1ZSZA

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
molecule keywords Stringent starvation protein B homolog
molecule tags De novo protein
source organism Haemophilus influenzae
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszA00
1OX8A 1OU8A 2QAZA 2QASA 1OULA 1ZSZC 1TWBA 1ZSZB 1ZSZA 1OX9A 1OU9A 1YFNA 2NYSA
chains in the Genus database with same CATH superfamily
3JCMP 4MDXA 4V2SA 3MPUB 4A53A 2KMTA 4M78C 4KGXB 1G3YA 1CSKA 4M78G 4ORZA 2K5IA 2JS0A 5GAN3 2QA4Q 1OEBA 2AHJB 1AWWA 1WDXA 1NPRA 5LJ5h 2KE9A 2DM1A 2JMCA 4NOYA 4EPCA 1JB0E 2DXBA 1KD1R 1SPKA 3P8BB 2RK1A 1NJIC 5FW9A 1YBYA 4CC3A 3CCEQ 4F7UG 1U1SA 2RI5A 3OYAA 4PJLA 4BB7A 4A54A 2RJFA 5FLXE 1BI0A 2D9TA 1ZUUA 2LP5A 2E41A 5EG2A 5CKBA 3M56A 2IG0A 3FLGA 3BDUA 3L2ZA 2EFIA 2LJ1A 3L2UA 1IXDA 1WJRA 3HRTA 2KI7A 2KEAA 1Q7YR 4FYYB 2CSIA 2DPPB 1OULA 1WI7A 1VQ6T 1YI2Q 2XG8D 1S72Q 5D6YA 4OB0B 1D09B 1AWOA 2YXYA 5DM7R 3L2QA 2LJ3A 4JRIA 3H9NA 5LL6S 1NLOC 1WQ7A 3R6OA 2C0OA 5J39A 4FT2A 3OYFA 1WZOA 2COWA 3I56Q 1IGQA 3OY9A 2LCCA 2LC4A 2EQIA 2XK0A 3CCQT 4LE9A 4IKFA 3MP8A 2LQNA 5EC7A 5LJ5f 2YLBA 3CC2Q 3L1AA 1ZA2B 1IGUA 3UDCA 2LZ6B 3OS1A 2L89A 1UGVA 4C92C 2ROTA 2E6NA 4C92G 3CMAT 2V1QA 3BY7A 3V8KA 1MNDA 2JVVA 3A1PA 2OTLA 1UGRB 4Z02A 3A8OB 2NLUA 4LN2A 2DBKA 2EPDA 5CR2A 1WHJA 2F2VA 1WXUA 4PFOA 3CCMA 1N8RR 1KG1A 5L8RE 2KVQG 5GANj 4BDZA 5AT1B 1VYTA 3BFMA 2MWOA 2NUZA 3M59A 3DLMA 5KH6A 1VQMA 1YWOA 2H3EB 2EKHA 3HRSA 4JUVA 3SD4A 2SEMA 4MDWA 1YJWQ 2CKKA 1HXDA 2XMFA 4IUPA 4ELZC 2EQKA 1ZSZB 5IH2A 5A0LA 1JBMA 1NYFA 2JXBA 2EYWA 4J7IA 4O5VA 1K73R 1R77A 2V8KA 2O9SA 4M77C 3CC7A 4M77G 4FSSA 3M54A 4KGZB 4OGEA 1ABOA 3CCJT 4XTYA 1KIKA 5LJ5g 4PJOD 3ME9A 4RMOA 3RMQA 5C0MA 2I2LA 2A28A 2K2VA 3DLLA 4WTOB 4ZGJB 3GNGA 2RHUA 3SHWA 4ZN1A 4J6WA 1B34A 2K5FA 1YI2A 3OQ5A 4F7UA 1M2OA 2QDYB 4OB3B 3CPWP 1JRIA 2H8HA 1YJNT 1I5LA 1GFDA 1UECA 1C0MA 1VQLQ 5FU6B 2KT1A 5C6SA 4PJJA 2GBQA 2O01E 4KBMB 3O8VA 2O4XB 1M1FA 1G3TA 4D8KA 1OV3A 5FU7C 3OYCA 1KQ1A 2AZSA 2DYBA 1B7TA 3QHSA 1UTIA 3HHTB 4C5IA 3M0SA 1AT1B 3VKIA 4BACA 3E2UA 4KUDK 4PK4A 2XHCA 2CP5A 2CUBA 4JLIA 3J80E 2LX7A 1X27A 3NTKA 2BE9B 5GAOm 1IZ6A 3CD6T 2J7IA 2XDPA 1WHKA 1PD0A 1YIJT 2E70A 5I2SA 2NUPB 1U8RA 1M1KC 4IUTA 4ATOA 3G6EA 2DILA 5GAOq 1BKBA 1S1NA 4LNPA 5KCOA 4J9GA 1KHIA 2DRMA 4Z8AA 3CCLQ 1MV0B 2LT4A 1EIFA 2C0TA 2DXUA 4PL6A 1WXTA 1UHFA 1W6XA 1T3SA 2KQWA 3A8LB 2M0OA 3M4GA 4DEYA 3EG0A 1D1BA 4XAXB 2FPDA 2DO3A 4C5EA 4E7IA 1K4US 3JB9F 1UDLA 4C92A 3IQLA 2AKKA 2OJ2A 3VS6A 3OYHA 4F16A 3PVLA 3EHRA 1GFCA 2DTOA 5CIUA 1U1TA 5GMKm 2D0NA 4BI8B 1I5OB 2B8AA 1D1AA 4C8QF 4PJNA 3J81E 3J7AF 1UGSB 3LWIA 3O5ZA 3V8JA 1Q86C 2CP2A 4M7DE 1VQKQ 1QWFA 1QVFP 3H6ZA 5KE2A 1WNLA 1M1KU 4EMHA 3OSSC 4F14A 3JB9J 2A37A 1M3BA 2QYZA 2JTEA 1MV3A 1Y96A 3CPWA 1QVFS 1D3BB 3MP1A 2HCKA 1KSWA 2K2MA 2JM9A 3OS5A 2DEUA 1TS9A 1VQ5T 3KXTA 3BW1A 3SWNC 1QP2A 5CQXA 2K79A 4OMOA 3EAEA 1VQ9T 4PJOF 3EGXA 1KC8C 3G71A 4GBQA 1P92A 4M77A 5CVIA 3E9FA 4VUBA 1BIBA 3I35A 2ZPHB 2LX9A 1YITA 2AKLA 4OMPA 2F69A 4L59A 1MHNA 5IXFA 3OYBA 2Y90A 5FRMA 1Y0MA 1W70A 5KYWB 1Q86U 2Y4XA 2HKQB 1NEGA 4JJBA 4N4IA 2PVOB 2MWPA 4M78D 4XTWA 3CCET 2ZPFB 2PUKB 2HAXA 3CCVQ 5KYYA 2F2WA 1H92A 1XNIA 3L42A 3HRUA 3FJ5A 3GIBA 4JZ3A 1C6VX 3CC4A 2ZCFB 1YHQT 5IXBA 2OI3A 4RG8A 1UE9A 5D7UA 4AG1C 3A8HB 2FL7A 2VWFA 4A4GA 3LYIA 4PJOG 4F04B 5KYXB 4R55A 2KNBB 1JEGA 2DMOA 2RPNA 5GAMf 2CP7A 1KC8U 1MMDA 4MZPA 3JCMc 2QEXT 2EGEA 4A4HA 2ROLA 3OSVA 2DZCA 4JRPA 1T3LA 2QQAA 5HCKA 4ANJA 3H0IA 2PUOB 2EQUA 4XU2A 2EYYA 1D1CA 5LJ5j 1K76A 1QKXA 1JJ2S 1GRIA 2QGGA 4OMMA 4FYVB 1VQOT 3SEMA 4LDVA 3JCMf 1OQKA 3OYMA 2RJEA 1G5VA 2AT1B 1M90C 4QVDA 5DLQE 4EMKB 5LJ3f 1WXBA 1ZA1B 1OPLA 2HQEA 3QYHB 1G2BA 5IHNA 1VQ6A 2YRVA 1NPPA 1V29B 4WCIA 1JQQA 1K1ZA 1WHMA 1U5SA 4J9CA 2X3WD 3NFCA 2VYTA 3EGDB 3EFOB 3PFSA 1WIEA 5GAN4 3CCUT 2LVMA 1X69A 2OTJT 4C92D 4AMCA 1ZBXA 3NHNA 4RCBA 4YTLA 3QUIA 2DXCA 3G7ZA 2MPXC 2XDDA 4QKUA 4RTVA 4IUUA 5CO7A 3WVDB 1QLYA 3PE0A 3MEWA 4OMNA 2GF7A 2EYXA 1Q82R 1VQ8T 3MHXA 3P8HA 