1ZT7A

Crystal structure of class i mhc h-2kk in complex with a nonapeptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
275
structure length
275
Chain Sequence
GPHSLRYFHTAVSRPGLGKPRFISVGYVDDTQFVRFDSDAENPRYEPRVRWMEQVEPEYWERNTQIAKGNEQIFRVNLRTALRYYNQSAGGSHTFQRMYGCEVGSDWRLLRGYEQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGDAERDRAYLEGTCVEWLRRYLQLGNATLPRTDSPKAHVTRHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-K alpha chain
publication title The H-2Kk MHC Peptide-Binding Groove Anchors the Backbone of an Octameric Antigenic Peptide in an Unprecedented Mode
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 62
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zt7A01
4WW2C 4MNHA 1UM5L 3NFPA 2GJ6B 2H9GB 2RR3A 5HYSG 3KYKL 2ILLA 5E2WL 4FQXC 4XP4H 3ERYA 4N0FB 3RWFB 1NMCC 2L4OA 3ILPB 5FHBH 3TA3C 3TO4B 2CKBA 1EEQA 5HGGS 4R4NC 4LLYA 4PP2A 3QUXD 3MUGB 1RUAH 3RI5K 1HNFA 3WXWL 3FT3A 1R3IL 4JN1H 4QOKB 1XF5B 3T0BA 3BQUD 3U7YL 4PP8C 2ITDA 4N0UA 4JG1H 5GRWA 4JPIB 4OZFB 3RGVB 4OM1L 3GDBA 4LHUB 2VDNH 5JTWA 1RZ8A 1UWXK 5DRZA 4X6CE 1SEQL 4NT6B 3EO0A 4O51B 4WUUA 4YNYA 1M6OB 1AGDA 2NTSP 1IJ9A 1J05B 3IDGB 3NCBB 2Q3ZA 1MIMH 3FQXB 4P49A 4Y1AB 3FQRA 2W9LA 4UOJA 1UENA 2GSIA 3SDAD 4EI5A 4LSPL 1DBML 4UU9B 1I1AD 2APXA 2AABH 1RZIA 3L5IA 4JAMA 1MCWW 2V2WA 2KPNA 4KI5E 3HRZB 2CIKA 1ZHNB 5J12C 3QO0B 1FFNA 4YXKL 1HZHH 1TITA 4XXDA 1VFBB 4HLJA 4IRSA 1F5WA 5IW1B 5FECB 3ULSA 4OI9A 4E41E 1F3JA 5H94A 3C6LC 4TYUA 4X6DB 3RAJL 4YHPA 5J13C 4PJ7F 3ZYOA 1ZHKB 4C83B 3QWQB 3L3IA 3F6IA 3P77A 2EDOA 4YH6A 1DJSA 1AGEB 5DYOB 1IM9B 4N8PA 2DOCA 4KTYA 1FVDA 3UJTL 4MCYB 4M3JA 2V17L 4D3CL 1UJ3C 3CSYA 1MJ8H 3MJ9H 1AKJB 4ZUWA 4HG4K 5GS0L 1YYML 1MJJB 4Z8FL 3CCHB 2R39A 4HPYH 4X5XB 1CU4H 5F9DC 4HIJA 5IBLD 3T3PE 3IF1B 2ZPKL 2CLRA 3IKCB 4WWID 2XN9A 4GAGL 1UVQB 4PJAE 2D7QA 3ALPA 1LO2H 2V5SA 4KKNA 1LEGA 3VXMA 1KPUB 4F2MB 3ARYA 3DTXA 2Y9RT 2NXZB 3AY4C 3HAEB 4Q58C 4L8CA 3DVNB 1GXEA 