1ZSZC

Crystal structure of a computationally designed sspb heterodimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
SSPKRPYYLRGFYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNQRFKGVSRELYIPMGAALAIYARENGDGMMFEPEEIYDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszC00
1OX8A 2QAZA 2NYSA 1TWBA 2QASA 1OX9A 1ZSZA 1OU9A 1OU8A 1YFNA 1ZSZC 1OULA 1ZSZB
chains in the Genus database with same CATH superfamily
1O75A 3SFMA 1Y96B 1G3YA 1M2VA 2H8HA 3VUBA 4AFQC 1K9MC 3SEMA 4A4FA 2FG0A 3G6EQ 3OW2P 3RKYA 1WLPB 1KQSA 2DIGA 2XI9A 1WPYA 4GBQA 2XDDA 4KULA 2HL5C 2DL3A 3AHUA 2DKGA 2P4TA 2CT3A 4ME7A 1QVGP 1AWWA 3INZA 2LTOA 4RTZA 1VQ9T 1NEBA 3L2WA 1D1AA 2HL3A 3M0SA 1M1KC 4PJOA 1JO8A 1VQ4Q 4M7DE 2MMPA 1G3SA 3OYEA 3OYLA 4M7AC 1IRXA 2H3JA 2M1HA 4XU0A 3H0IA 1PM3A 2EJGA 2COWA 1VQPQ 5GAN3 1WDXA 3J81E 1JB0E 2DO3A 4LUEA 1VYVA 1UGQB 1U06A 4RCBA 1NJIC 5M9OA 4LDWA 4FYXB 4RG2A 4C8QE 3QBYA 4FL6A 2V8KA 2RF0A 1Z9QA 2AKLA 2VC8A 3ULRB 4RTUA 2KAFA 3X28B 2VYTA 1OQKA 1Y07A 1VQLA 1Y0MA 1M3AA 3CXCP 4OMLA 2QQBA 2EQMA 3JAME 4XU2A 2EYZA 1OPLA 3M0QA 1Q81R 1PSEA 1NM7A 4LXCA 1JXOA 4FYWB 4J83A 2EYYA 3JB9D 3DB3A 2DILA 2GF7A 3QYGB 1H8KA 3PTAA 2EYWA 3V8KA 3HFOA 1OV3A 1TG0A 4C92F 4PJOE 2K3BA 1YP5A 2IVWA 2E65A 1GFCA 4PJJA 4NOYA 3PGGA 1F1BB 1OX9A 2XICA 5GAN2 1BYMA 3JRZA 3CCUQ 1NPPA 3RMQA 1W2BP 1VQ8T 1QWFA 1Q82R 1MV3A 1N8RC 1M90U 3G4ST 3KUFA 3VS5A 5KCOA 4CRIA 1RUWA 2GQVA 2R57A 2NUTA 3VS0A 1D0XA 2EFIA 3CCLQ 2L5QA 4E7HA 1Z9ZA 1QW1A 2K6DA 2YRVA 3V7CA 4XTXA 2DEQA 3G1JA 3M58A 5GAOm 2FPDA 3OW2S 4PJMA 2LX7A 2JM9A 1UE9A 3CCSQ 2NUPB 2F2WA 5GAOn 4OGEA 1QCNA 1RLPC 2OAWA 4XU3A 4ZTJA 2DZ9A 4E47A 3PVLA 3A8LB 1BU1A 3CC2T 3MO8A 1M1GA 2CYZB 1RAHB 2HDAA 1HJDA 2DVEA 1QVGS 4C92C 5AYFA 2MIOA 1BI0A 2P0PA 1U5SA 1RL2A 4EPCA 4PKCC 3HKSA 5DLQE 4M7AA 4DOWA 5LL6S 4M75F 2L2PA 3VRZA 2V26A 1GCQC 2OTLT 4LDUA 2HNIA 4AFSC 3EH1A 1Q95G 1PG5B 2RQVA 2HBPA 1BKBA 2RI3A 3HSBA 3NGPA 3FIFA 1LOJA 3EG9B 2QGFB 5C6SA 2QTXA 6AT1B 3QKJA 4PFPA 5GAOr 1FMKA 1YCYA 2FYKA 3CXCS 2RI2A 3OSVA 3CC7A 1FXXA 4Z88A 2DMOA 3GF5A 1N9SA 1LNXA 2SRCA 4J8OA 1Q7YU 4OMOA 3QYHB 1X75C 5GAN7 2X4WA 2EPDA 2VASA 2XHCA 4DBHA 2ESWA 1KG1A 2BZYA 2BE7D 3OS0A 4M7AE 1V1CA 4N4GA 2COZA 1UDLA 3VKIA 2MI6A 4M75C 3SHWA 5D7UA 3JCMW 4ANJA 3JCMJ 3JB9H 1W2BS 1Q86R 2PU9B 1K9MU 2M02A 2RN8A 4J5YA 5I22A 1WA7A 1ZLMA 5LJ3g 2QGGA 1MNEA 5AT1B 5CKDA 2BTTA 4A4GA 2EYQA 3NMZC 1MNDA 1QVPA 2EW3A 4RTXA 4NL2A 3A1PA 3GLXA 3OYNA 4PJNA 2DBKA 2FZCB 1LJOA 1H3HA 2X3WD 1Q81C 2ZPBB 2DBMA 1HSQA 1PSFA 1M1KU 3HPWA 1M5Q1 3VUZA 3H41A 1D0YA 4IKFA 3A8OB 4ORZA 1E6HA 2AIRB 5FU6B 3OYHA 1NJIU 2KE9A 1I0CA 3OYGA 2ED1A 4C92A 3CCEA 4IIOA 3I5RA 1SEMA 2QK0A 3GOXA 1WXTA 1IHWA 2HSPA 1K76A 3GNGA 2E12A 2JN0A 1M3BA 5FWCA 2CZ1B 1Q82C 1NPRA 2W0ZA 4O6JA 3EG1A 1UGVA 4OVAA 3OYFA 5IAYA 4M78F 1S72Q 1VQOA 3FB9A 5GAMg 2O4XA 5C0MA 9ATCB 1VQNA 1X6GA 1AZEA 1R0CB 2D9TA 2RJDA 4ELYC 3EGXA 5GAN8 2F1LA 3OS2A 1OX8A 2KNBB 4D8KA 3I5SA 2R5MA 5IHIA 4BY6C 1M30A 3CC7Q 1BCOA 1XQHA 2E5KA 3LH0A 1YJNA 8ATCB 5CVIA 1B34A 3SWNC 1VYUA 2E3HA 2VGNA 3I55T 4DEXA 5GANg 3JCMg 1VQ5Q 1WZOA 3OYMA 4N4HA 1D09B 4JS5A 1VQ7A 4RG8A 4C92E 1JQQA 2P4RA 3M54A 3I56A 1UJYA 1YHQA 1YIJT 3HTRA 1CKBA 4M75A 1Y57A 4OMQA 3REAB 4J9HA 4M78C 3EH2A 2LNVA 3MP8A 1RABB 4M78D 4CC7A 3S3OA 2CKKA 3V8LA 2D1XA 2J6OA 1QVFA 4OMFB 5LJ3f 5L8RE 2KXDA 1W4SA 3JCMQ 2KXCA 3J80E 3N5BB 2WACA 5FW9A 2VWFA 2L3RA 3R6OA 4OMMA 3EFOA 1JJ2A 2BKDN 2XIDA 2J06A 1NLOC 3QO3A 4RKUE 4AT1B 1ZSZB 3CPWA 3CCEQ 3SDZA 4FT4A 4A4EA 4OGCA 3H8ZA 1O9SA 2DPPB 1E7OA 3VS7A 3CCMT 2RHZA 3QPHA 4M75E 4OB2B 3A8MB 1Q86C 3D7SB 3G7ZA 4F04B 2YT6A 2J05A 2FO0A 5LJ3j 1TXQA 2DEUA 1VQOQ 3L42A 4N0AC 3MEAA 4J9IA 1VQNQ 2HQXA 2RJEA 3CCVA 1KQSP 2KRSA 4JRQA 3PNWC 4C8QB 4GY5A 5FU7B 3M0RA 5GAMf 1NZ9A 3CMAA 4JRKA 3UDCA 2KT8A 3L2QA 1YWOA 1M2VB 4L6V5 4D6WA 4E7ZA 1YJNQ 2YUPA 2Y4XA 2AHJB 1UG1A 2KGTA 4EIKA 5EG2A 1BBZA 3SWNA 4QQDA 4J6XA 5CKBA 2HD0A 2ZCFB 1IB8A 2DJQA 3MJXA 4QVZA 1J3TA 4PNOA 5FWBA 1M9SA 4PL6A 3HRSA 4X34A 1AWXA 2ECZA 3CCQQ 