1ZSYA

The structure of human mitochondrial 2-enoyl thioester reductase (cgi-63)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
347
structure length
347
Chain Sequence
VDLGTENLYFQSMPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of human mitochondrial 2-enoyl thioester reductase (CGI-63)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL 2-ENOYL THIOESTER REDUCTASE
total genus 102
structure length 347
sequence length 347
ec nomenclature ec 1.3.1.104: Enoyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zsyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1zsyA01
1E3LA 4MPDA 4K6FA 3H5RA 5L7YA 1H2HA 3KYCA 3ORFA 3BTOA 4DUPA 4FCCA 2AEJA 1LJ8A 1H6DA 2EJVA 1Y8RB 4YXFA 3OICA 4MIYA 4ALKA 1JU9A 4ND5A 2Z1MA 4LGVA 3MWDB 5JSFA 3H4VA 5DNAA 4L4RA 5C37A 1T26A 3GVCA 5EESA 3PHLA 3O8QB 4RF5A 4BV9A 5H83A 1ZO8A 4IZHA 1IPFA 1BW9A 5JCJD 3DZHA 3NEPX 4BNNA 3RCBA 4FOOA 2WD7B 1O94A 5MDHA 2IYOA 3WGHA 3AY6A 2I3GA 2PZKA 3TSCA 4BKQA 4ZQGA 4IMRA 3GFGA 3FHLA 1E6UA 2NADA 5CDUA 2GCGA 3E5MA 4OKNA 2PZJA 3H5AA 3RJ9A 3RFTA 4D41A 2X9GA 3ZNQA 2GO1A 3SLGA 2QQ5A 4R3NA 3GUYA 1D3AA 1ZEJA 3CMCO 4I9HA 2C5AA 3BMOA 2EKQA 3WIEA 4J90A 4GH5A 5JC8A 3KEQA 2C29D 4M87A 2CVZA 4PG5A 2HK7A 3V2GA 3K92A 3WLEA 4RLHA 5IFLA 1LEHA 1P44A 1JLLA 2CNBA 4LMPA 3C7DB 3VKUA 1J0XO 4HKTA 1T2EA 3WGGA 1ENPA 5COAA 5G2OA 1ENOA 4OGWA 1OZAA 1E0DA 3F46A 4RF4A 4Q3NA 3BTVA 3K2EA 4CM6A 1K5HA 4J1NA 2D8AA 3ONFA 1O9BA 3MWEB 5L3ZA 4E5PA 2TMDA 4J0EA 3E1KA 5DCUA 4UUMA 3UAGA 1V9LA 3ICPA 3JQ7A 3LYLA 1QG6A 4AFNA 1UJMA 3WTBA 2ZQYA 3UXYA 1AHIA 4ID9A 3GDOA 2ZB8A 2D3TA 3E82A 1P74A 1EQUA 2HMWA 1H5QA 1EVIA 1PIWA 1WMBA 3D5QA 5HS6A 4EI2A 1JKFA 4XQGA 4B7UA 1XU9A 1PWZA 1MUUA 3QP9A 1QP8A 3JTMA 2PZMA 4NG5A 4FOSA 2PFGA 3DBRA 1DHRA 2CSUA 1HDGO 4OOEA 3JQ6A 3VZQA 5JS6A 4OH1A 4BOYA 4CM7A 3PQDA 1DRVA 1Q2XA 3WQQA 3TWOA 2UUPA 1I32A 4PZEA 4WCFA 3RC1A 3WNQA 3L6DA 1CF2O 2NU9A 1KY5A 2HRBA 4XB2A 2IODA 4BQRA 4IJWA 5JDCC 2ZKLA 3H2SA 3VZRA 2GLXA 1HDZA 4R51A 5KKCA 3WQRA 2O3SA 3JQAD 4DMMA 3ON5A 3JYPA 1BXGB 3KBOA 4Y6RA 1Q7CA 1TT5A 4DA9A 1VKOA 4OXNA 4FQ8A 5JAIA 5JDIC 4TWRA 1UXGA 2FZEA 3V1UA 4J9VA 5CDSA 5ENVA 1HETA 4DMLA 4CLEA 5HM8A 4CUKA 5B37A 2HDHA 4NIMA 4RPGA 4F45A 3GZNB 1HZJA 3O9ZA 3RBVA 3WGIA 5G4KB 4DVJA 3L9WA 2VUSA 4N5LA 4X54A 4YACA 4B3IA 2B69A 3PJEA 2JCVA 1Q0HA 3WGTA 2JJYA 1QRRA 6LDHA 5I8WA 3ADPA 1E3IA 2HCTA 3LZ6A 2OFPA 3KHUA 1GYPA 2ET6A 2X23A 4E31A 1EDOA 1UXKA 3OECA 1HE5A 4II3A 2D5AA 3Q6IA 4A27A 1V8BA 4E0BA 5EL0A 4A03A 3QWFA 1QR6A 4MVJP 4NJMB 3INRA 3WICA 5TNXA 4ALMA 4W6ZA 4E33A 3UW3A 3DOOA 3NGLA 1Y81A 1E1LA 4EW6A 1NXQA 4BO1A 1Q1NA 5JNLA 5EPOA 4UVGA 4HNGA 1Y8QB 5U9CA 4YAJA 5BNTA 1XQ1A 1N9GB 2I76A 1LRJA 5BNFA 3OA0A 4JBGA 3PFFA 1ORRA 4CQMB 3ULKA 1A72A 1ZMOA 4FSHA 3FF4A 3B6ZA 4UVHA 1Z7EA 2FMUA 4CM8B 3PVZA 4CM8A 4Z9XA 4FGWA 1I3MA 4WLNA 3D3WA 4JP2A 5KKAA 4DLBA 1GUYA 2Q2VA 1M76A 3FR7A 5LDHA 1WZEA 4XR9A 5A05A 3GC6A 4IM7A 3DZFA 4BHTA 1GFSA 3MOGA 4HXYA 1B2LA 4R16A 5DZSA 5G0UA 2GERA 4N7RA 1BDMA 3FNGA 3NTQA 1IHXA 3R0IA 3AFNA 1NAIA 4E5MA 5CFZA 4DWVA 4ZA2A 3RU7A 5KVVA 3PEFA 5EQDA 3JQAA 4ZVVA 1E3EA 1TI7A 3W6UA 5AXBA 4BNGA 1NP3A 5TF4A 2JFFA 3S2GA 3PHHA 4PVDA 4RQTA 5A3VA 5A9TA 1UZNA 1E5QA 4ND4A 3FRJA 2W8ZA 5TQVA 4CR6A 2AQIA 2H5LA 4J7UA 4RVGA 4YDRA 2QG4A 2DQ4A 4KDEA 3ETDA 5T8KC 3K6JA 3SBOA 2Q1SA 1LRLA 2DBRA 7ADHA 1UZLA 1EK5A 1GQYA 3QHAA 4MDHA 2G1UA 1P45A 3AUSA 4XD2A 2FWMX 1I5RA 5GMOA 3EHEA 3GDFA 4DPKA 1U8FO 3JQAB 4IQ8A 3M2PA 4QTZA 1SAYA 2R00C 5GY7A 3GAZA 3IUSA 4FN4A 2B83A 2JD0A 1JTVA 4DC1A 1K6XA 2VTDA 3GNQA 3D4PA 3DBLB 4D0SA 1GEEA 1KEVA 1NFQA 3HSKA 3W8EA 4URFA 2BGLA 4CM9A 4P38A 2P91A 2R2GA 1QYCA 1BW9B 3AUAA 3GVIA 3RROA 4Q3AA 4O59O 4CMEC 1GAEO 2A9FA 4Q3CA 4S3MA 4BVAA 4RF3A 1KVSA 3ABIA 2NWQA 5IAAA 1VPDA 3BTUA 3PPIA 3GT0A 5IXSA 2XXJA 4I5FA 4PN3A 1ISJA 1W8DA 3GGPA 1WPQA 2EG9A 5IJZA 4TZTA 4PZDA 3GK3A 3I9MA 5ILGA 5F1KA 2GASA 4WNIA 5KVSA 3PJGA 1MFZA 3PXXA 4YB8A 4ZQBA 4ALLA 2Z95A 4CL8A 4O5OA 2FR8A 3UCXA 2ZIZA 2RIRA 1H6BA 1Z6ZA 4WASA 1ADBA 4R5MA 5KJ6A 3D1LA 3R3JA 2FR1A 1FF9A 3VPXA 4CM3A 2AMFA 4Y9DA 3ROMA 4YRAA 3OJ0A 2G17A 4MINA 2O7SA 3RJ5A 4BO4A 4DXHA 5U1PA 2Q99A 3AUTA 3VPGA 3VTFA 4TROA 1T2DA 1F17A 1DB3A 1X7GA 4KZPA 1NASA 2BI8A 2C2YA 1PZGA 4C7JA 4EBFA 1I30A 1VC2A 3QVXA 1DC4A 3OQ6A 4BKUA 5I7SA 1P0CA 1P1HA 3QWAA 4YT2A 3V2HA 3GZ4A 5THKA 3GMSA 1LDGA 5FEUA 3K9QO 5CAEA 5EMHA 4EDFA 1D7OA 3SJUA 3OM9A 2NTVA 1O89A 2NU6A 2ZK7A 3HDYA 3A4VA 5TGDA 3PFWO 1UXJA 4RGBA 4B8ZA 4A26A 4CM9D 5L95A 2ZB3A 5KNLA 1PS0A 2W2KB 2EP5A 1ZXBA 2VWHA 3OHSX 2DC1A 2OXIA 1LLDA 3DAGA 3N58A 2A4KA 3P2YA 4H15A 4DTIA 4HUJA 3NT5A 4FFPA 1MG5A 3KSZO 1UP7A 3OP4A 3GY0A 4M54A 4L73A 2PNFA 2C7VA 4R68A 3F9IA 4Z3KA 3GR6A 2PKQP 3RU9A 2PY6A 4XA8A 3WSWA 1NVMB 3VDQA 1SB8A 1V3UA 3DEYX 4BNWA 3JV7A 1YL5A 2AQHA 3C1TA 2O3TA 3WOHA 4MP8A 3ITKA 2E6UX 3Q9UA 1Y7TA 2IYPA 3PWKA 3W4IA 4RORA 2RHRA 1HYHA 1LNQA 4AJIA 4R1UA 2RHCA 3D4OA 4J2OA 4DBZA 3FWNA 4QSMA 4Y67A 3E18A 2AA3A 1T2AA 4OIMA 1DAPA 3GGGA 3VH2A 1OBFO 5EIOA 4MO2A 2JAHA 1JA9A 2UAGA 2O23A 1YB5A 4WE3A 3NRCA 1MC4A 5G0WA 4AJ1A 4B8WA 3GVHA 4RF2A 4BNIA 4R1TA 3NJ8A 1YONA 