1ZSZC

Crystal structure of a computationally designed sspb heterodimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
SSPKRPYYLRGFYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNQRFKGVSRELYIPMGAALAIYARENGDGMMFEPEEIYDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
molecule keywords Stringent starvation protein B homolog
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszC00
1ZSZC 1OU9A 2NYSA 1YFNA 1OX9A 1OX8A 1OU8A 2QASA 1OULA 1ZSZA 2QAZA 1TWBA 1ZSZB
chains in the Genus database with same CATH superfamily
1VQOQ 2KNBB 1V76A 2KRSA 5GAOm 3J81E 3REBB 2VYTA 3D7SB 1KQSP 1M27C 5GAN2 2LCLA 3E9FA 1ZSZC 1W2BS 2DTHA 2VGMA 3DB3A 4M78C 1LVKA 5GAOq 3KXTA 3EGXB 3I55T 1Q7YR 1WX6A 1QP2A 1LPLA 1RLPC 1QVFP 4B9XA 3P8DA 1KHIA 2RQTA 2DXUA 1MUZA 1Q7YC 4JZ4A 2AKKA 2QI2A 2EPDA 4NL3A 3QG1A 5C6SA 4J9HA 3SDZA 5LJ5j 1IHVA 3MCAB 5GANg 2M9UA 1I4K1 2CP5A 2DXTA 4X9DA 4RMOA 4PKCC 1QP3A 4XTVA 4M4ZA 2RHYA 4OMMA 3A5ZB 2RK1A 4XTYA 3REAB 2JW4A 5I22A 2KY9A 4L59A 4KULA 3JCMV 4M7DA 4II1A 3I55A 2O9SA 2O4XA 3E19A 2RHUA 2XHCA 1G3WA 3QYHB 2PTKA 2HZYA 2KBTA 4CC3A 3RR6A 1EIFA 4O5VA 5GMKl 3LWIA 4X9CA 1PNJA 1QWFA 1RAAB 2EIFA 5LJ3d 2GNCA 4PJJA 3LGFA 1RAIB 2QA4T 2ZZDA 2DM1A 2OTLT 3S3OA 3LX7A 2EYQA 1PWTA 2KT1A 4JJBA 1IHWA 4KUDK 2HSEB 2EJGA 1JU5C 1MMAA 4R56A 1ZBXA 1WPYA 2PZ1A 3MP6A 2W0ZA 4PJLA 3FJ5A 4LUDA 1TOVA 4QW2A 5FWCA 4C8QG 2CP7A 1YJNT 3VV0A 3A8HB 1XOVA 5EC7A 3CPFA 3VS0A 3CCVT 1WZOA 2HQXA 2BTTA 1VA7A 1GCQC 1N9SA 1UJ0A 2R5MA 2OTLA 4GLMA 3HRUA 3L1AA 1TXQA 1BIBA 3BE3A 2KRMA 1MMGA 1ZQ1A 2ZGWA 5KYYA 2E10A 2I2LA 4JS5A 1Y07A 3QJYA 4HKEA 2WSEE 1VQKA 3MHXA 4PLLA 1QVFA 1YNZA 3E9GA 5A0LA 4M78A 1VQPA 2L3SA 3EFSA 4F16A 2LCSA 3CCRT 2QA4Q 1YIJA 3URGA 4R55A 1G83A 2K3YA 2D1XA 3OS5A 4ZTFA 1AZEA 4IUQA 4ZGDB 4EDUA 1KQSA 1M30A 2K2MA 1NPRA 2XICA 3QDFA 4LXCA 3RBBB 4F04B 3GBQA 3CMAA 4EMKC 2MPXC 1NJIC 3C94A 2QQSA 4QVZA 4C0FA 1AEYA 3L2RA 4J9FA 3HFOA 2DE0X 3CC7T 2K5LA 1UGPB 3VUBA 3L2QA 2D0NA 4RTXA 4BE0A 5GAMe 2DJZA 4M77A 3CBMA 2DLPA 1VQ8T 4E47A 1VQPT 4RTZA 2LX9A 4Z02A 3EG9B 4C8QC 4C8QD 3O5ZA 1ZA2B 2V1RA 1N5ZA 1PD1A 3JRZA 1U1SA 1KHCA 3UPUA 1BYMA 4M77D 2KI7A 1VQNA 3LH5A 1QVPA 4A4FA 3TU4K 5LL6S 1BBZA 4J9DA 3BFMA 1K0SA 4PFOA 1YHQT 1GBQA 4JRIA 4X34A 4F14A 1NM7A 3OY9A 5GMKj 3CXCP 4XU1A 2J7IA 2XG8D 4IURA 4F7UA 2XIDA 2P0PA 4OMQA 1G3TA 4JJCA 3JB9D 2Z0WA 2XU8A 3X26B 2YRVA 5IXBA 3GP8A 2K2VA 1X2QA 3EGDB 3EHQA 4HCKA 2D9TA 4OMPA 3CC2T 4O6JA 4LD6A 3M0RA 4M78D 4XTXA 4K11A 3A8GB 3JB9H 2A28A 2RQRA 4OP0A 5LJ5g 1H92A 4N4GA 3DLMA 2KXCA 3CCLT 5CK9A 2QXFA 4M7AF 3L2ZA 2CSIA 1YFNA 3MO8A 2LTOA 4A4EA 3JSCA 2OTJT 3FIFA 2D0QB 3SWNA 2J6FA 2LT4A 3PIPA 3BDUA 3P8BB 4D6WA 1YITT 3SWNC 1RAHB 4BE2A 2DBMA 3M5AA 2HAXA 4GBQA 1VQ7Q 2RO0A 4F7UE 3META 2HKNA 1QVGA 5FLXE 2KE9A 3SFMA 4E7ZA 4PJMA 1GL5A 2GGRA 2JMAA 2LNHB 4RTTA 1VQ7T 1VQ4A 1X43A 2VASA 4JDSA 2CDTA 1VQKQ 4FIBA 2OTJA 1D3BB 2ESWA 5HCKA 4E7SA 4N0AC 1VQ9Q 2H8HA 4BACA 2E5KA 2FPEA 1JEGA 4JJNK 3H0IA 4PFPA 2SRCA 3JCMe 2BZYA 2QEXA 3VS1A 2EYXA 5IXFA 4EPCA 1Y0MA 2WSCE 3PVLA 3OS1A 3CCMA 4M7DG 2X35A 1D0XA 5GAMh 1WJRA 3JCMQ 1QKWA 3C4SA 4IIOA 1D1CA 2CGHA 1FX7A 2RMOA 4BY6B 1ZSGA 4M77C 2QG9B 3CCUA 2RHZA 3V7RA 5I2SA 4PJOA 2CZ0B 3NTIA 1WFWA 2XDDA 1TG0A 3CMAQ 4B6MA 3CCQT 2DRMA 2XKOC 3E1SA 3OYJA 2K7AA 2RA2A 4IUVA 3EG3A 4PK4A 4BI8B 4PJOB 2P4RA 3H6ZA 1M4ZA 4M7AC 2X4YA 1K8AR 4KGVB 4LUEA 1NEBA 2DTIA 3ZFJA 3HRTA 4PL6A 3JCMg 1WXBA 1MHNA 1ACMB 2E4HA 3MPUB 1VYVA 1R8OB 2LDMA 4J9CA 1XTDA 3KUFA 5GJWB 1YWOA 2DD4A 2NUPA 3MEUA 2DERA 3A1PA 1BKBA 2ROLA 1M3BA 2DK3A 2X4WA 2JN0A 2GBQA 4RTVA 1NLOC 2MCNA 1SPKA 2DYBA 5GAOn 1VQMT 2VGNA 1VIEA 5LJ3e 3M9QA 4HVUA 2ZPEB 1H641 3FB9A 3I35A 3CCEA 1SRMA 3G7ZA 1OYXA 4N4HA 2EVRA 2HL3A 4Y91A 2HEQA 3OSSC 4LE9A 4J8OA 3VS4A 4PNOA 3WVDB 1YJ9A 2CREA 4E7IA 1Y7XA 1YBYA 2VV5A 5IHNA 2F2VA 5CO7A 2DX1A 4N0AA 3U23A 4OMFB 1RAGB 4QKUA 1FXXA 2RNAA 4DBRA 3QXEB 3A8OB 3I9QA 3CPWA 2EQKA 1WHMA 2JNGA 2BE9B 4J6WA 3CCVQ 1F1BB 1E6GA 5CKHA 4OB3B 1KC8R 3OYBA 3FDRA 4XU0A 5LJ3g 2OAWA 1PG5B 3CBPA 