1VQ7Q 3GNFB 3CPFA 2RQUA 2LT4A 2VV5A 1U1TA 4BI8B 4MZMA 3CD6T 3I56Q 1YHQQ 3PT9A 4M77F 2HMAA 4LE9A 4PJOB 5D6XA 2CUBA 1AT1B 2LQNA 3C4SA 4KUDK 2JNGA 3LWHA 5GAMj 4XTYA 2ZAEA 4M78A 4RTVA 4MZPA 1Q81U 2GGRA 2RO0A 3CMET 1YJ9A 1TWBA 2ROLA 1PRLC 7AT1B 2K5IA 1WHKA 1UFFA 2DM1A 2DXUA 5CAIA 1K1ZA 3MP1A 4F16A 5GANj 5KYXA 2KT1A 2YRCA 1C0MA 1VQMT 1SRLA 4C0GA 2A08A 1E6GA 2JS2A 4FYYB 2KMTA 3HFNA 3I9QA 1GRIA 2DRKA 1M3CA 1BIAA 4V2SA 1IGUA 4M77C 1FYNA 1QLYA 2RPNA 3NTKA 2JOYA 2F5TX 4M77D 3X26B 2RK1A 3JCMV 4M78E 2B8AA 2RA2A 4N0AA 1MHNA 2KRNA 4RTTA 3A5ZB 1KQSS 1GCPA 2DA9A 2L3SA 4C5HA 4JUVA 2ED0A 2CZ0B 1KC8C 1VYTA 2CS7A 1UGRB 2DIQA 1EFNA 4BDYA 1WJRA 2BZ8A 2JJ9A 3CC4T 1A0NB 2GFUA 1WHGA 4F7UF 2CDTA 2EKOA 1UTIA 5LJ5j 1PCXA 3JB9F 5HK0A 3EHQA 3L2UA 5GJWB 3CCSA 2LT1A 3THKA 3DB4A 2IG0A 5KE3A 1W1FA 3BFMA 2LQWA 1SHGA 3UT1A 2JS0A 2ZZDA 1GBRA 1YN8A 1D0ZA 5DY9A 1JU5C 2DTHA 3OB9A 3QWYA 3M9QA 1UGPB 4BACA 1B07A 3AT1B 1VQ6A 3OYIA 1VQKT 3X24B 2DXCA 1BIBA 3QWXX 3QJYA 1HXDA 1K73C 2AT1B 2ZPGB 2LVMA 2P0KA 1YJ9Q 4HCZA 2X4JA 4R55A 3FLGA 2MWOA 2CGHA 1X2QA 5CKFA 4IURA 1VQ8A 2DK3A 4OB0B 1PNJA 3RUXA 2V8JA 3G4SA 2M0YA 2CSQA 2JUFA 4EMHA 2ZPEB 5I2MA 2RH2A 1JXMA 1ZSGA 1VIFA 2HQEA 1YI2A 3KXTA 2HEQA 4RUGA 1NYFA 1WYXA 2K5LA 5KYYB 3JSCA 2K2MA 1VOMA 5A0LA 3OMGA 2DXBA 2HZYA 2OJ2A 4M77A 4AG1C 2KR3A 1WNLA 2W10A 2EVRA 2RQRA 4VUBA 1WHLA 4KT0E 3CC2A 5KYUA 1K0SA 3JCMP 1VQ9Q 4BDZA 2MK5A 4MDXA 1G5VA 3L2ZA 1AVZC 1GL5A 4HVVA 4Y92A 4J9EA 5GMKm 1AWOA 3ZEHA 2FL7A 1D1BA 3C0CA 1RAGB 3JV3A 2E1HA 3JCMb 2OTLA 2MOXA 3OYBA 2A3LA 2LC4A 1HK9A 1ABOA 3FJPA 4GLKA 3BDLA 1OULA 3PMIA 3WXMB 1VQLT 2PVDB 4BI3A 4K11A 4AMCA 4FIBA 2K5FA 5I11A 3LGFA 4M7DG 2I0NA 2ZPHB 4AFUC 2KI7A 2RNAA 2OTJT 4KGZB 3Q1JA 2JT4A 4M77E 2KK4A 4HCBA 4C92B 1I07A 1KSWA 2COYA 2D0QB 2E5QA 1ZBXA 4C8QG 2KROA 2XD0A 1YITT 3EHRA 1FX7A 4F17A 1VQ6Q 1UB4A 4RTWA 3HHTB 2FHDA 3FDRA 2DD4A 2JVVA 2A7YA 2LJ3A 2QQ9A 5GAOp 1S72A 2O4XB 1FWZA 4C0DB 3GP8A 3R6NA 2NLUA 3JB9J 4FSXA 2PUOB 1T3SA 4NS5A 3J7AF 2FEIA 3EGXB 2K7AA 4C5EA 1KQ1A 4AFZC 3UA7A 4HVWA 1VQ8Q 1IGQA 3G4SQ 3G71T 4JPBW 4F7UA 1G8XA 2F2XA 2CH4W 4P5NA 2QA4T 4WCIA 4PJOG 3NFCA 2NWMA 2QTVA 1TUCA 1YI2Q 2RHIA 2DNUA 5IN1A 4CI0C 3VRYA 2E70A 2YRDA 2YUNA 1VQ5A 1M8MA 1BB9A 2RQWA 2O88A 1AHJB 3EFRA 5LJ5h 2DL7A 2LCLA 3LWIA 1I81A 2CH4A 3EG0A 3M59A 4KUIA 3E19A 3TCJA 2PVOB 1G3WA 1QVFP 1KC8U 3CC2Q 4L5GA 2BUDA 4M75B 1K8AR 2DJZA 1YNZA 2QG9B 4LDVA 3DLMA 2EYXA 2VGMA 1GBQA 2QASA 1GXIE 2RB6A 2L89A 3JCMX 1ZQ1A 1JJ2P 1QQJA 2EAYA 2OTLQ 4LD9K 5CIUA 2FRYA 2DFUA 1SRMA 5L23A 2OI3A 1UHFA 4J9BA 2LRQA 4ZGEB 3CPWP 2YUQA 3RBBB 4F7UE 3VJPA 2CSIA 1RACB 3EFOB 1X69A 4B9WA 1TU0B 4OF1A 1CKAA 1ZA2B 5I2SA 3P8HA 3BDUA 3OS5A 4KGVB 3L1AA 3QSUA 1NLPC 1QP2A 2EWNA 3RKXA 1K73U 3VS6A 4E7LA 1JBMA 2FB7A 1SF9A 5KCHA 3I55A 2VXEA 1XNIA 3BE3A 1LPLA 2LCSA 1UUEA 1M90R 2V8IA 3WVEB 1GCQA 1KK7A 3M0UA 3CCRT 4IUPA 4XAXB 5FU6C 5GAN6 2C0OA 2IPOB 2NYSA 1YWPA 4DBRA 3RR6A 2LP5A 3QG1A 2JTFA 1KFZA 4E7IA 2DL8A 1V29B 2MAMA 4BY6B 4BI4A 2VXFA 1U3OA 4E7KA 4C0ZA 2C0TA 3VS1A 2DETA 1FMWA 4PLIA 4JRPA 1MMNA 1TUGB 2EJFA 5J26A 4M7AG 3T9NA 1C1AA 3O5ZA 2C06A 4E2FB 3UF4A 3RIRA 1SSHA 3CCQA 2A28A 1NG2A 1BK2A 1ZA1B 3CCJT 4DOVA 2M9UA 1WHMA 1BCMA 1N8RU 8AT1B 3OYJA 1X43A 1M27C 2ROTA 2EQJA 3BY7A 4OMNA 1S1NA 3CCET 4OB3B 1QVFS 2LX9A 2XMFA 4XTZA 1TS9A 2FZGB 4LDXA 4BE2A 4IUQA 4JZ4A 5GAN5 2EKHA 4F7UG 3JB9G 3CCMA 1VQOT 1JJ2S 1D1CA 3EGDA 1HD3A 2R5AA 5J39A 5FLXE 5A0GA 2E41A 1K4US 2E10A 1YJWT 3CPWS 4QQ6A 4XTUA 3RKWA 5FROA 1KHIA 2DX1A 4II1A 1KD1R 1N27A 2KVQG 2YSQA 2YUOA 4UC4A 3LGLA 1YJNT 4HVUA 2QYZA 4BE1A 4C5GA 2ATCB 5CKEA 1WHJA 1UGSB 2X35A 1R8OB 1ZUKA 1VQ7T 3I55Q 4DA4A 1SPKA 3S6WA 1QWEA 3REBB 1K8AC 2D0NA 2OAUA 4CC2A 1K9MR 5CO7A 4A4KA 2YWWA 3I56T 1AOJA 1TOVA 4M7DB 1I8FA 2DF6A 1U8RA 3LYIA 3CBPA 3CD6A 2HBWA 1YIJQ 3WVDB 4FM4B 1WJSA 4YTLA 3GIBA 3V8JA 3ZBDA 4QVCA 2KQWA 2CT4A 4OP0A 1XTDA 2GTOA 2J6KA 2KRMA 1T0HA 3TEEA 1NEGA 1QMCA 1RAEB 2QQRA 2QI2A 3EAEA 3QZ5B 4DEYA 2EGEA 3M0PA 1G3TA 4C92G 3CMEA 2NUZA 4M7DD 