1ZT4A

The crystal structure of human cd1d with and without alpha-galactosylceramide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
272
structure length
272
Chain Sequence
b'RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d
publication title The crystal structure of human CD1d with and without alpha-galactosylceramide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 272
sequence length 272
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zt4A01
2FL5A 4MNHA 1J8HD 2X9YA 3MJ9H 2HT2D 2NY5L 3ARTA 3TYFA 4E9LA 1T7WA 1XGYL 2CO6B 1S7RA 3AB0B 3Q1SL 1G7IA 1S7XA 4DUWA 3D0VB 5HHPB 4OCWL 5CILH 3L95A 5E2TL 2C4FU 1EPFA 4LSDA 4XH2A 1OTSD 1A6PA 3QDHA 1AKJB 1E27A 5LWYL 2OP4H 4G8GD 5E2UH 4ZUWA 3KJ4B 5AAWA 4KKCC 1YYMH 4JG1L 5SWQA 2BC4B 2GUOA 2XKSA 4RGND 4Y4KB 2VITB 3N06B 1WWAX 2XRAH 5IT2H 3T3PE 3MJ8A 3MUZ1 4XC3L 1FFPA 1D5MB 2BVEA 3GHBL 4JKLA 3QQ4B 3LKOB 15C8H 3MLRH 5ADPH 2FGZA 1D6VH 1A1MA 2VLKA 4Y5VC 3LKSA 5E2WL 4X4MA 2VO5A 2C3HA 5EB9A 1MIEH 3EJZD 1EAJA 2Y25A 2NY4C 2YUVA 1NMAL 2OZ4A 3CVHB 4U05A 4YK4C 5D96C 5DZLA 4P4KA 3ARQA 4W6WB 3HC3L 32C2A 3DUHA 1JNLH 3NOIA 3ALWA 1A6UL 1YPZA 2JLLA 3C5ZA 4HFWB 5DJZA 1KCLA 2BNRE 5I1GL 1V3LA 4K3HA 4HWZB 3ARFB 1ZS8A 1KTLB 2EDXA 1I7TB 3HAEB 3SN6N 5D72L 3EGSA 4N8CH 5DR5H 1CN4A 1DE4A 3WFCL 1F90L 4IRJD 5J1AB 2CDFA 2MCPL 1FG2A 1ACYL 3FFCE 4ZDHB 2IGFL 2XTJD 4K23H 3Q3GB 1WBXA 3VRIB 5BXFB 4DGIL 1UJTA 4NQEB 4TNWF 4GRWB 4NT6A 5KAQF 4M1DL 4G8IB 1IE5A 3FB7A 4I18A 2Q3AA 3L3KA 3H42H 5JHDE 2VZTA 4PJGE 2FCBA 2FX9H 5GS0C 3B9KD 1JRHL 1CE6B 1MWAL 1UVQB 3TT1L 4PPTA 4NDMB 1MI5E 3DSFL 3UJTL 3L7EA 2BNRD 3PUCA 3P0GB 4L9LA 2C1PA 1K4DA 1U8LA 3G04A 2WINB 3KS0J 3L5XL 3BZEB 4YHIA 3T2QA 3WXVL 1CDHA 4GRLA 2AEWA 2V2XB 3FO1B 1JPSL 1ZLSH 3BISA 2YD4A 3BKML 2EYSA 4MDJA 1P7KB 1CI5A 2R39A 3SGDH 3MOBL 3EUUA 1OAZL 3FFCD 2PO6B 2GKIA 1CLYH 1FN4B 2VIRB 4JFYA 4LLUA 1RJZB 1KBGL 3KLDA 4QYOA 3LN5A 2ZWLT 3I6GA 2J8UF 4LAQH 3IDIB 4P2RB 4FQHA 1J8HA 3U4AA 3M07A 3CDGA 4JKMA 5DFWH 5DQDL 3WFDL 4UINH 1QSED 3GI9H 1EMTH 2VDOL 4J8RB 5JHDD 1S78C 2D7PA 4L5FH 4XHJC 3DRTA 5I76A 1NBYA 3IS0X 2HLAA 4OGYL 4PGCA 2OI9B 3ABZA 3R1GH 4N0FB 5GZOC 1NGYA 1MI5D 2ZCLH 4NSKB 1G9EA 2F8VA 4TRPH 3E8UH 4S1RH 5E6IC 1RMFH 3V0AC 3NTCH 3QULA 1OM3L 3WHE1 1A3LH 1WBYB 4KTDL 3ZKMC 1TJIH 3S4SA 4Y4FC 4Q74A 4NM8H 4HH8A 4WW2A 1FRGL 1N7ML 1ZE3C 1KPRA 3NA4A 5TDOB 2EYRA 4KQ4L 4YHMH 5C70A 2DQIH 3VDCA 5IWLC 2QKIA 5I8CB 1MEXH 4R26L 3RY4A 4UBDC 1N64H 1I7ZA 5IFHL 2VKWA 1IZKA 4N9GA 3EO0B 1IAKA 5EU6D 1A7PH 5CJBA 4M6NL 5E00A 2FJGB 3KPQA 3OJ2C 5I19H 1A6ZA 3SBWC 3F7PC 4HMDA 1N8ZB 3SGKA 3A6BH 1B2WL 3GGWA 3TBSB 2NY1B 1WSST 1F4WH 4Z7UB 3LZFL 5DHYB 2P8MB 5BW7C 2NY6C 4YJZL 4AQ1B 2FH6A 1J5OH 4NHCL 5EC1B 2A2QT 1U42A 2DM3A 4Z7VE 1LO5A 3V6OE 4ZUTB 3LEVL 1H3XA 4FFVC 3WJJA 3ARGC 5I1HH 5JUEH 1NJ9A 4XNMB 2EEAA 3DROB 1UYWH 2YD8A 3N9GL 3PWJB 2NR6C 2Y5TA 2ERJB 1MFDL 4X4YA 3H6JA 5DEGA 1S5HA 1U8JB 5CBEA 5IB4B 3FMGH 1YYLH 3QJFA 2E9JA 2EC9T 4IRJA 3TJHD 5FF6B 5ESAB 4POUB 5F89A 2VJXA 2NY7L 3IJHA 5D7IE 4OFPA 3VG0L 1DLFH 5FO9B 4C4KT 1WFOA 4ZNEE 4IDJL 4QNPE 4TULL 3WIIH 2AK4B 1E6OL 3ESUF 3FKUS 5LCVH 5I71C 5FUOH 5DURD 3OX8A 4JFFB 2OL3B 1EGJL 4KU1A 5JQHC 4WJ5B 5DGQA 1NFIA 4CU8A 3X12A 2HJKB 5DSCA 3B9KA 1ZHBA 4HS3B 1C5DB 1FL5A 5DD5H 3MLXH 4TVPH 3FT3B 3RY6C 2W9EL 3LB6C 3KPRB 3VXTB 3P9MA 4HIXH 5FUCC 2BNRA 3G5VA 1H3UA 3U9UB 4J23A 1BEYL 3D2UA 1KLUA 1JFMA 1R3HA 1MRCL 2JJWA 4PFEA 4RISH 1BFTA 1BX2A 2L7UA 4LEXL 5JXED 2F19L 3ZSSA 4RDQG 4LSSL 4Z9KB 1KSRA 2XQBL 1XF2A 1HIMH 3UAJC 3O6FD 3S37H 4PB9L 3FFCA 3TIEA 1OGTB 4U6YA 3SO3B 4MAYB 4PJ7E 1WICA 2HP4A 1S7UB 4MQXC 3CFDB 2OJEA 5CZXD 2E6QA 2JELL 2J8OA 2CK0H 2YXFA 3OAUH 2QSCL 2V17H 3GSWB 4ZXBD 2V5TA 3L5WA 1NSNL 1KNOB 5C8JB 4PV9A 2R1YA 1QSFB 3GIVA 1FORH 4MD5A 5JHDA 4BKLB 4PJGA 2WIIB 4PJ8B 1SEBA 2HKFL 1Q9WA 3G6AB 3JV0A 2HTLD 4CN6A 1INQB 4AEIL 5FCUH 4X6BB 3RX7A 1HXYA 4ZOEA 3IXAA 2GJJA 4HXBH 4R7NA 5C0AD 1MI5A 1JGDB 3STBA 3VXME 4WGWB 3O2VH 4XWOC 1GGCL 5CUSL 2VDQL 1AY1L 2Y36H 5D5ME 2ENSA 4XNZC 5IBLD 2DIJA 4HULB 4IS6B 4I5BA 4FZEL 2AJ3B 5E2VL 5JW4N 1IEBB 1A4KB 3FQXB 4DEPC 1KCUH 2FX7L 4ZUUA 4CW1A 2F5BL 3GRWL 1U36A 3IYLW 5TQ2L 2Y7QA 1KACB 4MVBC 3RFZC 2VL4A 4Z76A 5L8KB 1D6EA 1C08A 1EEZA 1PZ5B 5IMOA 3MRDA 4S0UC 4M02A 3FZUC 4LOUC 2BNQB 4DWHA 5ADOH 1T0PB 3QH3A 4Y5YC 4CU7A 1DDHB 4R7DB 3MOAL 5ICZB 5I9QC 4M61A 4NNXA 5E8EB 4C54A 3MZGB 1JJUA 3R0MA 4S2SA 2DM7A 1K6QL 5HHMB 4U3HA 2Z31D 3SGJC 3T8XA 2DF3A 1IARB 5C6TH 4E5XA 4OCYH 3JTSA 1A2YB 2WIMA 1TVDA 3TFKC 3E3QC 4ESKA 1MLBA 4MZ2A 4HX1B 3VGHA 3C60B 3O6LH 1KPUA 5DEFA 1U58B 1DJSA 5KSBE 2DQHH 4JFOA 1I9RL 2H2PC 4MS8C 5D9SB 1PFCA 3KPMA 4AEFA 4N0UB 4LPUA 3ES6B 1PLGH 1ZXQA 5T1KA 4G6JL 3O2DL 2EICA 1T1XB 2PW1A 4TNWK 3VFWB 5HDQH 4HWBL 4ELKA 3QDMB 1JCKA 5D71L 2A1WH 3BAEL 1KCVL 3D25A 2X10A 1JGLL 3MV9D 3RAJL 1ACZA 1WZ1H 3BSZL 3O2WL 1N59A 2WWKO 4JE4B 4V2CB 5DMKB 3BXNB 2X4PA 3M1BB 2YKLL 1WV7T 3LRSA 4UUJB 4EI5D 3QDJB 3IFLL 3C5SB 2CRYA 2YPLE 5SWZE 3GMOA 2J12B 4MJ2A 1J0YA 5T3ZD 3GKWL 4D9QE 4K9EH 3PQYE 4DOHE 5B38B 4Z7VA 4MAUH 4XP5H 5EU3A 4P5TB 1Q9KB 3V6OA 3L3HA 1WWBX 3MYJA 