1ZSZA

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszA00
1OULA 1ZSZA 2NYSA 1TWBA 1ZSZC 2QAZA 1OU9A 1OX9A 1ZSZB 2QASA 1YFNA 1OX8A 1OU8A
chains in the Genus database with same CATH superfamily
1JJ2P 2KI7A 2PQWA 1OYXA 2K3XA 1NJIU 5KCHA 5DY9A 2DL5A 3EG9B 2OAUA 4JS4A 3PIOA 3AHUA 1RABB 3ZL7C 5KYXB 1NJIC 3PMIA 4N4HA 4IUUA 1N27A 1WHMA 2F1LA 5CKEA 3WXMB 4GLMA 4XTYA 1VQ8Q 2L3PA 3OS0A 3DKMA 2BE7D 2K2MA 4XTVA 3M0PA 3LGLA 2YHTA 1YJNA 1AWWA 2L5QA 5GMKi 3JCMQ 2HNIA 3OYGA 3MEAA 4OB3B 4A4GA 2O01E 3CPFA 1N9RA 2IG0A 2DXUA 2K6DA 4RCCA 2HBWA 2KYMA 3OYEA 1KQSP 2V1QA 1WJRA 4F17A 2RQVA 2A08A 5GAMd 4M78G 1YWOA 3DLLA 4M78B 5CCAA 3EHRA 3CCVQ 1PC0A 4GY5A 2FB7A 1I81A 1BI2A 2PUOB 2KRNA 1Q81R 1E7OA 3RBBB 3G7ZA 3CQTA 1IRXA 4M7AB 2DL4A 2MWOA 1ZX6A 5LJ5g 1VQ4Q 1B7TA 1VQ9T 3I5SA 2E65A 4VUBA 1UG1A 2E5KA 2QXFA 1AOJA 3M57A 1WHHA 4II1A 2X4YA 1GBQA 2QEXA 2EQMA 3C12A 1X2QA 5C0MA 1X01A 2LCLA 1YHQA 4AFZC 1NE8A 3JRZA 4XU2A 1M9SA 2EYYA 2WSEE 2E41A 2YUOA 3VYGA 3OS2A 5GAMe 1M1GA 4JUVA 1U06A 1WA7A 1VQ5Q 2FEIA 4X1VA 1ZUYA 4PFZA 4TVRA 1M3AA 5FU6B 1QP3A 2PVOB 1WHJA 4JZ4A 1M5Q1 4ZGEB 2D0QB 2MPXC 2E3IA 2O2OA 2O9SA 2QTXA 4E7ZA 4PFOA 3M58A 2E10A 1IZ6A 3P8DA 1VQ8T 2Y4XA 2FYKA 2H3EB 1W70A 1U8RA 5GAN7 2DEQA 5GJWB 3G4SQ 2JT4A 2VKNA 1D0YA 2BE9B 1QCFA 2HSPA 1Q86R 2LP5A 2RQUA 5GAOr 4E7LA 2EQUA 2L0AA 3H0IA 3PGGA 2DYBA 5GAN2 2BZ8A 3HFOA 1YI2Q 3FJPA 4LXCA 2DTHA 4C8QG 3JB9F 5FROA 2RJEA 4C8QB 1OX9A 2EQIA 3H0FA 4M77G 3C94A 2XG8D 4M7DC 1FYNA 2NUTA 2AT1B 2JZ2A 2VUBA 1BI0A 4CC3A 1VQKQ 1K9AA 2E12A 2LX7A 3LLRA 2X4JA 3D7SB 3CCVT 5HK3A 1PKTA 4ANJA 1UGSB 1FWZA 5LJ3d 2MWPA 1RADB 4BY6B 2LZ6B 1VQ4T 2QA4A 2JOYA 1KHCA 1Y07A 3TSZA 1NBEB 2MMPA 4FT4A 3O5ZA 2CKKA 3OYYA 2DXBA 4DBQA 3UA7A 2X3XD 2RM4A 1SPKA 4JJBA 1OZ2A 2MK5A 1VYTA 3PTAA 1K1ZA 4RTWA 1R0CB 1YBYA 1VQ5T 1KC8R 5GAMh 1XQHA 4PJOC 4Z8AA 1NZ9A 2CDTA 3LWHA 2DPPB 2JUFA 1AEYA 4IUTA 2QQAA 4C5EA 5LJ3e 4LD6A 4J5YA 3C95A 2QI2A 2ZPEB 3EG1A 3WVEB 2C06A 2FRYA 2PTKA 3G4ST 4MZTA 4DBRA 3CCMQ 2FO0A 2DX1A 2XU8A 1KQ1A 1I5OB 1WZOA 1MV0B 2YSQA 4MZMA 5GAN3 4C92B 1QVGA 1LOJA 4M7DE 3CBOA 3CCQA 2A0FB 1TSFA 1YI2T 2YUQA 5CO7A 8AT1B 2DXCA 1YCSB 5CKBA 3L2QA 2CP2A 3E9GA 2QGFB 1KD1R 1VQKT 5GANg 1S72A 1ZSZC 5GMKm 1SHFA 1UUEA 3QZ5B 4XU3A 1UFFA 2DNUA 4RUGA 2HCKA 4M7DF 3CCSQ 1N5ZA 2XDPA 2JVVA 1VQNQ 3ULRB 1KHIA 3SWNA 2RI3A 2WSFE 2KQWA 3JCMd 4PKCC 1JJ2S 3OQ5A 4J6YA 1SSFA 1RAFB 3BE3A 1M30A 5I2SA 2RH2A 4EMHA 4OGEA 5LJ5h 1W6XA 3ER0A 3RKYA 2J06A 3TQ7P 2KT8A 1AT1B 3QWXX 4AFUC 4OMLA 1H3HA 4MDXA 5IHKA 5CVIA 3ZBDA 2D9TA 2JJ9A 1CKAA 3EHQA 1G3YA 2FPDA 3VU3C 2XKOC 3RIRA 3GIBA 4GLKA 2OTLQ 4ZNXA 3O8VA 2EYWA 4DOWA 1LCKA 1S72T 1Q7YU 2LCCA 4PJOF 2DEUA 5LJ3h 3JCMe 1BCOA 5KYNA 1X2KA 2RQRA 3CCMT 1KQSS 4JJDA 1N6AA 1HD3A 1I1JA 2DJQA 2LQWA 2F2VA 2WSCE 3HRSA 4HCZA 5J3BA 4F04B 1RAGB 1UGQB 2W10A 2KXDA 4ZTFA 2EWNA 4M78E 3KUFA 2M1HA 2EIFA 2V8JA 3M5AA 4RTVA 1O9SA 1HSQA 1WPYA 2EQKA 4AG1C 3JCMJ 1UDLA 2ZPHB 1J3TA 4M7AE 2RHIA 4IUQA 3I56A 2CSIA 3CCST 2PU9B 4M77A 1BCMA 4MDWA 2QQRA 1VQNT 4MZPA 1UE9A 3CMEQ 4V2SA 2G6FX 3TVTA 4XU0A 3E9FA 2WACA 1S1NA 3A5ZB 5FLXE 2NUPA 3M53A 4E6RA 1VQ6Q 2DJZA 4QKUA 4F7UF 3NFCA 2VC8A 4NL2A 4M75A 4DBHA 5CKHA 2EJGA 1YNZA 2OX7A 3OYDA 5GAMj 9ATCB 2D1XA 1PG5B 3UF4A 1LJOA 3HL8A 4KGZB 3UATA 4EMGA 5GAN6 2LVMA 2ZPGB 4KUIA 3CMAQ 4DEYA 4CI0C 2DZ9A 2CP0A 1WYXA 2LRQA 1OOTA 2OTLT 2A36A 3A8OB 4RG2A 1C1AA 3RKXA 5KE2A 2CP6A 2DA9A 2HKNA 4BI8B 2K79A 3JSCA 3HPWA 3JCMh 3CXCA 4BUGA 3HHTB 1N8RC 4C8QE 2VXEA 2ZZDA 1UJ0A 3GF5A 4J9EA 4WCIA 5IXBA 2DTOA 3G71Q 3M56A 4KUDK 2VASA 1WJSA 3OYLA 2RO0A 4OMFB 1YJ9Q 3SFMA 5DLQE 1T3SA 1RL2A 1GFDA 1WXUA 4QQGA 1H92A 1WDXA 1B3QA 3VS7A 2E70A 4M77D 1M1KU 1D3BA 4HVWA 1RAEB 4BD3A 1WXBA 5GMKe 4HVUA 5LJ5f 5GANh 3MP1A 1M1KC 2J6FA 1M1FA 2MI6A 4PLIA 2GFUA 1YJWA 4YTLA 1IXDA 2A28A 1XNIA 2DK3A 5LJ5j 3CMET 2YLBA 2CS7A 1AWJA 4M75D 1TG0A 1U3OA 3VS2A 3CCUQ 4B9XA 4AT1B 2E64A 1VQ6T 1IO6A 2GBQA 5HKCA 4ESRA 5HCKA 3A8HB 2O31A 2EPDA 3FRNA 3OYHA 4EIKA 5D6XA 1W2BA 