1ZSZA

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
molecule tags De novo protein
source organism Haemophilus influenzae
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszA00
1OU9A 1OX8A 1YFNA 1OX9A 1OU8A 2QASA 1ZSZC 2NYSA 1TWBA 2QAZA 1OULA 1ZSZB 1ZSZA
chains in the Genus database with same CATH superfamily
1EIFA 3EGDA 1JXMA 3GLXA 1I5OB 4ESRA 4MZPA 3AT1B 2KYBA 1OULA 4MZMA 1KJWA 3CPWA 4XK8E 2JS2A 5I21A 1PWTA 1LVKA 3TSZA 3TSWA 2DILA 2QA4T 1FMWA 4M77F 4M78A 1LOJA 1YIJA 5A2QE 2A36A 2E3HA 3ZEHA 2CUDA 4KGXB 1D3BA 5IXBA 3M56A 2C0OA 3HPWA 4WTOB 4AFQC 3SFMA 4XTZA 4M75C 2E70A 2G3RA 2OAUA 2DLPA 4J7IA 4RKUE 4N4GA 1UJ0A 4L59A 3CCLT 2XG8D 4RTZA 3VRZA 1O9SA 2LQKA 4ZTJA 1B34A 2KEAA 1YITQ 4QT7A 4IUPA 3MPUB 3LLRA 1Y0MA 2COZA 4RMOA 3JB9G 4KH0B 2COWA 1I0CA 2YUOA 1G5VA 4TVRA 4FCYA 3TVTA 1K73U 1M90U 1T0HA 3E9FA 3H6ZA 3JCMP 1JJ2P 5AT1B 1R0CB 2KDSA 1X69A 2DXBA 2DFUA 1X6GA 4JS4A 1T0JA 2K2VA 3I35A 1Z9ZA 2PVGB 2AZVA 1OV3A 2RQRA 4J8OA 1IHWA 3QYHB 4OMPA 2VC8A 4J83A 5LJ5f 2RJEA 4J9IA 4A53A 3A8OB 1IREB 1IHVA 1VQ9Q 3P8BB 2CH4A 2HMAA 1D3BB 1OX9A 4BE2A 2RQVA 1M3BA 1G83A 3BW1A 3GNFB 2RHUA 1ZUUA 2RM4A 5IHKA 2L0AA 4M75D 1E6HA 1VQPA 2RI5A 2JVVA 3EHQA 2KR3A 4Q5WA 1K4US 4LDYA 3L1AA 3LW5E 2DYIA 3A8GB 4KGVB 1UGSB 1KHIA 5IXFA 1M1KU 1SKUB 5LJ5e 3OYLA 3H9NA 1N6AA 2ED0A 5I2SA 3JCMe 3CXCP 2CT3A 3GP8A 2JW4A 4BI4A 3PNWC 3CCRQ 2F1LA 3FEOA 1Q81R 2IG0A 3M5AA 3FRNA 1OQKA 1K9MC 4M7DB 1VA7A 2JN0A 3S3NA 4C0ZA 4HCCA 1KG1A 1H641 1M27C 1KQSS 3H8ZA 1JBMA 2F5TX 1SG5A 5LJ3g 3G6ET 1FXXA 2X9HA 4YTLA 1NJIR 1WIEA 3CCST 4JS5A 3M0QA 3M0RA 3HSBA 1Q7YR 3QPHA 1QVFP 5GAOm 3VS0A 2GTJA 5EG2A 1E6GA 2YLCA 2BUDA 4OB1B 1WJSA 2EYWA 3SWNA 2QXFA 3OYBA 1I81A 3FDRA 2CS7A 2R57A 1YHQA 1ZA2B 4E7KA 2V26A 4PJOA 2O31A 4BACA 2QQBA 2V8JA 4Z02A 5IAYA 4M7AA 3EG9A 1YHQQ 3MJXA 2RHIA 1AWXA 3M53A 1YJNA 4Y91A 1HXDA 3JCMb 3BE3A 2O9SA 2LX7A 1HYOA 1B07A 2LJ3A 2DERA 1TUDA 3URGA 1GBQA 8AT1B 3ASKA 3E1SA 4M77D 3JCMf 2KY9A 1VQ9A 2FO0A 3OSSC 4RTVA 2BE9B 2CP7A 4KBMB 4IUTA 4R55A 2LP5A 3RESA 2YLBA 3OMGA 5GAN3 4BE1A 2PNIA 3VS7A 2EQMA 4JPBW 4F7UA 2DVEA 3FJPA 4C92C 1K9AA 2CH4W 3MEVA 2AT1B 1IGQA 1JRIA 1VQNQ 2COYA 4FL6A 2DZCA 1UECA 1OYXA 4BD3A 4EMKA 1BCMA 4X9DA 2RJFA 4C5IA 2H3JA 2LT1A 3GPLA 3EFSA 3SWNB 3TCJA 1K0SA 3M0TA 1OPKA 2GTOA 1WJQA 1X43A 1M5Q1 1U06A 2YSQA 1YITT 2HSEB 1PC0A 1D0ZA 2PZ1A 2E64A 3DB3A 1XQHA 3INZA 4N0AC 4C8QF 2Y4XA 4M7AB 3BDLA 2DRMA 5DLQE 1YN8A 2OX7A 4DEYA 1HK9A 2QDYB 3H0HA 2XK0A 1Q82R 3M57A 4QW2A 5KE2A 3V8LA 4BDYA 1TG0A 2CZ1B 1JO8A 2QDLA 5HY6A 2MYSA 3OYGA 2QQRA 1WXUA 4PJJA 3V7SA 2CDTA 4RTYA 2B8AA 2QASA 3CCLA 3FC3A 1WHGA 2NUZA 3I56A 4OP0A 5A0LA 5GANh 1BI1A 4BI8B 1R0BG 1UEBA 3OYDA 1QKWA 1TSFA 2JS0A 4PFOA 4IIOA 2CZ6B 5CK9A 5I11A 3CMEA 2JTFA 3A1PA 2VGNA 3PVLA 3PMIA 2MOXA 2A08A 1O75A 1WZOA 1WQ7A 3T9NA 2WSFE 2KRMA 4PFZA 5GAOq 2YXYA 3I56T 3SB2A 3CXCS 5FU6C 3TREA 3RERA 2FYKA 2GFAA 2QEXT 2K4YA 4FW1A 3G71A 4PJMA 1VQOA 2RPNA 3E19A 5IT9E 1KFZA 4X34A 1RAFB 3OYCA 4HT8A 4NS5A 2FPDA 3JSCA 1WQWA 4J9FA 3VYHB 3I55T 3G71Q 3GOXA 1K73C 1I5LA 1VQOQ 1UFFA 1C6VX 2JMCA 1M2VA 1VQ8T 2M0OA 2DZ9A 3CC2A 4C5GA 2EYYA 3UA7A 3NTIA 5GMKe 1ZSZB 3CCJA 2A7YA 1UG1A 3CC7Q 3CBOA 2FPEA 2X3XD 2E3IA 4KUIA 4M7DA 1W2BS 4LDUA 1VQ7A 5LJ3d 2EJFA 2L3SA 3SDZA 2R5AA 1N8RU 3I5RA 3CCSQ 3CCMA 4ZN3A 4PL6A 1J3TA 1FMVA 1VYTA 3VRYA 1AVZC 2W10A 2RJDA 5GANj 4C0FA 1OEBA 4VUBA 3VS1A 3EGXB 2L8DA 1VIEA 2VXEA 1IB8A 1UUEA 3JV3A 3L2ZA 2QA4A 2EQUA 4HVVA 1RUWA 2K5IA 4M7DC 2L3RA 4M7AE 3JCMJ 2C06A 2QYZA 4N0AA 3ZBDA 3OW2S 3M9QA 2VVKA 3MEWA 1D09B 4KGZB 4EMGA 4ZNXA 2DL8A 1RAGB 4HCZA 1K9MU 1WA7A 3CD6Q 3ULRB 3EH2A 3S6WA 1NJIU 1E7OA 2Y4YA 4C0GA 4E6RA 1TOVA 2CREA 4XTUA 1ZUYA 4XTVA 1GCPA 1TTHB 5GMKh 1EZZB 1EFNA 2DD5A 3OYYA 2H3EB 2QEXQ 1M1KR 2XU8A 2GGRA 1X75C 2ATCB 3QZ5B 5LJ3f 1D0XA 3QBYA 1SRLA 3BDUA 2IIMA 3R6NA 2O9VA 2RB6A 1G3SA 1X6BA 2AKKA 2O4XB 1VQMT 4FIBA 2QAZA 3L2QA 2DVJA 5C6SA 3OBWA 3NHNA 1K8AC 1MV3A 4IIMA 2DBKA 4BY6B 2YUPA 2M16A 2OAWA 2ZPBB 2DKGA 4P5NA 2K5FA 