1JGDB 3MRHB 3SOBL 2DLFL 4F7EB 5ALBL 5D7KD 5HHPA 4HWUA 4MJ5A 3PNWB 1RIVL 1T5XB 2D31A 2EEAA 2HT2C 4P2OC 4JM4L 5GHWH 4OZGF 1JGEA 3OSKA 4PJIF 5DHVH 3GO1L 3QDMA 5GRUL 3SKOA 3Q6GH 3MCG1 1BBJA 1BJ8A 5GGRA 3Q1SL 4NO5A 2V2TA 4JO4L 2DJSA 1II4E 4B41A 4I48B 1EJ6A 2R0WH 1RSFA 3D85D 4HZLB 4XVUC 3UJJL 1G84A 1RMFL 1KLUB 4Z5RB 1R5WA 1JF6A 3JWOL 3H6JA 3V6OE 4U1JA 4O2EB 3KXFD 5CAYB 2MQ0A 4FFZL 4M93B 5IMLA 4WDIA 4LCYA 1NBYB 2VZOA 1ONQB 3MRFA 5EUOE 1R5IB 2BY1A 4NO3A 3GUTA 2Y36L 3OB0H 4I13B 1RUPH 1RZ7L 4Q9CA 2HLAB 2D7MA 2ZNXA 2RCSH 5HYIA 1ORSB 1WZLA 3HHRB 3Q5YA 1ORQB 3KLAB 1FJ1B 3LEVL 1IZJA 3RPIA 5LGJB 3KHQA 4G43A 3ULUL 4K3JH 1GAFH 4P4RA 1I3GH 2R1YA 2AV7B 4OF0A 1UCBH 1TIUA 2BMKB 1F97A 1P7KA 4HFWA 4EN3A 3L7FB 4OGXH 1I8IA 2IFFH 4YHLL 2Z8RA 1QSFE 1KTDB 4IHOA 4RGOH 3SO3C 3BN3B 1B0RB 5C08B 3AFLA 3UYRH 3T08A 3A6BH 4G80B 4DFIA 4ZDHA 1M71A 5DUMH 4S1QL 3QEHB 4X4YB 5T1KA 3DSNA 3I2CH 4LCWE 2R8SH 4DGIH 3FFDB 3IXTB 3ARGC 3BZEA 3MCKA 2W65B 3QXDA 4BFIA 3L95A 5FGBA 4RNRA 1MCPH 3IDIB 4ODVL 4F7TA 4PGJA 1N0XL 3D0LA 5E08L 4M61A 3TBSA 1D5BA 4YHZL 3P4MB 5EU7E 4DGVL 3QNYB 3QJHB 1A6TB 3MODH 3S9DB 2NY3B 4JQIL 2BC4B 4WWKA 5HTSA 4R4BA 5KSAC 4E0RA 1TETH 4GKNB 2BNQD 2VABB 1Z6JT 3GSUA 3ULVD 1R3HB 1LMKA 1QLRB 5GSRB 4DQOH 2H32A 4YBLB 5KZCB 2VQ1B 2WM0A 3G5YB 1XF4B 5E6YA 2JK5B 1I85A 4UIKH 4V1DD 1RY7B 2DYPD 1KUMA 2WANA 3OB0K 4LSDA 2VB5A 1AGCA 4WGVB 3SCMA 4UQ2A 5EC1A 3KLHD 1KF9B 3DYPA 1MFEL 5D2NA 4N90E 3RZCA 4Y4FC 5DI8A 3TCLA 5ADOL 3TPUE 1CGSL 3SDXB 2I60L 4H8WH 3IDYB 3W82A 1Y18A 3VGFA 3O2DL 4AQ1B 4GKSB 4O02H 3DJ9A 3GSVA 5I8EA 1SJXA 4FZ8H 3T1FA 3O4LB 2G2RB 4WO4C 1NFDA 4XNUL 2V9QA 4NN5C 1LE5A 1A14L 2YC1B 5DURB 4CU8A 4KROC 1SMAA 3C60D 4HFUH 3RBGA 1RUQL 2AJZB 1LO0L 4IOIA 3GJFH 4MXQC 5FAAA 4N1HB 2HWZL 4DTGH 1YJDH 4CRPA 5TQ2H 2XFXA 4WJ5B 1I9EA 3FQNB 2AK1L 5L9DH 1BHGA 3I50L 4JB9L 5F7HA 4OCXH 1Z3GL 3WUWG 1WAAF 3SDCC 3QA3B 3MMEB 1RULL 4L8SA 2IADA 4MVBC 3C8KA 4F8QA 4X7TA 3RUGA 5FA3A 3MGOB 3PHQB 3X3FL 5DHVB 