2AK1H 4PJCB 4FABH 2UUDK 3SDDD 4AK1A 1VEOA 5D1XA 3T2PA 1NLDH 1UXSB 2J3SA 3SKJL 3CH1B 3MGTB 4QWWC 3F6LA 5KN5A 1PAMA 5HHVL 5FYKU 3D48R 5JHLL 2W91A 4RZCB 5J11B 1F4AA 1AC6A 5F3BA 2Q7NA 5D7IA 2WANA 3MRJA 1IMHC 1NGQL 3WUZA 4ZNEA 2B20A 4X6FB 4NUGL 4HUXA 5AYUL 3MRQA 3F65A 4WWID 5KVFL 4BZ1L 2YD3A 3VGEA 4LKCB 4R0LA 5HI5D 1U2CA 3HE6D 4HS8L 5SWZD 4JFZH 4M4PA 2V2TA 1C5CL 1RZKH 2EH8H 4D9QD 3PQYD 4U1JA 3ZTNH 3O8XC 5I16B 2R2EA 1T80A 2KBGA 2AGJH 3IAGC 4RAHA 2NY2D 2WP3T 1F6AB 1X6LA 3L3JA 4X5XA 3MRHB 3MYZA 4XMLH 4PJEE 4Y19B 2C1OA 4A6YH 1BZ7A 1OY3B 3WL9A 5MEPB 3TV3H 3U6RA 3GNMH 3RWHA 2AJVL 4AENB 4PJ7A 2WBJB 3TBTA 3P0VL 3S37X 3VWKC 3QUZB 2F9BT 4KY1H 1I7RB 5E0QA 4NKOA 3N1FC 3T4YB 1KN2H 1IT9L 1NDGB 2AW2A 1FPTH 2P24B 4K3JL 5C08E 4DTGL 3SE9L 3RL1A 4S1QH 4I0CC 4ETYA 2AQ1A 4ONHA 1N26A 5D2LE 5F97E 4KROD 3AUVA 3NZHH 4EI6A 4UT9L 3LKNB 2DDQL 3MLTA 4PRHB 3VXMA 4I0PB 1QLFA 3TPUB 5H8DA 3LVEA 5FYLL 5DVKA 4YWGL 4OV5B 1B0GA 4N5ED 5D5MA 3BZFA 3BP7B 1KUMA 4OLUL 1MJ7L 3LEYH 4MSWB 4YHNA 5IR1B 3GSUA 4WEUD 5LQBL 1R5WB 3ULUE 2IADB 3QXVA 1HI6A 1FLTX 5TF0A 3V9FA 1J88A 1A6TA 4UU9A 4BUGA 5GS0L 4EJ1C 1PKQB 3GSOB 4LSVH 1T2QL 4OKVB 5C09E 5F9WB 4PJ9B 5KVDL 4AG4H 3DXAE 2YPKA 3PGDB 1UACH 3AS1A 1L6XA 2XZAH 3WIHA 4HK3N 5BS0E 2AI0H 3DNKA 4J3VA 2ATPB 2DQFA 3H7BA 3GJEB 3IGAB 3KPLB 3PHQB 3VI4E 3B2VL 2AS5M 4OF3A 3PWNB 4GG6B 1FYTB 1MQKH 1T04B 4N1HB 3CIQA 2IWGA 1NFDF 2X5PA 5GHWH 2ARWA 5KSBA 4P0DA 1ZVSA 2FEEI 1P4LB 3SDDA 3BN3B 1U6AH 4QRTA 4WW1B 5TGBA 1D5XB 1HOCB 4M5ZH 4RFOL 3RWGB 3ULUD 2R2BB 1A0QL 3IRZA 5IEHA 3BWAB 1I8MB 4DCQA 4OLZL 1ADQA 4OGXH 5DJXB 4BK4A 5MHSE 1ZLUK 3ARDA 1G9MC 4M6MH 3IU4L 4Z5RA 4JFEB 4PGBA 2R4RH 2NXYC 4OZ4A 5FDYA 1S7VA 5ENWB 3HZMB 3V52H 1MAJA 3DXAD 5ACLA 3HNVL 1PYWB 2VL5B 1F4XL 4XBEL 2JCCF 5JQ6L 1AGBB 5DFVD 4F9PA 1IM3A 2ICEA 3I02B 5BS0D 4P3CH 2HVJA 4GS7B 3UTZA 3TO4B 4JPIB 3MRBA 3QUYB 4LLAA 3TN0B 5SWZA 1ODAA 5D7SL 3QDGE 3RTQA 4WY7H 4GQPH 5CSBA 1FL3A 2B1AH 4XTRD 3SE4A 3PQYA 4I0KA 3UJIH 4P59L 5J0BA 5H35A 4I3SL 4XRCB 2NNAA 2UYLA 1KCKA 3QP3A 1SM3L 1T03L 3X17A 5D70L 5F7KC 4DKFH 1HNGA 5C0ND 1ES0B 1X4YA 3ZDXF 3LCYA 3WNOA 4QTHB 3UBXA 4ODHL 4P46C 5MHSD 4NQXB 3MLVL 4ZSOB 2IC2A 3TWCL 4EIZC 2GFBB 2P43B 2BX5A 1EAPA 5AZ2L 1QFWI 2XTLA 1G1CA 2VAAA 2RB8A 4M1CD 3PWLB 5FKPA 5IFJA 5BVJA 3TVMB 2EDFA 1Q0YH 5HYSA 1HHJA 3ISWA 4RCAA 2P8PB 4CVZB 4XX1G 3F58L 3HRZA 1CE1H 3BX7C 2D0GA 1MIML 1X5ZA 4GW1B 5CD3A 3QDGD 4XPTH 4PUBH 1OAUH 3RPIA 2A77L 1OSZA 1S7QA 2O5YL 2R4SL 1UC6A 1CT8A 5HGHB 3IAPA 3SDXE 1EFXB 4HAFA 4X6EB 1LHZA 4N5EA 3QIWD 4FQ1H 1KCGC 4FQXC 4GG8A 5HVHB 4JFXA 1VCAA 4UILL 5C6WH 1ONQB 3X3FH 1CZ8H 3D85A 4DZ8B 4PJEA 3QQ3B 1A7RL 5AZEL 1JE6A 2ZG1A 4U33A 4KUZL 4LRIC 4CMHB 2VUYA 3MGOA 4X6CF 4XWGH 4DN3H 2V9QA 4Q9QL 1REIA 2DWEB 4GRWH 2HJFB 4EBQH 1BMGA 2GIYA 3RVVC 4DQOL 1KENH 2LQRA 1PY4A 4NN7C 3M17B 5J1TC 1BP3B 3FHQA 1KIUA 3HE7B 3GMLB 3TESA 3WSQL 5C08A 2R56H 3C8KA 4QKXB 1C7TA 2A38A 5F21B 5T5FL 2AXFA 3QXTA 1INDL 1OWWA 1HEZA 3WO4C 3PF2A 5D2LA 4GW4A 4LAJH 3O3AA 5IKCB 4YDKL 3WHXB 4UTAH 5EBWB 1ROWA 1X5IA 5DD0L 3SCMC 4Z7WB 1ZT1A 3C5JA 5CEZH 2EZ0D 3MLSH 4LRNL 3M8OL 2BFVH 3BGFB 2A6JB 1KIPB 3MLUL 4KK9C 4P2CG 2H26A 1U3HA 4FQCL 3WKML 3JWDH 2BSSB 1BQLH 1QFUH 4XXDA 3NAAH 1M7IB 4Y2DA 1Y18B 2HG5A 4J3TA 3HZKA 4XCEB 2AQ3A 2FRGP 4G5ZH 3UTTB 4Z78B 4WO4C 3PGFH 2VKXA 5DC4B 4R2GC 1FIEA 2YA1A 3F7VB 5C09A 4M8VA 1KELH 1N5AA 5GGUB 5JDJA 1OTTD 1W72H 3AY4C 4UT7L 3DXAA 2BHZA 2ADFH 1EBPA 4D2NA 5LG1A 1I4FB 2IAMC 4HCRA 4H1LH 4D9LL 1B0RA 3BVNA 1FFQA 4L29A 5EOCJ 5BS0A 1UEMA 1YNKH 4GKNB 2CR3A 4D0DA 4RNRB 2CLVA 1MCFA 2H6PA 4TSCL 2VDLL 3U0WH 4JFHD 4KHTH 4JHWL 5E9DB 1MJUL 4OCNC 5BRZD 4CADB 3LPWA 1UKTA 2XV6B 3KPNB 4PJFB 3T77B 5MP6L 3ARRA 2G60H 1KCSH 3H3PH 3PV6B 1MJJB 1K9TA 2HRPL 2H8PA 43C9B 1RJCA 5C0DB 3D3VE 1MFBL 4JDZA 4P2OC 3KAAA 4X9IA 3B2UD 5ACZA 3S96A 4L8SC 1TZHB 2OJZH 1Q0XH 4Y5VB 5JW5B 4OGZA 3V6ZB 4ORZC 4F8QA 4OM0H 4ZD3H 4JRWA 3IXTA 3NGBC 5IHZB 1P1ZA 2NY4B 4OZHF 3PL6C 4WHYH 4NQEE 3UTPD 4QTIH 5KVMC 1C8PA 1SQ2N 4M1GL 1BOYA 5JO5A 2JJSA 1QUNA 3DX9B 4JFDB 3FO9B 1XCTB 3IETA 1T7ZA 3B9VA 2D9QB 5KAQG 4KTEL 2V7NB 2ZOLA 1FL6B 2FHFA 4IRSC 4ZPVA 1CXIA 4NNPH 3ZHLA 2Y6SD 5DUMH 2D0FA 5T1DH 3UDWA 3RWFB 5I1LB 3D18B 4FQIL 3QDGA 3QQ9D 1SBSL 4O2EB 3RGVA 1M1SA 3VFNA 3ZO0A 2GAZA 4MXQC 2HVKA 3BEVA 4OGAD 4ZUVA 3D3VD 1ZLUH 5CLTA 5IW6B 5ITBH 3P4MB 3QIWA 1U92A 2AEPL 2PTUA 1AGCB 5I8KL 2LFGA 3P4NB 2VQ1B 3QT2A 3QUML 4PYGA 1R24A 5ILTH 1OCWL 3DYOA 4NRZA 2E5EA 3U4BH 5DRXB 3W11D 4JR9L 5GS1A 5EBGA 4HUVA 4FQJH 1D5IH 1U8OB 1I9EA 1FVEB 2IPUK 4P2RE 1PJ9A 4OQTA 4I2XE 1NMBH 4TQEH 4IOIA 3DX8B 4NQCB 1KB5L 2NXZC 1CIDA 4GAGH 1BIIA 3BD5A 4NC2B 1JNHB 2PYFB 4F33A 2ICWI 4OD1H 3U0TB 4YHOH 2J7LA 1J1XL 1F4YH 5CZVH 4Y16C 2OYPA 3MTRA 1EDQA 1BGXH 1FZMA 5C9KA 4GAYA 5I1CL 1JWMB 1RZFH 2EIZA 2ZCHH 4HJ0D 4M5YL 4XP6H 2BVYA 4P9ML 3SDXA 3U82B 1T5XA 4D0BA 1DUZB 3OJDB 5F9DC 3EYQC 3PWUB 1PBYA 4CN4A 3LDBB 1ZVYA 4KKAD 4GBXD 8CGTA 2GI7A 4HLZG 1IVLA 2C3VB 2Q76A 1TZIA 4JO4L 1T2JA 3P73B 4IOFD 4M7LH 1UZ6F 5T3XH 2UWEF 1IQDA 5DF0A 4P2RD 5F6HI 1LO4H 1QSVA 2WW8A 4TUKH 1CU4H 4MCYB 4KAQL 4MA1C 4OJFH 