3OW2P 3X20B 3CCQA 4UC4A 4N4GA 3H0HA 3A8GB 4EDUA 1M90U 2X9HA 3CMAA 1IREB 4DA4A 3SWNA 3META 1R0BG 4J83A 2J6FA 4CC2A 4J7FA 2FVUA 3M57A 3JCMJ 1M8MA 2RJCA 3LLRA 2J6OA 2MK5A 5D6WA 2YRDA 1LPLA 4GLKA 2ECZA 5A0DA 4FCYA 4RUGA 3X28B 3X26B 5KCHA 4M78F 3CXCP 4ZNXA 2BZYA 4QVCA 5GAN8 3G4ST 1QWEA 1PWTA 3OYYA 1KJWA 1QMCA 1PC0A 1PSEA 1O75A 4JZ4A 4ZN3A 2L3QA 2XKOC 5GMKe 2HSPA 3MEAA 1VQNT 3MJXA 3UT1A 2OTLQ 1RI0A 2EGAA 4CI0C 2ZPBB 4HXJA 5IHKA 3UA7A 1V76A 2BZ8A 2K6DA 2DBMA 5GAMe 1NBEB 1RLQC 1TUCA 3CCMQ 4PJOA 2YUPA 4KT0E 2JJ9A 2I0NA 3C12A 3CCJA 1ZSZC 3OBYA 1QW1A 4FW1A 2COYA 3OS2A 4AFUC 4LXCA 2F2XA 4RTUA 2HQHA 4M7DB 2DERA 1VQ4T 1VQMQ 1G3WA 4HCBA 3JCMe 1NE8A 1ZSGA 1QVGA 3HP9A 3DKMA 1YJNA 2YSQA 2F1LA 2CS7A 3GBQA 3I55Q 5LJ3e 2VKNA 2EBPA 4QQ6A 1M1KR 3OW2A 3RKXA 4D8DA 1W1FA 4PFZA 3M0RA 4Z89A 5GAMd 1SHFA 3QZ5B 3M0UA 1DJ7B 2P4RA 2KT8A 2IVWA 1KHCA 3CC7Q 2QK0A 4JDSA 3REAB 3C94A 1ZUYA 2HEQA 1UB4A 5FU6C 2JTFA 1AHJB 4E7LA 1XTDA 4C92F 5GAN6 1U3OA 3CMET 1AZEA 1EX4A 5AYFA 3OB9A 4RTZA 3CD6A 1M30A 3OYNA 3JCMd 3TCJA 3RUXA 5M9OA 2VUBA 2QAZA 2DL5A 3QBYA 3OBWA 1OX9A 4PFPA 1H641 3CXCA 5LJ3d 3M9QA 4M75E 1WHGA 5HKCA 3CCST 2VGNA 2RA2A 1Q86R 3RERA 2V26A 3HKSA 3OYLA 4LUEA 2EJFA 1NJIU 3QJ6A 2HKNA 2KDSA 1NLPC 3QJYA 2X35A 4WF2A 2E64A 2PU9B 2RQWA 1VQPT 3EG1A 2O9VA 2EVRA 2KY9A 3CCRT 3P8DA 4J5YA 3PNWC 2ABLA 5DLOA 2AIRB 3HFNA 2B86A 4PKCC 4F17A 1MUZA 3VS1A 4HVUA 2DJZA 3G6EQ 2RQUA 2QXFA 4DBHA 3TU4K 2QQRA 4M77F 1KC8R 1SKUB 1RAFB 7AT1B 2ENMA 1RAIB 1BK2A 2O31A 2L0AA 2RM4A 3ZFJA 1LVKA 4FYWB 1QCOA 4RTXA 4TVRA 3VJPA 2QQBA 3I9QA 2KRSA 3CCVT 1VQ5A 3MEVA 1CKBA 4Y92A 4C0ZA 4KH0B 4HVVA 2R5AA 3JV3A 1M2VB 3I55A 4AG2C 5GAN7 2LCSA 3VU3C 3RBBB 4O6JA 2DAQA 2EWNA 1J3TA 2P0KA 4LDXA 2DE0X 1PHTA 3CBMA 1ZSZA 1M5Q1 4M78A 1VUBA 2QI2A 2NUTB 5ECAA 3GNFB 1WHHA 5KYUB 4DBFA 2E10A 4X9CA 4L5GA 2DL4A 1HYOA 2H3JA 3L2VA 5LJ3j 1T0JA 3RNJA 1TOVA 3FDRA 1RAEB 5GAOr 1K8AC 3INZA 1D0ZA 2HZYA 4OF1A 4FM4B 1X01A 2A3LA 4QQGA 1BU1A 4AFZC 2JMAA 4II1A 3F70A 5GAOl 3G71Q 3FEOA 1FWZA 1OPKA 1M90R 1YITQ 3U23A 2W10A 3CPWS 3UATA 4MZTA 4GY5A 2E12A 3FIFA 2PQWA 1MGQA 3M0TA 2QEXA 2O4XA 4IUVA 4NL3A 1E7OA 3OYDA 3WVEB 1H3HA 3FB9A 1WPYA 3CEYA 3LX7A 2DZ9A 4PNOA 3GF5A 2XD0A 2R58A 3X25B 4C8QE 2FRYA 4RTYA 3QWXX 5J3BA 1GCQC 1OZ2A 3CC4Q 1VQ7T 2RHZA 4DOVA 5GMKl 2XI9A 1K8AU 2NUPA 4JJDA 3CBOA 2CH4A 1PKTA 3NMZC 3D7SB 1KD1C 2VVKA 5D6XA 2FZCB 2HNIA 3M4YA 2XU8A 4M7AE 4XTUA 2MAMA 2LJ0A 3E1SA 1O9SA 3CCUA 3V8LA 2K7AA 1PNJA 4EMKC 4X34A 1JO8A 3I5RA 1GL5A 3TSWA 2M0YA 1NYGA 2J05A 1TWBA 4DQ2A 1TXQA 1YP5A 4JLGA 1VQ8A 2JZ2A 1BBZA 4BUGA 3OYKA 1AZGB 1D0XA 3ER0A 4R56A 5GMKh 2CUDA 2ZPEB 1AWXA 2E6ZA 3VUZA 1UJYA 4NS5A 3BDLA 1BYMA 1YJ9T 3MO8A 1QVPA 4C0DB 1ABQA 1VQ6Q 4DEXA 4N0AC 2DA9A 5GAMh 2HL5C 3A5ZB 3T9NA 4LDUA 4JJCA 4BDYA 2K9GA 2KR3A 4JS4A 2QGFB 1KD1U 1Y96B 2A36A 2L8DA 2WSFE 4BE1A 2YUOA 1UGQB 4OMLA 2YT6A 1D3BA 2PNIA 3LWHA 3VS5A 3HL8A 1YCSB 2GFAA 1YCYA 2E5QA 3QDFA 2KAFA 2K3XA 3JCMh 3VS4A 1WQWA 3CCQQ 3G4SA 3JSCA 3HFOA 2QA4T 2YLCA 3JB9H 9ATCB 4FL6A 5GAN5 2DRKA 3EG9B 4M75B 2CZ0B 5LJ3h 2SRCA 4J6YA 4Z88A 2XDBA 2EKOA 3VRZA 3CMAQ 1VQNA 2DL3A 2K3YA 4J9DA 1OU8A 2LTOA 2DIGA 5DY9A 4OB2B 4X9DA 3VRYA 5KYWA 4XTZA 1F1BB 2ESWA 2R5MA 2MI6A 1Q81C 1NJIR 2QQ9A 3RESA 3CBPA 2F5TX 2VXFA 4XU0A 2FHDA 2RHYA 1SSHA 4BE2A 4LDWA 2DETA 1RL2A 1I0CA 2XICA 1AEYA 3LGLA 3OS0A 8ATCB 2HL3A 2HBPA 5HK3A 1YI2T 1VQ4A 3V7SA 1S72T 2PVDB 2QTXA 5GANf 5IT9E 3SDZA 1SRLA 4NL2A 4OMFB 2WACA 1K73C 4JRQA 1M3AA 3JCMb 4OB1B 2FG0A 3QWYA 1FMWA 4M7DC 1TG0A 4M7DG 2GQVA 1VOMA 3I56T 2K5LA 2V8IA 1K9MC 1PCXA 3CCJQ 1Q81U 3VS3A 2C0IA 3CC2T 4MZMA 1SEMA 1SRMA 3CMEA 1X2QA 1K9AA 2EYQA 4HVWA 4QVZA 3HPWA 4LD6A 5CAIA 3S3MA 4BI4A 1FXXA 3CQTA 2FZKB 3NTHA 2FZGB 4IIOA 4AT1B 1YJNQ 2OX7A 2DVEA 3HTRA 4BE0A 4EMGA 4J9HA 1RAAB 2RH2A 2HBWA 2D6FA 2LDMA 2RK2A 3EGDA 3H41A 3CCSA 3EFOA 2E5KA 1QVGP 3JRZA 4MMKA 5CKEA 4A4FA 5CKHA 3TSZA 4M78E 1FYNA 1E6GA 3BE3A 5I21A 1AVZC 2DLPA 2DL7A 5GAMg 4N0AA 1VQPA 4JRKA 3OYEA 1QVGS 2RQTA 3CCRA 4A63B 1YJWT 