1FL6B 5HVFB 2W9EL 4M1CC 3S37H 3DX8A 3DX6A 5IBUB 1HH6B 4QTHB 4OLWH 5T5NG 2NMSA 1PJ9A 4M62H 4J23A 1ADQA 3CD4A 5DT1L 1YUHB 1HKLH 3U79A 3F7RA 1QSZA 1S9VB 4BJLA 2A77L 5CJ5A 2N1KA 4AG4L 5A2FA 3C5ZB 3CFKA 1IGYA 4I2XA 4S1RL 1MHEB 4QGTA 3VXQB 1KNOB 5KS9B 1EAPB 4JFPB 4A2LA 1FL5B 5BVPH 3GSWA 2QQKL 3VXSD 5DLMH 4GG6B 5CJXA 1E4WH 4LKCA 1JV5B 2C7UB 1PYWA 1RJLA 3I3EA 3QI9C 4XT1C 5DJ8A 2PCPA 2F74A 3FMGL 3KPSB 2VC2H 5GSVB 3BH8B 3LV3A 2IJ0C 3F62A 1JNHA 2DBLH 2HKFH 4N68A 4RX4A 1F4YL 2DTSA 3K2UH 3PGDA 2AJVL 3EFDH 3PQYA 1S7XB 1CS6A 2A6JA 2C1OB 3OJ2C 4UDTB 3GJFK 1QA9A 1T7YA 3VWJA 5F3HA 3PWUA 5D96C 4BELD 2B20A 4XNZB 5ESQB 3EJJX 1I4FB 5GJSL 5IM7A 2ADJA 3VRJB 5AZ2H 4WIQA 5D6CA 1BFTA 2A1WH 4JJ5A 5TE4H 2DQIH 1MLCB 1PSKH 4NQCA 1T7WA 5HDQH 2Q8BL 2ESVE 4K23H 3MACL 2VH5L 4F58L 3NCJH 2HKHH 1KLFA 1S7VB 5EC2B 2F8VA 4CKVX 1QLFA 4S10A 5B38A 1S5HB 1FLRL 2RHEA 1ES0B 2VDLH 5GGVY 1U8LA 4Z7OF 2VNCA 3RU8H 2XT1B 4LVHB 2E27H 2Q3AA 2A9NL 5DD3H 3MRDA 1SY6H 5HHNB 4TVPL 3QR2A 2CK2A 3BD3A 5CGTA 3SE3A 3TZVC 4WHCA 2ZOLA 1TJIH 5GGQL 3L5WB 2X9WA 1QO3A 1BFVH 4S2SA 4ENED 1YNKL 1KELH 5EPMB 1T1YB 5EU6E 1C5DB 2A2QT 1I1RA 5E1AB 3ZMRA 4KWUA 3OAYK 2R4RL 5CIPH 3EYUL 4OZ4B 5HD8D 4CNIB 4YR6B 2QQLH 1BOGA 3DUHA 5MEND 1SVZA 5DQDL 4L8BB 3DRQA 1T7XA 3MLXH 3RBSA 4B50A 3JZ7A 1CE6B 4MNQA 5E6IC 5SWSD 5DF0A 1DVFA 2PO6A 2P8PB 4KZEH 5TDNA 3W39A 1IGTA 2DQHL 4AMKH 1IL1B 1Q0XL 5DK2A 5F96H 1H3PL 1S7UB 1UH4A 4X9GA 3GJFB 4OAWA 1JN6B 4LLUA 5C8JB 3HG1D 1F02I 3O2VL 4ZPTA 2AEQH 4UTAL 2BNRE 3QUMA 1D6EA 4APQC 2CIIB 4OFVA 4Z7NF 4K8RL 5JXEC 2Z35A 1KC5L 5GS1B 4LPXA 4JM2A 1IGCH 3O6FC 4F37K 3STLA 3FO1A 3FHAA 4HWZB 1CFTB 4EOWL 1N3NB 1W0YT 3QQNA 1IEAA 4MDJA 2NY1B 4GO6B 4NCC2 1DBAH 3ARTA 3AB0B 4OBSA 1MQKH 1IILE 5IMMB 1OGAB 2NYYD 1G7MA 2FWOB 3QUZA 5D1XB 1F45A 4NQEE 5ITBH 5B3JF 2NTFA 1C12A 1IT9H 5DJCA 1CICB 1P5UA 2Q76A 4DN4H 1P69B 4Y2OA 2BCKA 2VIRA 2VDRH 4OSUH 4JFFA 4L1DA 4OZFG 4LHUG 3LN4A 1NUDA 1G7PB 3V4PH 3VH8B 1YNLL 4X5LA 4ZSOA 