2O2OA 5GAMf 3CC4Q 1VQNQ 3VS6A 5FU7B 3JCMf 4A4GA 1UECA 2HD0A 3KFVA 1D3BA 2YDLA 4JS4A 2CP0A 3RKXA 1B3QA 2YUPA 3OYMA 5GANj 5FU7C 4C8QF 1VQ4T 4M7DC 3PMTA 4OVAA 2DFUA 8AT1B 2DD5A 5HKCA 4C92F 2C0TA 5AYFA 2JZ2A 2HNIA 2EYYA 4A4HA 1YJ9Q 4RTYA 1KQSS 4AFQC 1VQ6Q 3QIIA 1QKXA 2BKDN 3DB4A 5GAOl 2CH4W 5CCAA 3Q1JA 1QCOA 3R6NA 3SWNB 1BI1A 1V29B 1Q95G 2LQWA 4BI4A 4M7AG 4JRPA 1YHQQ 4UC4A 4GLKA 2P84A 1RAEB 3TQ7P 3UF4A 1M3AA 4J6XA 4FSSA 1M1KC 4RTWA 3OYGA 3OB9A 5D6WA 3NMZC 5FW9A 3G1JA 2PNIA 5J39A 1KD1R 2LRQA 3TSWA 2FRWA 5CKEA 1YI2Q 3CXCS 1UB4A 4CRIA 1Q81C 1VQ4Q 3LGLA 3A8MB 4J83A 2P0KA 3BW1A 4M78F 5KYNA 2JS2A 3GPLA 5HY6A 4A54A 4F7UG 1X6BA 3J80E 4M7AD 4F7UB 1BIAA 3TCJA 4AMCA 1G3YA 2GFAA 2A36A 4KUIA 1P92A 1U5SA 4C92E 4V2SA 3CCSQ 2DRKA 3G4SA 2GTOA 1M8MA 3NPFA 3M58A 5GMKm 2IPOB 1Q7YU 1LNXA 1X69A 2AHJB 1BI0A 3OYAA 3H41A 2NYSA 4C92G 2YT6A 1HSQA 5GAN6 5LJ3h 3M0TA 3LLRA 5IH2A 2ZPGB 5KCHA 3VRYA 3MP1A 2DTOA 4M7DF 2V1QA 1PM3A 1M8VA 4HCBA 2A37A 4M7AB 3QO3A 1K73U 2YUQA 2FRYA 2QK0A 1B34B 2DA9A 4C5GA 3OW2S 4OB1B 5CQYA 1AVZC 2K5IA 1AT1B 1O9SA 1ZUUA 1IREB 1A0NB 1JRIA 1MV0B 2XD0A 1I81A 1SHGA 5CAIA 1U06A 1UHFA 4M78G 3CCLQ 1KJWA 4AFZC 4J5YA 4KH1B 4Z89A 1RI9A 3EHRA 2KEAA 5I21A 1Q82R 4OB0B 3OW2A 2Y4YA 5IHKA 2FPDA 4A63B 5DLOA 3GLXA 2QEXT 4FM4B 4EIKA 3OYHA 3OA6A 2EWNA 1VYTA 1I0CA 3TREA 1X6OA 2RQUA 4NOYA 2EKOA 4MZPA 3I56Q 2LQNA 3JAME 5A0GA 5GMKe 4HVWA 1Y71A 2XI9A 5J3BA 2JM9A 1VQ8A 3CCST 1R0BG 1ZSZB 2LZ6B 4MDWA 3JCMP 1PRLC 4FU6A 1M90C 4L6V5 1M3CA 3QYGB 2RH2A 3SB2A 1WYXA 3EFOA 4ZN3A 4LDVA 1ARKA 2J05A 5KCOA 2PVOB 1OULA 2X3XD 2MOXA 2OTLQ 2KDSA 2K5FA 1VQLT 3CCUQ 2DVEA 2PU9B 2DYIA 4AG1C 4P5NA 2LJ0A 1X2KA 5HK3A 1K76A 2CT3A 2GF7A 3OYNA 1S72A 2MMPA 5KE2A 1KG1A 2LT1A 3R6OA 2A08A 4A4KA 4FT2A 2YWWA 1OZ2A 3EAEA 1PKTA 4XTZA 1IGQA 3OW2P 3S3NA 5FU6B 1WXUA 5CR2A 1LJOA 1GFDA 3M0PA 3HTRA 2M51A 2RHXA 2P0QA 1V1CA 1M90R 3C12A 1LOJA 4ELYC 1BI3A 3OYIA 4FYVB 3QZ5B 4M75B 3JB9I 4ZTJA 2E41A 1OU9A 1OU8A 2KYMA 2YSQA 3FC3A 2O01E 1M2OA 3CCLA 1YJWT 4J7IA 1YCSB 1SRLA 5GAMd 3EFRA 2YRCA 4Y28E 4FYYB 3ER0A 2CP3A 2K6DA 2COYA 3OYFA 1QWEA 2ABLA 1JQQA 3EH2A 3EGUA 3UATA 4ANJA 1JXMA 3OYCA 3CD6T 1OPLA 1VQNT 4BDZA 4RKUE 4E2FB 2QASA 2L8DA 2HQHA 3OMCA 1BI2A 1QMCA 2DAQA 1SHFA 4MZTA 2MAMA 3OBYA 2M0YA 5GAN8 2COZA 4D8DA 1NYFA 4IUUA 2RI3A 2CP2A 2QQRA 3OYLA 2RHIA 4FW2A 2DEUA 1Q81U 1R77A 1N9RA 2QQAA 3X24B 3BY7A 5LJ5h 3CCMT 2DKGA 2M16A 2VXFA 2CUDA 1WIEA 3CCEQ 2O88A 4JRKA 4KH0B 8ATCB 4BD3A 5KYWA 1WHKA 2LJ3A 3CCQA 1PD0A 4C92A 1WHGA 5GAN3 2QTXA 1VQOA 1VQ5T 3SD4A 3EGDA 2OI3A 1K8AU 2B8AA 3CCJT 4M7AA 2GQVA 1Y96B 3PIOA 4M75G 3MEAA 1AHJB 1SKUB 2L3PA 4M75C 4EMKA 1O75A 4Z88A 1HJDA 5LJ5e 3CCVA 1MNDA 3X25B 3CEYA 2NUZA 3T9NA 2ZAEA 1CSKA 1YCYA 3OS2A 3VYHB 1R0CB 1ABOA 1Y96A 1WI7A 2F2WA 2OJ2A 5EG2A 2JXBA 3PVQA 2P4TA 2E12A 4QQDA 1M2VA 2NUTB 1G5VA 2K3BA 3VKIA 1VQ8Q 2EJ9A 5ECAA 4LDUA 2IG0A 2IIMA 1OV3A 1NG2A 1VQ5A 2G3RA 1TUGB 3M0QA 2BE7D 2E6NA 2C06A 1U3OA 3GNGA 4OGEA 1UTIA 1J3TA 4E7HA 2DEQA 1W2BA 4AFSC 3QSUA 5GAN7 2AZSA 5L23A 2DIQA 1TTHB 5A0DA 4QQGA 2EBPA 1FMKA 4M7AE 5I11A 2QDLA 1Q82C 2GQIA 1M1KU 4RTUA 2LMJA 3CCUT 2L2PA 5GAN4 1FYNA 2AZVA 2E70A 4VUBA 4J9GA 5GANe 2JS0A 2PVGB 2A3LA 4PJOF 7AT1B 3RMQA 2HQEA 1OX8A 3GNFB 5GAMj 2FEIA 2ZPBB 3HP9A 1VQ9T 4E7LA 4BB7A 2R5AA 2ED0A 4M78B 2VWFA 2DXCA 3L2WA 1M5Q1 2MF2A 1K9MR 3QWYA 1QCNA 4LDWA 4MMLA 3L2VA 1K9MC 1B7TA 2FZKB 5KYWB 1S72Q 1Y57A 1OPKA 2KVQG 4M75D 3HSBA 1OQKA 2LJ1A 2FZCB 2WSFE 5D7UA 5KH6A 1YJWA 3A98A 3V7SA 4C92D 2KRNA 2QGGA 1BB9A 2OTJQ 1I5LA 1JBMA 1C1AA 4DBQA 1IO6A 4J7FA 3G6ET 1HYOA 2D8HA 5KYXA 2MWPA 3MP8A 1Q86C 2VVKA 2ZPHB 4E7JA 1Q81R 4CC7A 4LNPA 3CC7A 3LWHA 2RI5A 4XU3A 4DBHA 2RJCA 2R58A 3HL8A 1VYUA 4KRTA 3V8LA 3CC2Q 3RIRA 4B9WA 4PJOE 3IQLA 3QZ9B 1X6GA 3FRNA 3CMEQ 1EX4A 2L89A 3CCRA 2DL5A 3PNWC 1MMDA 3O8VA 3VRZA 3ZL7C 3WVEB 5LJ5f 3JCMd 1VQ7A 2K57A 3M0UA 3ZEHA 1H3HA 2QGFB 3FEOA 2XK0A 2F5TX 4FW1A 1D09B 2JTEA 3G6EA 1YJWQ 2KR3A 3EG1A 4AG2C 2CT4A 4M7DB 1IXDA 1PRMC 1WXTA 2QDYB 1UUEA 2O31A 4JUVA 2C0OA 3INZA 1H8KA 