5IHNA 2DTIA 4JDSA 2JNGA 1QQJA 1WJRA 4GLMA 5GAOl 2ROLA 2RA2A 5DY9A 2KT8A 1JB0E 2P0PA 5CR2A 3G6EQ 1AZGB 4J9DA 3RKYA 1NBEB 1Y7XA 5GAMe 2MK5A 4HVUA 1MHNA 1QVGS 2YWWA 3JCMh 2EGEA 2PQWA 4MMKA 4RCBA 2EVRA 4MDXA 5LL6S 3RR6A 4JRPA 1F1BB 1ZUKA 3PFSA 2JT4A 4J9EA 2YRCA 1W2BA 2LCSA 1KC8R 3P8HA 4J6XA 2V8KA 3TQ7P 5AYFA 3OS2A 1WYXA 1ZBJA 5GANe 4OVAA 4ELZC 2QTVA 4OMLA 4J6WA 1K8AU 3UPUA 1WGSA 3G7ZA 2C0TA 4IUVA 4KT0E 3OYHA 1N9RA 1UHCA 1JU5C 1MV0B 5KYNA 4ZGEB 1VUBA 2DRKA 3J80E 2OTLA 3VU3C 7AT1B 1U1TA 3M58A 2I2LA 1VQ4Q 4E47A 4J7FA 3U23A 1UGQB 1KSWA 2DXTA 4QVDA 2P84A 2D8JA 3META 2D0QB 1V76A 3OW2P 4M77A 2PUOB 2CGHA 1BI3A 2JJ9A 2HSPA 1N8RC 4M7DF 4ZN1A 1KQSP 5HK3A 3E9GA 4D6WA 2PVDB 3ER0A 1KHCA 3VS2A 2HBWA 3S3MA 5A0GA 3MHXA 2LCCA 4R0KA 1VQ8Q 4M7AC 2AK5A 1LCKA 1BB9A 2QI2A 2DMOA 1WHHA 3OS5A 3THKA 3CMET 3M4GA 1T3LA 3DB4A 3J7AF 2X51A 1PNJA 3PTAA 1W4SA 2NUPB 1C0MA 2ED1A 2KBTA 2K3XA 4AG2C 3PIOA 5GMKl 2KRSA 3M59A 3A8MB 3OYJA 2ESWA 2SEMA 4LNPA 3NMZC 4EIKA 2MIOA 4AFSC 1Q82U 5HKCA 1TUCA 2EW3A 1EX4A 1SF9A 2H8HA 1BU1A 4DOWA 2O01E 1WI7A 4CC7A 3X24B 2K57A 5LJ5d 1H8KA 5M9OA 3S3OA 4AG1C 3BY7A 5GAMj 1YJ9A 1UGVA 2HCKA 3VUBA 2PTKA 3EG0A 2JM9A 5CKDA 2O88A 2JTMA 2VKNA 4XAXB 4CC3A 2VWFA 2RHZA 3MCAB 1BKBA 1V29B 3RKWA 2DAQA 2DE0X 4FM4B 3CD6T 1Q81C 2F2VA 5FROA 2V1RA 1PSFA 2KGTA 3M54A 2LVMA 5CCAA 2DK3A 4MZTA 1SEMA 2DXCA 4RTUA 1M8MA 4LDWA 1KQSA 3RDVA 5GJVB 4HVWA 3CCUQ 2RQTA 5CKEA 4JZ3A 3H0IA 5KH6A 4M77C 2DL3A 4EMHA 4XU0A 3GIBA 1ZSZC 1GL5A 2EAYA 3OYIA 1WLPB 2A28A 4C92B 2E10A 4QKUA 1WFWA 4DQ2A 1PG5B 2KQWA 1G2BA 3UATA 4UC4A 2FPFA 1RI9A 2DL7A 5KCOA 3EG1A 2FG0A 1M1FA 1ZSGA 1VQ5Q 5KYYA 4LN2A 2P0KA 1N8RR 2ZPGB 1SRMA 4JRIA 2BZ8A 1FYNA 3CCRT 3X20B 4XU3A 3OYNA 4OMFB 2BKDN 4E7HA 1R77A 4QQ6A 2SRCA 3G4ST 2QG9B 1NJIC 1VQ5A 1YHQT 1X27A 4PLIA 1YJWT 4Z8AA 4JZ4A 2MAMA 3A98A 2DEUA 1PCXA 2IPOB 2E5QA 2VASA 2GQVA 4E7JA 4OB3B 1X2KA 3CCRA 5HK0A 4KULA 4C8QE 1KD1R 4V2SA 3CC2T 2VB6A 2F5KA 1A0NB 3HRTA 6AT1B 1ZHIA 3QO3A 5CKHA 1NPPA 3CCQA 2NWMA 4LDVA 4M77B 1KC8C 2F2XA 1K0XA 3MEUA 1DJ7B 1VQKA 2ZPFB 5GAOp 4ORZA 2FHDA 3CPFA 5IH2A 5GAN4 1S1NA 5IHIA 2CP6A 4BY6C 4E7IA 3E2UA 3LH0A 3M4YA 1OZ2A 8ATCB 1K9MR 4M7AG 2KXCA 1MMGA 1VQLQ 2LRQA 1RAAB 4A4KA 4RUGA 2GQIA 1ABOA 3LGLA 1I07A 2PUKB 4JRKA 4CRIA 1G3WA 4PKCC 4LD6A 3LWHA 1KC8U 3AHUA 4PJOE 2FEIA 1NEBA 1UB4A 2FZKB 1W1FA 5FU6B 1YFNA 2BIVA 1H3HA 2L3PA 3JAME 2E1HA 2BZYA 1UDLA 1K8AR 4O6JA 1XJWB 5CAIA 4M78G 2HKQB 2DL4A 2XDBA 4F7UG 5KCHA 3H41A 2E12A 2QQAA 2WSEE 1RLPC 4BB7A 4L6V5 2X4WA 1NZ9A 4Y92A 2XDPA 1PHTA 4RTWA 1QCNA 1NYFA 3R6OA 1JEGA 4F7UF 2OI3A 1H92A 2J06A 3OYFA 2X4XA 1AHJB 4A4GA 1RABB 2EPDA 3CCUT 1U3OA 2PVOB 2DO3A 4AFUC 1BI2A 2DYBA 4J9BA 1N27A 2MPXC 2D9TA 2E41A 2YT6A 3OQ5A 2IVWA 1NM7A 3JRZA 3LX7A 4M7AF 1S72T 1ZA1B 3N5BB 1Y57A 4XTWA 3EH1A 1K1ZA 3QZ9B 4LXCA 1QVPA 2ZGWA 5LJ3e 2YUQA 1H3ZA 2FRYA 2KAFA 1X2QA 3BFMA 3LWIA 1TS9A 1Q86C 4PJNA 2YHTA 1S72Q 3VS3A 1VQKQ 4FT4A 2RHYA 2EJ9A 3A8LB 2MMPA 1NG2A 3CQTA 1GFCA 1YI2T 4AT1B 3OBYA 1JJ2S 2EJGA 2FRWA 3P8DA 1B7TA 4O5VA 3QIIA 3J81E 1Y07A 2RF0A 4A54A 1QWFA 2CZ7B 4FYXB 1AWOA 4PJOG 1RAIB 2OTJA 3C0CA 2J6KA 3CMEQ 4B9XA 1MMDA 3OYMA 3JB9J 1FWZA 2E4HA 5J39A 3PT9A 2DXUA 2K7AA 1D1CA 3NFCA 2XICA 5DM7R 3OMCA 9ATCB 2XDDA 1VQKT 2HKNA 3CXCA 2OTJQ 3CCEA 3EG3A 2QA4Q 1VYVA 1M1GA 1ZBXA 5KYYB 3QXEB 4JLGA 4C92E 4RTXA 4IUUA 1JXOA 3RBBB 4C8QA 2MI6A 3PVQA 3CBMA 2WACA 3EG9B 2EQIA 4ZTFA 1VQ6T 4A4EA 4Y28E 4FYVB 2FB7A 4C5EA 2J05A 1AOJA 2LT4A 3QDRB 1SSFA 2D8HA 2LC4A 1M3AA 2DBMA 5J26A 4M75G 2L89A 4CC2A 3LYIA 2J6OA 5FU7C 2AHJB 1BI0A 3VS5A 1OPLA 2LCLA 1WHLA 3UF4A 1QCOA 4EMKC 1BIBA 4F16A 5FRNA 3VYGA 1GCQA 4HKEA 5GANd 3CCVA 1VYUA 3CCSA 1MMNA 2E5KA 3MO8A 2R5MA 1YJWA 2CT4A 4B6MA 2L5QA 1KIKA 3CMAT 1VQNA 3HFNA 1OU9A 3QWYA 1QW1A 1LJOA 2DTHA 2KE9A 2ZAEA 1PKSA 2W0ZA 4C5HA 5GAN2 5GAMd 4AFZC 4R56A 2OJ2A 2HZYA 3SD4A 5LJ5j 1Z9QA 3MP1A 2ZZDA 2KXDA 1M4ZA 3CCMT 3PMTA 2ROTA 2YDLA 3HKSA 5GAMg 3CMAA 2RO0A 1WPYA 2XIDA 4ZGJB 4M7AD 5GAMh 2R58A 2YRVA 3MP6A 1WHKA 3I55Q 