1ZT4A

The crystal structure of human cd1d with and without alpha-galactosylceramide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
272
structure length
272
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human CD1d with and without alpha-galactosylceramide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d
total genus 68
structure length 272
sequence length 272
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zt4A01
1P6AB 2FLRT 1RUMH 1W2KT 2BOBB 2HT2D 2VDNH 1PZ5B 2ITCB 1P7HL 4M7JL 3HE6D 2D7QA 2EE3A 5BS0D 1ORQA 1BM3L 3U82B 1S5HB 2YA0A 1OAXL 3F7QA 2V17L 1J0IA 4RGND 4Q0XH 5C0BD 5BO1H 3Q3GA 3LPGA 3B8YA 1XZ0A 2H1PH 1ZLSH 3P9MA 4K94C 4PFEA 4Y2DC 4OZFB 1MY5A 4L4VE 1RURH 1U2CA 2DIBA 4WI9A 3U9UB 3MOBL 4K3GA 3R0MA 5I15H 2ICCA 5DRNA 1ED3A 5CD5D 1T66C 2PYED 1JHTB 4WDIB 4XHQA 5L88L 3E6FA 5GSRA 4KHXH 1KJVA 4X6CA 1EHXA 4P9ML 1JGLL 4NHCL 1H8NA 4FFVD 1J8HD 1CICB 2H8PA 1IGTB 2BNRE 1JNLL 1J8HE 3LKRA 2V7NA 4NC1E 4EDXA 4JEGB 3GMMB 3DXAE 1QD0A 3QXDB 3MTRA 5BV7C 4IS6A 3C8KB 2QQLL 4WNQA 3UZVB 5CEZD 1FG2B 4YK4C 1CD0A 1I9JL 2Z93A 1F3DJ 2FEEI 1FZJB 2P5EB 4LLVB 2GTWB 2FJGA 3JTSB 4MCYB 1RK0A 3QAZB 4B7IA 1QR1B 2VDKH 3F8UB 4HD9A 3EHBC 5I9QC 1KXVC 2H26B 3PL6B 5GRZA 3TH2T 4YHLL 4DQOH 2GAZA 2G5BA 4IDJH 4XXCA 3DXAA 3O3BB 5IOPB 4RDQF 4O4YH 3TF7A 1A3LH 4TVPL 4XNXH 1C12B 2VLKB 3D3VB 2R23A 4KGLA 1VKXA 5HYEA 5A3IC 2HFFB 1N6VA 4TPRL 2CLVA 3OKLB 3EYSH 3QI9B 2DLFH 3BVNA 4DEPB 3JTTB 4S0UC 3IDYC 3WO4C 4BYHA 5IMOB 5J6GA 3C2AH 4UT9L 1WZ1H 2IQAA 2Q7NA 4W68A 4WUKH 5FHBH 1PGRB 1JPGB 4E41D 4HX1B 2DD8L 4WFFE 3B2VL 3BRFA 2CRIA 1RJZA 4X6BB 1LK3H 2A9NL 1DQML 4HEPG 5ITFA 4G9FA 5IJVA 2BFVH 5H94B 4Z95H 5SX4I 3UP1A 3VRLF 4EI6A 1U95B 5FGSA 3FB8B 3BZ4B 5DURD 2EO1A 5M95B 1NMBL 1UVQA 2W0FA 3OXRB 5ALBH 4LIQL 4P23B 5HGAB 4NOBA 1OPGL 4X5WB 1R0AL 3PP3H 3BEVB 4YHPB 4J3SA 5EIVA 3LEYH 5IQ7L 4TVPD 5E1AB 1CG9B 4GMSL 2EDQA 2JJTC 1J87A 1VSCA 3OHXB 4Q9BA 3ZDYE 1JYXA 3HMWH 2NY0C 1KTLB 5DUPH 4HMCA 5DK2A 5DGQA 2VAJA 5AWNL 3PV7A 3RNKB 1S7XA 4KTYA 5DI8B 1ONQB 1L7TH 1MFAL 3LS5H 5F1NA 5HHNA 4I18C 3I9GL 4F7PA 1FZOA 5I1AB 1ZHBB 2NTFA 4ERSL 2EECA 4KJPD 3VGBA 2AEPH 5AEAA 5A2FA 1NGPL 4A6YB 4ZFZB 5I19L 1OLLA 4QRPE 1U9KA 1GGUA 3T3MF 3F7YA 2NY3D 4HXBL 3CX2A 3S97C 2FB4L 1DQQA 4MD4B 1NFIA 2BNUA 1J8KA 1IGFH 1R24A 4XWGH 5BZWB 5GS1C 3AB0C 3TPUB 4PJ7B 2F15A 5ESQA 4Y16A 3QHFL 4P4RB 3OSKA 3WS3B 3KLAA 4YDKL 4I3RL 3X3FL 1XT5A 3C60B 5CJOL 3IDNA 1QQDB 4PV8B 2V5SA 3MV9A 5EO0B 1CXFA 2DQTH 5H2BB 3ISWA 5C86A 4RGMC 1RY7B 3PHQA 5D1ZD 3CLFL 2AXJA 4TUJB 4NJ9L 1GGIL 4MB4A 4UDUA 1MAJA 3SKMA 4WEBL 43C9B 3MSPA 1WTGT 2HH0L 1K8DA 3SDDD 3QDGA 4CJ0A 4Y4KB 3SOBL 2R4SH 2X44D 4JG1H 2CXKA 1D5XB 4MZ3A 4GQ9L 4BZ2L 5GRVL 1WV7T 2P8LB 3I85A 1MRDH 3PDDA 3TPKA 2CK2A 1U41A 5BW7A 2NY7L 1MAML 1XIWB 4S10A 5INDA 5F1NB 1MJ8L 1FYTD 1A3RL 3PQYB 3RX7A 3TN0B 2LABA 2JB5L 5TDPB 3DVNA 5KVGL 3EO9H 1Z0MA 3B2VH 4ONHB 3P4NA 5DFTA 2J4WH 2VXVL 4J6RH 4TSCL 2FECI 2FB4H 5FYJD 4G6AD 3C2AL 1A4KA 2XXCB 2X89A 1X9QA 4WY7L 2V7HA 4XP4L 1JYNA 4WEMB 5C0FA 4DGIH 3NZHH 5BRZB 2FX7L 2AJZA 3VA2C 3TYFA 3ZYJA 2DQJH 1JGUL 5JHDD 3CK0L 3GIVA 5J9PA 3WFDH 3E6HA 4ZFGL 1HILA 1YEKH 1UZ8A 1JJUA 4IRZL 2KBGA 4BZYA 5TPWL 1NCDL 4I13B 4LRIA 4L8SB 1MCKA 1NMCC 1ETZA 4HBCL 2AEQH 4IRJD 3TBVB 5EOQL 1K4CB 4FS0A 1R5WA 3BW9B 5LVEA 2I24N 3IFOB 2R29H 2Q7YB 2CGRL 1KACB 5TE4H 1XGQB 5I8CA 4K94L 3RKDC 9CGTA 3PGFH 2PYEB 1RZJL 4HT1L 3Q6GH 2A6IB 2XXMB 3SDXB 2DLHA 4JN2A 5GSVB 1BQUA 1IBGH 5CINL 3DXAB 5GRUL 3ULUE 2IANB 1CE6A 3RVVD 4WGVB 2BXYA 4X4ME 4LVNC 4OTXH 2WBKA 3MCKB 5L6YL 5DSCA 1KEML 4LQFL 1YEJL 4BFGA 4G8GE 4ERSH 3GI9H 5GZOC 5FA4B 4FXGA 1HXYB 1NC2D 1A1MB 4K23L 4YO0B 2EDDA 5EA0H 2UY7A 3BH9B 1CDIA 3EFFB 4M9OA 4DGIL 1CL7I 1FL6A 3QEHB 2BNUB 1Q94B 3DMMD 4GXVL 1FDLH 2MKLC 32C2A 4P2QD 1LE5A 5GQBA 4JHWL 3TA3A 4TSAL 1G7IB 3PQYA 2HN7A 4HMEA 3KR3L 4AIOA 2Y23A 1WEJH 2HWZL 4X6BA 4AG4L 2XZQH 2WSKA 3ARFC 1W72L 2ERJB 2RFXA 4Y2DD 4BFIB 4EDWL 4HPYH 1KIUA 3T1FA 2OTUB 2CKBA 3IKCA 4C56A 5F6IB 5DFVD 3D2UD 4WJ5B 1KCRL 4L3ED 4Z77B 4IRSC 4MQTB 5KSBA 1FSKC 1S7VB 4GG6E 3EDEA 1PYWB 1F58H 1MCNA 4NKDA 2A73B 4WFHD 4G9FD 4C56D 3OTTA 4MXVF 1XGYL 4PJEB 5JO5A 4ZUUB 2V9RA 3VRJA 1MI5A 3KLDA 4PLNC 4P23D 4QT5A 1ZE3C 4N0YH 4LP5A 1PVHA 4FTVE 4YHPA 4EBQH 1EZVY 3HC0A 1GOGA 4APQD 5DWUL 1D9KA 2NXYC 1G0XA 1KJ3L 3UCRA 4RAUB 1ETZB 1BREA 1WLHA 4PGJA 1ZANH 3MRHB 4ZNCD 5ERWA 5F89B 4P2YA 4NM8L 4PJEF 5EU3A 3I84A 1J1PH 3CSYB 3JWDH 3MBXL 3UJJH 1RVFL 3T3PF 3UO1L 2EXWC 5HYSA 2AK1H 4XWOC 3NN8A 4MX7A 4JDTH 2IJ0C 2Q76B 5C7XH 1HXYA 4CW1B 3L3GB 1B90A 3GMOA 1NFDA 4DZBB 2AV1B 2X09A 4B7LA 1F4WL 3TCLA 4U1IB 4MNQD 1QBAA 3TIDA 1FYTB 2Y7QB 2EDYA 3QEGL 3G9VA 1Y18B 2BSED 4XI5D 4EKXA 4DAGL 4HUNB 3T0XA 3MJ9H 3OR7B 3D6GA 1SBBA 5B3JE 5IQ9B 2R0WL 2DIAA 3BIBX 3LVEA 4ZS6D 3BDBA 1SMOA 1V7MH 4YFLI 3LEXA 1JV5A 3KS0H 3PWUA 4QNPE 2GT9B 1MFDH 4KROB 2D03H 1QSZA 4KI5D 4MNHA 2X4UB 3P0YL 4MXWH 1S9YB 4PTUB 5ADOH 5EOQH 1TJIH 2AABL 2YD3A 4N0YL 4KGJA 3A6BL 4OLWL 3DGCR 4X4YB 1KENL 1BBJB 1ZA6B 2V2XB 3TIEA 5JHLH 2H32H 2DIJA 3GSVA 4GXUN 4JZNA 3ETBF 1I1AA 4PJGF 4GW5B 3SKOA 