1GZPB 4JN1H 4L4TD 4Z7UE 1T89A 5D6CB 3O4OC 5HHPA 3V8CA 5E6IB 3ULVE 3I6KB 2NY5H 5IM7B 1XGYH 4PJBF 5IB1A 4Y4FB 3Q1SH 4U49A 3ARUA 4BJLA 1UEYA 1AKJA 3PXJA 1B4JL 3CU1A 3WFHB 2BMKB 2AXGB 5E2TH 4X7SH 1DEEB 5EO9B 5TJWK 3U9PH 4OIBA 3ZSTA 5LWYH 4Y4KA 2VITA 1K8IB 4KC3B 1KULA 2DTML 1D5MA 4PRDB 2IBBA 4FXLA 3A0OA 5IIEA 3KYKL 4M7LT 3LKOA 4P4KC 1J05B 4YE4L 4BELD 4WHCA 3K81A 4XC3H 5C0EB 4NKIL 4NP4H 2AK4E 3GHBH 2NY6B 4JFFE 3HR6A 2GTWB 2X9WA 3VFUA 3MV01 1KYOK 1A02N 1IKFH 3CVHA 2C26A 3HCVA 3ULVD 4HIHB 3ARGB 4PREB 4LVNC 5FO8B 3X3GH 3HMXH 3OGCB 4NKMB 4WTXA 3KPRE 4XNQB 4QRRD 5E03A 3CSPA 4ZODA 1HYRC 4X99B 4MQ7B 4HWZA 3ARFA 1A6UH 3UBXI 3D3VA 1KTLA 3WXWL 3NFPB 1OTUC 1I7TA 3HAEA 3FQWB 5GRUL 2XZCL 5M95B 1MCPL 4JGJA 5I1GH 1HE7A 4YBLC 4K7FB 5J1AA 5E94B 5TDPB 4ZFOL 3LY6A 4ZDHA 1RUML 5I71B 3Q3GA 1VFAB 1FVCA 3VRIA 5BXFA 3CFJB 3WFCH 4PP8C 1EA9C 1MRFL 4NQEA 1FVDA 4YHKL 2MCPH 2AK4D 2IGFH 3WS6C 4MXWH 4G8IA 3K3QA 5I1EL 5GGSA 4DGIH 3PHOB 4L9LC 1JWUA 1QSFE 5BO1L 2FBJL 4YXLH 5GS3A 3WYRA 4M1DH 3BESR 2XQYK 5EA0H 4GRLC 3O3EB 3EJYC 1NUFA 2HLFD 1CE6A 3U4EB 3VD7A 1UVQA 3MNVB 3KPRD 3GSNB 4NDMA 4FQ2L 3G5YA 4H88L 1G9ML 2VWEC 5GGTA 4YHZL 1CFQB 2X4NB 3BZEA 2WINA 4HBCL 1MWAH 4I4WB 1AP2B 4UIMB 2BP3A 3TT1H 2V2XA 3FO1A 1HHKB 1F45A 3DSFH 3FT2B 3UJTH 1P7KA 5FYKD 1IGJA 1ORQB 1LEKB 1EIBA 3B9AA 3NACL 5IFAL 2HT2C 3R8BB 1DQMH 3WXVH 2PO6A 4GBXA 3TBVB 4G59A 2W38A 1JPSH 1FN4A 2VIRA 4F8TA 4YFEA 1RJZA 3BKMH 4JJ5B 3K4ZA 3U2SB 3MOBH 2BNQE 3CCHA 3UTQA 3LIZL 2XACC 1OAZH 4P2RA 4FTVD 4I2XA 1LO3L 4P3WA 5DWUL 2VABA 3VXSB 1KBGH 1XGUB 1IQWH 2NZ9D 3NN8A 1FAIH 2COQA 4J8RA 3AGVA 1MAMH 4PJ8D 4CGTA 4WW2C 1NL0L 1SBBA 4G42B 4FFWD 4RGNC 5CJ5A 4NO5B 5DQDH 2OI9A 5CFHA 4N0FA 2VDOH 5CCKL 5DVMA 1S3KH 4HGWB 4M6OL 4DEPB 3VXRB 2X1WL 1KCRL 3BP4A 2WUBL 4OGYH 1WBYA 4OLYH 4WU5B 3KPSB 3TH4T 4N0UE 1DQJB 1WBZA 1RHHB 1YY8B 5TDOA 1A8JH 1F02I 3EJZC 4ODTH 1OM3H 5LXGH 4KTDH 5FA4A 3SGKC 5I8CA 4Y5YB 4S0SD 4FQQB 1FRGH 1N7MH 5I9QB 4ODWA 5SX5H 4KQ4H 5EIQA 3EO0A 4WTWA 2DKUA 4QY8A 2FJGA 4UQ2A 2H9GA 4Z6AT 5DQ9A 3P30L 4HJGB 5IFHH 3ORJA 5F3HB 1F3RB 4KGLA 3AROA 1N8ZA 3TBSA 3O81A 3H9SD 4M6NH 5FV1L 4Y89A 4PRBB 4FG6D 4G9FD 4Z7UA 2I60L 1VB9A 2P8MA 2MHAB 3QDJE 3MRKB 5KJRH 2DB8A 1B2WH 1RULL 5F1NB 1MFEH 3EYVB 5J13C 3C60D 1C16A 3LZFH 3P9LB 4IRJC 2LVEA 6FABL 2X4TB 4ZUTA 2XTJC 3ZT6A 4OAWB 4PJCE 5EC2B 2BVUA 1MCJA 4TPRL 4APQB 1UA6H 4KKBD 2X4RB 3DROA 4NHCH 4PG2C 3PWJA 2EE3A 4MD4A 5I75C 3DBXB 3LEVH 1U8JA 1A22B 4GRMB 5DEZA 2A6DB 5IB4A 3IRPX 3N9GH 3Q5OA 5ESAA 3BP5A 1NQBA 1MFDH 3IFOB 3B9KC 3P77B 5FO9A 5EN2B 4KKLD 3QUMB 3H8NA 3ZZ1A 2AK4A 3E6HB 4P49A 2J5LC 4K2UL 1AGDA 1RSFA 4JFFA 5JR1L 3VG0H 2OL3A 1D9KD 3BW9B 2L0DA 4LLWB 5FYJE 1ZHNB 4WJ5A 3AS0A 4X0KB 1DN2A 4IDJH 1J18A 1QLRB 4ZFFB 1MCIA 2HJKA 3MLZL 3C8DA 3MMEB 5I1JL 4HS3A 3VI3F 3O6KL 1C5DA 1KB5B 1QR1B 3MRMB 3FT3A 4AZ8A 5J9PB 2XN9D 3KPRA 4P5TD 3VXTA 3UTSB 4EQ2A 4PJDF 3SKMB 4U7MA 3U9UA 1U3YA 3VFGL 4DKEL 2W9EH 2B2XL 2HH0H 4B7IA 1GPOH 3OBAA 3I3BA 3RNQB 3RIAK 4Y19E 2HN7B 1T20B 1BEYH 1JTOA 3CFKB 5MEOB 1MRCH 3U7AA 1OGTA 1TVHA 1GAFL 1CF8L 3CXDL 4NQSB 4LEXH 4MAYA 4J6RH 2XQBH 1S7UA 3VGGA 4DUVA 1PQZA 1SYSB 1E6JL 1WEJL 3GSWA 4GW5B 3KLSA 3PIQB 1Y6KR 3EJJX 5FYJD 1KNOA 1OSPL 1RK0B 1QSFA 5IVOA 5IG7B 4BKLA 3FQUB 2JELH 3O8XB 1A9EB 2WIIA 2YEZB 3BKJL 2Z8SA 4PJ8A 2QSCH 3G6AA 1INQA 1NSNH 1FP5A 4X9FA 1RFDL 4OFDA 4X6BA 9CGTA 5DLML 1ITBB 4ZPTB 4Q0XL 2XA8L 3JTTB 1MCKA 1JGDA 1CQKA 4PRHE 1EVTC 2HKFH 5F72S 3A67L 3TPUE 3UYOD 3NIFE 1QPXA 4AEIH 4HD9A 3QNYB 1RK1B 2IBGA 1DBAH 4FQPA 4IS6A 5E4EC 1IEBA 1A4KA 1L7TL 1VPOL 3A6OA 3FQXA 4U6XB 4WFFE 5C1MB 3MV8B 5DA0B 3ROOB 2FD6H 2NW3B 3MRRB 4Y19D 5CUSH 3MODH 5A2LH 1E4KA 1AY1H 2ADGB 4L4VB 4LSPH 3BPNB 3IAQA 4U1GC 1HZHL 1PKQE 4FZEH 1PZ5A 5IMMB 4HFUL 2FX7H 2F5BH 2OK0L 1KEGH 1PX4A 5TQ2H 4UOJA 2DQCL 2K3TA 3L5HA 1DDHA 3IDMB 5ICZA 5E8EA 3RP1A 4N0YL 3EFFB 3JVGA 5A2IH 2YD1A 5SV3A 3RUGB 3DGGB 3MOAH 5A2FA 3NCYS 5DVNA 4GG6E 2DYPD 1A2YA 3WV0A 5K9KB 1I85C 3C60A 4KI5D 4PRHD 3TJHC 4H20L 4MA7L 1U58A 3ROLB 3QNZB 2EEBA 5F93C 5D9SA 4KDTA 1A9BB 5I74C 4N0UA 4S1DD 4WFFD 5DT1L 1KJ3L 2IH1B 1I9RH 3ARVA 3K7UA 1BBJB 5T1LD 3VFWA 2EO9A 5L0QB 3TYGL 3LEXB 3N85L 5FOBB 3QHFH 2XICA 4DGVH 4PJ9D 4G6JH 5J4MA 3JUZA 5HHOD 1MREL 5FCSH 5ITFB 2WLZA 5HGAB 1NCAH 5LAXB 4W4OC 4KZEL 4RBPK 1D9KA 1EX0A 2FIKB 2RQ8A 5DMKA 3BXNA 3I84A 1IM9B 4UDUB 3M1BA 3S36L 1JGLH 3RAJH 4JREB 2I07B 4UUJA 3UYPA 3QDJA 3OHXA 3BSZH 4N0CD 2NY0D 5GGVL 3C5SA 1YEGL 3HB3D 5JXEC 1PZUB 2IPTL 4MQTB 4YFLF 25C8L 5I0ZA 1JV5A 2YKLH 3QPXL 4Z95H 3O6FC 1ERNA 4P5TA 1Q9KA 1SYVB 2EXYD 5D7LB 1P69B 3IFLH 4LVOC 4WUUB 4PJCA 5HTSA 2CSPA 1F42A 1UXSA 3HZVB 4MJ6B 4HBQA 5F7WC 3GKWH 1X7QB 1I3UA 5CZXC 1N0XL 3QEQE 1TENA 3MGTA 4S1SL 2NXYB 3MRIB 1KGCE 2CJUL 4ZXBC 1TTUA 5DHVH 1CGSH 4NJ9L 3ZKND 1CGTA 4BUHA 2Y5EA 3NCMA 1FGNL 2HTLC 4X6FA 2J8HA 5JHLH 1U8MB 3AAZA 1MCCA 1U95B 3CFBB 2MKWA 4NUGH 2FZ3B 5AYUH 3WLBB 5IBLC 4LKCA 4WI9A 3TO4D 2XI9A 4AIOA 3OKKB 4UB0L 3DRQB 3QUYD 1KOAA 3TN0D 2VLLB 5KVFH 1XIWD 5K9JH 4MNGB 5EBMB 3QUXD 4QHMB 4GAFB 5I16A 5E8NB 1BFVL 3HN3A 4HS8H 4OBRA 2E8ZA 1NMCC 4P46B 1C5CH 