3VYGA 2KDSA 1OEBA 1N9RA 2WSEE 2EQUA 1NJIR 2D8JA 2HKNA 5IT9E 3L2VA 4DBFA 1JEGA 2CP7A 4HXJA 2FZKB 4C8QD 3OBYA 2BIVA 2AZVA 3M56A 1VQMA 5GAMd 1M90C 2JTMA 2PZ1A 3RESA 3U23A 2LMJA 1VIEA 4E7JA 2CP0A 5HKCA 2EIFA 2LNHB 3HL8A 3CCMQ 2QDLA 2ZGWA 1NYGA 2EJ9A 3V7RA 2QEXT 2RJCA 1WQWA 2X3XD 2P0QA 1BI2A 3CCVT 3FRNA 5GANd 3JCMd 2JTEA 2AKKA 4ZTFA 2DXTA 2VB6A 4PJOD 5A0DA 3CMAT 1PKSA 2A0FB 2CP3A 2YHTA 4OMPA 2F69A 4XTWA 1RLQC 4D8DA 4OB1B 3MHXA 2EGAA 2RQTA 4A53A 4F14A 3URGA 1LCKA 1YCSB 1ACMB 3MKDA 3OA6A 3G6ET 4M75G 1X6BA 2KY9A 4ZNXA 1Q82U 5KYWA 4JRIA 3CC4A 1EZZB 4DBQA 3NTIA 1OU8A 4J9FA 4ZGDB 2DD5A 4KRTA 1WI7A 4J9CA 3SD4A 1QKWA 2CZ7B 3CD6Q 5KH6A 3UWNA 1VQ4T 3OYDA 4R0KA 1VQ9A 2K9GA 4HT8A 1VQPT 1RI0A 3TSWA 2D6FA 2FPEA 2NUTB 1Y7XA 1YJ9T 1QP3A 1VQKA 3OYYA 4MDWA 5LJ5d 4FCYA 1WIEA 1WFWA 2ENMA 1KHCA 2FRWA 3CMEQ 1KD1C 2YXYA 3JB9I 2YLBA 3CEYA 1I1JA 2Y4YA 4J9DA 4ESRA 4EMKC 1Y71A 1MV0B 5IXFA 4L59A 3O8VA 1OI1A 2ZPFB 1VQMQ 4J9GA 2O01E 4HCKA 2M51A 1SG5A 3S3NA 1V76A 4JDSA 1AZGB 2C0IA 1X27A 3V7SA 1X2KA 4M7AB 2DAQA 3TSZA 1G2BA 2HKQB 4EMGA 1I5OB 2GNCA 5LJ3e 1WXUA 3OS1A 4IUUA 4JS4A 3CCUT 2A37A 4Z89A 4RTYA 1RI9A 5LJ3h 2H3EB 1WHHA 2KEAA 4AG2C 1KJWA 3M0TA 3CCLT 2CUDA 3JCMc 4KGXB 4M7AD 2K4YA 4F7UB 2WSCE 3E2UA 1K8AU 1IXDA 2A36A 3S3MA 2DVJA 3CC4Q 1Q86U 4QW2A 3CCST 3C12A 4M78G 5J3BA 4ELZC 3M53A 2OX7A 4RCCA 4J7IA 3LLRA 4LD6A 3A98A 5GMKj 1RADB 4ZN3A 2E3IA 4BB7A 2CREA 4FU6A 2WSFE 3E1SA 1UECA 4KH0B 1MMGA 2OTJA 2XG8D 1VQ6T 5GAMe 3PMTA 3C94A 1WJQA 2XDPA 1ABQA 4E6RA 1AEYA 1B3QA 2HCKA 1YITA 2LZ6B 2O9VA 1M1FA 1MUZA 2RI5A 2RM4A 2EQKA 2RD1A 1VQKQ 2GTJA 3NTHA 5GAMh 4HT9A 4PFZA 3IQLA 2GFAA 2K57A 4ZN1A 4FYVB 4LNPA 3KFVA 4C0FA 1M4ZA 1D3BA 4QQGA 5GANe 3JCMe 3KBGA 4EMKA 3OYAA 3EG2A 4FW2A 4N4IA 4NL3A 1AD5A 1OYXA 2E6ZA 2HAXA 1YI2T 3G71A 5GANh 3JCMh 4BD3A 3QUIA 1Y96A 2QA4A 1PD1A 1MMDA 2M16A 3DLLA 4X9CA 1QCOA 1NBEB 3RMSA 3H0FA 1P92A 4A63B 1WXBA 4JJDA 2JW4A 2X4XA 4X1VA 2AZSA 4WTOB 4HCCA 3FEOA 1BI1A 2FVUA 1N5ZA 4RMOA 4QKUA 4LN2A 2L0AA 2SEMA 1DJ7B 2LCCA 3OW2A 4XQ3A 1CSKA 4C92D 4CC4B 2M0OA 2KSSA 1XOVA 1K9AA 4Q5WA 2DZCA 5A2QE 5CQXA 3P8BB 4HKEA 1B34B 1QVGA 5IXBA 4C0DC 2RMOA 1ZUUA 5LJ5e 3OBWA 5CKHA 2AK5A 1PRMC 2DYBA 4MMLA 4IUVA 3A8GB 1VQLQ 3RDVA 1IREB 1I4K1 3MEWA 3VYHB 5CK9A 5D6YA 2MWPA 3UPUA 2X4YA 2MPXC 1OZ3A 3EG3A 2L3QA 2XDBA 5HCKA 1W6XA 2K3YA 5CCAA 3QDFA 4CC3A 2OTJQ 4BUGA 3OQ5A 3X25B 3QHSA 3C95A 3QJ6A 1KD1U 1YBYA 4XU1A 3VS2A 3HRUA 3E9GA 5KYYA 3VS3A 1ZBJA 1EX4A 1YITQ 2QXFA 3CXCA 3LX7A 1S72T 2J7IA 3EGDB 2DL4A 1LVKA 2KYBA 3MEUA 1ZUYA 3H0HA 1TSFA 3OYCA 4MZTA 3CCRA 2K3XA 2PNIA 1MGQA 1SSFA 4M75D 4M77G 5FRMA 4FSSA 2VKNA 2BZXA 1OU9A 3CC7T 3QZ9B 3PIOA 1IHVA 4XTVA 1SHFA 3G71Q 3GBQA 2QQSA 4O5VA 2XU8A 5DLOA 5DM7R 4R56A 2QA4Q 1H92A 3PE0A 1VQ5T 3PIPA 2F5KA 3M55A 1W2BA 3I35A 4EDUA 2E64A 1T0JA 2MF2A 3M57A 2NUPA 1QCFA 5GMKe 1RAAB 2J6FA 3CCJA 3OMCA 4BE0A 1RAFB 1H3ZA 1UJ0A 2RHUA 1YFNA 2JXBA 5GMKh 1M8VA 1YIJA 2DERA 3QIIA 3ASKA 5HK3A 2QDYB 2E6NA 2VUBA 4A4HA 3EFSA 2B86A 4MMKA 1ARKA 2YLCA 1JRIA 2O9SA 4X9DA 3ME9A 2LQ8A 3SWNB 4M4ZA 2L3PA 1IZ6A 1FMVA 3EG9A 3OYKA 1YJWA 3SB2A 4B6MA 2O2OA 3NPFA 5GJVB 3CBMA 2O31A 3CQTA 3H6ZA 3VU3C 1UHCA 3VS4A 4E7SA 2XK0A 2PQWA 2PTKA 1MMAA 4Y28E 1N6AA 3HP9A 4FW1A 2HSEB 4JLGA 2EBPA 2ABLA 2IIMA 2CZ6B 2LJ1A 2RHYA 4M78B 4J6WA 2QAZA 3LH5A 4QVDA 1KQ2A 1KIKA 3EGUA 3RNJA 5GAOq 4KBMB 1TUDA 1VQNT 5CQYA 2K2VA 2RJFA 2YDLA 3CCRQ 2HQHA 4M7DF 1Q7YR 1EIFA 4JZ3A 2KBTA 1ZHIA 3QXEB 2G6FX 4IIMA 4JJBA 4LUDA 2GCXA 5KYXB 4TVRA 2BE9B 5GMKi 4C8QF 4FT2A 3OSSC 5KYWB 2GQIA 2LJ0A 1KC8R 1VUBA 3QDRB 3ZL7C 3TU4K 1AWJA 4IUTA 2CP6A 2PUKB 3CCQT 3CBOA 2JMCA 3MP6A 5LJ3d 4LDYA 3HRTA 4PFOA 1YHQT 3CCJQ 5LJ5g 4KH1B 2L8DA 1G83A 4GLMA 1PHTA 2MCNA 3MCAB 2K79A 2LDMA 5IHKA 3M4GA 1B7TA 3BW1A 1ZSZC 1ZX6A 4QT7A 2Y90A 1XJWB 4PLLA 3FJ5A 4PJOF 4HA8A 2F2VA 2V1RA 3F70A 2X9HA 4M7DC 3UA6A 1M1KR 3VV0A 2I2LA 2G3RA 3H9NA 1H641 3DKMA 4B9XA 1I5LA 2QEXA 2DLPA 1K73R 4ATOA 1T3LA 2ZPIB 4C8QC 1YJWQ 1K0XA 2MYSA 5FU7C 5I21A 2DTOA 4PJLA 2DL5A 4PK4A 1X6OA 