3CNKA 4JN1H 4M5YL 5D8JL 4N9GA 5DD1H 2BNRA 4F3FB 3RA7H 1WBYA 4Z9KB 3STLB 4LLQB 3EUUA 3LKSA 4Q6IC 1HCFX 1F90H 5HGDA 1AE6H 4M9PA 5CWSA 3AVEA 4RMVA 3WS6C 5JHDB 1LDSA 1C5CH 4GS7C 4CMHC 1XGRA 5JIKA 5GS0C 3O3AA 3BDXA 4TSAH 2JJUA 2B20A 1G7HA 4HK0A 3S4SA 1FYTA 2VXQH 4N0UA 4K7PL 3HFMH 3NCMA 5FA3A 4IOIB 4XNYH 1D5XA 4GMSH 3QUXA 5JW3H 4YHLH 5JLZA 3HE6B 3QXVA 2YMXL 3ECBB 2BOCA 2BSSA 3GMOB 3BEWB 4X8JB 5HJ3A 4Z7UE 4TUOA 3DUHA 2G5BB 3TFKC 3MLUL 5LKNA 1AD9A 1TITA 4P2OA 5E5MB 5DRZB 1AR1C 3REVB 3UJTL 1LDPH 1N3NA 5DD3L 1VFMA 4GBXA 2DL2A 3UZQA 1K3ZA 3JVGC 1TZIB 4JAMA 2JKXA 1K85A 2C5DC 3BUTA 4U31A 5B22A 3UAJC 2UWEE 4EI5B 5CJ5A 3KGRA 1SBSL 4P57B 4NKIL 1NKRA 4XMLL 5F9WB 2DMCA 1P9MA 2CIIB 4PRDB 2AV7B 5IFHL 1RK1A 4HAGA 4GG6B 2I27N 2A6IA 4K7FA 3KYMB 2ZZUT 5CS7A 3MACL 1UEYA 3U0PB 3AU1A 2ESVD 3KXFA 4A2MA 1N5AA 1QRNA 1N8ZA 2HFGL 2HJLA 3VXSA 3BW9A 5ABDE 3HUJA 4FHBD 4X4ZA 1IGYA 3VJ6A 4X8XA 3QEGH 3WDHA 4JPVL 1FBIL 1IRAY 5F7LB 4Z7NF 2OLDA 2ZUQB 3FB5B 5EFIA 4H8WL 3RTQC 2MQ0A 2GY5A 3EHBD 3BKYH 4F3FA 5GGTL 1DN0B 4G9DA 3U1SH 4C83A 3C87A 5FYKD 3D3VD 2OXHA 4R4FL 5E56A 2OQJA 3FT4B 1D9KD 2D03L 3G5XA 3RI5F 4R8WH 4LFHD 1ZV5A 4JE4B 3NZ8A 2ARWA 4FQ2H 4HIJB 3GBNH 4WWKD 4QKXB 1CFTB 5HYQB 3SDAA 2CLZA 5JOFA 1MAKA 3AAZB 3MV7D 5TF1H 3LQAC 2P5ED 2GK0A 1P9MC 5DJXA 1YMHA 1WIPA 3ALPA 4GRMA 1Q94A 2XICA 3UTQB 2A0LC 3G5VB 3LN4B 5DO2D 5C0IA 3BYTA 3CFBB 1QA9A 1IQDA 2HLFC 4G6FD 3PJSA 1J8HB 3D5OF 1F2XK 3MLTB 3DHMA 4MDIA 4PBWD 3DV6B 5ILTL 1XCTB 1RJZB 5TQ0L 5D7JB 4MAYD 3TEUA 4AH2B 2QHRH 3U2SB 2VLLA 3PGDA 2Q8AL 3SGJC 1CQKA 3GSOB 4MA3B 3QJHB 3FOLB 4H0GA 3CFEB 3H42H 4YDVB 3OF6D 4DK6A 3QPQC 3ZT6A 3FKUS 4L4TA 3PJSB 1YPZB 1ZSDB 4DUWA 2VDOL 3FQNB 1ZS8A 3VI4F 1G9NH 3T65A 5CBAB 5I75B 5JZ7D 2CIKB 2MHAB 2IG2L 2FSEB 4LAJH 1S9WA 4M43H 4FABL 4DTGL 1G1YA 2VN4A 5F21B 4FG6D 3RGHA 3RTQB 3MV7B 4FRWA 2VQUA 3TO2B 5GJSL 3P9MB 4UTBH 1MEXH 4PYHA 4S0SD 1RZGB 1ZS8B 3KYNB 2DI7A 1ZTXH 4FQJL 4XC1L 2CDFB 3CLEL 5EOCL 4I0CC 5FO8B 1ZKAA 2PCPB 3H3PH 2J5LB 4NWTL 3LS4L 4O2CB 1B4JH 4N5EC 2IPUK 4ODVL 4KJQD 2RJMA 4MCYA 4NO5B 4JO4H 4C58B 1A47A 3WXVL 2X4PA 5I2IB 4POUB 5DJCA 4I77L 1FZOB 5IT2L 5FK9A 1I1AC 1N0XL 2DTMH 2VAAA 2VERN 1PX4A 1X5KA 2RBLA 2NW2B 3BWAA 4J8RB 5DEZA 4CVZB 1G7MB 3RIFK 1QFWH 4DKFL 3PHOB 1TMCA 3RUGF 4S1DC 4D3CL 2I9TB 4PRIE 1U91A 3DBXB 2GFBB 4JVWA 3QUXD 4LPXA 3TO4A 3S36H 4I48B 3EJYC 4PS4L 1QP1A 4DGVL 3FO0L 4Q9QL 1J05A 5KSUB 5EORH 4NO0D 2YD7A 1T22B 3HZVB 4K3DH 4EI5D 5E6ID 1XF5A 4GH7B 1EAPA 4NQUA 1RQ5A 3P0VL 4KI1A 5F9JB 3KVQA 4I9WE 3L3IB 1YEIH 2EDOA 3QZWG 1HINH 5MERB 4I9WD 4KROC 3WUWG 5I0ZA 2NY5C 1G6RL 5HYJE 1OSPL 2F54E 1EMTH 1XGYH 3MC0A 1LEIA 5HVHC 4WFEE 1NGZA 1BJ1J 3K8MA 3TJEL 4U6VL 5A1AA 1FSKB 1SYSB 3GUTA 3BT2L 4I5BA 1OOAA 3VXSB 3CX5J 3GMMA 1OP3H 1UWXH 3PGFL 4Q2ZB 1IQWL 5TF1L 3VGFA 4YC2C 3E3QC 5B8CB 2V9TA 1QACA 3GB7A 2G60H 4OF0A 3W0WD 5CAYB 1QLRA 2YN5A 5EU6E 4F7CA 1JRHI 3QDME 3QR2A 1CGTA 5D96C 5I73B 3KXFB 5L9DL 3G6JA 1LWRA 4HEME 3MMEA 3S37L 1MRCH 1WBZA 5C0CA 1HXMA 4K7PY 3QPQD 1BFOA 4CN1A 1FGVL 4UV7L 3LKNB 1U8KB 4N8VA 1MCPH 2E7CA 2NTFB 3GSNL 3CH8A 3VH8B 5BRZA 1FO0B 1BWMA 3VFPA 4H0IA 3QEUB 3ZKSD 5EU4A 4L1DA 5SWZD 2KZ1B 2BOBA 5F7NC 2NY4B 4Y5VC 3MRKB 3X3FH 2E9JA 5CZKA 3L5WB 4POZD 2WUBH 5E00B 3EZ8A 4JM4H 1G9NL 3BZEB 4O51A 4L8BA 3BMWA 1I9IL 3MLZL 4PRHA 5GISH 2ICES 1FRGH 3TO4B 3CUPA 3EYOA 3EO1A 4PJ9B 1XGTB 5J13C 2AP2A 1MFEH 4NWTH 1A14L 3BIAX 5B38B 1IILE 4UB0L 4TRPL 5CMAA 1FC1A 2DBJA 3M8OH 4OFYD 1F3JB 1MCLA 4F37K 4PDCE 1ACYH 2K7QA 3RKPA 2C3XA 5CLWA 1RV6X 2A77H 2ADGB 2B5IC 5C09E 5HDLA 4LVEA 3L3OA 3ILQC 3HZKA 1P4IH 4Y19A 4BQ8A 1XGTA 4PJFA 4WFHE 1FGNH 2R69H 2CRZA 1EV2E 4O9HH 3QDGB 1DE4A 4FXLA 4JM2D 3HE7B 1YNTB 5GPRA 1SJHB 1TLKA 1DQLH 5T3XD 5DA0B 1TPXC 3VDAA 5FGBA 5C92A 3QDJE 3BQUB 4XB8A 1T20B 4S1QH 3BHBB 3SY0A 4PS4H 4M4PA 5H8DA 1J5OH 4RA0C 1YEGL 4X9HA 3ZKND 4H8WC 1MCJA 3SGKA 3OJ2C 4U1NA 4XVSH 5DJZA 3B6SB 1BGXL 4CDGC 4TTDD 2YD9A 1K4DA 3WHXA 1REIA 1U8QB 3OKOB 1ZHLB 3GK8H 3I6LE 2D4FA 3V6ZA 2MCPL 1C16A 3L5IA 4I4WB 3QDMB 3SDDB 4MXWL 3SDXA 2HJKA 3LOWA 5LGKA 3PWUB 4F7TB 5ADOL 3FQNA 1D6VH 2JK5A 4JFXA 4YIQB 4JDVB 4GKNA 1I8IB 5GS0H 1UYWH 4ONGH 1ERNA 3N1FC 1YMMD 5CP7B 1HE7A 3OAYH 3T4AA 1T1YB 1A6PA 3STBA 2VE6A 4QF1A 4D9LL 3HZMB 3MBEC 1XF5B 3V7AG 4RZCA 4OM0H 4U6VH 4GQ9H 4BZ2H 1KLUA 4JVPA 1CLZL 2GTZB 1I8KB 2Y36H 3D18B 3EYVB 4U1KA 3BX7C 3RL1B 4FFYL 4N0RA 1B6UA 5DUMH 1LEIB 1CDGA 3CIQA 4YE4H 5GRJH 1C5CL 5EC1B 1MCPL 5L2KA 2HFGH 5KANG 3MBEB 3AREA 1DQJA 1T6VN 5I71B 3AFLA 5KW9L 1BP3B 4NPYA 3QCTH 5EN2A 5DSCB 1G7HB 3NTCH 4LPYA 5C08A 2IAMA 4K8RC 1YEDB 1UACH 4MHHG 4NBXB 3ARGA 2XZCH 5JW3L 4L9LA 1KJMA 2WLZA 3N1GC 3VRJB 5IBTH 1JK8B 4S1RL 1Q38A 5C0CB 2ICWA 4ELMA 5CEYA 3HI5L 1GC1H 3W0WA 3CU1A 5IVXA 4KV5F 3JV5A 4P5TA 5E8OA 1OGAA 3WYRA 3OKLA 3T0EE 1I8LC 3EYOB 4UB0H 5FYKH 1XR9B 1WJ3A 3KPNB 2ADFH 1Z9SA 3SGEH 3ARDC 5I1HL 4M6MH 5J9PB 4EOWH 3C6LC 3QO0A 3VFOA 2GJ6E 4UINH 2Y36L 2YOCA 3Q6GL 4HT1H 4FQLH 4YHML 5J1TC 3CXHJ 4YUEH 4AT6A 4UQ2B 3QAZC 4LPUA 3JUYA 1AKJB 1FL5A 5MEPA 5B21A 2PR4H 1KGCD 2HTKD 2VABA 3O4LA 1E4JA 5CILL 4K23H 3MUHL 5IHBA 5GGQL 