4Z77B 1YMME 1F6AA 1ZANL 4G6MH 5I6XB 3QIUD 3QEQD 3GBLA 4I48B 3MRHA 3RHWF 3VXUB 5FGCB 4Y19A 4ODSL 3CGTA 5MEPA 4KJPD 4MA8L 1NC2B 4C55A 4HH9B 4AENA 5K9OB 4OFYD 4TOYL 2WBJA 2Z31C 3BE1L 3ZKXC 3QUZA 4AM0A 2QQQA 3T4YA 4EVNB 1H8OA 4QCIB 1NDGA 2JJTA 2P24A 1QBBA 3FOLB 4TVPD 5E7FA 1IAII 1YN7A 3X11B 1KIQB 4FFZL 1LO2L 3DUUB 5ICYB 1H0DB 2APBA 3SE9H 4UV7L 3UEZA 4FQXB 3LKNA 4RFEA 3V7AG 4PRHA 3O6MH 3TPUA 4LPWA 3S9DB 1UCTA 4M43L 4NQTA 1YMMD 3FFDB 3BP7A 3EOYG 1MH5B 4PG9B 4J3XA 1Q72L 4UT9H 4MSWA 5IR1A 2DDQH 1OP5H 4FFYH 4MLIA 1R5WA 1FCCA 2IADA 5FYLH 4M48L 1CTOA 1U8PB 1ZLWK 3UTTE 3MACL 1E4XI 1PKQA 1MJ7H 4XCYA 4NN7B 3HNTL 3GSOA 3DSNA 4OKVA 3HS0B 4EI5C 3B3IB 3FONB 3RPKA 4PJ9A 5I66B 3DHJA 5GS0H 2F58L 3PGDA 5J6HA 3WO4B 3VD5A 3HE7D 1T2QH 1RZJH 3BUYB 4U6HB 5KVDH 2ATPA 2YRLA 3VFPB 3SDDC 3KPLA 2ZZUT 5AYQA 3PHQA 3SCMB 1RVFL 3C2AL 1XMWA 3PWNA 5E9DE 4EXKA 4N0CA 1EGJA 4GG6A 1M05B 3QIBD 1ZEAH 3KVQA 1DN0A 1FC2D 4KTYA 4PJFE 4C56B 1NCDL 3DECA 3VFSB 1P4LA 5CIPH 4WO4B 4Q6IC 3ILPB 4WW1A 1TNNA 1D5XA 1HOCA 3RWGA 1GOHA 4QXWA 2R2BA 3BQUD 3DO7B 2OR8A 3OKEA 3TNMB 3BWAA 1I8MA 1ND0B 3CDCA 3QFJB 4AEHH 4D0CB 3UYRL 1NFDB 1JK8B 2Z8RA 2IAMB 4G6KL 4HKJB 2FECI 5ENWA 5HI5C 3HI5L 3HZMA 3Q0HA 3HE6C 4OLZH 1F11B 2VL5A 4KXZI 1NCCH 4JFDE 2XYCA 5DMYA 1AGBA 1YNLL 3SE4C 3IU4H 1YJDH 2WAHA 3AMLA 1YEKH 1DL7L 3I02A 3AXLB 3HNVH 1F4XH 4XBEH 2NY2C 5JQ6H 3TO4A 4JPIA 5FA3B 2Z93A 5E9DD 3U0PB 1I1AD 1LMKA 3QUYA 3TN0A 4YQXL 2OBGA 4P2OB 4MNQE 3O3DB 5ETUB 3QUXA 4PDCE 5TE6L 5J89A 4L8SB 5CGTA 3EOAA 3MA7A 2FO4B 2X1OA 1ZLVK 5K59F 5D7SH 4XRCA 2NQCA 3NGBB 4UV4H 3PL6B 4TSBL 3QEQA 4LP4A 5L2JB 1ES0A 5H2BB 3EDDA 4QTHA 1DQDL 4I3SH 4NQXA 2C3XA 2C4XA 1T03H 4LU5H 2MCG1 2D7QA 1OW0A 5I30L 1NGZB 3GI8L 1YEIL 3GRWA 4OTXL 4OFYA 2FEEL 3QRGL 4IRSB 2DL9A 3PWLA 4UIKL 3OQ3B 4KROC 1ED3B 2KL6A 1BVKB 1TITA 2DMCA 4B53A 2F53E 4L3CB 4JKKA 3KYMB 5JOEA 5AZ2H 3V4VH 2P8PA 4N5EC 3JV4B 1IC5L 5IBTL 4CVZA 1R3JB 1KXQE 3OXRB 4GW1A 5E2JA 3P4OB 4JFQB 4MDIB 5IQ7L 2WQ8A 4MNQD 1U2HA 2AEIT 2MSPA 4F37F 3F58H 2OTPA 1G7LA 4XX1E 1NPUA 1DBKL 1BHGA 3D9AL 2YRZA 5HGHA 1MIMH 2YPVL 1EFXA 2O5XL 1G9NC 4X6EA 5JZ7D 1YMMA 2ITCB 2ESVB 2A77H 1IGTB 4TTGA 3EIFA 1ONQA 3SPVB 2O5YH 2P5EB 2R4SH 3MREA 4DZ8A 5IV2B 3QQ3A 3WDJA 2B4CC 4KJWD 2XWTB 2F15A 3QXDB 4XPFH 4OV6F 4UILH 2BCKB 5JXAL 5LGKA 3O2DA 2BY3A 1A7RH 2DWEA 2HJFA 2EDEA 3QAZC 4HWBA 1LEIB 3EAKA 4KVNL 3CLEH 4MD0B 4Y16B 4GH7B 4OIAA 2F53D 3HE7A 3GMLA 2KDGA 1I3RB 3RKPA 4DQOH 3C6LB 3RBGA 3S3JA 5I1KL 3WSQH 3DURB 3ULUC 3B5TA 5IKCA 4BH8A 5ISZB 3UJJL 1QFWL 3WHXA 2MNUA 5T5FH 1BLNB 5A1AA 2VXSL 4R8WL 4F58H 2LAAA 4O4YL 2CLZB 4MXVF 4YDKH 1S7XB 2A6JA 3PNWB 4GKSB 1KIPA 5DD0H 3L95B 4OZGF 2BSSA 5DFVC 5D6DC 1M7IA 3M8OH 1Y18A 3JWOC 4XCEA 3UTTA 4Z78A 2BZDA 1RV6X 2NMSA 4P99A 4MA1B 4Z7NE 1KFAH 3WKMH 4ZYKA 2VDPH 3F7VA 4ZUWB 5GGUA 3HI6H 3O4OB 2HFEA 2D0HA 3IB4A 3MJ6A 1NDMA 1CR9H 1Y6MR 4XTRC 3FO2B 4ZTOL 2FIRT 1I4FA 1FFPB 4UT7H 4GKNA 5E6ZA 4UI2A 1WZMA 3KNBB 1N4XL 5E9DA 2VLKB 3GSQB 1FZJA 4CADA 5C0NC 3PGCA 3PP3K 4PJFA 2E7HA 4TSCH 3PV6A 1ZLWH 1MJJA 4LCIL 1MJUH 5C0DA 5CAYB 3RHWK 1Q9OB 5DJYB 3P40A 4NQDD 5MP6H 4P4KB 4M1CC 1LQVA 4Y5VA 5JW5A 1B4RA 2HRPH 3V6ZA 4XP9H 1LGVA 1MFBH 1ORSB 5BOPA 2CO7B 5K9QI 2CLRB 3CDFA 1JHTB 1EO5A 4XMPL 3WEXB 5IHZA 5HGDB 1L9NA 1V05A 3T0AA 3E6FB 3QWQB 3S35L 3UDWC 3FAXA 1B6UA 4DVBA 5BCAA 3DX9A 4JFDA 1L7IL 3L3DA 3LHPL 3FO9A 4LVNB 1JL8A 1XCTA 1DE4B 4G7VL 4M1GH 2V7NA 4IEFB 3QIWC 5FUCE 4OZHB 1WVZA 1RZGB 3WNLA 2E8YA 4HG4J 2E7BA 5I1LA 3D18A 4KTEH 4S10A 4MNQA 4FP8L 2X40A 1B88A 1RD6A 4LQFH 4NT6B 5BJTB 1I8IB 1G6RB 4L8BB 4O2EA 1WIOA 4RIRA 5CEYB 3SE3C 3BT2L 4OF7A 5IW6A 3A6CH 4FQIH 2A0LD 2NW2B 3P4MA 2CRZA 4RWYH 2MTPA 1SBSH 1AGCA 4ZQKB 5FIEA 1IGCH 4MQSB 2DLFL 3P4NA 2VQ1A 5FOJA 4S11A 5D93C 1F58H 2X89A 4M4RA 1TJGL 3L1OL 5DRXA 3MXWH 2DIAA 5IB5A 3FB8B 1FVEA 2DOCA 3B43A 4L9LB 5I8KH 2C1PB 1K4DB 4WFED 1OCWH 1HHIB 4YHIB 3BH8B 2CUHA 3DX8A 4JR9H 4HS6B 2H2SD 3C08H 4PJXB 3MV7B 3RI5K 4CVUA 3VXSE 1K5NB 1QBLL 3B8YA 2F53A 2EZ0C 1JNHA 3HI1B 2P1YA 3T08A 3U0TA 2EEDA 3N1QC 4O2CB 4LLUB 2V5MA 4DFIA 1DQTA 1MPAL 1VADB 4CN1A 1TJHH 2XY1A 1MHHA 1XF1A 2DBLL 1QZ1A 1J1XH 4A2MA 1UB5B 4MJID 4L8CB 3BDYL 5HVFB 4LFHD 2O61B 3KPSE 5TDNB 5I1CH 2VH5L 1OTTC 1QO3B 4AIXA 3OJDA 2XWBB 4NZTL 5I76B 3VDAA 3PWUA 4M5YH 2HLAB 4X8XA 1HDMA 4KMQA 3UROR 3AB0C 1QFPA 2C3VA 4BFIB 1T89C 1RZ7L 3P73A 3DWTA 4G8GB 4QOKB 3HR5B 5TF1L 3R8QA 3BJ91 1FNGB 4JQVC 4JO4H 1G1YA 4RGNB 3D39D 2EYRB 3VXSD 1NGPL 1JVKA 1GZPA 3FL7A 2YBRB 5CGYD 1FAKT 4HUKB 1NEZG 1Z5LB 1YUHB 4QF1B 1R6VA 3B8SA 4NZRL 5E6IA 1I7ZB 3I6KA 3B2UC 5IM7A 4GOSA 2V5RA 2J4WL 5T33L 1IAKB 4Y4FA 3UCRA 3WNNA 1MY7A 2YUXA 3I6LE 1AI1L 1HWGB 3WFHA 2AXGA 2R23B 5HI4D 4DVRL 5EO9A 3W82A 1SJXA 3GKZA 2VZUA 1K8IA 4PY8I 1J1PL 1TFHA 4PJBB 4HGKC 2Y06L 3T0BA 4BSJA 2AJUH 12E8L 5HY9B 3R06A 1LO5B 1J05A 5IHUL 3KHOA 3MUY1 5C0EA 1NJ9B 2Y6SC 4U3XA 2DTMH 2X1XR 2Y5TB 3KYKH 4LPCA 3QQ9C 3HPJB 4M93C 1KB9J 2GTWA 4TSAL 5GS2H 4CVXB 4WIQA 1N6QL 4ORGB 5J13B 4NKIH 5IB2B 4IRJB 4OGAC 1IC1A 2XTJB 4RRPG 2DLGA 4F37K 3ARGA 4K7PL 4PREA 5FO8A 3OGCA 4NKMA 1VFOA 1JI1A 4XNQA 1BF2A 5FB8A 