 3AG1B 4JI7B 2V7QG 3QNEA 2UUBB 4QIWF 1SA0A 3SPJA 1K9MW 2B1GA 3WB1A 4ZKIA 1F4MA 1S76D 1PL0A 4UV8A 3L72H 3S3WA 2YEVA 3OAAG 3AG1C 4DR1O 3BY6A 5CB4B 4DUYB 1N8RW 1B06A 3F7YC 3FX7A 1Y6XA 1M4UA 4GZRB 2A0LA 4DV4O 4B3TO 5LOVB 2OCHA 4X66B 2CTQA 3APOA 1URFA 4DR2B 2Q9LA 1WA8B 3ZHRA 4UVBA 5LHIA 1RM1B 1X59A 1PL4A 3JAWB 2OT5A 4GKJB 4B3RO 1US6A 1H2KA 1QR9A 5LMUO 4UB6Z 1GRJA 3ABKB 1VQ5V 2R72A 5LP6B 2UUAO 5JVDB 1N32B 2W6JG 2P06A 5IYZA 2HHHB 1JVMA 2OIEA 5B1BB 1RM1C 2DJVA 2XAHA 1R6NA 2VRZA 4K8ZA 1B3QA 3Q4HA 2BTQA 2OIGA 3OEEG 4BWAA 5A2QN 1RSOB 2RNBA 4IIJA 3ZX6A 2AZ2A 1VQ7V 4RAIA 1FAFA 5BY1A 5GTIZ 1Q86W 3ZRVA 4J80A 5LA6A 4EB6A 3CE2A 1N0JA 1SZTA 1GAXA 1XMOB 4DRXB 1IDSA 1R3IC 1WNSA 4J11A 3F5WC 3SPGA 2MK3A 4IHJB 4C7UA 4I4TB 1N33B 3RFRA 3OGIB 1Y74B 4DR3O 4X65B 3WG7B 4JPRA 3SPCA 2YS8A 3A2FA 3JATA 3RYFB 4PI2A 4MSWC 2NN4A 2QE7G 3P3NA 4DR4O 2YSUB 1MABG 2B9ZA 1IBMB 3CC7V 4MVMA 2D2CB 3OMIB 3RYIB 4JI2B 3WG7C 2W0XA 3IC7A 3HR0A 3EHBB 1O9GA 4K3AA 1GN4A 3JSLA 4OPHA 4DK0A 4R50A 3W7UA 3JAMN 4WFGA 4O2BB 1HNWO 2P7TC 3H1LH 4IL6Z 3UCSC 4I0XB 3JALB 4O4LA 1IZ3A 1RFYA 3D3IA 3CB2A 2ZM6B 1R6KA 4NB5A 4JI6O 3W7SA 4JI4O 4CH4A 1OZ0A 3ZRWB 3U0ZA 2UU9O 2YIDA 1FXKA 4KFMA 5FPRA 3ZMUA 2LFRA 3BFRA 4X64O 3OW2U 3K04A 4MVZA 1L0LH 4ZI7A 1VIBA 1AP6A 4DV6B 3OGCC 2A9HA 3P30A 4RUFA 5EC1C 4BR6A 2HR3A 2GBOA 3SYCA 4YJ2A 2PI4A 2AW9A 2OTJV 4GCZA 4PA3A 3GB7C 2PF4E 3D8CA 1AJPA 5CBHA 5KHIA 2IBZH 1K5SA 1SQVH 3LUTB 2WLIB 3P32A 5LGTA 4FIPC 1KC8W 1YCIA 1TUBA 2Y4UA 3GWKC 4G27B 1S72V 1FFXB 3X2QB 1ORQC 2ETNA 5H9CA 3RYHB 2UXBO 5EYPB 2LGQA 3B40A 4DV5B 2IM9A 3L75H 3QF7A 2BE3A 3JD1A 4CS4A 4RO2A 3SPHA 2QGNA 1Q81W 2WLNA 3OUSA 4MVSA 1XNRO 4LF7O 1NTKH 4QPJA 1KUQA 3JAKB 5GTHZ 2R70A 5LYJA 1DTOA 2RMKB 4QPKA 3L74H 3M7MX 2CTPA 3X2QC 2F23A 4GYCB 2ZINA 3CMAV 5LOVA 4NTXA 1KKCA 3ZMTA 1HNZB 4KXRA 5IJ0B 3K5NA 5CA3A 2EINC 4E2LA 5KHJA 1GN3A 1VQKV 3ZN0A 1DF5A 2CK3G 2EZPA 3AG2C 5LGNA 1SRYA 1F4NA 3M99B 5CMUA 4JI1O 2EBOA 2JRIA 3HB3B 3G4SV 1ROPA 4U3JA 4JZ2A 1I08A 2YXHA 2IU0A 3ZBHA 1CEZA 2F66C 3ZEDA 5KLVH 5JJNB 1Q6UA 1J5EB 2XOKG 2ITCC 1GM7A 1QU7A 3OM3B 1ZWIC 5J2TB 3OTOB 2V1DA 1VQMV 4AHCA 5K1XA 3JYCA 2ZXWC 4CZZA 3G80A 3T4DA 1TVKA 1O9HA 1QNMA 1RPRA 1KP3A 2F43G 4IGGA 2VQEO 3RVZA 1AI6A 1X4TA 4I4TA 4DV1O 2DN9A 2UXNA 2GUZB 4GKKO 1KECA 2QA4V 1OHHG 5B1AB 4LFCB 4OX9B 3M8AA 4O2AB 4HBNA 5LMNB 3F7VC 4NXNB 4UVCA 3O65A 1RP3B 5TISZ 3FAVB 4JI5O 4DR7B 4WFEA 5DEDA 3CCSV 3A0BZ 5L3GA 1F7YA 2NNUA 2QJ1A 4DV0O 3LSSA 1SC5B 5BZBA 4Q20A 4FVMA 3CEIA 1RPOA 2DQ0A 2CGNA 4LF8B 1THZA 1WAZA 4WFFA 4B3SB 3D36C 3OTFA 4MS2A 2X6AA 4LH7A 1N36B 4PA7A 3MHHC 2P4VA 2LFSA 2ZDIC 1Z2GA 2EILB 2GHYA 2EIMC 3E35A 2Z5UA 3APQA 3L9DA 2Q73A 5B66Z 5HFLA 1N34O 4I0XA 3CP1A 5H5NA 3RWRD 1MSWD 4KHPO 2FTKA 1NS1A 3KG2A 2RN9A 1OCZB 1NR7A 1JFFB 3H01A 1OCRB 4R6ZA 3ZRWA 1NVPD 5LXTA 2EILC 4CC6A 1KBHA 4IT5A 5BMVA 2HEPA 2EZOA 2VS0A 2P22C 2VQFO 1V54B 2WA3A 3CSXA 1AJNA 1GTOA 2PZSA 1MZFA 5J9PC 3TJTA 4LP8A 2ATKC 2EX3A 1OCRC 1K34A 1V9PA 4Z1MG 5IYBO 3RVYA 4WFBV 2DQ3A 3BA9A 5IYCO 2OTLV 1BS3A 2H3OA 2GTAA 5DM6V 1XILA 1AR4A 1Y4MA 2DYRC 5B3SB 1S77D 2WLIA 1MMMA 2IJKA 1IBLB 2JEXA 2UXXA 2GV9A 4G2KA 4PDRA 3CRAA 3KCXA 