3GBML 5EZLA 2R2EB 1ZLWK 4QHLA 1NFIB 3ZKNC 1HH6A 1FDLL 1LEKB 4LSVH 4QWWD 1F4WH 3TN0D 1Y0LB 1ZHKA 1Z6JT 2O5ZL 4S2SB 3P11H 4S1RH 1DEEB 2JJSA 4JQXC 3UDWA 1DEDA 2DLTA 4OZHA 3SE3C 2X5PA 1QLRB 3QUZB 3W0WB 4MJ6B 1MFAH 4WY7H 2ENSA 5HHNB 4R26L 4ZPVB 2J2ZA 3K7UA 2VUOA 3P9WB 1RZ8B 4J3UA 4S1DD 4D9LH 1FIEA 4JO1H 2IAMB 3AMKA 3GSQB 1FIGL 4JG0H 2ZUYA 3ULVC 4MJIE 1CGVA 4UBDD 5HYFA 5C6TH 4HAFA 3H9HB 3QIUB 4UUJA 5BOZG 4ZO9A 3V6BR 4NFBA 4AT6B 1FLRH 1CL7L 3GJFA 4DOHB 2FWOA 1L9MA 2WBWB 3WS3A 1S7VA 1BOGA 5E2JA 1NCUA 3S35X 1GYAA 5J1SC 4NCDA 1X5IA 4UNVA 5J0BA 3LZFH 4ZFZA 2NY1D 3TF7C 4N5EA 5FB8A 3S6CA 4LCYB 1BAFH 2GJJA 4HULB 4O00A 4XXCC 3MRBA 4KTDH 2W9EH 1I9RH 4CGTA 1YEFL 3UTOA 4F57L 4IS6B 5DJ6B 1S9VA 2GYSA 5DZOA 2X4UA 4PJCF 4OI7A 1SEQH 5TGBB 4WU5A 5HD8D 1A22B 3W39B 3U9PH 3MRRB 5IV2A 5E4EB 4K7PX 1J1OH 2DKUA 4XAWL 3FTGB 1KJ2B 1B4JL 3MRLB 3NCJH 5L7XL 1T0MB 1CE6B 4HS6A 1N2RB 3SGJA 1T7WA 5JW5B 5F8RC 1ODAA 2MJWA 2NR6C 1A7PH 3EZJB 1FIGH 1QSFA 3H9SD 3RVWC 2AABH 1KN4L 1A6TA 2W0LA 5T1DH 5IKCA 3GMQA 3MV8E 3FO1A 2W9LA 3TV3L 2ADFL 1HWHB 4PV9B 4YWGL 3EOBA 1S7TA 3RL2A 3HUJB 5C08B 3AREC 3DPBA 2K7PA 1CU4H 1RZKC 3BGFC 2LE9A 4GSDL 1AE6L 1QRND 4PJEA 1P6FA 3BD5A 5D7JA 5FM5O 3RNKA 4WRLA 1T89A 5TPWH 5E6YA 2YUXA 5D2NE 1I9RL 3O11B 4PY7A 2XYCA 5HYJD 3LQZB 1FNGA 1NBZA 1MVUB 2EYRB 4X99A 4KU1A 1J0YA 4XGZB 1RIHL 3UXFA 5L6YH 2HJFA 1F6LL 1U8JB 3UO1H 1D3CA 1TPXB 2NXZD 3BESR 3LN5B 3VFUA 2NZ9D 1MCFA 5T5FH 1DBKH 5ICYA 2VDML 4YK4B 1IC4L 1KLUB 2EO9A 3HE7C 25C8L 1LO4L 3BT2H 2C4FU 1QSVA 1IGCL 2J6EA 2XACC 1PX3A 3RDTD 4DOHE 5I0DA 5FM4A 5C07A 4LP4A 5D1QA 2H1PL 1UXSA 1YYLH 3EO0B 4Z8FH 2EEAA 4Z7UF 5FM5M 4KC3B 4BK5A 1I4FA 3VI4E 4X4XA 3P30L 1A1NB 2AJUH 5D7IA 1YMMB 5D93C 2ZPKH 3GKWL 3KPOB 5JXED 1OSZB 1IGYB 5D7LB 3ZE0E 5IEKB 1I3VA 1T7XA 4P9HL 1GZQA 3M07A 4HV8B 4NQDA 1MIMH 3PIQB 2P43B 4FZ8L 1NGYB 4LCUA 4LARL 2FX8H 1E4XI 1RU9L 5HGBA 3ZKXC 5DRXB 2P46B 3MLPA 5HGHB 1FVCA 2BNQD 3FO1B 4XAKE 4UAOC 2NLJB 4NQSA 3VXTB 3RRQA 4NHUE 4MJIB 4Y5YB 4KQ4H 3P40A 4JFDD 1I7ZB 1F6AB 1H3GA 3VE0B 2W9EL 3UJJL 4M7LT 1X6NA 2PXYC 3C9NB 1OTTD 4I3GA 3OGOE 3AS2A 5DK0A 1X4YA 3MRNA 3HUJE 1NJ9A 3EDDA 5LQBH 3O2DA 1W0VA 1MCIA 4YHIA 4PJ9A 2DQIL 3E8UL 4LDLB 4OM0L 2Q8BL 2XG4A 4KQ3H 2BJMH 2YC1A 3GKZA 3MLTA 3LS4H 2YPLA 1KCVL 3ZMRA 5TGBA 1FV1B 3DVGB 5F7KC 3R06A 2C1OB 4L4VB 2GITA 1DFBH 4MJ2A 4U7MA 2GFBA 3JWOC 4UBDC 5TDOA 4HJGA 5CGTA 1NGPH 3FFDB 4I48A 1Z5LA 2NW3B 3TBWA 2J88L 3WHE1 5F7HA 3HZYB 4M6NH 3ME0A 3C5JA 2PO6A 1BM3H 4M4RA 2DB8A 2YS4A 5C9KA 4EZMA 3IDGA 4HIHA 5I76B 1MCOH 1H3WM 1YJDL 1F8TH 4LSSL 1UZ6F 5EZIL 1FO0H 1SY6H 4L8CA 2GJZB 2IADA 1WFTA 2I07B 3MA7B 5FYKE 3U30B 2DM3A 4KI5C 5HGAA 5JPMA 3E2HB 1N7ML 1GGYA 3CXDL 5CGMA 4U1LB 5E8EA 4MAUL 4YLQT 3REWB 5I15L 4QRPB 3NPZB 4XPGL 2B5IB 1RIHH 4LHJB 4XI5C 4M5YH 5DD1L 3MUGA 4PJBF 4QTHB 2WW8A 4RDQG 4URTB 1BVZA 2IG2H 2NY6B 4NQCE 5GIRB 4IMLA 3O4OB 1F11A 1EUUA 4U1LA 5E8EB 3O6ML 4FFEX 2DQGL 4OLWH 2HFEA 5IMLB 4J3TA 4LKCA 4XCNB 1F3RB 5BMFL 4LSTH 1TCMA 1N0LA 3BGAA 5KSUA 4HCRA 1P84K 1QO3A 8FABA 3MRPA 4Y4HB 4YPGA 2OI9C 4OZGF 1SJEA 3ZHLA 3I2CL 4J3XA 1QSED 2VDKL 2XPGB 2PXYA 1UXSB 1J0JA 3MNZA 1XF2B 2MTPA 1GPOH 4LGRB 4QRRA 3HS0A 1I3GH 3C6LD 1WCQA 2ZPKL 3GKWH 5IHZA 2B1AH 4WJ5A 1NCWH 1U8HA 2DTML 1VPOH 4R8WL 35C8L 5D6DA 2MKWA 2HT3D 5IW6A 4XXDB 4FQXB 1DR9A 4WHTB 1LP9E 1W0VB 4KRPD 3UPCA 5HYSG 4JFOB 4NQVA 5J6HB 4WUUE 2D0HA 3AS0A 4XPFL 3ZYZA 3RVTD 3QXWA 2VXQL 3QA3A 4QRRB 3PQYE 2W65A 4NRYB 4XC3H 3P73B 4LHUG 4HFWB 3BUYB 4CUCA 4X83A 3FONB 5KS9A 2PO6C 2ZUVA 4KDVA 4P2RD 4WI5A 3OV6A 5FOJA 4D94A 1PKQE 4NO2B 4RIRA 2NLJA 4NQSB 3VXTA 3X11B 3E3QE 4O58L 5AG8A 3B9AA 2GCYB 1EO5A 4WI2A 4CU8A 3IJYB 3F6LA 3FFCD 4ORZC 5FHAH 3IAQA 3UYRL 3MYJB 3MXVL 2DTSA 4NC2B 4WI6A 4C83B 4HS3B 4G8EA 2DYPA 4CKVX 3MLZH 5GISL 1MIEL 2VZ3A 4KDTA 3DVIA 1CT8B 1BVKA 5GS1B 1HYSC 5J57B 3HNSH 3CFEA 4YDVA 3UTSD 2F19L 1OP9A 1VERA 3TNNA 1MHPL 3HE7A 3EDKA 2Z8SA 5FO9A 4Q9RH 4LDOB 1AGFA 4A6YL 1P7QB 4OTXL 3LMJH 1WIUA 1JZ7A 3VW3H 2XZQL 1V7NH 3S37X 4DUXA 4X6DF 3SPVB 1FC2D 1OARH 4HZAA 2X1OA 2EKSA 2YXFA 1FAIH 2E9IA 5E0QA 1T89C 3RNQA 1HILB 3JXAA 4R97C 4TNVK 2WM0A 1HNGA 3QFJA 1U58A 2YD4A 1VFBB 4A2LA 3ARPA 1FV1A 3DVGA 1EEZA 3U0WL 2BHZA 4ZAKB 3KR3H 4ESKA 3ZKXB 2FD6H 2YWYA 2X7LB 1FFQA 5TDPA 3S3JA 2DF3A 3FO9A 1QG3A 2AGJH 4G3YL 5GGVL 1AC0A 5E4EC 1EK3A 5D5ME 4LGSB 3WEXA 1MREH 2XKSA 3SDAC 1DLHB 3CFDA 2HFEB 2VLJA 1CFSA 3TH3T 3L95B 1BQHG 4LVOB 3C5ZD 4JDTL 4AENA 3EJYD 1LD9A 3U7WL 4ZS7L 5A2JH 1JI2A 1AGCA 4XVJL 4KVCL 5L2JB 4V3DB 3ILQD 2Y07L 1QBBA 3BH8B 3BISA 5JPNB 4LCUB 4HDIA 3R1GH 2R1XB 4IMLB 4XTRC 1A6WH 3UYPA 1ES0A 3QIBB 2HH0H 1MEXL 1HOCB 1KIRA 1WBYB 2EDEA 3STLA 4PRPB 4XNZB 2X1PA 1IE5A 4BSWB 5BW7C 1UH2A 1X5LA 3G6DH 5KTEL 5D7JC 2N7BA 5IW1A 5K9JL 3V8CA 2BVQB 1OP5K 4LLDB 4F80A 3WJLA 1WUNT 5I30L 5DS8B 4NRYA 4JHWH 2APTA 4P3DB 4LFHG 1NQBA 4ZTOH 1WWWX 3U0TB 1BIIB 4L3AA 1P53A 4JRXD 1U3JA 2UZIH 1UC6A 4JRXE 4O2EA 4HZLA 3HA0A 2DBLH 3QUZD 1F4XH 1UJTA 3RWJB 4U3HA 2I9TA 5IB3B 5EUOB 2YC1B 4LMQE 3NCEB 1IZJA 1QFWL 3T4AB 4DFHA 2P24A 1OGAD 3NFSH 3C8KA 4OF8A 5FHAL 4KFZC 1FCCA 4JKPH 2GITB 4PJIB 