4JJNK 2DYIA 3L2RA 1HYOA 5KE2A 2LQKA 3M5AA 2DE0X 2EQIA 5KYNA 3MPUB 3LW5E 3NHNA 4Y91A 3MEVA 1VA7A 1PWTA 3PVQA 5HY6A 1TH7A 3G6EA 1PD0A 1C6VX 2FPFA 2GBQA 3M4YA 3X20B 4ZGJB 1IO6A 4Z02A 5GANf 3JCMf 1QKXA 4DQ2A 4JJCA 2QQAA 2CP5A 4A54A 3RERA 2P84A 4PJOC 5IHNA 1BI3A 5D6WA 1VQ4A 2XKOC 5GAN4 3ZFJA 1U1SA 1SKUB 2E4HA 1NE8A 2RHXA 1VQPA 1R0BG 3P8DA 3TQ7P 5EC7A 2KYMA 2JMAA 2DRMA 2V1QA 3FC3A 1M2OA 1N8RR 5FRNA 4Z8AA 2PVGB 3A8HB 1WGSA 3TVTA 2VVKA 2JM8A 4XK8E 4M77B 1R77A 2CP2A 3GPLA 1PC0A 2DTIA 5GMKl 2R58A 5KYUB 1RAIB 1WX6A 3TREA 3E9FA 5ECAA 1ZSZA 2Z0WA 4JLIA 5LJ5f 5GAOl 2D8HA 1PKTA 1Q7YC 1OZ2A 3UATA 1TTHB 4M7AF 1UEBA 4M7DA 4WF2A 1WQ7A 2QEXQ 3OY9A 1X01A 3PFSA 2RK2A 2JZ2A 4C5IA 3CCVQ 2X51A 3CCUA 5IH2A 1D3BB 1W70A 3ER0A 1OOTA 4EMKB 4J6YA 4C8QA 3CMAQ 1GFDA 4J7FA 3CCLA 1OPKA 3META 2EGCA 5CR2A
chains in the Genus database with same CATH topology
1OX8A 2QAZA 2NYSA 1TWBA 2QASA 1OX9A 1ZSZA 1OU9A 1OU8A 1YFNA 1ZSZC 1OULA 1ZSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX8 A;  2QAZ A;  2NYS A;  1TWB A;  2QAS A;  1OX9 A;  1ZSZ A;  1OU9 A;  1OU8 A;  1YFN A;  1ZSZ C;  1OUL A;  1ZSZ B; 
#chains in the Genus database with same CATH topology
 1O75 A;  3SFM A;  1Y96 B;  1G3Y A;  1M2V A;  2H8H A;  3VUB A;  4AFQ C;  1K9M C;  3SEM A;  4A4F A;  2FG0 A;  3G6E Q;  3OW2 P;  3RKY A;  1WLP B;  1KQS A;  2DIG A;  2XI9 A;  1WPY A;  4GBQ A;  2XDD A;  4KUL A;  2HL5 C;  2DL3 A;  3AHU A;  2DKG A;  2P4T A;  2CT3 A;  4ME7 A;  1QVG P;  1AWW A;  3INZ A;  2LTO A;  4RTZ A;  1VQ9 T;  1NEB A;  3L2W A;  1D1A A;  2HL3 A;  3M0S A;  1M1K C;  4PJO A;  1JO8 A;  1VQ4 Q;  4M7D E;  2MMP A;  1G3S A;  3OYE A;  3OYL A;  4M7A C;  1IRX A;  2H3J A;  2M1H A;  4XU0 A;  3H0I A;  1PM3 A;  2EJG A;  2COW A;  1VQP Q;  5GAN 3;  1WDX A;  3J81 E;  1JB0 E;  2DO3 A;  4LUE A;  1VYV A;  1UGQ B;  1U06 A;  4RCB A;  1NJI C;  5M9O A;  4LDW A;  4FYX B;  4RG2 A;  4C8Q E;  3QBY A;  4FL6 A;  2V8K A;  2RF0 A;  1Z9Q A;  2AKL A;  2VC8 A;  3ULR B;  4RTU A;  2KAF A;  3X28 B;  2VYT A;  1OQK A;  1Y07 A;  1VQL A;  1Y0M A;  1M3A A;  3CXC P;  4OML A;  2QQB A;  2EQM A;  3JAM E;  4XU2 A;  2EYZ A;  1OPL A;  3M0Q A;  1Q81 R;  1PSE A;  1NM7 A;  4LXC A;  1JXO A;  4FYW B;  4J83 A;  2EYY A;  3JB9 D;  3DB3 A;  2DIL A;  2GF7 A;  3QYG B;  1H8K A;  3PTA A;  2EYW A;  3V8K A;  3HFO A;  1OV3 A;  1TG0 A;  4C92 F;  4PJO E;  2K3B A;  1YP5 A;  2IVW A;  2E65 A;  1GFC A;  4PJJ A;  4NOY A;  3PGG A;  1F1B B;  1OX9 A;  2XIC A;  5GAN 2;  1BYM A;  3JRZ A;  3CCU Q;  1NPP A;  3RMQ A;  1W2B P;  1VQ8 T;  1QWF A;  1Q82 R;  1MV3 A;  1N8R C;  1M90 U;  3G4S T;  3KUF A;  3VS5 A;  5KCO A;  4CRI A;  1RUW A;  2GQV A;  2R57 A;  2NUT A;  3VS0 A;  1D0X A;  2EFI A;  3CCL Q;  2L5Q A;  4E7H A;  1Z9Z A;  1QW1 A;  2K6D A;  2YRV A;  3V7C A;  4XTX A;  2DEQ A;  3G1J A;  3M58 A;  5GAO m;  2FPD A;  3OW2 S;  4PJM A;  2LX7 A;  2JM9 A;  1UE9 A;  3CCS Q;  2NUP B;  2F2W A;  5GAO n;  4OGE A;  1QCN A;  1RLP C;  2OAW A;  4XU3 A;  4ZTJ A;  2DZ9 A;  4E47 A;  3PVL A;  3A8L B;  1BU1 A;  3CC2 T;  3MO8 A;  1M1G A;  2CYZ B;  1RAH B;  2HDA A;  1HJD A;  2DVE A;  1QVG S;  4C92 C;  5AYF A;  2MIO A;  1BI0 A;  2P0P A;  1U5S A;  1RL2 A;  4EPC A;  4PKC C;  3HKS A;  5DLQ E;  4M7A A;  4DOW A;  5LL6 S;  4M75 F;  2L2P A;  3VRZ A;  2V26 A;  1GCQ C;  2OTL T;  4LDU A;  2HNI A;  4AFS C;  3EH1 A;  1Q95 G;  1PG5 B;  2RQV A;  2HBP A;  1BKB A;  2RI3 A;  3HSB A;  3NGP A;  3FIF A;  1LOJ A;  3EG9 B;  2QGF B;  5C6S A;  2QTX A;  6AT1 B;  3QKJ A;  4PFP A;  5GAO r;  1FMK A;  1YCY A;  2FYK A;  3CXC S;  2RI2 A;  3OSV A;  3CC7 A;  1FXX A;  4Z88 A;  2DMO A;  3GF5 A;  1N9S A;  1LNX A;  2SRC A;  4J8O A;  1Q7Y U;  4OMO A;  3QYH B;  1X75 C;  5GAN 7;  2X4W A;  2EPD A;  2VAS A;  2XHC A;  4DBH A;  2ESW A;  1KG1 A;  2BZY A;  2BE7 D;  3OS0 A;  4M7A E;  1V1C A;  4N4G A;  2COZ A;  1UDL A;  3VKI A;  2MI6 A;  4M75 C;  3SHW A;  5D7U A;  3JCM W;  4ANJ A;  3JCM J;  3JB9 H;  1W2B S;  1Q86 R;  2PU9 B;  1K9M U;  2M02 A;  2RN8 