1KC8U 5DM7R 3EH1A 4LD9K 4M77G 4N4IA 4M77B 3G71T 1GBRA 1I07A 1YP5A 4LDXA 4NS5A 1RL2A 3CCJA 4MDXA 4BDYA 5KYUA 3JB9G 2SEMA 2KROA 3QPHA 3I5SA 1W6XA 4C0DB 5GAOr 1QVGP 2BIVA 1NJIU 2D6FA 1WHLA 3HPWA 2EYZA 9ATCB 1G2BA 1UJYA 4PJNA 4HCCA 1RACB 3RDVA 1FMWA 4M7DD 4FL6A 1NPPA 4BI3A 3HRSA 3CC2A 2M0OA 2W10A 2K9GA 3LW5E 1VQ5Q 3CPWS 2CSQA 1W70A 2KK4A 1W1FA 2QQ9A 3NTHA 1TUDA 2EQJA 4F17A 4D8KA 4MMKA 3GIBA 2M02A 3CMET 3ME9A 1ZSZA 2HSPA 4OMOA 1VQ6T 1T3LA 3ZBDA 2KSSA 1WNLA 5GANf 1S1NA 3CC4T 1OOTA 1KQ2A 3OS0A 1UGQB 2OX7A 4JZ3A 1YWPA 4C92C 3VJPA 2DILA 3I56T 3H9NA 2EW3A 5FRMA 4HA8A 1GCPA 1WHHA 1OI1A 2QEXQ 3CBOA 2EJFA 3NHNA 3PFSA 1IRXA 1TUCA 2DL7A 2KQWA 4F7UF 4DEYA 1QW1A 1CKAA 5DY9A 3CCMQ 4C8QB 2LQKA 1OX9A 3NTKA 2CH4A 3PT9A 4M75A 4JRQA 3MKDA 2RQWA 1WA7A 1NE8A 1KD1U 4DA4A 3VYGA 4HT8A 2YXYA 3CMEA 2AK5A 2B86A 1ZHIA 3VS2A 4OF1A 1YJNQ 2NUPB 2HBPA 2PQWA 3C95A 3CCET 1WGSA 1D1BA 1SSFA 4A53A 1YI2A 2OAUA 2CKKA 3ULRB 4EMKB 1NZ9A 2R57A 4M78E 1WDXA 1SSHA 1JJ2P 1SEMA 3CD6Q 4C5HA 3JCMh 4JPBW 3JV3A 3M57A 2AIRB 4ELZC 3DLLA 4L5GA 2MYSA 1ZBJA 2CYZB 1EFNA 3M4YA 3C0CA 3QBYA 2XDBA 3QHSA 2XDPA 3SHWA 3VUZA 2RK2A 1WQWA 4J9EA 4C92B 2KT8A 4QVCA 1UDLA 1T3SA 2JTFA 2E64A 4KBMB 1UE9A 2DL8A 1N27A 4NL2A 2X4JA 2V8IA 1NBEB 1FWZA 4OGCA 2A0FB 4LN2A 3RKYA 2CZ6B 4EMHA 2DL3A 3X20B 1K9MU 1G3SA 1B07A 1YI2T 2EGCA 1PC0A 2E3IA 4ZGEB 3GOXA 3I5RA 3VS3A 3H8ZA 4J6YA 4C5IA 3OSVA 1YIJT 4C0DC 1N8RU 4HVVA 2AT1B 2HCKA 4QQ6A 2FB7A 2KGTA 4AFUC 3FLGA 5DLQE 4IUPA 2L0AA 4RCBA 3KBGA 3CD6A 1JXOA 2G6FX 3NFCA 5GAOp 4KT0E 3M56A 1K0XA 4C0ZA 2YUNA 2JOYA 5KYYB 3CC7Q 4DOWA 1ZX6A 4EMGA 2YHTA 4E6RA 3TEEA 2ENMA 1UGVA 1QLYA 1UGRB 2WACA 2DIGA 2A7YA 3AHUA 2F5KA 2RD1A 1RAFB 2CP6A 3JCMJ 1AWJA 1WJSA 1YJ9T 3GF5A 5GAN5 4BE1A 1C0MA 2K79A 5KE3A 2DZCA 1Z9ZA 2LP5A 3WXMB 1KSWA 3PGGA 1AWWA 4WF2A 1XQHA 2FO0A 1U1TA 2COWA 1RUWA 4Y92A 4FCYA 4R0KA 2YLCA 5IT9E 1HK9A 1UHCA 4YTLA 4J9BA 1QQJA 3HFNA 2EQMA 5LJ3j 2IVWA 1VUBA 4PFZA 1PCXA 1D0YA 2JM8A 2JMCA 3J7AF 4Q5WA 1X75C 5CKBA 5I2MA 3JCMb 4TVRA 4BY6C 5KYUB 1T0HA 1TU0B 2F2XA 3QKJA 2ROTA 2HBWA 4C8QA 1VQOT 2RI2A 1MMNA 3E2UA 1VQ6A 4CC2A 2DZ9A 4FT4A 3UWNA 1IZ6A 2DO3A 1VOMA 2RPNA 2J06A 1SG5A 2QA4A 1S72T 2ZPFB 2HMAA 1ZA1B 2HKQB 1M2VB 2NUTA 3RERA 2X3WD 2GFUA 4BUGA 4MZMA 2DL4A 4PLIA 1ZUYA 4E7KA 3SEMA 1GRIA 2JUFA 1PSEA 3JCMc 4IUTA 4CI0C 2RJFA 2L3QA 4ATOA 2K4YA 1GFCA 1UEBA 3M0SA 1K1ZA 2PUKB 1KIKA 3RMSA 1PSFA 2O4XB 4ZN1A 4DOVA 1I5OB 1EZZB 1JJ2A 4QT7A 1M1FA 1D0ZA 3V7CA 4HT9A 2LX7A 4C8QE 1VQMQ 3VU3C 1G8XA 1MNEA 5AT1B 4GY5A 1N6AA 1W2BP 2D8JA 1XJWB 3THKA 4KGZB 2BZ8A 2KYBA 3HKSA 2GTJA 3MEWA 3P8HA 4M75E 1QVFS 5GANd 1RLQC 3CCSA 2E5QA 1QCFA 3MJXA 1M9SA 1NYGA 4PJOG 1DJ7B 2DPPB 2FG0A 1GCQA 1WQ7A 3OMGA 1XNIA 2H3JA 4HCZA 2EGAA 2JVVA 2F69A 1KC8C 2MIOA 2VXEA 4OMNA 4PJOD 3A8LB 3CXCA 5FU6C 4C5EA 2K3XA 1FMVA 2ECZA 2M1HA 3M59A 2VKNA 3CC4A 2PUOB 4FSXA 4FYWB 2ZCFB 2J6OA 1K8AC 1BCOA 2LQ8A 2EQIA 1JB0E 1M1GA 3EG9A 3TSZA 1RABB 3G71Q 1VQ9A 2DJQA 1WJQA 5HK0A 4M75F 1K9AA 3RUXA 3X28B 1K4US 2JJ9A 3CCJQ 4JLIA 3EFOB 5GMKi 3UDCA 2LVMA 3UA7A 2L5QA 1IGUA 3OYDA 1YHQA 2EYWA 1M1KR 4AT1B 5GANh 2E65A 1RADB 2ED1A 2RM4A 1QVGS 4ZGJB 1D1AA 5D6XA 1ABQA 1H3ZA 3RNJA 5CVIA 4XQ3A 4DBFA 3G4ST 3VS7A 5C0MA 5A2QE 1K73R 4J9IA 4KGXB 2RB6A 4OB2B 2NLUA 2RJDA 2FL7A 3JB9J 2LCCA 1BK2A 3CCRQ 2L3RA 3JCMW 2YRDA 3JB9F 5CIUA 1AD5A 1JO8A 3OBWA 3BDLA 1U8RA 4DEXA 1Q86R 3NGPA 2DXBA 3QJ6A 2E3HA 1N8RR 2GCXA 2O9VA 1Q82U 6AT1B 2CS7A 3UT1A 3G4SQ 5FRNA 2EGEA 1OZ3A 3CQTA 4RG8A 2FPFA 5GJVB 1MGQA 2DBKA 5L8RE 2VUBA 2I0NA 4X1VA 5FROA 3ASKA 2YUOA 3RKWA 3V8KA 2CUBA 2JTMA 5IAYA 1UGSB 1YITA 2VC8A 4CC4B 1HD3A 3H0HA 4M77E 2H3EB 3OYKA 2J6KA 4IIMA 1W4SA 4XTUA 1C6VX 5KYXB 4XTWA 2BZXA 3UA6A 2X51A 3EGXA 2FZGB 4IKFA 5D6YA 3HHTB 3DKMA 2QQBA 1LCKA 2RN8A 1E6HA 2NWMA 4PJOC 1KD1C 2Y90A 3CPWP 4ORZA 3CMAT 3S6WA 1GXIE 2V8KA 3M53A 4ZNXA 1TH7A 3PMIA 1B34A 4XAXB 2F1LA 5LJ5d 1CKBA 5J26A 2DETA 1ZUKA 1HXDA 5FWBA 4WTOB 4OMLA 1WLPB 1YN8A 2KMTA 4Z8AA 1SF9A 4JJDA 2DNUA 1ZLMA 3I56A 3OQ5A 5GMKh 4HXJA 3F70A 3TVTA 3OYEA 