1RLQC 1AT1B 3CBPA 2QTXA 2HD0A 2K9GA 5CQYA 3QWXX 3QG1A 4M7DG 1G3YA 3ME9A 4HXJA 2AKLA 1NEGA 4C8QC 3L42A 5GMKj 2EYZA 1UHFA 1YITA 3QKJA 4C0DC 3TU4K 2QK0A 3JCMW 1M2VB 3RIRA 2EQJA 1P92A 2X35A 3V7RA 1FMKA 1SHGA 4M78F 4GBQA 2CUBA 2CSIA 1I8FA 1YCSB 2M02A 2LJ0A 3MEAA 2MWOA 2X4JA 2LQWA 4C0DB 4M77G 4EMKB 4NL2A 3UT1A 2XMFA 2A3LA 1UJYA 4FT2A 4A63B 5GMKi 4HA8A 1RAHB 5D6XA 3REBB 2DX1A 3MP8A 4A4HA 3LGFA 1Q81U 1YIJQ 3EGXA 3QJYA 4DOVA 3HRUA 1MGQA 2GF7A 1KK7A 2B86A 3RMQA 4M4ZA 3VUZA 1U5SA 1QLYA 3V8JA 1WDXA 5LJ5g 4BE0A 5LJ3h 3SHWA 2LQ8A 2PU9B 4KH1B 3EHRA 4RG8A 5D6YA 3TEEA 3G4SA 1VQ5T 4PK4A 3SEMA 1YWPA 4J9HA 4DBHA 2FL7A 4N4HA 3CPWS 1MNDA 2KMTA 4J9CA 3OS0A 5C0MA 3NTKA 4F17A 1M8VA 4F7UB 2K3BA 4ME7A 5FW9A 5EC7A 2QGGA 2DTOA 1U8RA 4E7ZA 4JJBA 2DJQA 5CQXA 3JCMV 2HQXA 1MNEA 1M2OA 2I0NA 2BZXA 1HJDA 1TU0B 1ZQ1A 1Q86R 1NE8A 3L2VA 3GF5A 1ARKA 3KXTA 1QVGA 2K3YA 1D1BA 2EFIA 2HQEA 4XQ3A 4FSSA 3IQLA 4FW2A 2J7IA 2JUFA 5I2MA 1QP2A 3C4SA 3JCMQ 4M75E 4XTYA 2DIQA 2ZPHB 1VQ7T 1OI1A 2BE7D 4EPCA 1M30A 1I4K1 3JB9H 1WXBA 2LTOA 3CC4Q 1SHFA 2G6FX 3RUXA 2NUTA 3G1JA 5IN1A 4RG2A 2LQNA 2KYMA 2LJ1A 4D8DA 1YI2A 1N9SA 1BIAA 1KQ1A 2NLUA 2RK2A 5D6WA 3UA6A 5FU7B 1WNLA 1U1SA 5L8RE 2HEQA 3OYAA 2HQHA 3CD6A 1YI2Q 3EFOA 1TXQA 4PJOC 3JB9F 4GLKA 4FU6A 1TH7A 5D7UA 4J6YA 1UGRB 3QUIA 4M78B 2CZ0B 2CP3A 1RAEB 4OMOA 4OB0B 4M75A 2WSCE 1HSQA 4C8QG 1XOVA 4A4FA 3GNGA 1Q7YC 2F2WA 4ATOA 5CIUA 4LUDA 4C8QD 4BI3A 1GFDA 3MKDA 2P0QA 2EGCA 4XTXA 1Y96B 3JCMg 2DD4A 3L2WA 2O4XA 1YJNQ 2XKOC 4M75B 1AWWA 2MWPA 3CPWP 2YUNA 1C1AA 1HD3A 2M1HA 4JJCA 2RQWA 3JCMd 1ACMB 2EYQA 4L5GA 4IKFA 3HHTB 1YJ9Q 1JQQA 2CKKA 1VOMA 4K11A 3OS1A 4M7DD 2GBQA 3EFOB 3L2RA 2MF2A 2RHXA 1ZLMA 4J5YA 3PIPA 3G4SQ 4F7UE 2M51A 5GAN7 1NPRA 3QJ6A 5KYWA 3FIFA 3RKXA 1IZ6A 4C92F 3KBGA 3VV0A 2BTTA 2JTEA 2ZPIB 1WXTA 4ZGDB 3CCUA 4OGEA 2K2MA 4JJDA 1VQNT 4M78E 2EBPA 1OX8A 5I22A 3WXMB 5FLXE 3CEYA 4MMLA 1UTIA 1T3SA 5FWBA 5ECAA 2QQ9A 1RI0A 1XTDA 2XHCA 1KD1C 3FJ5A 2RI3A 4ELYC 3L2UA 2RN8A 3VS4A 2Y90A 1NYGA 2A0FB 2VXFA 3A8HB 1WX6A 3CCQT 1M1KC 3CCQQ 2FZGB 2DEQA 4DBQA 4PFPA 4C92A 3FLGA 3QSUA 3SWNC 5KYWB 2KSSA 4DA4A 2L3QA 1W6XA 3HTRA 4C8QB 3A5ZB 3CCLQ 1NLPC 4LUEA 4RTTA 1PKTA 3EGUA 5GAMf 3G71T 1ZX6A 3O8VA 2D1XA 1QVGP 1LNXA 1VQOT 5GAOn 3ZL7C 4M77E 2RK1A 4F04B 2DL5A 3EGDB 2HBPA 1VQLA 2VV5A 4LD9K 4HCBA 2DM1A 4DBRA 4E2FB 1SSHA 3M0UA 3F70A 5J3BA 1VQPQ 2NUPA 4JUVA 2L2PA 3V7CA 2CSQA 3QDFA 1TWBA 1VQ8A 2X3WD 3UDCA 1M90R 1RACB 2C0IA 1VQLT 1BYMA 3PE0A 4JLIA 2A37A 4E7LA 3D7SB 2JZ2A 3EFRA 4QQGA 2KK4A 1TUGB 5HCKA 1OOTA 1LPLA 4M75F 2M9UA 2K5LA 2ZPEB 4PNOA 3G6EA 3JB9D 5CKBA 1FX7A 4PJOB 4E7SA 3VKIA 1GRIA 3NTHA 4OMQA 5KYUB 3CC7T 5CVIA 2E65A 4F14A 1R8OB 2DNUA 3VJPA 4NOYA 1Q95G 2EWNA 4X1VA 3CC2Q 2X4YA 4IURA 1YBYA 3O5ZA 3KUFA 3I56Q 1VQ7Q 2NYSA 1G8XA 3CCJQ 1IGUA 3EG2A 4CC4B 3X26B 1PRMC 3KFVA 2DPPB 4M7DE 5CKFA 1X01A 4WCIA 3M55A 4PJLA 2LDMA 4OB2B 1BCOA 4PJOF 2EGAA 3CCMQ 1K73R 4JJNK 3DLLA 1QVFA 2RI2A 3LH5A 1BK2A 4FYWB 2XD0A 1B3QA 2RNAA 1AZEA 1KD1U 1PSEA 2KROA 4C92D 5KE3A 1YJNT 3OB9A 2EIFA 2EKHA 3HFOA 1QMCA 2DIGA 1KQ2A 3WVEB 5FRMA 3CCVT 1BBZA 1QWEA 5LJ5h 2ENMA 3JCMX 2AZSA 4J9GA 1Q86U 3OW2A 1I1JA 1AD5A 1GBRA 2KVQG 2HAXA 2YRDA 1YJ9T 1IRXA 1JJ2A 1VQ9T 2DA9A 2KI7A 4EDUA 1M3CA 5KYXB 5DLOA 4OMNA 4HT9A 2LNHB 2D0NA 4NL3A 4DEXA 5L23A 1ABQA 2VGMA 1Q7YU 1VQMQ 3GBQA 3EAEA 3JCMc 4II1A 2ABLA 1QKXA 3REAB 4DBFA 2O2OA 2RMOA 1D1AA 3NPFA 5KYXA 4D8KA 5KYUA 2RJCA 4KRTA 1OZ3A 2DJZA 4B9WA 4KUDK 4X9CA 1W2BP 3CCJT 1VQMA 2GFUA 4JRQA 1VQPT 2MCNA 2LZ6B 2EYXA 2DF6A 3M0PA 3HL8A 1CSKA 1IO6A 4OMMA 1YIJT 3I9QA 3RMSA 2CP0A 1Q82C 2OTJT 3H0FA 4LE9A 2VUBA 3PGGA 1PM3A 2DETA 1YNZA 3DKMA 1SPKA 2LX9A 4OF1A 1D0YA 1RL2A 4BUGA 2LNVA 1XNIA 5GANf 4MDWA 1X6OA 3CCET 4CI0C 3CCEQ 4HCKA 3DLMA 1UE9A 5GAN5 3FB9A 3OYKA 3OSVA 4LDXA 3HRSA 3OYEA 5GAOr 2RH2A 2J6FA 2K79A 2CP5A 2V8IA 1CKBA 1MUZA 5GAN6 4BDZA 2RQUA 4QQDA 3M0SA 5CO7A 5FWCA 3OA6A 1MMAA 2JOYA 2EKOA 4C92G 2ZCFB 4XU2A 1PD0A 1NLOC 3X28B 1PRLC 1S72A 4PJOD 3C12A 1YWOA 