5GGTA 1URLA 4ELKB 4OZHF 2W9DL 4UI2A 1CFQB 4Z78B 5A40E 5IBLD 4P2OB 5DEGA 2NY3C 5LBSL 1JZ4A 1G9MH 5CHNA 2ARJA 1JF6A 2V9QA 4BKLA 4LNVA 3GI8H 1TMCB 3EJZD 1NCNA 3O81A 3IXAB 3T2PA 3QRGL 3SE3A 2IANE 1NLBL 5D1XD 4YEFA 3DLQR 3L6FA 4JM4L 2Z4QA 1E27B 3UTTB 1ZHLA 5F70A 4P59L 4YZFF 4G7VH 5ESVA 1PW3A 5DXWA 2CDGB 1A9EB 4K94H 1IM9D 2CDEA 2FNBA 4Y5XC 2X4TA 3PP4H 5AYQA 4DWHA 4M7JH 3CVHB 3WS6A 5D7KD 3QCVH 4QCIB 4AIZA 1Z2KA 1UM5L 1T0NB 3RHWK 5IB2A 5IFJB 4OBSA 3M45A 4LSUL 5FOBB 3QQ3B 2F5AH 3CZFB 1FNFA 5LXGL 4MNQA 4NBZB 2CR6A 3BPLC 1XR8A 4OGYL 5MI0B 4Y5XA 1YN7A 1SJXA 2YPKB 2CH8A 4EI5C 3DRQA 2Q20A 4M5ZL 3HAEB 3WCYA 1YYMH 4G8FB 4OCLC 3BWUC 2APFA 3EOTL 5HHOA 4JJHA 2P5EE 5HI5C 1KULA 3ZTJG 3C5SA 4HF5H 1HH6B 5TDNB 2XWTA 3SCMB 1ZLSL 1W8OA 1I8LA 3L5XH 5T5NF 1R5IA 3NACL 1EEZB 4OQTL 1I7RA 3BGMA 1AKJA 3DO3A 2FEDC 4OZFA 3RX8A 4P5TC 5BXFB 5LCVH 1QEWA 1Q9KB 1UEMA 2VISA 5BS0A 1MLCB 3BDYH 4F9PC 4B5EA 3ES6A 4G43A 5GGRB 5DT1L 4BQ9A 1BPVA 2P5EA 4LLVA 4PD4J 1R0AH 3SJVD 4YPJA 3ARGC 5F7DA 1MCOL 2L7JA 2ORBH 1HDMB 3RWGB 1JF1A 4WCYH 4FZ8H 4Y1AE 1T0PB 4G6ML 3GRWA 3MRGB 3LKRB 4EI6B 2DOCA 4HGKC 1AY1L 1ZAGA 1FYHB 1T1XA 1GL4B 4NQEA 4R9HA 3GMLA 3ARRA 4S1SH 5GSRB 5GRVK 4GO6B 5ENWA 4Q6YA 1RZ7H 1G0YR 4QOKA 2X4QA 3WE6A 3JWDC 4HKXB 1FYTE 2V7NB 4IIQC 1ZXQA 4JFZL 4K71C 3MV8D 4P2RE 5HGHA 3CVHH 4GAYB 4XBPB 4FQQB 4PB0L 4PJ8B 4R0LA 4LSRL 1OLZA 4AEHH 3GMPA 4RAVA 4L3CB 1SEQL 1EERB 2RR3A 2R2BB 2ZCHL 4NSKB 2IPKA 3C6LA 3OKNA 3CVIL 4U1JA 1AQDB 4FOMA 2JIXB 2Y6SD 3AUVA 3MRMB 5HHQB 5JHDA 4CVUA 4ETQA 3PXHA 1A7QH 1RZGA 2MCG1 3VH8G 5C0JB 5KW9H 1OTUC 1UM4L 1OAKL 1WSST 1SYSA 1HOCA 4IRSA 1BLNA 1WVZA 1Z0NA 4W6YB 2VDPL 4XPAL 1A6VL 5CIPB 2X89D 5H37G 1KGCE 5D9SB 3LAFA 3W39A 2OZ4L 4YEEA 3OJDB 3D0VB 3V4PH 3OKYA 3N1MC 2EYSA 4L9DA 1NPUA 4ODHH 1KC5L 1JMZA 1KLGA 1NCWL 2KH2B 3FQWB 4FQ1L 3P0YH 1INQB 2LV4A 4NFDA 5MERA 1ZHBA 2NCMA 4AENB 5CJQH 3OR6B 3O9WD 3SGKC 5J1AA 2NZIA 3RWHA 1X5GA 4Z76A 4ZUSA 3DYOA 4U4BA 5JOEA 3HZMA 3CXDH 2VIRB 4JFPB 1BHGA 1YECH 2VOTA 1GGTA 3ARBB 4NZUL 4OGXL 1SEBA 2O61A 1S9KC 4I3SH 5J1AB 5F88B 4MHHI 3O9WB 2BOCB 4H8WH 2HJKB 3UBXB 3BP5A 4X5WA 3K8KA 1EVUA 2Y5EA 4XH2B 4U1SB 1D5IL 4M8QA 3NA4A 4J2XA 1SVCP 2BVQA 5EC2A 4CN6A 1HXMB 1U92A 3SKMB 1N4XL 4Z7UB 3KPQB 2LVEA 3GBMH 1MY7A 3PGCA 4ZUWA 4U1HB 4NDMA 1ADQH 3LEVL 4KK8D 4Y7MA 3V5KA 1DUZA 1WWBX 3P77A 4N8VG 4PJCA 2X4TB 5D72H 4JR9H 4HLZH 1GHFL 15C8L 1JNNL 1M71A 2ICEB 3IGAB 4LL9A 3RWEA 3C60A 2XWJA 5HPMB 1F97A 5C0DB 3VXUE 4RWYL 3ZE2E 3K1DA 4QHUB 3FRPG 4ODTH 4MNGB 5IB4B 4JO3H 3HB3D 2B7DT 5BJTA 3MV8B 3SHSA 3QJHA 1NCAH 4PG2C 3RWDA 1DQQB 1QR4A 4DVRL 3RUGE 4A6YA 3VFWB 4TVSa 3I3EA 1TVBB 3MA9H 1CDYA 3KG5A 2FECL 1NGXB 2F53E 3W82A 4ALAL 1EHAA 1FZMA 2LTQB 2RB8A 3MRDA 2OSLA 1PDKA 3SOBH 3NBNA 3KPPA 3X12B 2BVYA 3P4OA 1UENA 2H26A 1GZPB 2H45A 3PL6C 1QHPA 5DC4B 3IFLH 4UQ2A 4AEFA 3MLSH 1EEUA 2AGJL 3OG4B 5JQHC 5INCA 5D6DC 4IIQA 4R96B 3IAGC 3CFBA 1UG9A 4D0CB 4HWNA 2PYFB 2QQLH 4JM2A 5ISZA 4U1MB 3D0LB 3LCYA 1SYVB 4LCWE 1T03L 2XTLA 5DJXB 4PJAB 4XNUL 5JA8B 5KS9F 4XCFH 4HWEH 3O6LH 3H9HA 4JY5H 4OI8A 1F5WA 1IEAB 2YRPA 1HCVA 3FQUB 5C2BH 1WCBA 5E95B 1FNGB 5IEHA 3L7EB 2C9AA 1BWWA 3FT2A 5I18L 1W72H 1L0QA 1BVLB 4HFUL 4F9PA 2AKRA 4OLVH 3WFZA 3PWJB 5FO7A 4FQ2L 4PJBE 5FYLL 3P30H 5H35B 1IEAA 5E2TH 2HVJA 3V6OC 3G6DL 3EYSL 2WUBL 1BQLL 1TJHL 3OF6A 3FQUA 3I6GB 4Y16C 3RVVC 1KBGH 2KQNA 1PEZA 1UKSA 3I6KB 1QBMH 4NUGH 5L7XH 2Q7YA 5TE4L 5D7KE 2DWEA 5L8JB 4L4JA 2LAGB 5L2KB 4EJ1C 1U3HD 5K59E 2WLYA 3N0PB 3FRUB 2J8OA 2XNAB 5HHMA 1MJ7H 3F7VB 3QG6A 3BUYA 1OM3L 2AI0L 3VWKD 4EI5A 1N64H 2YA2A 2Z8VC 4PJ7E 1M6OA 2OTUA 5FDWA 1AC6A 2XV6B 3PWLA 5INCB 4MB5A 5TQ0H 1FLTX 2YBRA 4JKPL 1U93A 4LCYA 3U4BH 3OKKB 3ZDZF 2OSLB 4YHZH 5HHME 3R4DA 5DZNA 1JPTH 5IHZB 1NDGA 4PJ9C 2EXWD 2P47B 3BN3B 1XR9A 3QUKA 3EFDH 3FQXB 3V52H 1J5OL 5HJ3B 2HTKC 1G6RA 3MCLH 1NC4B 4X7SH 2R56H 1L4IA 4G42B 4OZ4B 1U8KA 5J89A 5EU6D 1XF4A 3RVXD 5EO9A 5EOCH 1BQLH 1TJHH 2LFGA 2J88H 3O3EA 4PIRF 4N1EA 1VPOL 3MRJB 1YEFH 4F57H 4CJ1A 4JO4L 4CRPA 5ICZB 2Q87A 4ALAH 2R8SH 2M8XA 1MCDA 3MRQA 3HTLX 1YYLL 1RUQL 1Z3GH 4N0FB 4OFPA 4DVRH 3TYGL 3NCYS 5H2BA 3ZTNL 3A6OA 4KZEH 4FFZL 1T4KB 3AM8C 3HNTL 1UKTA 2Z91B 4YX2L 3V0VA 5CWSB 1D9KB 4GAJL 2O26U 4ZPTA 4XNZC 3FFCA 4KJQC 4LVHB 4HK3J 3T0VA 3UYOD 4W70A 4Z77A 4M93C 2QV2A 4I3RH 2HRPL 3S36L 1CDHA 2XY2A 2ZCKL 5DC0A 5IBUG 4YHZL 3LHPL 2NY5L 4GRWB 3H9ZA 1YZZA 2ESVE 3IS1X 3VXRE 4UAOB 2J8HA 3L95A 4MA3A 4X7FC 1NBYB 5DDHA 3PWNA 4BELD 3OR6A 4NWUL 2I60H 4DK3A 5DTFA 3T8XA 3CLFH 3DTXB 3OMZA 1ACYL 3IJHA 2D7PA 2H6PB 1GAFH 2OJEB 1H0DA 3GIZL 1G6RB 1MI5E 3BH9A 4NQDD 1MI5D 1E6OL 1UB5A 5C7XL 1QLEH 2PYEE 1U93B 3QHZL 3QO1B 4X7DC 3VXOB 3QIUA 3ARTA 1A6TB 2RHEA 2DMBA 5HTSA 3HN3A 3EGSB 5TE6H 3K0WA 3QEUA 2H2PC 4JDZB 4KMTH 4F9LA 4BSVB 2AV1A 5A16B 3VFGH 2X4OB 1MF2H 3O3BA 5HYSB 2Q3AA 1UJ3A 1P1ZA 4S11A 1KEGH 3L3GA 5HHPB 5DVNA 5HHMB 5IF0B 3O8XB 4ZO6A 4PTTA 3CC5A 5D5MB 1EHNA 4NDMB 4MJ5B 4P46D 1EA9C 4PRHD 1A6ZB 2XFXB 3O11A 4WU5B 3MLVL 1PBYA 3MRJA 3R0NA 4NQDB 2P8MA 4K9EH 4WNQB 5L2JA 1YNTA 5I1EL 1CDBA 1OAKH 3DYMA 3Q0HA 3KYKL 2O5YL 2XFXA 5L2KE 1T04B 