A;  4J5Y A;  5I22 A;  1WA7 A;  1ZLM A;  5LJ3 g;  2QGG A;  1MNE A;  5AT1 B;  5CKD A;  2BTT A;  4A4G A;  2EYQ A;  3NMZ C;  1MND A;  1QVP A;  2EW3 A;  4RTX A;  4NL2 A;  3A1P A;  3GLX A;  3OYN A;  4PJN A;  2DBK A;  2FZC B;  1LJO A;  1H3H A;  2X3W D;  1Q81 C;  2ZPB B;  2DBM A;  1HSQ A;  1PSF A;  1M1K U;  3HPW A;  1M5Q 1;  3VUZ A;  3H41 A;  1D0Y A;  4IKF A;  3A8O B;  4ORZ A;  1E6H A;  2AIR B;  5FU6 B;  3OYH A;  1NJI U;  2KE9 A;  1I0C A;  3OYG A;  2ED1 A;  4C92 A;  3CCE A;  4IIO A;  3I5R A;  1SEM A;  2QK0 A;  3GOX A;  1WXT A;  1IHW A;  2HSP A;  1K76 A;  3GNG A;  2E12 A;  2JN0 A;  1M3B A;  5FWC A;  2CZ1 B;  1Q82 C;  1NPR A;  2W0Z A;  4O6J A;  3EG1 A;  1UGV A;  4OVA A;  3OYF A;  5IAY A;  4M78 F;  1S72 Q;  1VQO A;  3FB9 A;  5GAM g;  2O4X A;  5C0M A;  9ATC B;  1VQN A;  1X6G A;  1AZE A;  1R0C B;  2D9T A;  2RJD A;  4ELY C;  3EGX A;  5GAN 8;  2F1L A;  3OS2 A;  1OX8 A;  2KNB B;  4D8K A;  3I5S A;  2R5M A;  5IHI A;  4BY6 C;  1M30 A;  3CC7 Q;  1BCO A;  1XQH A;  2E5K A;  3LH0 A;  1YJN A;  8ATC B;  5CVI A;  1B34 A;  3SWN C;  1VYU A;  2E3H A;  2VGN A;  3I55 T;  4DEX A;  5GAN g;  3JCM g;  1VQ5 Q;  1WZO A;  3OYM A;  4N4H A;  1D09 B;  4JS5 A;  1VQ7 A;  4RG8 A;  4C92 E;  1JQQ A;  2P4R A;  3M54 A;  3I56 A;  1UJY A;  1YHQ A;  1YIJ T;  3HTR A;  1CKB A;  4M75 A;  1Y57 A;  4OMQ A;  3REA B;  4J9H A;  4M78 C;  3EH2 A;  2LNV A;  3MP8 A;  1RAB B;  4M78 D;  4CC7 A;  3S3O A;  2CKK A;  3V8L A;  2D1X A;  2J6O A;  1QVF A;  4OMF B;  5LJ3 f;  5L8R E;  2KXD A;  1W4S A;  3JCM Q;  2KXC A;  3J80 E;  3N5B B;  2WAC A;  5FW9 A;  2VWF A;  2L3R A;  3R6O A;  4OMM A;  3EFO A;  1JJ2 A;  2BKD N;  2XID A;  2J06 A;  1NLO C;  3QO3 A;  4RKU E;  4AT1 B;  1ZSZ B;  3CPW A;  3CCE Q;  3SDZ A;  4FT4 A;  4A4E A;  4OGC A;  3H8Z A;  1O9S A;  2DPP B;  1E7O A;  3VS7 A;  3CCM T;  2RHZ A;  3QPH A;  4M75 E;  4OB2 B;  3A8M B;  1Q86 C;  3D7S B;  3G7Z A;  4F04 B;  2YT6 A;  2J05 A;  2FO0 A;  5LJ3 j;  1TXQ A;  2DEU A;  1VQO Q;  3L42 A;  4N0A C;  3MEA A;  4J9I A;  1VQN Q;  2HQX A;  2RJE A;  3CCV A;  1KQS P;  2KRS A;  4JRQ A;  3PNW C;  4C8Q B;  4GY5 A;  5FU7 B;  3M0R A;  5GAM f;  1NZ9 A;  3CMA A;  4JRK A;  3UDC A;  2KT8 A;  3L2Q A;  1YWO A;  1M2V B;  4L6V 5;  4D6W A;  4E7Z A;  1YJN Q;  2YUP A;  2Y4X A;  2AHJ B;  1UG1 A;  2KGT A;  4EIK A;  5EG2 A;  1BBZ A;  3SWN A;  4QQD A;  4J6X A;  5CKB A;  2HD0 A;  2ZCF B;  1IB8 A;  2DJQ A;  3MJX A;  4QVZ A;  1J3T A;  4PNO A;  5FWB A;  1M9S A;  4PL6 A;  3HRS A;  4X34 A;  1AWX A;  2ECZ A;  3CCQ Q;  1VQ7 Q;  3GNF B;  3CPF A;  2RQU A;  2LT4 A;  2VV5 A;  1U1T A;  4BI8 B;  4MZM A;  3CD6 T;  3I56 Q;  1YHQ Q;  3PT9 A;  4M77 F;  2HMA A;  4LE9 A;  4PJO B;  5D6X A;  2CUB A;  1AT1 B;  2LQN A;  3C4S A;  4KUD K;  2JNG A;  3LWH A;  5GAM j;  4XTY A;  2ZAE A;  4M78 A;  4RTV A;  4MZP A;  1Q81 U;  2GGR A;  2RO0 A;  3CME T;  1YJ9 A;  1TWB A;  2ROL A;  1PRL C;  7AT1 B;  2K5I A;  1WHK A;  1UFF A;  2DM1 A;  2DXU A;  5CAI A;  1K1Z A;  3MP1 A;  4F16 A;  5GAN j;  5KYX A;  2KT1 A;  2YRC A;  1C0M A;  1VQM T;  1SRL A;  4C0G A;  2A08 A;  1E6G A;  2JS2 A;  4FYY B;  2KMT A;  3HFN A;  3I9Q A;  1GRI A;  2DRK A;  1M3C A;  1BIA A;  4V2S A;  1IGU A;  4M77 C;  1FYN A;  1QLY A;  2RPN A;  3NTK A;  2JOY A;  2F5T X;  4M77 D;  3X26 B;  2RK1 A;  3JCM V;  4M78 E;  2B8A A;  2RA2 A;  4N0A A;  1MHN A;  2KRN A;  4RTT A;  3A5Z B;  1KQS S;  1GCP A;  2DA9 A;  2L3S A;  4C5H A;  4JUV A;  2ED0 A;  2CZ0 B;  1KC8 C;  1VYT A;  2CS7 A;  1UGR B;  2DIQ A;  1EFN A;  4BDY A;  1WJR A;  2BZ8 A;  2JJ9 A;  3CC4 T;  1A0N B;  2GFU A;  1WHG A;  4F7U F;  2CDT A;  2EKO A;  1UTI A;  5LJ5 j;  1PCX A;  3JB9 F;  5HK0 A;  3EHQ A;  3L2U A;  5GJW B;  3CCS A;  2LT1 A;  3THK A;  3DB4 A;  2IG0 A;  5KE3 A;  1W1F A;  3BFM A;  2LQW A;  1SHG A;  3UT1 A;  2JS0 A;  2ZZD A;  1GBR A;  1YN8 A;  1D0Z A;  5DY9 A;  1JU5 C;  2DTH A;  3OB9 A;  3QWY A;  3M9Q A;  1UGP B;  4BAC A;  1B07 A;  3AT1 B;  1VQ6 A;  3OYI A;  1VQK T;  3X24 B;  2DXC A;  1BIB A;  