4O51B 5I75B 3UTSE 4WI4A 3W11C 4APQD 4X99A 4MQ7A 5ALBH 5IHLB 4LCCC 2CMRH 3NFPA 4ONFL 1LILA 3WD5H 3FQWA 1QHOA 4OCXL 3CMGA 5DSCB 4JEGB 3WFBH 2W0FB 4F2MB 4K7FA 4NGHL 5E94A 5TDPA 1J7VR 2AXHA 2EDLA 3WXWH 2CXGA 2J5LB 2C5DC 1VFAA 5GRUH 2XZCH 1P4BL 1MCPH 1FNSL 3P9MB 3PWPD 1WLHA 3AM8C 2BNRB 3G5VB 1AD0A 5IF0B 2BERA 1RUMH 1ADQL 2BRRL 4HPYL 1OB1B 4HJ0C 5FGBC 5I15H 3PP3H 4YHKH 1G7PB 3VGAC 1NANI 1JZ7A 5D1QB 3O3EA 2N7AA 5I1EH 5ID0B 4EN3D 1B90A 3U4EA 3MNVA 5BO1H 5MEND 2FBJH 3GSNA 2OJEB 5E5MB 4KKAC 1KEMH 4GBXC 5FHAL 4LP5A 1WCQA 1CFQA 2X4NA 4IIQB 4IOFC 3VFVB 2JIXD 5DK0A 4DGYL 4I4WA 1AP2A 4UIMA 4KK5D 1QSEB 2AJYL 3BHBA 4MD5B 1HHKA 5F8RC 5JHDB 4FQ2H 3FT2A 4H88H 2D3VA 3DI3B 1ORQA 1SEBB 4YHZH 5LKNA 1LEKA 5IESL 4L4VE 4HBCH 4L9DA 3TBVA 4HK3J 4J3SA 1OD9A 1TQBB 4B41A 1AXTL 4XVSL 4JN2B 1JHKL 1F6FB 1NAMA 1U9KA 1FE8L 2OI9C 5F7YC 4NRXA 3IFNH 3CZFB 4I5BB 4QLRA 1IAMA 5GRJH 1WISA 3VXSA 1XGUA 3LIZH 2IH3B 4CW1B 3RUGE 1JI2A 2GTZB 4H0GA 1CDYA 3T0ED 5LGHH 1LO3H 4ONGL 4G42A 5C0IB 1EEZB 4LIQE 4NO5A 3OPZL 4WUKL 1XAUA 5EU6B 1U41A 5E4EB 4HGWA 4BFBD 2EIBA 3IDGB 1X6NA 1BQHG 1JZ4A 2NLJB 3DETD 1FO0B 4WU5A 5ERWB 1BF8A 2H32H 3SDAB 4MVBA 4M6OH 2R8SL 4J3OC 1PG7W 1RHHA 1YY8A 2EDRA 3TH3T 1F2XK 3QR2A 1FGVH 4XCFL 2WUBH 2YZ8A 1AR1D 5L6YH 2ZUWA 5DDHB 4Y5YA 3S34H 1WT5A 1MLBB 5F6IC 1CQYA 4XGZB 3ULVC 4JO1L 2XG4A 5DK3A 5KZCD 5GSVB 5F3HA 1HHHB 3SGJA 1MVFA 3SOBL 4J3WA 1YDPB 3OV6A 1G9NL 4EIGB 3TFKA 1ZT7B 4PRBA 4QRUB 2MHAA 5EOTA 3P30H 2EH7L 2ZOKB 5KSUB 1F00I 3QSKB 4MS8A 5F1NA 2VAJA 2B4CL 4HG4K 3EYVA 4M03A 1KJ2B 2I60H 2E6PA 3P9LA 2Z8WC 1MQ8A 4R6UA 1NEZB 3G6DH 3QEUB 4WUUE 4JHAL 1ZGLM 5EC2A 5DURB 1JF1A 3RBSA 1RULH 4APQA 4EOWL 3VFTB 3TLRA 2X4RA 2QR0B 1DQQB 4JPWH 5EH1A 2X4PB 4DKDC 3H2WA 3LQMA 2YZ1A 3DBXA 4GRMA 2A6DA 5T3XD 3OAZK 1UT9A 2O5ZL 1CDIA 2C4FT 3OXSB 4R4ND 4D9RE 3IFOA 4P2QD 4XVTH 5EU3B 4O5LH 1ZOXA 5EN2A 4OZFH 2BJML 4GKZB 2HLFC 3ULUL 2FJFB 3E6HA 1AGEA 2A83B 4KQ3L 3BW9A 4MJ5B 1TCRB 1ZHNA 4X0KA 5KN5B 1F5WA 1IM9D 4ZFFA 3RZWA 3K80A 3O6FB 4PRAB 4F15B 4K2UH 4LVOB 1KB5A 5F3BB 5JR1H 1QR1A 1Z0NA 5EULV 3MRMA 4EN3A 5J9PA 4PTTB 1XGQB 3JWOL 5DJDB 3HG1D 4LLDA 1GVIA 3UTSA 5I1JH 3RX8A 5JIPA 3O6KH 3SO3C 4ZXBB 3UZQA 2MKLC 2JIXA 3OKOB 3GBNH 3MRCB 3RNQA 5FGCE 7FABL 1MCLA 1T20A 2HN7A 3VFGH 2V2TB 3CFKA 2B2XH 5MEOA 2QEJA 2NZ9C 5C0AB 4IMKA 4NQSA 4PJ8C 4AY0A 3EYOB 3ZE1F 4FFWC 2EIDA 3MLWL 3ZMRA 1QKZL 1SYSA 2BHYA 3UXFA 3RGHA 3BDBA 1GAFH 4GW5A 3PIQA 3MBXL 3CXDH 2R1XB 2E27L 1RK0A 1Q1JH 4WU7B 3OG4B 5L88L 5IG7A 1E6JH 3FQUA 4IBLT 1A9EA 2YEZA 3WL9B 1WEJH 1R0AL 4Z7VF 3MC0A 3RWHB 1OSPH 1C1EL 3EYFB 1E4KC 3QCUL 4BZYA 4ZPTA 2VZ3A 3ECBB 3JTTA 3BKJH 3QO1B 4PRID 1T5WB 4YR6B 4WI7A 1F8TH 3F12B 4XP1L 4FNLL 1UWEH 3EKCA 3QNYA 1RK1A 5FM4A 5KSVB 2WY3A 3EOTL 4OCSL 4Q0XH 2XA8H 3SHSA 4U6XA 3A67H 2NW3A 1AO7B 3MRRA 2Z31B 1SEQL 5C7XL 5D7IF 3JVGC 2ADGA 4L4VA 4J2XA 2ICWB 1FLRL 2J6EA 3OR7B 1NC2D 1NAKL 4FG6C 1L7TH 1VPOH 4U7SA 5IMMA 2PNDA 4Q9RL 5HHQB 1FV1B 1VSCA 3IDMA 3MR9B 5SX4H 4N0RA 3C60C 3KWWB 3VFMB 4YHNB 5I2IA 5F1OB 3EFFA 4HFUH 1LK3H 5EWIL 3E2HC 1KB9K 2OK0H 5IGXL 2DQCH 4KKBC 3KJ6H 4OQTL 3DGGA 4KDTC 3GJFB 1G0XA 4N0YH 5DFTA 5AWNL 1TETL 3CFCL 3DYPA 5K9KA 4C56E 3OWEA 3MV9B 5FDWB 3ROLA 3QNZA 5JW4Q 4KHXL 1H3GA 3C09C 4NPYA 3CMOH 1A9BA 1CDGA 4KKLC 4X7TB 5DJCB 1OARL 4HF5H 5C07B 4MA7H 2IH1A 2XZZA 4EI5B 1BQHB 5D4QA 1BBJA 1D9KC 1RIVL 3QFJE 2P47B 1NFDE 5DT1H 3UZVB 4O2FA 4P2QA 5FOBA 1EEQA 5KSBB 3ARYA 4P57B 5TGBB 3TYGH 5HGAA 5LAXA 4P5TC 1QA9B 2FIKA 4RMWA 4YDJB 1IM9A 4UDUA 4P3DA 4XAWH 3REVA 3D1MC 1TPXC 3CUPB 2I07A 3FCTB 2Y23A 1P84J 4KDWA 4Z5RB 4NO0B 3FN9A 4G3YL 2R69L 4PBXA 4Q6IB 2HWZH 4C56D 3S36H 1UM6L 2JCCE 1SYVA 3QCVL 5GGVH 4OZFG 4WUUA 1YEGH 1CDCA 1IM3B 1UCBH 3HZVA 25C8H 4MJ6A 3QPXH 1FFNA 3ZKSD 4G6FD 3MRIA 1YEEL 2BDNL 3HE6B 3QFJD 2VB5A 1FBIL 4OLWL 1N0XH 1OGAD 1NCWL 3PQYB 4S1SH 4GXVL 2MQCA 1KJMB 2W60B 1GGIH 2XPGB 4FMKA 1U8MA 1EVUA 1P7QD 2NNAB 2BSTB 2NY2B 2R0LL 1U95A 2ZUTA 3E1F1 3CFBA 3ZDXE 1J1OL 1M7DB 2FZ3A 2MQ3A 3WLBA 2YSSB 1A6AB 2ORBH 2L7JA 3MGAA 1MHEB 2VLLA 1FZKB 1UJ3C 4TNVF 3RRQA 5EBMA 4QHMA 2IFGA 2VAAB 3CVHL 4YXHL 3OAZH 3JZ7A 2IJ0C 4Z8FL 3VE0B 5E8NA 2XT1B 5IFJB 5BVJB 4P46A 3GMMA 2R29L 2OZ4H 3NCCB 3K4AA 2A9NL 3MXVH 2ESVE 3RA7H 4C59B 5E99L 1DANU 4I48A 2P5EE 5F9AC 1BFVH 4JY6B 3BRFA 2LV4A 4EDXB 4CU6A 4M6AA 2OSLB 1ZANH 3OTTA 4KROB 2Z35A 1T7XA 2YS4A 1JF6A 1Q38A 1NC2A 2DD8L 4HH9A 5K9OA 1CT8B 2CKBL 4R96A 1J86A 3EZJB 4ODSH 4JVUA 4QCIA 4MA8H 3OZ9L 1JHLL 4KI5C 1H3TA 1RUAL 4HQQL 4LQ1A 4TOYH 3FOLA 2ZSWB 3V5HB 3AVEA 4C58B 5DD1L 5AG8A 4M7KL 5J06A 1KIQA 1KT2B 4X6CE 4S1DC 3T1WA 3DUUA 5ICYA 1H0DA 1QRKA 3NCFB 3LKPB 5ISZE 4M7ZC 2JTDA 3RWIB 3HC0B 4FQXA 3MSPA 4F7EB 4PGEB 5E8DH 1V7ML 4FFZH 1LO2H 2OS7A 3ZE0E 5F9WC 3FFDA 3KYAA 4PG9A 3C8KB 4UV7H 2ESVD 4PJ9C 4NCC2 2P5ED 2DQGH 5GGTL 1A7QH 2PCPB 5D2LB 1HINL 1U8PA 3LS5H 1UQSB 4M43H 5D2NC 4FA8A 1LD9B 1BAFL 3RWDB 1CK0H 1JZ6A 3HS0A 3B3IA 4M48H 4F9LC 4N0CC 2NY0C 5I66A 3MACH 1F3JB 3HB3C 2VC2L 3SEPA 2RHEA 1MJ8H 3HNTH 4X5LA 3UPAA 4ZAKD 2EXYC 3UX9B 4U6HA 2PUQT 4EUPG 1JGEB 4IRZH 1S9WB 3VFPA 5C9JB 2F58H 3C6LD 3FQTB 2ZPKL 2OR9L 