4J16A 1YKFA 4DPMA 2GDZA 3ZWPA 1VJ1A 3KO8A 1B7GO 2TMGA 2I3AA 1CWUA 1G1AA 2BH9A 3GN1A 5L4LA 1NHWA 4L0QA 1LC0A 1JVBA 3M6IA 1EBFA 3EMKA 1GR0A 1HSOA 4EITA 1E7YA 1LBEA 4XEHA 4OQYA 3CSDA 3L4BA 3QVWA 1ENZA 1PWXA 4IQGA 4GLLA 2YQ5A 3WX0A 1EUDA 1U4OA 3DOCA 5IDXA 5ILOA 4CQMA 1HRDA 2I67A 3AJRA 4R3WA 4PLVA 1WMAA 1ZK3A 3BHMA 3KRTA 3ASVA 1KBZA 1HE2A 1BXGA 1E77A 4Y98A 2Q4EA 1HT0A 3TL2A 1XCBA 4EGFA 4CLRA 3B1FA 4QQRA 3V5NA 4XQCA 2AW5A 3BMNA 3VVBA 5B4VA 2W2LA 1SO8A 3TF5A 4YRDA 2GUGA 4L8VA 2HQ1A 1JWBB 3EVTA 3PJFA 3TZ6A 4Z9FA 2YUTA 3VAZA 1YOVA 4LSMA 2H63A 1JVSA 1F12A 3IQDB 4YJDA 2BMAA 1YB4A 4ZQHA 1N1EA 2VHVA 4D79A 4YCAA 3T4XA 1NVGA 1E7MA 1I3LA 4E30A 2RCYA 1E3SA 4ZRMA 5AXAA 4QFCA 4HBGA 2PH3A 3OH8A 2ZB4A 4EUFA 1HEUA 1R4NA 1E1MA 3C24A 4E2WA 2XF8A 5DOZA 3CZRA 3QSGA 4CLXA 3I9OA 2DFDA 4LSWA 4FFNA 2X86A 4BNKA 1H9BA 3F1KA 1P33A 3LT4A 1DBVO 4LK3A 2HRZA 2ZCUA 4XCVA 1BXKA 5F1PA 2WYWA 1E7SA 3G17A 2P5UA 1T2CA 4ZICA 1DRUA 2QHXA 1SEVA 1NNUA 1V0JA 2B4TO 3L07A 1N8KA 3O03A 1Z7BA 4KOAA 5JO9A 3TL3A 1KERA 2HSDA 2ZCVA 1G0NA 3L9XA 2AEMA 3SX2A 4IINA 1WWKA 4NHEA 3M2TA 1OMOA 1GCOA 2C54A 5JDCA 3S2EA 1EK6A 4ALIA 3AM4A 3UH1A 1SZJG 4E5KA 4WPGA 4BKPA 5IG2A 1ENYA 3BMCA 3OMLA 4FDAA 2X6TA 3BMOB 5CG2A 1B8PA 1CYDA 5K6AA 3ONDA 2EKLA 1OC4A 3TOXA 3I1JA 4E2ZA 2AEFA 3DC2A 1D8AA 3EZYA 3L6EA 4RPHA 3JYLA 3GFBA 3MJSA 4Q3BA 4RCVA 2ZYDA 1XQ6A 2R6JA 3EZLA 4HV4A 2GN8A 3KXDA 2E37A 3GNTA 4HFNA 3MJVA 3UFXA 2BKAA 1K3TA 2YV2A 3JD0A 4IGFA 2VRCA 3PIDA 4J7XA 4KWIA 3SJ7A 1IZ9A 5A3JA 2PGLA 1E1NA 2NV6A 3TN7A 2VWQA 4J1QA 1HE4A 3DQPA 4FW8A 1QV7A 4FC7A 3O8QA 3RWBA 4NQZA 4D46A 3TFQA 4FJ2A 2HU2A 4PG4A 4PLHA 4NPCA 2ZJ0A 3HDQA 5JDIA 3FSRA 1WDLA 1YB1A 2EEZA 3AM3A 3HB5X 1T1RA 2YY7A 1ZH8A 1O6ZA 4IXTA 5ENDA 2A92A 2WJPA 3WS7A 5KWEA 2RAFA 3VH1A 4BNVA 3OF2A 3QVSA 4D43A 4BMNA 1PJ3A 3MJEA 2FPIA 1ZUD1 4HADA 1BDBA 2E82A 4GGPA 1EDZA 3MTJA 4WUVA 1XGKA 1KVRA 4K9DA 3EAGA 1U3VA 3BZUA 3OJFA 4MVJG 3WQSB 4J4BA 5KTKA 4B79A 2OP1A 5BSEA 3GPIA 3ZHBA 2I66A 1TEHA 2D5CA 1TB4A 3CKYA 3U4IA 2P5YA 1IY8A 3JQ9A 4XGNA 3DXFA 3GHYA 1YGYA 3IIEA 5GZ3A 1PL6A 3S8MA 3WFJA 1KOLA 2WMDA 3OFSA 4II2A 4PZCA 1P1JA 2OGUA 5IN4A 3ENNA 4IDCA 1O5IA 2VUUA 3Q9NA 3JQ8B 4B4UA 3UGKA 1EBUA 1GUZA 3OJOA 1ZFNA 1FDUA 1A7AA 1XYGA 3ROKA 2IZ1A 9LDTA 3AW9A 3K73O 4G2NA 2VRBA 3DTYA 4AL4A 2DTDA 3AM5A 1LU9A 1SB9A 2FSSA 4J1SA 2OUIA 4GSKA 2YFHA 3ZNOA 3ST7A 1BXZA 4OXKA 1ZSNA 5KVCA 1EMDA 5TRTA 3AOEC 1BVRA 3MJTA 3CINA 4WLOA 1XWFA 2YHIA 2NTNA 3GPDG 1F0YA 2PKQO 1RM3A 4RVFA 2DT5A 3BTSA 5JLAA 4E5YA 4NK5A 5B4TA 1LDYA 1SCUA 2O7QA 4UUPA 4AJLA 3IUPA 3QE3A 3U0BA 1ZNQO 2HK8A 1BTOA 1EFLA 5L53A 3F6YA 3JD3A 3IKTA 5L45A 1IYZA 1H93A 3PGXA 4JJGA 1OAAA 4W4TA 4CLHA 3D3EA 3NUGA 4FJ1A 1Z82A 2VRCD 4YT8A 1LSJA 3M1LA 4N18A 1T2FA 3W8DA 2B5WA 1LSSA 3KLPX 2EW2A 4RO0A 3I3OA 4BGUA 1ZMTA 4BNTA 1W0CA 1ISGA 3CE6A 3T7EA 4GVXA 3BIOA 3H7AA 1P0FA 3ROPA 3OQBA 4JNKA 1KIFA 4M89A 3W4KA 4PG8A 2NNLD 3UUWA 3RFXA 5BSHA 3VVCA 4B4VA 1B8UA 1ISHA 1PJ2A 1ZK0A 4TRNA 1NQ5A 3AU9A 4MVJH 5A5FA 3K96A 2V7PA 3WLFA 3NAQA 2EW8A 4ND3A 2V6FA 4FFOA 3NTRA 4NBVA 3VTZA 2DTXA 4XQEA 3TZKA 4GX1A 1JW9B 3R1IA 2IZ0A 3DZIA 3WGQA 4Q39A 4CMJA 3NKLA 2YHUA 2JKVA 4I08A 3HN2A 5B1YA 4RVDA 2E4AA 1ONNA 2EERA 2WSBA 3LU1A 4Q3DA 2W2LD 5FF9A 4YJGA 2Q49A 4J4TA 4GBJA 3AOGA 3VZPA 3DONA 4C7KA 5A04A 4YT5A 5JXWA 3FBGA 1N5DA 1DFGA 3UVEA 3D3WB 3BMCB 3LC7O 5AOVA 3ZU2A 4Z3DA 5BSGA 4CMIB 1U3WA 3PHGA 3NDIA 3SC4A 1U5AA 4O0LA 1NBOA 4M8SA 2J3IA 3WGZA 3HHPA 2AXQA 4CLOB 3T4EA 1T1SA 1DJNA 3RVDA 1KEPA 3HWRA 3QRWA 3E8XA 3NDJA 3NGXA 3KTDA 4I1IA 1Y8RA 1UDAA 3Q2IA 3E5RA 3IP3A 2Y1CA 2ZTVA 4WOJA 5I9MA 1PX0A 1YL7A 2X0NA 4ESOA 3UOGA 4B4WA 2X1HA 3HN7A 3QQPA 1LLUA 2GN9A 3VHRA 3CZMA 3F47A 3Q1LA 3TFOA 5AVOA 1HDYA 3GEGA 1GU7A 1TLTA 5FWNA 3DL2A 2NQ8A 3HDJA 3IDSA 4E4YA 2NACA 2X5JO 3DR3A 4MVJD 4INAA 5F1OA 2Q46A 1DLIA 4PLWA 2J6IA 1ZK1A 4F46A 3V8BA 1M6WA 2ZYGA 4Y6PA 4BO6A 1YS4A 4UUNA 4AVYA 4DIBA 3QY9A 3NTOA 3GOHA 1KS9A 1PJ4A 4U7WA 1BVUA 2O2YA 3ANMA 4N54A 4UVEA 1D4FA 1ISMA 5CHEA 4OSOA 3VDRA 1GPJA 2CF6A 1C0IA 2Q50A 4G65A 3R6DA 2HMTA 2DM6A 4WOKA 1J5PA 3ZI0A 3U62A 2FOIA 3RD5A 3ZHZA 3BHJA 3PZBA 5K1SA 1V6AA 2C82A 4BNZA 3MOIA 4OYRA 3ZWMA 2VZ8A 3PYXA 4GAEA 3G1TA 4W7IA 1A5ZA 2XAAA 4FFMA 4RZIA 4HNHA 4ZHSA 1PTJA 4L9RA 4UEKA 1LDBA 2PV7A 1P3DA 3ZNNA 3ZV3A 1N2SA 4JXKA 4DRYA 1UAGA 1H6CA 1NX6A 1EVJA 2GYYA 2GPTA 2Y67A 1VSVA 1YRLA 1E3WB 4PRLA 4IJVA 1PJSA 1M75A 3JQBA 5EQFA 3RSHA 4XDZA 1DJQA 1C0KA 3G49A 4IMPA 4AJPA 1LDNA 3PZRA 3QWIA 1U7TA 2V6GA 1MLDA 1SMKA 2DVMA 5LC1A 3VKVA 3PYLA 4MKZA 4RDHA 3PQEA 4J4HA 3DHEA 4BNXA 1YL6A 2OHXA 3KETA 5KJEA 2JFHA 5JAZA 3TZHA 4HWKA 8ADHA 4CJXA 5EINA 2FHSA 4N5MA 3RC9A 1MGOA 1QKIA 3JQBC 3LVFO 2WDZA 5JMWA 2YV1A 1GV1A 3DAFA 3TZQA 3U09A 5A9RA 1HZZA 3A1NA 3KSUA 4RVSA 2EGGA 3ZH2A 5KIAA 2E49A 5I9LA 1VSUA 3BMQA 2EWMA 3ETEA 4BO2A 2IXBA 3D7LA 2CDCA 1QYVA 5JY1A 4PVCA 1IUKA 1VKNA 4MIOA 4A7PA 3HZZA 4GVLA 3ZZNA 4XYMA 4J9UE 1IE3A 1HWYA 2CDBA 3ZWBA 2GZ3A 2AQKA 3EW7A 2VTEA 1QYWA 4F6LA 3I4CA 3KYDB 1SC6A 3NYWA 4YJFA 4BL5A 3PRJA 3I52A 3ZHYA 4RPKA 1HDOA 1UDBA 4R69A 1B14A 5A5EA 1A7KA 5C5IA 1T24A 2CZCA 3AY7A 1UAYA 4D3DA 1DIGA 