3M54A 1NJIR 1BCMA 1OEBA 1AOJA 3EG2A 3VS5A 2DMOA 4RCCA 1Z9QA 1KQ1A 2HDAA 1KFZA 2MI6A 4JLGA 1TWBA 3PE0A 2DVJA 2MWOA 1VQPQ 1I8FA 3LYIA 3M4GA 1YIJQ 2FVUA 1VIFA 2ATCB 2X9HA 2LC4A 1MV3A 1NEGA 3PTAA 1AWOA 2QAZA 4M77F 1TS9A 2LNVA 4QVDA 4ESRA 3AT1B 3CCQQ 2XMFA 3I55Q 3L2UA 2VB6A 2JT4A 2RF0A 5LJ3f 1YJNA 5IHIA 1VQLQ 2CZ1B 2V26A 5IN1A 1UFFA 3JCMX 2RJEA 5GAMg 2X4XA 4C0GA 2MK5A 1I1JA 1BU1A 3G6EQ 2HL5C 2Y4XA 2PVDB 1VQKT 1N8RC 2ZPIB 4WCIA 1JJ2S 2DF6A 3MEVA 3QWXX 2EFIA 1IB8A 2AKLA 1VQMA 1PKSA 5CKFA 2C0IA 4RG2A 2E1HA 1TSFA 4DQ2A 2BUDA 2EKHA 2RQVA 3H0FA 4ME7A 1RI0A 2KXDA 1KK7A 2YLBA 1X01A 3N5BB 5CKDA 5M9OA 3S3MA 2FHDA 4XK8E 4XU2A 2FYKA 1E7OA 4LDYA 1K73C 3RESA 2CZ7B 1YITQ 1X27A 2V8JA 2QTVA 2KAFA 3M55A 3OYYA 4FYXB 2EAYA 1M90U 4RUGA 3V8JA 1VQLA 1PHTA 1WHJA 3G71A 1AWXA 2E6ZA 5CQXA 2EQUA 3QUIA 1T0JA 3LH0A 4M7DE 1UG1A 1AZGB 3EG0A 2QYZA 3L42A 1Q86U 3QDRB 1NLPC 3FJPA
chains in the Genus database with same CATH topology
1ZSZC 1OU9A 2NYSA 1YFNA 1OX9A 1OX8A 1OU8A 2QASA 1OULA 1ZSZA 2QAZA 1TWBA 1ZSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSZ C;  1OU9 A;  2NYS A;  1YFN A;  1OX9 A;  1OX8 A;  1OU8 A;  2QAS A;  1OUL A;  1ZSZ A;  2QAZ A;  1TWB A;  1ZSZ B; 
#chains in the Genus database with same CATH topology
 1VQO Q;  2KNB B;  1V76 A;  2KRS A;  5GAO m;  3J81 E;  3REB B;  2VYT A;  3D7S B;  1KQS P;  1M27 C;  5GAN 2;  2LCL A;  3E9F A;  1ZSZ C;  1W2B S;  2DTH A;  2VGM A;  3DB3 A;  4M78 C;  1LVK A;  5GAO q;  3KXT A;  3EGX B;  3I55 T;  1Q7Y R;  1WX6 A;  1QP2 A;  1LPL A;  1RLP C;  1QVF P;  4B9X A;  3P8D A;  1KHI A;  2RQT A;  2DXU A;  1MUZ A;  1Q7Y C;  4JZ4 A;  2AKK A;  2QI2 A;  2EPD A;  4NL3 A;  3QG1 A;  5C6S A;  4J9H A;  3SDZ A;  5LJ5 j;  1IHV A;  3MCA B;  5GAN g;  2M9U A;  1I4K 1;  2CP5 A;  2DXT A;  4X9D A;  4RMO A;  4PKC C;  1QP3 A;  4XTV A;  4M4Z A;  2RHY A;  4OMM A;  3A5Z B;  2RK1 A;  4XTY A;  3REA B;  2JW4 A;  5I22 A;  2KY9 A;  4L59 A;  4KUL A;  3JCM V;  4M7D A;  4II1 A;  3I55 A;  2O9S A;  2O4X A;  3E19 A;  2RHU A;  2XHC A;  1G3W A;  3QYH B;  2PTK A;  2HZY A;  2KBT A;  4CC3 A;  3RR6 A;  1EIF A;  4O5V A;  5GMK l;  3LWI A;  4X9C A;  1PNJ A;  1QWF A;  1RAA B;  2EIF A;  5LJ3 d;  2GNC A;  4PJJ A;  3LGF A;  1RAI B;  2QA4 T;  2ZZD A;  2DM1 A;  2OTL T;  3S3O A;  3LX7 A;  2EYQ A;  1PWT A;  2KT1 A;  4JJB A;  1IHW A;  4KUD K;  2HSE B;  2EJG A;  1JU5 C;  1MMA A;  4R56 A;  1ZBX A;  1WPY A;  2PZ1 A;  3MP6 A;  2W0Z A;  4PJL A;  3FJ5 A;  4LUD A;  1TOV A;  4QW2 A;  5FWC A;  4C8Q G;  2CP7 A;  1YJN T;  3VV0 A;  3A8H B;  1XOV A;  5EC7 A;  3CPF A;  3VS0 A;  3CCV T;  1WZO A;  2HQX A;  2BTT A;  1VA7 A;  1GCQ C;  1N9S A;  1UJ0 A;  2R5M A;  2OTL A;  4GLM A;  3HRU A;  3L1A A;  1TXQ A;  1BIB A;  3BE3 A;  2KRM A;  1MMG A;  1ZQ1 A;  2ZGW A;  5KYY A;  2E10 A;  2I2L A;  4JS5 A;  1Y07 A;  3QJY A;  4HKE A;  2WSE E;  1VQK A;  3MHX A;  4PLL A;  1QVF A;  1YNZ A;  3E9G A;  5A0L A;  4M78 A;  1VQP A;  2L3S A;  3EFS A;  4F16 A;  2LCS A;  3CCR T;  2QA4 Q;  1YIJ A;  3URG A;  4R55 A;  1G83 A;  2K3Y A;  2D1X A;  3OS5 A;  4ZTF A;  1AZE A;  4IUQ A;  4ZGD B;  4EDU A;  1KQS A;  1M30 A;  2K2M A;  1NPR A;  2XIC A;  3QDF A;  4LXC A;  3RBB B;  4F04 B;  3GBQ A;  3CMA A;  4EMK C;  2MPX C;  1NJI C;  3C94 A;  2QQS A;  4QVZ A;  4C0F A;  1AEY A;  3L2R A;  4J9F A;  3HFO A;  2DE0 X;  3CC7 T;  2K5L A;  1UGP B;  3VUB A;  3L2Q A;  2D0N A;  4RTX A;  4BE0 A;  5GAM e;  2DJZ A;  4M77 A;  3CBM A;  2DLP A;  1VQ8 T;  4E47 A;  1VQP T;  4RTZ A;  2LX9 A;  4Z02 A;  3EG9 B;  4C8Q C;  4C8Q D;  3O5Z A;  1ZA2 B;  2V1R A;  1N5Z A;  1PD1 A;  3JRZ A;  1U1S A;  1KHC A;  3UPU A;  1BYM A;  4M77 D;  2KI7 A;  1VQN A;  3LH5 A;  1QVP A;  4A4F A;  3TU4 K;  5LL6 S;  1BBZ A;  4J9D A;  3BFM A;  1K0S A;  4PFO A;  1YHQ T;  1GBQ A;  4JRI A;  4X34 A;  4F14 A;  1NM7 A;  3OY9 A;  5GMK j;  3CXC P;  4XU1 A;  2J7I A;  2XG8 D;  4IUR A;  4F7U A;  2XID A;  2P0P A;  4OMQ A;  1G3T A;  4JJC A;  3JB9 D;  2Z0W A;  2XU8 A;  3X26 B;  2YRV A;  5IXB A;  3GP8 A;  2K2V