1ZSZA

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
molecule keywords Stringent starvation protein B homolog
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszA00
2QAZA 1ZSZA 1OX9A 2NYSA 1ZSZB 1TWBA 1OX8A 1OU8A 1YFNA 1OULA 1ZSZC 2QASA 1OU9A
chains in the Genus database with same CATH superfamily
5KYNA 2MCNA 1IGQA 4D8DA 2HKQB 1YJ9T 1UDLA 1UGVA 2JM8A 2QQAA 5HKCA 4FYVB 3EHQA 4CC4B 2CGHA 3I56Q 1WXUA 1D3BB 1D0YA 4J9HA 2KYBA 2W0ZA 3RUXA 4E7ZA 4BE2A 4P5NA 4LUEA 2K5LA 1ZA2B 4QVCA 1JBMA 3CPFA 2RHXA 4NL2A 4F7UA 5GAN5 3CCUT 1UGSB 5KH6A 2CH4W 3L2QA 1AWJA 3PT9A 2D8JA 5LJ5j 5HY6A 3H0FA 1YJWQ 1UE9A 3UDCA 1VQPA 3EH1A 4DBHA 2CREA 3M0QA 1H8KA 2FZCB 2V8KA 2EQJA 5GANd 2L3SA 3ZL7C 5CKDA 1FMWA 3GOXA 4X34A 2COWA 2COYA 4M77D 3HKSA 4II1A 2KDSA 2F2VA 4AG2C 2MYSA 4C8QD 2GBQA 2GFUA 6AT1B 4BACA 4A53A 4FCYA 2DBKA 1JJ2S 4LD9K 3A5ZB 4F16A 4E7HA 1Q86U 3L2RA 2QQSA 1GFDA 1OZ3A 2X4XA 1Q95G 2DF6A 3DKMA 1KIKA 2P84A 3I5RA 2LP5A 5KYYA 5KYUB 1UJ0A 1W2BS 2FPDA 4HA8A 4EMHA 4EIKA 4CC3A 2J6OA 1TUDA 2EAYA 3LLRA 2DETA 4M78B 1J3TA 1UHFA 1TXQA 3EG2A 3BFMA 4XK8E 3PVQA 1Q86R 3HP9A 1VQKQ 3GPLA 1WYXA 3G1JA 4QQGA 2DL3A 4FSSA 4ELZC 9ATCB 3UF4A 3I55T 4OGEA 3QXEB 2ZPBB 3H9NA 4Q5WA 2CDTA 3WVDB 2D1XA 3ZEHA 3CCST 1I07A 1YJNA 3CMET 3PMTA 2YLBA 1M2OA 4J8OA 4C92G 1OPLA 3KXTA 3CMAA 1YIJQ 1D1BA 4E6RA 3CC7Q 3X24B 2DM1A 2KRMA 5GMKi 2LX7A 1WJRA 2PUOB 2EJFA 3VS3A 5KYXA 1BK2A 1U06A 1PWTA 4C92C 2RB6A 1YIJT 3CXCA 2CP3A 1KFZA 3CD6T 3OW2A 4RTVA 1YNZA 5IHKA 2QXFA 1KG1A 2JW4A 4RTWA 2M02A 5GMKe 4F04B 2DEUA 2V8IA 1BB9A 5FU6B 1R77A 1NYGA 3CC7A 1K9MU 4LNPA 2BZ8A 4LE9A 5GANf 1Q81R 2AKLA 4OVAA 4J6YA 1VQ4T 2VASA 2YDLA 3OSVA 1VQ9A 5A0GA 3M5AA 4A4FA 4RTTA 2E6ZA 1F1BB 2E10A 3HFOA 2K5FA 3CCMT 2DX1A 5M9OA 1AWXA 1VQ6A 3MEAA 3SD4A 1GRIA 3G6EA 1Y71A 3CC4Q 4ESRA 2EYQA 4RMOA 1VQOQ 1KHIA 4F7UG 5D6XA 4XTVA 3WVEB 3J81E 2MPXC 4C8QE 3CPWP 2E70A 4JPBW 1JRIA 3G7ZA 2A37A 1NPRA 1N8RU 5I2SA 2YRVA 2HEQA 4FM4B 1I5LA 1UG1A 1JXMA 2QGFB 5GANh 2R5AA 3JCMc 4BI8B 1TG0A 2L3RA 1UUEA 5GAN2 2GQIA 2DTOA 3V7RA 5LJ5g 1HSQA 1IO6A 1WQ7A 1IGUA 3DB4A 1KD1R 1N8RR 5IN1A 4M4ZA 3TREA 1VUBA 2HBPA 3S3MA 2CP6A 1GFCA 2O4XB 3M4GA 3LGFA 2DIGA 4DEYA 3VS0A 5KCOA 1M5Q1 2KSSA 4L59A 1U3OA 3JCMf 1K8AR 1I8FA 4FW2A 3M0PA 2AKKA 1T3SA 4MZTA 2F5KA 5IH2A 2R5MA 3GLXA 2JMAA 1ABOA 3CMEA 2LQNA 1QW1A 2KT8A 3G71A 2JN0A 1GCPA 4OGCA 3RERA 1G3TA 4E7JA 4M7AC 2ED0A 5FU7B 2EQIA 3HSBA 3MP1A 2ESWA 1QVFS 3CCRQ 5GAN8 3CCVQ 1BYMA 4GBQA 1YJWT 1Q86C 3M53A 1MMGA 2M9UA 4J9FA 2KBTA 1VQ9T 1IREB 1T3LA 1SG5A 4FT4A 4LDUA 2CZ1B 2D8HA 1IRXA 3QJ6A 1ZHIA 2LX9A 2DMOA 2DK3A 2ZPHB 1YHQT 1XJWB 5D7UA 1VQ8T 2RI5A 3SFMA 5LJ5h 1LCKA 2QAZA 1QVGS 1VIEA 4M7DG 1ZUYA 4FSXA 1B7TA 2ZPFB 4JLIA 3GIBA 3JAME 3JCMb 1VQNQ 4LDVA 2C0OA 3M54A 1MHNA 1VQNT 2YHTA 4TVRA 1CKAA 2HKNA 2DL5A 3ER0A 5FRMA 3A8OB 4J7FA 2EGAA 3TVTA 4WTOB 2ENMA 3UWNA 1S72A 3EH2A 4OMMA 2HQEA 2ED1A 4M7DA 4V2SA 4JZ4A 5GAOq 1Y0MA 1QCFA 2I0NA 4F17A 2H8HA 3CCRA 4MMKA 3RKYA 4RTZA 3ULRB 5FU6C 3J7AF 2DXCA 2LJ3A 2WACA 3C0CA 4LDYA 5GAN3 2OTLT 1KHCA 2Y90A 1M1KR 1D1CA 2ZCFB 3HHTB 2CP0A 2JZ2A 3MPUB 3I55Q 2DRKA 2O9VA 4M7DB 1HJDA 4AT1B 1AZEA 1ZUKA 4C8QA 1Q82R 4DEXA 4M77G 2LJ0A 2DNUA 3CBOA 2DVEA 4Z88A 3J80E 1E6HA 2RK2A 1JJ2A 1KQSA 1ZA1B 4OB2B 1N9RA 4B9XA 1FMKA 1MNEA 2RHZA 4J7IA 3PIPA 1CSKA 3FEOA 2K7AA 5LJ5f 4EMGA 4E7LA 4BY6B 2HD0A 4CI0C 4L6V5 3R6OA 3CCJQ 2P4TA 8AT1B 1MMNA 2X3XD 3PE0A 4B9WA 2M51A 1VQ4A 4A54A 5ECAA 3RKWA 1RAAB 1JJ2P 5FRNA 3HRUA 1VIFA 3TEEA 1OZ2A 2Y4YA 1VQ6Q 3CMAQ 4E7SA 4C92E 1QVGA 2E41A 1VQOT 4KULA 2K57A 5GAOn 3JB9J 2EGCA 1WHLA 1SRLA 5J3BA 1QP2A 1VYTA 1OEBA 2EFIA 1Q81C 4PJOG 2QGGA 1K9AA 1IB8A 1QCNA 1ZX6A 1Q82C 1H3ZA 2E3HA 1OX9A 1ZSZB 5KYXB 1ZSZA 1WJSA 2FYKA 1KQ2A 5LJ3f 1Q81U 4LXCA 4KGZB 1TUGB 2EQUA 2PVOB 1BCOA 4JS5A 5CO7A 3CC4T 4XQ3A 1NEGA 4PJOC 4M77E 4L5GA 1RL2A 3G6ET 1G3SA 2MOXA 1C0MA 2L0AA 4LDWA 4RKUE 4QVDA 3MP6A 2DVJA 4IUQA 2IG0A 1PG5B 2HL3A 3N5BB 2RPNA 3H41A 4C0DC 2HZYA 3JCMP 2IVWA 4J6WA 4HCBA 5CAIA 3JCMJ 3RR6A 