1UUEA 1K9MU 3CD6Q 1RUWA 2VC8A 1WGSA 2EIFA 4XTXA 4E6RA 3ASKA 1YIJQ 3OW2S 2DVJA 4XTVA 4F7UE 2QDLA 1QCNA 1Z9QA 2E4HA 3ZEHA 2M16A 2D8JA 4J9BA 3L2WA 1PM3A 2RHXA 4CC4B 1U06A 3LGFA 4LDYA 3JCMg 1XJWB 2X51A 4E47A 2GTJA 2ZZDA 4RCCA 4B9XA 3PMIA 3KUFA 2OAWA 1UGPB 1NG2A 1YN8A 2VASA 4C8QB 2LNHB 4IURA 5LJ3g 2ZGWA 2RI3A 3KFVA 4HKEA 4L6V5 1IB8A 5CQYA 3ZBDA 4LD9K 2EQMA 1WJQA 3L2RA 2RHIA 1RABB 3TREA 3MEUA 1WHLA 2HSEB 3CXCS 1OYXA 2JM8A 1VQLT 2HQXA 1WA7A 2DL8A 1MMNA 1NEBA 4M7AB 4FIBA 1BCOA 2JS2A 4P5NA 3GP8A 1TH7A 1RAGB 4M75D 5GANe 4N4HA 5HK0A 2LRQA 2FPFA 1ARKA 2MOXA 2D1XA 2M1HA 2BKDN 1XQHA 5KYNA 2JNGA 2ZPGB 4PJOB 2V8JA 1R8OB 2VV5A 4C92E 4BY6B 2X3XD 4ZGDB 5KE3A 1VQ5Q 1KK7A 4Y28E 1H8KA 2CZ1B 2C06A 3CC4T 4Q5WA 4M7DA 3KBGA 4ESRA 4E7JA 3CCLT 1MMGA 3QSUA 2P4TA 2DXTA 1WX6A 2FB7A 3NTIA 1V1CA 3OMCA 5I22A 1VYUA 3SB2A 2RQVA 5GANd 2KK4A 3QDRB 2CZ6B 4FYXB 2CH4W 2NWMA 2BE7D 1ZX6A 4EIKA 1W2BA 4OP0A 1QKWA 1YIJA 4R0KA 3TVTA 2LQWA 1M3CA 1KFZA 2W0ZA 2ZPIB 3OYGA 1YHQQ 1VQ7A 1VQKT 2G3RA 1N9SA 5L23A 2GFUA 1PKSA 1RI9A 1FX7A 1UJ0A 4M77E 1I07A 4BI3A 1Y07A 2IIMA 2G6FX 3LH5A 4FSXA 3OMGA 2QG9B 3FJPA 3UPUA 3QZ9B 3Q1JA 2EAYA 2JW4A 1X6BA 1KQ2A 2JN0A 3PVQA 2QEXQ 2E1HA 3WXMB 2EJGA 4E7KA 3H0FA 4ZGEB 3RMSA 3S3OA 1Z9ZA 1G83A 1VQOQ 3E19A 1I1JA 2COZA 1I4K1 3V7CA 1Y7XA 3R6NA 1FMKA 4Y91A 3X24B 3EHQA 4A4EA 4BD3A 2J6KA 1YJ9A 1WYXA 2GQIA 3URGA 1OX8A 2JOYA 5GMKj 1B07A 2DNUA 2J06A 3JB9D 2M51A 3G1JA 8AT1B 2DEQA 3NPFA 1M27C 4M75F 4J6XA 3CCUQ 2NYSA 4JS5A 3GPLA 1BI3A 2OTJQ 4DBRA 2JT4A 4RTWA 2KRNA 2YUQA 4PLIA 1Q82C 1JXMA 1UEBA 1IHVA 1N27A 5GAMj 3H8ZA 2DTIA 4C0DC 1EFNA 1VQ9A 1Q81R 4QT7A 4C8QD 3CPFA 2FO0A 2D8HA 5CKFA 3THKA 2K4YA 1VQ8Q 4JJNK 1ZBJA 1Q95G 2IPOB 2EGCA 3UF4A 2QA4A 2X4WA 1M2VA 5GMKi 1I8FA 1SHGA 5J26A 3PTAA 4ELYC 2M9UA 3OYJA 4KUIA 3JCMV 2O88A 4M7AD 3QKJA 2KYBA 3CCEA 4M78B 1NM7A 2AK5A 4MMLA 2DD4A 5HY6A 2L3SA 1LJOA 2NUTA 2PZ1A 4B6MA 1N9RA 5KYUA 2CYZB 4M75C 2RI2A 4AFSC 2VB6A 4M75G 2DTHA 4B9WA 1B34B 5GAOn 2YWWA 1YHQA 1TUDA 2P0PA 1X43A 3REBB 1HJDA 2E3IA 4F7UB 1JXOA 1B3QA 3EGUA 3MKDA 1Q82U 3RR6A 1K9MR 4M7DD 3G4SQ 2VGMA 3TQ7P 1GBQA 1S72A 2KYMA 2DKGA 1ACMB 3FRNA 1SSFA 3JCMX 5IHIA 3M58A 3UWNA 5FRNA 1BB9A 2L2PA 2YRCA 1VQNQ 4XU3A 4QQDA 2EQJA 1ZHIA 3C0CA 2RQRA 2DJQA 5CCAA 1M9SA 4OVAA 2X4XA 3VS7A 2E65A 1VA7A 5FWBA 1G3SA 4J9EA 2R57A 1VQOA 4QW2A 1OU9A 3VS2A 3I56A 3PMTA 5GAOp 3DB3A 3CC2A 6AT1B 2BIVA 4PJMA 3UA6A 1A0NB 2ATCB 3EFRA 1JU5C 1VQ4Q 5IN1A 1PD1A 2RJDA 2MCNA 3EFSA 2GTOA 4E7HA 4RTTA 5LJ5e 1UFFA 1BCMA 1ZLMA 4XQ3A 2QQSA 2DFUA 2OTJA 2A0FB 3HSBA 4C92B 4ZTFA 1YNZA 2YUNA 3PT9A 2FYKA 4HT9A 4K11A 2DK3A 1PRLC 2HMAA 1EZZB 2K57A 4PJOE 3VUBA 3DB4A 2ED0A 3EG2A 5I2MA 2BUDA 1Q7YC 3EH2A 3C95A 3MCAB 2A7YA 2X4YA 3AHUA 3SFMA 1UHCA 2P84A 3CMEQ 2CGHA 1YFNA 5A0GA 1YJWA 3LW5E 1T0HA 1NZ9A 4J9FA 4C5HA 3ZL7C 4OMQA 2OTLT 1BI2A 1IRXA 5GANh 1MNEA 3AT1B 2CP0A 3S6WA 5LJ5d 1TSFA 4E7ZA 3LH0A 2WSCE 4E7SA 1D0YA 2CP6A 2CREA 4FW2A 1ZQ1A 1PSFA 3CCMT 1VIEA 1TUGB 2CSQA 2RN8A 2KBTA 3CCSQ 2ED1A 4RKUE 4HCZA 2WSEE 4XU1A 4M7AF 2V1RA 5CK9A 3A8MB 1MMAA 2BTTA 1RLPC 3EG3A 2KSSA 2CZ7B 4J9IA 2DIQA 2DYIA 2OAUA 3EGXB 2RF0A 3M0QA 2A08A 1VQMT 2O2OA 3JB9G 1VQPQ 5FWCA 3CCRQ 2DD5A 4M77B 1Q7YU 2LQ8A 2PTKA 1X75C 1VQLA 1X6OA 1UG1A 3I55T 4A4KA 1KQSP 4C8QC 3EG9A 4C5GA 2D0QB 4M75A 3QPHA 4C8QG 2JUFA 1N8RC 1I81A 2GGRA 4M7DF 1AD5A 3VV0A 1X2KA 2BZXA 2LT1A 1WJSA 4E2FB 2KXDA 2KXCA 2L3RA 3CC7T 2LMJA 1KQSS 2X4JA 5KYYB 3OA6A 3JAME 5GJVB 1XOVA 1VIFA 3MP6A 1GBRA 3QG1A 1K0SA 1WLPB 3PIOA 1GCPA 2PVGB 4M7AC 3FC3A 2RD1A 3V7RA 4M7AG 2VXEA 5FU7B 3VYHB 5KYXA 2LNVA 4CRIA 2E3HA 1QQJA 2XIDA 3CCLA 1R0CB 3M5AA 4PJOC 3C4SA 1M8VA 1TU0B 1GCQA 3M0PA 4PLLA 4BY6C 3TEEA 2Y4YA 2M02A 3ULRB 1JJ2P 3I5SA 1N8RU 3S3NA 2LCLA 1QCFA 2MIOA 2RNAA 1OOTA 2YHTA 2FPEA 1FMVA 1M4ZA 1QVFA 5A2QE 2AZVA 1H3ZA 3GOXA 1HSQA 1AOJA 5IAYA 4EMKA 2L3PA 3G6ET 4CC7A 2CDTA 3VYGA 1SG5A 4HT8A 1LCKA 1VQKA 2MYSA 4ME7A 4KGVB 1LOJA 2EJ9A 1AWJA 4DBQA 3M53A 3A98A 5FROA 4KULA 1K73U 3N5BB 4X1VA 3RKWA 1M1GA 1W4SA 2KRMA 