1T0MB 3PDDA 5B4MD 3VMNA 4WENB 4JG0L 4JRYD 4C56A 3DXAB 1T0NA 1RVFH 1A7OL 3VFSA 3C2AH 5B21A 4JM2F 3ZKNC 4Q7DA 2DQTL 2DI9A 3WE6B 4OI9A 4D3CL 1JYXA 3NIDE 2GY7B 4PJEF 4OD3L 1HKLL 2LVCA 4WO4A 5CJXA 3ILPA 1NCDH 1IAIL 2KPNA 2H6PB 3DO7A 5DXWA 3TNMA 3G9VA 1MCWW 2X1QA 3O0RL 1XEDA 2X4SB 1ND0A 3AY4A 3QFJA 3QHZL 4D0CA 4GS7C 5F88B 1NFDA 4WRLA 3TO4C 4HKJA 2IAMA 1E4WH 1O7VA 3QUYC 3TN0C 1XIWC 3H3BC 1F11A 2MMXA 1X4XA 2ITDB 3QUXC 5ACZB 4HAGA 2YMXL 2B8OT 5KW9L 4M7JL 4HJJH 3B4NA 1HQRB 3AXLA 4OCRL 4YDLB 1FSKC 1E4XL 4OZHE 5FA3A 3NVQA 1YNLH 3TO2B 3U0PA 3QIUC 1CDJA 2Y9RT 3IVKB 3ERYA 4P2OA 3O4LE 1DL7H 2VUOA 1RIUH 3MUJA 4L8SA 4R9HA 2JCCA 2FO4A 3ULVL 1CD1B 1OW0C 2MPAL 2I5YL 4KJPC 4YQXH 3IETB 3IF1B 2ZOLB 3S36X 5TE6H 1P4IL 3PL6A 1OP9A 5DC9B 4X80L 4LBEA 1CFVL 5L2JA 5H2BA 1CGUA 2Z0BA 4PY7B 3QDGB 4WHTA 5ALCH 1L4IA 1NGZA 4TSBH 4U6TA 1S7WB 2GJZB 4UT6L 1DQDH 1EXUA 2HMID 4O02L 3ELAT 3GHEL 4NHUE 3QIWB 4PJXE 3MV7E 5I30H 5CSGA 1BVKA 1YEIH 4NCDA 1N6VA 4OTXH 3O9WD 4L3CA 1UADC 3G9AB 1R24B 4K8RL 3BIKA 3JV4A 4KDVA 5TFSL 1P2CB 1T6WA 2VWEE 4UIKH 5HVHC 3KDMA 4MXQA 1R3JA 3Q5TA 1MFAH 3OXRA 2OL3L 3O4LD 5DUPL 3P4OA 4JFQA 4MDIA 1FC1A 2FECL 3UPCA 5DA4A 3OL2A 5IBTH 1IC5H 4JQIH 4FZ8L 3G08A 4LLQB 2HA1A 1ITCA 3HPLB 5IQ7H 5D93B 1KXTB 2ITCA 2ESVA 4U1IB 1TNMA 3SPVA 2P5EA 1DBKH 3D9AH 2DKMA 5IV2A 2IFFH 3VJ6B 2O5XH 3HE7C 1FZMB 2XWTA 4LVHB 4H25B 1IGMH 3QXDA 5T5NF 4BQ9A 4G8GE 4QOKE 2BCKA 4OFVA 4MMXC 3DARA 3SDXB 1CICD 3PG2A 3QIBC 4I3RL 4F7TB 4EKXA 2N56A 3JUYA 3MV7D 3NPSC 1LEIA 1T5XB 4MD0A 4Y16A 4XPGL 5JXAH 3CK0L 5HSFA 4GMTL 3C6LA 4WHDA 2DQEL 2Q76B 5L9DL 4KVNH 1O7SA 4LHUD 1UZ6E 3BPLC 4X6CA 2UWEE 1P84K 3SE8L 1IQDB 3BQUC 5ISZA 1BLNA 1NCTA 2LTQC 1WZKA 2NY3D 1CXHA 5J3HD 2ENYA 4JDVB 5I1KH 4HEME 2CLZA 5JLZB 1JZ5A 4YC2B 3PNWA 4U1SB 5F7LB 1GSMA 4GKSA 5BZWB 5LBSL 2ZG2A 3MCG1 3P2TA 1A6WH 2VXSH 4PJBE 5IB1B 1BECA 5BRZB 3NIGF 4QOKD 3CU7A 4N8VG 1BM3H 1I1AC 2MFNA 4NWUL 1WAAF 3FO2A 1N2RB 4OZGB 3OJMB 3BKYL 4JGUA 5EUOF 5HXMA 4TNVK 1NFKA 2XTJE 3GBML 3KNBA 3DHMA 3CFEB 3MRGB 5IIEB 1GGBL 4ZTOH 3JV5A 2MQ0A 1NGXB 1V5JA 3GSQA 1HYSD 2FJHB 4GO6B 3TBYB 3MCLL 4RGOH 4YEEA 4EUPB 3O3UN 3NA9H 7CGTA 1N4XH 5GRVL 5JTWA 1FNEB 4K3DL 2P45B 3K8LA 2B1HL 5FYLD 1Z2KA 3VFUB 1Q9OA 5DJYA 3X13A 2W9LA 3HCVB 5J1SC 4R4FL 2P7TB 4M8QB 3MA9L 4YZFF 1ORSA 3OR6B 1NUGA 2FDBP 2CLRA 1JHTA 5TE4H 3WEXA 4X5WB 5HGDA 1YEFL 4M93B 2R15A 4YAQB 4K9EC 1JN6A 5IVXB 3E6FA 4E42B 4WEBH 3D3VB 3C8HA 3TEUA 4XMPH 3K8KA 3LQZB 2HRLA 2CKBB 2J1KA 5IVZB 1I3VA 1AXIB 3QCTL 5JZ7C 1LQSR 4OZHA 1FVCB 1RZGA 4HUWB 2B5IB 4WVRA 5EU4B 1QYGH 5CILL 1FVDB 3O4LA 4LCCB 1E4JA 4G7VH 2XXMB 4DN4L 1MCOH 5BJTA 1I8IA 4KJWC 1G6RA 4L8BA 5CEYA 1R3KB 1S5IL 5GGSB 2OP4L 5E2UL 5HYIA 1JWUB 3ARWA 1QSEE 5AAMA 3V4PH 2NW2A 4OFIA 5F1SA 4LASH 1NBVL 2VDKL 3KLHD 3EO9L 3O45B 4ZQKA 3BT2H 2RIKA 4LGRB 1L0YA 5IT2L 3MNWB 1W8NA 4X7FC 2ZCKL 1VACB 3WS6A 2RR3A 5HDBF 1GIGL 4ODUB 3EYUH 5F96L 3SKUD 1RZKC 3G5YB 3FB8A 4LMQE 1BD2B 3VGAB 5ADPL 1JTPA 4BH7A 1HHIA 2RFXB 3BH8A 4NHUA 4HS6A 4PJXA 3MV7A 1K5NA 1IGJB 3B9EA 1MIEL 1BOGB 3L3IB 1OAKL 3HI1A 5IB3B 5D1QD 4GBXB 4PJAB 1CS6A 4O2CA 5EFIB 1QBLH 3WCYA 1VADA 3UTQB 3CCHB 5FYJL 2KH2B 5EU6E 1DCLA 1JNLL 3LDBC 3I9GL 3CLFH 2G75A 4I2XB 4R97C 1UB5A 3I85A 4L8CA 1ULVA 3INUL 1MPAH 2VABB 2IMMA 2O61A 3NN8B 5TDNA 4L4TB 5HVGB 1QO3A 2XWBA 4KFZC 1R3LA 1E28B 3BDYH 3FHAA 4C57C 2PW2B 4MB4A 1CLZL 3O3BB 3HZYB 5DMGD 4GRWF 4BFIA 5CEXB 2A74A 4NYLB 4NZTH 4U2YA 4G8GA 4QOKA 2VDNL 3HR5A 3TC9A 3BP4B 1I8LC 4WTZG 1FNGA 3WNKA 5FFLA 3MRPB 1RZ7H 1WBZB 1KTKE 2RJMA 3MUGA 2YBRA 3TJEL 5FA4B 1Z5LA 1YUHA 2Q8AH 3HFML 4QF1A 1ZGLP 1UXWB 4Z7OF 4ODWB 1NGPH 1YC7A 3BD4A 2UWEA 3PJSB 3HUJB 3F6IA 5CD5D 2L4OA 4QY8B 5DVOA 1LO0L 4UQ2B 2H9GB 3MCKB 3GSVB 5DQ9B 4KRMB 1LDSA 2J4WH 2R23A 3SDAD 2VXUL 2EO1A 1ZWIB 5F6IB 3STZB 1Q9LA 1GZQB 4PP1D 4PJBA 1I8KB 5D8JH 2P5WD 4J1UB 1EERB 2EDWA 3PDOB 1C16B 1CDBA 5HY9A 4QRRB 1CLCA 4OSUL 3W5NA 1J1PH 2P8LA 1MY5A 2Y06H 4ETQA 1S7SB 12E8H 4MD4B 3HPJA 4IJ3C 5F9JB 3SKOA 1J12A 1PG7L 3SY0A 4KVCL 5C0RL 5K9QG 2DMBA 4CVXA 4ORGA 5IB2A 3R0NA 5ESVB 3BP5B 2A0LC 4XNXH 4LNVA 4OBSA 4L5FL 4TSAH 5C2BH 1WJ3A 1TVBB 4KGJA 5EO1A 3OKNB 4PG2A 1LEGB 2ZSVB 4O51A 3W2DH 2OMNA 1BVZA 4K7PH 1AGDB 4JAMB 5ABDE 5CP7B 3WIHH 1A3LL 4GQ9L 4RQQB 3WLWD 3VI3E 2H2SC 2W0FA 1CD8A 5HDLA 4F2MA 4JPVL 4XXCC 4LKXB 4ONFH 5C0AE 1LNUA 1N64L 4ODVH 3BFOA 4KJYB 5IF0A 3VA6A 4RGMC 2BOCA 1OB1A 1QBAA 2WQRA 1T3FB 1G7PA 4J3UA 1JZ3A 5D1QA 1ADQH 1TTFA 2BRRH 1TVHB 5ID0A 4ALAL 1CFTB 5E5MA 5KOVC 1PQZB 3NABH 4K3GA 5F7HA 2VXVH 2Y07L 4FTVB 4G7YL 4NKQB 1NGWB 2IQAB 1J9CT 4IIQA 3VFVA 2VLMD 3T65B 2CPCA 1FH5L 1QSEA 5JUEL 1DZBA 4LL9A 3AREB 1UYWL 5FHAH 1AO7E 1LE5B 2CUMA 2X42A 1JZ2A 2VE6B 1M6OB 5HHNB 3ZDYF 2AJYH 2R0WH 1W0YT 5DHXB 5CGYC 1R3IH 4JN2A 3U36A 2X7LB 4KI1A 4Q9BA 5IMLB 1DTUA 2FEDD 4Y4HD 3CZFA 3KG5A 3WIIL 1AXTH 4XVSH 1TQCC 1JHKH 2IH3A 4RMVA 4GUPA 1FE8H 4LK4A 5C2UB 2GTZA 5HI4C 5GSRB 5C0IA 4PYHA 3KPTA 1IZJA 4WWKB 5MEQB 4FQLH 5A40E 5EU6A 3MLXL 4TVPL 5FKAB 3WN5C 1WT5C 3IDGA 3MV9E 2Y4SA 3UO1L 2NLJA 3OPZH 4WUKH 3K4DA 3NBNA 1FO0A 2CUIA 1HCVA 3IS1X 5ERWA 3H9SB 3SDAA 2AV1B 