1AT1B 4DBFA 1VQLA 2J6KA 4HVWA 5AYFA 4M78C 3EFRA 1YITT 2ECZA 4AFQC 2L89A 2O9SA 2FPFA 5I11A 2QA4A 3OYFA 3FIFA 3BDUA 4R0KA 3CCSQ 1K0SA 5DY9A 1ZLMA 3PTAA 3CMEQ 4E47A 3M57A 3EG9B 3EGUA 2LT1A 2RN8A 2KXDA 2VC8A 3CPWS 4E2FB 1WGSA 2DLPA 5GANe 2BE9B 2QDYB 1LNXA 1D0ZA 2GGRA 2LJ1A 1KC8R 1M1FA 1VQ9Q 2KR3A 2DL4A 2FEIA 2OJ2A 2XMFA 4HCKA 5EC7A 1GCQA 4LD6A 1PCXA 1VQLT 2RQUA 3CCSA 2KY9A 3HRTA 4OMFB 4JRQA 3EGDA 4F7UB 2DL8A 2QG9B 3NTIA 2C0IA 5D6YA 5KYUA 5KYYB 1I1JA 3RKXA 4C5EA 4N0AA 2Y4XA 1OX8A 2MIOA 2VV5A 3URGA 2O2OA 1VQPQ 4PJLA 3G71T 1Q7YC 4LDXA 4OB0B 4M75A 1GCQC 3X26B 4PJOB 2JM9A 3TSZA 2KK4A 3HTRA 2YRDA 1Q7YU 2RI2A 1TOVA 2WSEE 3I9QA 1PD0A 2GTJA 2A0FB 2O31A 3HFNA 3V8KA 1ZSGA 5DM7R 4NOYA 3JCMe 1Y57A 4J6XA 3LWHA 3VS6A 4XU2A 2DXTA 5GAN6 1YI2T 2JS0A 1K73C 2RHYA 1VQOA 4JRKA 1GBQA 2MMPA 2CP2A 4M78A 1M90C 4EMKB 1X75C 2VKNA 1FX7A 1CKBA 3CCLA 1JQQA 1U1TA 2M1HA 3ASKA 1OU8A 3SWNC 3VS5A 2I2LA 3RNJA 2L2PA 2JJ9A 3M56A 1KQSS 2DBMA 3RMQA 2COZA 1YWOA 4MDXA 3VUZA 1H3HA 1YJNT 3NHNA 1SSHA 1RAHB 4J9CA 3OA6A 4J9GA 3QJYA 5CCAA 2CP7A 5GAOr 2B86A 2YWWA 1M1KU 1W1FA 2X4YA 1AHJB 3UT1A 4JJBA 4JS4A 4OF1A 1VYVA 1N5ZA 2R58A 1K73U 2GF7A 4RTXA 4HVUA 1QKXA 2PTKA 2HSPA 3CXCP 4D8KA 1ARKA 1TU0B 3JCMg 2XKOC 1GL5A 4M77B 3UPUA 4C92F 3QYGB 4BDZA 1OULA 2CSIA 2LQKA 4A63B 1SRMA 1TTHB 4JLGA 1UGPB 4RTYA 3EFSA 4M77A 4LN2A 1QWEA 1YWPA 1YI2A 2MI6A 3KFVA 2K3YA 2VGMA 2RQRA 1U5SA 1QVGP 4MMLA 1RLQC 4B6MA 4C0ZA 4GY5A 1UJYA 3MO8A 3G4ST 2RD1A 4IIMA 1OOTA 3AT1B 3EGXB 4KBMB 2EQKA 3OMCA 2HQXA 3C95A 2DKGA 4JDSA 1VQPT 3X28B 4M75D 4ME7A 1M4ZA 3QBYA 4HT9A 7AT1B 1M27C 2HNIA 4E7IA 3QIIA 3O8VA 2EJGA 3QDRB 4EMKA 3TSWA 2KT1A 2B8AA 3IQLA 2D6FA 3OYEA 2QI2A 3UA7A 2KVQG 2X51A 1QVPA 3MP8A 3DB3A 3DLMA 4AMCA 3QUIA 3M4YA 2OTJQ 1E7OA 4J9BA 4QQ6A 2GFAA 3A8HB 3CEYA 1S1NA 1X01A 1JO8A 2FZKB 1ZUUA 1BIAA 3X20B 4OMPA 3E2UA 2BZXA 3EFOA 3E1SA 1H641 5FU7C 4FIBA 4X1VA 1YFNA 4M7DE 3X25B 3L1AA 1SF9A 3A98A 4Y91A 3QSUA 2FRWA 4CRIA 1PSEA 4PLIA 1IHWA 1WZOA 3CCMA 2PVGB 2LVMA 1UHCA 3FRNA 4M78D 1UECA 2P0KA 3OYCA 2NUZA 2KI7A 2K6DA 4HVVA 2DYBA 1BI0A 1M90R 4AFUC 1SSFA 3EGDB 1PKSA 4JUVA 1PC0A 4M78G 4N4GA 3CCUA 2DJZA 2HSEB 3CCLT 1X2QA 4Z8AA 2KRNA 2LT4A 1YJ9Q 5GAMh 1XOVA 2FB7A 3SHWA 4HKEA 2CZ0B 4RCCA 4OMLA 2DPPB 3CCQQ 1K0XA 2F69A 5AT1B 3CCQT 1M90U 3C94A 3CCJA 3WXMB 2K2MA 1NLOC 4OMOA 3A8MB 2QTVA 3REBB 2FPEA 3C4SA 2X4WA 1GBRA 1K76A 2AK5A 2ATCB 3OS1A 3H0HA 3L2ZA 5CVIA 1LVKA 3ZFJA 5KE2A 2K5IA 3OYDA 1K9MR 2LZ6B 2RJFA 4XAXB 2RMOA 2AHJB 1QVFP 3KBGA 2KRSA 3S3NA 3RMSA 4PK4A 3SB2A 1RUWA 3KUFA 3S6WA 2EGEA 1VQ6T 1K1ZA 5GAMf 2NLUA 3QDFA 5J26A 2KQWA 2H3EB 2AIRB 2PVDB 4RUGA 2QQBA 1NYFA 2L3PA 1V76A 3JCMd 3G6EQ 2AT1B 2OI3A 3REAB 2P0PA 1SEMA 1IZ6A 3I35A 5FW9A 2F5TX 5GMKm 1LOJA 2K2VA 2R57A 2OTJT 4A4HA 5GAN7 4O6JA 3BW1A 1WIEA 1LJOA 3M0RA 2DXUA 2EJ9A 4PLLA 4F7UE 3CC2A 2Z0WA 2LMJA 2IIMA 5IAYA 2BTTA 1VQ5A 3GNGA 1UGQB 1KD1U 2L3QA 2OX7A 2YUQA 3LWIA 1BCMA 4OMQA 2PNIA 1SHFA 3EGXA 1G5VA 2EKHA 2XG8D 3VS2A 3NGPA 2RJDA 3OBYA 4KRTA 4Z89A 3EG1A 3M0SA 1M8MA 3FDRA 3D7SB 2KEAA 4AG1C 3R6NA 2A3LA 2MAMA 3V8JA 5L23A 5GANg 3Q1JA 2HDAA 1WA7A 2J06A 4C5GA 1SHGA 1QVFA 3JB9I 4QW2A 2PZ1A 2VXFA 2OAWA 2VB6A 4A4KA 4HCZA 3MEVA 4AFSC 4IUPA 2BE7D 2CUBA 3LH5A 2JNGA 3FJ5A 1NZ9A 3PIOA 2ZAEA 1NLPC 2K3BA 2DZ9A 2DA9A 1RACB 2OAUA 2DERA 3BDLA 4GLKA 2CSQA 3OMGA 4FT2A 4BE1A 3THKA 3LW5E 3L2VA 2VUBA 2G6FX 3QZ5B 1MGQA 1VQNA 3GP8A 3I5SA 5GAN4 1VQMQ 2K9GA 3JRZA 3QKJA 4M75B 3GBQA 5EG2A 1Z9QA 4FYYB 3OBWA 4J9EA 2A36A 1BIBA 3CBMA 2YRCA 2OTLQ 4ZTJA 3PFSA 1MV0B 1VQ8A 1PKTA 4FW1A 2JUFA 2V1RA 4OMNA 1AVZC 2E5QA 1WLPB 4XU3A 2HAXA 3H6ZA 1JB0E 3GF5A 2AZSA 3CQTA 4XTUA 2XDPA 1PHTA 4QKUA 4KUDK 2H3JA 1K73R 4C5IA 5GANj 1K8AC 3I56A 3PGGA 2CZ7B 2FG0A 1WNLA 3LH0A 5LJ5e 1PNJA 1YJWA 1AZGB 1BKBA 1RAEB 3EG3A 2F2WA 2EW3A 3TQ7P 1WDXA 4RG2A 2CH4A 4HCCA 1RAFB 1UTIA 4YTLA 2DRMA 2VYTA 2FRYA 2P4RA 1B34A 4IUUA 2KXCA 3CCVT 1D0XA 3VJPA 8ATCB 2E6NA 3H0IA 1Q82U 5LJ3j 4ATOA 4MZPA 1M1GA 3OYNA 5FWCA 5A0LA 1KJWA 2E64A 1VQLQ 