3CUKA 2X7HA 4M49A 4PGFA 3VZSA 4XR4A 1X7HA 4R9RA 4A2CA 1FDTA 4EUHA 5BSFA 2PK3A 1A71A 2Y66A 5JBIA 2B35A 1H9AA 2DUUA 3S2IA 3ZDFA 1IOLA 5ER9A 2NVBA 1CQIA 2V6MA 2I9PA 3C1AA 2BELA 2DLDA 1R16A 3CTMA 3HADA 2RH8A 2VYNA 1DDOA 3GH3A 1UP4A 4WNCA 4DYVA 3K5PA 4D45A 4NR0A 5KJCA 3DBHB 1NR7A 3ENKA 3WMWA 4CM4B 1PR3A 1XR3A 2HLPA 2I6TA 2HJRA 1U5CA 5I8ZA 2DBQA 2X0JA 4KMSA 4YTEA 3LLVA 3PYMA 1EQ2A 2BGMA 1PQUA 3ONEA 4OSPA 4ZRNA 2B4RO 2BD0A 2VWGA 1X15A 5MGBA 1PZFA 4J2HA 2CDAA 5CP8A 4YA6A 3H9JA 4W82A 4E32A 4EYEA 3VPHA 5I7VA 2FR0A 5IZCC 1P1FA 3CXRA 3N74A 4FBGA 4BKOA 2QZZA 2GF2A 1NAHA 2P68A 5DBFA 2BF7A 4ZN6A 4P22A 5HRUA 2B4QA 3GHHA 1ZSVA 3LK7A 3H5NA 3TOZA 5AXDA 1P9LA 2X9VA 2H1SA 3PQFA 3U4CA 1Y1PA 3L77A 2ZTUA 3ANNA 1EUZA 3KM0A 2Q1UA 1EE9A 2QRKA 3CH6A 2JAPA 4YBZA 2IZZA 1PQPA 3D0OA 5TT1A 1PQWA 1BSVA 3AI2A 4CQLA 4GX0A 1FMCA 4R1SA 4WECA 5T8KA 4ND2A 4GWKA 1C14A 2V65A 2CF5A 2VHYA 3ITDA 5DDIP 1YQGA 4TSKA 3KB6A 4XRGA 2PD6A 3QWBA 4CMAA 1PS8A 3GNSA 2G76A 4FJ0A 4I9NA 4B4OA 1GPDG 4YAEA 1M2WA 4WEOA 4CMEA 4W7HA 3F4LA 3PDUA 1ZEMA 4DQVA 1ULUA 5ES3A 5HWSA 1ZZEA 1NPDA 3UN1A 2O3RA 4LN1A 1VE9A 7MDHA 5DP2A 1VL8A 3DFUA 1W4ZA 3EK2A 1N92A 1KC3A 1OOEA 3IS3A 3I6IA 2O3QA 4PLPA 1W73A 1B8VA 1NWHA 2Q2QA 4L4XA 5A4DA 1I36A 3TDKA 2WD7A 2CVQA 1R4MA 5IDWA 1MA0A 1HE3A 2AHRA 5TC4A 4CV1A 5JFOA 2QX7A 4YQYA 2HMSA 1RPNA 1QMGA 5DCWA 1GL3A 3PTZA 3WNVA 2X58A 2NQTA 1I24A 3RQSA 3CMMA 1CDOA 4BNLA 5KJ1A 5HA5A 3WSVA 3A9WA 4I9UA 1ADFA 4U6QA 4BO9A 1FK8A 1DPGA 1FJHA 3K8ZA 1VRWA 2O4UX 2Z1NA 4J91A 4QO7A 5GZ1A 2YYYA 3AFMA 1A9YA 2UDPA 5IZCA 1RM4A 4QXMA 1ZXLA 2RH4A 4KTTE 4PRKA 2Q45A 4IIVA 1LDMA 3DMTC 2VZ9A 2IEDA 2YDXA 1V35A 1DXYA 2VYVA 5A03A 1YO6A 2HUNA 4L74A 2DUWA 1HYGA 1PJLA 2VZ0A 3ZWAA 1NQTA 9LDBA 1NFRA 1NQOA 2Y0CA 4H16A 2GNAA 3DZKA 1R15A 1L7EA 4TVOA 2W90A 3LT2A 3GG9A 2OBNA 1ZJZA 2CY0A 3FD8A 3EUWA 1RYEA 2WYUA 4JBIA 1Z74A 2X0IA 4MIEA 1SNYA 4PIVA 3HJAA 2D59A 2UYYA 1P1IA 5JC1A 3ZU4A 2JD2A 5ICMA 4AJ2A 4RL6A 3GDGA 3I9JA 4XB1A 5F3RA 2I5PO 1XDWA 1PJBA 1Z75A 3EVNA 4CMIA 3RC7A 4YRBA 3DB2A 3IJRA 4ZQFA 1C0PA 1CETA 5I7FA 5EERA 2YHIB 4ALNA 4GX2A 1I2BA 4H7PA 4I5DA 1LUAA 4IPTA 4CUZA 5CDYA 3GG2A 2BFAA 3SEFA 3HE3A 4AJJA 1WVGA 2JCYA 1UP6A 2PKRA 2QIOA 4QUKA 4YYZA 2J5KA 3ROQA 4BNHA 1ZW1A 3O38A 3EYWA 4MP6A 4YJGB 2EIHA 5A02A 4QX6A 3JQFA 2QRLA 4QT0A 1Y9EA 4EEZA 4CV3A 3KYDA 5FFFA 4DLAA 1ISFA 4P8RA 3BYZA 1XU7A 3HG7A 1MXHA 5T64A 5TT0A 4C4OA 5ITWA 2VQ3A 1KETA 3VH3A 3FI9A 5LDGA 1BGVA 3UHAA 1I8TA 1ISIA 4UUOA 4NBTA 5KOIA 5IDQA 1F8GA 4WLFA 4J43A 3IC5A 4PG7A 3S55A 5JY6A 1HL3A 2NVUA 3Q11A 1I0ZA 1CJCA 2NLOA 1R37A 3D4NA 4R41A 4OHUA 1B15A 3JQCA 2C2XA 1U2GA 4JN6B 3TJRA 2JFGA 4A0SA 5HS4A 1NWCA 4ALJA 1UXHA 5HBRA 1A4IA 1P31A 4WK6A 5I7EA 1IHYA 1EE2A 4OXYA 1DEHA 2XPCA 3I5MA 4HFJA 5DT9A 4BGEA 3BMQB 1QV6A 3STHA 5CDGA 4LISA 4CQMD 3E03A 2WD8A 3PP8A 3WR5A 3QJ5A 4R1NA 3P19A 4YWJA 3MJCA 5GZ6A 1CQJA 3H9GA 1PGPA 3KUXA 1Y9AA 2P9GA 2Y1FA 5JE8A 2FZWA 3FNHA 1NTOA 2QZ9A 2C59A 3LDHA 4XYBA 2JL1A 3FN4A 4YQZA 1O8CA 1RYDA 5LCXA 3TPCA 1B3BA 1K2WA 2O48X 1DAOA 2VNAA 2VT2A 3QV1A 4QO8A 2HO5A 2JCXA 3DHYA 4TRJA 3HUDA 3PIIA 3QVTA 2UUOA 5T67A 2Q1TA 4B3HA 1WXDA 3EDMA 4FD3A 5DBGA 3ICCA 3G3EA 2C5EA 4L76A 2D0IA 2EKPA 4ONEA 1C1DA 2DU8A 4MKRA 1K0UA 2GSDA 5G0SA 1UXIA 3O4RA 3LF1A 1DC6A 4GWGA 2VUTA 4LCEA 1KC1A 1PGJA 1E92A 3JQGA 1V3TA 2FN7A 2YDYA 5CDTA 2D4AA 1VJ0A 4J7CA 3H8VA 1I3KA 1YBVA 3M1AA 4DIOA 1NR1A 1P1KA 3OJLA 1OI7A 3JQ7B 5L4SA 3HNPA 2G5CA 4ZJUA 5IZ4A 3RUIA 2CUKA 2PH5A 4IJUA 3WGOA 3TQHA 4RPLA 3W1VA 4XYGA 3ZGYA 4BIIA 5FI3A 3WJAA 4KDFA 4GKVA 3G0OA 3EC7A 1KVUA 5DBIA 4AJ4A 1I3NA 4JIGA 3VOSA 2Y1OA 2I99A 1SEPA 3JYOA 4NFYA 5TJHA 5TJ9A 4CPDA 3LLSA 2W98A 3H9UA 1DC5A 3LT0A 3MEQA 3UICA 3ZU5A 4CV2A 1GZ4A 3UKOA 1H2BA 1ZIDA 2BFMA 4RV9A 3X2FA 4WKGA 1N1GA 3FCOA 1PL7A 1ZVMA 2Y93A 1LA2A 3ZCXA 4IS2A 5T5QA 1N7HA 1RKXA 2DBVO 4OOFA 1NYTA 4OO3A 3FPLA 1LI4A 4GI2A 1W6UA 2B0JA 1ML3A 2FPGA 2PA3A 4IQ0A 3RIHA 3WXBA 2EHDA 1VI2A 1X0VA 2PD4A 1B16A 3LSYA 4FFLA 4TRRA 4IGEA 4IDEA 3AI1A 4JJIA 2ZJ1A 3IKVA 2JHGA 1DHTA 4RZHA 1I2ZA 4R54A 4BO3A 2AQ8A 2R00A 3OIDA 4U0KA 4UVDA 3G79A 1A9ZA 1GV0A 3A14A 4DQUA 2PWZA 4IDBA 1LSOA 1SOWA 2DTEA 1NFFA 3PGJA 2DAPA 4U8GA 1N9GA 4GL4A 3LF2A 3LC1O 1LLQA 1RM5A 1AGNA 2DFVA 1YJQA 2DKNA 3MTGA 4U6SA 5TIIA 2PD3A 4YVFA 5C7OO 3GA0A 2BLLA 4E5NA 3K30A 2FRDA 1U7HA 3WWYA 2GZ2A 3ZV5A 2C20A 2EP7A 4CR7A 2C07A 4CMKA 5DULA 2BHLA 5K6AC 1ZBQA 2QW8A 4K26A 3AU8A 4OL9A 4G5HA 5L51A 3VC7A 2P2SA 1DIRA 4Z0PA 1YVEI 3FNFA 1JQBA 5TX7A 1LX6A 4BGIA 4JJFA 4WGGA 4CL3A 4RQUA 1H0KA 4FB5A 4XJTA 3IJPA 1DSSG 3D64A 4LVCA 1KEUA 1CEQA 3I9KA 3Q2KA 3H2ZA 4JQCA 1UUFA 1S6YA 2B5VA 1DIHA 1LRKA 3H3JA 4OAQA 5G0TA 1MFPA 1IULA 3ASUA 2J3KA 3GRKA 3DZGA 4NH4A 4BS9A 2WE8A 1K6JA 4JGBA 4DGSA 2EF1A 1GDHA 2HAEA 1AUPA 2NVWA 1FXSA 3CIFA 4KTVE 4FPXA 3OQ1A 1YOVB 4XWYA 3MJ4A 2AE2A 1R4MB 2Y1DA 3SC6A 1RWBA 3DZBA 4CUJA 2BGKA 2ZB7A 3H9EO 2G82A 4NU6A 4GMFA 3INTA 2Y0EA 2O3JA 3KOUA 2OP0A 4IIUA 1E3JA 4PLGA 1BMDA 3OETA 3RKUA 1RM0A 2VHWA 1C3VA 4WCFB 1ADCA 1JWAB 5EJ2A 2WE7A 4CMGA 5DOVA 5FI5A 1HF3A 5AYVA 4D3FA 3W4JA 1R0KA 4BNJA 3I9LA 4YPOA 3BA1A 4E13A 3DBRB 2P4HX 