3SJVA 3NGBC 2X4RB 2OLDA 3N1FC 4Z7WE 3D39A 5C3TA 4NM4H 1H15A 2AJXL 1Z9LA 2ZWLT 4XP6H 3WN5B 1FGNH 4F3FA 1JHLH 4U1MB 3DBXB 1NFKA 1J12A 1IFHH 1YPZE 3LH2L 2CRYA 1Q0YH 2PYFB 2A73A 2OSLB 1FC2D 2VTFA 4FZEH 3TPKA 4NO0A 5TGBA 2ZUYA 5LWYH 1YEGL 4PJHF 4U1LB 2CDEA 4MD5A 5H37H 2VDPL 5ILTL 1TZIA 1TJGL 3T77A 4ONGL 5FGCB 3LCYA 1J1XH 2YSSA 3LS5L 3PE9A 1S9YB 4O2FB 2P7TB 1T4KB 1OAYH 1AO7B 3T4YB 5HYJD 3BT2L 3Q3GA 2H45A 4CL7A 3JUZA 5SWQA 4JQXC 2ID5A 4PP1C 3MLWL 3QFDB 2R2CA 4NQDA 4NJ9H 5B4MC 3EKCA 3F58H 5DD6A 3QPXL 3IDMA 4KKCC 5FUOH 3SKJL 3C2AH 4N8CH 1L7TH 3FOLB 2FEEI 4MAYD 4R96B 1GHFH 4YC2B 3UMTA 3VG0L 1RZKC 4JPWH 5CEZE 4G8IA 3BUYA 3VMNA 3TFKD 4XCYB 5HDOA 3O3EB 5IGXH 2BVQA 4G42A 5GGSB 2B1AH 3C87A 2LE9A 1CTNA 3U9UA 4YK4B 2VLJD 4JQVA 2PW1B 3QNZA 3RTQA 1IC4H 3HAEG 3RL1A 2IAMA 1QVOA 1RK1B 3MLYL 2V5TA 4CU7A 2J88L 5C0DA 4X98A 3B6SA 2A6KA 1LNUB 4CW1A 5JXAL 1S9KC 3IETA 4LOUC 1AIFB 3MBEB 3GFUA 5DMIL 3MV8D 1MAJA 4NGHL 2DQDL 2E7LA 2I9LB 1JF1A 3PWPE 3TN0C 2BVOA 1U92A 1NCCH 4XNMB 4N0YH 4WHTB 5CIPB 3K8LA 4OZIE 1E27B 4HKXB 3Q6FA 4P46B 1G1CA 5BS0E 5E0QA 3RX5A 4NDMB 1UJTA 4NFCA 5DEFB 5ID0A 1OTTD 4XNXL 5SX5H 3CVIH 1CLZH 3SE4A 1CFVH 5E03A 4C54A 2QTEA 4L9LA 1YEHL 3MROA 4PRNA 2R1WB 1YEEL 4PJ5B 2NY4C 5EZIL 1R3LB 4LFHD 3GB7A 5MP6H 4JRYE 3REVB 4WY7H 3GBML 1PEWA 2IANB 4I0PB 3V52L 3WUWA 2ATKA 3DV6B 2DWEB 3QO1A 4XP9H 3BXNB 2GY5A 5C0AE 2BOBB 2NY7H 4Y5XB 5EFIB 4LDLB 4FFVC 1OCWL 5I73B 2YD5A 1WBYA 2QSTA 3KPLB 4EJ1C 5T3ZH 4P4KA 4LIQL 3MXVH 3QCVL 1BIIB 2PXYD 1AD0B 5I76B 1NPUA 3BO8B 2EO1A 2FX9L 4OCSL 1D9KA 2OQJB 1RURL 4JFDB 2GK0B 1MCHA 2P5ED 4CVZA 3DIFB 1GGIL 2UWEE 3DO7B 2VLRD 2Q86A 3B8YA 5F9JA 2G75A 1VENA 5J56B 3WKMH 3L3OA 5KOVC 1XCTB 2KKQA 3UTSA 1I3VA 1KFAH 4K94L 4PJAA 4FQXB 2EYRB 4WI5A 4M1GH 3WJJA 5J9PB 2J7LA 4G9FD 1OTUD 3KPPB 5KTEH 1XEDA 4U6YB 3V7MA 5I19H 4QNPF 4M8QB 5E2UL 3I75A 2DKUA 1MCDA 2QHRH 4OGZA 2APVA 3RWGA 4PGCA 3EJZD 3MLVH 5SX5K 2QHLA 5TDPB 2XIDA 1FE8L 3QQ9D 3WNOA 4DGYL 1NGWA 