1G3WA 2NUPA 2D0NA 1PD1A 3QO3A 1RI0A 4NL3A 1G2BA 2FHDA 4KH0B 4ANJA 2LTOA 2ABLA 1M2VB 3HPWA 2LRQA 3CCJT 4BB7A 2O01E 1IHVA 3CD6A 4FYXB 1I0CA 1W2BP 1EFNA 4RCBA 2J6FA 1YIJA 2HL5C 2OTLA 4ZGEB 2XK0A 4ZN1A 2D0QB 2YXYA 4IURA 5LJ3d 4XU1A 5L8RE 2JS2A 3L42A 2DZCA 1WI7A 4KGVB 2QEXA 2LCCA 3MCAB 3L2UA 1MV3A 1M3BA 2SRCA 4C92B 1BI2A 3JCMW 1T0JA 4C8QF 2XDBA 3QPHA 4C5HA 4PJOA 3JCMV 5KYWB 3VS7A 2NYSA 1ZBJA 1XQHA 3OYKA 5KE3A 1N8RC 2K3XA 1NPPA 3EG9A 5J39A 3G4SA 1KSWA 1ZSZC 3OQ5A 5CK9A 1ZBXA 3SDZA 1M30A 1TUCA 1AEYA 2CYZB 2XDDA 2F1LA 2QASA 3E19A 3FJPA 4J9DA 2MF2A 3TCJA 1X6BA 4JJNK 4ZGDB 4OB3B 5DLQE 1K4US 2D9TA 1GXIE 3V8LA 5I2MA 1VQ7A 3OS0A 1OU9A 2DE0X 2FZGB 2RK1A 4BD3A 3VKIA 2YSQA 3LYIA 4HT8A 4N4IA 3CCEA 1HXDA 3AHUA 5GAMg 3RIRA 1G8XA 1M9SA 1QLYA 2RO0A 3FB9A 2RHUA 5LJ3e 2A7YA 4M75F 4LUDA 4PJOD 3QWXX 1P92A 4QQDA 1OV3A 2M16A 4Y28E 1YBYA 1KD1C 1YITQ 4AFZC 1N27A 5GJVB 2M0YA 4JRPA 3E9GA 1X6GA 4PFOA 2HCKA 3PMIA 2JT4A 1UFFA 4OP0A 1V1CA 4DBQA 4C8QC 1R0BG 5GAOl 2RJCA 3EHRA 3OW2P 3CMAT 3VUBA 4C0GA 2GCXA 2X4JA 1YJNQ 2J7IA 2K4YA 1YHQQ 1WHKA 1FYNA 3NTKA 2KGTA 3E9FA 2RM4A 4J83A 3UA6A 4C8QG 2KYMA 3I55A 4PFZA 4F14A 4IKFA 3VS4A 4IUVA 4M7AE 2VXEA 5A0DA 1V29B 4MZMA 4R55A 1X6OA 2DILA 4IUTA 5IHIA 3T9NA 2X35A 1N6AA 4RTUA 1O9SA 2QEXQ 4OB1B 1KC8U 1YHQA 2ZGWA 4XTWA 2RQWA 2YT6A 4JJCA 1NJIC 3RESA 2DTHA 4O5VA 3TU4K 1TS9A 2DL7A 5D6WA 2LNVA 1VA7A 3H8ZA 4E7KA 4PJMA 1VQ5Q 2BZYA 3HRSA 3HL8A 1A0NB 2V26A 1B34B 2X3WD 2JMCA 2RNAA 3QHSA 5I22A 5C0MA 3OY9A 1WHMA 4PNOA 1TSFA 4K11A 4Y92A 2EYZA 1WFWA 4D6WA 1OYXA 4DA4A 4C8QB 3JCMX 2EVRA 1HYOA 4R56A 1WXBA 3OB9A 1WJQA 2E1HA 1AWWA 4A4EA 1D09B 1JXOA 1Y96A 2QEXT 2KROA 4DBRA 2ZPIB 1AD5A 1QWFA 4PJJA 3VV0A 2P0QA 1TH7A 1Y07A 2J05A 3L2WA 1M8VA 2G3RA 2X9HA 2NUPB 4ELYC 2E12A 2PQWA 5GMKj 2RJEA 1NM7A 1U8RA 3JB9F 4FYWB 3A8GB 3OYAA 2DEQA 5IXFA 1OI1A 2YUOA 2W10A 3C12A 3DLLA 5HK3A 2NWMA 2BIVA 4M7AB 2DTIA 4C92A 2JXBA 1B3QA 3CBPA 3P8DA 1VQ4Q 4M7AA 5HK0A 5FLXE 1AWOA 1YITA 1NG2A 3JSCA 4X9CA 3U23A 3CCET 1ACMB 1BU1A 4DOWA 1X43A 2FVUA 5GMKl 1MNDA 2MK5A 5GAMj 4A4GA 3CCQA 4WF2A 1M2VA 2O88A 5CIUA 3CD6Q 1I4K1 2CUDA 2XICA 3CCEQ 3M0TA 5LJ3g 2GNCA 1W4SA 1M3AA 4PJNA 1YN8A 3JCMQ 3CCRT 1D3BA 1Y96B 3LGLA 1M3CA 4N4HA 1RABB 2YUPA 1RADB 3CC7T 1LPLA 2ROTA 2CT4A 4ZNXA 2JOYA 1G3YA 3MEUA 3OSSC 3QG1A 3VRZA 2PUKB 5CKBA 3CCLQ 2RQTA 5GMKh 1MUZA 4BY6C 2HQHA 4EDUA 4ZGJB 1WPYA 2VGNA 3F70A 2CP5A 1VQKA 2QQ9A 4DQ2A 1VQ7Q 1FMVA 1YP5A 2QA4Q 5LL6S 4M78E 3VYHB 5C6SA 1JU5C 1AOJA 3RDVA 2LQWA 1M1KC 4KH1B 3JB9G 3QYHB 2XD0A 3V7CA 2RHIA 2OTJA 2L5QA 3SWNB 4ZTFA 5A2QE 4JJDA 4N0AC 2VWFA 2M0OA 1WHHA 1B07A 3INZA 5LJ5d 3NMZC 2EBPA 4J9IA 1VYUA 1T0HA 3OS5A 2CZ6B 3S3OA 2DIQA 1PSFA 1E6GA 1WQWA 2DAQA 1G83A 4C92D 1QP3A 1MMDA 1SKUB 1BI1A 2DXBA 5HCKA 2C0TA 1JEGA 5CQXA 2E65A 3VRYA 4KT0E 3SEMA 1W2BA 2FL7A 3CC4A 2XU8A 1WX6A 3I56T 1PRMC 2O4XA 3OYBA 3MHXA 2RH2A 3META 4F7UF 3NFCA 4BI3A 2JTMA 1EZZB 2K79A 3NPFA 4M75E 1K9MC 1DJ7B 2EKOA 5GAMd 1WXTA 1TWBA 5GAOm 4RG8A 5CKEA 1Y7XA 2IPOB 4BE0A 3A8LB 3JB9H 2RF0A 3QWYA 1N9SA 1RLPC 2DD5A 2MWOA 2RA2A 2KNBB 5GAOp 1VQ8Q 3OYGA 3JV3A 2KE9A 5CKFA 1EIFA 2KMTA 4FL6A 4X9DA 2VVKA 4XTYA 4PL6A 2SEMA 3VU3C 3GNFB 3M9QA 2KAFA 1QKWA 1YCSB 2YLCA 2F2XA 4XTXA 1W6XA 4ORZA 3EG0A 1S72T 2E4HA 3OYMA 5LJ3h 1X2KA 2V1QA 1X27A 1XNIA 3OYJA 3M0UA 1C1AA 2QQRA 5KYWA 4XU0A 1VOMA 3LX7A 4PFPA 1PM3A 5GJWB 3CXCS 1NEBA 2CT3A 2WSFE 2EYWA 3MEWA 1RAIB 5FWBA 3EFOB 2C06A 5FROA 2YUNA 4BUGA 4M75C 2LQ8A 2RQVA 2LNHB 1U1SA 1ZQ1A 1VQMT 1WHGA 2LDMA 4M7DC 1H92A 3RBBB 2WSCE 1HD3A 3P8BB 1D1AA 1X69A 1KQSP 2AZVA 1C6VX 4PJOE 2EWNA 2LC4A 4M75G 3CC2T 1NE8A 4GLMA 1KQ1A 3JCMh 1VQKT 5DLOA 3M59A 1QMCA 2QK0A 2A08A 4M77F 1O75A 2ROLA 4EMKC 5GAMe 1MMAA 3M58A 1YI2Q 2XIDA 5IXBA 3PNWC 1IXDA 4JZ3A 5CR2A 1W70A 2MWPA 3JB9D 1NBEB 2EPDA 1KK7A 2A28A 2E3IA 2QTXA 4MDWA 2DJQA 2LCSA 1UEBA 3O5ZA 2L8DA 3P8HA 4CC7A 2DD4A 2QYZA 3A1PA 4NS5A 4CC2A 2BKDN 5KCHA 3OYIA 4ZN3A 4Z02A 1PRLC 1UB4A 2GQVA 2HBWA 4WCIA 1K8AU 1FWZA 2XHCA 4BDYA 1QQJA 1YJ9A 