3EGDA 4N4GA 2HDAA 1M3CA 4BDYA 2L89A 1M90R 2EKHA 5FWCA 4ZN1A 1WXTA 4ME7A 5GAOp 3JV3A 3BDUA 3CMAT 1KQ2A 1VQLQ 1WNLA 5LJ3j 1YITQ 1BB9A 1VOMA 2D8JA 2P4RA 4IUPA 4ELYC 4C92E 1M2OA 4P5NA 1M27C 1QVPA 1ZSGA 2AKKA 1AWXA 2MYSA 4BE1A 3VV0A 4M7DG 1M2VA 5D7UA 3TEEA 4M7DB 4J6XA 3CCEQ 2CZ6B 4FM4B 2E6NA 2QYZA 2V1RA 2JTMA 4LUDA 1YJ9T 1NJIR 2F2XA 4Q5WA 2YRCA 1NPPA 3EFOB 3L2WA 2A37A 2KRMA 2YRVA 1Q82C 1K9MU 4RG8A 5GMKh 1K76A 3QDFA 2OTJQ 2JS2A 2RNAA 2SEMA 3J80E 2X51A 3JAME 4C5HA 3VS4A 4NL3A 1K8AU 1K9MC 2K57A 1ZUUA 3L1AA 5GAN8 5KYUA 4EPCA 3SB2A 3CPWP 2DD4A 1Z9ZA 3CCUT 1FMVA 5GAMg 3G1JA 2AKLA 5KH6A 1X6OA 1VQOQ 1UTIA 3UA6A 3JB9I 4PJOG 5KCOA 4PJOB 3OYJA 2HQEA 1VQ9A 2AZSA 1P92A 4C0GA 3QXEB 1Y96A 5L23A 3CC4Q 4OMQA 2GF7A 2XDDA 2ROLA 4M4ZA 1I4K1 4OMPA 1YITT 3OYFA 5KYYB 4O6JA 1W4SA 1BK2A 2PUKB 1SSHA 2SRCA 4N0AA 2EKOA 2RI2A 4J9DA 1QMCA 4OB0B 1PRLC 5KYWB 1AZGB 1B07A 2YUPA 2ZPFB 2K3YA 3RUXA 1JO8A 4HVVA 3CCET 5GANf 2VGMA 1ZSZB 1VQ8A 1ZUKA 1PNJA 4HA8A 3X25B 2O4XA 4DBFA 2BUDA 1G5VA 2DF6A 1GCPA 2ED0A 1OQKA 3H0HA 5GANj 4HCCA 4M7AG 4A54A 7AT1B 2DZCA 2GQVA 2O88A 3QJYA 1YWPA 4LE9A 1Y0MA 5I11A 2KROA 3PFSA 4F7UB 2RPNA 1F1BB 1RLQC 2X3WD 2OTJT 1A0NB 1D1CA 2F5KA 3THKA 1K0XA 2FZCB 4OB1B 3CBMA 4MMKA 2LTOA 3J81E 2CGHA 4OMNA 2EVRA 1VYVA 3CCVA 2YRDA 2C0IA 3X24B 3INZA 2K9GA 2MAMA 2JMAA 3OYBA 4XTUA 3M4GA 5L8RE 1VQ4A 2KK4A 3ZFJA 5LJ3g 1RACB 2DKGA 3CC4T 1VIEA 2DXTA 4LDVA 3VJPA 3S3MA 2HL5C 4QVDA 3CXCP 1ZQ1A 2EYZA 2CH4W 2FVUA 4A4HA 3CBPA 1VQMQ 2DLPA 2ECZA 3RR6A 2RQTA 1Q81C 4O5VA 1UECA 2JNGA 3HFNA 2QG9B 1X6BA 2X35A 1VQ5A 2XK0A 4JLIA 2DO3A 1WJQA 1FMKA 3OMCA 3KXTA 1N9SA 3H6ZA 1QVFA 3FB9A 3NTHA 2KBTA 1JBMA 2PZ1A 1GL5A 2L3QA 4FYXB 3G4SA 2PVGB 4B6MA 2LCSA 2KY9A 3GNFB 2MIOA 2H8HA 3RESA 2QQBA 3FEOA 2L3RA 1GRIA 2ROTA 2E6ZA 3LW5E 1YI2A 4J9HA 2AK5A 3PIPA 1I07A 4XK8E 1PWTA 3HRTA 1VQKA 1OEBA 2KVQG 4J9GA 3T9NA 3F70A 1WFWA 1BIBA 3OYIA 1Q86C 4JRIA 3V7SA 2L8DA 4Y91A 1CKBA 2LJ1A 2QDLA 2DAQA 1QKWA 2Y4YA 4AFQC 4LDYA 3LYIA 2DL7A 4UC4A 1QVGS 1GCQA 1NG2A 3V8KA 2M16A 2FZKB 1PRMC 4A4EA 3V8LA 2BTTA 1JXOA 3EG9A 2EW3A 2DYIA 3JCMg 4HT8A 1ABQA 5DM7R 5KYXA 1NEGA 3MKDA 4XAXB 4IIOA 4FT2A 1OPLA 4BE0A 3FC3A 4RCBA 2CP3A 1VQMT 4Y28E 4C92G 3RMSA 3PT9A 2RHYA 1BI3A 3L42A 2OAWA 3ME9A 1WHGA 5I2MA 2EBPA 2LQ8A 2EQJA 2LMJA 1ZA1B 2QGGA 3UT1A 4OMOA 5IHIA 1WQ7A 3CCMA 1QCNA 2QK0A 4CC4B 3LGFA 2GQIA 1RAHB 2JTFA 1SKUB 4NS5A 1OZ3A 4Z89A 3X28B 4M78A 3CCRQ 4E47A 3CPWS 3H41A 1KC8C 1VQ7Q 3SWNC 3EFRA 4JPBW 1RLPC 4Z88A 3KFVA 1MMGA 1R8OB 1Q7YR 1PD1A 2RMOA 1IREB 3EG3A 1B34B 4M7AA 2D0NA 3QUIA 3REBB 2KE9A 4CC7A 4D8DA 3QYHB 3HRUA 2OJ2A 5GAOn 5IXFA 4PJOE 2KRSA 3CCSA 5AYFA 2DE0X 3EGXB 1BBZA 4HKEA 1VQNA 2DRKA 2XICA 1RUWA 4PJMA 1Y71A 3CCJQ 2V8KA 2XD0A 4BACA 2KEAA 2XMFA 2DIQA 4PLLA 3M0TA 1OU8A 1VQPQ 1KD1C 3L2UA 1MV3A 3DB4A 2MCNA 4L5GA 3L2ZA 3JB9J 4C0DC 4LN2A 4E2FB 4EMKB 5GAOq 2KAFA 2XDBA 5J26A 3JCMW 4L6V5 3E1SA 2V26A 5GMKl 4AG2C 2R5MA 2OTLA 2HZYA 3EFSA 2AIRB 3CC2Q 1U5SA 4FCYA 3JCMP 1M8MA 2JTEA 3LH0A 4M78D 1NLOC 2X4XA 3MP6A 4C8QA 2EJ9A 4QT7A 1VIFA 4F7UE 2M9UA 1H8KA 4QVZA 2RN8A 4HXJA 1KK7A 4J7FA 3RMQA 3GOXA 4M77C 1JXMA 1I8FA 4C0FA 4M7AD 3CCRT 2CZ0B 2LJ3A 2FRWA 3RNJA 1VQ7T 1TU0B 3UPUA 1UEBA 4X9DA 2QDYB 1ZLMA 1SRMA 1X6GA 1TXQA 5GAMf 2RJFA 4BY6C 2F5TX 1UGPB 4AFSC 2FL7A 4HCKA 4M75C 3DB3A 2LQKA 3L2RA 2PNIA 3FJ5A 3CXCS 5FRNA 3CMEA 4J8OA 2DD5A 2VVKA 2DRMA 1NYGA 4RTZA 3MO8A 3CCJT 3JB9G 3VS6A 1M1KR 1ZA2B 3HP9A 3CD6Q 4LDWA 1VQ6A 3I55Q 1XJWB 1VQPT 1N8RU 3OY9A 3Q1JA 2LC4A 3A8GB 1QVFP 1MMNA 2YWWA 3VS1A 1X27A 2K4YA 5GAN4 1G8XA 3CMAA 2CH4A 4WTOB 4BI4A 3VS0A 4C8QD 2HAXA 4L59A 2K5FA 4EDUA 5FU7C 4C92A 3RKWA 3SD4A 3CC2T 2ESWA 1TUCA 4AMCA 2ZGWA 3EH1A 1HK9A 2RI5A 4OGCA 1AZEA 4ORZA 2BIVA 1QP2A 3TCJA 5GAOm 3CCLQ 5KE3A 3MPUB 4LNPA 2XI9A 2C0TA 1YJ9A 4M77F 3L2VA 2JW4A 4CRIA 3FIFA 5CK9A 1OX8A 2XIDA 1LPLA 1VUBA 2I0NA 3NMZC 5CIUA 2KXCA 3MEVA 3VYHB 4DEXA 4A4FA 1JRIA 1MNEA 1NEBA 2R57A 3X20B 4JRQA 5LJ3f 4BDZA 4ZGDB 2QQSA 4HCBA 3C0CA 1XTDA 1ABOA 