4KQXA 3H3FA 4PLCA 1FDWA 5ER6A 3GLQA 2Q4BA 4XQ9A 4IUYA 4PCVA 1MV8A 4KWHA 2YV3A 3ZHXA 2O4CA 3FPCA 5K9ZA 1PGQA 1XHLA 2UVDA 4JP3A 3LT1A 2D1YA 3DMTA 3B1JA 5A1TA 3QWHA 3RUDA 3KYCB 3KLMX 5DCYA 3U5TA 2J5RA 2CFCA 1VJTA 1LLCA 5C7IO 1HTBA 1EFKA 2OZPA 3JQFC 1T4BA 4G81A 2ZQZA 4IBOA 3L4BC 3IL2A 1X14A 1TA4A 1ID1A 1WZIA 4E2YA 2VYVD 1BHSA 1MXFA 2Z5LA 4D42A 3RAJA 3GMDA 4DC0A 2CMDA 4GX5A 1PJQA 2X9NA 4NI5A 1T25A 4K28A 4RVUA 4UULA 1JDJA 4YR9A 1QYDA 2PLAA 1EEHA 1GQQA 1ZSYA 2XOXA 4GQAA 5C7LO 4E21A 3I9NA 2VOEA 3FBTA 2ZTLA 3S2FA 4BNMA 3FWZA 4P4NA 1L1FA 4CV0A 3RKRA 4MJLA 3ADOA 4DYDA 2BI7A 6ADHA 3OEWA 3KSDO 2FSVA 1ULSA 2ILTA 3RFVA 4YEDA 1EUCA 3JYNA 3RASA 1EVYA 4Z0TA 3ZV6A 2VNSA 2E48A 2HMUA 3ZWNA 1DIAA 2DPHA 1U9JA 3KEOA 4TVBA 4CMBA 4U5QA 1YDWA 5CEJA 3BHIA 4A5OA 2H6EA 4A10A 1QXSA 3AI3A 2NU8A 1Q0LA 4S1VA 5J23A 1IPEA 1EVZA 4BNFA 1GZ6A 1ZK2A 3JCZA 4WCDA 1YWGO 4NJMA 3E9QA 2BFOA 5L40A 1X1EA 3COSA 1GY8A 4D7AA 5KCZA 2NM0A 4ZD6A 4AJOA 4R5HA 4BB6A 1Z45A 3ETGA 1GD1O 5U4QA 3RC2A 3ZWYA 2OL4A 3WFIA 2RBEA 2CVOA 4RPJA 4EJ0A 2Q1WA 4K6CA 1HSZA 2SCUA 3UCFA 4GLOA 5CG1A 3IAHA 3QIVA 2VHZA 3ZWWA 2GN4A 4RJTA 1QSGA 4IDDA 3JQ9C 1AN9A 3E48A 1SBYA 2HKIA 1ADGA 1B26A 1TXGA 2IEBA 4BB5A 4AICA 1H6AA 5TSDA 5KVQA 5B12A 1X1TA 3MCVA 4ITUA 3HDHA 4LCJA 1DLJA 5JO0A 2IXAA 4HX5A 4WCFC 3ZV4A 3I23A 3U9LA 3WWZA 3NJ4A 3DTTA 1Y5MA 5H82A 4ZU3A 4IS3A 1M6HA 2J3HA 4F6CA 1PGNA 2JD1A 3A28A 4TKLA 4MVJM 4AJHA 1KY4A 1DC3A 4B7XA 4CM5A 2FP4A 2QYTA 4QFDA 3RUHA 4W9NC 1YE3A 3B20A 4NBRA 1MG0A 4BO7A 3DAPA 3PDJA 1B3RA 5BR7A 4JK3A 4CMHA 4NNJA 1R12A 2G0TA 4XJSA 3G1UA 1J6UA 1C1DB 3HFSA 3L0DA 3UCEA 1FDSA 3GF4A 3AK4A 3KV3O 4MVJE 5A06A 4BMVA 4J49A 1AXEA 2NUAA 3R3SA 5FYDA 3H9QA 3WJ7A 2WYVA 1NPTO 2ZATA 4TZKA 4HFRA 4J3FA 5DF1A 5F21A 4AG3A 4BO0A 5JCXA 1DFIA 4Y6SA 4TRMA 3DBHA 1G0OA 2OMEA 1Y5RA 1Y8QA 3V1YA 1XELA 2POQX 1LSUA 1VL0A 4ZGWA 3WBBA 4LRSB 2X4GA 1I10A 4MVJF 5L7TA 3NDRA 1X7DA 1WDKA 4YJHB 1E7RA 3JQEA 3PJDA 1R0LA 4DPLA 4XDYA 1E6EA 3AWDA 4IJKA 4XGIA 4DLLA 5B4UA 1N7GA 1C0LA 3GAFA 4BQPA 4NBUA 3LQFA 1LXCA 2OO5A 2P4QA 4M1QA 4MP3A 1E6WA 3NV9A 3DWFA 4RLSA 5IN5A 4E12A 1DOHA 1GCUA 1JAYA 3WDSA 2PGJA 4XIJA 4NMHA 5COQA 4P4LA 1I01A 4AJKA 5A9SB 2PTGA 3SVTA 1U8XX 2Y1GA 3PLNA 3RUEA 5L4NA 3C85A 2X8LA 1TT7A 3EGOA 3NT2A 2AG8A 2PGDA 2YQ4A 4JLWA 1TT5B 1E5LA 1PS9A 1R66A 1ZKMA 2C7GA 2NU7A 5AQ1A 2J5QA 2GN6A 2YW9A 3WMXA 1ZCJA 3IP1A 5G0VA 1I2CA 5EN4A 3U49A 3I83A 2Q3EA 2YFQA 3JD4A 1M67A 1WW8A 3DDNA 1DFHA 3JQGB 1AE1A 1S7CA 1F14A 3FNEA 3MZ0A 4B3JA 1GQ2A 4L75A 1A4UA 1PGOA 4PLYA 1YQXA 1JKJA 3OEYA 4PLFA 2JHFA 2A35A 3HQ4O 5CPFA 3N7UA 2O50A 4CLDA 3D5TA 4IDGA 4O63O 1E7QA 2UV8A 3JSAA 5TS3A 1PU2A 2AG5A 3QLJA 3RBXA 5F5LA 1D1SA 1HDCA 5T57A 3E9NA 2B36A 4IDAA 5HTOA 2LDXA 2J3JA 4CM4A 4A73A 1B0AA 1KVQA 1PJTA 4B7CA 5THQA 1P77A 4GMGA 4KQWA 1Q7BA 1E7WA 3TRIA 1NVTA 4HP8A 3WYCA 5DP1A 4BV8A 3WBFA 2IE0A 5ADHA 2BRUA 3C1OA 3ZWCA 4UEOA 4MOWA 4OM8A 3CEAA 1WP4A 1SOVA 1CIVA 3Q0EA 4GKBA 3NT4A 4QECA 5JPIA 3ZN2A 4BMSA 8LDHA 1WAMA 3H65A 4OJNA 4BUCA 2GRAA 3QVOA 4FFRA 4BGVA 3ANLA 1OFGA 1ONOA 3C8MA 4PFJA 4YAGA 1UDCA 1R4NB 1HLDA 2NSDA 1JN0A 3AY3A 3DOJA 4YJFB 1YBAA 4NDNE 4OKIA 4M55A 3A06A 3ZWOA 4YAIA 1BG6A 4NFSA 4D44A 2WWRA 1YBMA 3F4BA 5CEFA 4PLTA 4HY3A 1C1XB 4D0RA 3DMYA 4YT4A 4J0FA 1F06A 4F3YA 3SLKA 1QYXA 3GGOA 4CMCA 3OJEA 2VHXA 3GVPA 4LRTB 3PHIA 5KJFA 4UREA 5TLSA 2VT3A 1VM6A 1PL8A 3U4DA 4EZBA 4EUEA 3K31A 3U4HA 1YJ8A 4GPD1 5L9AA 1PR9A 2WTBA 3RBZA 4NU5A 1KEWA 3WB9A 4GSLA 4BNUA 3C3XA 3ZW9A 5JAQA 4W99A 3DBLA 1D1TA 5H81A 1AXGA 4PG6A 4E3ZA 3JQDA 1EZ4A 3QA9A 4I5EA 4KUGA 1U4SA 1K89A 1JKIA 4Z9YA 3F3SA 4XYEA 1DO8A 4MVJA 4Q9NA 3I6QA 1E3WA 2X5OA 2XXBA 4FGSA 5COBA 5CPBA 4NK4A 2HK9A 2VYND 1P1RA 1XLTA 2O3UA 3PK0A 3PLRA 3PWSA 4KUEA 3ZWVA 1L7DA 3P7MA 4RDIA 4CM1A 3L4SO 3FTNA 4J1TA 4NFHA 1HKUA 4Y8VA 3OBBA 1XEAA 3DFZA 3BXXA 3KVOA 1UR5A 3WYEA 4RVHA 5K0ZA 4EJMA 3H6KA 4UAGA 1YDEA 1QORA 2ZYAA 2FY8A 4OMUA 3WYBA 2P9EA 4FR5A 4BO5A 1QLJA 1V3VA 4Z0HO 4MVJI 1ONPA 1UH5A 1U28A 1ARZA 4NJOA 3PI7A 3GEMA 4JROA 2WEKA 2GR9A 3L6OO 3W6ZA 1GZ3A 1LQUA 5ICSA 4TQGA 4R01A 1MB4A 1HDRA 1PZEA 1IB6A 1R0SA 1X0XA 1GTMA 2GZ1A 2IDZA 5L7WA 1ZJYA 1IZ0A 4NBWA 5G4LA 4DIFA 1M66A 5JW6A 2PZLA 3VH4A 2VOJA 3JD1A 1A27A 4E2XA 5BNIA 2IRWA 2LDBA 2NVUB 4XRRA 3WTCA 2J8ZA 3FTPA 4IY1A 5G4KA 4JCOA 3ZWXA 5C3MA 2X22A 3ZU3A 4CODB 4R4JA 3DBVO 3KYBA 1XA0A 4LMRA 3V1TC 2VCYA 4XGKA 1HLPA 2Y0DA 3ZW8A 4LVUA 3B70A 1YH3A 3C7AA 3WIDA 3HFGA 4XIYA 3V2UA 4BNYA 2GGSA 4O1MA 4XKJA 4R9SA 1PJCA 4WLEA 1K6IA 1GEGA 1HYEA 1XSEA 2H9IA 1GYQA 2X5KO 5IF3A 4ROSA 4WJZA 3BAZA 2W2KA 1YQDA 2CD9A 4W9NA 2BFPA 3P5SA 3TZCA 3ZNPA 4CLOA 3GN2A 4O6VA 4UEJA 4DREA 4BKRA 4J6FA 4NZ9A 3U3XA 4H3VA 3K2BA 3INGA 1PZHA 1HXHA 4YAKA 4LW8A 2AE1A 3QW2A 4M86A 1LC3A 1GYRA 1LDEA 4ILKA 5JYEA 3OSUA 1F8FA 5ITVA 1XKQA 4D3SA 2Y1EA 2EV9A 3NX4A 4I8XA 4L4SA 4Q3EA 3W8FA 2Y05A 1R6DA 1U2DA 3O26A 5CEEA 4JX8A 1DRWA 1NPYA 3C7CB 2ZTMA 4PLZA 1Q0QA 3JQ8A 5T6BA 2PR2A 4ND1A 2NTJA 3KZVA 3RUAA 4CQLB 5F5NA 2OOSA 4QEDA 3IMFA 4DQXA 2WM3A 2O2SA 4MKXA 1GUFA 1Y6JA 2W4QA 1VLLA 3GZNA 1Q7GA 4XYLA 1U1IA 4P4GA 5IDYA 1X13A 3T7CA 2A94A 1DIBA 3X2EA 3WG9A 