3QWX X;  3QJY A;  1HXD A;  1K73 C;  2AT1 B;  2ZPG B;  2LVM A;  2P0K A;  1YJ9 Q;  4HCZ A;  2X4J A;  4R55 A;  3FLG A;  2MWO A;  2CGH A;  1X2Q A;  5CKF A;  4IUR A;  1VQ8 A;  2DK3 A;  4OB0 B;  1PNJ A;  3RUX A;  2V8J A;  3G4S A;  2M0Y A;  2CSQ A;  2JUF A;  4EMH A;  2ZPE B;  5I2M A;  2RH2 A;  1JXM A;  1ZSG A;  1VIF A;  2HQE A;  1YI2 A;  3KXT A;  2HEQ A;  4RUG A;  1NYF A;  1WYX A;  2K5L A;  5KYY B;  3JSC A;  2K2M A;  1VOM A;  5A0L A;  3OMG A;  2DXB A;  2HZY A;  2OJ2 A;  4M77 A;  4AG1 C;  2KR3 A;  1WNL A;  2W10 A;  2EVR A;  2RQR A;  4VUB A;  1WHL A;  4KT0 E;  3CC2 A;  5KYU A;  1K0S A;  3JCM P;  1VQ9 Q;  4BDZ A;  2MK5 A;  4MDX A;  1G5V A;  3L2Z A;  1AVZ C;  1GL5 A;  4HVV A;  4Y92 A;  4J9E A;  5GMK m;  1AWO A;  3ZEH A;  2FL7 A;  1D1B A;  3C0C A;  1RAG B;  3JV3 A;  2E1H A;  3JCM b;  2OTL A;  2MOX A;  3OYB A;  2A3L A;  2LC4 A;  1HK9 A;  1ABO A;  3FJP A;  4GLK A;  3BDL A;  1OUL A;  3PMI A;  3WXM B;  1VQL T;  2PVD B;  4BI3 A;  4K11 A;  4AMC A;  4FIB A;  2K5F A;  5I11 A;  3LGF A;  4M7D G;  2I0N A;  2ZPH B;  4AFU C;  2KI7 A;  2RNA A;  2OTJ T;  4KGZ B;  3Q1J A;  2JT4 A;  4M77 E;  2KK4 A;  4HCB A;  4C92 B;  1I07 A;  1KSW A;  2COY A;  2D0Q B;  2E5Q A;  1ZBX A;  4C8Q G;  2KRO A;  2XD0 A;  1YIT T;  3EHR A;  1FX7 A;  4F17 A;  1VQ6 Q;  1UB4 A;  4RTW A;  3HHT B;  2FHD A;  3FDR A;  2DD4 A;  2JVV A;  2A7Y A;  2LJ3 A;  2QQ9 A;  5GAO p;  1S72 A;  2O4X B;  1FWZ A;  4C0D B;  3GP8 A;  3R6N A;  2NLU A;  3JB9 J;  4FSX A;  2PUO B;  1T3S A;  4NS5 A;  3J7A F;  2FEI A;  3EGX B;  2K7A A;  4C5E A;  1KQ1 A;  4AFZ C;  3UA7 A;  4HVW A;  1VQ8 Q;  1IGQ A;  3G4S Q;  3G71 T;  4JPB W;  4F7U A;  1G8X A;  2F2X A;  2CH4 W;  4P5N A;  2QA4 T;  4WCI A;  4PJO G;  3NFC A;  2NWM A;  2QTV A;  1TUC A;  1YI2 Q;  2RHI A;  2DNU A;  5IN1 A;  4CI0 C;  3VRY A;  2E70 A;  2YRD A;  2YUN A;  1VQ5 A;  1M8M A;  1BB9 A;  2RQW A;  2O88 A;  1AHJ B;  3EFR A;  5LJ5 h;  2DL7 A;  2LCL A;  3LWI A;  1I81 A;  2CH4 A;  3EG0 A;  3M59 A;  4KUI A;  3E19 A;  3TCJ A;  2PVO B;  1G3W A;  1QVF P;  1KC8 U;  3CC2 Q;  4L5G A;  2BUD A;  4M75 B;  1K8A R;  2DJZ A;  1YNZ A;  2QG9 B;  4LDV A;  3DLM A;  2EYX A;  2VGM A;  1GBQ A;  2QAS A;  1GXI E;  2RB6 A;  2L89 A;  3JCM X;  1ZQ1 A;  1JJ2 P;  1QQJ A;  2EAY A;  2OTL Q;  4LD9 K;  5CIU A;  2FRY A;  2DFU A;  1SRM A;  5L23 A;  2OI3 A;  1UHF A;  4J9B A;  2LRQ A;  4ZGE B;  3CPW P;  2YUQ A;  3RBB B;  4F7U E;  3VJP A;  2CSI A;  1RAC B;  3EFO B;  1X69 A;  4B9W A;  1TU0 B;  4OF1 A;  1CKA A;  1ZA2 B;  5I2S A;  3P8H A;  3BDU A;  3OS5 A;  4KGV B;  3L1A A;  3QSU A;  1NLP C;  1QP2 A;  2EWN A;  3RKX A;  1K73 U;  3VS6 A;  4E7L A;  1JBM A;  2FB7 A;  1SF9 A;  5KCH A;  3I55 A;  2VXE A;  1XNI A;  3BE3 A;  1LPL A;  2LCS A;  1UUE A;  1M90 R;  2V8I A;  3WVE B;  1GCQ A;  1KK7 A;  3M0U A;  3CCR T;  4IUP A;  4XAX B;  5FU6 C;  5GAN 6;  2C0O A;  2IPO B;  2NYS A;  1YWP A;  4DBR A;  3RR6 A;  2LP5 A;  3QG1 A;  2JTF A;  1KFZ A;  4E7I A;  2DL8 A;  1V29 B;  2MAM A;  4BY6 B;  4BI4 A;  2VXF A;  1U3O A;  4E7K A;  4C0Z A;  2C0T A;  3VS1 A;  2DET A;  1FMW A;  4PLI A;  4JRP A;  1MMN A;  1TUG B;  2EJF A;  5J26 A;  4M7A G;  3T9N A;  1C1A A;  3O5Z A;  2C06 A;  4E2F B;  3UF4 A;  3RIR A;  1SSH A;  3CCQ A;  2A28 A;  1NG2 A;  1BK2 A;  1ZA1 B;  3CCJ T;  4DOV A;  2M9U A;  1WHM A;  1BCM A;  1N8R U;  8AT1 B;  3OYJ A;  1X43 A;  1M27 C;  2ROT A;  2EQJ A;  3BY7 A;  4OMN A;  1S1N A;  3CCE T;  4OB3 B;  1QVF S;  2LX9 A;  2XMF A;  4XTZ A;  1TS9 A;  2FZG B;  4LDX A;  4BE2 A;  4IUQ A;  4JZ4 A;  5GAN 5;  2EKH A;  4F7U G;  3JB9 G;  3CCM A;  1VQO T;  1JJ2 S;  1D1C A;  3EGD A;  1HD3 A;  2R5A A;  5J39 A;  5FLX E;  5A0G A;  2E41 A;  1K4U S;  2E10 A;  1YJW T;  3CPW S;  4QQ6 A;  4XTU A;  3RKW A;  5FRO A;  1KHI A;  2DX1 A;  4II1 A;  1KD1 R;  1N27 A;  2KVQ G;  2YSQ A;  2YUO A;  4UC4 A;  3LGL A;  1YJN T;  4HVU A;  2QYZ A;  4BE1 A;  4C5G A;  2ATC B;  5CKE A;  1WHJ A;  1UGS B;  2X35 A;  1R8O B;  1ZUK A;  1VQ7 T;  3I55 Q;  4DA4 A;  1SPK