4M75F 2RHUA 3JCMc 3VUBA 1C6VX 5D6WA 3CC7Q 1QVGP 3CCUA 2P84A 3CD6T 4KRTA 2EYQA 3I55T 1K9MR 5CR2A 5HK0A 1AD5A 1OI1A 3E19A 1WIEA 4Y92A 1SF9A 1K8AR 2VV5A 2FPFA 3S3NA 2JMCA 5CQXA 3A1PA 4IIMA 1NLPC 1G3SA 4C92D 3G71T 2E4HA 1IGUA 2NUTB 1PKSA 1VQLA 3CEYA 3BY7A 4K11A 5IAYA 1YITA 1Q82U 2RQWA 4KULA 4F16A 1AHJB 2L3SA 1HYOA 1M8VA 2DMOA 2LDMA 2K2VA 1YP5A 2C0OA 3OW2A 3HSBA 3OYCA 5CAIA 1YIJQ 1T0HA 3G6EQ 3BDLA 3E2UA 1PCXA 4PFPA 3JCMb 1BYMA 3CCEA 3IQLA 3M54A 1OPKA 3NTIA 2LNHB 1GBRA 2GFAA 1BI1A 3AT1B 1RI9A 1OULA 5C6SA 3PMTA 4A4KA 3OYKA 3EG0A 4PNOA 5FWBA 1K73U 4R55A 2K5LA 2COWA 4PJNA 1K73C 2CUDA 5IT9E 2OTJA 1T3LA 1MMAA 2CT3A 3PVLA 3QDRB 3GBQA 1YJNQ 3JCMf 3J7AF 4JS5A 2FG0A 1W1FA 4KGVB 1WHLA 1C0MA 4D6WA 1VQLT 1NYFA 3URGA 3EGUA 1G83A 1NPRA 2HSEB 4KH0B 1BU1A 2NUZA 3CC7T 1VQOA 3JCMX 1FXXA 1Z9QA 2J05A 1R77A 4N0AC 3QBYA 1SEMA 3M59A 1ACMB 3CC4A 2ZPBB 3OYAA 3FLGA 2FZGB 4QQDA 4FU6A 2FPEA 1WX6A 3QYGB 1EIFA 3QZ9B 4KBMB 2LJ0A 5CKFA 4F7UG 2QASA 2QEXQ 3SWNB 1H641 2R58A 3BW1A 3M9QA 3N5BB 2CZ7B 1YIJT 1YHQQ 2KT1A 3G6ET 2GTOA 4CC2A 1JU5C 1V76A 2JM8A 2W0ZA 5AT1B 4JJNK 1IHVA 2NYSA 2V8IA 3KBGA 4J9BA 2D6FA 4C5IA 2J7IA 4QQ6A 3M0RA 2YXYA 4E7IA 2D8HA 2HQXA 3LX7A 4N4IA 2CP5A 2EFIA 1VQOT 1LNXA 3QWYA 1QWEA 3A8LB 2HQHA 2XHCA 3PNWC 2B8AA 5M9OA 1CSKA 5IHNA 2QTVA 1FMWA 5ECAA 1YJNT 1Q81U 1QVFS 3GLXA 1GXIE 2DBKA 4OB2B 3PE0A 4C0DB 3JB9D 2JN0A 4XTZA 3SDZA 2MOXA 2R5AA 3C4SA 1UGVA 4KT0E 4RMOA 2CSQA 1RAIB 4XTXA 5LJ5d 4E7KA 4LDUA 4BE2A 4OMMA 3OB9A 4X9CA 2GGRA 2IPOB 2QA4Q 4M7DA 1TTHB 1OV3A 1VQMA 5GMKj 1KIKA 4JRPA 3RDVA 3QPHA 3OBWA 4RTXA 1M3BA 4M77B 1R0BG 3OA6A 1QQJA 2QEXT 2NLUA 1KSWA 1WQWA 1I5LA 3I35A 1YHQT 3NTKA 1QKXA 2DL3A 3EFOA 2J6KA 1Q86U 4J9FA 1PD0A 2NUPB 4IKFA 2P0KA 2LNVA 1W2BP 1MNDA 5GJVB 3M55A 2JM9A 4M75G 4XU1A 3R6OA 1UB4A 3VS5A 3LH5A 4M75B 2X4WA 5LJ5e 5A0DA 4ZTJA 2LQNA 4JLGA 2VB6A 3MJXA 4DA4A 1HJDA 2ABLA 4WF2A 2P4TA 3JB9H 1WHKA 1X43A 1WLPB 1H3ZA 3ZEHA 4LDXA 3NPFA 1GCQC 3OBYA 2YUNA 2E1HA 3OSVA 2ATCB 3H9NA 4R56A 1WI7A 4BB7A 4IURA 4PJOA 2G3RA 3MCAB 3QIIA 6AT1B 3CCQQ 1IB8A 2A7YA 1TOVA 4PJJA 4RTYA 4FSXA 4RTUA 4FW2A 3HKSA 2DM1A 5IN1A 1S72Q 4Z02A 1VA7A 3WVDB 2ZPIB 3QHSA 3P8HA 2CP7A 3VRZA 1RAAB 5KYYA 3MP8A 3I9QA 8ATCB 2RF0A 2CREA 5FU7B 4M7DD 1G3TA 2RA2A 2HL3A 2O9VA 3OW2P 2BKDN 1D3BB 5KYWA 1VYUA 2QA4T 2H3JA 2ZAEA 2VWFA 1KC8U 1UHFA 4J7IA 2DL8A 2NWMA 4E7HA 2K5IA 1ZSZA 2RJCA 1AVZC 3QJ6A 5HY6A 4M78C 1V1CA 2GTJA 1KJWA 3SHWA 3M0QA 2HBPA 3SEMA 2CYZB 2I2LA 3QSUA 1E6HA 4F7UA 3OYMA 4M7AC 1UJYA 3NHNA 1JEGA 5I21A 1LVKA 2GCXA 1ZBJA 3I5RA 2YT6A 2KNBB 3EGDB 2AZVA 3MHXA 3CCRA 2DERA 1XOVA 1VQ7A 4PJOD 1KD1U 3META 2DVJA 1T0JA 2HMAA 2KSSA 1TH7A 3M0UA 1JJ2A 3CPWA 1YFNA 2VXFA 5GANd 3CCQT 4DOVA 5FU6C 3P8BB 3ASKA 3M4YA 2ED1A 3VS3A 1QW1A 1M2VB 1KFZA 2ZCFB 2DILA 1IHWA 1Y57A 2Z0WA 2CT4A 3CCJA 1E6GA 3I56Q 1D0ZA 1Q7YC 2EAYA 4FYWB 4DQ2A 2A3LA 1VQPA 3TREA 3EAEA 2EGCA 3RERA 4JDSA 1G3WA 1DJ7B 2L2PA 3GP8A 2EGAA 4C8QC 4LD9K 2LT4A 1AWOA 4F14A 2M0YA 2JS0A 2QQ9A 2BZXA 1KQSA 3S3OA 5GANe 2QAZA 1ZHIA 3OS5A 4NOYA 5KYUB 3PVQA 2LT1A 1N8RR 2MF2A 3CC2A 1PHTA 5FW9A 3GNGA 3S6WA 2CUBA 3TSWA 4M78F 2KR3A 3X26B 5DLOA 2RK2A 2ENMA 1O75A 2IVWA 4OVAA 1JB0E 3QKJA 1YCYA 2RHZA 2HKQB 1SRLA 4IUVA 2RB6A 2RD1A 4GBQA 1FX7A 1RI0A 2X9HA 2K3BA 4M7AF 4FL6A 4J83A 1Y96B 2E5QA 5A2QE 2JXBA 1K0SA 1EZZB 3DLMA 2VGNA 1D1BA 2KYBA 2KDSA 1M4ZA 1MMDA 4RKUE 1UHCA 1KG1A 2HD0A 1D0XA 1Y7XA 2DTIA 3HTRA 3A98A 3EH2A 5FRMA 1X69A 4KGXB 1IGQA 1I0CA 3A8MB 4E7JA 2DETA 5LL6S 1D09B 1QLYA 1EFNA 1SHGA 4E7SA 2J6OA 4HT9A 4QW2A 1EX4A 2HEQA 2EGEA 3V8JA 2O4XB 3I56T 1TUDA 2M51A 1YJWQ 3CD6A 5D6YA 3I55A 1GFCA 4C92C 2YLCA 3TU4K 1PSEA 2M02A 1SG5A 4M77E 4ZGJB 1UGRB 2M0OA 3LWIA 5GAN5 2P0QA 1PSFA 5J39A 1WGSA 4PK4A 1ARKA 1D1AA 1W2BS 5CQYA 3G71A 4A53A 4B9WA 2GNCA 4J9CA 1K4US 2DFUA 4C8QF 4KH1B 4J9IA 4FSSA 1BKBA 4M75E 2PVDB 3EG2A 2EJFA 1ZBXA 1TUGB 5CKDA 4RTTA 2RJDA 1PM3A 1U1TA 3JCMV 2COZA 4J6WA 4PL6A 5A0GA 1BIAA 3VUZA 3VRYA 4ZN3A 2IIMA 1B34A 3REAB 3V7RA 1MHNA 