A;  1X2Q A;  3EGD B;  3EHQ A;  4HCK A;  2D9T A;  4OMP A;  3CC2 T;  4O6J A;  4LD6 A;  3M0R A;  4M78 D;  4XTX A;  4K11 A;  3A8G B;  3JB9 H;  2A28 A;  2RQR A;  4OP0 A;  5LJ5 g;  1H92 A;  4N4G A;  3DLM A;  2KXC A;  3CCL T;  5CK9 A;  2QXF A;  4M7A F;  3L2Z A;  2CSI A;  1YFN A;  3MO8 A;  2LTO A;  4A4E A;  3JSC A;  2OTJ T;  3FIF A;  2D0Q B;  3SWN A;  2J6F A;  2LT4 A;  3PIP A;  3BDU A;  3P8B B;  4D6W A;  1YIT T;  3SWN C;  1RAH B;  4BE2 A;  2DBM A;  3M5A A;  2HAX A;  4GBQ A;  1VQ7 Q;  2RO0 A;  4F7U E;  3MET A;  2HKN A;  1QVG A;  5FLX E;  2KE9 A;  3SFM A;  4E7Z A;  4PJM A;  1GL5 A;  2GGR A;  2JMA A;  2LNH B;  4RTT A;  1VQ7 T;  1VQ4 A;  1X43 A;  2VAS A;  4JDS A;  2CDT A;  1VQK Q;  4FIB A;  2OTJ A;  1D3B B;  2ESW A;  5HCK A;  4E7S A;  4N0A C;  1VQ9 Q;  2H8H A;  4BAC A;  2E5K A;  2FPE A;  1JEG A;  4JJN K;  3H0I A;  4PFP A;  2SRC A;  3JCM e;  2BZY A;  2QEX A;  3VS1 A;  2EYX A;  5IXF A;  4EPC A;  1Y0M A;  2WSC E;  3PVL A;  3OS1 A;  3CCM A;  4M7D G;  2X35 A;  1D0X A;  5GAM h;  1WJR A;  3JCM Q;  1QKW A;  3C4S A;  4IIO A;  1D1C A;  2CGH A;  1FX7 A;  2RMO A;  4BY6 B;  1ZSG A;  4M77 C;  2QG9 B;  3CCU A;  2RHZ A;  3V7R A;  5I2S A;  4PJO A;  2CZ0 B;  3NTI A;  1WFW A;  2XDD A;  1TG0 A;  3CMA Q;  4B6M A;  3CCQ T;  2DRM A;  2XKO C;  3E1S A;  3OYJ A;  2K7A A;  2RA2 A;  4IUV A;  3EG3 A;  4PK4 A;  4BI8 B;  4PJO B;  2P4R A;  3H6Z A;  1M4Z A;  4M7A C;  2X4Y A;  1K8A R;  4KGV B;  4LUE A;  1NEB A;  2DTI A;  3ZFJ A;  3HRT A;  4PL6 A;  3JCM g;  1WXB A;  1MHN A;  1ACM B;  2E4H A;  3MPU B;  1VYV A;  1R8O B;  2LDM A;  4J9C A;  1XTD A;  3KUF A;  5GJW B;  1YWO A;  2DD4 A;  2NUP A;  3MEU A;  2DER A;  3A1P A;  1BKB A;  2ROL A;  1M3B A;  2DK3 A;  2X4W A;  2JN0 A;  2GBQ A;  4RTV A;  1NLO C;  2MCN A;  1SPK A;  2DYB A;  5GAO n;  1VQM T;  2VGN A;  1VIE A;  5LJ3 e;  3M9Q A;  4HVU A;  2ZPE B;  1H64 1;  3FB9 A;  3I35 A;  3CCE A;  1SRM A;  3G7Z A;  1OYX A;  4N4H A;  2EVR A;  2HL3 A;  4Y91 A;  2HEQ A;  3OSS C;  4LE9 A;  4J8O A;  3VS4 A;  4PNO A;  3WVD B;  1YJ9 A;  2CRE A;  4E7I A;  1Y7X A;  1YBY A;  2VV5 A;  5IHN A;  2F2V A;  5CO7 A;  2DX1 A;  4N0A A;  3U23 A;  4OMF B;  1RAG B;  4QKU A;  1FXX A;  2RNA A;  4DBR A;  3QXE B;  3A8O B;  3I9Q A;  3CPW A;  2EQK A;  1WHM A;  2JNG A;  2BE9 B;  4J6W A;  3CCV Q;  1F1B B;  1E6G A;  5CKH A;  4OB3 B;  1KC8 R;  3OYB A;  3FDR A;  4XU0 A;  5LJ3 g;  2OAW A;  1PG5 B;  3CBP A;  2O2O A;  5GAM f;  3CC4 Q;  1VQN Q;  3VS6 A;  5FU7 B;  3JCM f;  4A4G A;  1UEC A;  2HD0 A;  3KFV A;  1D3B A;  2YDL A;  4JS4 A;  2CP0 A;  3RKX A;  1B3Q A;  2YUP A;  3OYM A;  5GAN j;  5FU7 C;  4C8Q F;  1VQ4 T;  4M7D C;  3PMT A;  4OVA A;  2DFU A;  8AT1 B;  2DD5 A;  5HKC A;  4C92 F;  2C0T A;  5AYF A;  2JZ2 A;  2HNI A;  2EYY A;  4A4H A;  1YJ9 Q;  4RTY A;  1KQS S;  4AFQ C;  1VQ6 Q;  3QII A;  1QKX A;  2BKD N;  3DB4 A;  5GAO l;  2CH4 W;  5CCA A;  3Q1J A;  1QCO A;  3R6N A;  3SWN B;  1BI1 A;  1V29 B;  1Q95 G;  2LQW A;  4BI4 A;  4M7A G;  4JRP A;  1YHQ Q;  4UC4 A;  4GLK A;  2P84 A;  1RAE B;  3TQ7 P;  3UF4 A;  1M3A A;  4J6X A;  4FSS A;  1M1K C;  4RTW A;  3OYG A;  3OB9 A;  5D6W A;  3NMZ C;  5FW9 A;  3G1J A;  2PNI A;  5J39 A;  1KD1 R;  2LRQ A;  3TSW A;  2FRW A;  5CKE A;  1YI2 Q;  3CXC S;  1UB4 A;  4CRI A;  1Q81 C;  1VQ4 Q;  3LGL A;  3A8M B;  4J83 A;  2P0K A;  3BW1 A;  4M78 F;  5KYN A;  2JS2 A;  3GPL A;  5HY6 A;  4A54 A;  4F7U G;  1X6B A;  3J80 E;  4M7A D;  4F7U B;  1BIA A;  3TCJ A;  4AMC A;  1G3Y A;  2GFA A;  2A36 A;  4KUI A;  1P92 A;  1U5S A;  4C92 E;  4V2S A;  3CCS Q;  2DRK A;  3G4S A;  2GTO A;  1M8M A;  3NPF A;  3M58 A;  5GMK m;  2IPO B;  1Q7Y U;  1LNX A;  1X69 A;  2AHJ B;  1BI0 A;  3OYA A;  3H41 A;  2NYS A;  4C92 G;  2YT6 A;  1HSQ A;  5GAN 6;  5LJ3 h;  3M0T A;  3LLR A;  5IH2 A;  2ZPG B;  5KCH A;  3VRY A;  3MP1 A;  2DTO A;  4M7D F;  2V1Q A;  1PM3 A;  1M8V A;  4HCB A;  2A37 A;  4M7A B;  3QO3 A;  1K73 U;  2YUQ A;  2FRY A;  2QK0 A;  1B34 B;  2DA9 A;  4C5G A;  3OW2 S;  4OB1 B;  5CQY A;  1AVZ C;  2K5I A;  1AT1 B;  1O9S A;  1ZUU A;  1IRE B;  1A0N B;  1JRI A;  1MV0 B;  2XD0 A;  1I81 A;  1SHG A;  5CAI A;  1U06 A;  1UHF A;  4M78 G;  3CCL Q;  1KJW A;  4AFZ C;  4J5Y A;  4KH1 B;  4Z89 A;  1RI9 A;  3EHR A;  2KEA A;  5I21 A;  1Q82 R;  4OB0 B;  3OW2 A;  2Y4Y A;  5IHK A;  2FPD A;  4A63 B;  5DLO A;  3GLX A;  2QEX T;  4FM4 B;  4EIK A;  3OYH A;  3OA6 A;  2EWN A;  1VYT A;  1I0C A;  3TRE A;  1X6O A;  2RQU A;  4NOY A;  2EKO A;  4MZP A;  3I56 Q;  2LQN A;  3JAM E;  5A0G A;  5GMK e;  4HVW A;  1Y71 A;  2XI9 A;  5J3B A;  2JM9 A;  1VQ8 A;  3CCS T;  1R0B G;  1ZSZ B;  2LZ6 B;  4MDW A;  3JCM P;  1PRL C;  4FU6 A;  1M90 C;  4L6V 5;  1M3C A;  3QYG B;  2RH2 A;  3SB2 A;  1WYX A;  3EFO A;  4ZN3 A;  4LDV A;  1ARK A;  2J05 A;  5KCO A;  2PVO B;  1OUL A;  2X3X D;  2MOX A;  2OTL Q;  2KDS A;  2K5F A;  1VQL T;  3CCU Q;  2DVE A;  2PU9 B;  2DYI A;  4AG1 C;  4P5N A;  2LJ0 A;  1X2K A;  5HK3 A;  1K76 A;  2CT3 A;  2GF7 A;  3OYN A;  1S72 A;  2MMP A;  5KE2 A;  1KG1 A;  2LT1 A;  3R6O A;  2A08 A;  4A4K A;  4FT2 A;  2YWW A;  1OZ2 A;  3EAE A;  1PKT A;  4XTZ A;  1IGQ A;  3OW2 P;  3S3N A;  5FU6 B;  1WXU A;  5CR2 A;  1LJO A;  1GFD A;  3M0P A;  3HTR A;  2M51 A;  2RHX A;  2P0Q A;  1V1C A;  1M90 R;  3C12 A;  1LOJ A;  4ELY C;  1BI3 A;  3OYI A;  4FYV B;  3QZ5 B;  4M75 B;  3JB9 I;  4ZTJ A;  2E41 A;  1OU9 A;  1OU8 A;  2KYM A;  2YSQ A;  3FC3 A;  2O01 E;  1M2O A;  3CCL A;  1YJW T;  4J7I A;  1YCS B;  1SRL A;  5GAM d;  3EFR A;  2YRC A;  4Y28 E;  4FYY B;  3ER0 A;  2CP3 A;  2K6D A;  2COY A;  3OYF A;  1QWE A;  2ABL A;  1JQQ A;  3EH2 A;  3EGU A;  3UAT A;  4ANJ A;  1JXM A;  3OYC A;  3CD6 T;  1OPL A;  1VQN T;  4BDZ A;  4RKU E;  4E2F B;  2QAS A;  2L8D A;  2HQH A;  3OMC A;  1BI2 A;  1QMC A;  2DAQ A;  1SHF A;  4MZT A;  2MAM A;  3OBY A;  2M0Y A;  5GAN 8;  2COZ A;  4D8D A;  1NYF A;  4IUU A;  2RI3 A;  2CP2 A;  2QQR A;  3OYL A;  2RHI A;  4FW2 A;  2DEU A;  1Q81 U;  1R77 A;  1N9R A;  2QQA A;  3X24 B;  3BY7 A;  5LJ5 h;  3CCM T;  2DKG A;  2M16 A;  2VXF A;  2CUD A;  1WIE A;  3CCE Q;  2O88 A;  4JRK A;  4KH0 B;  8ATC B;  4BD3 A;  5KYW A;  1WHK A;  2LJ3 A;  3CCQ A;  1PD0 A;  4C92 A;  1WHG A;  5GAN 3;  2QTX A;  1VQO A;  1VQ5 T;  3SD4 A;  3EGD A;  2OI3 A;  1K8A U;  2B8A A;  3CCJ T;  4M7A A;  2GQV A;  1Y96 B;  3PIO A;  4M75 G;  3MEA A;  1AHJ B;  1SKU B;  2L3P A;  4M75 C;  4EMK A;  1O75 A;  4Z88 A;  1HJD A;  5LJ5 e;  3CCV A;  1MND A;  3X25 B;  3CEY A;  2NUZ A;  3T9N A;  2ZAE A;  1CSK A;  1YCY A;  3OS2 A;  3VYH B;  1R0C B;  1ABO A;  1Y96 A;  1WI7 A;  2F2W A;  2OJ2 A;  5EG2 A;  2JXB A;  3PVQ A;  2P4T A;  2E12 A;  4QQD A;  1M2V A;  2NUT B;  1G5V A;  2K3B A;  3VKI A;  1VQ8 Q;  2EJ9 A;  5ECA A;  4LDU A;  2IG0 A;  2IIM A;  1OV3 A;  1NG2 A;  1VQ5 A;  2G3R A;  1TUG B;  3M0Q A;  2BE7 D;  2E6N A;  2C06 A;  1U3O A;  3GNG A;  4OGE A;  1UTI A;  1J3T A;  4E7H A;  2DEQ A;  1W2B A;  4AFS C;  3QSU A;  5GAN 7;  2AZS A;  5L23 A;  2DIQ A;  1TTH B;  5A0D A;  4QQG A;  2EBP A;  1FMK A;  4M7A E;  5I11 A;  2QDL A;  1Q82 C;  2GQI A;  1M1K U;  4RTU A;  2LMJ A;  3CCU T;  2L2P A;  5GAN 4;  1FYN A;  2AZV A;  2E70 A;  4VUB A;  4J9G A;  5GAN e;  2JS0 A;  2PVG B;  2A3L A;  4PJO F;  7AT1 B;  3RMQ A;  2HQE A;  1OX8 A;  3GNF B;  5GAM j;  2FEI A;  2ZPB B;  3HP9 A;  1VQ9 T;  4E7L A;  4BB7 A;  2R5A A;  2ED0 A;  4M78 B;  2VWF A;  2DXC A;  3L2W A;  1M5Q 1;  2MF2 A;  1K9M R;  3QWY A;  1QCN A;  4LDW A;  4MML A;  3L2V A;  1K9M C;  1B7T A;  2FZK B;  5KYW B;  1S72 Q;  1Y57 A;  1OPK A;  2KVQ G;  4M75 D;  3HSB A;  1OQK A;  2LJ1 A;  2FZC B;  2WSF E;  5D7U A;  5KH6 A;  1YJW A;  3A98 A;  3V7S A;  4C92 D;  2KRN A;  2QGG A;  1BB9 A;  2OTJ Q;  1I5L A;  1JBM A;  1C1A A;  4DBQ A;  1IO6 A;  4J7F A;  3G6E T;  1HYO A;  2D8H A;  5KYX A;  2MWP A;  3MP8 A;  1Q86 C;  2VVK A;  2ZPH B;  4E7J A;  1Q81 R;  4CC7 A;  4LNP A;  3CC7 A;  3LWH A;  2RI5 A;  4XU3 A;  4DBH A;  2RJC A;  2R58 A;  3HL8 A;  1VYU A;  4KRT A;  3V8L A;  3CC2 Q;  3RIR A;  4B9W A;  4PJO E;  3IQL A;  3QZ9 