4C0GA 2QASA 2YDLA 3QYGB 1Y71A 2EW3A 1KQSA 1N6AA 3PIPA 4IIMA 1IO6A 5GANg 5I11A 3E9GA 2ZAEA 3M55A 2CP3A 2L5QA 2DF6A 3JCMW 1X6GA 2GNCA 4XK8E 3QXEB 2QTVA 1IHWA 1OZ3A 1HD3A 4DOWA 5GAN2 1VQ7Q 5GJWB 1W2BP 1RACB 1WFWA 4AFQC 1QP3A 3SWNB 4HCKA 3RDVA 1BI1A 4RG2A 2KGTA 2RB6A 2MF2A 4ZTJA 1ZUKA 2JTMA 2KROA 3GLXA 3QIIA 2RO0A 2CT4A 1W2BS 2F5KA 3RIRA 4JPBW 3CCVA 4FU6A 1OI1A 1Y57A 4M4ZA 3EH1A 4LUDA 4C0FA 2LQKA 3NGPA 4C8QA 1N5ZA 1HK9A 3VS0A 4IUQA 1JJ2A 1YWPA 4D6WA 1K8AR 3G71T 2EYZA 2CT3A 1VYVA 3OYIA 3JB9I 2GCXA 2HD0A 1YITT 2DX1A 1CKAA 1K0XA 2HDAA 2FEIA 4M77D 4OGCA 1RAHB 1SF9A 5CKDA 3PGGA 4M7AA 1PRMC 4KH1B 1YJ9Q 1G8XA 1C1AA 4F7UF 4KRTA 1PG5B 2RMOA 1E6HA 2K3BA 4HA8A 4J8OA 3QO3A 3JCMQ 1TTHB 4HCCA 1GXIE 2Z0WA 4FT4A 1BIAA 2P0QA 1RADB 2MMPA 1LNXA 3RKYA 4GLMA 1VQ9Q 2FRWA
chains in the Genus database with same CATH topology
1OX8A 1OU8A 2QAZA 2QASA 1OULA 1ZSZC 1TWBA 1ZSZB 1ZSZA 1OX9A 1OU9A 1YFNA 2NYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX8 A;  1OU8 A;  2QAZ A;  2QAS A;  1OUL A;  1ZSZ C;  1TWB A;  1ZSZ B;  1ZSZ A;  1OX9 A;  1OU9 A;  1YFN A;  2NYS A; 
#chains in the Genus database with same CATH topology
 3JCM P;  4MDX A;  4V2S A;  3MPU B;  4A53 A;  2KMT A;  4M78 C;  4KGX B;  1G3Y A;  1CSK A;  4M78 G;  4ORZ A;  2K5I A;  2JS0 A;  5GAN 3;  2QA4 Q;  1OEB A;  2AHJ B;  1AWW A;  1WDX A;  1NPR A;  5LJ5 h;  2KE9 A;  2DM1 A;  2JMC A;  4NOY A;  4EPC A;  1JB0 E;  2DXB A;  1KD1 R;  1SPK A;  3P8B B;  2RK1 A;  1NJI C;  5FW9 A;  1YBY A;  4CC3 A;  3CCE Q;  4F7U G;  1U1S A;  2RI5 A;  3OYA A;  4PJL A;  4BB7 A;  4A54 A;  2RJF A;  5FLX E;  1BI0 A;  2D9T A;  1ZUU A;  2LP5 A;  2E41 A;  5EG2 A;  5CKB A;  3M56 A;  2IG0 A;  3FLG A;  3BDU A;  3L2Z A;  2EFI A;  2LJ1 A;  3L2U A;  1IXD A;  1WJR A;  3HRT A;  2KI7 A;  2KEA A;  1Q7Y R;  4FYY B;  2CSI A;  2DPP B;  1OUL A;  1WI7 A;  1VQ6 T;  1YI2 Q;  2XG8 D;  1S72 Q;  5D6Y A;  4OB0 B;  1D09 B;  1AWO A;  2YXY A;  5DM7 R;  3L2Q A;  2LJ3 A;  4JRI A;  3H9N A;  5LL6 S;  1NLO C;  1WQ7 A;  3R6O A;  2C0O A;  5J39 A;  4FT2 A;  3OYF A;  1WZO A;  2COW A;  3I56 Q;  1IGQ A;  3OY9 A;  2LCC A;  2LC4 A;  2EQI A;  2XK0 A;  3CCQ T;  4LE9 A;  4IKF A;  3MP8 A;  2LQN A;  5EC7 A;  5LJ5 f;  2YLB A;  3CC2 Q;  3L1A A;  1ZA2 B;  1IGU A;  3UDC A;  2LZ6 B;  3OS1 A;  2L89 A;  1UGV A;  4C92 C;  2ROT A;  2E6N A;  4C92 G;  3CMA T;  2V1Q A;  3BY7 A;  3V8K A;  1MND A;  2JVV A;  3A1P A;  2OTL A;  1UGR B;  4Z02 A;  3A8O B;  2NLU A;  4LN2 A;  2DBK A;  2EPD A;  5CR2 A;  1WHJ A;  2F2V A;  1WXU A;  4PFO A;  3CCM A;  1N8R R;  1KG1 A;  5L8R E;  2KVQ G;  5GAN j;  4BDZ A;  5AT1 B;  1VYT A;  3BFM A;  2MWO A;  2NUZ A;  3M59 A;  3DLM A;  5KH6 A;  1VQM A;  1YWO A;  2H3E B;  2EKH A;  3HRS A;  4JUV A;  3SD4 A;  2SEM A;  4MDW A;  1YJW Q;  2CKK A;  1HXD A;  2XMF A;  4IUP A;  4ELZ C;  2EQK A;  1ZSZ B;  5IH2 A;  5A0L A;  1JBM A;  1NYF A;  2JXB A;  2EYW A;  4J7I A;  4O5V A;  1K73 R;  1R77 A;  2V8K A;  2O9S A;  4M77 C;  3CC7 A;  4M77 G;  4FSS A;  3M54 A;  4KGZ B;  4OGE A;  1ABO A;  3CCJ T;  4XTY A;  1KIK A;  5LJ5 g;  4PJO D;  3ME9 A;  4RMO A;  3RMQ A;  5C0M A;  2I2L A;  2A28 A;  2K2V A;  3DLL A;  4WTO B;  4ZGJ B;  3GNG A;  2RHU A;  3SHW A;  4ZN1 A;  4J6W A;  1B34 A;  2K5F A;  1YI2 A;  3OQ5 A;  4F7U A;  1M2O A;  2QDY B;  4OB3 B;  3CPW P;  1JRI A;  2H8H A;  1YJN T;  1I5L A;  1GFD A;  1UEC A;  1C0M A;  1VQL Q;  5FU6 B;  2KT1 A;  5C6S A;  4PJJ A;  2GBQ A;  2O01 E;  4KBM B;  3O8V A;  2O4X B;  1M1F A;  1G3T A;  4D8K A;  1OV3 A;  5FU7 C;  3OYC A;  1KQ1 A;  2AZS A;  2DYB A;  1B7T A;  3QHS A;  1UTI A;  3HHT B;  4C5I A;  3M0S A;  1AT1 B;  3VKI A;  4BAC A;  3E2U A;  4KUD K;  4PK4 A;  2XHC A;  2CP5 A;  2CUB A;  4JLI A;  3J80 E;  2LX7 A;  1X27 A;  3NTK A;  2BE9 B;  5GAO m;  1IZ6 A;  3CD6 T;  2J7I A;  2XDP A;  1WHK A;  1PD0 A;  1YIJ T;  2E70 A;  5I2S A;  2NUP B;  1U8R A;  1M1K C;  4IUT A;  4ATO A;  3G6E A;  2DIL A;  5GAO q;  1BKB A;  1S1N A;  4LNP A;  5KCO A;  4J9G A;  1KHI A;  