5C07E 4G9FB 1AO7D 2X4UA 2BVTA 3ZHKA 4XB7A 5DDHA 3KHQA 3W5MA 3BWUC 5T3ZE 2R8SH 3S37L 5TH2B 4XGZA 2CK2A 1V7NH 3E2HB 3H7LA 1A6VL 5KSAD 4OM1L 5GSVA 3MJGX 1HHHA 1YDPA 3OAUL 2GJ6D 4DFHA 4JO1H 1ZT7A 1XR9A 5F70A 4APQC 4QRUA 1I85A 2ZP0T 3TJHA 2ZOKA 3IDXL 3E0GA 5DS8B 4NKDA 5KSUA 1EBAA 1HNFA 2I9LB 3SOBH 5D7JD 3C09B 4M9PA 1GC1C 1KJ2A 1MNUL 2Z4QB 3KR3H 5HPOA 1FQ9C 5A3ID 5FCUL 2EH7H 1NEZA 1RZ8B 3QEUA 1AXSB 2GHWB 2V2WB 5GJTL 3VFTA 1D9KB 2QR0A 1DQQA 5C07D 3K1DA 1QSZA 1UENA 3OHXB 4JHAH 1VFMA 2OXHA 1S7TB 3OXSA 1KCUL 4QO1A 3S97C 2XN9B 3MJ7A 1JV5B 1FYHB 4V2BA 1NCBL 4W4OA 4JRXD 2H1PL 4GKZA 5FO7A 3QEGH 4EN3C 3I2CH 1TPXB 2FJFA 1J8KA 4H26B 5ADOL 1M4KA 2A83A 3T04D 5DC0A 4MJ5A 1TCRA 5JXEA 2BJMH 3ULUH 2ZUYA 3C6SB 1CL7H 1YC8A 5C3TA 3O6FA 4PRAA 4KK5C 1MRDH 4KQ3H 4NO0D 4BK5A 1VGKA 4P23D 4PTTA 1XGQA 5DJDA 5C6TL 3GMPB 4LDLB 2RBLA 3AAZB 4R3SA 3NFNB 2G9HA 2GSGB 3BIAX 4NN5B 4ZXBA 3O6LL 4IMKC 4RRPA 1GH7A 3DLQR 4QRQB 4HCRH 3OKOA 5F7FA 4WI6A 3MRCA 2C7UB 2B39A 3HNSH 3STLB 3EYSH 4K7PX 3W9DB 1GXEA 5CS7A 3NMEA 3WS3B 1NCUA 2XWJB 2NYYD 5GIRB 1BIHA 5C0AA 3VFRA 3T0EC 3EYOA 5CJ8A 5GS2D 7FABH 4G6AD 4MZ3A 1X4ZA 3L6FA 2AAVA 2N4IA 4YFDB 2R1XA 1UJ3B 3V0WL 1WZ1L 1Z9LA 3QB7C 4WU7A 3DETC 3LMJL 2DLTA 1K85A 2NCMA 3V5DB 3MBXH 2E27H 4B50A 2E7LE 2DIBA 3EYFA 1B6DA 1UM4L 3GO1H 5L88H 1AR1C 1H8NA 3BPNC 3ECBA 4ACPA 4AM0B 3QO1A 1FNAA 1T5WA 4YR6A 3F12A 4K9EL 4KV5F 3TT3H 4MAUL 4POYA 5KSVA 3QCUH 3VWJD 1FIGL 3EDFA 2PXYB 1NLDL 1YN7B 4XP1H 1AO7A 2Z31A 2V5YA 4FNLH 5FHBL 5AG9A 1OP3H 2WV3A 3REWB 1LP9F 1PGRB 2AEQL 2DYPB 2ICWA 3RL2B 5GRWA 3OR7A 1L0QA 2FATL 4PBVC 4RFEB 3QA3B 4JO2L 2LU7A 3P9WB 1UWGL 5C7XH 3O11B 3IU3B 5HHQA 1FV1A 3K74B 3MR9A 4U1KA 3KWWA 3VFMA 3I50H 4YHPB 4LSRL 1VHPA 1DBMH 1NLBL 4M7ZB 4Q9RH 4LPVA 3W0WE 5T1LB 3GJFA 4XCYB 2X9XA 2E7MA 4N9OB 4NFCA 5IGXH 4OT1H 3TZVD 4RAVB 1N5YH 4PJIF 4OQTH 4OUUB 5HHOB 1RZKL 4R4NC 2AERT 1VEMA 2EH8L 3MV9A 5FDWA 5L0QC 2VZSA 5J6HB 1NC4B 5D2NB 5AWNH 1TETH 4X7TA 1XT5A 2AGJL 5DJCA 5EOQL 5C07A 3BN9D 3B5GA 3JWNC 2VDML 4YDIH 4KHXH 4EI5A 2NY0B 1BQHA 3DMMD 2XZQL 1DN0B 5CLWA 4MHHG 2O26U 4Y8DC 3SDYH 5FAAA 1OARH 5GJSL 2Z92A 4JREC 2M26A 5GGVY 4NM4H 3LPFA 4JKPL 4BZ2L 1RIVH 4P57A 2SEBB 3ZT7A 2AJSL 4ELMF 4KY1L 3ARBB 1O0VA 2X09A 1QA9A 3OKEB 1MCQA 1QBML 2UVFA 4YDJA 3W0WD 4F3FB 3K2MC 3CUPA 3FCTA 2R1WA 4WFHE 4WNQB 3QI9B 1UKSA 4NO0A 2JB6A 3UPRA 4P23A 5DRZB 4EDWL 5EIIB 1EUUA 4Q6IA 3S3PA 1URLA 5HPMB 2D9CA 5F9OH 4G3YH 2R69H 3D0LB 2A6IB 1HKFA 1AHWC 4XNYL 3QCVH 1ZA6B 3QHTC 2Z93B 2Q6WB 3FB6B 3HE6A 1VFUA 1XIWB 1X5GA 5ACMA 1EO8L 3MROB 3WO3B 1RU9L 3QUXB 3EOAB 3MA7B 1YEEH 3K2UL 4BSVB 4K55A 5K59E 3P3YA 1KJMA 2W60A 1FSKB 2XPGA 5C0CB 2A9ML 2X05A 2BY1A 4OLWH 3L3OA 2BSTA 5BOZG 1HCFX 3QIUB 1QEWB 3QEQB 4GXVH 4PV8B 2H3NB 3DVGA 2D31B 1M7DA 5AUMB 2YSSA 1A6AA 2R0LH 4G8EB 4WFHD 3ZE2F 2AI0L 5I6XC 1SVCP 1UB6A 5I1IL 1MHEA 1OLZA 1MFCL 3LOWA 1FZKA 5CHNB 5KVGH 5DVLA 3PXHA 4NNYB 3CH8A 1MQKL 1CD0A 2QQNL 2OMBA 3VE0A 4OF6A 1IJ9A 1EJ6A 1U8HB 2Q20A 1RUPH 3CVHH 5EZJB 1CGWA 2OM5A 3WKNA 4Z8FH 1U6AL 4JY6A 4LMQI 4EDXA 1RIHL 4OCMC 3SDCD 2OSLA 5E99H 4TTDD 1G7LB 5I18L 4NQVB 4YO0B 5T5NG 4UQ3A 1YMMB 3V52L 4HKZB 3HAEH 4G8FB 3SJVD 4LCWD 2EDOA 3MREB 2ZSWA 3V5HA 1U91B 5HYQB 5E5UB 5J12C 1KT2A 3OZ9H 1JHLH 1RUAH 2E7LA 4HQQH 3LKPA 4JY5H 3RWIA 4LSQL 5DD1H 1EHXA 3RZCB 3HC0A 1RAMA 3TZVA 3QJHB 4F7EA 4PGEA 1DSFL 2R9HD 2ZUQC 3G5XB 1KIRA 3GSNL 1C7SA 2ZG3A 1V7MH 4AT6B 2LAGB 4JFHE 2PCPA 1U8QB 1UQSA 3OGOE 3DMMA 4DKFL 3QIBB 5BRZE 1LD9A 4BH8B 3NPSB 4JANA 3RWDA 3U7WL 3S88L 5JIIA 4RMQA 3WFZA 4MCZB 5GGTH 5B22A 3TGXA 3DUSB 2A73B 4ERSH 4MXVE 4OKDA 1F3JA 2X1PA 2W0KA 4NZUL 2VOTA 2QV2A 4HSQA 3BPLB 4OZGE 1NAML 3BQUB 1JGEA 1S9WA 4FXKA 5C9JA 1Q0YL 3FQTA 3W0WA 2LTQB 5CJXC 3RJQB 5AD0B 1T0MA 1KLGB 3UTPE 4ZYKB 4O58L 1U0QA 1BREA 1LE9B 2GEEA 2HFEB 1IAIM 1NDMB 2OR9H 4XAKD 5D6DA 3WE6A 1PY9A 5L7XH 4XHQA 4JG0H 1QNZL 2BNUB 3C2SA 1AQDB 4D94A 5M94B 5KVEL 1A7OH 1XZ0B 8FABB 5M7QA 5FECB 2DQTH 1I1AB 2X4SA 1FZJB 3X3FL 1CZ8L 4D3CH 4OD3H 1HKLH 1ZHKB 3PGCB 1IAIH 5F88A 4YHYC 5IVXE 4LCYB 4XWGL 4DN3L 1CFNB 2FB4L 3GEWB 2ITDA 4C83B 4EBQL 4PGJA 4LF3B 4YNYB 1HQRA 4QHKJ 2VZVA 2AKRB 1NBQA 4HV8B 3TO2A 2YMXH 5KW9H 4Z7WF 3IVKA 5LGJB 3DV6B 3ZYZA 4OCRH 3AC0A 1E4XH 3P11L 4DVBB 1C12B 1CD1A 3CFIC 4NN6C 3L3DB 1SVZA 4PJHF 3IF1A 2YWZA 4OZIF 1OAQL 4WV1C 4NC1C 1UH2A 1CFSA 5CJQL 3ULVH 2MPAH 2I5YH 4HW6A 2BSED 4LFHG 1S9XB 1DBBL 3SDCA 4PY7A 1BQLL 2WWMD 1QFUL 4URTB 3S5LG 4MNQB 3VMOA 1ZK9A 1P4IH 1BD2E 4X80H 4RIRB 1UH3A 1S7WA 4HWEL 3PGFL 1AJ7L 1MHPL 2GJZA 4MMZC 5EO0B 4ZTPH 3BPCB 5I17A 1GC1L 3MRNB 3OB0H 2CQVA 4G43B 1A3RL 3LH2H 2X41A 2E9BA 4LGPB 5DD6B 1V3KA 4UT6H 5I8EB 3GHEH 1P2CA 4PJAE 4PP2B 4XVJH 3SE3A 3F7YB 5IB5B 4RFNB 2D7MA 4K8RH 3TBWB 1P53A 1RUQH 3GSRB 4LLQA 2HJLB 2EIEA 5DUPH 2OL3H 2G60L 3HPLA 5SX5K 3H3PL 2F53B 4LHQB 4X9HA 4L4TE 2BY0A 1T4KB 3HAEG 4KXZH 4U1IA 4FZ8H 4EEEA 3VJ6A 2OJZL 2DS4A 2R0ZL 4ZAKC 1FHGA 3DO3A 1ZA3B 4H25A 1MHHB 4OM0L 4QHUA 2F54B 1BD2D 3C6LC 2IMNA 4HWUA 5B4MC 3W9EB 4F7TA 1G7JB 4IM8A 1CGVA 4ZO7A 4A6YB 2YK1L 1I1CA 4E41B 1HDMB 1T1WB 2GSIB 4I3RH 3U83A 4R97B 4QGTA 2AJZA 3RIAF 