3CCLA 4FW1A 4D8KA 1U1SA 3H8ZA 2CZ1B 1HXDA 2VYTA 4JRKA 1OU9A 4A63B 1Q82R 4X34A 4JZ3A 3OSSC 3EGXA 4FIBA 4XQ3A 5EC7A 4C5GA 1QCOA 3UWNA 2KGTA 3OS1A 2EYXA 4BI3A 5I22A 2BZYA 1G2BA 1MGQA 1JQQA 3R6NA 3M0SA 4OF1A 3OW2S 2B86A 2DIGA 2RK1A 1V29B 2P0PA 4OP0A 4C0ZA 3BFMA 4EMKA 3V7CA 5A0LA 4ELZC 3CC7A 4XTWA 2E3HA 3QG1A 1K73R 3UDCA 5GAOl 3QO3A 4EMKC 5IH2A 1YJWT 2AHJB 1TWBA 2LX9A 2K7AA 2OI3A 2Y90A 2DVEA 4LUEA 1X75C 4FYYB 1MUZA 2F2WA 1YN8A 4ATOA 1M90U 3OYNA 4QVCA 2COYA 2KMTA 3OMGA 3FDRA 2F69A 5EG2A 4C92F 1Q95G 4JJCA 1NM7A 3CCLT 1M90C 1TS9A 3NGPA 4PJLA 1QWFA 2RHXA 3GPLA 1VQ9Q 3MEUA 4MMLA 4R0KA 2DBMA 4FYVB 3VKIA 2FHDA 3U23A 2YDLA 1YIJA 1K8AC 3G6EA 3MEWA
chains in the Genus database with same CATH topology
1OULA 1ZSZA 2NYSA 1TWBA 1ZSZC 2QAZA 1OU9A 1OX9A 1ZSZB 2QASA 1YFNA 1OX8A 1OU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUL A;  1ZSZ A;  2NYS A;  1TWB A;  1ZSZ C;  2QAZ A;  1OU9 A;  1OX9 A;  1ZSZ B;  2QAS A;  1YFN A;  1OX8 A;  1OU8 A; 
#chains in the Genus database with same CATH topology
 1JJ2 P;  2KI7 A;  2PQW A;  1OYX A;  2K3X A;  1NJI U;  5KCH A;  5DY9 A;  2DL5 A;  3EG9 B;  2OAU A;  4JS4 A;  3PIO A;  3AHU A;  1RAB B;  3ZL7 C;  5KYX B;  1NJI C;  3PMI A;  4N4H A;  4IUU A;  1N27 A;  1WHM A;  2F1L A;  5CKE A;  3WXM B;  4GLM A;  4XTY A;  1VQ8 Q;  2L3P A;  3OS0 A;  3DKM A;  2BE7 D;  2K2M A;  4XTV A;  3M0P A;  3LGL A;  2YHT A;  1YJN A;  1AWW A;  2L5Q A;  5GMK i;  3JCM Q;  2HNI A;  3OYG A;  3MEA A;  4OB3 B;  4A4G A;  2O01 E;  3CPF A;  1N9R A;  2IG0 A;  2DXU A;  2K6D A;  4RCC A;  2HBW A;  2KYM A;  3OYE A;  1KQS P;  2V1Q A;  1WJR A;  4F17 A;  2RQV A;  2A08 A;  5GAM d;  4M78 G;  1YWO A;  3DLL A;  4M78 B;  5CCA A;  3EHR A;  3CCV Q;  1PC0 A;  4GY5 A;  2FB7 A;  1I81 A;  1BI2 A;  2PUO B;  2KRN A;  1Q81 R;  1E7O A;  3RBB B;  3G7Z A;  3CQT A;  1IRX A;  4M7A B;  2DL4 A;  2MWO A;  1ZX6 A;  5LJ5 g;  1VQ4 Q;  1B7T A;  1VQ9 T;  3I5S A;  2E65 A;  4VUB A;  1UG1 A;  2E5K A;  2QXF A;  1AOJ A;  3M57 A;  1WHH A;  4II1 A;  2X4Y A;  1GBQ A;  2QEX A;  2EQM A;  3C12 A;  1X2Q A;  5C0M A;  1X01 A;  2LCL A;  1YHQ A;  4AFZ C;  1NE8 A;  3JRZ A;  4XU2 A;  1M9S A;  2EYY A;  2WSE E;  2E41 A;  2YUO A;  3VYG A;  3OS2 A;  5GAM e;  1M1G A;  4JUV A;  1U06 A;  1WA7 A;  1VQ5 Q;  2FEI A;  4X1V A;  1ZUY A;  4PFZ A;  4TVR A;  1M3A A;  5FU6 B;  1QP3 A;  2PVO B;  1WHJ A;  4JZ4 A;  1M5Q 1;  4ZGE B;  2D0Q B;  2MPX C;  2E3I A;  2O2O A;  2O9S A;  2QTX A;  4E7Z A;  4PFO A;  3M58 A;  2E10 A;  1IZ6 A;  3P8D A;  1VQ8 T;  2Y4X A;  2FYK A;  2H3E B;  1W70 A;  1U8R A;  5GAN 7;  2DEQ A;  5GJW B;  3G4S Q;  2JT4 A;  2VKN A;  1D0Y A;  2BE9 B;  1QCF A;  2HSP A;  1Q86 R;  2LP5 A;  2RQU A;  5GAO r;  4E7L A;  2EQU A;  2L0A A;  3H0I A;  3PGG A;  2DYB A;  5GAN 2;  2BZ8 A;  3HFO A;  1YI2 Q;  3FJP A;  4LXC A;  2DTH A;  4C8Q G;  3JB9 F;  5FRO A;  2RJE A;  4C8Q B;  1OX9 A;  2EQI A;  3H0F A;  4M77 G;  3C94 A;  2XG8 D;  4M7D C;  1FYN A;  2NUT A;  2AT1 B;  2JZ2 A;  2VUB A;  1BI0 A;  4CC3 A;  1VQK Q;  1K9A A;  2E12 A;  2LX7 A;  3LLR A;  2X4J A;  3D7S B;  3CCV T;  5HK3 A;  1PKT A;  4ANJ A;  1UGS B;  1FWZ A;  5LJ3 d;  2MWP A;  1RAD B;  4BY6 B;  2LZ6 B;  1VQ4 T;  2QA4 A;  2JOY A;  1KHC A;  1Y07 A;  3TSZ A;  1NBE B;  2MMP A;  4FT4 A;  3O5Z A;  2CKK A;  3OYY A;  2DXB A;  4DBQ A;  3UA7 A;  2X3X D;  2RM4 A;  1SPK A;  4JJB A;  1OZ2 A;  2MK5 A;  1VYT A;  3PTA A;  1K1Z A;  4RTW A;  1R0C B;  1YBY A;  1VQ5 T;  1KC8 R;  5GAM h;  1XQH A;  4PJO C;  4Z8A A;  1NZ9 A;  2CDT A;  3LWH A;  2DPP B;  2JUF A;  1AEY A;  4IUT A;  2QQA A;  4C5E A;  5LJ3 e;  4LD6 A;  4J5Y A;  3C95 A;  2QI2 A;  2ZPE B;  3EG1 A;  3WVE B;  2C06 A;  2FRY A;  2PTK A;  3G4S T;  4MZT A;  4DBR A;  3CCM Q;  2FO0 A;  2DX1 A;  2XU8 A;  1KQ1 A;  1I5O B;  1WZO A;  1MV0 B;  2YSQ A;  4MZM A;  5GAN 3;  4C92 B;  1QVG A;  1LOJ A;  4M7D E;  3CBO A;  3CCQ A;  2A0F B;  1TSF A;  1YI2 T;  2YUQ A;  5CO7 A;  8AT1 B;  2DXC A;  1YCS B;  5CKB A;  