A;  3S6W A;  1QWE A;  3REB B;  1K8A C;  2D0N A;  2OAU A;  4CC2 A;  1K9M R;  5CO7 A;  4A4K A;  2YWW A;  3I56 T;  1AOJ A;  1TOV A;  4M7D B;  1I8F A;  2DF6 A;  1U8R A;  3LYI A;  3CBP A;  3CD6 A;  2HBW A;  1YIJ Q;  3WVD B;  4FM4 B;  1WJS A;  4YTL A;  3GIB A;  3V8J A;  3ZBD A;  4QVC A;  2KQW A;  2CT4 A;  4OP0 A;  1XTD A;  2GTO A;  2J6K A;  2KRM A;  1T0H A;  3TEE A;  1NEG A;  1QMC A;  1RAE B;  2QQR A;  2QI2 A;  3EAE A;  3QZ5 B;  4DEY A;  2EGE A;  3M0P A;  1G3T A;  4C92 G;  3CME A;  2NUZ A;  4M7D D;  3VYG A;  2KDS A;  1OEB A;  1N9R A;  2WSE E;  2EQU A;  1NJI R;  2D8J A;  2HKN A;  5IT9 E;  3L2V A;  4DBF A;  1JEG A;  2CP7 A;  4HXJ A;  2FZK B;  4C8Q D;  3OBY A;  2BIV A;  2AZV A;  3M56 A;  1VQM A;  5GAM d;  1M90 C;  2JTM A;  2PZ1 A;  3RES A;  3U23 A;  2LMJ A;  1VIE A;  4E7J A;  2CP0 A;  5HKC A;  2EIF A;  2LNH B;  3HL8 A;  3CCM Q;  2QDL A;  2ZGW A;  1NYG A;  2EJ9 A;  3V7R A;  2QEX T;  2RJC A;  1WQW A;  2X3X D;  2P0Q A;  1BI2 A;  3CCV T;  3FRN A;  5GAN d;  3JCM d;  2JTE A;  2AKK A;  4ZTF A;  2DXT A;  2VB6 A;  4PJO D;  5A0D A;  3CMA T;  1PKS A;  2A0F B;  2CP3 A;  2YHT A;  4OMP A;  2F69 A;  4XTW A;  1RLQ C;  4D8D A;  4OB1 B;  3MHX A;  2EGA A;  2RQT A;  4A53 A;  4F14 A;  3URG A;  1LCK A;  1YCS B;  1ACM B;  3MKD A;  3OA6 A;  3G6E T;  4M75 G;  1X6B A;  2KY9 A;  4ZNX A;  1Q82 U;  5KYW A;  4JRI A;  3CC4 A;  1EZZ B;  4DBQ A;  3NTI A;  1OU8 A;  4J9F A;  4ZGD B;  2DD5 A;  4KRT A;  1WI7 A;  4J9C A;  3SD4 A;  1QKW A;  2CZ7 B;  3CD6 Q;  5KH6 A;  3UWN A;  1VQ4 T;  3OYD A;  4R0K A;  1VQ9 A;  2K9G A;  4HT8 A;  1VQP T;  1RI0 A;  3TSW A;  2D6F A;  2FPE A;  2NUT B;  1Y7X A;  1YJ9 T;  1QP3 A;  1VQK A;  3OYY A;  4MDW A;  5LJ5 d;  4FCY A;  1WIE A;  1WFW A;  2ENM A;  1KHC A;  2FRW A;  3CME Q;  1KD1 C;  2YXY A;  3JB9 I;  2YLB A;  3CEY A;  1I1J A;  2Y4Y A;  4J9D A;  4ESR A;  4EMK C;  1Y71 A;  1MV0 B;  5IXF A;  4L59 A;  3O8V A;  1OI1 A;  2ZPF B;  1VQM Q;  4J9G A;  2O01 E;  4HCK A;  2M51 A;  1SG5 A;  3S3N A;  1V76 A;  4JDS A;  1AZG B;  2C0I A;  1X27 A;  3V7S A;  1X2K A;  4M7A B;  2DAQ A;  3TSZ A;  1G2B A;  2HKQ B;  4EMG A;  1I5O B;  2GNC A;  5LJ3 e;  1WXU A;  3OS1 A;  4IUU A;  4JS4 A;  3CCU T;  2A37 A;  4Z89 A;  4RTY A;  1RI9 A;  5LJ3 h;  2H3E B;  1WHH A;  2KEA A;  4AG2 C;  1KJW A;  3M0T A;  3CCL T;  2CUD A;  3JCM c;  4KGX B;  4M7A D;  2K4Y A;  4F7U B;  2WSC E;  3E2U A;  1K8A U;  1IXD A;  2A36 A;  3S3M A;  2DVJ A;  3CC4 Q;  1Q86 U;  4QW2 A;  3CCS T;  3C12 A;  4M78 G;  5J3B A;  4ELZ C;  3M53 A;  2OX7 A;  4RCC A;  4J7I A;  3LLR A;  4LD6 A;  3A98 A;  5GMK j;  1RAD B;  4ZN3 A;  2E3I A;  4BB7 A;  2CRE A;  4FU6 A;  2WSF E;  3E1S A;  1UEC A;  4KH0 B;  1MMG A;  2OTJ A;  2XG8 D;  1VQ6 T;  5GAM e;  3PMT A;  3C94 A;  1WJQ A;  2XDP A;  1ABQ A;  4E6R A;  1AEY A;  1B3Q A;  2HCK A;  1YIT A;  2LZ6 B;  2O9V A;  1M1F A;  1MUZ A;  2RI5 A;  2RM4 A;  2EQK A;  2RD1 A;  1VQK Q;  2GTJ A;  3NTH A;  5GAM h;  4HT9 A;  4PFZ A;  3IQL A;  2GFA A;  2K57 A;  4ZN1 A;  4FYV B;  4LNP A;  3KFV A;  4C0F A;  1M4Z A;  1D3B A;  4QQG A;  5GAN e;  3JCM e;  3KBG A;  4EMK A;  3OYA A;  3EG2 A;  4FW2 A;  4N4I A;  4NL3 A;  1AD5 A;  1OYX A;  2E6Z A;  2HAX A;  1YI2 T;  3G71 A;  5GAN h;  3JCM h;  4BD3 A;  3QUI A;  1Y96 A;  2QA4 A;  1PD1 A;  1MMD A;  2M16 A;  3DLL A;  4X9C A;  1QCO A;  1NBE B;  3RMS A;  3H0F A;  1P92 A;  4A63 B;  1WXB A;  4JJD A;  2JW4 A;  2X4X A;  4X1V A;  2AZS A;  4WTO B;  4HCC A;  3FEO A;  1BI1 A;  2FVU A;  1N5Z A;  4RMO A;  4QKU A;  4LN2 A;  2L0A A;  2SEM A;  1DJ7 B;  2LCC A;  3OW2 A;  4XQ3 A;  1CSK A;  4C92 D;  4CC4 B;  2M0O A;  2KSS A;  1XOV A;  1K9A A;  4Q5W A;  2DZC A;  5A2Q E;  5CQX A;  3P8B B;  4HKE A;  1B34 B;  1QVG A;  5IXB A;  4C0D C;  2RMO A;  1ZUU A;  5LJ5 e;  3OBW A;  5CKH A;  2AK5 A;  1PRM C;  2DYB A;  4MML A;  4IUV A;  3A8G B;  1VQL Q;  3RDV A;  1IRE B;  1I4K 1;  3MEW A;  3VYH B;  5CK9 A;  5D6Y A;  2MWP A;  3UPU A;  2X4Y A;  2MPX C;  1OZ3 A;  3EG3 A;  2L3Q A;  2XDB A;  