3Q1JA 1WHJA 4FYYB 1AEYA 2QQSA 2JM8A 2GCXA 1QCFA 2LMJA 2QGFB 1UGPB 4M78C 2QEXA 5GMKm 2OTLT 2ECZA 1N5ZA 1WHMA 5GJWB 3JB9I 4GY5A 3CC4T 3C94A 3CC7A 3X25B 2FVUA 3OY9A 1YJWQ 4QVCA 5LJ3j 3C95A 2HNIA 2KNBB 1QVFS 1VQ4T 2AIRB 4IUQA 2P4RA 3RNJA 4Z89A 1G3TA 1Y71A 3HP9A 2NUTB 2OTLQ 2EQKA 3ZFJA 1GCQC 3CC4A 1M90C 4FSXA 2E6ZA 1ZSZA 2VYTA 2GNCA 5GAN8 3CMAQ 1VQ4A 2CYZB 3WVDB 4AMCA 2M0YA 1K76A 5A0DA 2XI9A 4M78D 2CP2A 5GANg 1YCYA 3I55A 1W70A 1V1CA 2E6NA 1GXIE 1Y96A 4PLLA 3V8KA 1B34B 4RCCA 1M9SA 2D6FA 3QHSA 4OGCA 2JXBA 3QYGB 3UWNA 2Z0WA 2P4TA 4Z88A 2HL5C 3CCVQ 3NGPA 4WF2A 1VQ6A 4N4IA 4ANJA 2V1QA 1YP5A 2JMAA 2HL3A 4XU1A 2K6DA 1OU8A 1CKAA 2FZCB 1IXDA 2F69A 4QVZA 3I5SA 2RD1A 2KRNA 2KT1A 3VS6A 1QP3A 2HDAA 1PD1A 1VIFA 1VQ6Q 1AWJA 1RADB
chains in the Genus database with same CATH topology
1OU9A 1OX8A 1YFNA 1OX9A 1OU8A 2QASA 1ZSZC 2NYSA 1TWBA 2QAZA 1OULA 1ZSZB 1ZSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OU9 A;  1OX8 A;  1YFN A;  1OX9 A;  1OU8 A;  2QAS A;  1ZSZ C;  2NYS A;  1TWB A;  2QAZ A;  1OUL A;  1ZSZ B;  1ZSZ A; 
#chains in the Genus database with same CATH topology
 1EIF A;  3EGD A;  1JXM A;  3GLX A;  1I5O B;  4ESR A;  4MZP A;  3AT1 B;  2KYB A;  1OUL A;  4MZM A;  1KJW A;  3CPW A;  4XK8 E;  2JS2 A;  5I21 A;  1PWT A;  1LVK A;  3TSZ A;  3TSW A;  2DIL A;  2QA4 T;  1FMW A;  4M77 F;  4M78 A;  1LOJ A;  1YIJ A;  5A2Q E;  2A36 A;  2E3H A;  3ZEH A;  2CUD A;  4KGX B;  1D3B A;  5IXB A;  3M56 A;  2C0O A;  3HPW A;  4WTO B;  4AFQ C;  3SFM A;  4XTZ A;  4M75 C;  2E70 A;  2G3R A;  2OAU A;  2DLP A;  4J7I A;  4RKU E;  4N4G A;  1UJ0 A;  4L59 A;  3CCL T;  2XG8 D;  4RTZ A;  3VRZ A;  1O9S A;  2LQK A;  4ZTJ A;  1B34 A;  2KEA A;  1YIT Q;  4QT7 A;  4IUP A;  3MPU B;  3LLR A;  1Y0M A;  2COZ A;  4RMO A;  3JB9 G;  4KH0 B;  2COW A;  1I0C A;  2YUO A;  1G5V A;  4TVR A;  4FCY A;  3TVT A;  1K73 U;  1M90 U;  1T0H A;  3E9F A;  3H6Z A;  3JCM P;  1JJ2 P;  5AT1 B;  1R0C B;  2KDS A;  1X69 A;  2DXB A;  2DFU A;  1X6G A;  4JS4 A;  1T0J A;  2K2V A;  3I35 A;  1Z9Z A;  2PVG B;  2AZV A;  1OV3 A;  2RQR A;  4J8O A;  1IHW A;  3QYH B;  4OMP A;  2VC8 A;  4J83 A;  5LJ5 f;  2RJE A;  4J9I A;  4A53 A;  3A8O B;  1IRE B;  1IHV A;  1VQ9 Q;  3P8B B;  2CH4 A;  2HMA A;  1D3B B;  1OX9 A;  4BE2 A;  2RQV A;  1M3B A;  1G83 A;  3BW1 A;  3GNF B;  2RHU A;  1ZUU A;  2RM4 A;  5IHK A;  2L0A A;  4M75 D;  1E6H A;  1VQP A;  2RI5 A;  2JVV A;  3EHQ A;  2KR3 A;  4Q5W A;  1K4U S;  4LDY A;  3L1A A;  3LW5 E;  2DYI A;  3A8G B;  4KGV B;  1UGS B;  1KHI A;  5IXF A;  1M1K U;  1SKU B;  5LJ5 e;  3OYL A;  3H9N A;  1N6A A;  2ED0 A;  5I2S A;  3JCM e;  3CXC P;  2CT3 A;  3GP8 A;  2JW4 A;  4BI4 A;  3PNW C;  3CCR Q;  2F1L A;  3FEO A;  1Q81 R;  2IG0 A;  3M5A A;  3FRN A;  1OQK A;  1K9M C;  4M7D B;  1VA7 A;  2JN0 A;  3S3N A;  4C0Z A;  4HCC A;  1KG1 A;  1H64 1;  1M27 C;  1KQS S;  3H8Z A;  1JBM A;  2F5T X;  1SG5 A;  5LJ3 g;  3G6E T;  1FXX A;  2X9H A;  4YTL A;  1NJI R;  1WIE A;  3CCS T;  4JS5 A;  3M0Q A;  3M0R A;  3HSB A;  1Q7Y R;  3QPH A;  1QVF P;  5GAO m;  3VS0 A;  2GTJ A;  5EG2 A;  1E6G A;  2YLC A;  2BUD A;  4OB1 B;  1WJS A;  2EYW A;  3SWN A;  2QXF A;  3OYB A;  1I81 A;  3FDR A;  2CS7 A;  2R57 A;  1YHQ A;  1ZA2 B;  4E7K A;  2V26 A;  4PJO A;  2O31 A;  4BAC A;  2QQB A;  2V8J A;  4Z02 A;  5IAY A;  4M7A A;  3EG9 A;  1YHQ Q;  3MJX A;  2RHI A;  1AWX A;  3M53 A;  1YJN A;  4Y91 A;  1HXD A;  3JCM b;  3BE3 A;  2O9S A;  2LX7 A;  1HYO A;  1B07 A;  2LJ3 A;  2DER A;  1TUD A;  3URG A;  1GBQ A;  8AT1 B;  3ASK A;  3E1S A;  4M77 D;  3JCM f;  2KY9 A;  1VQ9 A;  2FO0 A;  3OSS C;  4RTV A;  2BE9 B;  2CP7 A;  4KBM B;  4IUT A;  4R55 A;  2LP5 A;  3RES A;  2YLB A;  3OMG A;  5GAN 3;  4BE1 A;  2PNI A;  3VS7 A;  2EQM A;  4JPB W;  4F7U A;  2DVE A;  3FJP A;  4C92 C;  1K9A A;  2CH4 W;  3MEV A;  2AT1 B;  1IGQ A;  1JRI A;  1VQN Q;  2COY A;  4FL6 A;  2DZC A;  1UEC A;  1OYX A;  4BD3 A;  4EMK A;  1BCM A;  4X9D A;  2RJF A;  4C5I A;  2H3J A;  2LT1 A;  