1XGTB 4L4JA 2VAAA 1G7JB 3AXLB 2XACC 4KHXH 4F7PB 1A6WL 1U58A 4L5FH 1QBBA 1KCSH 5ICZB 1T7ZA 3WHE0 4XHQA 3IFLH 4ZTOL 1T1WB 1AP2A 2P48B 1MAML 3G6AB 5EB9A 4OIIH 1J9CT 3G5ZB 2OBGA 5I71B 5HXMA 4KK6D 2IQ9L 3FB8B 4IDLA 5D2LB 4P5TC 1UZ8B 2YPLE 3QT2A 4H25B 4NO2A 5EUOA 1R0AH 3D0VB 1QLEH 3CC5A 3FB5A 2BHZA 1G1YA 4R4ND 5EU5A 4ZUSB 2NZ9D 1BAFH 1MAKA 32C2B 1HDMA 1QRNB 5KOMC 3AS3A 2DI8A 4PLJD 5D6DA 5FV2A 1XGQB 5D9SB 3RWEA 1S7SB 2XKNB 3SE9H 5T33H 3OJMB 1CFBA 1FO0L 1D5XB 1MHPL 5CZXD 1C5BL 1QSFA 3FFCB 4RAVA 4JZOA 5EU4B 2PTUA 4JO3L 5C92A 1YY9C 4OFKA 5F9AC 1J8HD 3RDTC 1YEDB 1IEBB 5CMAA 3DVGB 3N1QC 4YHOL 4P5KB 5E5MA 2DKMA 4OUUB 4XCCH 3LRGA 3CU7A 3I6KA 4MCZB 1XGPA 4NC0B 4HCRA 3NFSL 3V6OC 3QP3A 3PIQA 3MO1B 4GQPH 4LCWA 4U0QB 5IBUG 2XA8H 1ZSDB 5JPMB 1NDGA 2Y5TA 2DQTH 5DEGA 1JWSB 5D5MA 5IF0B 3O6LH 1UZ6E 4NN6C 5HGDA 3MBXL 2ZZUT 2D4FA 2ZSWB 3C6LD 4P23C 4KTDL 5BMFL 4D8PB 4ZUVB 4NM8L 1NC2B 5E8NA 4G6KH 4JJHA 2JELH 2FGZA 1HIML 1LP9F 3STBA 3O41A 5FKAA 3MRIA 2OYPA 2YD8A 4LEOA 4RBPK 5F1SA 4OCNC 1RPQA 3PXHA 3P9MA 3BPLC 3EYOB 4WUUD 5LG1A 4MQ7A 3S6CA 1KB5L 5GISL 5BXFB 5K33A 3TNMB 5GS3A 3FQUB 4XNQB 3HI6L 1UADC 3S4SB 5JNYB 4R26L 1AE6L 4EI5D 3BWUC 4LSTL 1WT5C 1FH5H 4P48A 5C09B 3TPUA 2AK4B 2FLRT 4JKPH 1A1OA 5DRWB 4UBDC 5F7LB 5HHOB 4YE4L 1RIHL 3MV9E 2AS5M 2RIKA 4IRSD 1LILA 1IKFH 4FA8A 5F6IB 5IMOB 2VOTA 1LD9A 5CGYC 4PRID 5GS2D 1DANT 2H2PC 5GGVL 3QEGL 3BUTA 1I8KA 1RJZA 5ENWB 3T8XB 3T09A 2GI7A 4HG4J 1TJHH 2XA3A 2FBJL 1XIWC 4Y88A 5IT2L 1JNLH 2JJVA 2AXGA 5I1CH 1MUJA 1YA5A 5DMJB 3P9WB 3GM0A 4JN2B 4DKEL 4HX1B 1KJ3H 2JCCF 4UIMA 4MA7H 3NN8B 4F9PA 2X4UA 1F8TL 4LMQE 4UTBH 3QZWB 1T03L 3P40A 3CSPA 1IAMA 2MPAH 3GMMB 1Q72H 3L5HA 3DX7A 1P7QA 1WFOA 5HGHB 4QRPA 2XN9D 3IDXL 4BH8A 3QIWA 3KYMB 3WFDL 3I3DA 4RRPA 3CDYA 1FO0B 4PJCB 3VXMD 2GITA 3VFGL 5JLZB 1WZ1H 1SM3H 5SV3A 5MEQB 5ANMB 1WTLA 1ZLVH 2YUXA 1CTOA 3O3BA 3IXAA 5D8JL 5T5FL 1JPSH 1YMHA 2X4NA 1HYRC 2EDKA 4PLOB 1CFNA 1U36A 5BQ7A 1VFMA 3G5XA 1YY8B 1CGYA 