1YCYA 4M7AF 2DO3A 4KUIA 1OPKA 3M55A 4PKCC 4M77C 3ME9A 3CCUQ 1Q7YR 3OYHA 2HMAA 3OYYA 4DOVA 2EQMA 1VQ7T 1I81A 3OS2A 3CCVA 1R8OB 3CCMQ 1WHJA 4M78F 2V8JA 3G4SQ 1XTDA 4KGXB 1VQ5T 2NUTA 3VYGA 3G71Q 5CKHA 2EYXA 3MJXA 2QDLA 1EX4A 4UC4A 2CKKA 3UATA 3BE3A 3BY7A 2JTFA 3OYLA 3NTHA 4JRIA 2QA4T 4VUBA 2CS7A 2EIFA 2NUTB 1SPKA 3QZ9B 4M7DF 1OQKA 1ABQA 2JTEA 2PU9B 3CPWA 2DFUA 2ZZDA 1RAGB 1BI3A 2DYIA 2ZPEB 5IT9E 3PVLA 1I5OB 4M7AD 3MKDA 1Z9ZA 2GTOA 3FLGA 4PJOF 1S72Q 4EPCA 1FXXA 1UGRB 4M7DD 3SWNA 3FC3A 2BUDA 4M7AG 2XI9A 1QCOA 4J5YA 5CQYA 3CC2Q 4IIOA 4QT7A 3EAEA 1NJIR 5I21A 4XTZA 2JVVA 3VS1A 1HK9A 1R0CB 4C0FA 1BBZA 4QVZA 1RI9A 2E5KA 3OW2S 4HXJA 3V7SA 4BI4A 4C0DB 2ZPGB 1VQMA 2EYYA 4FU6A 1NJIU 2LCLA 2RI3A 3ZBDA 5IHNA 1KC8C 2FO0A
chains in the Genus database with same CATH topology
2QAZA 1ZSZA 1OX9A 2NYSA 1ZSZB 1TWBA 1OX8A 1OU8A 1YFNA 1OULA 1ZSZC 2QASA 1OU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAZ A;  1ZSZ A;  1OX9 A;  2NYS A;  1ZSZ B;  1TWB A;  1OX8 A;  1OU8 A;  1YFN A;  1OUL A;  1ZSZ C;  2QAS A;  1OU9 A; 
#chains in the Genus database with same CATH topology
 5KYN A;  2MCN A;  1IGQ A;  4D8D A;  2HKQ B;  1YJ9 T;  1UDL A;  1UGV A;  2JM8 A;  2QQA A;  5HKC A;  4FYV B;  3EHQ A;  4CC4 B;  2CGH A;  3I56 Q;  1WXU A;  1D3B B;  1D0Y A;  4J9H A;  2KYB A;  2W0Z A;  3RUX A;  4E7Z A;  4BE2 A;  4P5N A;  4LUE A;  2K5L A;  1ZA2 B;  4QVC A;  1JBM A;  3CPF A;  2RHX A;  4NL2 A;  4F7U A;  5GAN 5;  3CCU T;  1UGS B;  5KH6 A;  2CH4 W;  3L2Q A;  1AWJ A;  3PT9 A;  2D8J A;  5LJ5 j;  5HY6 A;  3H0F A;  1YJW Q;  1UE9 A;  3UDC A;  1VQP A;  3EH1 A;  4DBH A;  2CRE A;  3M0Q A;  1H8K A;  2FZC B;  2V8K A;  2EQJ A;  5GAN d;  2L3S A;  3ZL7 C;  5CKD A;  1FMW A;  3GOX A;  4X34 A;  2COW A;  2COY A;  4M77 D;  3HKS A;  4II1 A;  2KDS A;  2F2V A;  4AG2 C;  2MYS A;  4C8Q D;  2GBQ A;  2GFU A;  6AT1 B;  4BAC A;  4A53 A;  4FCY A;  2DBK A;  1JJ2 S;  4LD9 K;  3A5Z B;  4F16 A;  4E7H A;  1Q86 U;  3L2R A;  2QQS A;  1GFD A;  1OZ3 A;  2X4X A;  1Q95 G;  2DF6 A;  3DKM A;  1KIK A;  2P84 A;  3I5R A;  2LP5 A;  5KYY A;  5KYU B;  1UJ0 A;  1W2B S;  2FPD A;  4HA8 A;  4EMH A;  4EIK A;  4CC3 A;  2J6O A;  1TUD A;  2EAY A;  3LLR A;  2DET A;  4M78 B;  1J3T A;  1UHF A;  1TXQ A;  3EG2 A;  3BFM A;  4XK8 E;  3PVQ A;  1Q86 R;  3HP9 A;  1VQK Q;  3GPL A;  1WYX A;  3G1J A;  4QQG A;  2DL3 A;  4FSS A;  4ELZ C;  9ATC B;  3UF4 A;  3I55 T;  4OGE A;  3QXE B;  2ZPB B;  3H9N A;  4Q5W A;  2CDT A;  3WVD B;  2D1X A;  3ZEH A;  3CCS T;  1I07 A;  1YJN A;  3CME T;  3PMT A;  2YLB A;  1M2O A;  4J8O A;  4C92 G;  1OPL A;  3KXT A;  3CMA A;  1YIJ Q;  1D1B A;  4E6R A;  3CC7 Q;  3X24 B;  2DM1 A;  2KRM A;  5GMK i;  2LX7 A;  1WJR A;  2PUO B;  2EJF A;  3VS3 A;  5KYX A;  1BK2 A;  1U06 A;  1PWT A;  4C92 C;  2RB6 A;  1YIJ T;  3CXC A;  2CP3 A;  1KFZ A;  3CD6 T;  3OW2 A;  4RTV A;  1YNZ A;  5IHK A;  2QXF A;  1KG1 A;  2JW4 A;  4RTW A;  2M02 A;  5GMK e;  4F04 B;  2DEU A;  2V8I A;  1BB9 A;  5FU6 B;  1R77 A;  1NYG A;  3CC7 A;  1K9M U;  4LNP A;  2BZ8 A;  4LE9 A;  5GAN f;  1Q81 R;  2AKL A;  4OVA A;  4J6Y A;  1VQ4 T;  2VAS A;  2YDL A;  3OSV A;  1VQ9 A;  5A0G A;  3M5A A;  4A4F A;  4RTT A;  2E6Z A;  1F1B B;  2E10 A;  3HFO A;  2K5F A;  3CCM T;  2DX1 A;  5M9O A;  1AWX A;  1VQ6 A;  3MEA A;  3SD4 A;  1GRI A;  3G6E A;  1Y71 A;  3CC4 Q;  4ESR A;  2EYQ A;  4RMO A;  1VQO Q;  1KHI A;  4F7U G;  5D6X A;  4XTV A;  3WVE B;  3J81 E;  2MPX C;  4C8Q E;  3CPW P;  2E70 A;  4JPB W;  1JRI A;  3G7Z A;  2A37 A;  1NPR A;  1N8R U;  5I2S A;  2YRV A;  2HEQ A;  4FM4 B;  1I5L A;  1UG1 A;  1JXM A;  2QGF B;  5GAN h;  2R5A A;  3JCM c;  4BI8 B;  1TG0 A;  2L3R A;  1UUE A;  5GAN 2;  2GQI A;  2DTO A;  3V7R A;  5LJ5 g;  1HSQ A;  1IO6 A;  1WQ7 A;  1IGU A;  3DB4 A;  1KD1 R;  1N8R R;  5IN1 A;  4M4Z A;  3TRE A;  1VUB A;  2HBP A;  3S3M A;  2CP6 A;  1GFC A;  2O4X B;  3M4G A;  3LGF A;  2DIG A;  4DEY A;  3VS0 A;  5KCO A;  1M5Q 1;  2KSS A;  4L59 A;  1U3O A;  3JCM f;  1K8A R;  