3UT5B 3RYHA 1OCCB 2IW5A 4LCUC 1FJGB 5CBFA 1BE3H 1AVMA 2W6IG 4UV9A 3MDSA 5CA1B 2N05A 5IJ9B 4LFBO 4PJ0Z 3B8MA 4RQFA 1BHAA 4JGSA 1S3JA 1LR1A 2M6YA 3E86A 3P3PA 4JZGA 3SJBC 4P9OA 5H6QA 2IJHA 1I5YA 3A0HZ 1M57C 2Y4TA 3IFXA 3I56V 4DV3B 1B04A 5KA6A 1YHQV 2FB5A 5LL6Y 1BCCH 5EZYA 1TA8A 2XAJA 3GWOA 4UFZA 2UUCO 2CUGA 1UPGA 1WPBA 1H2LA 2IH3C 4JTDB 1MNGA 4FPPA 4JI3O 1FXHA 3W7XA 1CXZB 2DWDC 3WFVA 3BHPA 5C8YB 1PNLA 4J7ZA 5J2TA 3QVNA 4YHHO 5CN0A 4X62O 1L1FA 3VQVA 3SYPA 4FM1A 3K57A 1JOYA 5KMGB 1LNQA 4YIOA 2LJ2A 3N2GB 1OCOC 1XNQB 5ITZB 3B2EE 4MVOA 4XDKA 4DR1B 2O57A 3ZRSA 5L3EA 2YI9A 2GUZA 4CH6A 3QO7A 4DV4B 4FFBA 1NH2B 2JS5A 2ZT9B 1NQTA 1GH6A 2YXLA 3H1JH 4J42A 1VQNV 2XAFA 4GX2A 4PDVA 4CS3A 2XAQA 3HKCA 4UCTA 2HP8A 1YDXA 4JAVA 2KKWA 4J9ZB 1K97A 3HPLC 1M93A 4B3RB 5IE9A 5LMUB 3ZIAG 1Y67A 3WB0A 5BXZA 1ENVA 3KZIZ 2ADQB 3E8HA 1KB9F 1XOUA 4YJ3A 2UUAB 4JI8B 1IVSA 4MTXA 3SYAA 4PV1B 4FLWA 4MTOA 1EBOA 1FXKC 1R3KC 1UJWB 4X1YB 2QDOA 1QLNA 2A79B 4I9QA 1MSDA 3DC5A 1QBZA 3AK3A 4JI0O 3N2KB 3GVMA 5KAFZ 1H8HG 4X20A 2RCVA 4X1IA 4QNHB 3TK1A 3CJHB 2YI8A 1PNKA 4F6RA 5JQGA 2JIZG 1HWYA 2RJZA 1QQCA 1ZX3A 3CRQA 4DR6O 2WAMA 3AG3C 4QE7A 1JPXA 3HKEB 2E75B 3CYOA 4QGPA 2ILMA 1A32A 1VMGA 4YIPA 4DUZB 4GX1A 3CRCA 4LR3A 1M56B 2JVDA 2LGWA 5GW7A 3BPZA 1TUEB 4QJFB 1YVWA 1H38A 4FMTA 2LQTA 1FKAO 3ABUA 3RBZA 1PKXA 4NYKA 2E74B 1NH2D 3FB8C 1AI4A 2Q69A 1M56C 1G1XB 2ZNJA 5FNVB 5IJ9A 2ZE6A 1BSMA 3JD0A 4NTWA 1YXBA 4D7TA 1HNWB 1QHTA 2PYJA 2QKSA 1VF5B 4FLUA 5EIBC 4BW9A 4TUYA 1I94O 1WN7A 4O4JB 4OPAA 4JI6B 4ZHQB 1AR1B 1K4CC 2F4VB 1U97A 5BR8O 2UU9B 3JASA 4H0LB 3KKYA 3B4SA 4X64B 4WFAV 3LDCA 1W0KG 4FLXA 2QTSA 2EJ7A 1E1RG 3J80N 3H9VA 1DGSA 1KP2A 1XI1A 2ZE5A 1R3LC 4K0KO 4O4HA 3SYQA 1YEWA 2ZR3A 2WLKA 4TT3G 1Z5WA 3RW0A 3D3QA 2WLLA 2IJJA 1HDJA 3CC2V 3G67A 1OV9A 4I50B 2AGAA 1R1BA 4X1KB
chains in the Genus database with same CATH topology
3LSUA 1ZTEA 3BFRA 3QVNA 1IXBA 2P4KA 2GDSA 1AP6A 1IX9A 4X9QA 3TJTA 1D5NA 1BT8A 4YIPA 4BR6A 4YIOA 1EM1A 2AW9A 1XREA 1MA1A 1QNMA 1BS3A 1N0JA 1XDCA 1SZXA 1XILA 1AR4A 1PM9A 4E4EA 1IDSA 1LUVA 4GUNA 1MMMA 1AP5A 4C7UA 1XUQA 3DC6A 1EN4A 2CE4A 1JA8A 3EVKA 1AVMA 1GN6A 3AK2A 4JYYA 3MDSA 1VEWA 1BSMA 5A9GA 3AK1A 1GN2A 3RN4A 4FFKA 1Y67A 1ZSPA 4JZGA 4F6EA 1EN5A 3KDRA 2ADQB 1B06A 3OT7A 1I0HA 3C3TA 3CEIA 1ZUQA 1KKCA 2QKCA 1P7GA 3K9SA 2CDYA 1GN4A 3C3SA 3KKYA 1GN3A 1WB8A 2QKAA 1PL4A 1VARA 1MSDA 1LUWA 3IC9A 3DC5A 3AK3A 1ZLZA 1MNGA 5AG2A 4JZ2A 1I08A 2RCVA 1EN6A 1WB7A 1JR9A 1N0NA 1AR5A 2ADPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSU A;  1ZTE A;  3BFR A;  3QVN A;  1IXB A;  2P4K A;  2GDS A;  1AP6 A;  1IX9 A;  4X9Q A;  3TJT A;  1D5N A;  1BT8 A;  4YIP A;  4BR6 A;  4YIO A;  1EM1 A;  2AW9 A;  1XRE A;  1MA1 A;  1QNM A;  1BS3 A;  1N0J A;  1XDC A;  1SZX A;  1XIL A;  1AR4 A;  1PM9 A;  4E4E A;  1IDS A;  1LUV A;  4GUN A;  1MMM A;  1AP5 A;  4C7U A;  1XUQ A;  3DC6 A;  1EN4 A;  2CE4 A;  1JA8 A;  3EVK A;  1AVM A;  1GN6 A;  3AK2 A;  4JYY A;  3MDS A;  1VEW A;  1BSM A;  5A9G A;  3AK1 A;  1GN2 A;  3RN4 A;  4FFK A;  1Y67 A;  1ZSP A;  4JZG A;  4F6E A;  1EN5 A;  2ADQ B;  1B06 A;  3OT7 A;  1I0H A;  3C3T A;  3CEI A;  1ZUQ A;  1KKC A;  2QKC A;  1P7G A;  3K9S A;  2CDY A;  1GN4 A;  3C3S A;  3KKY A;  1GN3 A;  1WB8 A;  2QKA A;  1PL4 A;  1VAR A;  1MSD A;  1LUW A;  3IC9 A;  3DC5 A;  3AK3 A;  1ZLZ A;  1MNG A;  5AG2 A;  4JZ2 A;  1I08 A;  2RCV A;  1EN6 A;  1WB7 A;  1JR9 A;  1N0N A;  1AR5 A;  2ADP A; 
#chains in the Genus database with same CATH topology
 2WLH A;  5KHH A;  1EFR G;  4TV9 A;  1W2B U;  4PD4 F;  2PY5 A;  1IX9 A;  3CXC U;  4X9Q A;  3T1Y B;  1ZL8 B;  2HVJ C;  1AI7 A;  3VOU A;  2IU3 A;  3ZMS A;  1AI5 A;  1H2N A;  4D7S A;  1Z5V A;  4MVQ A;  1NI8 A;  1XNR B;  4LF7 B;  4XDJ A;  3A0R A;  4H13 B;  4E4E A;  1V55 C;  5JJE B;  1H2G A;  2XTA A;  3T1C A;  3TXS A;  4FLZ A;  2QTO A;  2NLJ C;  5EIB D;  1N33 O;  3CX5 F;  4LF9 B;  3LNM B;  4UB8 Z;  1MOF A;  1VEW A;  5GON B;  3JAR A;  2A7W A;  3ABM C;  3CCQ V;  1XMQ O;  2JGD B;  3E22 B;  4JTC B;  4JI1 B;  2M7W A;  4EKW A;  1VQL V;  1Q90 D;  3ZMV A;  2HLD G;  2PYL A;  1P7G A;  2WA4 A;  3ETG A;  3BEH A;  3A8T A;  1VF6 C;  4QE9 A;  3K59 A;  1Q8I A;  4X1Y A;  2Q68 A;  2CH7 B;  2FL4 A;  4O4I B;  2EIN B;  4TWK A;  4BAY A;  5F2V O;  3FYI B;  1VAR A;  5CB4 A;  4N23 A;  4KL1 A;  4XBF A;  3CD6 V;  2H8P C;  4RUE A;  1DK1 A;  3AG2 B;  5KX5 B;  3LDE A;  3FB5 C;  1XEQ A;  3ZMZ A;  1QVF U;  3CJH A;  3J81 N;  1WA8 A;  3CS5 A;  4DW0 A;  1ARO P;  2ZNI A;  3PJS K;  2VQE B;  4DV7 B;  4NXM O;  3LSU A;  4DV1 B;  4I55 B;  3JAW A;  3OMA B;  2BTO A;  4DV2 O;  4GKK B;  4TQD A;  3OFN G;  1XL4 A;  5LP6 A;  4JV5 B;  5JVD A;  4P30 A;  2YC0 A;  4I7Z B;  1JMK C;  2ZIM A;  3VQW A;  1NKD A;  1ZAU A;  4JI5 B;  3ZS8 C;  1YIT V;  2PUS A;  2ZXW B;  4JAS A;  1NVP B;  4NKG B;  2UXC O;  1CP9 A;  3QG5 A;  4DV0 B;  2A3Q A;  4LWS B;  1RSO A;  4PDL A;  4DO2 A;  3MAQ A;  2YIB D;  2BOC C;  2AZ0 A;  5EC2 C;  1W0J G;  4LFA O;  2YIA A;  3ICX A;  3E83 A;  4JYY A;  1Q3E A;  1JCH A;  5A9G A;  2KSD A;  3JCU Z;  2KG7 B;  2XUM A;  4BW5 A;  4DRX A;  3OR7 C;  1N34 B;  3CCJ V;  4NR1 A;  2LO1 A;  2R9I A;  3AG7 A;  4DR5 O;  1IJG A;  5CA0 B;  3ZCC A;  4IHJ A;  4KHP B;  4J10 A;  2QWO B;  2V4D A;  1Y74 A;  1IXM A;  1YJ9 V;  1NTM H;  3RYF A;  1SQQ H;  1L0N H;  5E79 Z;  1KKD A;  1SER A;  1HNZ O;  3ETE A;  5IWA O;  3HKD B;  1Y76 B;  1CPY A;  1GO3 F;  1G4Y B;  4B7K A;  1S0V A;  3RYI A;  4MW3 A;  5JCO C;  4LF5 O;  2GTS A;  4FLV A;  2EIM B;  2Y0P A;  4FZ0 A;  3OMN B;  4WFH A;  1WPX A;  5AG2 A;  2FKX A;  4K35 A;  2Y48 A;  2E5L B;  4JYA O;  4CH5 A;  3ASN C;  1YJW V;  4W4K A;  5DN6 G;  1WB7 A;  4I50 A;  5JH7 B;  2EIJ B;  1VQ8 V;  3AEI A;  3K0G A;  1SQX H;  4RWU A;  4BIU A;  1HR0 O;  3K5L A;  4O2B A;  3BAA A;  1IXB A;  3ABT A;  1YJN V;  2HG5 C;  4IYH A;  2F93 B;  3JAL A;  3OTO O;  1ZL8 A;  2QWN B;  2ZQM A;  3H1I H;  2WSS G;  1K3E A;  3STL C;  1SA0 B;  4R7C A;  2EIJ C;  4TOI A;  1SET A;  3FKS G;  5L3C A;  4J9Y B;  3E2E A;  2B1I A;  4B08 A;  2Q0O C;  1E1Q G;  3ABL C;  5LGU A;  1K73 W;  2YEV B;  2DYR B;  1XUQ A;  2Q6A A;  3K03 A;  1JQ0 A;  3OEH G;  3DXR B;  2AXT Z;  3KCY A;  2KQX A;  4U3F H;  1GN6 A;  3AK2 A;  4H44 B;  4FM0 A;  3SPI A;  5KUK A;  2Y0I A;  3DSQ A;  3IJ4 A;  4X8A A;  4FK5 C;  1BQ0 A;  1WJZ A;  2EJR A;  4DR7 O;  3SR2 C;  4PDM A;  1HNX B;  2ZR2 A;  4P2Z A;  3KDR A;  1IBK O;  4JI3 B;  3ZRX A;  3C3T A;  1AIL A;  1FFX A;  1WP7 A;  2D3O W;  2EIK C;  3DGE A;  3T1H O;  3K5M A;  5EYP A;  1M57 B;  4LF4 O;  3K9S A;  4FM2 A;  4O4I A;  1H2M A;  3ZHQ A;  1PPJ H;  4JAU A;  1WB8 A;  2JGU A;  1YSC A;  5FPO A;  3JAK A;  3Q4H B;  4CH3 A;  4YHH B;  2BTQ B;  3RT3 C;  5KHG A;  1HP8 A;  2X6B A;  2H94 A;  1NZ6 A;  2N74 A;  3CCE V;  1EN6 A;  4AQY O;  5IJ0 A;  3EFF K;  5H6R A;  1JR9 A;  1AB3 A;  3CXH F;  1SQG A;  1JJO A;  5LA6 B;  5EBL C;  4EB6 B;  4LF6 O;  1NU1 H;  2P90 A;  3E89 A;  1KU9 A;  1DLB A;  5EBW C;  4I9W A;  1SQP H;  1YIJ V;  1R73 A;  4D6T H;  5B1N A;  3SGI A;  2BOB C;  4UCV A;  3B09 A;  1J95 A;  2UXD O;  3BVO A;  2QM4 A;  1OCO B;  1NTZ H;  4LWS A;  3OR6 C;  1KMI Z;  4BIO A;  1K7D A;  1NT2 B;  2Q4P A;  1D5A A;  2CE4 A;  1IBL O;  4JYC A;  2XAS A;  2PGG A;  4G28 B;  1GN2 A;  4EFB A;  4I5S A;  3AG4 B;  4L8J A;  1VP7 A;  1XL6 A;  4F6E A;  3F5T A;  4JI0 B;  2DW4 A;  2F95 B;  5IY5 B;  1EN5 A;  4LH6 A;  4UUJ C;  5LBQ A;  2XT9 A;  4B3T B;  1FOU A;  4O2A A;  2ZE7 A;  1JX9 A;  4DV3 O;  2N04 A;  5B5E Z;  3IGA C;  3LSQ A;  1Y76 A;  3D36 A;  1QLE C;  3UKM A;  4Z1V A;  3AG4 C;  3FAV A;  1EZV H;  4YY3 O;  3ETQ A;  4DR6 B;  1FXK B;  3G71 V;  2QKA A;  3B8N A;  1WLE A;  5IY5 C;  2JEU A;  2QM7 A;  1WP8 A;  2JJ1 G;  1VQ4 V;  2NR5 A;  2OCC C;  3TCU A;  4BIZ A;  1NR1 A;  1P49 A;  3SJA C;  4B3M O;  2CGO A;  1Q7Y W;  5L3B A;  3THO A;  2B5U A;  2BCC H;  2PI5 A;  5IYD O;  2HVK C;  4YJ2 B;  1F51 A;  5JH7 A;  3ASO C;  4LNU B;  4ZBM A;  3UO2 A;  4L87 A;  1BQZ A;  2YXY A;  1H5W A;  1TUB B;  1COW G;  1Q5O A;  2AHY A;  2HKO A;  2IH1 C;  1D5N A;  3AG3 B;  1FFT B;  1BT8 A;  2ZE8 A;  1JFF A;  1BL8 A;  3L71 H;  1YTF D;  3SYO A;  3TGU H;  1XNQ O;  3E8B A;  1M1K W;  2ZD9 A;  2OYQ A;  1I94 B;  3SJQ C;  1K5Q A;  5LYJ B;  4DR3 B;  1XHZ A;  5L3F A;  4PEL A;  3DXR A;  4CBC A;  3S3X A;  4IYI A;  4X88 A;  2PTM A;  5BR8 B;  1MG1 A;  4MW8 A;  2L35 A;  4LC1 A;  4DR4 B;  2FYU H;  3AK1 A;  5IDJ A;  3SJC C;  3FYE B;  4MVU A;  4OGQ B;  3RN4 A;  4K0K B;  4H37 A;  3CCM V;  4F4L A;  4EEQ A;  2AHZ A;  3I5D A;  3OE7 G;  1DF4 A;  3RYC B;  2C2A A;  3OT7 A;  5C93 A;  3UT5 A;  1BMF G;  4JI7 O;  4U3J B;  2UUB O;  5JJJ B;  4JI8 O;  4MT8 A;  3IAY A;  3U11 A;  5CA1 A;  4UCU A;  4NTY A;  4MTF A;  1D2D A;  4K8X A;  3B77 A;  3ABK C;  2P5O A;  5LP6 C;  1B6Q A;  2YUA A;  1SS3 A;  5E1A C;  4DUY O;  3E8F A;  3ZHT A;  2DWE C;  3LDD A;  4CC5 A;  5B1B C;  4JI4 B;  1XHX A;  1TVK B;  3CME V;  1HW7 A;  1QR8 A;  2DMX A;  4UVA A;  4X66 O;  4TV8 B;  4UCO A;  2Q0A A;  4DR2 O;  4HZ3 A;  3PN1 A;  1E79 G;  2WLM A;  3G6B A;  4GKJ O;  2HJF C;  4CS2 A;  3OD4 A;  4DK1 A;  1P4R A;  3JCZ A;  4PA6 A;  4OXS A;  5JWP A;  4DUZ O;  1N32 O;  5C8Y A;  1XMQ B;  1MZE A;  1FPO A;  3NR7 A;  1Q82 W;  1GK9 A;  2P67 A;  1PM9 A;  2HHH O;  1LUV A;  4AI8 A;  1AP5 A;  1V55 B;  1EN4 A;  5D5P A;  5KMG A;  1K92 A;  3FD9 A;  2UXB B;  2ARH A;  3JD3 A;  3N2G A;  4LBE C;  1YZB A;  5ITZ A;  2KB1 A;  3H1H H;  5KUM A;  