B;  1X6G A;  3FRN A;  3CME Q;  1EX4 A;  2L89 A;  3CCR A;  2DL5 A;  3PNW C;  1MMD A;  3O8V A;  3VRZ A;  3ZL7 C;  3WVE B;  5LJ5 f;  3JCM d;  1VQ7 A;  2K57 A;  3M0U A;  3ZEH A;  1H3H A;  2QGF B;  3FEO A;  2XK0 A;  2F5T X;  4FW1 A;  1D09 B;  2JTE A;  3G6E A;  1YJW Q;  2KR3 A;  3EG1 A;  4AG2 C;  2CT4 A;  4M7D B;  1IXD A;  1PRM C;  1WXT A;  2QDY B;  1UUE A;  2O31 A;  4JUV A;  2C0O A;  3INZ A;  1H8K A;  1KC8 U;  5DM7 R;  3EH1 A;  4LD9 K;  4M77 G;  4N4I A;  4M77 B;  3G71 T;  1GBR A;  1I07 A;  1YP5 A;  4LDX A;  4NS5 A;  1RL2 A;  3CCJ A;  4MDX A;  4BDY A;  5KYU A;  3JB9 G;  2SEM A;  2KRO A;  3QPH A;  3I5S A;  1W6X A;  4C0D B;  5GAO r;  1QVG P;  2BIV A;  1NJI U;  2D6F A;  1WHL A;  3HPW A;  2EYZ A;  9ATC B;  1G2B A;  1UJY A;  4PJN A;  4HCC A;  1RAC B;  3RDV A;  1FMW A;  4M7D D;  4FL6 A;  1NPP A;  4BI3 A;  3HRS A;  3CC2 A;  2M0O A;  2W10 A;  2K9G A;  3LW5 E;  1VQ5 Q;  3CPW S;  2CSQ A;  1W70 A;  2KK4 A;  1W1F A;  2QQ9 A;  3NTH A;  1TUD A;  2EQJ A;  4F17 A;  4D8K A;  4MMK A;  3GIB A;  2M02 A;  3CME T;  3ME9 A;  1ZSZ A;  2HSP A;  4OMO A;  1VQ6 T;  1T3L A;  3ZBD A;  2KSS A;  1WNL A;  5GAN f;  1S1N A;  3CC4 T;  1OOT A;  1KQ2 A;  3OS0 A;  1UGQ B;  2OX7 A;  4JZ3 A;  1YWP A;  4C92 C;  3VJP A;  2DIL A;  3I56 T;  3H9N A;  2EW3 A;  5FRM A;  4HA8 A;  1GCP A;  1WHH A;  1OI1 A;  2QEX Q;  3CBO A;  2EJF A;  3NHN A;  3PFS A;  1IRX A;  1TUC A;  2DL7 A;  2KQW A;  4F7U F;  4DEY A;  1QW1 A;  1CKA A;  5DY9 A;  3CCM Q;  4C8Q B;  2LQK A;  1OX9 A;  3NTK A;  2CH4 A;  3PT9 A;  4M75 A;  4JRQ A;  3MKD A;  2RQW A;  1WA7 A;  1NE8 A;  1KD1 U;  4DA4 A;  3VYG A;  4HT8 A;  2YXY A;  3CME A;  2AK5 A;  2B86 A;  1ZHI A;  3VS2 A;  4OF1 A;  1YJN Q;  2NUP B;  2HBP A;  2PQW A;  3C95 A;  3CCE T;  1WGS A;  1D1B A;  1SSF A;  4A53 A;  1YI2 A;  2OAU A;  2CKK A;  3ULR B;  4EMK B;  1NZ9 A;  2R57 A;  4M78 E;  1WDX A;  1SSH A;  1JJ2 P;  1SEM A;  3CD6 Q;  4C5H A;  3JCM h;  4JPB W;  3JV3 A;  3M57 A;  2AIR B;  4ELZ C;  3DLL A;  4L5G A;  2MYS A;  1ZBJ A;  2CYZ B;  1EFN A;  3M4Y A;  3C0C A;  3QBY A;  2XDB A;  3QHS A;  2XDP A;  3SHW A;  3VUZ A;  2RK2 A;  1WQW A;  4J9E A;  4C92 B;  2KT8 A;  4QVC A;  1UDL A;  1T3S A;  2JTF A;  2E64 A;  4KBM B;  1UE9 A;  2DL8 A;  1N27 A;  4NL2 A;  2X4J A;  2V8I A;  1NBE B;  1FWZ A;  4OGC A;  2A0F B;  4LN2 A;  3RKY A;  2CZ6 B;  4EMH A;  2DL3 A;  3X20 B;  1K9M U;  1G3S A;  1B07 A;  1YI2 T;  2EGC A;  1PC0 A;  2E3I A;  4ZGE B;  3GOX A;  3I5R A;  3VS3 A;  3H8Z A;  4J6Y A;  4C5I A;  3OSV A;  1YIJ T;  4C0D C;  1N8R U;  4HVV A;  2AT1 B;  2HCK A;  4QQ6 A;  2FB7 A;  2KGT A;  4AFU C;  3FLG A;  5DLQ E;  4IUP A;  2L0A A;  4RCB A;  3KBG A;  3CD6 A;  1JXO A;  2G6F X;  3NFC A;  5GAO p;  4KT0 E;  3M56 A;  1K0X A;  4C0Z A;  2YUN A;  2JOY A;  5KYY B;  3CC7 Q;  4DOW A;  1ZX6 A;  4EMG A;  2YHT A;  4E6R A;  3TEE A;  2ENM A;  1UGV A;  1QLY A;  1UGR B;  2WAC A;  2DIG A;  2A7Y A;  3AHU A;  2F5K A;  2RD1 A;  1RAF B;  2CP6 A;  3JCM J;  1AWJ A;  1WJS A;  1YJ9 T;  3GF5 A;  5GAN 5;  4BE1 A;  1C0M A;  2K79 A;  5KE3 A;  2DZC A;  1Z9Z A;  2LP5 A;  3WXM B;  1KSW A;  3PGG A;  1AWW A;  4WF2 A;  1XQH A;  2FO0 A;  1U1T A;  2COW A;  1RUW A;  4Y92 A;  4FCY A;  4R0K A;  2YLC A;  5IT9 E;  1HK9 A;  1UHC A;  4YTL A;  4J9B A;  1QQJ A;  3HFN A;  2EQM A;  5LJ3 j;  2IVW A;  1VUB A;  4PFZ A;  1PCX A;  1D0Y A;  2JM8 A;  2JMC A;  3J7A F;  4Q5W A;  1X75 C;  5CKB A;  5I2M A;  3JCM b;  4TVR A;  4BY6 C;  5KYU B;  1T0H A;  1TU0 B;  2F2X A;  3QKJ A;  2ROT A;  2HBW A;  4C8Q A;  1VQO T;  2RI2 A;  1MMN A;  3E2U A;  1VQ6 A;  4CC2 A;  2DZ9 A;  4FT4 A;  3UWN A;  1IZ6 A;  2DO3 A;  1VOM A;  2RPN A;  2J06 A;  1SG5 A;  2QA4 A;  1S72 T;  2ZPF B;  2HMA A;  1ZA1 B;  2HKQ B;  1M2V B;  2NUT A;  3RER A;  2X3W D;  2GFU A;  4BUG A;  4MZM A;  2DL4 A;  4PLI A;  1ZUY A;  4E7K A;  3SEM A;  1GRI A;  2JUF A;  1PSE A;  3JCM c;  4IUT A;  4CI0 C;  2RJF A;  2L3Q A;  4ATO A;  2K4Y A;  1GFC A;  1UEB A;  3M0S A;  1K1Z A;  2PUK B;  1KIK A;  3RMS A;  1PSF