1I8F A;  4FW2 A;  3M0P A;  2AKK A;  1T3S A;  4MZT A;  2F5K A;  5IH2 A;  2R5M A;  3GLX A;  2JMA A;  1ABO A;  3CME A;  2LQN A;  1QW1 A;  2KT8 A;  3G71 A;  2JN0 A;  1GCP A;  4OGC A;  3RER A;  1G3T A;  4E7J A;  4M7A C;  2ED0 A;  5FU7 B;  2EQI A;  3HSB A;  3MP1 A;  2ESW A;  1QVF S;  3CCR Q;  5GAN 8;  3CCV Q;  1BYM A;  4GBQ A;  1YJW T;  1Q86 C;  3M53 A;  1MMG A;  2M9U A;  4J9F A;  2KBT A;  1VQ9 T;  1IRE B;  1T3L A;  1SG5 A;  4FT4 A;  4LDU A;  2CZ1 B;  2D8H A;  1IRX A;  3QJ6 A;  1ZHI A;  2LX9 A;  2DMO A;  2DK3 A;  2ZPH B;  1YHQ T;  1XJW B;  5D7U A;  1VQ8 T;  2RI5 A;  3SFM A;  5LJ5 h;  1LCK A;  2QAZ A;  1QVG S;  1VIE A;  4M7D G;  1ZUY A;  4FSX A;  1B7T A;  2ZPF B;  4JLI A;  3GIB A;  3JAM E;  3JCM b;  1VQN Q;  4LDV A;  2C0O A;  3M54 A;  1MHN A;  1VQN T;  2YHT A;  4TVR A;  1CKA A;  2HKN A;  2DL5 A;  3ER0 A;  5FRM A;  3A8O B;  4J7F A;  2EGA A;  3TVT A;  4WTO B;  2ENM A;  3UWN A;  1S72 A;  3EH2 A;  4OMM A;  2HQE A;  2ED1 A;  4M7D A;  4V2S A;  4JZ4 A;  5GAO q;  1Y0M A;  1QCF A;  2I0N A;  4F17 A;  2H8H A;  3CCR A;  4MMK A;  3RKY A;  4RTZ A;  3ULR B;  5FU6 C;  3J7A F;  2DXC A;  2LJ3 A;  2WAC A;  3C0C A;  4LDY A;  5GAN 3;  2OTL T;  1KHC A;  2Y90 A;  1M1K R;  1D1C A;  2ZCF B;  3HHT B;  2CP0 A;  2JZ2 A;  3MPU B;  3I55 Q;  2DRK A;  2O9V A;  4M7D B;  1HJD A;  4AT1 B;  1AZE A;  1ZUK A;  4C8Q A;  1Q82 R;  4DEX A;  4M77 G;  2LJ0 A;  2DNU A;  3CBO A;  2DVE A;  4Z88 A;  3J80 E;  1E6H A;  2RK2 A;  1JJ2 A;  1KQS A;  1ZA1 B;  4OB2 B;  1N9R A;  4B9X A;  1FMK A;  1MNE A;  2RHZ A;  4J7I A;  3PIP A;  1CSK A;  3FEO A;  2K7A A;  5LJ5 f;  4EMG A;  4E7L A;  4BY6 B;  2HD0 A;  4CI0 C;  4L6V 5;  3R6O A;  3CCJ Q;  2P4T A;  8AT1 B;  1MMN A;  2X3X D;  3PE0 A;  4B9W A;  2M51 A;  1VQ4 A;  4A54 A;  5ECA A;  3RKW A;  1RAA B;  1JJ2 P;  5FRN A;  3HRU A;  1VIF A;  3TEE A;  1OZ2 A;  2Y4Y A;  1VQ6 Q;  3CMA Q;  4E7S A;  4C92 E;  1QVG A;  2E41 A;  1VQO T;  4KUL A;  2K57 A;  5GAO n;  3JB9 J;  2EGC A;  1WHL A;  1SRL A;  5J3B A;  1QP2 A;  1VYT A;  1OEB A;  2EFI A;  1Q81 C;  4PJO G;  2QGG A;  1K9A A;  1IB8 A;  1QCN A;  1ZX6 A;  1Q82 C;  1H3Z A;  2E3H A;  1OX9 A;  1ZSZ B;  5KYX B;  1ZSZ A;  1WJS A;  2FYK A;  1KQ2 A;  5LJ3 f;  1Q81 U;  4LXC A;  4KGZ B;  1TUG B;  2EQU A;  2PVO B;  1BCO A;  4JS5 A;  5CO7 A;  3CC4 T;  4XQ3 A;  1NEG A;  4PJO C;  4M77 E;  4L5G A;  1RL2 A;  3G6E T;  1G3S A;  2MOX A;  1C0M A;  2L0A A;  4LDW A;  4RKU E;  4QVD A;  3MP6 A;  2DVJ A;  4IUQ A;  2IG0 A;  1PG5 B;  2HL3 A;  3N5B B;  2RPN A;  3H41 A;  4C0D C;  2HZY A;  3JCM P;  2IVW A;  4J6W A;  4HCB A;  5CAI A;  3JCM J;  3RR6 A;  1AT1 B;  4DBF A;  1VQL A;  2J6K A;  4HVW A;  5AYF A;  4M78 C;  3EFR A;  1YIT T;  2ECZ A;  4AFQ C;  2L89 A;  2O9S A;  2FPF A;  5I11 A;  2QA4 A;  3OYF A;  3FIF A;  3BDU A;  4R0K A;  3CCS Q;  1K0S A;  5DY9 A;  1ZLM A;  3PTA A;  3CME Q;  4E47 A;  3M57 A;  3EG9 B;  3EGU A;  2LT1 A;  2RN8 A;  2KXD A;  2VC8 A;  3CPW S;  4E2F B;  1WGS A;  2DLP A;  5GAN e;  2BE9 B;  2QDY B;  1LNX A;  1D0Z A;  2GGR A;  2LJ1 A;  1KC8 R;  1M1F A;  1VQ9 Q;  2KR3 A;  2DL4 A;  2FEI A;  2OJ2 A;  2XMF A;  4HCK A;  5EC7 A;  1GCQ A;  4LD6 A;  1PCX A;  1VQL T;  2RQU A;  3CCS A;  2KY9 A;  3HRT A;  4OMF B;  4JRQ A;  3EGD A;  4F7U B;  2DL8 A;  2QG9 B;  3NTI A;  2C0I A;  5D6Y A;  5KYU A;  5KYY B;  1I1J A;  3RKX A;  4C5E A;  4N0A A;  2Y4X A;  1OX8 A;  2MIO A;  2VV5 A;  3URG A;  2O2O A;  1VQP Q;  4PJL A;  3G71 T;  1Q7Y C;  4LDX A;  4OB0 B;  4M75 A;  1GCQ C;  3X26 B;  4PJO B;  2JM9 A;  3TSZ A;  2KK4 A;  3HTR A;  2YRD A;  1Q7Y U;  2RI2 A;  1TOV A;  2WSE E;  3I9Q A;  1PD0 A;  2GTJ A;  2A0F B;  2O31 A;  3HFN A;  3V8K A;  1ZSG A;  5DM7 R;  4NOY A;  3JCM e;  1Y57 A;  4J6X A;  3LWH A;  3VS6 A;  4XU2 A;  2DXT A;  5GAN 6;  1YI2 T;  2JS0 A;  1K73 C;  2RHY A;  1VQO A;  4JRK A;  1GBQ A;  2MMP A;  2CP2 A;  4M78 A;  1M90 C;  4EMK B;  1X75 C;  2VKN A;  1FX7 A;  1CKB A;  3CCL A;  1JQQ A;  1U1T A;  2M1H A;  3ASK A;  1OU8 A;  