5BQFA 4U0JA 1C1XA 3VPSA 4DL9A 5JMPA 2HJSA 2EGHA 1PEDA 3S1LA 2Q2WA 1UZMA 4HFMA 1JAXA 1YXMA 3IOYA 1LQTA 3WGYA 5A9SA 2OBYA 4WLVA 3GRPA 3E9MA 4XZ3A 1SPXA 1U3TA 2P9CA 3FR8A 2FPPA 2QYSA 1O0SA 1T4DA 3PHJA 3F5QA 1XG5A 2B37A 1PSDA 4AJNA 5JAMA 4IDFA 2OORA 1KVTA 1NHGA 1CERA 3OA2A 4WEQA 2EJWA 2QRJA 3PWZA 4JBHA 1HDXA 3TNLA 4WLUA 1AHHA 4GGOA 3RUFA 4E6PA 4FS3A 4YJHA 4K1LA 3DHNA 4FIZA 1MX3A 2DPGA 2YZ7A 2DBZA 1NQAO 4FC6A 1E1KA 4CR8A 3CPSA 1Z73A 1BRMA 1GADO 2X0RA 3OIGA 2VN8A 1KYQA 5JYDA 4EJ6A 1IL0A 1J4AA 4XX0A 1MP0A 3GQVA 4EEXA 4KP7A 1O95A 1MC5A 1QLHA 3EY4A 1RJWA 3BMNB 3P2OA 4CLRB 1TVEA 2Y99A 1NM5A 3HB4X 2GD1O 3Q3CA 5I9NA 3VPFA 1ZK4A 3AOEA 1LTHR 3E6AA 2EXXA 5BT9A 2V6BA 3JD2A 3RUCA 3F5SA 4TKMA 5IXYA 4OQZA 4I5GA 3B1KA 1WLYA 1WNTA 3AUUA 1G6KA 4AJEA 3F1LA 5JCJA 2F00A 1I33A 3GUCA 3JYQA 1CRWG 3DO5A 3LC2O 3RI3A 1U3UA 3GVXA 2C0CA 2I65A 2F1KA 4IZIA 4BO8A 4Z6KA 3I4FA 3GEDA 4IXWA 1XIVA 1WDMA 1VL6A 2YJZA 3OIFA 1J49A 4N5NA 4KUHA 4TMFA 5AXCA 3SXPA 2HMVA 2D2IA 1FDVA 4UVIA 1BWSA 4ZQEA 3UF0A 4DBVO 5DN9A 3DZJA 1H94A 1OC2A 2Y68A 2VWPA
chains in the Genus database with same CATH superfamily
4Z4FA 4K0KB 3GDHA 3H5RA 5L7YA 1ODJA 1H2HA 3HH8A 4I1YA 3KYCA 4M37A 5KHAA 1XZNA 4B43A 4C6TA 2JCSA 2AEJA 4PQGA 1LJ8A 4EFMA 2RHDA 1E9SA 1Y8RB 4ZTBA 2OHGA 2H1VA 1VSQA 3EXHB 2N46A 2N1MA 3DPUA 1J70A 1PQ4A 3O47A 3QOFA 1DQRA 5FOUA 5B7PA 1L5HA 1TVCA 2CMGA 2VQ6A 4DMRA 4GL2A 4N47A 1W2WB 2ZAMA 4LGVA 3FAKA 5IMBA 3KD3A 2CJPA 3CSSA 5EESA 2PL9A 4O2AF 3L06A 4RIEA 2ARKA 2VPWA 1N2JA 2QJTA 5CT5A 1AO0A 4IZHA 1L4FA 1N8NA 3ENVA 4HQRA 1TU0A 1FBNA 4PTLA 1BW9A 1FTQA 1ZU5A 3NEPX 3NQ41 2R0QC 2Z5GA 1CUDA 1L2TA 1NNI1 2NSYA 3RCBA 4AMZA 4BNNA 5LU8A 1WY5A 4JXZA 5CM9C 3FMGA 3REGA 1C9NA 3OM8A 3SBXA 1XZHA 4GZMA 1A50B 1O94A 3TNJA 1COWD 1AO3A 3IYLW 1GL9B 4B31A 3HYTA 2PZKA 4JOSA 1F0NA 1XTSA 1CS0A 1I7PA 3IV9A 3T0IA 4V2IA 3ZJ4A 3GFGA 1XQ9A 2HUPA 1KO1A 1ZJWA 2BLNA 2XKAA 2XDWA 2I6XA 1KDRA 1D0SA 2QD4A 3G13A 3L0BA 2I4RA 4G25A 4INOA 5ER9A 3RJ9A 1MOQA 1F4LA 2X9GA 4G0QA 3V4PB 2HNKA 1DAIA 1V4NA 3SQWA 1G5RA 2QQ5A 4QNMA 1GSIA 2IELA 1W75A 4DARA 4I9HA 5BR4A 5LQJA 3QVUA 5GQSA 2IYEA 2EKQA 4GXQA 3WIEA 4E46A 5HGXA 4GH5A 3NBUA 1TJNA 2VDUE 3KEQA 5IHXA 2F55A 4G1MB 2D5BA 4EPWA 4Z1MA 1U0JA 2CVZA 4M87A 4IEIA 4PC7A 2WF6A 3R4VA 2FEWB 1CJUC 2JK0A 2KLHA 3VKUA 4CIYA 2J0SA 4HKTA 3QENA 2UXDB 4PBRA 1T2EA 2WA1A 4BGDA 1ESNA 1KJJA 4HVTA 2Z2KA 1KEZA 3F46A 3HP7A 3U56A 1RLTA 1NSTA 2AZMA 4Q3NA 4CM6A 3AHJA 2WJ3A 2MYTA 4CXMA 5CW1A 5HCUA 2GK3A 1C81A 1YDMA 3GUUA 3K0KA 3ONFA 1O9BA 5L3ZA 2BEWA 4GPIB 3HM9A 2HB6A 2TMDA 1HK7A 4C3OB 2PAFA 3NPAA 5JAUA 2I9KA 5FOTA 3CXUA 5DCUA 3BGSA 3A1EA 4LZZA 4BWFB 4AFNA 3B7PA 3I0NA 3T9EA 4P3KA 1E3QA 4DADA 4EL0A 1GZSA 4X95A 2I2XB 3EFBA 1RYMA 4NENA 3WTBA 4M7WA 4JBLA 3H99A 1MQ8B 1W87A 1AHIA 3D8TA 2ZRKA 4NESA 2ZB8A 2D3TA 3CX6A 1U0SY 1EQUA 2XADA 4L2IA 4CDGA 5C9ZA 1H5QA 4EI2A 4OB8A 1Z6AA 3T06B 3ZXYA 2MSNA 5LMZA 2OA0A 4V0KA 1HFJA 5CA1F 1MUUA 3QP9A 1E1CB 3SSAA 1E1QD 2XKJE 1ZVVA 4XARA 2PZMA 2QGZA 2X2OA 3U5ZB 3N5CA 2CSUA 4R84A 3VZQA 4OB6A 5JJLA 1DKPA 2YXNA 4R8RA 4OH1A 5KQPA 1VZ3A 1CNFA 5JJ5A 5CYGA 3PFIA 5K0LA 1CZHA 2H4XA 1QZ3A 4WCFA 1EXMA 1AY0A 3TECE 2OQIA 1TPYA 3L6DA 3LXXA 3QUQA 3A11A 2HRBA 3BSSA 1YS9A 2IODA 3KT8A 4N7JA 4BQRA 5JDCC 3WOVA 4OQEA 3VZRA 1BZYA 2VCEA 1XTBA 3TSWA 1USWA 5HFAA 4JASB 1NV8A 2PX6A 1UBMS 4XX0B 1OYWA 4IIBA 3IOEA 4YASA 3OPVA 3BD7A 3IAFA 1JEEA 1QHIA 1DNPA 2WSYB 3HACA 3Q3JB 1H9CA 1GOTA 2Y3IA 1MX5A 3Q3VA 1E9FA 1PFGA 1GSHA 2ZAYA 4OVKA 3IGFA 5BUCA 4YCNA 2PT6A 5FPPA 2FZEA 2MYPA 4WT7A 2FPOA 4TKVB 1KIMA 2BFEA 1GQRA 1EX7A 1L1QA 1HETA 3MWJA 4WZBE 1GPLA 4I7EA 3AUYA 3DVRX 3M4ZA 1FFYA 1Z5PA 3F3KA 1IH8A 3LMKA 3MPUA 4KXMA 3STXA 4F9EA 5DM1A 4F93B 4L6CA 4C2TA 5I45A 1JBEA 2VH5R 4DVJA 4Z54A 5IJ9A 4IF4A 1Q0TA 4X54A 2JLXA 4X85A 2UUCB 1Q0HA 4A6EA 5LKAA 6LDHA 5I8WA 3H05A 3ADPA 4CKBB 4A0QA 1DKUA 2ZJ6A 3P0EA 3GLGB 1SVUA 2IP2A 3LZ6A 2QTRA 3O8DA 4ZO7A 3P0IA 5IHPA 2OPBA 4P4SA 1L8XA 5FH9A 4KR7A 4FWTA 2JIQA 3ZWKA 2AFIB 1CZLA 2RHLA 3G2OA 1ZCBA 1V8BA 4LNAA 1P39A 2QLFA 3A6EA 4RY8A 4A03A 4RAOA 4E1BA 1UBRS 3H5OA 1QR6A 2GFHA 4NJMB 2VJAA 3VBCA 2A2ZA 1E2PA 3DPIA 1K63A 1DKQA 2Q6VA 4E33A 3UUEA 3KCNA 3UW3A 3DOOA 2CLSA 3A6PC 1NYLA 1Y81A 4GXTA 4IFBA 5JUWA 4QM7A 1WSWA 3G23A 3LHFA 2D2FA 2BKEA 2WTXA 4YAUA 1ZGBA 3GLTA 2G71A 4U2DA 1P4GA 3IQIX 3IAM1 3PXUA 4RCYA 5JNLA 4UVGA 4F2HA 5CGQB 1N2BA 3GEEA 3EXG2 4MR8B 2DEUA 5EIFA 5BNTA 4UZSA 2I76A 1LRJA 2IP4A 4EG5A 3AHEA 1E0KA 2AI3A 2IZ6A 1ORRA 2C1EA 3DYBA 1V5WA 3QA3E 1KJNA 3B3FA 3MRXA 1WOMA 4E3WA 1PFQA 1ZMOA 1WNFA 3FF4A 2QDKA 1FPMA 2GKSA 4UVHA 1DC7A 1TM4E 2GN1A 1DKMA 4M1WA 4CM8B 2X8BA 2HU7A 4HDMB 4FGWA 4H6VA 3D3WA 1RQXA 3HJTA 1W96A 3GLHA 2BYTA 5K8CA 4D0LB 1GUYA 1UAAA 4WBNB 2P0EA 4L51A 2ZWIA 4O4JB 3TIXB 4MVCA 2AZXA 1FUEA 5A05A 3KHTA 3C4VA 4HQLA 4FEEA 4IFEA 5K3FA 3P27A 1GXSB 3TQTA 3WGLA 1TYDE 4UQLA 1JFFA 1GFSA 1W44A 1IY0A 1XNHA 3MOGA 4HXYA 4N12A 5DZSA 5K3DA 4MWTA 1EFDN 2EJUA 4JODA 1EVEA 2EG5A 4N7RA 2Q9UA 5H1YA 4HWRA 2HJGA 8OHMA 4B2IA 1IHXA 4KJZA 1RTTA 2Q3DA 3ZOKA 1NAIA 1R0ZA 4IGAA 4LKOA 3NM5A 5CFOA 1J8VA 5K7SA 4D41A 1SQ5A 1DUSA 2HN9A 