3L2Q A;  2CP2 A;  3E9G A;  2QGF B;  1KD1 R;  1VQK T;  5GAN g;  1S72 A;  1ZSZ C;  5GMK m;  1SHF A;  1UUE A;  3QZ5 B;  4XU3 A;  1UFF A;  2DNU A;  4RUG A;  2HCK A;  4M7D F;  3CCS Q;  1N5Z A;  2XDP A;  2JVV A;  1VQN Q;  3ULR B;  1KHI A;  3SWN A;  2RI3 A;  2WSF E;  2KQW A;  3JCM d;  4PKC C;  1JJ2 S;  3OQ5 A;  4J6Y A;  1SSF A;  1RAF B;  3BE3 A;  1M30 A;  5I2S A;  2RH2 A;  4EMH A;  4OGE A;  5LJ5 h;  1W6X A;  3ER0 A;  3RKY A;  2J06 A;  3TQ7 P;  2KT8 A;  1AT1 B;  3QWX X;  4AFU C;  4OML A;  1H3H A;  4MDX A;  5IHK A;  5CVI A;  3ZBD A;  2D9T A;  2JJ9 A;  1CKA A;  3EHQ A;  1G3Y A;  2FPD A;  3VU3 C;  2XKO C;  3RIR A;  3GIB A;  4GLK A;  2OTL Q;  4ZNX A;  3O8V A;  2EYW A;  4DOW A;  1LCK A;  1S72 T;  1Q7Y U;  2LCC A;  4PJO F;  2DEU A;  5LJ3 h;  3JCM e;  1BCO A;  5KYN A;  1X2K A;  2RQR A;  3CCM T;  1KQS S;  4JJD A;  1N6A A;  1HD3 A;  1I1J A;  2DJQ A;  2LQW A;  2F2V A;  2WSC E;  3HRS A;  4HCZ A;  5J3B A;  4F04 B;  1RAG B;  1UGQ B;  2W10 A;  2KXD A;  4ZTF A;  2EWN A;  4M78 E;  3KUF A;  2M1H A;  2EIF A;  2V8J A;  3M5A A;  4RTV A;  1O9S A;  1HSQ A;  1WPY A;  2EQK A;  4AG1 C;  3JCM J;  1UDL A;  2ZPH B;  1J3T A;  4M7A E;  2RHI A;  4IUQ A;  3I56 A;  2CSI A;  3CCS T;  2PU9 B;  4M77 A;  1BCM A;  4MDW A;  2QQR A;  1VQN T;  4MZP A;  1UE9 A;  3CME Q;  4V2S A;  2G6F X;  3TVT A;  4XU0 A;  3E9F A;  2WAC A;  1S1N A;  3A5Z B;  5FLX E;  2NUP A;  3M53 A;  4E6R A;  1VQ6 Q;  2DJZ A;  4QKU A;  4F7U F;  3NFC A;  2VC8 A;  4NL2 A;  4M75 A;  4DBH A;  5CKH A;  2EJG A;  1YNZ A;  2OX7 A;  3OYD A;  5GAM j;  9ATC B;  2D1X A;  1PG5 B;  3UF4 A;  1LJO A;  3HL8 A;  4KGZ B;  3UAT A;  4EMG A;  5GAN 6;  2LVM A;  2ZPG B;  4KUI A;  3CMA Q;  4DEY A;  4CI0 C;  2DZ9 A;  2CP0 A;  1WYX A;  2LRQ A;  1OOT A;  2OTL T;  2A36 A;  3A8O B;  4RG2 A;  1C1A A;  3RKX A;  5KE2 A;  2CP6 A;  2DA9 A;  2HKN A;  4BI8 B;  2K79 A;  3JSC A;  3HPW A;  3JCM h;  3CXC A;  4BUG A;  3HHT B;  1N8R C;  4C8Q E;  2VXE A;  2ZZD A;  1UJ0 A;  3GF5 A;  4J9E A;  4WCI A;  5IXB A;  2DTO A;  3G71 Q;  3M56 A;  4KUD K;  2VAS A;  1WJS A;  3OYL A;  2RO0 A;  4OMF B;  1YJ9 Q;  3SFM A;  5DLQ E;  1T3S A;  1RL2 A;  1GFD A;  1WXU A;  4QQG A;  1H92 A;  1WDX A;  1B3Q A;  3VS7 A;  2E70 A;  4M77 D;  1M1K U;  1D3B A;  4HVW A;  1RAE B;  4BD3 A;  1WXB A;  5GMK e;  4HVU A;  5LJ5 f;  5GAN h;  3MP1 A;  1M1K C;  2J6F A;  1M1F A;  2MI6 A;  4PLI A;  2GFU A;  1YJW A;  4YTL A;  1IXD A;  2A28 A;  1XNI A;  2DK3 A;  5LJ5 j;  3CME T;  2YLB A;  2CS7 A;  1AWJ A;  4M75 D;  1TG0 A;  1U3O A;  3VS2 A;  3CCU Q;  4B9X A;  4AT1 B;  2E64 A;  1VQ6 T;  1IO6 A;  2GBQ A;  5HKC A;  4ESR A;  5HCK A;  3A8H B;  2O31 A;  2EPD A;  3FRN A;  3OYH A;  4EIK A;  5D6X A;  1W2B A;  3EGD A;  4N4G A;  2HDA A;  1M3C A;  4BDY A;  2L89 A;  1M90 R;  2EKH A;  5FWC A;  4ZN1 A;  1WXT A;  4ME7 A;  5GAO p;  3JV3 A;  3BDU A;  3CMA T;  1KQ2 A;  1VQL Q;  1WNL A;  5LJ3 j;  1YIT Q;  1BB9 A;  1VOM A;  2D8J A;  2P4R A;  4IUP A;  4ELY C;  4C92 E;  1M2O A;  4P5N A;  1M27 C;  1QVP A;  1ZSG A;  2AKK A;  1AWX A;  2MYS A;  4BE1 A;  3VV0 A;  4M7D G;  1M2V A;  5D7U A;  3TEE A;  4M7D B;  4J6X A;  3CCE Q;  2CZ6 B;  4FM4 B;  2E6N A;  2QYZ A;  2V1R A;  2JTM A;  4LUD A;  1YJ9 T;  1NJI R;  2F2X A;  4Q5W A;  2YRC A;  1NPP A;  3EFO B;  3L2W A;  2A37 A;  2KRM A;  2YRV A;  1Q82 C;  1K9M U;  4RG8 A;  5GMK h;  1K76 A;  3QDF A;  2OTJ Q;  2JS2 A;  2RNA A;  2SEM A;  3J80 E;  2X51 A;  3JAM E;  4C5H A;  3VS4 A;  4NL3 A;  1K8A U;  1K9M C;  2K57 A;  1ZUU A;  3L1A A;  5GAN 8;  5KYU A;  4EPC A;  3SB2 A;  3CPW P;  2DD4 A;  1Z9Z A;  3CCU T;  1FMV A;  5GAM g;  3G1J A;  2AKL A;  5KH6 A;  1X6O A;  1VQO Q;  1UTI A;  3UA6 A;  3JB9 I;  4PJO G;  5KCO A;  4PJO B;  3OYJ A;  2HQE A;  1VQ9 A;  2AZS A;  1P92 A;  4C0G A;  3QXE B;  1Y96 A;  5L23 A;  3CC4 Q;  4OMQ A;  2GF7 A;  2XDD A;  2ROL A;  4M4Z A;  1I4K 1;  4OMP A;  1YIT T;  3OYF A;  5KYY B;  4O6J A;  1W4S A;  1BK2 A;  2PUK B;  1SSH A;  2SRC A;  4N0A