2A06 H;  1ZSP A;  1XMO O;  2EUL A;  3ABM B;  3VBB A;  5IT9 N;  1K8A W;  3QTC A;  3K0D A;  1S5H C;  2QSA A;  3CRM A;  5D5Q A;  4X65 O;  5J2U B;  4U7O A;  1VF7 A;  4NXM B;  2F4V O;  3C3S A;  5LXT B;  4DV2 B;  2LW1 A;  1FS0 G;  3L70 H;  5BMV B;  2Q7G A;  1IBM O;  1S5J A;  4FLT A;  3IC9 A;  4A5U B;  4JI2 O;  2GSM B;  4WBN B;  2UXC B;  4W4L A;  4LNU A;  1N0N A;  3N27 A;  4PI0 A;  2R9R B;  1R3J C;  1BHB A;  4GX0 A;  1KQS U;  3G6E V;  1M9N A;  4TSF G;  5L3D A;  3N2K A;  4LFA B;  5CBG A;  1L8D A;  3BRC A;  1QCE A;  4H33 A;  4ZOL B;  4HAM A;  3T1Y O;  1SF9 A;  1P7B A;  3ZN1 A;  1Q6I A;  1GM9 A;  3I55 V;  2E76 B;  2ZM6 O;  3FFQ A;  3K3W A;  4DR5 B;  1XDC A;  4P9P A;  1TGO A;  1VQO V;  1IUR A;  3H1K H;  3HKB B;  1YI2 V;  1VQP V;  4JF3 A;  3DC6 A;  3HKE A;  3L73 H;  3W7W A;  4FZ1 A;  3UM7 A;  1UFI A;  3BA8 A;  4DV6 O;  1R6T A;  4XDL A;  3EXA A;  4UCS A;  5IWA B;  4LF9 O;  3TXQ A;  2W0F C;  5EZY B;  5LHH A;  2Z0A A;  3NXS A;  3J7A U;  4LF5 B;  4DW1 A;  3K79 A;  3RYC A;  3DTU B;  1EZJ A;  4JYA B;  4FLY A;  1I0H A;  2RQ6 A;  1PV0 A;  5FNV A;  2QKC A;  3R66 A;  4AIL C;  4FJC C;  2CDY A;  1HR0 B;  4DV5 O;  1SQF A;  2Q7H A;  4KUM A;  1K33 A;  2HFE C;  4MVR A;  1LUW A;  2WPD G;  1ZLZ A;  1TAE A;  4O4J A;  4ZHQ A;  1PP9 H;  3K58 A;  5KHK A;  2CTR A;  4HNA B;  3ASN B;  4TV8 A;  1SKV A;  4RQE A;  4JAA A;  3O9O A;  1NJI W;  5DEC A;  4WCE V;  3K5O A;  2QR4 A;  3C90 A;  4DV7 O;  2Q67 A;  2QWP B;  1ZTE A;  2ITD C;  2VQF B;  2P4K A;  2FML A;  4FFB B;  3ML0 A;  3OUF A;  4YXW G;  1FD9 A;  4JV5 O;  2L6L A;  3T2M A;  3HKC B;  4X1K A;  1FYJ A;  2QWR B;  3CCR V;  1IBK B;  3CCU V;  1J5E O;  5B1A C;  2BSK B;  1T5E A;  3FB6 C;  3ABL B;  4J41 A;  3JD4 A;  4YJ3 B;  3T1H B;  1JA8 A;  4LF4 B;  2X7R B;  4NVP A;  5B1O A;  1Q6H A;  3E8G A;  4U7N A;  4LFB B;  3U10 A;  3VQY A;  2F1M A;  3K08 A;  1W59 A;  4ABM A;  2JJ2 G;  2MW2 B;  4KP4 A;  4J7J A;  4ZIB A;  2YIB A;  1Q43 A;  4B7E A;  2RDC A;  1G8M A;  4PHZ A;  1GKF A;  1QVG U;  4AQY B;  5FL7 G;  1JJ2 U;  1ZUQ A;  5J2U A;  1N4C A;  4LFC O;  4OX9 O;  4X20 B;  3MHS C;  2Q8V A;  1VQ6 V;  3R65 A;  4X1I B;  3STZ C;  2EIK B;  3ZHU A;  4DXW A;  5LMN O;  5GON A;  1M90 W;  2Q5Z A;  2DOS A;  4LF6 B;  1VF6 A;  4NXN O;  3UO3 A;  3K9A A;  4F6R B;  5JQG B;  2JGD A;  2UUC B;  4ICG A;  3E22 A;  3JSN A;  2VWJ A;  1F23 A;  3UQ8 A;  1FXV A;  4EFE A;  2X6C A;  1KD1 W;  2DYS B;  2YDE A;  1OCZ C;  1H8E G;  2K9P A;  2DE0 X;  5FLX N;  3QO5 A;  4WBN A;  2E5L O;  4LF8 O;  2UXD B;  4B3S O;  4N21 A;  1BGY H;  2CH7 A;  1AR5 A;  2ODM A;  3ETD A;  5LHG A;  1JNB A;  2ADP A;  5IYZ B;  1N36 O;  4WF9 V;  1NBM G;  1V54 C;  1I5X A;  2JDI G;  1P84 F;  1KYO F;  2ZCE A;  4X62 B;  2DYS C;  3ZHV A;  2K1E A;  2LP7 A;  1AJQ A;  3ZJZ A;  3SDL A;  2GDS A;  5KX5 A;  4IIJ B;  4ZOL A;  2JK5 C;  4HYO A;  2Q7E A;  2WWW A;  3WB2 A;  1XRE A;  2X0L A;  5B3S C;  3CHX A;  2CAZ C;  1VQ9 V;  1PD3 A;  4UCR A;  1M5I A;  1SZX A;  4I55 A;  3FB7 C;  3HKB A;  4JYB A;  1SQB H;  2WLJ A;  4X89 A;  2QM8 A;  1OCC C;  4TUY B;  3BCC H;  3CPW U;  2Y69 B;  3EVK A;  1I7F A;  3JAT B;  4JTA B;  1YTF