2GPBA 4FS8A 2FE1A 3RHSA 5ALYA 1T8PA 3MWLA 3R44A 4RCZA 3THSA 3CNOA 3ETHA 4RQTA 3RF7A 3A1TA 4I4CA 4ND4A 2QBYA 3WL3A 3CE9A 1I6LA 2J3DA 3HA5A 3O3MB 1Q0SA 2QG4A 5C8YA 1JT2A 1RQ7A 5EXTA 1IG0A 1E32A 3K6JA 4GWLA 4PC3A 1H1LB 2QKYA 2SKDA 3R24A 3SBOA 1ODLA 1YBHA 1ANKA 1LWNA 1ZW6A 1EK5A 1H2RS 1GRVA 3QHAA 4N39A 5CIQA 3CSUA 4YAOA 4GP9A 4S05A 2Q3JA 1C7JA 1OCEA 1HY3A 5GMOA 1E3DA 3GDFA 2IXGA 4TTQA 4QTZA 3M2PA 2FDCA 3IMGA 3U3MA 1W5SA 2Z43A 5GY7A 3IUSA 1L5FA 4V1CA 3ZBTA 4AF7A 3DW3X 3UPDA 4DC1A 1JTVA 2FG5A 3X1KA 2MINB 3R9WA 3ABRB 4LNHA 3P9ZA 1I5EA 3BCHA 2GM9A 1NFQA 2JC3A 3HHEA 1ICEA 3Q85A 2H4YA 4O4HF 1W49A 4OFZA 2O7VA 2PPLA 4PY2A 3UA4A 2QR5A 1GNRA 4FZ3A 4BRSA 4DJEC 1FDIA 3VHLB 1B8NA 4DG5A 3H6HA 4KODA 5AKJA 5BVGA 2ZUSA 1OFIA 2XB6A 1TEXA 4NOLA 2A9FA 4QUAA 4U3JB 1A5SB 2WICA 4Q3CA 4JEMA 5BN4B 2VJNA 5AW2A 3FOBA 5KINB 2NU6B 3R7FA 2NWQA 3IIIA 4HHEA 4ZVKA 5GONA 1JDVA 3BTUA 3MERA 3NHKA 1JHZA 3LUFA 3PQ6A 1LBIA 1W8DA 1WPQA 3W7VA 4TGLA 4ZVRA 1FS6A 5BWLA 1WUJS 3I2FA 3MWDA 3JWEA 3SI7A 3RSZA 3PJGA 4ALLA 2AJDA 1KXZA 3R5HA 1R5JA 2Z95A 4CL8A 2B98A 1UXOA 3L1VA 4JLNA 1TYAE 2CLMB 3GGDA 5ALGA 5DRYA 1W6RA 4FYXA 1GA6A 2VSXA 3O8NA 3RHTA 4AY4A 5DX1A 4E08A 1FIUA 3LPDA 1ADBA 1O2DA 2P8SA 2ZT8A 4XUCA 4JR1A 1L5WA 4RDXA 1P19A 3VPXA 2PE5A 3GJ6A 4RA6A 2X2FA 4Q3OA 3M4YA 4DDUA 2G17A 2RKOA 3LBHA 5ITZA 4Y6LA 3L4JA 3E15A 1KU0A 3KCQA 2C0QA 3C3CA 3PSAA 1N2OA 1QTNA 4WX2B 5JEDA 1DB3A 3EZXA 1JSLA 2VNHA 3DDUA 3G2LA 4IKPA 2BI8A 5HIJA 3A31A 1LZLA 1W5AA 4RA9B 1RAHA 4X7RA 5EWJB 3O1JC 5FUBA 4CTKA 3QVXA 3DHWC 3MGGA 1KZ9A 4Q4HB 1FSPA 4LTDA 4BXOB 1P1HA 3N8KA 4FSXA 1Y3FE 1SXJA 3EGXB 4FOLA 5K3SA 2NPFA 3RVBA 1X80A 3V2HA 4GPZA 5FPTA 1RXWA 1ZJ4A 4ZVNA 4KQ9A 1EM6A 2GYWA 3D8RA 4KIUA 3TG2A 1JU3A 5CLHA 4CCAA 2WILA 2IQ5A 1D7OA 3G0GA 3SJUA 4A2QA 1O89A 3DPSA 2R7AA 1CY2A 5TGDA 4TKVA 2CHFA 4DB2A 3R3VA 4JEHA 3G9UA 3NJRA 4JEUA 4QASA 3L8GA 1JUDA 1B0PA 3H1AA 4HDQB 4RGBA 5IWAB 4KVFA 1L3CA 4PX9A 4DDHA 1JLRA 4MEAA 3HCAA 1QNLA 3DFKA 1C2YA 2W2QA 2YHBA 5EP1A 3WNBA 3P2YA 1ZC3A 3ZK8A 4MLCA 4D8VA 4QRDA 3NT5A 4FFPA 4DTIA 5CB4A 1MOSA 4YP0A 2NZVG 4QDXA 2HF8A 2WF7A 3K09C 4I19A 2AZTA 4L73A 3E5NA 2PNFA 4M54A 5KWSA 3PUIA 2DH6A 2ZROA 3HB7A 4MW9A 2YVKA 3BT7A 3F9IA 3FB4A 3GR6A 3TBHA 1N6NA 2PKQP 5KU1A 1LV7A 2PT7A 2PBRA 3RVSA 2INGX 3A4YA 3WHLA 4ENVA 2WB2A 4AT1A 3DEYX 1DO2A 4MCAA 4ARZA 1P4SA 2PQ2A 3SQDA 1PO7A 1XZFA 4KQFA 4O25A 2AG6A 1GKUB 2WJIA 3W4IA 2HD4A 1NP6A 4UPVA 3PPVA 2RHCA 4TTRA 3FFWA 1AK1A 2PFSA 4Y67A 3RIGA 3MRVA 1GU1A 4M8IA 1DAKA 2IPNA 3E18A 4NSNA 4QD3A 1T2AA 5JR3A 4WXMA 1HL7A 3IT1A 3A32A 3KSMA 4JKYA 5B1IA 1O4VA 3JZFA 4RX1A 3TTTA 4OX9B 4KIWA 4GE0A 3VH2A 5MGNA 4MO2A 2JAHA 3TVTA 3SZMA 2O23A 2VNJA 1YB5A 2SBTA 4YRZA 2K5UA 2ZI4A 5DYNA 4AJ1A 4RIIA 3SFZA 1NATA 1JEYB 3I2IA 3P9YA 3ZLJA 1IY2A 4C0KA 4W5NA 3SVZA 3QPCA 4W63A 4H0NA 4LOHA 3NETA 1XD2B 4A16A 3NJ8A 4JU9A 1JQEA 3HCPA 4HOYA 1U3FA 4PGAA 2F9FA 2R6R1 3BQ9A 4LOKA 2IUUA 4OB7A 1VJ1A 1K8ZB 1AKRA 3KO8A 1K7SN 1Z0SA 3BXGA 4U2CA 1SY7A 4K6KA 4JUFA 2NZ2A 5L4LA 1EFRD 1NHWA 1KXJA 1IVNA 1V16A 4L0QA 4ZGBA 2C5BA 1T1JA 2H31A 4HGRA 3FKSD 2JIPA 1JFSA 1FMFA 2HXSA 1HSOA 2HZ7A 1P7WA 3QPVA 4J0QA 4Y18A 4KR0A 3BXPA 2B8WA 4OYLA 4TS3A 1UPTA 1YZLA 1M5UA 2JI9A 3LCVB 3ZEAA 1IMOA 3GGCA 3WMFA 4HLUA 5JD6A 1UOQA 2YQ5A 1EUDA 2OFOA 2VDOB 3CLVA 3TFWA 2NIPA 5IDXA 5ILOA 1U11A 4KI7A 2QP9X 5D86A 1VCIA 1NRWA 2XRMA 1DV1A 1ZD9A 3EOBI 2EHJA 4R3WA 5KYVA 4HYQA 3RTBA 3U1TA 4MYHA 1BXGA 4YJ3A 3JQPA 2V59A 3C0KA 1HT0A 3CISA 3TL2A 4BC0A 2XVZA 4YV0A 2AW5A 1KQFA 2XD9A 4FMDB 5B4VA 5JPDA 4QVGA 5A4KA 4B6OA 1SO8A 3CURA 3HBFA 5AM0A 1Q0RA 1Y1TA 2B1JA 4L8VA 3QEJA 1K8XB 3I1FA 2XYPA 3KJGA 4JC8A 1JWBB 3EVTA 4X63A 4D0GA 3K9HA 2OG2A 3LY7A 4J76A 3TZ6A 1H4QA 2YUTA 1RWKA 1W19A 3BH7A 5CX1A 3FA2A 3HUFA 3OD5A 1ETUA 4FEAA 3JS5A 4CIBA 5H7XA 1PTKA 4YLYA 4OBXA 1XP5A 3U9SA 1NVGA 4S1TA 1I3LA 2QEQA 5EFOA 3A1FA 1TAQA 2QA5A 1JR3E 4YNBA 4ZRMA 4NXMB 4HBGA 3A27A 3N59A 5JCOA 1R74A 1FX0A 1U6KA 4RZQA 1G5TA 4TXMA 3H9CA 1CD5A 4ZJYA 3LW7A 3UJPA 1NXPA 1CSEE 2P1DA 3C24A 3FUTA 1EFHA 2P9YA 5EKUA 4G4JA 5G40A 1JLMA 3RS9A 4E2WA 4R3UC 1Y6FA 5FBKA 2ZJ2A 3CZRA 2VK4A 1HG1A 2WAOA 1UANA 2DFDA 2ZRCA 2GT1A 3A4NA 4B4KA 5ES4B 1GTRA 3D6UA 4Q6BA 1L4EA 4D98A 3RV4A 5LQNA 2P9QA 2Q6KA 4JLOA 2PJDA 4WKNA 1AHPA 2ZIFA 4NCJA 3TQSA 4G0MA 1Q1ZA 2W2VA 4Q1EA 1D2GA 5F1PA 1E7SA 5BNWA 5JIBA 2P5UA 4RTMA 4ZYZA 2XCLA 3O8CA 3OCYA 5J5VA 2DR3A 2QHXA 1SEVA 2OLEA 4QOHA 1GPUA 5HDQA 4KOAA 4J75A 1Z7BA 2H06A 3N1UA 3AR2A 4QPNA 4WH0A 4UCQA 2ZCVA 4H27A 4PWYA 3QBTA 2YWXA 3SX2A 5ECYA 3L40A 4NHEA 3GJ5A 1OI4A 2NQ2C 1XQWA 5JDCA 3S2EA 1EK6A 5GADl 4Q4AA 2JGEA 4WVLA 1INLA 3CZ5A 2BTOA 3AM4A 3NWBA 1SZJG 4GUAA 1L5OA 3IJEB 4V0SA 2PZEA 3LCJA 3PFKA 1CUJA 3OMLA 4Q5IA 2R8PA 4Y6QA 5ALPA 5DN6D 3RVPA 1RQLA 4UDOA 4XX1A 5K6AA 3P9SA 1OC4A 2BAGA 2GN2A 1YR2A 3FGOA 3I1JA 3BIWA 4GI5A 1JXMA 5E0KB 3TOXA 3DC2A 1OWPA 3KHKA 3JYLA 2AB0A 4O0MA 3C43A 5J4LA 2Y9MB 1MQSA 2B2XA 2AXPA 2WTMA 1XQ6A 3DV0A 2Z2JA 3SVLA 2GN8A 3KXDA 3ZDQA 1Z4KA 4QXQA 4UD2A 4EF4A 2J0VA 1XDUA 1T3ZA 1OLXB 3COZA 3IIJA 2X5NA 3JD0A 2H8GA 4HEA1 4P3PA 4D6XA 4AUNA 1IZ9A 1F0PA 2GHTA 3EXIB 3NP7A 3PGVA 