3VRIB 4JM2F 4G6FB 1S7RB 3MREB 3BP7A 4NNYB 2DQUL 5DEGB 3V52L 1AR1D 3HAEG 1I1FA 4UT6H 4KRNA 1RUAH 4H88L 1L6XA 3FFCB 2D7OA 1OAYH 1Q9KA 2KL6A 5F9JA 3ES6B 4TNVF 2WWKT 3TJEH 4RFEA 1IKFH 4HH9B 3VW3L 4HUUB 3EGSA 3TA3B 4NJAH 4YDJA 4E9LA 5KSAC 4TUOB 2R4SL 4JG1L 1IC7H 2HG5B 3QDJB 4LVHC 5FIEA 2XZAL 5A3ID 1P69B 3GHBH 3S98A 5I30H 4RFEB 3QWQB 4CN4A 5SX5H 5A2KH 4OV5B 4XNYL 3LQAL 4Q6IA 4G42A 4OZ4A 4RMTA 4KK5D 3SBWC 1ZLVH 3DWTA 2GIYA 4F33B 2J6EH 5B3JF 4PRBB 1NC4D 2ZCKH 4ZQKB 1QSEA 1UVQB 4XP4H 2F54A 3QNZA 4M7LH 4GBXC 4MLIA 3SKNB 3OWEA 1MREL 5E24E 5EG6C 1FN4B 3EJJX 5D6CB 1FVDA 3BIKA 3SDCD 2PW2A 3OGCA 2YUWA 4LKXA 3RU8H 3PWPE 1F3DH 1X5ZA 4LLUB 5MEQB 4JR9L 5DRWA 3RVTC 3IETA 4XB7A 5CGYD 3V0VB 3TO2A 4NKIH 5KN5B 2Z31B 3KPSE 5KOMC 3C2SA 1DBBL 3ARFB 3MRQB 1AH1A 3SKUD 1NCAL 4Q2ZA 2F8OA 1HEZA 1CL7H 4JQXA 1A4JB 1ZT1A 2R29L 3OAZH 2VH5L 4K8RD 1KF9B 4APQA 3TBYA 1HHHA 2NY0D 5E9DD 5I66B 4DKAA 3PV6A 4GUPA 1J1PL 1JHKH 3D69A 2C1PA 4YDLB 2WWKO 5FGCE 3ZHDA 1DANU 3VRLE 2VWEC 3ILPB 2YZ1A 4JFOA 4Q9RL 1SEBB 1PFCA 4OV5A 4OF5A 5IVXB 2AJ3B 1HQ4A 1U8HB 4XZUB 4GRMB 2CJUH 2I25N 3CZJA 5L0QB 1LE9A 1M7DA 4NM4H 3VGEA 3DVNB 2BFVL 4NQTA 1T03H 1NL0L 3GJFK 5KSBF 2BVTA 4XWGL 4BA8A 4DKDC 1BQHB 2EIZB 2XPGA 1AIFB 4X0KA 3O4LB 2DQDL 1K8IB 5E7FA 4JFQA 1LHZA 5GIRA 3MRNB 1U58B 3QFJB 3DRTB 3H42L 4DJMA 2ATKB 4Q9QH 5FO8A 5DJCB 5C07D 2EH8L 3HPJB 2GJ6B 4KKAD 1QFOA 1NAML 3FL7A 4PREB 5C6TL 4QCIA 1KIPB 3MGTB 3DGGB 4QO1A 3IRPX 2KPNA 1UCBL 1AGFB 3H0TA 4JGUA 2HTLC 3ZSSA 1BQSA 4YAQA 4XPHL 4P59H 4Z7VA 1K4CA 1CR9L 1QFUH 3C8DA 4K3EL 4WFGE 4LQ1A 4XC1H 3V7AE 4AEEA 2GJZA 2IADB 1X7QA 4NSKA 4I1NB 2YWZA 5D71H 4M43L 4Z0XB 1GXEA 4NJAL 4Z0BH 4LDEB 4JM2C 4ZXBA 1IEHA 4J1UA 4MDJB 1AR2A 1KOAA 1UA6L 3D18A 1INDL 4XZUA 5ACMA 4J3VA 2G9HB 4IRJB 1T22A 1QYGL 4Z7VE 4JFEB 4U2ZA 3PL6A 2D0GA 4GW1B 1BD2B 4NKOA 3R8QA 4M7LL 4Y19D 5DQJA 5E8NB 2FH8A 4M6AA 3MRKA 1XCQA 3HPLB 5IBLC 4PGBB 1XMWA 1KNOB 4G43B 1MCWM 5GGRA 1A1MA 3H2WA 3ARYA 3NTCL 4WV1C 3P11L 1UACL 3G5VA 4KHTH 1MQKL 3QDMA 4JFFA 4PUBH 3CFJA 2DQCL 3IXTA 1X5HA 4JANA 4U3XA 1DBBH 5FGCB 3WFHB 4PGCB 2ZP0T 4PJ5B 4X9FA 1BJ1H 4JVUA 5IFAL 4POZC 3HS0B 3TM6A 3C60C 2YA1A 3BOVA 4PY7B 1NUGA 2E5EA 3OGCB 3O45B 4JG0L 4G9FB 7CGTA 4J8RA 4Y8DC 3L3DB 5I9QB 5F89A 1JHLL 5AAMA 1OQXA 1JCKA 2F5BL 3SE4C 4ZQKA 2ZCLL 1YMME 2IC2A 2X70A 1PG7W 5GGVH 1LO2H 1NLBH 1TCRA 2JF1A 3QEQE 4UDTA 2PNDA 5L88H 1H15A 1RD6A 1OAUL 1M05B 2O5XH 4DN4H 3D25B 3SY0B 4ELME 4G80B 4IIQB 3KPRA 4J3WA 1AD0A 3TT1L 2AEIT 3EYQC 4JY4A 3D3VA 4HWUA 5T3ZE 3WFCL 1JPTL 5B38A 3AC0A 5GGTH 1D5MA 3L3HA 3JSSA 2X4RA 5DVLA 2Q6WB 4CAGA 3IKKA 1NLDH 3WD5H 3VXMB 6FABL 4FXKB 1YEGH 4H20H 4OJFH 4V3EB 2Y4SA 1JWSB 1ZT7A 4RISL 5DVKA 1TVBA 4KVNH 3ARED 1X6LA 4F7MB 15C8H 1JNNH 4JDVA 2Y7QA 4KI5F 4P99A 4U6HA 4HV8A 3SN6N 5MHSE 4LHUD 5D1ZC 4AH2A 1IGMH 1KPVB 4F7CB 3P4OB 1UB6B 4N90E 1U3YA 5C09B 1CTOA 1IT9L 4Y5VA 5F9AC 3T0ED 1FRGL 3O4LE 4M3JA 4U3CA 4OCSH 5TH2B 1RUQH 5GS0L 4GG8A 3SQOL 5FF6B 1FVEA 1DQTA 3DRQB 2R1YA 5HVGB 3ZE1F 4EIGB 1TJGL 3EO0A 4U1NB 1JHTA 1TDQA 5JZ7C 4MWFB 2Y5TB 4L4TD 2ZUTA 4OB5L 2R0ZL 1GIGH 3MV9B 4TNWK 2A1WH 1WWCA 4FFYH 1OF2A 1AQKL 3WLWC 3DIFB 3SDDC 2YBRB 1S3KH 1KYOK 1TZGL 2VDOH 1BAFL 5JIPA 4OLYH 2BRQA 4O5LH 3QNYB 3ARWA 5DLML 4GAGH 4NO0B 1HSAA 3E3QA 4E42B 4CMMB 5DF0A 1RUAL 4H88H 5DO2C 1F4YH 4OGYH 2JJTA 4TN9A 3J8F7 3LEVH 1H15B 3NCBB 3S96A 3QULA 3DI2B 3LRGA 4LNRB 4U33A 2FJHA 4KKNA 4XH2A 3RL1A 1LO4H 1OP5H 3QG7L 1E28A 4PJ5A 3DSFH 2R0LH 2ZCHH 3OKEA 4M00A 4P3CH 1P5VA 5DUPL 1ONQA 3LIZH 5KG9A 5IB2B 4QGYA 3BI9X 5IFJA 4ZXBB 4NGHL 3GNMH 4QY8A 2YPVH 1IAII 3OXSB 2F5AL 1LP9F 3WFBL 2DLIA 4LNRA 3SDCC 4Z7NE 5FAAA 3GJEA 2NX5D 5GZNC 4B0MM 4EBQL 2AS5M 1ZMYA 4K9EC 4XC3L 4PJXA 3DJ9A 4UUJB 4K3HA 3TO4C 3L5WA 1A9EA 4P5MB 4BZ1H 3OAUL 1DP0A 3CCHA 4MSWB 1AGDB 1BOGB 4P3DA 1KC5H 3S34H 3VGHA 3UDWC 2JJSC 1N59A 2V5MA 2WQ8A 3H8NA 3MRMA 4P4KB 4OZGE 3QUMH 3EOAA 5DMGC 5EWIH 1D6EB 2APXA 3OZ9H 2F53A 3KLHC 4RMWA 1RJYB 4I18A 3KPRB 5EBMB 1ED3B 4F15B 4JFHD 3FB5A 5IIEB 1KG0B 3LPFA 2GUOA 5ITFB 4XP6L 5EU7C 5SWSD 5IG7A 3KNBB 1TFHA 2ZUWA 4LOUD 3OKNB 1MHPH 3V5DB 3W81A 5BVJA 3B5TA 3T0EB 3PWNB 3B9VA 3QIWD 4YAQB 3REWA 4U6XB 3I6GA 5C09D 5T1KB 2EXYD 2AAVA 3H7BA 2R0KH 5ESQB 1NLDL 3B5HA 3WD5L 2A83B 4EUPB 2OL3B 4YDIL 3F7RA 4E41A 2FBJH 3ARDA 3LSOB 5CZVL 4BFIA 4C4KO 2YD8A 4HGMA 5C2UB 2Z8WC 4IJ3C 4G3YH 5FKPA 4PJAA 4JFZH 5CZXD 1IC5L 2NYYD 3GHBL 4TQEL 3ALXA 3O8XD 2V17H 1PD6A 5M7QA 1WZKA 1F6FB 1C12A 3WXWL 1WAAA 4G8GA 1CXHA 3IJYA 3MROB 3SO3C 2BERA 1T2XA 2BSRA 3BZEA 1GGBH 1EAJA 2ZWLT 2VR5A 4L9LC 4MXQD 4J12A 5J56B 4PGEB 2ENYA 1RJLB 3TWCL 2LU4A 2C26A 3KPLB 3FOLA 4TULH 4HMDA 2GW5A 5INDB 4HCRL 3OB0H 5F7YC 5D2LB 4XPAH 1FORL 1YEEH 3QP3A 1F2QA 1YEHH 1NC4A 4NQEE 1V3LA 4ETYA 1H3PL 4XP6H 2CUHA 3VFRA 3WJLC 4DCQB 1ZVSB 3KPSA 3INUL 2HKHH 3KYOA 4N8VB 4KK9D 3V0WL 3QUYB 1W0YT 5BJTB 1T04A 5DJ0B 1TENA 3WN5C 3PHQB 1RZ8A 3RWDB 3NOIA 3O2WH 1CGWA 1VFAA 4GMTL 2AW2A 5JW4Q 1BJMA 1JL8A 2N56A 3NFPB 2DQGH 3QI9D 5F3HB 3MJ7B 4PP2B 3CSBA 2XKUA 1XGQA 5I8CB 1QFWM 2BNRB 3MBEA 4OUOA 3RWEB 4OT1H 3RTQA 3DARA 1HKFA 3LY6A 3PHSA 5DMIH 2ZOLA 