5HCK A;  1W6X A;  2K3Y A;  5CCA A;  3QDF A;  4CC3 A;  2OTJ Q;  4BUG A;  3OQ5 A;  3X25 B;  3QHS A;  3C95 A;  3QJ6 A;  1KD1 U;  1YBY A;  4XU1 A;  3VS2 A;  3HRU A;  3E9G A;  5KYY A;  3VS3 A;  1ZBJ A;  1EX4 A;  1YIT Q;  2QXF A;  3CXC A;  3LX7 A;  1S72 T;  2J7I A;  3EGD B;  2DL4 A;  1LVK A;  2KYB A;  3MEU A;  1ZUY A;  3H0H A;  1TSF A;  3OYC A;  4MZT A;  3CCR A;  2K3X A;  2PNI A;  1MGQ A;  1SSF A;  4M75 D;  4M77 G;  5FRM A;  4FSS A;  2VKN A;  2BZX A;  1OU9 A;  3CC7 T;  3QZ9 B;  3PIO A;  1IHV A;  4XTV A;  1SHF A;  3G71 Q;  3GBQ A;  2QQS A;  4O5V A;  2XU8 A;  5DLO A;  5DM7 R;  4R56 A;  2QA4 Q;  1H92 A;  3PE0 A;  1VQ5 T;  3PIP A;  2F5K A;  3M55 A;  1W2B A;  3I35 A;  4EDU A;  2E64 A;  1T0J A;  2MF2 A;  3M57 A;  2NUP A;  1QCF A;  5GMK e;  1RAA B;  2J6F A;  3CCJ A;  3OMC A;  4BE0 A;  1RAF B;  1H3Z A;  1UJ0 A;  2RHU A;  1YFN A;  2JXB A;  5GMK h;  1M8V A;  1YIJ A;  2DER A;  3QII A;  3ASK A;  5HK3 A;  2QDY B;  2E6N A;  2VUB A;  4A4H A;  3EFS A;  2B86 A;  4MMK A;  1ARK A;  2YLC A;  1JRI A;  2O9S A;  4X9D A;  3ME9 A;  2LQ8 A;  3SWN B;  4M4Z A;  2L3P A;  1IZ6 A;  1FMV A;  3EG9 A;  3OYK A;  1YJW A;  3SB2 A;  4B6M A;  2O2O A;  3NPF A;  5GJV B;  3CBM A;  2O31 A;  3CQT A;  3H6Z A;  3VU3 C;  1UHC A;  3VS4 A;  4E7S A;  2XK0 A;  2PQW A;  2PTK A;  1MMA A;  4Y28 E;  1N6A A;  3HP9 A;  4FW1 A;  2HSE B;  4JLG A;  2EBP A;  2ABL A;  2IIM A;  2CZ6 B;  2LJ1 A;  2RHY A;  4M78 B;  4J6W A;  2QAZ A;  3LH5 A;  4QVD A;  1KQ2 A;  1KIK A;  3EGU A;  3RNJ A;  5GAO q;  4KBM B;  1TUD A;  1VQN T;  5CQY A;  2K2V A;  2RJF A;  2YDL A;  3CCR Q;  2HQH A;  4M7D F;  1Q7Y R;  1EIF A;  4JZ3 A;  2KBT A;  1ZHI A;  3QXE B;  2G6F X;  4IIM A;  4JJB A;  4LUD A;  2GCX A;  5KYX B;  4TVR A;  2BE9 B;  5GMK i;  4C8Q F;  4FT2 A;  3OSS C;  5KYW B;  2GQI A;  2LJ0 A;  1KC8 R;  1VUB A;  3QDR B;  3ZL7 C;  3TU4 K;  1AWJ A;  4IUT A;  2CP6 A;  2PUK B;  3CCQ T;  3CBO A;  2JMC A;  3MP6 A;  5LJ3 d;  4LDY A;  3HRT A;  4PFO A;  1YHQ T;  3CCJ Q;  5LJ5 g;  4KH1 B;  2L8D A;  1G83 A;  4GLM A;  1PHT A;  2MCN A;  3MCA B;  2K79 A;  2LDM A;  5IHK A;  3M4G A;  1B7T A;  3BW1 A;  1ZSZ C;  1ZX6 A;  4QT7 A;  2Y90 A;  1XJW B;  4PLL A;  3FJ5 A;  4PJO F;  4HA8 A;  2F2V A;  2V1R A;  3F70 A;  2X9H A;  4M7D C;  3UA6 A;  1M1K R;  3VV0 A;  2I2L A;  2G3R A;  3H9N A;  1H64 1;  3DKM A;  4B9X A;  1I5L A;  2QEX A;  2DLP A;  1K73 R;  4ATO A;  1T3L A;  2ZPI B;  4C8Q C;  1YJW Q;  1K0X A;  2MYS A;  5FU7 C;  5I21 A;  2DTO A;  4PJL A;  2DL5 A;  4PK4 A;  1X6O A;  4JJN K;  2DYI A;  3L2R A;  1HYO A;  5KE2 A;  2LQK A;  3M5A A;  2DE0 X;  2EQI A;  5KYN A;  3MPU B;  3LW5 E;  3NHN A;  4Y91 A;  3MEV A;  1VA7 A;  1PWT A;  3PVQ A;  5HY6 A;  1TH7 A;  3G6E A;  1PD0 A;  1C6V X;  2FPF A;  2GBQ A;  3M4Y A;  3X20 B;  4ZGJ B;  1IO6 A;  4Z02 A;  5GAN f;  3JCM f;  1QKX A;  4DQ2 A;  4JJC A;  2QQA A;  2CP5 A;  4A54 A;  3RER A;  2P84 A;  4PJO C;  5IHN A;  1BI3 A;  5D6W A;  1VQ4 A;  2XKO C;  5GAN 4;  3ZFJ A;  1U1S A;  1SKU B;  2E4H A;  1NE8 A;  2RHX A;  1VQP A;  1R0B G;  3P8D A;  3TQ7 P;  5EC7 A;  2KYM A;  2JMA A;  2DRM A;  2V1Q A;  3FC3 A;  1M2O A;  1N8R R;  5FRN A;  4Z8A A;  2PVG B;  3A8H B;  1WGS A;  3TVT A;  2VVK A;  2JM8 A;  4XK8 E;  4M77 B;  1R77 A;  2CP2 A;  3GPL A;  1PC0 A;  2DTI A;  5GMK l;  2R58 A;  5KYU B;  1RAI B;  1WX6 A;  3TRE A;  3E9F A;  5ECA A;  1ZSZ A;  2Z0W A;  4JLI A;  5LJ5 f;  5GAO l;  2D8H A;  1PKT A;  1Q7Y C;  1OZ2 A;  3UAT A;  1TTH B;  4M7A F;  1UEB A;  4M7D A;  4WF2 A;  1WQ7 A;  2QEX Q;  3OY9 A;  1X01 A;  3PFS A;  2RK2 A;  2JZ2 A;  4C5I A;  3CCV Q;  2X51 A;  3CCU A;  5IH2 A;  1D3B B;  1W70 A;  3ER0 A;  1OOT A;  4EMK B;  4J6Y A;  4C8Q A;  3CMA Q;  1GFD A;  4J7F A;  3CCL A;  1OPK A;  3MET A;  2EGC A;  5CR2 A; 
#chains in the Genus database with same CATH homology
 1OX8 A;  2QAZ A;  2NYS A;  1TWB A;  2QAS A;  1OX9 A;  1ZSZ A;  1OU9 A;  1OU8 A;  1YFN A;  1ZSZ C;  1OUL A;  1ZSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...