3SWN C;  3VS5 A;  2I2L A;  3RNJ A;  2L2P A;  2JJ9 A;  3M56 A;  1KQS S;  2DBM A;  3RMQ A;  2COZ A;  1YWO A;  4MDX A;  3VUZ A;  1H3H A;  1YJN T;  3NHN A;  1SSH A;  1RAH B;  4J9C A;  3OA6 A;  4J9G A;  3QJY A;  5CCA A;  2CP7 A;  5GAO r;  2B86 A;  2YWW A;  1M1K U;  1W1F A;  2X4Y A;  1AHJ B;  3UT1 A;  4JJB A;  4JS4 A;  4OF1 A;  1VYV A;  1N5Z A;  2R58 A;  1K73 U;  2GF7 A;  4RTX A;  4HVU A;  1QKX A;  2PTK A;  2HSP A;  3CXC P;  4D8K A;  1ARK A;  1TU0 B;  3JCM g;  2XKO C;  1GL5 A;  4M77 B;  3UPU A;  4C92 F;  3QYG B;  4BDZ A;  1OUL A;  2CSI A;  2LQK A;  4A63 B;  1SRM A;  1TTH B;  4JLG A;  1UGP B;  4RTY A;  3EFS A;  4M77 A;  4LN2 A;  1QWE A;  1YWP A;  1YI2 A;  2MI6 A;  3KFV A;  2K3Y A;  2VGM A;  2RQR A;  1U5S A;  1QVG P;  4MML A;  1RLQ C;  4B6M A;  4C0Z A;  4GY5 A;  1UJY A;  3MO8 A;  3G4S T;  2RD1 A;  4IIM A;  1OOT A;  3AT1 B;  3EGX B;  4KBM B;  2EQK A;  3OMC A;  2HQX A;  3C95 A;  2DKG A;  4JDS A;  1VQP T;  3X28 B;  4M75 D;  4ME7 A;  1M4Z A;  3QBY A;  4HT9 A;  7AT1 B;  1M27 C;  2HNI A;  4E7I A;  3QII A;  3O8V A;  2EJG A;  3QDR B;  4EMK A;  3TSW A;  2KT1 A;  2B8A A;  3IQL A;  2D6F A;  3OYE A;  2QI2 A;  3UA7 A;  2KVQ G;  2X51 A;  1QVP A;  3MP8 A;  3DB3 A;  3DLM A;  4AMC A;  3QUI A;  3M4Y A;  2OTJ Q;  1E7O A;  4J9B A;  4QQ6 A;  2GFA A;  3A8H B;  3CEY A;  1S1N A;  1X01 A;  1JO8 A;  2FZK B;  1ZUU A;  1BIA A;  3X20 B;  4OMP A;  3E2U A;  2BZX A;  3EFO A;  3E1S A;  1H64 1;  5FU7 C;  4FIB A;  4X1V A;  1YFN A;  4M7D E;  3X25 B;  3L1A A;  1SF9 A;  3A98 A;  4Y91 A;  3QSU A;  2FRW A;  4CRI A;  1PSE A;  4PLI A;  1IHW A;  1WZO A;  3CCM A;  2PVG B;  2LVM A;  1UHC A;  3FRN A;  4M78 D;  1UEC A;  2P0K A;  3OYC A;  2NUZ A;  2KI7 A;  2K6D A;  4HVV A;  2DYB A;  1BI0 A;  1M90 R;  4AFU C;  1SSF A;  3EGD B;  1PKS A;  4JUV A;  1PC0 A;  4M78 G;  4N4G A;  3CCU A;  2DJZ A;  2HSE B;  3CCL T;  1X2Q A;  4Z8A A;  2KRN A;  2LT4 A;  1YJ9 Q;  5GAM h;  1XOV A;  2FB7 A;  3SHW A;  4HKE A;  2CZ0 B;  4RCC A;  4OML A;  2DPP B;  3CCQ Q;  1K0X A;  2F69 A;  5AT1 B;  3CCQ T;  1M90 U;  3C94 A;  3CCJ A;  3WXM B;  2K2M A;  1NLO C;  4OMO A;  3A8M B;  2QTV A;  3REB B;  2FPE A;  3C4S A;  2X4W A;  1GBR A;  1K76 A;  2AK5 A;  2ATC B;  3OS1 A;  3H0H A;  3L2Z A;  5CVI A;  1LVK A;  3ZFJ A;  5KE2 A;  2K5I A;  3OYD A;  1K9M R;  2LZ6 B;  2RJF A;  4XAX B;  2RMO A;  2AHJ B;  1QVF P;  3KBG A;  2KRS A;  3S3N A;  3RMS A;  4PK4 A;  3SB2 A;  1RUW A;  3KUF A;  3S6W A;  2EGE A;  1VQ6 T;  1K1Z A;  5GAM f;  2NLU A;  3QDF A;  5J26 A;  2KQW A;  2H3E B;  2AIR B;  2PVD B;  4RUG A;  2QQB A;  1NYF A;  2L3P A;  1V76 A;  3JCM d;  3G6E Q;  2AT1 B;  2OI3 A;  3REA B;  2P0P A;  1SEM A;  1IZ6 A;  3I35 A;  5FW9 A;  2F5T X;  5GMK m;  1LOJ A;  2K2V A;  2R57 A;  2OTJ T;  4A4H A;  5GAN 7;  4O6J A;  3BW1 A;  1WIE A;  1LJO A;  3M0R A;  2DXU A;  2EJ9 A;  4PLL A;  4F7U E;  3CC2 A;  2Z0W A;  2LMJ A;  2IIM A;  5IAY A;  2BTT A;  1VQ5 A;  3GNG A;  1UGQ B;  1KD1 U;  2L3Q A;  2OX7 A;  2YUQ A;  3LWI A;  1BCM A;  4OMQ A;  2PNI A;  1SHF A;  3EGX A;  1G5V A;  2EKH A;  2XG8 D;  3VS2 A;  3NGP A;  2RJD A;  3OBY A;  4KRT A;  4Z89 A;  3EG1 A;  3M0S A;  1M8M A;  3FDR A;  3D7S B;  2KEA A;  4AG1 C;  3R6N A;  2A3L A;  2MAM A;  3V8J A;  5L23 A;  5GAN g;  3Q1J A;  2HDA A;  1WA7 A;  2J06 A;  4C5G A;  1SHG A;  1QVF A;  3JB9 I;  4QW2 A;  2PZ1 A;  2VXF A;  2OAW A;  2VB6 A;  4A4K A;  4HCZ A;  3MEV A;  4AFS C;  4IUP A;  2BE7 D;  2CUB A;  3LH5 A;  2JNG A;  3FJ5 A;  1NZ9 A;  3PIO A;  2ZAE A;  1NLP C;  2K3B A;  2DZ9 A;  2DA9 A;  1RAC B;  2OAU A;  2DER A;  3BDL A;  4GLK A;  2CSQ A;  3OMG A;  4FT2 A;  4BE1 A;  3THK A;  3LW5 E;  3L2V A;  2VUB A;  2G6F X;  3QZ5 B;  1MGQ A;  1VQN A;  3GP8 A;  3I5S A;  5GAN 4;  1VQM Q;  2K9G A;  3JRZ A;  3QKJ A;  4M75 B;  3GBQ A;  5EG2 A;  1Z9Q A;  4FYY B;  3OBW A;  4J9E A;  2A36 A;  1BIB A;  3CBM A;  2YRC A;  2OTL Q;  4ZTJ A;  3PFS A;  1MV0 B;  1VQ8 A;  1PKT A;  4FW1 A;  2JUF A;  2V1R A;  4OMN A;  1AVZ C;  2E5Q A;  1WLP B;  4XU3 A;  2HAX A;  3H6Z A;  1JB0 E;  3GF5 A;  2AZS A;  3CQT A;  4XTU A;  2XDP A;  1PHT A;  4QKU A;  4KUD K;  2H3J A;  1K73 R;  4C5I A;  5GAN j;  1K8A C;  3I56 A;  3PGG A;  2CZ7 B;  2FG0 A;  1WNL A;  3LH0 A;  5LJ5 e;  1PNJ A;  1YJW A;  1AZG B;  1BKB A;  1RAE B;  3EG3 A;  2F2W A;  2EW3 A;  3TQ7 P;  1WDX A;  4RG2 A;  2CH4 A;  4HCC A;  1RAF B;  1UTI A;  4YTL A;  2DRM A;  2VYT A;  2FRY A;  2P4R A;  1B34 A;  4IUU A;  2KXC A;  3CCV T;  1D0X A;  3VJP A;  8ATC B;  2E6N A;  3H0I A;  1Q82 U;  5LJ3 j;  4ATO A;  4MZP A;  1M1G A;  3OYN A;  5FWC A;  5A0L A;  1KJW A;  2E64 A;  1VQL Q;  1G3W A;  2NUP A;  2D0N A;  1PD1 A;  3QO3 A;  1RI0 A;  4NL3 A;  1G2B A;  2FHD A;  4KH0 B;  4ANJ A;  2LTO A;  2ABL A;  1M2V B;  3HPW A;  2LRQ A;  3CCJ T;  4BB7 A;  2O01 E;  1IHV A;  3CD6 A;  4FYX B;  1I0C A;  1W2B P;  1EFN A;  4RCB A;  2J6F A;  1YIJ A;  2HL5 C;  2OTL A;  4ZGE B;  2XK0 A;  4ZN1 A;  2D0Q B;  2YXY A;  4IUR A;  5LJ3 d;  4XU1 A;  5L8R E;  2JS2 A;  3L42 A;  2DZC A;  1WI7 A;  4KGV B;  2QEX A;  2LCC A;  3MCA B;  3L2U A;  1MV3 A;  1M3B A;  2SRC A;  4C92 B;  1BI2 A;  3JCM W;  1T0J A;  4C8Q F;  2XDB A;  3QPH A;  4C5H A;  4PJO A;  3JCM V;  5KYW B;  3VS7 A;  2NYS A;  1ZBJ A;  1XQH A;  3OYK A;  5KE3 A;  1N8R C;  2K3X A;  1NPP A;  3EG9 A;  5J39 A;  3G4S A;  1KSW A;  1ZSZ C;  3OQ5 A;  5CK9 A;  1ZBX A;  3SDZ A;  1M30 A;  1TUC A;  1AEY A;  2CYZ B;  2XDD A;  2F1L A;  2QAS A;  3E19 A;  3FJP A;  4J9D A;  2MF2 A;  3TCJ A;  1X6B A;  4JJN K;  4ZGD B;  4OB3 B;  5DLQ E;  1K4U S;  2D9T A;  1GXI E;  3V8L A;  5I2M A;  1VQ7 A;  3OS0 A;  1OU9 A;  2DE0 X;  2FZG B;  2RK1 A;  4BD3 A;  3VKI A;  2YSQ A;  3LYI A;  4HT8 A;  4N4I A;  3CCE A;  1HXD A;  3AHU A;  5GAM g;  3RIR A;  1G8X A;  1M9S A;  1QLY A;  2RO0 A;  3FB9 A;  2RHU A;  5LJ3 e;  2A7Y A;  4M75 F;  4LUD A;  4PJO D;  3QWX X;  1P92 A;  4QQD A;  1OV3 A;  2M16 A;  4Y28 E;  1YBY A;  1KD1 C;  1YIT Q;  4AFZ C;  1N27 A;  5GJV B;  2M0Y A;  4JRP A;  3E9G A;  1X6G A;  4PFO A;  2HCK A;  3PMI A;  2JT4 A;  1UFF A;  4OP0 A;  1V1C A;  4DBQ A;  4C8Q C;  1R0B G;  5GAO l;  2RJC A;  3EHR A;  3OW2 P;  3CMA T;  3VUB A;  4C0G A;  2GCX A;  2X4J A;  1YJN Q;  2J7I A;  2K4Y A;  1YHQ Q;  1WHK A;  1FYN A;  3NTK A;  2KGT A;  3E9F A;  2RM4 A;  4J83 A;  3UA6 A;  4C8Q G;  2KYM A;  3I55 A;  4PFZ A;  4F14 A;  4IKF A;  3VS4 A;  4IUV A;  4M7A E;  2VXE A;  5A0D A;  1V29 B;  4MZM A;  4R55 A;  1X6O A;  2DIL A;  4IUT A;  5IHI A;  3T9N A;  2X35 A;  1N6A A;  4RTU A;  1O9S A;  2QEX Q;  4OB1 B;  1KC8 U;  1YHQ A;  2ZGW A;  4XTW A;  2RQW A;  2YT6 A;  4JJC A;  1NJI C;  3RES A;  2DTH A;  4O5V A;  3TU4 K;  1TS9 A;  2DL7 A;  5D6W A;  2LNV A;  1VA7 A;  3H8Z A;  4E7K A;  4PJM A;  1VQ5 Q;  2BZY A;  3HRS A;  3HL8 A;  1A0N B;  2V26 A;  1B34 B;  2X3W D;  2JMC A;  2RNA A;  3QHS A;  5I22 A;  5C0M A;  3OY9 A;  1WHM A;  4PNO A;  1TSF A;  4K11 A;  4Y92 A;  2EYZ A;  1WFW A;  4D6W A;  1OYX A;  4DA4 A;  4C8Q B;  3JCM X;  2EVR A;  1HYO A;  4R56 A;  1WXB A;  3OB9 A;  1WJQ A;  2E1H A;  1AWW A;  4A4E A;  1D09 B;  1JXO A;  1Y96 A;  2QEX T;  2KRO A;  4DBR A;  2ZPI B;  1AD5 A;  1QWF A;  4PJJ A;  3VV0 A;  2P0Q A;  1TH7 A;  1Y07 A;  2J05 A;  3L2W A;  1M8V A;  2G3R A;  2X9H A;  2NUP B;  4ELY C;  2E12 A;  2PQW A;  5GMK j;  2RJE A;  1NM7 A;  1U8R A;  3JB9 F;  4FYW B;  3A8G B;  3OYA A;  2DEQ A;  5IXF A;  1OI1 A;  2YUO A;  2W10 A;  3C12 A;  3DLL A;  5HK3 A;  2NWM A;  2BIV A;  4M7A B;  2DTI A;  4C92 A;  2JXB A;  1B3Q A;  3CBP A;  3P8D A;  1VQ4 Q;  4M7A A;  5HK0 A;  5FLX E;  1AWO A;  1YIT A;  1NG2 A;  3JSC A;  4X9C A;  3U23 A;  3CCE T;  1ACM B;  1BU1 A;  4DOW A;  1X43 A;  2FVU A;  5GMK l;  1MND A;  2MK5 A;  5GAM j;  4A4G A;  3CCQ A;  4WF2 A;  1M2V A;  2O88 A;  5CIU A;  3CD6 Q;  1I4K 1;  2CUD A;  2XIC A;  3CCE Q;  3M0T A;  5LJ3 g;  2GNC A;  1W4S A;  1M3A A;  4PJN A;  1YN8 A;  3JCM Q;  3CCR T;  1D3B A;  1Y96 B;  3LGL A;  1M3C A;  4N4H A;  1RAB B;  2YUP A;  1RAD