A;  2O4X B;  4ZN1 A;  4DOV A;  1I5O B;  1EZZ B;  1JJ2 A;  4QT7 A;  1M1F A;  1D0Z A;  3V7C A;  4HT9 A;  2LX7 A;  4C8Q E;  1VQM Q;  3VU3 C;  1G8X A;  1MNE A;  5AT1 B;  4GY5 A;  1N6A A;  1W2B P;  2D8J A;  1XJW B;  3THK A;  4KGZ B;  2BZ8 A;  2KYB A;  3HKS A;  2GTJ A;  3MEW A;  3P8H A;  4M75 E;  1QVF S;  5GAN d;  1RLQ C;  3CCS A;  2E5Q A;  1QCF A;  3MJX A;  1M9S A;  1NYG A;  4PJO G;  1DJ7 B;  2DPP B;  2FG0 A;  1GCQ A;  1WQ7 A;  3OMG A;  1XNI A;  2H3J A;  4HCZ A;  2EGA A;  2JVV A;  2F69 A;  1KC8 C;  2MIO A;  2VXE A;  4OMN A;  4PJO D;  3A8L B;  3CXC A;  5FU6 C;  4C5E A;  2K3X A;  1FMV A;  2ECZ A;  2M1H A;  3M59 A;  2VKN A;  3CC4 A;  2PUO B;  4FSX A;  4FYW B;  2ZCF B;  2J6O A;  1K8A C;  1BCO A;  2LQ8 A;  2EQI A;  1JB0 E;  1M1G A;  3EG9 A;  3TSZ A;  1RAB B;  3G71 Q;  1VQ9 A;  2DJQ A;  1WJQ A;  5HK0 A;  4M75 F;  1K9A A;  3RUX A;  3X28 B;  1K4U S;  2JJ9 A;  3CCJ Q;  4JLI A;  3EFO B;  5GMK i;  3UDC A;  2LVM A;  3UA7 A;  2L5Q A;  1IGU A;  3OYD A;  1YHQ A;  2EYW A;  1M1K R;  4AT1 B;  5GAN h;  2E65 A;  1RAD B;  2ED1 A;  2RM4 A;  1QVG S;  4ZGJ B;  1D1A A;  5D6X A;  1ABQ A;  1H3Z A;  3RNJ A;  5CVI A;  4XQ3 A;  4DBF A;  3G4S T;  3VS7 A;  5C0M A;  5A2Q E;  1K73 R;  4J9I A;  4KGX B;  2RB6 A;  4OB2 B;  2NLU A;  2RJD A;  2FL7 A;  3JB9 J;  2LCC A;  1BK2 A;  3CCR Q;  2L3R A;  3JCM W;  2YRD A;  3JB9 F;  5CIU A;  1AD5 A;  1JO8 A;  3OBW A;  3BDL A;  1U8R A;  4DEX A;  1Q86 R;  3NGP A;  2DXB A;  3QJ6 A;  2E3H A;  1N8R R;  2GCX A;  2O9V A;  1Q82 U;  6AT1 B;  2CS7 A;  3UT1 A;  3G4S Q;  5FRN A;  2EGE A;  1OZ3 A;  3CQT A;  4RG8 A;  2FPF A;  5GJV B;  1MGQ A;  2DBK A;  5L8R E;  2VUB A;  2I0N A;  4X1V A;  5FRO A;  3ASK A;  2YUO A;  3RKW A;  3V8K A;  2CUB A;  2JTM A;  5IAY A;  1UGS B;  1YIT A;  2VC8 A;  4CC4 B;  1HD3 A;  3H0H A;  4M77 E;  2H3E B;  3OYK A;  2J6K A;  4IIM A;  1W4S A;  4XTU A;  1C6V X;  5KYX B;  4XTW A;  2BZX A;  3UA6 A;  2X51 A;  3EGX A;  2FZG B;  4IKF A;  5D6Y A;  3HHT B;  3DKM A;  2QQB A;  1LCK A;  2RN8 A;  1E6H A;  2NWM A;  4PJO C;  1KD1 C;  2Y90 A;  3CPW P;  4ORZ A;  3CMA T;  3S6W A;  1GXI E;  2V8K A;  3M53 A;  4ZNX A;  1TH7 A;  3PMI A;  1B34 A;  4XAX B;  2F1L A;  5LJ5 d;  1CKB A;  5J26 A;  2DET A;  1ZUK A;  1HXD A;  5FWB A;  4WTO B;  4OML A;  1WLP B;  1YN8 A;  2KMT A;  4Z8A A;  1SF9 A;  4JJD A;  2DNU A;  1ZLM A;  3I56 A;  3OQ5 A;  5GMK h;  4HXJ A;  3F70 A;  3TVT A;  3OYE A;  3M54 A;  1NJI R;  1BCM A;  1OEB A;  1AOJ A;  3EG2 A;  3VS5 A;  2DMO A;  4RCC A;  1Z9Q A;  1KQ1 A;  2HDA A;  1KFZ A;  2MI6 A;  4JLG A;  1TWB A;  3PE0 A;  2DVJ A;  2MWO A;  1VQP Q;  1I8F A;  3LYI A;  3M4G A;  1YIJ Q;  2FVU A;  1VIF A;  2ATC B;  2X9H A;  2LC4 A;  1MV3 A;  1NEG A;  3PTA A;  1AWO A;  2QAZ A;  4M77 F;  1TS9 A;  2LNV A;  4QVD A;  4ESR A;  3AT1 B;  3CCQ Q;  2XMF A;  3I55 Q;  3L2U A;  2VB6 A;  2JT4 A;  2RF0 A;  5LJ3 f;  1YJN A;  5IHI A;  1VQL Q;  2CZ1 B;  2V26 A;  5IN1 A;  1UFF A;  3JCM X;  2RJE A;  5GAM g;  2X4X A;  4C0G A;  2MK5 A;  1I1J A;  1BU1 A;  3G6E Q;  2HL5 C;  2Y4X A;  2PVD B;  1VQK T;  1N8R C;  2ZPI B;  4WCI A;  1JJ2 S;  2DF6 A;  3MEV A;  3QWX X;  2EFI A;  1IB8 A;  2AKL A;  1VQM A;  1PKS A;  5CKF A;  2C0I A;  4RG2 A;  2E1H A;  1TSF A;  4DQ2 A;  2BUD A;  2EKH A;  2RQV A;  3H0F A;  4ME7 A;  1RI0 A;  2KXD A;  1KK7 A;  2YLB A;  1X01 A;  3N5B B;  5CKD A;  5M9O A;  3S3M A;  2FHD A;  4XK8 E;  4XU2 A;  2FYK A;  1E7O A;  4LDY A;  1K73 C;  3RES A;  2CZ7 B;  1YIT Q;  1X27 A;  2V8J A;  2QTV A;  2KAF A;  3M55 A;  3OYY A;  4FYX B;  2EAY A;  1M90 U;  4RUG A;  3V8J A;  1VQL A;  1PHT A;  1WHJ A;  3G71 A;  1AWX A;  2E6Z A;  5CQX A;  2EQU A;  3QUI A;  1T0J A;  3LH0 A;  4M7D E;  1UG1 A;  1AZG B;  3EG0 A;  2QYZ A;  3L42 A;  1Q86 U;  3QDR B;  1NLP C;  3FJP A; 
#chains in the Genus database with same CATH homology
 1ZSZ C;  1OU9 A;  2NYS A;  1YFN A;  1OX9 A;  1OX8 A;  1OU8 A;  2QAS A;  1OUL A;  1ZSZ A;  2QAZ A;  1TWB A;  1ZSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...