A;  2EKO A;  2RI2 A;  4J9D A;  1QMC A;  4OB0 B;  1PRL C;  5KYW B;  1AZG B;  1B07 A;  2YUP A;  2ZPF B;  2K3Y A;  3RUX A;  1JO8 A;  4HVV A;  3CCE T;  5GAN f;  2VGM A;  1ZSZ B;  1VQ8 A;  1ZUK A;  1PNJ A;  4HA8 A;  3X25 B;  2O4X A;  4DBF A;  2BUD A;  1G5V A;  2DF6 A;  1GCP A;  2ED0 A;  1OQK A;  3H0H A;  5GAN j;  4HCC A;  4M7A G;  4A54 A;  7AT1 B;  2DZC A;  2GQV A;  2O88 A;  3QJY A;  1YWP A;  4LE9 A;  1Y0M A;  5I11 A;  2KRO A;  3PFS A;  4F7U B;  2RPN A;  1F1B B;  1RLQ C;  2X3W D;  2OTJ T;  1A0N B;  1D1C A;  2F5K A;  3THK A;  1K0X A;  2FZC B;  4OB1 B;  3CBM A;  4MMK A;  2LTO A;  3J81 E;  2CGH A;  4OMN A;  2EVR A;  1VYV A;  3CCV A;  2YRD A;  2C0I A;  3X24 B;  3INZ A;  2K9G A;  2MAM A;  2JMA A;  3OYB A;  4XTU A;  3M4G A;  5L8R E;  1VQ4 A;  2KK4 A;  3ZFJ A;  5LJ3 g;  1RAC B;  2DKG A;  3CC4 T;  1VIE A;  2DXT A;  4LDV A;  3VJP A;  3S3M A;  2HL5 C;  4QVD A;  3CXC P;  1ZQ1 A;  2EYZ A;  2CH4 W;  2FVU A;  4A4H A;  3CBP A;  1VQM Q;  2DLP A;  2ECZ A;  3RR6 A;  2RQT A;  1Q81 C;  4O5V A;  1UEC A;  2JNG A;  3HFN A;  2QG9 B;  1X6B A;  2X35 A;  1VQ5 A;  2XK0 A;  4JLI A;  2DO3 A;  1WJQ A;  1FMK A;  3OMC A;  3KXT A;  1N9S A;  3H6Z A;  1QVF A;  3FB9 A;  3NTH A;  2KBT A;  1JBM A;  2PZ1 A;  1GL5 A;  2L3Q A;  4FYX B;  3G4S A;  2PVG B;  4B6M A;  2LCS A;  2KY9 A;  3GNF B;  2MIO A;  2H8H A;  3RES A;  2QQB A;  3FEO A;  2L3R A;  1GRI A;  2ROT A;  2E6Z A;  3LW5 E;  1YI2 A;  4J9H A;  2AK5 A;  3PIP A;  1I07 A;  4XK8 E;  1PWT A;  3HRT A;  1VQK A;  1OEB A;  2KVQ G;  4J9G A;  3T9N A;  3F70 A;  1WFW A;  1BIB A;  3OYI A;  1Q86 C;  4JRI A;  3V7S A;  2L8D A;  4Y91 A;  1CKB A;  2LJ1 A;  2QDL A;  2DAQ A;  1QKW A;  2Y4Y A;  4AFQ C;  4LDY A;  3LYI A;  2DL7 A;  4UC4 A;  1QVG S;  1GCQ A;  1NG2 A;  3V8K A;  2M16 A;  2FZK B;  1PRM C;  4A4E A;  3V8L A;  2BTT A;  1JXO A;  3EG9 A;  2EW3 A;  2DYI A;  3JCM g;  4HT8 A;  1ABQ A;  5DM7 R;  5KYX A;  1NEG A;  3MKD A;  4XAX B;  4IIO A;  4FT2 A;  1OPL A;  4BE0 A;  3FC3 A;  4RCB A;  2CP3 A;  1VQM T;  4Y28 E;  4C92 G;  3RMS A;  3PT9 A;  2RHY A;  1BI3 A;  3L42 A;  2OAW A;  3ME9 A;  1WHG A;  5I2M A;  2EBP A;  2LQ8 A;  2EQJ A;  2LMJ A;  1ZA1 B;  2QGG A;  3UT1 A;  4OMO A;  5IHI A;  1WQ7 A;  3CCM A;  1QCN A;  2QK0 A;  4CC4 B;  3LGF A;  2GQI A;  1RAH B;  2JTF A;  1SKU B;  4NS5 A;  1OZ3 A;  4Z89 A;  3X28 B;  4M78 A;  3CCR Q;  4E47 A;  3CPW S;  3H41 A;  1KC8 C;  1VQ7 Q;  3SWN C;  3EFR A;  4JPB W;  1RLP C;  4Z88 A;  3KFV A;  1MMG A;  1R8O B;  1Q7Y R;  1PD1 A;  2RMO A;  1IRE B;  3EG3 A;  1B34 B;  4M7A A;  2D0N A;  3QUI A;  3REB B;  2KE9 A;  4CC7 A;  4D8D A;  3QYH B;  3HRU A;  2OJ2 A;  5GAO n;  5IXF A;  4PJO E;  2KRS A;  3CCS A;  5AYF A;  2DE0 X;  3EGX B;  1BBZ A;  4HKE A;  1VQN A;  2DRK A;  2XIC A;  1RUW A;  4PJM A;  1Y71 A;  3CCJ Q;  2V8K A;  2XD0 A;  4BAC A;  2KEA A;  2XMF A;  2DIQ A;  4PLL A;  3M0T A;  1OU8 A;  1VQP Q;  1KD1 C;  3L2U A;  1MV3 A;  3DB4 A;  2MCN A;  4L5G A;  3L2Z A;  3JB9 J;  4C0D C;  4LN2 A;  4E2F B;  4EMK B;  5GAO q;  2KAF A;  2XDB A;  5J26 A;  3JCM W;  4L6V 5;  3E1S A;  2V26 A;  5GMK l;  4AG2 C;  2R5M A;  2OTL A;  2HZY A;  3EFS A;  2AIR B;  3CC2 Q;  1U5S A;  4FCY A;  3JCM P;  1M8M A;  2JTE A;  3LH0 A;  4M78 D;  1NLO C;  2X4X A;  3MP6 A;  4C8Q A;  2EJ9 A;  4QT7 A;  1VIF A;  4F7U E;  2M9U A;  1H8K A;  4QVZ A;  2RN8 A;  4HXJ A;  1KK7 A;  4J7F A;  3RMQ A;  3GOX A;  4M77 C;  1JXM A;  1I8F A;  4C0F A;  4M7A D;  3CCR T;  2CZ0 B;  2LJ3 A;  2FRW A;  3RNJ A;  1VQ7 T;  1TU0 B;  3UPU A;  1UEB A;  4X9D A;  2QDY B;  1ZLM A;  1SRM A;  1X6G A;  1TXQ A;  5GAM f;  2RJF A;  4BY6 C;  2F5T X;  1UGP B;  4AFS C;  2FL7 A;  4HCK A;  4M75 C;  3DB3 A;  2LQK A;  3L2R A;  2PNI A;  3FJ5 A;  3CXC S;  5FRN A;  3CME A;  4J8O A;  2DD5 A;  2VVK A;  2DRM A;  1NYG A;  4RTZ A;  3MO8 A;  3CCJ T;  3JB9 G;  3VS6 A;  1M1K R;  1ZA2 B;  3HP9 A;  3CD6 Q;  4LDW A;  1VQ6 A;  3I55 Q;  1XJW B;  1VQP T;  1N8R U;  3OY9 A;  3Q1J A;  2LC4 A;  