2DRM A;  4Z8A A;  3CCL Q;  1MV0 B;  2LT4 A;  1EIF A;  2C0T A;  2DXU A;  4PL6 A;  1WXT A;  1UHF A;  1W6X A;  1T3S A;  2KQW A;  3A8L B;  2M0O A;  3M4G A;  4DEY A;  3EG0 A;  1D1B A;  4XAX B;  2FPD A;  2DO3 A;  4C5E A;  4E7I A;  1K4U S;  3JB9 F;  1UDL A;  4C92 A;  3IQL A;  2AKK A;  2OJ2 A;  3VS6 A;  3OYH A;  4F16 A;  3PVL A;  3EHR A;  1GFC A;  2DTO A;  5CIU A;  1U1T A;  5GMK m;  2D0N A;  4BI8 B;  1I5O B;  2B8A A;  1D1A A;  4C8Q F;  4PJN A;  3J81 E;  3J7A F;  1UGS B;  3LWI A;  3O5Z A;  3V8J A;  1Q86 C;  2CP2 A;  4M7D E;  1VQK Q;  1QWF A;  1QVF P;  3H6Z A;  5KE2 A;  1WNL A;  1M1K U;  4EMH A;  3OSS C;  4F14 A;  3JB9 J;  2A37 A;  1M3B A;  2QYZ A;  2JTE A;  1MV3 A;  1Y96 A;  3CPW A;  1QVF S;  1D3B B;  3MP1 A;  2HCK A;  1KSW A;  2K2M A;  2JM9 A;  3OS5 A;  2DEU A;  1TS9 A;  1VQ5 T;  3KXT A;  3BW1 A;  3SWN C;  1QP2 A;  5CQX A;  2K79 A;  4OMO A;  3EAE A;  1VQ9 T;  4PJO F;  3EGX A;  1KC8 C;  3G71 A;  4GBQ A;  1P92 A;  4M77 A;  5CVI A;  3E9F A;  4VUB A;  1BIB A;  3I35 A;  2ZPH B;  2LX9 A;  1YIT A;  2AKL A;  4OMP A;  2F69 A;  4L59 A;  1MHN A;  5IXF A;  3OYB A;  2Y90 A;  5FRM A;  1Y0M A;  1W70 A;  5KYW B;  1Q86 U;  2Y4X A;  2HKQ B;  1NEG A;  4JJB A;  4N4I A;  2PVO B;  2MWP A;  4M78 D;  4XTW A;  3CCE T;  2ZPF B;  2PUK B;  2HAX A;  3CCV Q;  5KYY A;  2F2W A;  1H92 A;  1XNI A;  3L42 A;  3HRU A;  3FJ5 A;  3GIB A;  4JZ3 A;  1C6V X;  3CC4 A;  2ZCF B;  1YHQ T;  5IXB A;  2OI3 A;  4RG8 A;  1UE9 A;  5D7U A;  4AG1 C;  3A8H B;  2FL7 A;  2VWF A;  4A4G A;  3LYI A;  4PJO G;  4F04 B;  5KYX B;  4R55 A;  2KNB B;  1JEG A;  2DMO A;  2RPN A;  5GAM f;  2CP7 A;  1KC8 U;  1MMD A;  4MZP A;  3JCM c;  2QEX T;  2EGE A;  4A4H A;  2ROL A;  3OSV A;  2DZC A;  4JRP A;  1T3L A;  2QQA A;  5HCK A;  4ANJ A;  3H0I A;  2PUO B;  2EQU A;  4XU2 A;  2EYY A;  1D1C A;  5LJ5 j;  1K76 A;  1QKX A;  1JJ2 S;  1GRI A;  2QGG A;  4OMM A;  4FYV B;  1VQO T;  3SEM A;  4LDV A;  3JCM f;  1OQK A;  3OYM A;  2RJE A;  1G5V A;  2AT1 B;  1M90 C;  4QVD A;  5DLQ E;  4EMK B;  5LJ3 f;  1WXB A;  1ZA1 B;  1OPL A;  2HQE A;  3QYH B;  1G2B A;  5IHN A;  1VQ6 A;  2YRV A;  1NPP A;  1V29 B;  4WCI A;  1JQQ A;  1K1Z A;  1WHM A;  1U5S A;  4J9C A;  2X3W D;  3NFC A;  2VYT A;  3EGD B;  3EFO B;  3PFS A;  1WIE A;  5GAN 4;  3CCU T;  2LVM A;  1X69 A;  2OTJ T;  4C92 D;  4AMC A;  1ZBX A;  3NHN A;  4RCB A;  4YTL A;  3QUI A;  2DXC A;  3G7Z A;  2MPX C;  2XDD A;  4QKU A;  4RTV A;  4IUU A;  5CO7 A;  3WVD B;  1QLY A;  3PE0 A;  3MEW A;  4OMN A;  2GF7 A;  2EYX A;  1Q82 R;  1VQ8 T;  3MHX A;  3P8H A;  3OW2 P;  3X20 B;  3CCQ A;  4UC4 A;  4N4G A;  3H0H A;  3A8G B;  4EDU A;  1M90 U;  2X9H A;  3CMA A;  1IRE B;  4DA4 A;  3SWN A;  3MET A;  1R0B G;  4J83 A;  2J6F A;  4CC2 A;  4J7F A;  2FVU A;  3M57 A;  3JCM J;  1M8M A;  2RJC A;  3LLR A;  2J6O A;  2MK5 A;  5D6W A;  2YRD A;  1LPL A;  4GLK A;  2ECZ A;  5A0D A;  4FCY A;  4RUG A;  3X28 B;  3X26 B;  5KCH A;  4M78 F;  3CXC P;  4ZNX A;  2BZY A;  4QVC A;  5GAN 8;  3G4S T;  1QWE A;  1PWT A;  3OYY A;  1KJW A;  1QMC A;  1PC0 A;  1PSE A;  1O75 A;  4JZ4 A;  4ZN3 A;  2L3Q A;  2XKO C;  5GMK e;  2HSP A;  3MEA A;  1VQN T;  3MJX A;  3UT1 A;  2OTL Q;  1RI0 A;  2EGA A;  4CI0 C;  2ZPB B;  4HXJ A;  5IHK A;  3UA7 A;  1V76 A;  2BZ8 A;  2K6D A;  2DBM A;  5GAM e;  1NBE B;  1RLQ C;  1TUC A;  3CCM Q;  4PJO A;  2YUP A;  4KT0 E;  2JJ9 A;  2I0N A;  3C12 A;  3CCJ A;  1ZSZ C;  3OBY A;  1QW1 A;  4FW1 A;  2COY A;  3OS2 A;  4AFU C;  4LXC A;  2F2X A;  4RTU A;  2HQH A;  4M7D B;  2DER A;  1VQ4 T;  1VQM Q;  1G3W A;  4HCB A;  3JCM e;  1NE8 A;  1ZSG A;  1QVG A;  3HP9 A;  3DKM A;  1YJN A;  2YSQ A;  2F1L A;  2CS7 A;  3GBQ A;  3I55 Q;  5LJ3 e;  2VKN A;  2EBP A;  4QQ6 A;  1M1K R;  3OW2 A;  3RKX A;  4D8D A;  1W1F A;  4PFZ A;  3M0R A;  4Z89 A;  5GAM d;  1SHF A;  3QZ5 B;  3M0U A;  1DJ7 B;  2P4R A;  2KT8 A;  2IVW A;  1KHC A;  3CC7 Q;  2QK0 A;  4JDS A;  3REA B;  3C94 A;  1ZUY A;  2HEQ A;  1UB4 A;  5FU6 C;  2JTF A;  1AHJ B;  4E7L A;  