B;  4YY3 B;  2QEX V;  3JAS B;  2IJI A;  4UXN A;  4FFK A;  2QWQ B;  4Q6G A;  1XBL A;  1XQ8 A;  4B3M B;  2XAG A;  1HNX O;  2Y69 C;  4O4H B;  2ZKO A;  4J7K A;  2XHB A;  3JD2 A;  4Z2W A;  2YIC A;  1GM8 A;  1BZK A;  2WLL B;  1OJH A;  1FJG O;  2KG7 A;  3BAB A;  5H2F Z;  2G38 A;  1Y66 A;  4ASU G;  1QLE B;  5CA0 A;  2VWK A;  2HJD A;  3MD0 A;  3W7T A;  5K1P A;  4TV9 B;  5JCO A;  2OCC B;  2LW7 A;  2E3C A;  1GMG A;  4O4L B;  4DYL A;  4TQF A;  5HFM A;  4GLX A;  1K4D C;  3K06 A;  4HNA A;  3CCL V;  4GX5 A;  5EK0 A;  5KA5 A;  5KAI Z;  2Z3Y A;  3CCV V;  3CRR A;  3HKD A;  2CTW A;  1S5L Z;  3VQX A;  2R9A A;  1SES A;  1U96 A;  3ASO B;  2XND G;  1G6U A;  2ZDI A;  4R8C A;  1YF2 A;  3RGB A;  2JS3 A;  4ZI7 B;  2P6J A;  5EBM C;  3LNN A;  4PA9 A;  1PNM A;  1EM1 A;  1MA1 A;  3WU2 Z;  3TET A;  4GT1 A;  3JAR B;  4MTG A;  3CC4 V;  3T4Z A;  1H2S B;  3CWB H;  3ZHS A;  4GUN A;  4PA4 A;  2BSK A;  2OWO A;  2ZIO A;  3QO8 A;  3AG1 B;  4JI7 B;  2V7Q G;  3QNE A;  2UUB B;  4QIW F;  1SA0 A;  3SPJ A;  1K9M W;  2B1G A;  3WB1 A;  4ZKI A;  1F4M A;  1S76 D;  1PL0 A;  4UV8 A;  3L72 H;  3S3W A;  2YEV A;  3OAA G;  3AG1 C;  4DR1 O;  3BY6 A;  5CB4 B;  4DUY B;  1N8R W;  1B06 A;  3F7Y C;  3FX7 A;  1Y6X A;  1M4U A;  4GZR B;  2A0L A;  4DV4 O;  4B3T O;  5LOV B;  2OCH A;  4X66 B;  2CTQ A;  3APO A;  1URF A;  4DR2 B;  2Q9L A;  1WA8 B;  3ZHR A;  4UVB A;  5LHI A;  1RM1 B;  1X59 A;  1PL4 A;  3JAW B;  2OT5 A;  4GKJ B;  4B3R O;  1US6 A;  1H2K A;  1QR9 A;  5LMU O;  4UB6 Z;  1GRJ A;  3ABK B;  1VQ5 V;  2R72 A;  5LP6 B;  2UUA O;  5JVD B;  1N32 B;  2W6J G;  2P06 A;  5IYZ A;  2HHH B;  1JVM A;  2OIE A;  5B1B B;  1RM1 C;  2DJV A;  2XAH A;  1R6N A;  2VRZ A;  4K8Z A;  1B3Q A;  3Q4H A;  2BTQ A;  2OIG A;  3OEE G;  4BWA A;  5A2Q N;  1RSO B;  2RNB A;  4IIJ A;  3ZX6 A;  2AZ2 A;  1VQ7 V;  4RAI A;  1FAF A;  5BY1 A;  5GTI Z;  1Q86 W;  3ZRV A;  4J80 A;  5LA6 A;  4EB6 A;  3CE2 A;  1N0J A;  1SZT A;  1GAX A;  1XMO B;  4DRX B;  1IDS A;  1R3I C;  1WNS A;  4J11 A;  3F5W C;  3SPG A;  2MK3 A;  4IHJ B;  4C7U A;  4I4T B;  1N33 B;  3RFR A;  3OGI B;  1Y74 B;  4DR3 O;  4X65 B;  3WG7 B;  4JPR A;  3SPC A;  2YS8 A;  3A2F A;  3JAT A;  3RYF B;  4PI2 A;  4MSW C;  2NN4 A;  2QE7 G;  3P3N A;  4DR4 O;  2YSU B;  1MAB G;  2B9Z A;  1IBM B;  3CC7 V;  4MVM A;  2D2C B;  3OMI B;  3RYI B;  4JI2 B;  3WG7 C;  2W0X A;  3IC7 A;  3HR0 A;  3EHB B;  1O9G A;  4K3A A;  1GN4 A;  3JSL A;  4OPH A;  4DK0 A;  4R50 A;  3W7U A;  3JAM N;  4WFG A;  4O2B B;  1HNW O;  2P7T C;  3H1L H;  4IL6 Z;  3UCS C;  4I0X B;  3JAL B;  4O4L A;  1IZ3 A;  1RFY A;  3D3I A;  3CB2 A;  2ZM6 B;  1R6K A;  4NB5 A;  4JI6 O;  3W7S A;  4JI4 O;  4CH4 A;  1OZ0 A;  3ZRW B;  3U0Z A;  2UU9 O;  2YID A;  1FXK A;  4KFM A;  5FPR A;  3ZMU A;  2LFR A;  3BFR A;  4X64 O;  3OW2 U;  3K04 A;  4MVZ A;  1L0L H;  4ZI7 A;  1VIB A;  1AP6 A;  4DV6 B;  3OGC C;  2A9H A;  3P30 A;  4RUF A;  5EC1 C;  4BR6 A;  2HR3 A;  2GBO A;  3SYC A;  4YJ2 A;  2PI4 A;  2AW9 A;  2OTJ V;  4GCZ A;  4PA3 A;  3GB7 C;  2PF4 E;  3D8C A;  1AJP A;  5CBH A;  5KHI A;  2IBZ H;  1K5S A;  1SQV H;  3LUT B;  2WLI B;  3P32 A;  5LGT A;  4FIP C;  