3A8G B;  1QVF P;  1MMN A;  2YWW A;  3VS1 A;  1X27 A;  2K4Y A;  5GAN 4;  1G8X A;  3CMA A;  2CH4 A;  4WTO B;  4BI4 A;  3VS0 A;  4C8Q D;  2HAX A;  4L59 A;  2K5F A;  4EDU A;  5FU7 C;  4C92 A;  3RKW A;  3SD4 A;  3CC2 T;  2ESW A;  1TUC A;  4AMC A;  2ZGW A;  3EH1 A;  1HK9 A;  2RI5 A;  4OGC A;  1AZE A;  4ORZ A;  2BIV A;  1QP2 A;  3TCJ A;  5GAO m;  3CCL Q;  5KE3 A;  3MPU B;  4LNP A;  2XI9 A;  2C0T A;  1YJ9 A;  4M77 F;  3L2V A;  2JW4 A;  4CRI A;  3FIF A;  5CK9 A;  1OX8 A;  2XID A;  1LPL A;  1VUB A;  2I0N A;  3NMZ C;  5CIU A;  2KXC A;  3MEV A;  3VYH B;  4DEX A;  4A4F A;  1JRI A;  1MNE A;  1NEB A;  2R57 A;  3X20 B;  4JRQ A;  5LJ3 f;  4BDZ A;  4ZGD B;  2QQS A;  4HCB A;  3C0C A;  1XTD A;  1ABO A;  4M75 F;  2RHU A;  3JCM c;  3VUB A;  1C6V X;  5D6W A;  3CC7 Q;  1QVG P;  3CCU A;  2P84 A;  3CD6 T;  4KRT A;  2EYQ A;  3I55 T;  1K9M R;  5CR2 A;  5HK0 A;  1AD5 A;  1OI1 A;  3E19 A;  1WIE A;  4Y92 A;  1SF9 A;  1K8A R;  2VV5 A;  2FPF A;  3S3N A;  2JMC A;  5CQX A;  3A1P A;  4IIM A;  1NLP C;  1G3S A;  4C92 D;  3G71 T;  2E4H A;  1IGU A;  2NUT B;  1PKS A;  1VQL A;  3CEY A;  3BY7 A;  4K11 A;  5IAY A;  1YIT A;  1Q82 U;  2RQW A;  4KUL A;  4F16 A;  1AHJ B;  2L3S A;  1HYO A;  1M8V A;  2DMO A;  2LDM A;  2K2V A;  1YP5 A;  2C0O A;  3OW2 A;  3HSB A;  3OYC A;  5CAI A;  1YIJ Q;  1T0H A;  3G6E Q;  3BDL A;  3E2U A;  1PCX A;  4PFP A;  3JCM b;  1BYM A;  3CCE A;  3IQL A;  3M54 A;  1OPK A;  3NTI A;  2LNH B;  1GBR A;  2GFA A;  1BI1 A;  3AT1 B;  1RI9 A;  1OUL A;  5C6S A;  3PMT A;  4A4K A;  3OYK A;  3EG0 A;  4PNO A;  5FWB A;  1K73 U;  4R55 A;  2K5L A;  2COW A;  4PJN A;  1K73 C;  2CUD A;  5IT9 E;  2OTJ A;  1T3L A;  1MMA A;  2CT3 A;  3PVL A;  3QDR B;  3GBQ A;  1YJN Q;  3JCM f;  3J7A F;  4JS5 A;  2FG0 A;  1W1F A;  4KGV B;  1WHL A;  1C0M A;  4D6W A;  1VQL T;  1NYF A;  3URG A;  3EGU A;  1G83 A;  1NPR A;  2HSE B;  4KH0 B;  1BU1 A;  2NUZ A;  3CC7 T;  1VQO A;  3JCM X;  1FXX A;  1Z9Q A;  2J05 A;  1R77 A;  4N0A C;  3QBY A;  1SEM A;  3M59 A;  1ACM B;  3CC4 A;  2ZPB B;  3OYA A;  3FLG A;  2FZG B;  4QQD A;  4FU6 A;  2FPE A;  1WX6 A;  3QYG B;  1EIF A;  3QZ9 B;  4KBM B;  2LJ0 A;  5CKF A;  4F7U G;  2QAS A;  2QEX Q;  3SWN B;  1H64 1;  2R58 A;  3BW1 A;  3M9Q A;  3N5B B;  2CZ7 B;  1YIJ T;  1YHQ Q;  2KT1 A;  3G6E T;  2GTO A;  4CC2 A;  1JU5 C;  1V76 A;  2JM8 A;  2W0Z A;  5AT1 B;  4JJN K;  1IHV A;  2NYS A;  2V8I A;  3KBG A;  4J9B A;  2D6F A;  4C5I A;  2J7I A;  4QQ6 A;  3M0R A;  2YXY A;  4E7I A;  2D8H A;  2HQX A;  3LX7 A;  4N4I A;  2CP5 A;  2EFI A;  1VQO T;  1LNX A;  3QWY A;  1QWE A;  3A8L B;  2HQH A;  2XHC A;  3PNW C;  2B8A A;  5M9O A;  1CSK A;  5IHN A;  2QTV A;  1FMW A;  5ECA A;  1YJN T;  1Q81 U;  1QVF S;  3GLX A;  1GXI E;  2DBK A;  4OB2 B;  3PE0 A;  4C0D B;  3JB9 D;  2JN0 A;  4XTZ A;  3SDZ A;  2MOX A;  2R5A A;  3C4S A;  1UGV A;  4KT0 E;  4RMO A;  2CSQ A;  1RAI B;  4XTX A;  5LJ5 d;  4E7K A;  4LDU A;  4BE2 A;  4OMM A;  3OB9 A;  4X9C A;  2GGR A;  2IPO B;  2QA4 Q;  4M7D A;  1TTH B;  1OV3 A;  1VQM A;  5GMK j;  1KIK A;  4JRP A;  3RDV A;  3QPH A;  3OBW A;  4RTX A;  1M3B A;  4M77 B;  1R0B G;  3OA6 A;  1QQJ A;  2QEX T;  2NLU A;  1KSW A;  1WQW A;  1I5L A;  3I35 A;  1YHQ T;  3NTK A;  1QKX A;  2DL3 A;  3EFO A;  2J6K A;  1Q86 U;  4J9F A;  1PD0 A;  2NUP B;  4IKF A;  2P0K A;  2LNV A;  1W2B P;  1MND A;  5GJV B;  3M55 A;  2JM9 A;  4M75 G;  4XU1 A;  3R6O A;  1UB4 A;  3VS5 A;  3LH5 A;  4M75 B;  2X4W A;  5LJ5 e;  5A0D A;  4ZTJ A;  2LQN A;  4JLG A;  2VB6 A;  3MJX A;  4DA4 A;  1HJD A;  2ABL A;  4WF2 A;  2P4T A;  3JB9 H;  1WHK A;  1X43 A;  1WLP B;  1H3Z A;  3ZEH A;  4LDX A;  3NPF A;  1GCQ C;  3OBY A;  2YUN A;  2E1H A;  3OSV A;  2ATC B;  3H9N A;  4R56 A;  1WI7 A;  4BB7 A;  4IUR A;  4PJO A;  2G3R A;  3MCA B;  3QII A;  6AT1 B;  3CCQ Q;  1IB8 A;  2A7Y A;  1TOV A;  4PJJ A;  4RTY A;  4FSX A;  4RTU A;  4FW2 A;  3HKS A;  2DM1 A;  5IN1 A;  1S72 Q;  4Z02 A;  1VA7 A;  3WVD B;  2ZPI B;  