4ZNEE 4HIXH 1DUZB 5D5MA 5AZEH 2FJFA 2GSIB 2QADB 4WO4B 5L2KD 2YRLA 5CD5C 3FCTB 1IBGL 4NO2A 1OAXH 4YR6B 1JP5A 2HG5A 3QDJA 12E8H 4LRNH 1FFOA 2YPVL 4Q0XL 5BO1L 1MF2L 5T1MA 1KV3A 5IK3A 1SY6A 1U8IB 3S5LA 3FN0H 2UUDH 1JN6B 1GGBL 1U92B 4F15C 3QQ4A 5A43C 1CVSC 4EN3D 2ZOLB 5BV7B 1E28B 3I02A 4FFZH 1HQRB 3MPCA 1P7QA 4YXKL 4PRPD 4JDZA 3U6RA 1WZLA 3H3KA 5IHUH 2DQHH 4ODXA 4NN7B 4YGVB 1MJJB 4QTIH 4V1DD 5CJBA 1R3LA 3W11C 2DQJL 5F71A 5DYOB 3MRDB 5K9QI 5FGBC 5ECJE 4KXZH 4YHYB 4JRYD 3L7EA 1EVTC 1AD9B 4XGZA 1NDMB 4W6WB 1QUNA 4R7NB 2HMID 5I1DB 4QYOA 4F37F 4GRWE 4L4TE 4P2OC 5I8KL 3L3JA 2X40A 1NMBH 2D4DA 3MV8A 5KSAB 3TFKA 1EH9A 1P4LA 5J13B 3TJHD 4I0PB 2NZ9C 4APQC 2FL5A 5FDWB 32C2B 2EDHA 4WTWA 5F3BB 4GW5A 5EC1A 5TJWK 3TVMB 5F44A 1D5BA 5AYUH 4E42A 5ADPH 4LASL 4M1GL 4OCYH 1PG7H 4EXKA 3MV9E 3TBYB 3TNMA 3LKOA 5JXAH 4JO2L 4KDTC 2FJFB 3IFLL 3EOAB 4LCCA 5F97E 4MVBA 3Q5OA 5D71L 1MHEA 3G6AB 5DFVC 4A6YH 1GPOL 1C5DB 3MR9B 1RSFA 5KSVB 3H3BC 3NAAH 1FQ9C 1QSFB 4XWOD 1MQ8A 2PYEA 35C8H 5IG7B 1HKLL 3DROB 1FL3B 5DRWB 4XAWH 3TZVB 2QBWA 5BZWA 1Q0XH 3NH7H 4KUZH 1W0WA 3GO1L 2QQKH 2XTJD 3TCLB 3IDJA 4L4VD 3QH3A 3P9LA 1T5WB 2ORBL 4HWZA 2CIIA 4PRIA 4P23C 1KN4H 1BX2B 3C09B 4OAWB 4AQ1B 3PNWA 2VMFA 1OW0C 2DS4A 3FJTA 5SWQA 5JA9A 3NA9L 2MOVA 1MWAH 3KPSB 4J3OC 2OZ4A 1T83C 1A6AB 4RISH 1GCFA 1A3QA 2XZZA 1I1AB 3DUUA 5KS9B 3OQ3B 3IJSA 3C9NA 1N6QH 1FL5B 5MEPB 3PE9A 4IRSD 3JWNC 5I66A 3I50L 1BFTA 2EYSB 4PGZA 1YQVL 5AYUL 1A7BA 5IHLB 1FNSL 1DBKL 1TQBB 3O2WL 4OFVA 4U1IA 1HH9B 5C0GA 3WIHL 3LKPB 4GJTB 6CGTA 3SE9L 3WNKA 5ICYB 4G6MH 1LVEA 5FUCE 2QSCH 4OBRA 2NY2D 2AK4D 2OI9A 1HHJA 4R2GB 3B5GA 3O45A 2ZKHH 2P8PB 4ENED 3HNVL 3S4SB 5BVPL 4H25A 1LO2L 2VZSA 1X5AA 2ARJB 3TP4A 4TUJA 2X1XR 1JYVA 2R0ZH 1KCVH 3OJMB 4C57C 4PLKC 5HHOB 2DWEB 4FP8L 1DL7H 5GZOD 4PBVC 1OARL 4MNGA 1A64A 1EBPA 4MA7L 5KVGH 1XGRB 3O2VL 2EDBA 1BZQK 2DICA 4U49A 4KAQL 1OSZA 5D7LA 3VMOA 4JQIL 4YXKH 1D9KC 2PTTA 2BMKB 3UPRB 1L8JA 1A7QL 4N5UA 3HC3H 5MP6L 4HKJA 2R8SL 1IGFL 3KDMA 1KB9J 3A67L 3T4YA 1PAMA 2P48B 4GS7B 2FD6L 4M1DL 4AIZB 2EKJA 2GK2A 3NABH 2HP4A 4OCXH 4J23A 1VKXB 5H37H 2WZPD 2DDQH 1KFAH 5C0RH 4HUVB 2UYLB 3WFDL 4DVBB 4N9OB 5D2NA 1FNEA 1A7OL 4XPTL 4Y4FB 5IBTL 4JFED 3BFOA 1LEGB 4G6KH 2Q86A 3C08H 1F00I 3CH1A 4V2CB 1LMKA 4ZODA 4HWBA 4R4BB 3O6KL 1Z3GL 2PUQT 2IPTL 4X7TA 2A2QT 2IAND 2X6MA 3AXLA 1UB5B 1F4AA 4PJHB 5HYJB 3VXOA 1ZA3B 4N8CL 3AROA 4K3EH 4ONOA 1TJGH 2W91A 4GKNB 1H0DB 2K1MA 3FQTB 5MENB 1FLRL 3MREA 4NNYA 2HA1A 2VXUH 1YEJH 3FMGL 4X8JA 1W8NA 4QOKD 5SV3A 2A1WL 2YPLB 3MLXL 2PW1A 1NMAH 3OL2A 4YFEA 3V6FA 2ZUXA 4AMKL 3HG1B 5ESAB 4GG6F 3GRWL 1MRCL 3O2VH 1F11B 1TVHA 4OKVB 1I1YA 2E3VA 2R9HC 5LGHL 4CVXB 2OR9H 4G80A 1B2WL 1D5ZA 4TYUA 4WTZA 4OZIF 4IOFC 4X6DA 1FO0L 3RBSA 4CU7A 4Z0XA 1J12A 1KJMB 1MELA 1C5DA 3MR9A 4LLDA 3RQ3A 3Q5TA 3O4OC 5EDXA 1U8MA 3V79C 1F13A 1SJVA 2LU7A 1F02I 4WW2F 3EOTH 2CMRL 1GOFA 4DVBA 2A6KA 3GK8L 1OGTA 3DHJA 4P3CL 4LCWA 4XVUD 5F93C 1EFXA 5DHYA 5T1KD 3ALWA 2PO6B 2GSGA 4LRIC 4P46A 2FZ3A 4BFBD 2DQFA 5ITBH 4RFNB 5D1QC 1X3DA 3MA7A 2BY1A 5SWQB 4OLXH 1UH4A 5GRWA 4R90L 3G04A 3NMEA 4EVNB 3S3PA 2A74A 1KB5H 2DI9A 3MOAL 1JGDB 4NN7C 3KPSD 3GUTB 4QHNB 5CFHA 2VLJD 2NY1B 2OYPA 1HHKA 4NYLB 4R7NA 1ZT4A 5KBNC 4YO0A 4R4BA 5GHWL 1RUKL 1KXTB 5F6HI 2PN5A 5DHVH 2FIKA 2UWEB 2EZ0D 2OK0L 4HIJA 2OI9B 4CMHB 1CYGA 4ZAKA 1YN6B 4P2OD 3ULVH 4ZS6C 2XZAH 2KUTA 2YUVA 5IVZB 2IALB 8CGTA 1S9WB 4FZEL 4F8QA 3WNLA 2VR9A 1MHHB 2GTWA 3HUJF 4JPIB 2XZCL 3TA3D 2NNAB 3D25A 2H32A 4IDJL 3U4EB 3VXUA 2QADD 4WO4D 3V5HB 1IL1A 3KAAA 1TVHB 5C8JB 1SJEB 4U7SA 1G7MA 4RA3A 1RAMA 4XXDA 1AJ7H 3JVGA 5EUKA 2BP3A 1ZOXA 1LD9B 1XF4B 1FVDB 3BIKB 5J3HD 2DQDH 3HG1E 3QHFH 5CZXC 1OGAE 1BFVL 4ONFL 2VXTL 2JB6A 1JF5A 2XRAH 4HS3A 3B9KA 4U1HA 5HYJA 1YPZA 1ZSDA 3BXNB 1A2YB 3C6SB 5HI5D 1CT8A 5GS1A 3GJFB 4D8PB 4QHNA 4PJBB 2E6QA 3B9KD 3FO2A 4YHMH 2ZCLH 2NQCA 2DMKA 4WI3A 3D69B 3R1GL 4P4KA 1OL0A 2ERJC 4PB9L 2Y06H 4HUMB 1HYSD 4C55A 3D85B 3TIEB 1CCZA 3V6OE 4NN6B 4GKZA 4ZMAT 4KXZI 4IOSD 4QXWA 1FAIL 4KQ4L 4PJDF 3H9SE 4JZJA 4KK9C 4L29A 1MCRA 3HFML 1CFVL 2J1KA 5ETUA 3FT3B 3QCTL 4WFFD 3U83A 1AO7A 2AJ3A 1HIMH 2VLLB 3BP4B 4LLWA 2O5ZH 5DMGD 1WC7B 1JUFB 3U4EA 3VXUB 4BUGA 1RUML 1EUTA 4F58H 5MENA 1H3TA 1J10A 1PG7L 1NL0H 3WNMA 1U6AH 2OL3A 1G7PA 5DC9B 4P46B 4WW2A 4JFHE 2IH3B 1PG7X 1FE8L 3BRGC 1KCSL 2X4NA 5IP4A 1NFDB 3EO9L 3LHPH 4ZD3L 5F6IC 2W60B 5FECB 4UINL 1T0MA 3A6BH 5E2WL 3VMNA 4W6XB 2JCCA 3ARVA 2Z9TA 4WWKA 3MV01 5JHLL 4LSSH 5KANI 1OM3H 3BD4A 4P2RA 2AXHA 3B6SA 4KKCD 1SYVA 4GG6A 4HDIB 4I0KA 1I7UB 1IEBA 2AJXH 4FTVD 4XP9L 5EU5B 2OK0H 3N85L 3KHQA 1CR9H 1N5YL 2VXSL 4HUUA 4P9HH 1S8DA 4AY0A 4UQ3B 1QLEL 4XCCH 4JCMA 3F6IA 4JPVH 5FYJL 1LEGA 4Z7WB 5TH2A 1A21A 3IFPA 4HW6A 2GKIA 1MOEA 5JO5B 1WBXA 4HBCH 3RWCB 4OIAA 4QEGA 4BKLB 1D7FA 4LLUA 3NIFE 2AVGA 4J4PD 3UTSA 1G6VK 1IC1A 4X0KB 5DJ8A 1IAMA 4PJFB 1UCBH 1OSPH 5EB9A 3RZCA 5IGXL 2WQRA 2Z35B 4ZXBD 3B2UD 4EUPH 4F33A 4CNIB 2Z93B 3DIFA 3I2CH 2N1KA 3T0BA 4XNUH 5EUKB 1A9BB 3W5NA 3T0AA 5GGSA 3V5DA 1PEWA 3MNWB 3LIZL 3ULUH 4ZTOL 1KLGB 2UZXB 3DX8B 4K3JH 4LKCB 3BO8A 1MQKH 1UA6H 