1PLJA 3TKAA 2C4TA 2VQSA 2D13A 4Y2RA 3FCCA 5ESWA 5BOVA 2VWQA 4ENTA 1KK1A 1DVRA 2K4MA 2R5NA 4QUJA 2PRJA 5DXJA 4FW8A 1Z0JA 2VQDA 3A1VA 2GZHA 1LVHA 3PCXA 4JL8A 1S8OA 3RWBA 3V9PA 3ZI4A 4G0OA 4D46A 3VR3D 1ZIOA 2BISA 1CDDA 1Q0ZA 2HU2A 3HP4A 4GI3A 4KPYA 1YIAA 4PLHA 4NPCA 4LHYA 2ZJ0A 1JIIA 2ZVPX 1KYWA 3HDQA 3D3NA 3CPJB 3FSRA 2I80A 1JZTA 3MC1A 3MGAA 3U81A 4AP6A 5KVVA 5M34A 1T1RA 2C7OA 1XZIA 2YY7A 3O8BA 2VK2A 3KPWA 5DM0A 2QY6A 2JCBA 3OCVA 3VYVA 4BNVA 4MQFB 3VKHA 2FPIA 3AB8A 4IOMA 1KOFA 4EJSB 4I55F 4JCCA 3I39X 2ZSKA 2A5YB 2H2GA 3O8OA 2GEJA 2XQFA 3W1WA 2CL5A 2IHBA 3AEQB 1A95A 1Z08A 2D0DA 4JLVA 6ABPA 2H8KA 2TMKA 1EA7A 3N2KB 4LJLA 1AQLA 2FEXA 4MVJG 2APJA 3OM1A 4G1FA 1V6CA 4UZEA 5AW5A 4H1WA 5LP1A 2JLSA 1KE1A 4W1QA 2MR6A 4R6XA 5LQRA 1YVPA 3U4IA 2PEYA 4UXIA 4JC5A 2I29A 1IY8A 4XGNA 3JATB 1YGYA 3IIEA 1N7JA 1PL6A 1SBQA 2RFLA 3L8CA 1GNPA 3VV2A 2XWSA 4OLJA 4TV8F 3ENNA 5HE8A 2VJYA 1UBGA 2JIOA 2VUUA 3DV0B 3OKCA 3Q9NA 1QGAA 3IBFA 4C0HA 3S1AA 4B4UA 4AQDA 1EI9A 4N9WA 1Z18A 3UGKA 4C0WA 4GBED 3B78A 3CFYA 1SU7A 1HFEL 3PNVA 4TXNA 5FLYA 2BKVA 3EFOA 1KTIA 3CRQA 1WQ4A 4JLKA 1DUIA 4IIJA 4B5LA 3IT2A 3AW9A 3VNBA 4TYNA 2G5TA 5I4IA 4AL4A 2GHQA 1LU9A 1SB9A 3AM5A 1O97D 2FMTA 2HLDA 1V2GA 3C3WA 4PICA 4RNCA 4Y2SA 1BS2A 1XT6A 3ST7A 2E87A 4LHXA 1ZSNA 3UJBA 5KVCA 2C0PA 2XX3A 3FCSB 3K0HA 3UG6A 4DZRA 2C1ZA 1NUUA 3CRW1 4R2MA 1WABA 3RE1A 1QB7A 2AX4A 1Z2PX 2NN3C 1E1RA 4MAFA 5CH3A 2DHCA 3GJ8A 4WLOA 4C7MA 4MWDA 1Z0KA 16PKA 2YHIA 4TMKA 1GKIA 1VTKA 3ZY3A 4LRUA 1SHTX 3HCRA 3S5JA 5DM4A 4FNOA 3GLUA 2C4HA 4IO1A 5CB4F 2LD4A 3BTSA 3Q87B 1T3LA 4NK5A 4AJLA 1OXBB 4YYEA 1PWHA 5AICA 2X76A 3JZDA 1ZNQO 2HK8A 3MBOA 4KXFB 3ZIDA 1U7XA 3F6YA 3R8CA 3FNQA 2ZYIA 3EIUA 4ISBA 4TLAA 3CV3A 4LBWA 3AKZA 1KKMA 2X8AA 2PSSA 4W4TA 1YULA 2NUPA 2R5FA 4O4LB 3HJNA 3TCNA 3NUGA 1GUBA 1ORWA 5AUNB 5E7IA 4GOMD 1LSJA 1T0PA 1UKYA 1T2FA 1SIBE 1XRSB 2B5WA 4XPIA 3KLPX 5EZYB 3E7DA 4L16A 2HR1A 1JEDA 4Q21A 2ZXUA 1VL5A 3JWPA 3IUJA 4L0MA 1AJEA 1CEYA 5BP7A 4JNKA 3KYJB 3W4KA 2ISSD 3UUWA 2QYOA 3EXHC 5THXA 1XPRA 3CW8X 3G5LA 4OGKA 1VSBA 1NUSA 4UM5A 1BFKA 1NQ5A 3K96A 3EXEB 5F64A 3RK0A 3MNFA 2XCRB 2WIJA 2F3SA 1ZOPA 2QUJA 5CD9A 2F90A 2V6FA 5EA2A 4YN3A 4NBVA 2FDXA 2VT7A 3N3AC 2DTXA 3EAFA 4HWSA 3QXGA 1KZ4A 3AKDA 3R1IA 3CR3C 2N0SA 1JR3D 3TGPA 1KK2A 4M88A 2R6GA 1ICIA 1X9HA 3DTVB 4CMJA 3A0RB 1Q0UA 2V96A 2W83A 1TECE 1U1EA 3H9BA 2WJHA 4Q19A 1XNGA 2YC2C 2OCYC 2WINI 4GG1A 1SXGA 3A6GA 3WL6A 5B64A 2WSBA 4WNAB 5CVCA 3T9AA 1BJRE 1WCIB 5CT9A 4NVRA 4LF9B 5EQTA 1Z15A 3QJYA 3ANSA 3OLZA 4RZ3A 5DLEA 3VZPA 4ARSA 4C7KA 5A04A 4YT5A 3ZYZA 3W2FA 1ZRNA 1HDIA 1XZDA 3MTQA 3BMCB 2WYHA 5AOVA 3WL5A 2C7QA 1XDDA 5ESXA 3C3AA 1URPA 1CUIA 3K20A 4M0KA 5J3JA 4ARVA 3THWA 3WGZA 4QG3A 1QRAA 2BJWA 2CUTA 2PVCA 5FWXB 3L4EA 1DGQA 2FV8A 3ZHOA 2A7QA 2Z3VA 4I1RA 1NXSA 4KLAA 4C0JA 1J0AA 1KQPA 1S4QA 3E8XA 1MC1A 1AQUA 1WD7A 1GNQA 2IJGX 2VBIA 2R7NA 2P30A 2GPSA 4KFTA 5J2TA 5I9MA 1WDWB 5D5PA 4ESOA 5AVWA 1KMCA 1YR7A 4B4WA 2H92A 3HN7A 4UBLA 1JSRA 3OHPA 3QQPA 1LLUA 3A2MA 5HIIA 1U04A 2FW8A 3LGSA 2XRZA 2P9HA 3CZMA 3Q1LA 3TFOA 3I1IA 1HDYA 2RBKA 1XZPA 5FJJA 2ODBA 1A5BB 1GU7A 1ORVA 1TLTA 2PMDA 2Z6AA 3FH0A 1PNQA 3HDJA 4H35A 4F4UA 3DR3A 1XRMA 3AZPA 4B6JA 5IEJA 4LXIA 1DLIA 1TKCA 2OD2A 2XR1A 3DGEC 3QVVA 4PLWA 3AW8A 3YASA 5DCLA 1GCAA 1M6WA 4J16C 3HEMA 4KG7A 1YS4A 4AVYA 2Z5VA 3HABA 1ZLXA 4FT4A 2ERYA 4MW5A 2RGUA 5BMVB 4IDQA 5FNVB 1U8ZA 3ZIUA 5KC8A 2BM1A 2CFTA 3UMYA 4HI0E 1BVUA 4MUGA 4UVEA 4N54A 2D0OB 2A3RA 3E3OA 3HL4A 2XCUA 2CF6A 1QZUA 2OR3A 4YMGA 5B6PA 4KAXA 1QQBA 3R6DA 5AJXA 2Y1KA 1G4UR 3TE7A 4AO8A 4LXXA 2WQ7A 3RD5A 3ZHZA 1BWQA 4BP9A 5LNK1 2FPLA 2JVJA 4MPRA 5K1SA 2FMFA 3KKQA 1D9XA 4OYRA 4F2PA 3ZWMA 1SA0B 3BJIC 4WESB 1PDOA 3O1HB 3P94A 4GAEA 1YACA 1NY5A 4W7IA 3WRVA 5LMCA 3NONA 3E3AA 2G7MC 3THYA 1P3DA 3ZNNA 1Z12A 3ZV3A 4JXKA 3W2GA 3GT7A 2OVBA 3M82A 4E5SA 1UAGA 4OGFA 1NX6A 2GYYA 4MS3A 3M33A 2XGJA 4MYSA 1PJSA 4CN9A 1QFYA 3JQBA 1EUCB 5IJWA 4BWYA 3QWIA 4EHDA 4L3WA 1QIFA 1U7TA 2V6GA 1MLDA 1AA9A 1SMKA 1ZITA 3D6NB 4WCVA 4YJ3B 5LC1A 3VQTA 4C3ZA 5CA1B 2IW3A 3VKVA 4RDHA 5JV5A 1NIJA 4LHSA 4BNXA 4YP9A 4LDJA 5JAZA 3TZHA 2Q21A 3NEAA 5EINA 5SY9A 4EM6A 1HT2E 3R0VA 4A82A 5IMSA 1KJ8A 3LVFO 1GG8A 2WDZA 3CTPA 4F1KA 1RKVA 1V4BA 4YONB 2BZ0A 3K0CA 2YV1A 3NALA 1LFDB 2JGLA 3TZQA 3C4QA 1VGVA 5E8RA 2DJIA 4R1MA 4CF4A 4QE3A 3U09A 2P9ZA 3ZH2A 5A5VA 1SG0A 1G7TA 1TCVA 5E3JA 2E49A 2GNOA 3RIYA 2WUFA 4FDMA 4FUTA 4ZIRB 2FUG6 1UPFA 2H1CA 4JGGA 2XQVA 2IXBA 4JELA 4M1OA 3P2KA 2OV1A 2FWNA 3D7LA 4IJQA 3LP6A 2OZLA 3LP5A 4MW6A 2GH1A 4PVCA 3QFFA 4LZOA 5SYAA 2AVDA 3TW8A 3U3JA 2AKYA 1RAEA 1M8FA 4A7PA 2HADA 3HZZA 2W8BB 3F7TA 3IR5A 2IYTA 1UFOA 4TS9A 1IE3A 4WD3A 1ECPA 2XNDA 4YRMA 3ED1A 3I4CA 3N2EA 3O6VA 1F3OA 5DLYA 3FYSA 1B8OA 1M2OB 3FYUA 3HLTA 4MV0A 1OTYA 3ZHYA 3I52A 3NHUA 2HRCA 4RELA 1CUHA 3EVZA 3A36A 3FLMA 4M0FA 3TUIC 5C5IA 2PZBA 4V0OA 5EVJA 4D3DA 1ZNXA 4R83A 5K05A 1K0FA 4WWHA 1YU9A 4E14A 3WMGA 2B7CA 3DMFA 4XR4A 1X7HA 4R9RA 3OWXA 4TL8A 3RUCA 2VF8A 3K8OE 4TXJA 5BSFA 2ZTHA 4OLHA 1A71A 5JBIA 1KI7A 2HV9A 1L7PA 1O54A 3JASA 3HBAA 3ZDFA 5B6JA 1OUMA 5BN3A 5LZ5A 