3QHS A;  3P8H A;  2CP7 A;  3VRZ A;  1RAA B;  5KYY A;  3MP8 A;  3I9Q A;  8ATC B;  2RF0 A;  2CRE A;  5FU7 B;  4M7D D;  1G3T A;  2RA2 A;  2HL3 A;  2O9V A;  3OW2 P;  2BKD N;  1D3B B;  5KYW A;  1VYU A;  2QA4 T;  2H3J A;  2ZAE A;  2VWF A;  1KC8 U;  1UHF A;  4J7I A;  2DL8 A;  2NWM A;  4E7H A;  2K5I A;  1ZSZ A;  2RJC A;  1AVZ C;  3QJ6 A;  5HY6 A;  4M78 C;  1V1C A;  2GTJ A;  1KJW A;  3SHW A;  3M0Q A;  2HBP A;  3SEM A;  2CYZ B;  2I2L A;  3QSU A;  1E6H A;  4F7U A;  3OYM A;  4M7A C;  1UJY A;  3NHN A;  1JEG A;  5I21 A;  1LVK A;  2GCX A;  1ZBJ A;  3I5R A;  2YT6 A;  2KNB B;  3EGD B;  2AZV A;  3MHX A;  3CCR A;  2DER A;  1XOV A;  1VQ7 A;  4PJO D;  1KD1 U;  3MET A;  2DVJ A;  1T0J A;  2HMA A;  2KSS A;  1TH7 A;  3M0U A;  1JJ2 A;  3CPW A;  1YFN A;  2VXF A;  5GAN d;  3CCQ T;  4DOV A;  5FU6 C;  3P8B B;  3ASK A;  3M4Y A;  2ED1 A;  3VS3 A;  1QW1 A;  1M2V B;  1KFZ A;  2ZCF B;  2DIL A;  1IHW A;  1Y57 A;  2Z0W A;  2CT4 A;  3CCJ A;  1E6G A;  3I56 Q;  1D0Z A;  1Q7Y C;  2EAY A;  4FYW B;  4DQ2 A;  2A3L A;  1VQP A;  3TRE A;  3EAE A;  2EGC A;  3RER A;  4JDS A;  1G3W A;  1DJ7 B;  2L2P A;  3GP8 A;  2EGA A;  4C8Q C;  4LD9 K;  2LT4 A;  1AWO A;  4F14 A;  2M0Y A;  2JS0 A;  2QQ9 A;  2BZX A;  1KQS A;  3S3O A;  5GAN e;  2QAZ A;  1ZHI A;  3OS5 A;  4NOY A;  5KYU B;  3PVQ A;  2LT1 A;  1N8R R;  2MF2 A;  3CC2 A;  1PHT A;  5FW9 A;  3GNG A;  3S6W A;  2CUB A;  3TSW A;  4M78 F;  2KR3 A;  3X26 B;  5DLO A;  2RK2 A;  2ENM A;  1O75 A;  2IVW A;  4OVA A;  1JB0 E;  3QKJ A;  1YCY A;  2RHZ A;  2HKQ B;  1SRL A;  4IUV A;  2RB6 A;  2RD1 A;  4GBQ A;  1FX7 A;  1RI0 A;  2X9H A;  2K3B A;  4M7A F;  4FL6 A;  4J83 A;  1Y96 B;  2E5Q A;  5A2Q E;  2JXB A;  1K0S A;  1EZZ B;  3DLM A;  2VGN A;  1D1B A;  2KYB A;  2KDS A;  1M4Z A;  1MMD A;  4RKU E;  1UHC A;  1KG1 A;  2HD0 A;  1D0X A;  1Y7X A;  2DTI A;  3HTR A;  3A98 A;  3EH2 A;  5FRM A;  1X69 A;  4KGX B;  1IGQ A;  1I0C A;  3A8M B;  4E7J A;  2DET A;  5LL6 S;  1D09 B;  1QLY A;  1EFN A;  1SHG A;  4E7S A;  2J6O A;  4HT9 A;  4QW2 A;  1EX4 A;  2HEQ A;  2EGE A;  3V8J A;  2O4X B;  3I56 T;  1TUD A;  2M51 A;  1YJW Q;  3CD6 A;  5D6Y A;  3I55 A;  1GFC A;  4C92 C;  2YLC A;  3TU4 K;  1PSE A;  2M02 A;  1SG5 A;  4M77 E;  4ZGJ B;  1UGR B;  2M0O A;  3LWI A;  5GAN 5;  2P0Q A;  1PSF A;  5J39 A;  1WGS A;  4PK4 A;  1ARK A;  1D1A A;  1W2B S;  5CQY A;  3G71 A;  4A53 A;  4B9W A;  2GNC A;  4J9C A;  1K4U S;  2DFU A;  4C8Q F;  4KH1 B;  4J9I A;  4FSS A;  1BKB A;  4M75 E;  2PVD B;  3EG2 A;  2EJF A;  1ZBX A;  1TUG B;  5CKD A;  4RTT A;  2RJD A;  1PM3 A;  1U1T A;  3JCM V;  2COZ A;  4J6W A;  4PL6 A;  5A0G A;  1BIA A;  3VUZ A;  3VRY A;  4ZN3 A;  2IIM A;  1B34 A;  3REA B;  3V7R A;  1MHN A;  3CCL A;  4FW1 A;  4D8K A;  1U1S A;  3H8Z A;  2CZ1 B;  1HXD A;  2VYT A;  4JRK A;  1OU9 A;  4A63 B;  1Q82 R;  4X34 A;  4JZ3 A;  3OSS C;  3EGX A;  4FIB A;  4XQ3 A;  5EC7 A;  4C5G A;  1QCO A;  3UWN A;  2KGT A;  3OS1 A;  2EYX A;  4BI3 A;  5I22 A;  2BZY A;  1G2B A;  1MGQ A;  1JQQ A;  3R6N A;  3M0S A;  4OF1 A;  3OW2 S;  2B86 A;  2DIG A;  2RK1 A;  1V29 B;  2P0P A;  4OP0 A;  4C0Z A;  3BFM A;  4EMK A;  3V7C A;  5A0L A;  4ELZ C;  3CC7 A;  4XTW A;  2E3H A;  3QG1 A;  1K73 R;  3UDC A;  5GAO l;  3QO3 A;  4EMK C;  5IH2 A;  1YJW T;  2AHJ B;  1TWB A;  2LX9 A;  2K7A A;  2OI3 A;  2Y90 A;  2DVE A;  4LUE A;  1X75 C;  4FYY B;  1MUZ A;  2F2W A;  1YN8 A;  4ATO A;  1M90 U;  3OYN A;  4QVC A;  2COY A;  2KMT A;  3OMG A;  3FDR A;  2F69 A;  5EG2 A;  4C92 F;  1Q95 G;  4JJC A;  1NM7 A;  3CCL T;  1M90 C;  1TS9 A;  3NGP A;  4PJL A;  1QWF A;  2RHX A;  3GPL A;  1VQ9 Q;  3MEU A;  4MML A;  4R0K A;  2DBM A;  4FYV B;  3VKI A;  2FHD A;  3U23 A;  2YDL A;  1YIJ A;  1K8A C;  3G6E A;  3MEW A; 
#chains in the Genus database with same CATH homology
 1OUL A;  1ZSZ A;  2NYS A;  1TWB A;  1ZSZ C;  2QAZ A;  1OU9 A;  1OX9 A;  1ZSZ B;  2QAS A;  1YFN A;  1OX8 A;  1OU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...