1XTD A;  4C92 F;  5GAN 6;  1U3O A;  3CME T;  1AZE A;  1EX4 A;  5AYF A;  3OB9 A;  4RTZ A;  3CD6 A;  1M30 A;  3OYN A;  3JCM d;  3TCJ A;  3RUX A;  5M9O A;  2VUB A;  2QAZ A;  2DL5 A;  3QBY A;  3OBW A;  1OX9 A;  4PFP A;  1H64 1;  3CXC A;  5LJ3 d;  3M9Q A;  4M75 E;  1WHG A;  5HKC A;  3CCS T;  2VGN A;  2RA2 A;  1Q86 R;  3RER A;  2V26 A;  3HKS A;  3OYL A;  4LUE A;  2EJF A;  1NJI U;  3QJ6 A;  2HKN A;  2KDS A;  1NLP C;  3QJY A;  2X35 A;  4WF2 A;  2E64 A;  2PU9 B;  2RQW A;  1VQP T;  3EG1 A;  2O9V A;  2EVR A;  2KY9 A;  3CCR T;  3P8D A;  4J5Y A;  3PNW C;  2ABL A;  5DLO A;  2AIR B;  3HFN A;  2B86 A;  4PKC C;  4F17 A;  1MUZ A;  3VS1 A;  4HVU A;  2DJZ A;  3G6E Q;  2RQU A;  2QXF A;  4DBH A;  3TU4 K;  2QQR A;  4M77 F;  1KC8 R;  1SKU B;  1RAF B;  7AT1 B;  2ENM A;  1RAI B;  1BK2 A;  2O31 A;  2L0A A;  2RM4 A;  3ZFJ A;  1LVK A;  4FYW B;  1QCO A;  4RTX A;  4TVR A;  3VJP A;  2QQB A;  3I9Q A;  2KRS A;  3CCV T;  1VQ5 A;  3MEV A;  1CKB A;  4Y92 A;  4C0Z A;  4KH0 B;  4HVV A;  2R5A A;  3JV3 A;  1M2V B;  3I55 A;  4AG2 C;  5GAN 7;  2LCS A;  3VU3 C;  3RBB B;  4O6J A;  2DAQ A;  2EWN A;  1J3T A;  2P0K A;  4LDX A;  2DE0 X;  1PHT A;  3CBM A;  1ZSZ A;  1M5Q 1;  4M78 A;  1VUB A;  2QI2 A;  2NUT B;  5ECA A;  3GNF B;  1WHH A;  5KYU B;  4DBF A;  2E10 A;  4X9C A;  4L5G A;  2DL4 A;  1HYO A;  2H3J A;  3L2V A;  5LJ3 j;  1T0J A;  3RNJ A;  1TOV A;  3FDR A;  1RAE B;  5GAO r;  1K8A C;  3INZ A;  1D0Z A;  2HZY A;  4OF1 A;  4FM4 B;  1X01 A;  2A3L A;  4QQG A;  1BU1 A;  4AFZ C;  2JMA A;  4II1 A;  3F70 A;  5GAO l;  3G71 Q;  3FEO A;  1FWZ A;  1OPK A;  1M90 R;  1YIT Q;  3U23 A;  2W10 A;  3CPW S;  3UAT A;  4MZT A;  4GY5 A;  2E12 A;  3FIF A;  2PQW A;  1MGQ A;  3M0T A;  2QEX A;  2O4X A;  4IUV A;  4NL3 A;  1E7O A;  3OYD A;  3WVE B;  1H3H A;  3FB9 A;  1WPY A;  3CEY A;  3LX7 A;  2DZ9 A;  4PNO A;  3GF5 A;  2XD0 A;  2R58 A;  3X25 B;  4C8Q E;  2FRY A;  4RTY A;  3QWX X;  5J3B A;  1GCQ C;  1OZ2 A;  3CC4 Q;  1VQ7 T;  2RHZ A;  4DOV A;  5GMK l;  2XI9 A;  1K8A U;  2NUP A;  4JJD A;  3CBO A;  2CH4 A;  1PKT A;  3NMZ C;  3D7S B;  1KD1 C;  2VVK A;  5D6X A;  2FZC B;  2HNI A;  3M4Y A;  2XU8 A;  4M7A E;  4XTU A;  2MAM A;  2LJ0 A;  3E1S A;  1O9S A;  3CCU A;  3V8L A;  2K7A A;  1PNJ A;  4EMK C;  4X34 A;  1JO8 A;  3I5R A;  1GL5 A;  3TSW A;  2M0Y A;  1NYG A;  2J05 A;  1TWB A;  4DQ2 A;  1TXQ A;  1YP5 A;  4JLG A;  1VQ8 A;  2JZ2 A;  1BBZ A;  4BUG A;  3OYK A;  1AZG B;  1D0X A;  3ER0 A;  4R56 A;  5GMK h;  2CUD A;  2ZPE B;  1AWX A;  2E6Z A;  3VUZ A;  1UJY A;  4NS5 A;  3BDL A;  1BYM A;  1YJ9 T;  3MO8 A;  1QVP A;  4C0D B;  1ABQ A;  1VQ6 Q;  4DEX A;  4N0A C;  2DA9 A;  5GAM h;  2HL5 C;  3A5Z B;  3T9N A;  4LDU A;  4JJC A;  4BDY A;  2K9G A;  2KR3 A;  4JS4 A;  2QGF B;  1KD1 U;  1Y96 B;  2A36 A;  2L8D A;  2WSF E;  4BE1 A;  2YUO A;  1UGQ B;  4OML A;  2YT6 A;  1D3B A;  2PNI A;  3LWH A;  3VS5 A;  3HL8 A;  1YCS B;  2GFA A;  1YCY A;  2E5Q A;  3QDF A;  2KAF A;  2K3X A;  3JCM h;  3VS4 A;  1WQW A;  3CCQ Q;  3G4S A;  3JSC A;  3HFO A;  2QA4 T;  2YLC A;  3JB9 H;  9ATC B;  4FL6 A;  5GAN 5;  2DRK A;  3EG9 B;  4M75 B;  2CZ0 B;  5LJ3 h;  2SRC A;  4J6Y A;  4Z88 A;  2XDB A;  2EKO A;  3VRZ A;  3CMA Q;  1VQN A;  2DL3 A;  2K3Y A;  4J9D A;  1OU8 A;  2LTO A;  2DIG A;  5DY9 A;  4OB2 B;  4X9D A;  3VRY A;  5KYW A;  4XTZ A;  1F1B B;  2ESW A;  2R5M A;  2MI6 A;  1Q81 C;  1NJI R;  2QQ9 A;  3RES A;  3CBP A;  2F5T X;  2VXF A;  4XU0 A;  2FHD A;  2RHY A;  1SSH A;  4BE2 A;  4LDW A;  2DET A;  1RL2 A;  1I0C A;  2XIC A;  1AEY A;  3LGL A;  3OS0 A;  8ATC B;  2HL3 A;  2HBP A;  5HK3 A;  1YI2 T;  1VQ4 A;  3V7S A;  1S72 T;  2PVD B;  2QTX A;  5GAN f;  5IT9 E;  3SDZ A;  1SRL A;  4NL2 A;  4OMF B;  2WAC A;  1K73 C;  4JRQ A;  1M3A A;  3JCM b;  4OB1 B;  2FG0 A;  3QWY A;  1FMW A;  4M7D C;  1TG0 A;  4M7D G;  2GQV A;  1VOM A;  3I56 T;  2K5L A;  2V8I A;  1K9M C;  1PCX A;  3CCJ Q;  1Q81 U;  3VS3 A;  2C0I A;  3CC2 T;  4MZM A;  1SEM A;  1SRM A;  3CME A;  1X2Q A;  