2NVBA 3B1YA 1DMSA 4ENSA 3LQ4A 1JGTA 1L7MA 2BELA 3OZBA 3W6PA 3HADA 1MIOA 2VPXA 4EHNA 1MW9X 2VTBB 1KDTA 1QF9A 2VG8A 3GH3A 1UP4A 3HVJA 1JKXA 4WNCA 3MJRA 1NLZA 2J1LA 3AYZB 5DK6A 4D45A 3T0GA 5KJCA 3R7AA 1PHPA 2VDJA 4FE4A 5ICGA 1I3CA 1Z28A 1E5VA 2HJRA 2NTYC 3L7MA 3KSBC 4EW3A 4OLAA 1X94A 1O1YA 2ZSFA 1GZVA 4KMSA 3CR8A 1F6DA 1QQTA 4YTEA 3M81A 1ULTA 1CX9B 3G5AA 4WXHA 2V5UA 3FNBA 1PZFA 3C4JA 3Q15C 1NV9A 4EELA 3ZHTA 3Q12A 2AFHE 1FLAA 4KQGA 3CYFA 1W36C 2PKYX 4I9GA 3LUAA 5AVRA 1OA1A 4CEJB 3VR5H 1T4GA 3T3OA 5IZCC 3ESRA 4PHFA 5CCXA 5LD2C 1B0UA 1SXPA 2ODEA 1FDRA 3DWEX 3AC0A 2Q41A 2GF2A 3IDAA 4U2KA 2QVCA 3VHQA 1EGQA 2I2FA 2YXEA 2ZSUA 4MYCA 1ADYA 1V8DA 3GLSA 4QGBA 5EZYA 5IJ9B 1QP7A 5EJEA 5AESA 1KY3A 3I62A 1QIIA 4WA7A 1Z29A 5AXDA 1C1HA 3OZ7A 5AHWA 1Z5UA 3WA6A 2VUHB 4KRFA 1MR3F 1JHPA 3ANNA 4F9FA 2YR0A 3N3BC 1SULA 1EE9A 2VAPA 1OHHA 2JAPA 3NXSA 3A37A 1O77A 4RTPA 1PQWA 4A2WA 2QU7A 4CQLA 3EFHA 5T8KA 3CUUA 2JJQA 4MRMA 4GP7A 4GR9A 4UNNA 1RJEA 3S0JA 2WUGA 4F2WA 4O2AB 1FZQA 3A6LA 3P2MA 3O9VA 1E98A 1PNVA 3Q40A 2WLTA 4QDUA 4LWOA 4TSKA 3FDJA 1MEJA 5REQB 3GYBA 3QIAA 3QWBA 4GOOD 1SOAA 3GNSA 2G76A 4PC2A 2IU6A 5T4HA 2GXSA 1DC8A 4YAEA 1M2WA 4XGQA 4CMEA 1FL9A 3C3EA 4X7PA 2R7MA 3ZE7A 4BKMA 4D97A 4DQVA 1THMA 4DIKA 5KOJA 3A3NA 3TTSA 3FCXA 1HI9A 1W0JA 5CITA 3TI7A 1XZGA 3FVQA 3HNRA 4KIFA 4DF3A 4EYGA 5A6VA 3THOA 2JK1A 2NXJA 1A8IA 3AFOA 2VDWB 4ZO8A 4G1CA 3WDLA 1OOEA 2NV0A 3TRFA 2IX9A 2W0MA 3CZ4A 2PU7A 2QN2A 4F84A 2HWUA 2OAP1 2ZU6A 4PLPA 2NTEA 3KQSA 1WQ1R 3O4HA 5CGZA 1RRKA 3MT7A 4L4XA 4U00A 4D4LA 5WRFA 5DHSA 1RQGA 3JRXA 2C3YA 4JBXA 4MW7A 4PHCA 1K98A 2WD7A 4Z9BA 2AS0A 4OJTA 2ZSBA 1R4MA 5IDWA 1BCSB 2AHRA 4G0NA 5C8VA 5AVTA 2C2BA 4X1IB 1U0FA 2L82A 5FV7A 5TC4A 4BP8A 5B6IA 4ARBA 1RPNA 4KN8A 1UK6A 2CHQA 3IHLA 1GL3A 1NDUA 3OY7A 3PPYA 4PZUA 2ZYVX 3RQSA 1WXXA 5BWNA 4BNLA 2BT4A 3LGAA 5JU6A 1QHSA 2Q62A 2R6ZA 3UT5A 4PO1A 3HKDB 4U6QA 1FK8A 1DPGA 1HH4A 2QRGA 4JI7B 1XTVA 1KRWA 2FCRA 4TSFA 5GZ1A 2YYYA 2ZJAA 4YMSA 5D3MA 2XCOA 5FBQB 3V1KA 4Y2YA 3GLRA 3QX7A 3KFXA 4PXSA 1JWLA 2VRWA 3UAWA 4YCLA 4B74A 1ZP6A 1JDNA 4F4CA 2JLYA 4OG2A 4X41A 4I3FA 1V35A 1XRJA 3ZVRA 1YO6A 1SH7A 2WDPA 3KUDA 4L74A 3ZEIA 4D9GA 2I1QA 4YH1A 2QM8A 3UKDA 1QC5A 4KXLA 3VYWA 5KSOA 2GNAA 2CJXA 4JI2B 1FUUA 2W90A 4YROA 3A58B 3GG9A 3LWNA 1DS6A 1GL6A 2OBNA 2VDLB 2BN4A 2CY0A 5FEMA 2IKQA 4YHBA 3PRYA 4DJDC 4PIVA 1YRYE 3HJAA 1U0RA 2UYYA 3BL8A 5AH0A 5FKJA 4CGZA 3KAPA 5IBCA 1JA1A 1H2WA 1L8QA 2AJ8A 3PB3A 4N7MA 4AJ2A 2PGAA 3GUZA 3W1EA 3BWCA 5F3RA 2F3RA 4AZ0A 5CB0A 3G2NA 2QT1A 5IJ0B 2FSIA 4BO1A 4EW2A 3OHMA 4C1BA 4DUYB 2YHIB 4PPQA 3NHWA 5FA5A 5CXQA 1Z6PA 4H7PA 3U26A 1OPRA 4EPXA 4S35A 1LUAA 4XM1A 1X87A 4CHGA 4HSEA 4PS0A 2O19A 1GLGA 2JHAA 3V1MA 5K3OA 3DCYA 2ZJZA 4XUEA 5IH3A 3SEFA 2YWFA 1WVGA 2JCYA 4UTXA 2RK4A 4M36A 4BQPA 1AU9A 3W9YA 2E85A 4PYQA 4UXJA 1OH7A 5EIHA 3ROQA 2XUPA 4RIGA 1H4SA 1C0EA 2FSHA 3L7CA 4MP6A 4P2GA 4WZAE 4YJGB 2HPVA 3BE6A 1YA8A 5DNVA 4QX6A 2CNNA 1WOYA 3JQFA 5KTMA 1FTNA 1Q3HA 4AS3A 4EEZA 4UUAA 2M6KA 4AZ3A 4JI1B 1ISFA 2NZXA 2ZUUA 3E4CA 5FNVF 3EJWA 3HG7A 3LPCA 3TI9A 2JJ1A 2LR0A 2XVXA 3M6AA 3WYNA 4UPEA 1EZZA 1YZ3A 3NHSA 4H60A 5TT0A 1FNCA 4YMTA 2ZWAA 5AJZA 2ZOSA 5DNWA 2JG3A 3PUKA 1KETA 4DV2B 2XF2A 1B23P 1E4OA 4YJ2B 5HFJA 1M6VA 3E22A 3ONWA 4UUOA 2RHMA 4XM2A 5SZIA 1NA5A 1L4NA 1F8GA 2J9GA 4WLFA 1J39A 2QRMA 4IP0A 1FSSA 1L3IA 4RC9A 1DX6A 1BEEA 1D1QA 2B1GA 2VPQA 4BFUA 1PR6A 1I0ZA 1S3SA 1PN3A 2NLOA 1G60A 3EGVA 3FLBA 3Q11A 2X9QA 5LQSA 1YAHA 3KOOA 3OAAA 4R41A 4OHUA 1D07A 3WIOA 2OD7A 1P3JA 2QSYA 2RH9B 3KEFA 4JN6B 4KNVA 4ZOCA 3VC2A 1WV1A 4A0SA 1I7SB 1V11B 5KOHB 1CVLA 1NWCA 4RFSA 2FOXA 4XQ0A 5C8XA 4ITRC 2Z1DA 3QYFA 2CCJA 3PQ8A 1I1NA 5LQAA 1PRYA 1N6KA 1EE2A 5ED0A 4OPMA 3KELA 3U61B 1QV6A 3KLOA 1ECCA 1G19A 3AESB 5CDGA 2PLFA 1N6IA 1WF3A 3GFQA 4J07A 1EXWA 4LISA 4OJKA 4AF6A 2ZYTX 5B3LA 4WXRA 1NKSA 4R1NA 1IMJA 5CNIA 3MHPA 5GZ6A 4QU9A 1CQJA 3H1FA 5LUBA 4B35A 1JB9A 1N77A 2NUAB 4E2FA 4PNZA 5IK2A 2XB2A 3C5EA 4O4JF 5EGSA 1K92A 5TPWB 3LDHA 2JL1A 1UPUA 2YIDA 3C41J 3FN4A 1ZRHA 2ZIGA 1D1PA 2GEFA 3WLSA 3QYJA 1A2OA 1UT6A 2P5TB 4XVHA 3I8OA 1YQUA 4FYKA 3PF9A 3IUBA 1IXSB 1YUMA 3PIIA 2O59A 3QVTA 3TJMA 3NBMA 3UY4A 2Q1TA 4EQZA 4FZVA 5IKOA 4AURA 5ITZB 2DY0A 2OUKA 3B82A 4IKEA 3G3EA 1R8YA 1BAPA 4KQ6A 3ZE6A 3TDNA 1OA0A 4P5DA 5AW1A 1U9ZA 2D0IA 2G1AA 2P2ZA 3P1JA 2DWCA 1NXOA 4MKRA 2QD5A 1MNQA 2GSDA 3EGWA 5DSZA 4ZVTA 2H18A 5LXTB 3BHNA 1JR2A 1F48A 3IAM6 3LF1A 4O2AA 1DC6A 3ELUA 3OX3A 1Q2UA 2PL1A 2R6AA 2O2ZA 2XGOA 3GFPA 3ORSA 4GWGA 5CMLA 1PGJA 1E92A 3O1LA 2FN7A 4YQFA 3TE6A 2ZJ4A 4AKEA 3NGMA 4LTNA 4C0SA 3U17A 3G8AA 2JLVA 2VDQB 1PX2A 1QZXA 2RJOA 1G8HA 2R8YA 4QDKA 1EB9A 2QVYX 3AF3A 5DV9A 4B82A 1WMEA 2BW0A 1LLFA 2L19A 3H11A 4ESEA 3UZUA 4EO4A 3LBYA 5L4SA 3L7NA 2R9VA 1V71A 1MB3A 1ZKDA 1UKVY 3DLCA 1N0WA 2CUKA 2PH5A 4GLBA 3RUIA 3T5PA 3ZGLA 2Z6VA 4HGOA 1OIWA 1S02A 3TQHA 4XYGA 4BQOA 1NMXA 4EZIA 1ZNYA 3DDWA 2ZUVA 4S04A 2ZWPA 2OFFA 5DBIA 1R0WA 3PGA1 2M6LA 1FJ2A 3HCDA 3K1AA 4UTOA 1G41A 1JXQA 1B73A 1SEPA 1Y1RA 3JYOA 5TJHA 1NOKA 1N6RA 3LLSA 4N5HX 5TJ9A 2W98A 5LFAA 5EKDA 5BR8B 2WG2A 3MEQA 5LZ8A 3UICA