1KC8 W;  1YCI A;  1TUB A;  2Y4U A;  3GWK C;  4G27 B;  1S72 V;  1FFX B;  3X2Q B;  1ORQ C;  2ETN A;  5H9C A;  3RYH B;  2UXB O;  5EYP B;  2LGQ A;  3B40 A;  4DV5 B;  2IM9 A;  3L75 H;  3QF7 A;  2BE3 A;  3JD1 A;  4CS4 A;  4RO2 A;  3SPH A;  2QGN A;  1Q81 W;  2WLN A;  3OUS A;  4MVS A;  1XNR O;  4LF7 O;  1NTK H;  4QPJ A;  1KUQ A;  3JAK B;  5GTH Z;  2R70 A;  5LYJ A;  1DTO A;  2RMK B;  4QPK A;  3L74 H;  3M7M X;  2CTP A;  3X2Q C;  2F23 A;  4GYC B;  2ZIN A;  3CMA V;  5LOV A;  4NTX A;  1KKC A;  3ZMT A;  1HNZ B;  4KXR A;  5IJ0 B;  3K5N A;  5CA3 A;  2EIN C;  4E2L A;  5KHJ A;  1GN3 A;  1VQK V;  3ZN0 A;  1DF5 A;  2CK3 G;  2EZP A;  3AG2 C;  5LGN A;  1SRY A;  1F4N A;  3M99 B;  5CMU A;  4JI1 O;  2EBO A;  2JRI A;  3HB3 B;  3G4S V;  1ROP A;  4U3J A;  4JZ2 A;  1I08 A;  2YXH A;  2IU0 A;  3ZBH A;  1CEZ A;  2F66 C;  3ZED A;  5KLV H;  5JJN B;  1Q6U A;  1J5E B;  2XOK G;  2ITC C;  1GM7 A;  1QU7 A;  3OM3 B;  1ZWI C;  5J2T B;  3OTO B;  2V1D A;  1VQM V;  4AHC A;  5K1X A;  3JYC A;  2ZXW C;  4CZZ A;  3G80 A;  3T4D A;  1TVK A;  1O9H A;  1QNM A;  1RPR A;  1KP3 A;  2F43 G;  4IGG A;  2VQE O;  3RVZ A;  1AI6 A;  1X4T A;  4I4T A;  4DV1 O;  2DN9 A;  2UXN A;  2GUZ B;  4GKK O;  1KEC A;  2QA4 V;  1OHH G;  5B1A B;  4LFC B;  4OX9 B;  3M8A A;  4O2A B;  4HBN A;  5LMN B;  3F7V C;  4NXN B;  4UVC A;  3O65 A;  1RP3 B;  5TIS Z;  3FAV B;  4JI5 O;  4DR7 B;  4WFE A;  5DED A;  3CCS V;  3A0B Z;  5L3G A;  1F7Y A;  2NNU A;  2QJ1 A;  4DV0 O;  3LSS A;  1SC5 B;  5BZB A;  4Q20 A;  4FVM A;  3CEI A;  1RPO A;  2DQ0 A;  2CGN A;  4LF8 B;  1THZ A;  1WAZ A;  4WFF A;  4B3S B;  3D36 C;  3OTF A;  4MS2 A;  2X6A A;  4LH7 A;  1N36 B;  4PA7 A;  3MHH C;  2P4V A;  2LFS A;  2ZDI C;  1Z2G A;  2EIL B;  2GHY A;  2EIM C;  3E35 A;  2Z5U A;  3APQ A;  3L9D A;  2Q73 A;  5B66 Z;  5HFL A;  1N34 O;  4I0X A;  3CP1 A;  5H5N A;  3RWR D;  1MSW D;  4KHP O;  2FTK A;  1NS1 A;  3KG2 A;  2RN9 A;  1OCZ B;  1NR7 A;  1JFF B;  3H01 A;  1OCR B;  4R6Z A;  3ZRW A;  1NVP D;  5LXT A;  2EIL C;  4CC6 A;  1KBH A;  4IT5 A;  5BMV A;  2HEP A;  2EZO A;  2VS0 A;  2P22 C;  2VQF O;  1V54 B;  2WA3 A;  3CSX A;  1AJN A;  1GTO A;  2PZS A;  1MZF A;  5J9P C;  3TJT A;  4LP8 A;  2ATK C;  2EX3 A;  1OCR C;  1K34 A;  1V9P A;  4Z1M G;  5IYB O;  3RVY A;  4WFB V;  2DQ3 A;  3BA9 A;  5IYC O;  2OTL V;  1BS3 A;  2H3O A;  2GTA A;  5DM6 V;  1XIL A;  1AR4 A;  1Y4M A;  2DYR C;  5B3S B;  1S77 D;  2WLI A;  1MMM A;  2IJK A;  1IBL B;  2JEX A;  2UXX A;  2GV9 A;  4G2K A;  4PDR A;  3CRA A;  3KCX A;  3UT5 B;  3RYH A;  1OCC B;  2IW5 A;  4LCU C;  1FJG B;  5CBF A;  1BE3 H;  1AVM A;  2W6I G;  4UV9 A;  3MDS A;  5CA1 B;  2N05 A;  5IJ9 B;  4LFB O;  4PJ0 Z;  3B8M A;  4RQF A;  1BHA A;  4JGS A;  1S3J A;  1LR1 A;  2M6Y A;  3E86 A;  3P3P A;  4JZG A;  3SJB C;  4P9O A;  5H6Q A;  2IJH A;  1I5Y A;  3A0H Z;  1M57 C;  2Y4T A;  3IFX A;  3I56 V;  4DV3 B;  1B04 A;  5KA6 A;  1YHQ V;  2FB5 A;  5LL6 Y;  1BCC H;  5EZY A;  1TA8 A;  2XAJ A;  3GWO A;  4UFZ A;  2UUC O;  2CUG A;  1UPG A;  1WPB A;  1H2L A;  2IH3 C;  4JTD B;  1MNG A;  4FPP A;  4JI3 O;  1FXH A;  3W7X A;  1CXZ B;  2DWD C;  3WFV A;  3BHP A;  5C8Y