3GPL A;  3EFS A;  3SWN B;  3TCJ A;  1K0S A;  3M0T A;  1OPK A;  2GTO A;  1WJQ A;  1X43 A;  1M5Q 1;  1U06 A;  2YSQ A;  1YIT T;  2HSE B;  1PC0 A;  1D0Z A;  2PZ1 A;  2E64 A;  3DB3 A;  1XQH A;  3INZ A;  4N0A C;  4C8Q F;  2Y4X A;  4M7A B;  3BDL A;  2DRM A;  5DLQ E;  1YN8 A;  2OX7 A;  4DEY A;  1HK9 A;  2QDY B;  3H0H A;  2XK0 A;  1Q82 R;  3M57 A;  4QW2 A;  5KE2 A;  3V8L A;  4BDY A;  1TG0 A;  2CZ1 B;  1JO8 A;  2QDL A;  5HY6 A;  2MYS A;  3OYG A;  2QQR A;  1WXU A;  4PJJ A;  3V7S A;  2CDT A;  4RTY A;  2B8A A;  2QAS A;  3CCL A;  3FC3 A;  1WHG A;  2NUZ A;  3I56 A;  4OP0 A;  5A0L A;  5GAN h;  1BI1 A;  4BI8 B;  1R0B G;  1UEB A;  3OYD A;  1QKW A;  1TSF A;  2JS0 A;  4PFO A;  4IIO A;  2CZ6 B;  5CK9 A;  5I11 A;  3CME A;  2JTF A;  3A1P A;  2VGN A;  3PVL A;  3PMI A;  2MOX A;  2A08 A;  1O75 A;  1WZO A;  1WQ7 A;  3T9N A;  2WSF E;  2KRM A;  4PFZ A;  5GAO q;  2YXY A;  3I56 T;  3SB2 A;  3CXC S;  5FU6 C;  3TRE A;  3RER A;  2FYK A;  2GFA A;  2QEX T;  2K4Y A;  4FW1 A;  3G71 A;  4PJM A;  1VQO A;  2RPN A;  3E19 A;  5IT9 E;  1KFZ A;  4X34 A;  1RAF B;  3OYC A;  4HT8 A;  4NS5 A;  2FPD A;  3JSC A;  1WQW A;  4J9F A;  3VYH B;  3I55 T;  3G71 Q;  3GOX A;  1K73 C;  1I5L A;  1VQO Q;  1UFF A;  1C6V X;  2JMC A;  1M2V A;  1VQ8 T;  2M0O A;  2DZ9 A;  3CC2 A;  4C5G A;  2EYY A;  3UA7 A;  3NTI A;  5GMK e;  1ZSZ B;  3CCJ A;  2A7Y A;  1UG1 A;  3CC7 Q;  3CBO A;  2FPE A;  2X3X D;  2E3I A;  4KUI A;  4M7D A;  1W2B S;  4LDU A;  1VQ7 A;  5LJ3 d;  2EJF A;  2L3S A;  3SDZ A;  2R5A A;  1N8R U;  3I5R A;  3CCS Q;  3CCM A;  4ZN3 A;  4PL6 A;  1J3T A;  1FMV A;  1VYT A;  3VRY A;  1AVZ C;  2W10 A;  2RJD A;  5GAN j;  4C0F A;  1OEB A;  4VUB A;  3VS1 A;  3EGX B;  2L8D A;  1VIE A;  2VXE A;  1IB8 A;  1UUE A;  3JV3 A;  3L2Z A;  2QA4 A;  2EQU A;  4HVV A;  1RUW A;  2K5I A;  4M7D C;  2L3R A;  4M7A E;  3JCM J;  2C06 A;  2QYZ A;  4N0A A;  3ZBD A;  3OW2 S;  3M9Q A;  2VVK A;  3MEW A;  1D09 B;  4KGZ B;  4EMG A;  4ZNX A;  2DL8 A;  1RAG B;  4HCZ A;  1K9M U;  1WA7 A;  3CD6 Q;  3ULR B;  3EH2 A;  3S6W A;  1NJI U;  1E7O A;  2Y4Y A;  4C0G A;  4E6R A;  1TOV A;  2CRE A;  4XTU A;  1ZUY A;  4XTV A;  1GCP A;  1TTH B;  5GMK h;  1EZZ B;  1EFN A;  2DD5 A;  3OYY A;  2H3E B;  2QEX Q;  1M1K R;  2XU8 A;  2GGR A;  1X75 C;  2ATC B;  3QZ5 B;  5LJ3 f;  1D0X A;  3QBY A;  1SRL A;  3BDU A;  2IIM A;  3R6N A;  2O9V A;  2RB6 A;  1G3S A;  1X6B A;  2AKK A;  2O4X B;  1VQM T;  4FIB A;  2QAZ A;  3L2Q A;  2DVJ A;  5C6S A;  3OBW A;  3NHN A;  1K8A C;  1MV3 A;  4IIM A;  2DBK A;  4BY6 B;  2YUP A;  2M16 A;  2OAW A;  2ZPB B;  2DKG A;  4P5N A;  2K5F A;  5IHN A;  2DTI A;  4JDS A;  2JNG A;  1QQJ A;  1WJR A;  4GLM A;  5GAO l;  2ROL A;  2RA2 A;  5DY9 A;  2KT8 A;  1JB0 E;  2P0P A;  5CR2 A;  3G6E Q;  1AZG B;  4J9D A;  3RKY A;  1NBE B;  1Y7X A;  5GAM e;  2MK5 A;  4HVU A;  1MHN A;  1QVG S;  2YWW A;  3JCM h;  2EGE A;  2PQW A;  4MMK A;  4RCB A;  2EVR A;  4MDX A;  5LL6 S;  3RR6 A;  4JRP A;  1F1B B;  1ZUK A;  3PFS A;  2JT4 A;  4J9E A;  2YRC A;  1W2B A;  2LCS A;  1KC8 R;  3P8H A;  4J6X A;  2V8K A;  3TQ7 P;  5AYF A;  3OS2 A;  1WYX A;  1ZBJ A;  5GAN e;  4OVA A;  4ELZ C;  2QTV A;  4OML A;  4J6W A;  1K8A U;  3UPU A;  1WGS A;  3G7Z A;  2C0T A;  4IUV A;  4KT0 E;  3OYH A;  1N9R A;  1UHC A;  1JU5 C;  1MV0 B;  5KYN A;  4ZGE B;  1VUB A;  2DRK A;  3J80 E;  2OTL A;  3VU3 C;  7AT1 B;  1U1T A;  3M58 A;  2I2L A;  1VQ4 Q;  4E47 A;  4J7F A;  3U23 A;  1UGQ B;  1KSW A;  2DXT A;  4QVD A;  2P84 A;  2D8J A;  3MET A;  2D0Q B;  1V76 A;  3OW2 P;  4M77 A;  2PUO B;  2CGH A;  1BI3 A;  2JJ9 A;  2HSP A;  1N8R C;  4M7D F;  4ZN1 A;  1KQS P;  5HK3 A;  3E9G A;  4D6W A;  2PVD B;  3ER0 A;  1KHC A;  3VS2 A;  2HBW A;  3S3M A;  5A0G A;  3MHX A;  2LCC A;  4R0K A;  1VQ8 Q;  4M7A C;  2AK5 A;  1LCK A;  1BB9 A;  2QI2 A;  2DMO A;  1WHH A;  3OS5 A;  3THK A;  3CME T;  3M4G A;  1T3L A;  3DB4 A;  3J7A F;  2X51 A;  1PNJ A;  3PTA A;  1W4S A;  2NUP B;  1C0M A;  2ED1 A;  2KBT A;  2K3X A;  4AG2 