1K9A A;  2EYQ A;  4HVW A;  4QVZ A;  3HPW A;  4LD6 A;  5CAI A;  3S3M A;  4BI4 A;  1FXX A;  3CQT A;  2FZK B;  3NTH A;  2FZG B;  4IIO A;  4AT1 B;  1YJN Q;  2OX7 A;  2DVE A;  3HTR A;  4BE0 A;  4EMG A;  4J9H A;  1RAA B;  2RH2 A;  2HBW A;  2D6F A;  2LDM A;  2RK2 A;  3EGD A;  3H41 A;  3CCS A;  3EFO A;  2E5K A;  1QVG P;  3JRZ A;  4MMK A;  5CKE A;  4A4F A;  5CKH A;  3TSZ A;  4M78 E;  1FYN A;  1E6G A;  3BE3 A;  5I21 A;  1AVZ C;  2DLP A;  2DL7 A;  5GAM g;  4N0A A;  1VQP A;  4JRK A;  3OYE A;  1QVG S;  2RQT A;  3CCR A;  4A63 B;  1YJW T;  1UUE A;  1K9M U;  3CD6 Q;  1RUW A;  2VC8 A;  1WGS A;  2EIF A;  4XTX A;  4E6R A;  3ASK A;  1YIJ Q;  3OW2 S;  2DVJ A;  4XTV A;  4F7U E;  2QDL A;  1QCN A;  1Z9Q A;  2E4H A;  3ZEH A;  2M16 A;  2D8J A;  4J9B A;  3L2W A;  1PM3 A;  2RHX A;  4CC4 B;  1U06 A;  3LGF A;  4LDY A;  3JCM g;  1XJW B;  2X51 A;  4E47 A;  2GTJ A;  2ZZD A;  4RCC A;  4B9X A;  3PMI A;  3KUF A;  2OAW A;  1UGP B;  1NG2 A;  1YN8 A;  2VAS A;  4C8Q B;  2LNH B;  4IUR A;  5LJ3 g;  2ZGW A;  2RI3 A;  3KFV A;  4HKE A;  4L6V 5;  1IB8 A;  5CQY A;  3ZBD A;  4LD9 K;  2EQM A;  1WJQ A;  3L2R A;  2RHI A;  1RAB B;  3TRE A;  3MEU A;  1WHL A;  2HSE B;  3CXC S;  1OYX A;  2JM8 A;  1VQL T;  2HQX A;  1WA7 A;  2DL8 A;  1MMN A;  1NEB A;  4M7A B;  4FIB A;  1BCO A;  2JS2 A;  4P5N A;  3GP8 A;  1TH7 A;  1RAG B;  4M75 D;  5GAN e;  4N4H A;  5HK0 A;  2LRQ A;  2FPF A;  1ARK A;  2MOX A;  2D1X A;  2M1H A;  2BKD N;  1XQH A;  5KYN A;  2JNG A;  2ZPG B;  4PJO B;  2V8J A;  1R8O B;  2VV5 A;  4C92 E;  4BY6 B;  2X3X D;  4ZGD B;  5KE3 A;  1VQ5 Q;  1KK7 A;  4Y28 E;  1H8K A;  2CZ1 B;  2C06 A;  3CC4 T;  4Q5W A;  4M7D A;  3KBG A;  4ESR A;  4E7J A;  3CCL T;  1MMG A;  3QSU A;  2P4T A;  2DXT A;  1WX6 A;  2FB7 A;  3NTI A;  1V1C A;  3OMC A;  5I22 A;  1VYU A;  3SB2 A;  2RQV A;  5GAN d;  2KK4 A;  3QDR B;  2CZ6 B;  4FYX B;  2CH4 W;  2NWM A;  2BE7 D;  1ZX6 A;  4EIK A;  1W2B A;  4OP0 A;  1QKW A;  1YIJ A;  4R0K A;  3TVT A;  2LQW A;  1M3C A;  1KFZ A;  2W0Z A;  2ZPI B;  3OYG A;  1YHQ Q;  1VQ7 A;  1VQK T;  2G3R A;  1N9S A;  5L23 A;  2GFU A;  1PKS A;  1RI9 A;  1FX7 A;  1UJ0 A;  4M77 E;  1I07 A;  4BI3 A;  1Y07 A;  2IIM A;  2G6F X;  3LH5 A;  4FSX A;  3OMG A;  2QG9 B;  3FJP A;  3UPU A;  3QZ9 B;  3Q1J A;  2EAY A;  2JW4 A;  1X6B A;  1KQ2 A;  2JN0 A;  3PVQ A;  2QEX Q;  2E1H A;  3WXM B;  2EJG A;  4E7K A;  3H0F A;  4ZGE B;  3RMS A;  3S3O A;  1Z9Z A;  1G83 A;  1VQO Q;  3E19 A;  1I1J A;  2COZ A;  1I4K 1;  3V7C A;  1Y7X A;  3R6N A;  1FMK A;  4Y91 A;  3X24 B;  3EHQ A;  4A4E A;  4BD3 A;  2J6K A;  1YJ9 A;  1WYX A;  2GQI A;  3URG A;  1OX8 A;  2JOY A;  5GMK j;  1B07 A;  2DNU A;  2J06 A;  3JB9 D;  2M51 A;  3G1J A;  8AT1 B;  2DEQ A;  3NPF A;  1M27 C;  4M75 F;  4J6X A;  3CCU Q;  2NYS A;  4JS5 A;  3GPL A;  1BI3 A;  2OTJ Q;  4DBR A;  2JT4 A;  4RTW A;  2KRN A;  2YUQ A;  4PLI A;  1Q82 C;  1JXM A;  1UEB A;  1IHV A;  1N27 A;  5GAM j;  3H8Z A;  2DTI A;  4C0D C;  1EFN A;  1VQ9 A;  1Q81 R;  4QT7 A;  4C8Q D;  3CPF A;  2FO0 A;  2D8H A;  5CKF A;  3THK A;  2K4Y A;  1VQ8 Q;  4JJN K;  1ZBJ A;  1Q95 G;  2IPO B;  2EGC A;  3UF4 A;  2QA4 A;  2X4W A;  1M2V A;  5GMK i;  1I8F A;  1SHG A;  5J26 A;  3PTA A;  4ELY C;  2M9U A;  3OYJ A;  4KUI A;  3JCM V;  2O88 A;  4M7A D;  3QKJ A;  2KYB A;  3CCE A;  4M78 B;  1NM7 A;  2AK5 A;  4MML A;  2DD4 A;  5HY6 A;  2L3S A;  1LJO A;  2NUT A;  2PZ1 A;  4B6M A;  1N9R A;  5KYU A;  2CYZ B;  4M75 C;  2RI2 A;  4AFS C;  2VB6 A;  4M75 G;  2DTH A;  4B9W A;  1B34 B;  5GAO n;  2YWW A;  1YHQ A;  1TUD A;  2P0P A;  1X43 A;  3REB B;  1HJD A;  2E3I A;  4F7U B;  1JXO A;  1B3Q A;  3EGU A;  3MKD A;  1Q82 U;  3RR6 A;  1K9M R;  4M7D D;  3G4S Q;  2VGM A;  3TQ7 P;  1GBQ A;  1S72 A;  2KYM A;  2DKG A;  1ACM B;  3FRN A;  1SSF A;  3JCM X;  5IHI A;  3M58 A;  3UWN A;  5FRN A;  1BB9 A;  2L2P A;  2YRC A;  1VQN Q;  4XU3 A;  4QQD A;  2EQJ A;  1ZHI A;  3C0C A;  2RQR A;  2DJQ A;  5CCA A;  1M9S A;  4OVA A;  2X4X A;  3VS7 A;  2E65 