B;  1PNL A;  4J7Z A;  5J2T A;  3QVN A;  4YHH O;  5CN0 A;  4X62 O;  1L1F A;  3VQV A;  3SYP A;  4FM1 A;  3K57 A;  1JOY A;  5KMG B;  1LNQ A;  4YIO A;  2LJ2 A;  3N2G B;  1OCO C;  1XNQ B;  5ITZ B;  3B2E E;  4MVO A;  4XDK A;  4DR1 B;  2O57 A;  3ZRS A;  5L3E A;  2YI9 A;  2GUZ A;  4CH6 A;  3QO7 A;  4DV4 B;  4FFB A;  1NH2 B;  2JS5 A;  2ZT9 B;  1NQT A;  1GH6 A;  2YXL A;  3H1J H;  4J42 A;  1VQN V;  2XAF A;  4GX2 A;  4PDV A;  4CS3 A;  2XAQ A;  3HKC A;  4UCT A;  2HP8 A;  1YDX A;  4JAV A;  2KKW A;  4J9Z B;  1K97 A;  3HPL C;  1M93 A;  4B3R B;  5IE9 A;  5LMU B;  3ZIA G;  1Y67 A;  3WB0 A;  5BXZ A;  1ENV A;  3KZI Z;  2ADQ B;  3E8H A;  1KB9 F;  1XOU A;  4YJ3 A;  2UUA B;  4JI8 B;  1IVS A;  4MTX A;  3SYA A;  4PV1 B;  4FLW A;  4MTO A;  1EBO A;  1FXK C;  1R3K C;  1UJW B;  4X1Y B;  2QDO A;  1QLN A;  2A79 B;  4I9Q A;  1MSD A;  3DC5 A;  1QBZ A;  3AK3 A;  4JI0 O;  3N2K B;  3GVM A;  5KAF Z;  1H8H G;  4X20 A;  2RCV A;  4X1I A;  4QNH B;  3TK1 A;  3CJH B;  2YI8 A;  1PNK A;  4F6R A;  5JQG A;  2JIZ G;  1HWY A;  2RJZ A;  1QQC A;  1ZX3 A;  3CRQ A;  4DR6 O;  2WAM A;  3AG3 C;  4QE7 A;  1JPX A;  3HKE B;  2E75 B;  3CYO A;  4QGP A;  2ILM A;  1A32 A;  1VMG A;  4YIP A;  4DUZ B;  4GX1 A;  3CRC A;  4LR3 A;  1M56 B;  2JVD A;  2LGW A;  5GW7 A;  3BPZ A;  1TUE B;  4QJF B;  1YVW A;  1H38 A;  4FMT A;  2LQT A;  1FKA O;  3ABU A;  3RBZ A;  1PKX A;  4NYK A;  2E74 B;  1NH2 D;  3FB8 C;  1AI4 A;  2Q69 A;  1M56 C;  1G1X B;  2ZNJ A;  5FNV B;  5IJ9 A;  2ZE6 A;  1BSM A;  3JD0 A;  4NTW A;  1YXB A;  4D7T A;  1HNW B;  1QHT A;  2PYJ A;  2QKS A;  1VF5 B;  4FLU A;  5EIB C;  4BW9 A;  4TUY A;  1I94 O;  1WN7 A;  4O4J B;  4OPA A;  4JI6 B;  4ZHQ B;  1AR1 B;  1K4C C;  2F4V B;  1U97 A;  5BR8 O;  2UU9 B;  3JAS A;  4H0L B;  3KKY A;  3B4S A;  4X64 B;  4WFA V;  3LDC A;  1W0K G;  4FLX A;  2QTS A;  2EJ7 A;  1E1R G;  3J80 N;  3H9V A;  1DGS A;  1KP2 A;  1XI1 A;  2ZE5 A;  1R3L C;  4K0K O;  4O4H A;  3SYQ A;  1YEW A;  2ZR3 A;  2WLK A;  4TT3 G;  1Z5W A;  3RW0 A;  3D3Q A;  2WLL A;  2IJJ A;  1HDJ A;  3CC2 V;  3G67 A;  1OV9 A;  4I50 B;  2AGA A;  1R1B A;  4X1K B; 
#chains in the Genus database with same CATH homology
 3LSU A;  1ZTE A;  3BFR A;  3QVN A;  1IXB A;  2P4K A;  2GDS A;  1AP6 A;  1IX9 A;  4X9Q A;  3TJT A;  1D5N A;  1BT8 A;  4YIP A;  4BR6 A;  4YIO A;  1EM1 A;  2AW9 A;  1XRE A;  1MA1 A;  1QNM A;  1BS3 A;  1N0J A;  1XDC A;  1SZX A;  1XIL A;  1AR4 A;  1PM9 A;  4E4E A;  1IDS A;  1LUV A;  4GUN A;  1MMM A;  1AP5 A;  4C7U A;  1XUQ A;  3DC6 A;  1EN4 A;  2CE4 A;  1JA8 A;  3EVK A;  1AVM A;  1GN6 A;  3AK2 A;  4JYY A;  3MDS A;  1VEW A;  1BSM A;  5A9G A;  3AK1 A;  1GN2 A;  3RN4 A;  4FFK A;  1Y67 A;  1ZSP A;  4JZG A;  4F6E A;  1EN5 A;  3KDR A;  2ADQ B;  1B06 A;  3OT7 A;  1I0H A;  3C3T A;  3CEI A;  1ZUQ A;  1KKC A;  2QKC A;  1P7G A;  3K9S A;  2CDY A;  1GN4 A;  3C3S A;  3KKY A;  1GN3 A;  1WB8 A;  2QKA A;  1PL4 A;  1VAR A;  1MSD A;  1LUW A;  3IC9 A;  3DC5 A;  3AK3 A;  1ZLZ A;  1MNG A;  5AG2 A;  4JZ2 A;  1I08 A;  2RCV A;  1EN6 A;  1WB7 A;  1JR9 A;  1N0N A;  1AR5 A;  2ADP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...