C;  3PIO A;  5GMK l;  2KRS A;  3M59 A;  3A8M B;  3OYJ A;  2ESW A;  2SEM A;  4LNP A;  3NMZ C;  4EIK A;  2MIO A;  4AFS C;  1Q82 U;  5HKC A;  1TUC A;  2EW3 A;  1EX4 A;  1SF9 A;  2H8H A;  1BU1 A;  4DOW A;  2O01 E;  1WI7 A;  4CC7 A;  3X24 B;  2K57 A;  5LJ5 d;  1H8K A;  5M9O A;  3S3O A;  4AG1 C;  3BY7 A;  5GAM j;  1YJ9 A;  1UGV A;  2HCK A;  3VUB A;  2PTK A;  3EG0 A;  2JM9 A;  5CKD A;  2O88 A;  2JTM A;  2VKN A;  4XAX B;  4CC3 A;  2VWF A;  2RHZ A;  3MCA B;  1BKB A;  1V29 B;  3RKW A;  2DAQ A;  2DE0 X;  4FM4 B;  3CD6 T;  1Q81 C;  2F2V A;  5FRO A;  2V1R A;  1PSF A;  2KGT A;  3M54 A;  2LVM A;  5CCA A;  2DK3 A;  4MZT A;  1SEM A;  2DXC A;  4RTU A;  1M8M A;  4LDW A;  1KQS A;  3RDV A;  5GJV B;  4HVW A;  3CCU Q;  2RQT A;  5CKE A;  4JZ3 A;  3H0I A;  5KH6 A;  4M77 C;  2DL3 A;  4EMH A;  4XU0 A;  3GIB A;  1ZSZ C;  1GL5 A;  2EAY A;  3OYI A;  1WLP B;  2A28 A;  4C92 B;  2E10 A;  4QKU A;  1WFW A;  4DQ2 A;  1PG5 B;  2KQW A;  1G2B A;  3UAT A;  4UC4 A;  2FPF A;  1RI9 A;  2DL7 A;  5KCO A;  3EG1 A;  2FG0 A;  1M1F A;  1ZSG A;  1VQ5 Q;  5KYY A;  4LN2 A;  2P0K A;  1N8R R;  2ZPG B;  1SRM A;  4JRI A;  2BZ8 A;  1FYN A;  3CCR T;  3X20 B;  4XU3 A;  3OYN A;  4OMF B;  2BKD N;  4E7H A;  1R77 A;  4QQ6 A;  2SRC A;  3G4S T;  2QG9 B;  1NJI C;  1VQ5 A;  1YHQ T;  1X27 A;  4PLI A;  1YJW T;  4Z8A A;  4JZ4 A;  2MAM A;  3A98 A;  2DEU A;  1PCX A;  2IPO B;  2E5Q A;  2VAS A;  2GQV A;  4E7J A;  4OB3 B;  1X2K A;  3CCR A;  5HK0 A;  4KUL A;  4C8Q E;  1KD1 R;  4V2S A;  3CC2 T;  2VB6 A;  2F5K A;  1A0N B;  3HRT A;  6AT1 B;  1ZHI A;  3QO3 A;  5CKH A;  1NPP A;  3CCQ A;  2NWM A;  4LDV A;  4M77 B;  1KC8 C;  2F2X A;  1K0X A;  3MEU A;  1DJ7 B;  1VQK A;  2ZPF B;  5GAO p;  4ORZ A;  2FHD A;  3CPF A;  5IH2 A;  5GAN 4;  1S1N A;  5IHI A;  2CP6 A;  4BY6 C;  4E7I A;  3E2U A;  3LH0 A;  3M4Y A;  1OZ2 A;  8ATC B;  1K9M R;  4M7A G;  2KXC A;  1MMG A;  1VQL Q;  2LRQ A;  1RAA B;  4A4K A;  4RUG A;  2GQI A;  1ABO A;  3LGL A;  1I07 A;  2PUK B;  4JRK A;  4CRI A;  1G3W A;  4PKC C;  4LD6 A;  3LWH A;  1KC8 U;  3AHU A;  4PJO E;  2FEI A;  1NEB A;  1UB4 A;  2FZK B;  1W1F A;  5FU6 B;  1YFN A;  2BIV A;  1H3H A;  2L3P A;  3JAM E;  2E1H A;  2BZY A;  1UDL A;  1K8A R;  4O6J A;  1XJW B;  5CAI A;  4M78 G;  2HKQ B;  2DL4 A;  2XDB A;  4F7U G;  5KCH A;  3H41 A;  2E12 A;  2QQA A;  2WSE E;  1RLP C;  4BB7 A;  4L6V 5;  2X4W A;  1NZ9 A;  4Y92 A;  2XDP A;  1PHT A;  4RTW A;  1QCN A;  1NYF A;  3R6O A;  1JEG A;  4F7U F;  2OI3 A;  1H92 A;  2J06 A;  3OYF A;  2X4X A;  1AHJ B;  4A4G A;  1RAB B;  2EPD A;  3CCU T;  1U3O A;  2PVO B;  2DO3 A;  4AFU C;  1BI2 A;  2DYB A;  4J9B A;  1N27 A;  2MPX C;  2D9T A;  2E41 A;  2YT6 A;  3OQ5 A;  2IVW A;  1NM7 A;  3JRZ A;  3LX7 A;  4M7A F;  1S72 T;  1ZA1 B;  3N5B B;  1Y57 A;  4XTW A;  3EH1 A;  1K1Z A;  3QZ9 B;  4LXC A;  1QVP A;  2ZGW A;  5LJ3 e;  2YUQ A;  1H3Z A;  2FRY A;  2KAF A;  1X2Q A;  3BFM A;  3LWI A;  1TS9 A;  1Q86 C;  4PJN A;  2YHT A;  1S72 Q;  3VS3 A;  1VQK Q;  4FT4 A;  2RHY A;  2EJ9 A;  3A8L B;  2MMP A;  1NG2 A;  3CQT A;  1GFC A;  1YI2 T;  4AT1 B;  3OBY A;  1JJ2 S;  2EJG A;  2FRW A;  3P8D A;  1B7T A;  4O5V A;  3QII A;  3J81 E;  1Y07 A;  2RF0 A;  4A54 A;  1QWF A;  2CZ7 B;  4FYX B;  1AWO A;  4PJO G;  1RAI B;  2OTJ A;  3C0C A;  2J6K A;  3CME Q;  4B9X A;  1MMD A;  3OYM A;  3JB9 J;  1FWZ A;  2E4H A;  5J39 A;  3PT9 A;  2DXU A;  2K7A A;  1D1C A;  3NFC A;  2XIC A;  5DM7 R;  3OMC A;  9ATC B;  2XDD A;  1VQK T;  2HKN A;  3CXC A;  2OTJ Q;  3CCE A;  3EG3 A;  2QA4 Q;  1VYV A;  1M1G A;  1ZBX A;  5KYY B;  3QXE B;  4JLG A;  4C92 E;  4RTX A;  4IUU A;  1JXO A;  3RBB B;  4C8Q A;  2MI6 A;  3PVQ A;  3CBM A;  2WAC A;  3EG9 B;  2EQI A;  4ZTF A;  1VQ6 T;  4A4E A;  4Y28 E;  4FYV B;  2FB7 A;  4C5E A;  2J05 A;  1AOJ A;  2LT4 A;  3QDR B;  1SSF A;  2D8H A;  2LC4 A;  1M3A A;  2DBM A;  5J26 A;  4M75 G;  2L89 A;  4CC2 A;  3LYI A;  2J6O A;  5FU7 C;  2AHJ B;  1BI0 A;  3VS5 A;  1OPL A;  2LCL A;  1WHL A;  3UF4 