3CVIL 3HUJE 4XPGH 3ARZA 4NNPL 5DUML 5T1DL 5A16B 4GMTH 1KG0B 5L9DH 4JDVA 1DBJL 2NX5E 5JLZA 2BXYA 4U1SA 5BZWA 4KRPD 2KKQA 3C5ZD 2YC1B 3EFDL 3TH2T 1J10A 1W2KT 4LPYA 2NTSP 5CP3A 1D5BA 2DLHA 3BDXA 5BRZA 2BHUA 4JQVA 4QRRE 3KPOA 2AQ2A 4OCWH 2JB5L 3F5WB 3U4BL 1JGUL 3B83A 3DOSA 4UDTB 5HDOA 2X6MA 2LU3A 1D5IL 2AABL 4I13B 3QG6A 5CSZA 3TNNB 2J6EL 5HJ3A 4NQDB 3L9RB 5KANG 1N2RA 4OZGA 4H1LG 2APVA 2R0KL 4GAGL 4JG1H 3QBTB 1GGYA 5EZIL 2QBWA 3CFEA 3MRGA 3R06B 3VCLB 2VR5A 4YHOL 1NGXA 5H37H 1YMHA 5CZVL 2FJHA 3TBYA 5B8CA 1CYGA 4CJ1A 4KMTL 4EUPA 3GBMH 1HH9A 4Q2ZB 1GGBH 3H0TA 3U79A 1FNEA 4LIQL 2NX5D 2M2DA 1W0VB 4GAJL 5E2WH 4XP6L 4YFLI 3FRPG 2HMIC 1WUNT 2VQUA 1T83A 2P7TA 1H3WM 2EKJA 4M8QA 1IEAA 4Z0BL 1NMAH 3OR6A 3O9WC 5L2KB 4X5WA 5FB8B 1HWHB 4IJ3B 2ID5A 4WHYG 1QFOA 4YAQA 3HC3H 5IVXA 4E42A 5JDSB 3Q6GL 4XBGA 3MA9H 5T3XL 1H5BC 3WNPA 1YEFH 2PR4L 3HHRB 5FYKE 4TUKL 2FHCA 3LQZA 2K7PA 1CU4L 1INEL 2CKBA 3HKFA 3NCJL 1A7NL 2YD6A 5IVZA 1QFHA 3CPLB 2GYSA 4HUWA 5EU4A 4Z18A 2ARJQ 5D72H 1F90H 1OF2B 4LCCA 1AD0B 3U30C 1ACYH 2OTUB 3TCXA 4FTVE 3QRFM 1HQ4A 3T0VA 3QCTH 3AS3A 1R3KA 4POZD 4P48A 2FNBA 1BWMA 4X7SL 4XMKL 4PR5B 4DN4H 1CICC 3O45A 2B0SL 1TIUA 3U9PL 1FNFA 3AM8A 2DL2A 1S5IH 4JZJB 5IW1B 4Z7NF 3VFOA 3MNWA 1VACA 2DQJL 4ODUA 1NBVH 2VDKH 4RGMB 3EO9H 1JRHH 3MRFB 4RAUA 5FGBA 1BD2A 3WBDA 4MJIB 5EU5B 5DK0B 2RFXA 2ZCKH 1GIGH 3BHBB 5F96H 5C6PB 2KQNA 4NP4L 1IL1A 3S5LB 1BOGA 3L3IA 4YEFA 1CVSC 3L5XH 2NY3C 5J3HC 5IB3A 1RUKL 5E4IA 2V5SA 1JNJA 2FWOB 1K8DB 1IKFL 4PJAA 5DO2D 2BK8A 5EFIA 4QHLB 3LSOB 5CKAA 1OAKH 1NAMB 3X3GL 4NRXB 3IJYB 3HMXL 1OTSC 1BBDL 3OSKA 3RVUD 2E6JA 5GXBB 3D39B 1FZOB 5FYJH 3H9SE 4HXAL 4KPHL 3I9GH 4L4TA 3ARED 4G9FE 3SKNA 2YN3A 1VKXA 2DMKA 1E28A 3INUH 3WFDH 4PRNB 2PW2A 2G5RA 1OPGL 3HZYA 3O3BA 5CEXA 2J8UB 2QSVA 3ZDZF 4NYLA 5JW3L 1TQCB 3DX6A 3VXPA 4YBQD 4G80B 4OF0A 4LDOB 1CLZH 1HYSC 1LK2B 5DYOB 1WIUA 1YECL 3MRPA 4TYUA 5IMKB 4MXWL 4LLYA 2DRUA 2VDNH 2Q86B 2I9TB 1CG9B 3WN5B 4X98A 1JPST 1UXWA 3GK8L 3ALPA 1MUJB 1QHPA 1SMOA 2OX5A 4WWKD 1WWCA 4YXLL 4RX4D 1EO7A 5EA0L 5HI3D 3PJSA 3HUJA 4P5KB 3QO0A 3TJEH 1HK6A 3KGRA 4R26H 1KTDB 3LN9A 3MCKA 3GSVA 3HFMH 2H45A 2OTWB 3V95A 2QHRL 4M3KB 3S7GA 1YEHL 2NX5A 4OLVL 1LO0H 1RZJC 3CJJA 1ZWIA 4JFPB 3STZA 5EOTB 5E5RB 3PE9A 2IG2L 2VLJB 1GZQA 1V8HA 3VRJB 1DP0A 3MLYL 4HIIB 1I8KA 3K0WA 3QXUA 4J1UA 2XN9E 2VXUH 3D2UD 2FBOJ 3DIFB 1DQML 3PDOA 4FRWA 4NC0B 5FGRA 4QRRA 2CD0A 5DZNA 4BFGA 1U3ZA 4K7PY 5H37G 1A21A 1S9YB 1JF1B 1WC7A 2JKXA 4QT5A 1SY6A 3OKMB 2VNCA 1F13A 1S7SA 5JPMB 1KPVB 4OSUH 4HC1A 5F9JA 1JPFB 1IC7L 4J7RA 4N8VA 5ESVA 1IQWL 1FAIL 2CKNA 1DQLL 4JB9L 1W72B 1DLHB 3LD8C 1MAML 1XGPB 3KLHC 1NH6A 1PG7H 3PWPB 1TVBA 4KVCH 5C0RH 3OKNA 1YN6B 4YHLL 4GLRI 1F3DH 2FSEB 1LEGA 2ZSVA 4H1LB 4DK6A 1S3KL 1AGEB 4GMSL 4B7LA 2NY7H 4OUOA 4JAMA 1ZKAA 1RQ5A 1YJDC 5CP7A 4MA3B 4RQQA 4TULH 4OLYL 1E6OH 1OOAA 4YIQB 5IROA 4CAGA 1KTRL 2ED7A 1EGJH 2ZUSA 4EN3B 4V3EB 4ODTL 4LKXA 5LXGL 3G6JF 5DJAA 4Z7QF 4GQ9H 5MENB 2W0LA 4LLDB 5D1QC 4HK0B 4KJYA 4JPVH 2JIXB 2P48B 5E56A 4J4PD 2EDQA 4TUOB 3PWVB 1CBVL 1MFNA 1T3FA 2DQUL 3RWCB 3PP4L 2ADJB 2QQLL 4IIQC 4DZBA 4AIZB 3ZTJH 3PDGA 3SGEI 2F19H 3ZE1E 4NUJB 4LSSH 1BFOB 5KJRL 1I3GL 1OP5K 1RURL 1CFTA 2ZUUA 4PB9H 1A5FL 5B38G 1MFEL 4FTVA 1NGWA 3OKLB 1XR8B 5DMGC 2IQAA 1TQBC 5INCB 4UTBL 3S8WA 1CXLA 1G0YR 1RHFA 1R5IB 3T65A 4ALAH 1A1NB 1UA6L 3AREA 4K94C 2Y07H 4G7YH 4AJ0A 3T0EB 4CUCA 1LE5A 2VE6A 1M6OA 1FH5H 2CDGB 5HHNA 3GUTB 2EDKA 3EOBB 4KI5E 4CNIB 2HFFB 3ZT5A 3FOMB 2X7LA 2FH8A 3PABB 5IMLA 4JHZA 5T1KD 1KV3A 5CD5C 5FUZL 5HYJB 5CKGA 2GK0B 2EYTB 1GGCH 3AS2A 5E1AB 4F7CB 2VDQH 3QXAB 5GSRA 3SDAC 4JN1L 1NUNB 3BH9B 3I75A 5E2VH 2APWA 4WWKA 4RX4A 5MEQA 2ZUXA 3GRWH 4PP1C 4O00A 5FKAA 5HHOE 4MLSA 4OIIL 5JORB 1SJEB 3MBEB 3RWEB 5C0JB 5KZCB 4U1LB 5I2IB 4NZDA 5D2NE 4WI2A 3H9SA 2IPUG 2AV1A 2PXYD 1BQSA 2EDYA 4G9FA 2HH0L 4PBWD 5SX4I 1GPOL 3UO1H 1RJYB 3QUKB 3BPOC 5CZKA 2YD9A 1IGIL 5BV7C 1K6QH 1NANH 5D1XD 5INDB 5TH2A 5IOPB 3L5IA 5EZLB 3E2HA 2OLDA 5GZND 2IQ9L 5C71A 4LARL 4J6RL 4NPYB 3V0VB 3BUTA 3FQNB 4AQOA 1NCNA 1A6VH 2ZJSL 5MI0C 4OM1H 4YGVB 3DTXB 5DS8A 4WTZA 5CBAB 5IBUG 2F74B 3WLWC 2I9LA 1JP5A 3MJ9A 4O2FB 4P2QB 2D03L 3O2DH 2Z4QA 5J6GB 1SHMA 1MVUA 3CDYA 1N3NB 3IDXH 4HWBH 1RZ8A 5TQ0L 1DVFD 3T1FB 3UZEA 3NH7L 1NC4D 5D71H 3KYNA 1AXSA 2AV7B 2V2WA 4P4RB 3BAEH 1KCVH 1MNUH 3REVB 4P3DB 4UZGA 1DBAL 3RU8L 3IFPB 3O2WH 2PTVA 5A2JH 5GJTH 3OF6D 1S7TA 2FD6L 3MNZB 3MODL 2XN9A 5HGBB 2DKSA 4LSPL 3VXQB 3HG1B 3FTGB 3VRLE 4F15C 4EXPX 2OCFD 5C0CE 4H26A 1KEGL 3RUGF 4J4PA 3ARBD 2VN4A 1FFNB 1NCBH 3RVWD 5JOPE 4F7PA 4IDLA 2H1PH 1J0JA 3C6SA 1EJOL 2ZKHL 3BI9X 3RQ3A 3SKJH 1ZTXL 3CXHJ 3IT8D 3QI9D 1P9MA 2M8XA 3BGMB 5HHVH 3MRLB 5LJYH 3GMPA 1AHWB 2GSGA 3NFNA 4KK6D 4UOW0 5B3JF 1PG7X 1NGQH 4QRQA 4TVPE 4BQBA 4HKBB 5ICXA 4KK8D 2FEDC 1PX3A 4UNTA 2C7UA 1AR2A 4Y4HC 3STLA 3W9DA 3VXMD 3WS3A 3ZTJG 4BZ1H 3T3MF 2BOBB 2XWJA 4HKXB 3IDYC 5GIRA 3L3GB 4PRIB 4X7CC 5C0CD 3QHFL 3GMMB 4DGVL 4I77L 5EOCL 3O41A 5JOPD 1OD7A 1UJ3A 3BP6B 1NCAL 5DJ0B 1G7QB 3C9NB 2VRAA 2HFGL 3V5DA 2Z35B 2FO1A 2X4QB 3VMPA 2EE9A 3V0WH 5DJ8A 5DRWB