A;  1VA7 A;  5FWB A;  1G3S A;  4J9E A;  2R57 A;  1VQO A;  4QW2 A;  1OU9 A;  3VS2 A;  3I56 A;  3PMT A;  5GAO p;  3DB3 A;  3CC2 A;  6AT1 B;  2BIV A;  4PJM A;  3UA6 A;  1A0N B;  2ATC B;  3EFR A;  1JU5 C;  1VQ4 Q;  5IN1 A;  1PD1 A;  2RJD A;  2MCN A;  3EFS A;  2GTO A;  4E7H A;  4RTT A;  5LJ5 e;  1UFF A;  1BCM A;  1ZLM A;  4XQ3 A;  2QQS A;  2DFU A;  2OTJ A;  2A0F B;  3HSB A;  4C92 B;  4ZTF A;  1YNZ A;  2YUN A;  3PT9 A;  2FYK A;  4HT9 A;  4K11 A;  2DK3 A;  1PRL C;  2HMA A;  1EZZ B;  2K57 A;  4PJO E;  3VUB A;  3DB4 A;  2ED0 A;  3EG2 A;  5I2M A;  2BUD A;  1Q7Y C;  3EH2 A;  3C95 A;  3MCA B;  2A7Y A;  2X4Y A;  3AHU A;  3SFM A;  1UHC A;  2P84 A;  3CME Q;  2CGH A;  1YFN A;  5A0G A;  1YJW A;  3LW5 E;  1T0H A;  1NZ9 A;  4J9F A;  4C5H A;  3ZL7 C;  4OMQ A;  2OTL T;  1BI2 A;  1IRX A;  5GAN h;  1MNE A;  3AT1 B;  2CP0 A;  3S6W A;  5LJ5 d;  1TSF A;  4E7Z A;  3LH0 A;  2WSC E;  4E7S A;  1D0Y A;  2CP6 A;  2CRE A;  4FW2 A;  1ZQ1 A;  1PSF A;  3CCM T;  1VIE A;  1TUG B;  2CSQ A;  2RN8 A;  2KBT A;  3CCS Q;  2ED1 A;  4RKU E;  4HCZ A;  2WSE E;  4XU1 A;  4M7A F;  2V1R A;  5CK9 A;  3A8M B;  1MMA A;  2BTT A;  1RLP C;  3EG3 A;  2KSS A;  2CZ7 B;  4J9I A;  2DIQ A;  2DYI A;  2OAU A;  3EGX B;  2RF0 A;  3M0Q A;  2A08 A;  1VQM T;  2O2O A;  3JB9 G;  1VQP Q;  5FWC A;  3CCR Q;  2DD5 A;  4M77 B;  1Q7Y U;  2LQ8 A;  2PTK A;  1X75 C;  1VQL A;  1X6O A;  1UG1 A;  3I55 T;  4A4K A;  1KQS P;  4C8Q C;  3EG9 A;  4C5G A;  2D0Q B;  4M75 A;  3QPH A;  4C8Q G;  2JUF A;  1N8R C;  1I81 A;  2GGR A;  4M7D F;  1AD5 A;  3VV0 A;  1X2K A;  2BZX A;  2LT1 A;  1WJS A;  4E2F B;  2KXD A;  2KXC A;  2L3R A;  3CC7 T;  2LMJ A;  1KQS S;  2X4J A;  5KYY B;  3OA6 A;  3JAM E;  5GJV B;  1XOV A;  1VIF A;  3MP6 A;  1GBR A;  3QG1 A;  1K0S A;  1WLP B;  3PIO A;  1GCP A;  2PVG B;  4M7A C;  3FC3 A;  2RD1 A;  3V7R A;  4M7A G;  2VXE A;  5FU7 B;  3VYH B;  5KYX A;  2LNV A;  4CRI A;  2E3H A;  1QQJ A;  2XID A;  3CCL A;  1R0C B;  3M5A A;  4PJO C;  3C4S A;  1M8V A;  1TU0 B;  1GCQ A;  3M0P A;  4PLL A;  4BY6 C;  3TEE A;  2Y4Y A;  2M02 A;  3ULR B;  1JJ2 P;  3I5S A;  1N8R U;  3S3N A;  2LCL A;  1QCF A;  2MIO A;  2RNA A;  1OOT A;  2YHT A;  2FPE A;  1FMV A;  1M4Z A;  1QVF A;  5A2Q E;  2AZV A;  1H3Z A;  3GOX A;  1HSQ A;  1AOJ A;  5IAY A;  4EMK A;  2L3P A;  3G6E T;  4CC7 A;  2CDT A;  3VYG A;  1SG5 A;  4HT8 A;  1LCK A;  1VQK A;  2MYS A;  4ME7 A;  4KGV B;  1LOJ A;  2EJ9 A;  1AWJ A;  4DBQ A;  3M53 A;  3A98 A;  5FRO A;  4KUL A;  1K73 U;  3N5B B;  4X1V A;  3RKW A;  1M1G A;  1W4S A;  2KRM A;  4C0G A;  2QAS A;  2YDL A;  3QYG B;  1Y71 A;  2EW3 A;  1KQS A;  1N6A A;  3PIP A;  4IIM A;  1IO6 A;  5GAN g;  5I11 A;  3E9G A;  2ZAE A;  3M55 A;  2CP3 A;  2L5Q A;  2DF6 A;  3JCM W;  1X6G A;  2GNC A;  4XK8 E;  3QXE B;  2QTV A;  1IHW A;  1OZ3 A;  1HD3 A;  4DOW A;  5GAN 2;  1VQ7 Q;  5GJW B;  1W2B P;  1RAC B;  1WFW A;  4AFQ C;  1QP3 A;  3SWN B;  4HCK A;  3RDV A;  1BI1 A;  4RG2 A;  2KGT A;  2RB6 A;  2MF2 A;  4ZTJ A;  1ZUK A;  2JTM A;  2KRO A;  3GLX A;  3QII A;  2RO0 A;  2CT4 A;  1W2B S;  2F5K A;  3RIR A;  4JPB W;  3CCV A;  4FU6 A;  1OI1 A;  1Y57 A;  4M4Z A;  3EH1 A;  4LUD A;  4C0F A;  2LQK A;  3NGP A;  4C8Q A;  1N5Z A;  1HK9 A;  3VS0 A;  4IUQ A;  1JJ2 A;  1YWP A;  4D6W A;  1K8A R;  3G71 T;  2EYZ A;  2CT3 A;  1VYV A;  3OYI A;  3JB9 I;  2GCX A;  2HD0 A;  1YIT T;  2DX1 A;  1CKA A;  1K0X A;  2HDA A;  2FEI A;  4M77 D;  4OGC A;  1RAH B;  1SF9 A;  5CKD A;  3PGG A;  4M7A A;  1PRM C;  4KH1 B;  1YJ9 Q;  1G8X A;  1C1A A;  4F7U F;  4KRT A;  1PG5 B;  2RMO A;  1E6H A;  2K3B A;  4HA8 A;  4J8O A;  3QO3 A;  3JCM Q;  1TTH B;  4HCC A;  1GXI E;  2Z0W A;  4FT4 A;  1BIA A;  2P0Q A;  1RAD B;  2MMP A;  1LNX A;  3RKY A;  4GLM A;  1VQ9 Q;  2FRW A; 
#chains in the Genus database with same CATH homology
 1OX8 A;  1OU8 A;  2QAZ A;  2QAS A;  1OUL A;  1ZSZ C;  1TWB A;  1ZSZ B;  1ZSZ A;  1OX9 A;  1OU9 A;  1YFN A;  2NYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...