A;  1QCO A;  4EMK C;  1BIB A;  4F16 A;  5FRN A;  3VYG A;  1GCQ A;  4HKE A;  5GAN d;  3CCV A;  1VYU A;  3CCS A;  1MMN A;  2E5K A;  3MO8 A;  2R5M A;  1YJW A;  2CT4 A;  4B6M A;  2L5Q A;  1KIK A;  3CMA T;  1VQN A;  3HFN A;  1OU9 A;  3QWY A;  1QW1 A;  1LJO A;  2DTH A;  2KE9 A;  2ZAE A;  1PKS A;  2W0Z A;  4C5H A;  5GAN 2;  5GAM d;  4AFZ C;  4R56 A;  2OJ2 A;  2HZY A;  3SD4 A;  5LJ5 j;  1Z9Q A;  3MP1 A;  2ZZD A;  2KXD A;  1M4Z A;  3CCM T;  3PMT A;  2ROT A;  2YDL A;  3HKS A;  5GAM g;  3CMA A;  2RO0 A;  1WPY A;  2XID A;  4ZGJ B;  4M7A D;  5GAM h;  2R58 A;  2YRV A;  3MP6 A;  1WHK A;  3I55 Q;  1RLQ C;  1AT1 B;  3CBP A;  2QTX A;  2HD0 A;  2K9G A;  5CQY A;  3QWX X;  3QG1 A;  4M7D G;  1G3Y A;  3ME9 A;  4HXJ A;  2AKL A;  1NEG A;  4C8Q C;  3L42 A;  5GMK j;  2EYZ A;  1UHF A;  1YIT A;  3QKJ A;  4C0D C;  3TU4 K;  2QK0 A;  3JCM W;  1M2V B;  3RIR A;  2EQJ A;  1P92 A;  2X35 A;  3V7R A;  1FMK A;  1SHG A;  4M78 F;  4GBQ A;  2CUB A;  2CSI A;  1I8F A;  1YCS B;  2M02 A;  2LJ0 A;  3MEA A;  2MWO A;  2X4J A;  2LQW A;  4C0D B;  4M77 G;  4EMK B;  4NL2 A;  3UT1 A;  2XMF A;  2A3L A;  1UJY A;  4FT2 A;  4A63 B;  5GMK i;  4HA8 A;  1RAH B;  5D6X A;  3REB B;  2DX1 A;  3MP8 A;  4A4H A;  3LGF A;  1Q81 U;  1YIJ Q;  3EGX A;  3QJY A;  4DOV A;  3HRU A;  1MGQ A;  2GF7 A;  1KK7 A;  2B86 A;  3RMQ A;  4M4Z A;  3VUZ A;  1U5S A;  1QLY A;  3V8J A;  1WDX A;  5LJ5 g;  4BE0 A;  5LJ3 h;  3SHW A;  2LQ8 A;  2PU9 B;  4KH1 B;  3EHR A;  4RG8 A;  5D6Y A;  3TEE A;  3G4S A;  1VQ5 T;  4PK4 A;  3SEM A;  1YWP A;  4J9H A;  4DBH A;  2FL7 A;  4N4H A;  3CPW S;  1MND A;  2KMT A;  4J9C A;  3OS0 A;  5C0M A;  3NTK A;  4F17 A;  1M8V A;  4F7U B;  2K3B A;  4ME7 A;  5FW9 A;  5EC7 A;  2QGG A;  2DTO A;  1U8R A;  4E7Z A;  4JJB A;  2DJQ A;  5CQX A;  3JCM V;  2HQX A;  1MNE A;  1M2O A;  2I0N A;  2BZX A;  1HJD A;  1TU0 B;  1ZQ1 A;  1Q86 R;  1NE8 A;  3L2V A;  3GF5 A;  1ARK A;  3KXT A;  1QVG A;  2K3Y A;  1D1B A;  2EFI A;  2HQE A;  4XQ3 A;  4FSS A;  3IQL A;  4FW2 A;  2J7I A;  2JUF A;  5I2M A;  1QP2 A;  3C4S A;  3JCM Q;  4M75 E;  4XTY A;  2DIQ A;  2ZPH B;  1VQ7 T;  1OI1 A;  2BE7 D;  4EPC A;  1M30 A;  1I4K 1;  3JB9 H;  1WXB A;  2LTO A;  3CC4 Q;  1SHF A;  2G6F X;  3RUX A;  2NUT A;  3G1J A;  5IN1 A;  4RG2 A;  2LQN A;  2KYM A;  2LJ1 A;  4D8D A;  1YI2 A;  1N9S A;  1BIA A;  1KQ1 A;  2NLU A;  2RK2 A;  5D6W A;  3UA6 A;  5FU7 B;  1WNL A;  1U1S A;  5L8R E;  2HEQ A;  3OYA A;  2HQH A;  3CD6 A;  1YI2 Q;  3EFO A;  1TXQ A;  4PJO C;  3JB9 F;  4GLK A;  4FU6 A;  1TH7 A;  5D7U A;  4J6Y A;  1UGR B;  3QUI A;  4M78 B;  2CZ0 B;  2CP3 A;  1RAE B;  4OMO A;  4OB0 B;  4M75 A;  2WSC E;  1HSQ A;  4C8Q G;  1XOV A;  4A4F A;  3GNG A;  1Q7Y C;  2F2W A;  4ATO A;  5CIU A;  4LUD A;  4C8Q D;  4BI3 A;  1GFD A;  3MKD A;  2P0Q A;  2EGC A;  4XTX A;  1Y96 B;  3JCM g;  2DD4 A;  3L2W A;  2O4X A;  1YJN Q;  2XKO C;  4M75 B;  1AWW A;  2MWP A;  3CPW P;  2YUN A;  1C1A A;  1HD3 A;  2M1H A;  4JJC A;  2RQW A;  3JCM d;  1ACM B;  2EYQ A;  4L5G A;  4IKF A;  3HHT B;  1YJ9 Q;  1JQQ A;  2CKK A;  1VOM A;  4K11 A;  3OS1 A;  4M7D D;  2GBQ A;  3EFO B;  3L2R A;  2MF2 A;  2RHX A;  1ZLM A;  4J5Y A;  3PIP A;  3G4S Q;  4F7U E;  2M51 A;  5GAN 7;  1NPR A;  3QJ6 A;  5KYW A;  3FIF A;  3RKX A;  1IZ6 A;  4C92 F;  3KBG A;  3VV0 A;  2BTT A;  2JTE A;  2ZPI B;  1WXT A;  4ZGD B;  3CCU A;  4OGE A;  2K2M A;  4JJD A;  1VQN T;  4M78 E;  2EBP A;  1OX8 A;  5I22 A;  3WXM B;  5FLX E;  3CEY A;  4MML A;  1UTI A;  1T3S A;  5FWB A;  5ECA A;  2QQ9 A;  1RI0 A;  1XTD A;  2XHC A;  1KD1 C;  3FJ5 A;  2RI3 A;  4ELY C;  3L2U A;  2RN8 A;  3VS4 A;  2Y90 A;  1NYG A;  2A0F B;  2VXF A;  3A8H B;  1WX6 A;  3CCQ T;  1M1K C;  3CCQ Q;  2FZG B;  2DEQ A;  4DBQ A;  4PFP A;  4C92 A;  3FLG A;  3QSU A;  3SWN C;  5KYW B;  2KSS A;  4DA4 A;  2L3Q A;  1W6X A;  3HTR A;  4C8Q B;  3A5Z B;  3CCL Q;  1NLP C;  4LUE A;  4RTT A;  1PKT A;  3EGU A;  5GAM f;  3G71 T;  1ZX6 A;  3O8V A;  2D1X A;  1QVG P;  1LNX A;  1VQO