3ZYOA 4XCYB 4HG4J 1MRFH 2VR4A 4X9GA 3CDYA 1U42A 1DE4B 1IGIL 2IALA 3ARFA 3RJDA 2YUZA 1MWAA 1DDHA 3L6FB 4XP9H 2IAMC 3MLRH 3B3IB 1KPVA 4G7VL 1RUPL 1CXEA 4G5ZL 4KJWD 3A0OA 2XWTB 5HI4D 2R1WB 5MI0C 1UWEL 1I85C 1KTDB 1YEHL 7FABL 1I7TB 2PXYD 2CIKA 3PIQA 1FN4A 2DYPD 5D6CA 1T3FB 4OZGA 3UYRH 3UTSB 1C16B 1JFMA 2VB5A 1GAFL 5DEFA 1TTFA 4WI4A 2CLVB 1AGBB 3GIZH 4Y5XB 1II4E 3MUY1 4WFED 4G59A 4I2XA 3JV6B 1EIBA 4P3WA 5EU5A 4JY4B 1MHCA 4OD3L 5FF6A 1U6AL 1CGXA 2P5WE 4Y1AA 3TZVC 1TXKA 2QSVA 5C0CD 4AM0A 5D1QB 2OTPA 4OCWH 4PGDA 1U8IA 2PKDA 5E6IA 3VXNB 5M94B 1NMCB 1DBAL 4GBXD 5HHVH 1UM5H 3CVHA 5F7DB 4KK6C 2R9HD 1E4WH 2A38A 3EFDL 5GRUH 2A6JA 3ABZA 5I74B 2CDGA 3EYVA 4HKBB 4Y1AB 4F7MA 1DZBA 3TBTB 3QCUL 5I1KH 5DJ6A 4XBGB 2HLFD 3MV7E 1FZKB 3GRWH 4LIQE 5DMJB 5BXFA 1FJ1A 4L1HA 3NGBC 1I3GL 1BVLA 5F7EL 4ODUB 3DX9A 3PUCA 2DD8H 2C7UB 5KVEH 4OGAD 1QBML 4MD5B 1DUYB 2YKLH 4NUGL 5DZLA 5SWSE 1IGTA 3ARDB 4PJ8D 3QPXH 1H3UA 1OCWH 3KXFD 5FUZL 5SWZE 3D87B 3C5SB 4RAVB 4M6OL 3F12B 2BXZA 2ZJSL 2R1WA 3VMPA 4K3DL 2HVKB 4UU9B 5D2LE 5FK9B 4KRMB 4QXTA 3RBGA 2YD2A 3X3GL 3OKDB 4FQCH 4PG9B 3ULVD 1LO3H 5IROC 4OZHE 4NUJA 3BDYL 1KPUA 4QNPF 5ENWB 2P42B 3RFZC 1G7QA 3RIAK 5AZ2L 3BZDA 2R2CA 4FMFA 4G6KL 1ZLUK 3VCLA 2UUDK 1AI1L 1KYOJ 3IJSB 3MJ9A 3MLWH 1EO8H 1IEBB 1GSMA 1RJLA 4GAFB 3QEHA 1MHCB 5J7CC 2I9LA 4JFEA 3HC4H 3LN9A 4YFLF 1JWSA 1ZT7B 2BNQB 1N4XH 1EMTL 2EDWA 4PJHF 1KJ3H 2BRRH 4GRLC 5C0BA 3M17A 3IFNL 3TGXA 1MJ8H 4QWWC 3WKNA 4V2BA 1QKZL 4ODVH 2CD0A 3W9EA 3FHAA 3PWPA 2NY4C 2E9BA 3QUKB 2F53D 4JFYA 5DMKA 3RY6C 4BM7A 2QADC 4PY8I 4WO4C 5EU7E 2YZ8A 3AB0B 4OUUB 5DJDB 4F2MA 3LRSB 3RJQB 2EYRA 4O5LL 1WTLA 4JHAL 4NFCA 4YH6A 1MWAB 2FO1A 3MNVB 4M3KB 4NIKB 1TETL 5IHUL 3ELAT 4N1HB 5IJKC 1KELH 4NP4H 4OSUH 4ISVB 1HSBA 4GW1A 2X9XA 4GKOA 5DJ2A 1AGEB 1CIUA 4XRCB 4S2SA 1M6OB 5EZJB 4EDXB 4PBXA 3ZYIA 3NPSB 2A9ML 2PCPA 1CLYL 2BX5A 3EOYG 4WW2B 1FNAA 4X6DE 2DKMA 1CLCA 4ZFOL 2NY0B 1WFNA 2BCKA 3WO4B 5JTWA 3WJJC 1C08A 4Z95L 5IKCB 3BP5B 3DV4B 4IM8A 5DJZB 1KPRA 5D1XB 2O5YH 4X98B 1QFPA 3TPUA 2VH5H 2W38A 4LSTL 2UWEF 3RGVA 2FHFA 1FFPA 4R90H 4UILL 3GSQA 4MNGE 5FDYA 3QUYD 1CDJA 1E4WL 2VIRA 4RFOH 2D7MA 3TVMC 5SX4H 5ICXB 3IFNH 1C5BH 1VDGA 5HHOE 4JQVA 4D9QE 5CJXA 2DYPB 1ADQL 3BPOB 4MJ6A 4EVNA 4KJWC 1A3RH 1RZFL 4YHOH 3OZ9L 4PRHB 5DHXB 2CJUL 1U3ZA 3AMLA 5FO9B 1HK6A 1WBXB 1BD2D 1QSFE 3RWCA 5A2IH 4L8DB 5CGYC 4FFWD 1IAIM 1M1SA 3BYYA 5D7LD 3D0LA 3RAJL 4O9HL 2ATPB 1T1WA 5AZEL 4C54A 4NRXA 3T2QA 1CG9A 1OAZH 4JQIH 4RQQA 1BGXH 4WW1B 1D6EA 5FA4A 2D2OA 4QHMB 4OLZL 3VI3E 3KHOA 3NABL 5EZLB 2ZJSH 1E4XL 2ICEA 3IGAA 5TE7L 1DQJB 1TQCC 1QLFB 4CADA 1L0XA 3OXRA 3I75B 3Q1SL 3MGOB 2WINB 1V3KA 5HY9B 1FPTH 1IKNA 1J1OL 2E7HA 5CSGA 3KPMA 3NFSL 1QRKA 3JTCA 4R96A 4JREC 2ADJB 4HQQH 4PP1C 4HHAA 1ZVSA 3B43A 4JZOA 3WDIA 2J8UF 5I8EB 3PHOA 1H5BC 5E4IA 5JNYA 1LO5A 4QY8B 3LKNA 3KPPB 3HR5A 3TESA 3SCMD 2XKNB 3D2UA 4HIIB 3TWCH 4ORGB 5JHDE 1ROWA 3BKML 3HNVH 3VD9A 3SDCB 3UTZA 4NN6C 1MLBB 2F74A 4CVWA 3UJIL 3F62A 3KJ6H 4F2MB 1AY1H 3FT2B 2Y06L 4MD0A 3MUGB 1K6QH 4S1SL 5IMKB 4NCC1 4WV1B 3RPKA 1N5YH 2VDNL 1QFHA 3L3IA 4P4KD 3HMXA 5TDOB 3BN9C 4MA7H 1CD8A 3DRTA 3TBTA 1XZ0B 4KRLB 5C0BB 4Y16D 5IMLA 4QXGH 3TLRA 5JUEL 5DD5H 4ZSOB 2CPCA 1K5NB 2CRMA 2VZVA 3N1QC 4YHIB 4QHMA 1UH3A 5I18H 2UVFA 3JTSA 2FX9L 2VL5B 3BP4A 4LLWB 4C59B 1DBML 4MZ2A 4XMKL 3QDJD 2WV3A 1HKLH 3FQRB 1ZTXL 4Z5RA 3ERYA 4CVXA 2QEJA 1IC4H 2J3SA 3HE6A 1KCRH 5IMMB 3GZKA 1FL6B 4KUZL 1NAMB 4Y2DA 1JGDA 2CK0H 4EUPA 4X98A 4NHCH 3CK0H 3DI3B 5IW6B 4LF3A 1CIDA 2Z92B 4R3SB 1VCAA 5IIEA 2YRZA 1T1YA 3JBG7 5I75C 4MQXD 4RZCB 2BZDA 3ESVF 2CLRB 1ZHNA 3LRHA 5SWSB 3MRIA 3W9DB 4I0PD 1VA9A 3JTTA 4L5FL 1HI6A 5KSAD 3GGWB 1EFXB 4XP5H 5DHYB 3O6FB 1CGSH 4MAYA 4OCRH 4NKMA 4KRPC 2XWBA 4AK1A 4BSVA 4HIEB 2O5XL 3O8XC 3X14B 4LGPB 4AZ8A 3IXAA 1Q9WB 5CILH 1ACZA 2AK1L 3SDAB 3UTTD 2D31B 2X10A 4OGXH 1M7XA 2EEBA 2GQHA 5C0GB 1S7TB 3RL2B 4O4YL 4JKMA 4NBYB 3FN3A 3WFCH 1XR8B 5DD0L 3AGVA 1ZEAH 2B1HH 3H6JA 5FXCH 1A6ZA 2HFTA 3CSGA 1MUJB 1S9YA 3UZEA 1JPST 1CD9B 2GEEA 4J7RA 5HGGS 4NQXB 2JE8A 4QHKJ 2EYTB 3TC9A 5AD0B 4HUXB 2FRGP 4R7DB 4FQXD 3IDXL 4J4PA 4G6JH 1TZHB 4OI9A 2B2XH 3PNWB 4LPTA 3X17A 3RDTB 2QSQA 4ZNEA 4YFDB 1HHGB 3QO1A 1IQWH 3HZKB 4H1LG 5MEQA 3K74B 1U2HA 3QWOB 5J4MA 3CAFA 1JGLH 4PP1D 1AD0B 4LHQB 1LEKA 1MI5B 4HBQA 4KV5E 1NGYA 4OUUA 5DJDA 4KHTL 2NXZB 3VDCA 5MEOA 4XMPL 4M1DH 1Q72L 4GW4B 4U0QB 1AXIB 4PJDE 2HKFH 3DNKA 3WUWB 1Z5LB 2NW3A 3TBWB 1I9EA 2MNUA 4DGYH 1CGSL 2OBGA 1JNJA 3IJHB 1I1CA 3T0EC 2X42A 3IF1A 1A6WL 3SGDH 4Z6AT 3QUXC 2HT4D 2X2YA 4QHKI 4Y0GA 3D9AH 1SY6L 1MIML 1U91B 1YY8B 2NY5H 3DBXA 4NO3B 1OWRM 2DQFB 3FB7B 4KZDL 1CD1A 3QEQD 4RMSA 4FQIH 2BSSB 1DJSA 2WINA 3X3GH 5AWNH 1S78D 4OZFG 3L9RB 2VLJB 5JOPD 4Y5YA 1JTPA 1J0KA 2R1YB 5LXGH 2VAAB 1V3MA 5GRXG 1NDMA 2R2BA 5I6XB 2FGWH 3QH3B 3QJFA 4JRYE 3MFFB 4FP8H 1FNSH 1AQDA 3HLAA 5JUEH 5DJ8B 4L8CB 3MRRA 2VN7A 5E03A 3SKNA 5IMKA 1OTTC 1CF8H 3CC5B 1BF2A 2CUMA 4PTTB 4NNXA 4GAYA 3IDGB 1MJJA 4HIHB 4PJ5D 5CLTA 3VU2A 2OJEA 1Q1JL 1M7IA 3M8OL 4JJ5A 1LK3L 1U3HC 3WSQH 1A7PL 4Y1AD 3GSWA 5CEXB 4Y4FC 1CE1H 5CEZH 