B;  3CC7 T;  1LPL A;  2ROT A;  2CT4 A;  4ZNX A;  2JOY A;  1G3Y A;  3MEU A;  3OSS C;  3QG1 A;  3VRZ A;  2PUK B;  5CKB A;  3CCL Q;  2RQT A;  5GMK h;  1MUZ A;  4BY6 C;  2HQH A;  4EDU A;  4ZGJ B;  1WPY A;  2VGN A;  3F70 A;  2CP5 A;  1VQK A;  2QQ9 A;  4DQ2 A;  1VQ7 Q;  1FMV A;  1YP5 A;  2QA4 Q;  5LL6 S;  4M78 E;  3VYH B;  5C6S A;  1JU5 C;  1AOJ A;  3RDV A;  2LQW A;  1M1K C;  4KH1 B;  3JB9 G;  3QYH B;  2XD0 A;  3V7C A;  2RHI A;  2OTJ A;  2L5Q A;  3SWN B;  4ZTF A;  5A2Q E;  4JJD A;  4N0A C;  2VWF A;  2M0O A;  1WHH A;  1B07 A;  3INZ A;  5LJ5 d;  3NMZ C;  2EBP A;  4J9I A;  1VYU A;  1T0H A;  3OS5 A;  2CZ6 B;  3S3O A;  2DIQ A;  1PSF A;  1E6G A;  1WQW A;  2DAQ A;  1G83 A;  4C92 D;  1QP3 A;  1MMD A;  1SKU B;  1BI1 A;  2DXB A;  5HCK A;  2C0T A;  1JEG A;  5CQX A;  2E65 A;  3VRY A;  4KT0 E;  3SEM A;  1W2B A;  2FL7 A;  3CC4 A;  2XU8 A;  1WX6 A;  3I56 T;  1PRM C;  2O4X A;  3OYB A;  3MHX A;  2RH2 A;  3MET A;  4F7U F;  3NFC A;  4BI3 A;  2JTM A;  1EZZ B;  2K79 A;  3NPF A;  4M75 E;  1K9M C;  1DJ7 B;  2EKO A;  5GAM d;  1WXT A;  1TWB A;  5GAO m;  4RG8 A;  5CKE A;  1Y7X A;  2IPO B;  4BE0 A;  3A8L B;  3JB9 H;  2RF0 A;  3QWY A;  1N9S A;  1RLP C;  2DD5 A;  2MWO A;  2RA2 A;  2KNB B;  5GAO p;  1VQ8 Q;  3OYG A;  3JV3 A;  2KE9 A;  5CKF A;  1EIF A;  2KMT A;  4FL6 A;  4X9D A;  2VVK A;  4XTY A;  4PL6 A;  2SEM A;  3VU3 C;  3GNF B;  3M9Q A;  2KAF A;  1QKW A;  1YCS B;  2YLC A;  2F2X A;  4XTX A;  1W6X A;  4ORZ A;  3EG0 A;  1S72 T;  2E4H A;  3OYM A;  5LJ3 h;  1X2K A;  2V1Q A;  1X27 A;  1XNI A;  3OYJ A;  3M0U A;  1C1A A;  2QQR A;  5KYW A;  4XU0 A;  1VOM A;  3LX7 A;  4PFP A;  1PM3 A;  5GJW B;  3CXC S;  1NEB A;  2CT3 A;  2WSF E;  2EYW A;  3MEW A;  1RAI B;  5FWB A;  3EFO B;  2C06 A;  5FRO A;  2YUN A;  4BUG A;  4M75 C;  2LQ8 A;  2RQV A;  2LNH B;  1U1S A;  1ZQ1 A;  1VQM T;  1WHG A;  2LDM A;  4M7D C;  1H92 A;  3RBB B;  2WSC E;  1HD3 A;  3P8B B;  1D1A A;  1X69 A;  1KQS P;  2AZV A;  1C6V X;  4PJO E;  2EWN A;  2LC4 A;  4M75 G;  3CC2 T;  1NE8 A;  4GLM A;  1KQ1 A;  3JCM h;  1VQK T;  5DLO A;  3M59 A;  1QMC A;  2QK0 A;  2A08 A;  4M77 F;  1O75 A;  2ROL A;  4EMK C;  5GAM e;  1MMA A;  3M58 A;  1YI2 Q;  2XID A;  5IXB A;  3PNW C;  1IXD A;  4JZ3 A;  5CR2 A;  1W70 A;  2MWP A;  3JB9 D;  1NBE B;  2EPD A;  1KK7 A;  2A28 A;  2E3I A;  2QTX A;  4MDW A;  2DJQ A;  2LCS A;  1UEB A;  3O5Z A;  2L8D A;  3P8H A;  4CC7 A;  2DD4 A;  2QYZ A;  3A1P A;  4NS5 A;  4CC2 A;  2BKD N;  5KCH A;  3OYI A;  4ZN3 A;  4Z02 A;  1PRL C;  1UB4 A;  2GQV A;  2HBW A;  4WCI A;  1K8A U;  1FWZ A;  2XHC A;  4BDY A;  1QQJ A;  1YJ9 A;  1YCY A;  4M7A F;  2DO3 A;  4KUI A;  1OPK A;  3M55 A;  4PKC C;  4M77 C;  3ME9 A;  3CCU Q;  1Q7Y R;  3OYH A;  2HMA A;  3OYY A;  4DOV A;  2EQM A;  1VQ7 T;  1I81 A;  3OS2 A;  3CCV A;  1R8O B;  3CCM Q;  1WHJ A;  4M78 F;  2V8J A;  3G4S Q;  1XTD A;  4KGX B;  1VQ5 T;  2NUT A;  3VYG A;  3G71 Q;  5CKH A;  2EYX A;  3MJX A;  2QDL A;  1EX4 A;  4UC4 A;  2CKK A;  3UAT A;  3BE3 A;  3BY7 A;  2JTF A;  3OYL A;  3NTH A;  4JRI A;  2QA4 T;  4VUB A;  2CS7 A;  2EIF A;  2NUT B;  1SPK A;  3QZ9 B;  4M7D F;  1OQK A;  1ABQ A;  2JTE A;  2PU9 B;  3CPW A;  2DFU A;  2ZZD A;  1RAG B;  1BI3 A;  2DYI A;  2ZPE B;  5IT9 E;  3PVL A;  1I5O B;  4M7A D;  3MKD A;  1Z9Z A;  2GTO A;  3FLG A;  4PJO F;  1S72 Q;  4EPC A;  1FXX A;  1UGR B;  4M7D D;  3SWN A;  3FC3 A;  2BUD A;  4M7A G;  2XI9 A;  1QCO A;  4J5Y A;  5CQY A;  3CC2 Q;  4IIO A;  4QT7 A;  3EAE A;  1NJI R;  5I21 A;  4XTZ A;  2JVV A;  3VS1 A;  1HK9 A;  1R0C B;  4C0F A;  1BBZ A;  4QVZ A;  1RI9 A;  2E5K A;  3OW2 S;  4HXJ A;  3V7S A;  4BI4 A;  4C0D B;  2ZPG B;  1VQM A;  2EYY A;  4FU6 A;  1NJI U;  2LCL A;  2RI3 A;  3ZBD A;  5IHN A;  1KC8 C;  2FO0 A; 
#chains in the Genus database with same CATH homology
 2QAZ A;  1ZSZ A;  1OX9 A;  2NYS A;  1ZSZ B;  1TWB A;  1OX8 A;  1OU8 A;  1YFN A;  1OUL A;  1ZSZ C;  2QAS A;  1OU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...