T;  5GAO n;  3ZL7 C;  4M77 E;  2RK1 A;  4F04 B;  2DL5 A;  3EGD B;  2HBP A;  1VQL A;  2VV5 A;  4LD9 K;  4HCB A;  2DM1 A;  4DBR A;  4E2F B;  1SSH A;  3M0U A;  3F70 A;  5J3B A;  1VQP Q;  2NUP A;  4JUV A;  2L2P A;  3V7C A;  2CSQ A;  3QDF A;  1TWB A;  1VQ8 A;  2X3W D;  3UDC A;  1M90 R;  1RAC B;  2C0I A;  1VQL T;  1BYM A;  3PE0 A;  4JLI A;  2A37 A;  4E7L A;  3D7S B;  2JZ2 A;  3EFR A;  4QQG A;  2KK4 A;  1TUG B;  5HCK A;  1OOT A;  1LPL A;  4M75 F;  2M9U A;  2K5L A;  2ZPE B;  4PNO A;  3G6E A;  3JB9 D;  5CKB A;  1FX7 A;  4PJO B;  4E7S A;  3VKI A;  1GRI A;  3NTH A;  4OMQ A;  5KYU B;  3CC7 T;  5CVI A;  2E65 A;  4F14 A;  1R8O B;  2DNU A;  3VJP A;  4NOY A;  1Q95 G;  2EWN A;  4X1V A;  3CC2 Q;  2X4Y A;  4IUR A;  1YBY A;  3O5Z A;  3KUF A;  3I56 Q;  1VQ7 Q;  2NYS A;  1G8X A;  3CCJ Q;  1IGU A;  3EG2 A;  4CC4 B;  3X26 B;  1PRM C;  3KFV A;  2DPP B;  4M7D E;  5CKF A;  1X01 A;  4WCI A;  3M55 A;  4PJL A;  2LDM A;  4OB2 B;  1BCO A;  4PJO F;  2EGA A;  3CCM Q;  1K73 R;  4JJN K;  3DLL A;  1QVF A;  2RI2 A;  3LH5 A;  1BK2 A;  4FYW B;  2XD0 A;  1B3Q A;  2RNA A;  1AZE A;  1KD1 U;  1PSE A;  2KRO A;  4C92 D;  5KE3 A;  1YJN T;  3OB9 A;  2EIF A;  2EKH A;  3HFO A;  1QMC A;  2DIG A;  1KQ2 A;  3WVE B;  5FRM A;  3CCV T;  1BBZ A;  1QWE A;  5LJ5 h;  2ENM A;  3JCM X;  2AZS A;  4J9G A;  1Q86 U;  3OW2 A;  1I1J A;  1AD5 A;  1GBR A;  2KVQ G;  2HAX A;  2YRD A;  1YJ9 T;  1IRX A;  1JJ2 A;  1VQ9 T;  2DA9 A;  2KI7 A;  4EDU A;  1M3C A;  5KYX B;  5DLO A;  4OMN A;  4HT9 A;  2LNH B;  2D0N A;  4NL3 A;  4DEX A;  5L23 A;  1ABQ A;  2VGM A;  1Q7Y U;  1VQM Q;  3GBQ A;  3EAE A;  3JCM c;  4II1 A;  2ABL A;  1QKX A;  3REA B;  4DBF A;  2O2O A;  2RMO A;  1D1A A;  3NPF A;  5KYX A;  4D8K A;  5KYU A;  2RJC A;  4KRT A;  1OZ3 A;  2DJZ A;  4B9W A;  4KUD K;  4X9C A;  1W2B P;  3CCJ T;  1VQM A;  2GFU A;  4JRQ A;  1VQP T;  2MCN A;  2LZ6 B;  2EYX A;  2DF6 A;  3M0P A;  3HL8 A;  1CSK A;  1IO6 A;  4OMM A;  1YIJ T;  3I9Q A;  3RMS A;  2CP0 A;  1Q82 C;  2OTJ T;  3H0F A;  4LE9 A;  2VUB A;  3PGG A;  1PM3 A;  2DET A;  1YNZ A;  3DKM A;  1SPK A;  2LX9 A;  4OF1 A;  1D0Y A;  1RL2 A;  4BUG A;  2LNV A;  1XNI A;  5GAN f;  4MDW A;  1X6O A;  3CCE T;  4CI0 C;  3CCE Q;  4HCK A;  3DLM A;  1UE9 A;  5GAN 5;  3FB9 A;  3OYK A;  3OSV A;  4LDX A;  3HRS A;  3OYE A;  5GAO r;  2RH2 A;  2J6F A;  2K79 A;  2CP5 A;  2V8I A;  1CKB A;  1MUZ A;  5GAN 6;  4BDZ A;  2RQU A;  4QQD A;  3M0S A;  5CO7 A;  5FWC A;  3OA6 A;  1MMA A;  2JOY A;  2EKO A;  4C92 G;  2ZCF B;  4XU2 A;  1PD0 A;  1NLO C;  3X28 B;  1PRL C;  1S72 A;  4PJO D;  3C12 A;  1YWO A;  3Q1J A;  1WHJ A;  4FYY B;  1AEY A;  2QQS A;  2JM8 A;  2GCX A;  1QCF A;  2LMJ A;  2QGF B;  1UGP B;  4M78 C;  2QEX A;  5GMK m;  2OTL T;  2ECZ A;  1N5Z A;  1WHM A;  5GJW B;  3JB9 I;  4GY5 A;  3CC4 T;  3C94 A;  3CC7 A;  3X25 B;  2FVU A;  3OY9 A;  1YJW Q;  4QVC A;  5LJ3 j;  3C95 A;  2HNI A;  2KNB B;  1QVF S;  1VQ4 T;  2AIR B;  4IUQ A;  2P4R A;  3RNJ A;  4Z89 A;  1G3T A;  1Y71 A;  3HP9 A;  2NUT B;  2OTL Q;  2EQK A;  3ZFJ A;  1GCQ C;  3CC4 A;  1M90 C;  4FSX A;  2E6Z A;  1ZSZ A;  2VYT A;  2GNC A;  5GAN 8;  3CMA Q;  1VQ4 A;  2CYZ B;  3WVD B;  4AMC A;  2M0Y A;  1K76 A;  5A0D A;  2XI9 A;  4M78 D;  2CP2 A;  5GAN g;  1YCY A;  3I55 A;  1W70 A;  1V1C A;  2E6N A;  1GXI E;  1Y96 A;  4PLL A;  3V8K A;  1B34 B;  4RCC A;  1M9S A;  2D6F A;  3QHS A;  4OGC A;  2JXB A;  3QYG B;  3UWN A;  2Z0W A;  2P4T A;  4Z88 A;  2HL5 C;  3CCV Q;  3NGP A;  4WF2 A;  1VQ6 A;  4N4I A;  4ANJ A;  2V1Q A;  1YP5 A;  2JMA A;  2HL3 A;  4XU1 A;  2K6D A;  1OU8 A;  1CKA A;  2FZC B;  1IXD A;  2F69 A;  4QVZ A;  3I5S A;  2RD1 A;  2KRN A;  2KT1 A;  3VS6 A;  1QP3 A;  2HDA A;  1PD1 A;  1VIF A;  1VQ6 Q;  1AWJ A;  1RAD B; 
#chains in the Genus database with same CATH homology
 1OU9 A;  1OX8 A;  1YFN A;  1OX9 A;  1OU8 A;  2QAS A;  1ZSZ C;  2NYS A;  1TWB A;  2QAZ A;  1OUL A;  1ZSZ B;  1ZSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...