1P2CB 2FIRT 4IMKA 4HUVA 1NGQH 3GI8L 3OB0K 4CU6A 5IWLC 3WXWH 4TNWF 2J8UA 3D85A 3U0TA 1JGEB 1XGUA 4KAQH 4OCMC 1ZA3A 2K3TA 2FWOB 4XHJD 5C07E 3MRHA 3Q6FA 3SJVA 1CU4L 1VGEH 5KVDL 3D85D 1T2QH 4MCZB 3X14A 2XN9B 1JMXA 3WL9B 4MJID 4QGTA 1QLFA 2P44B 4OCXL 1RI8A 2VWEE 1B0GB 1ZVHA 5JORB 3MRBB 3LEXB 5KVFH 1IQDB 3B9KB 1A7OH 3TN0A 4PJ9D 1G9NC 2IANA 5EOTB 1O7VA 1CWVA 1NBZB 4AYFA 1MAMH 5GRYA 2VXUL 3RA7L 1RIVH 1W72B 2FGWL 2HJFB 3KPNA 5ACZB 2Z92A 4R3SA 5T1LA 5C0NC 1ZEAL 3RDTC 5EO9B 2C3VB 2GK0B 1J88A 1S5IL 1P7KB 1EXUB 3FOMB 3MOQA 3EAKA 2EDFA 3HC4L 4I0PA 2UY6A 4O51B 4X7EC 1YA5A 1U8OB 2VXVH 1ZGLB 1BVKB 1WITA 5EU6B 4FQJH 5T3XL 3BPLB 1QA9B 1LO0H 3HCVA 1GOHA 4JFDA 3LKPA 4XMPH 2W65B 1IGCH 2G2RA 3FQRA 4KWUA 4FNLL 2V5RA 3ULUF 3KPQA 1EHLL 4H26A 1YDPA 2QHLA 2YR3A 3HB3C 4P49A 5KVMC 2CMRH 5F9DC 1CK0L 4H25B 3MX0A 5EZOL 4LSQH 4ZD3H 3T77A 4KRPB 2EXYC 2BSTB 5KN5A 3U7YL 1A9BA 4ZSOA 5KAQG 1EAPB 4JPKH 4MCZA 4LK4A 5JMOC 5CEXA 3DROA 4WU7A 1A4JA 4UTAL 2EH7L 3TA3C 1QFUL 5DJ0A 3FONA 4YHKL 4G5ZH 5EPMA 3L1OH 2A9MH 2SEBB 5EIIA 2H6PA 3S34L 5E2UL 4XCCL 3RVWD 5D70H 5CUSL 4XMLH 4MNHB 4X80H 4OZIB 4HLJA 4KZDH 2W60A 4KHXL 3QA3B 4RWHA 5FECA 4LF3B 1B3JA 1R5VB 4FTVB 1V8HA 2IFFL 3LKQA 5I1IH 3B3IA 5EH1A 5E00A 1HINL 1NH6A 1TZIA 3NAAL 3CDGB 2SEBA 5EIIB 3VFNA 2I26N 1CICA 2H8PB 5FM8A 4NNXB 3DETD 3O3DB 4TVPE 1Y6NR 4Y4HC 4AEIH 4BFEA 4UILH 5EA0L 4M6ML 4PREA 2OTWB 3UBXI 5HHXH 2P45B 3AAZA 4I0PC 2APBA 4G8GD 1M71B 4JO2H 2PF6A 2BHYA 1JGUH 4PGCA 4WTXA 3HC0B 1KB5A 4LLYA 2Y9RT 3DVFA 1U8LA 5FCSH 5I1JL 1VEMA 3WIFA 3MRCB 5D1QD 1J1XL 3HZYA 5E9DA 1Y6MR 3QIBC 4LCIL 1JGEA 4NKDB 4GRWF 3VFGL 5JDSB 2AJSL 4LSPH 5GGQH 3ZDZE 3TVMD 5I1CL 3RUGB 4QOKE 4P2QA 5JMRA 1BD2A 3HI6H 4NKOB 4N90D 1RURL 4QXGL 1YUHA 2FYYB 4F8TA 4HK3N 1HNFA 3L1OL 1WC7A 1JIBA 1RUPH 1H8SA 2MFNA 3ROOA 3PP3K 3S35L 5JDSA 4JFEE 1JHLH 2FL5B 3CDFA 4QLRA 5IMOA 5J6GB 3MLVH 4WTZG 3SQBA 3VWJB 2W0KA 4Y4KD 4E5XB 5MEND 1RIVL 2FO4A 5CIPA 3OHXA 3QWRA 1W72A 3QBTB 1JK8A 1T21A 4M62H 3S5LB 2VDLL 3P73A 2XI9A 1S5IH 4IMKC 3MRFB 3RTQD 3L7FA 1Q8MA 1MH5A 2X7LA 4ONFH 5D93B 3PF2A 3T1WA 4K07A 3C5ZC 3FO9B 3RVXC 1DVFA 5D1XA 3NIDF 1CLOL 4P57A 4L3CA 5DVMA 4UZGA 1OTSD 2VLKA 1AHWA 3NIGF 3FO2B 5JXAL 4LEXL 2GUOB 3ARQA 4O2FA 1Z9OA 5DRZA 5T3XH 2XOTA 2DQIH 3E8UH 6FABH 1YDPB 4PJXE 2IH3A 1VADB 1J1XH 3O6FC 3O4LD 2VSDA 3O3EB 4Y5YC 1JPFB 4EIZC 1BOYA 4XNXL 3BWAB 4RCAA 2LQRA 4CVZA 4PYGA 2W92A 1K6QL 1T7ZA 2HVKA 4FQXA 4UU9A 1A02N 2V6HA 1P2CA 4U1SA 5GGUB 3LV3A 1I3UA 3G9AB 3QYCA 3RVUD 3VE0A 1UXWB 3HE7D 3OAYK 2Z8RA 1KJ2H 2DL9A 4U7KA 4ZOCA 3E0GA 4PJCE 5DRNB 3AY4A 1RPQA 1AP2B 3HC3L 4PLJC 5CKGA 4OSUL 4F7TA 5IB1A 5EPMB 3KYMA 2FHBA 5E2UH 3ZO0A 2DQCH 2F54D 4QRTA 3WV0A 3ZDXE 1OTUD 4GOSA 4P2CG 1R3KB 1DBMH 4XMKH 5T1DL 3T77B 2EH7H 4MAUH 4GKZB 4RX4D 3WL9A 3RGVB 2WBJA 4L9LB 4YHKH 2OR8A 4P9HC 4GXUM 3IFPB 4R26H 2BVUA 2AK4B 3BP6B 3MFGB 4X4MA 1T4KA 2IQ9H 5E8PA 4QRQA 4KKBC 4AL8H 4KH2A 2BNRD 4POYA 2X9WA 5IMMA 3N85H 1D6VL 4Z7OF 1G1CA 5CHNB 4M8VA 4XAKD 1EFQA 3MXVH 5LBSH 4N5ED 1EFXD 2WWMD 5T1KA 3IT8D 4FQHA 4HJ0D 2AK4A 3BP6A 4KKLC 2ESVB 3OKMB 4U6YB 1KN2L 3QUYC 1MIEH 4NJ9H 4OD2B 1A4KB 3MLYH 4HJJH 3E2HA 1EBAA 1NBYA 2Z31C 4OJFL 5JLZB 2NX5E 2PO6D 1FGNL 1V05A 2RGSA 4LASH 2EE6A 4M1GH 4CDHA 4MAYB 4UDUB 4E0RA 4TSBH 2LVCA 3LMJL 1MRDL 3K4ZA 4PRNA 4ZG1A 2HYMA 5EO1A 1J7VR 5FYLE 5ACZA 4UIMB 5ALCH 3UTTA 4I4WA 1EZVX 3UROR 1IJ9A 3O8XA 1KB5B 2V2TB 1RZ7L 3K80A 5ANME 1LDPL 3Q3GB 5DD3H 5HY9A 1KELL 4NP4L 1JTOA 2VLRD 2AQ3A 2YPLE 4MAYC 3TYGH 3ZTNH 1XIWC 3HAEA 1RFDL 5A16A 2MQCA 1P5UA 4Z7WF 1PKQA 4WEUD 1N64L 5I8EA 1UQSB 4OM1H 4LAQL 1K9TA 2Y5TA 2XY1A 4XPBH 3ARBC 5HDBF 3ULUL 4KPHH 2VQTA 5DDHB 3ET9F 4QOKB 4RAUA 3BQUA 4UNUA 4OCSL 1DBJH 1MCCA 3OXSA 4O02L 4JKWA 5I73C 1UWEH 4OFDA 3P4MB 1EEYB 2VKWA 3C8HA 2IAMD 2Z35A 1NGQL 3TH4T 5MEOB 5BQ7B 2ESVA 1WISA 3OKMA 2EIBA 1SM3L 2FEEL 4QRUA 4PJ8A 4YQXH 3G5ZA 1RZKL 1F90L 4X5XA 2QL1A 1Z9MA 2Y25A 1DLFH 2HFFA 4JREB 4JCLA 2PTTB 1OQOA 1EGJH 3K3QA 5GHWH 3GSNA 4LEOA 5CSZB 1T1XB 1INEL 2QSTA 5FCUH 1N26A 3B4NA 4GT7A 5CINH 4HLZG 5T1MB 3FRPA 4KTEH 3EJZC 1VFBA 3BGFB 1NCCH 4NZUH 3RAJH 3RWGA 1S7QB 2A6DB 4ACPA 2WIIA 2VTFA 5IB1B 1MNUH 1QBLH 1RFDH 1OHQA 1OAZL 4NQCA 2VLKD 2YMXH 2H3NB 4K2UH 4P5KB 3LV3B 2EC9U 4PRPE 3DECA 1TTGA 4D9QD 2RIKA 2V5TA 5CP3H 1LO0L 3UJTH 4KI5E 2H41A 1O0VA 1YEKL 4EN3C 1P7QD 3VWKC 4FN0A 4NKMB 4XVSL 4XX1G 4NWUH 4XVUC 1WBZB 3V4PL 5T3ZD 1JBJA 4HJJL 1CFNA 4ODHL 3FFCE 5IB4A 3EBAA 1A6AA 4OD2A 5JPNA 4YQXL 5F9OL 4MXVE 1YQVH 4KVCH 1YMMA 4I2XE 1VGEL 5KVDH 5DJAB 4BQ6A 4FABH 4GKSB 4TSBL 4JANB 2VJXA 4RIRB 1AKJD 3D39A 1NGXA 4PJIE 5SX5K 3V5KB 3QI9C 4QRPD 1D5MB 3PXJA 5DWUH 5F6HJ 5ALCL 3LZFL 3GMQB 1L7TL 3MV9D 3WEXB 4Z5RB 1IARB 2JTDA 5IM7A 3F7YB 5DJAA 3G08A 4MQ7A 4D0DA 4DEPC 2AXGB 3Q5YA 5SV4A 1E27A 3MV11 4JPWH 1EO8L 3WXVH 4M8QB 1N2RA 4Z18A 4LSUH 5EUOF 4PJGA 1D5IH 1EGJA 5CSBA 2D31A 2FGZA 1TVDA 3IDJB 4MVBD 4DKEH 3QNZB 1HZHL 2WNGA 2VZUA 5D4QA 3QUYA 4NZDA 2CLRA 5SWSA 4OGZA 3ZE0F 5FYJE 4UIMA 5KSBB 4NC0B 5K9QG 1GVIA 1EJOH 1SMAA 4PJAF 4TULL 3GGWA 2OMNA 1IC5H 5T3ZL 1E4KC 1PLGL 3CPLA 2Y1VA 1DFBL 5CJOH 4HF5L 5DQ9A 2QK