3SBWC 3EUUA 4DZBB 3OKYA 2ZUXA 3BP7B 3H7BB 4XPGH 3TYGH 2W38A 2PNDA 3N1MC 1FN4B 1CDCA 5IHUH 4LARL 4ZXBB 3SQBA 1U8JB 1ZT1B 2BXZA 1U91B 3ARBB 4U1NA 4K3EL 1YN7B 5C0CE 3JTTA 1U3HC 3UTQB 1MWAA 1EVTC 4Q6IC 4DAGL 1V3JA 1CBVH 1G6RL 3WIHH 5A3ID 1KPRA 5E7BA 1IAII 1AI1L 2H3NB 1GZQA 3V4UH 4NNXA 5IHBA 4GQ9H 4P9HL 1QKZH 3RY6A 1JYWA 2D9QB 2V7HB 3V5KB 3NAAL 4ZYKB 5JA8B 3BN9C 2FB4L 3ARGD 4XNYH 3T0XA 4R90L 4WCYH 4D0DA 2XICA 5E2VL 4IMLA 5IB3A 2ZSVA 5J89A 4MQXC 3MLTB 4NN5B 4XRCA 3VFNA 5IR1A 1XF3A 1A2YB 5CZVH 5J11B 3X13B 1MCOH 1Y6NR 5F70A 1QFWH 3HZMB 3KPNA 3S88H 3HPJA 2NR6C 3QHZH 1A6AB 5AD0A 4OI7A 4H1LH 4IS6B 4AIOA 4JLRB 2ESVA 1T7VA 4YUEH 2VDKH 4M5ZH 3NZHH 3QUXB 4HC1L 3HLAB 4OLYL 3B5TA 4EN3D 4EUPB 4WTZA 4RMUA 1ZLUH 1NUFA 1AY1H 3DV4A 4KQ3L 5SWZD 4DK3A 5J6HB 5F7YC 1ZLVK 5FUCC 3OXSB 1SJEA 5T1KD 1PFCA 4Y4FD 1F4WH 5EH1A 1SEBA 1TTUA 3HMXH 3MLSH 1LEKA 1IAIL 5EO9B 4YX2H 2FJFB 1YYLL 1JMZA 1X4ZA 5A2LH 1UEMA 4R3SA 4WO4D 2VERN 2QADD 3UO1L 3SDAB 5EU6A 5EIQA 3H3BC 1FBIL 4KROD 2GK2A 5F71A 4OCLC 1WIUA 3ULVH 3ARFC 1ZHLA 4HJGA 5DD1H 5FYJH 1A1MB 1Z0MA 3E3QE 2AQ3A 2EDRA 2UVFA 4QT5B 4N5EA 3VXPA 5FHAL 5EBWB 2EDHA 4U0RC 2COQA 3QUYC 4KY1L 4PJEF 2Z92B 4DZ8A 3PF2A 3ZE0E 2ZUWA 3KPRB 1N6QH 2P47B 3ESVF 1WBXB 3RZCD 4IRZH 3AGVA 3LHPH 6CGTA 2R4SH 2BNRA 1JPTH 3P9LA 4PG9B 4M48L 3T0EE 3F12B 4KTEL 5FDYA 1LEIA 4UT6H 3QIBC 4FFWD 1G6RB 1FP5A 4I3SH 5JA9A 4JKKA 3VA2C 3MREA 1V3LA 43C9B 1YNTB 2AJUH 1TNNA 3TBWB 3OKLB 2VXSL 4O2CB 5BW7C 3KPMA 1RJCA 1BZ9B 1G7IA 3B9DA 4PJFB 3U9PH 3HNVH 4HIHA 1RZKH 4XVSL 4PJ5D 1PG7W 4R2GD 4RGNE 4OJFH 5D1QC 3TV3L 5A2JH 1DEEB 4M5YL 4JGJA 2ZJSH 4XMPH 4X99A 4TULH 2CD0A 3ZE1F 2VE6A 3LDBC 5FKPB 1BP3B 3RVUD 5E8EA 5ID1B 2H1PH 4LQFL 1RJYB 3P4LA 1A0QH 1I9IL 1RK0A 2HN7B 1L0QA 3RKDD 2GAZB 4KKBD 3D85B 1VKXB 5KVGH 1U3YA 2PKDA 1KBGH 1MREL 2F53A 4W4NA 5HDBE 1GZPB 1MHCA 4YBQC 1MI5B 3QNXA 5I18H 1ZGLA 2BOCB 4MA3B 4YHIA 2VL4A 1VSCA 3T4AA 5HVGB 1V7MH 4PD4K 4GKZA 4BZ2L 1W0WB 5ECJE 3LEYH 3MRNB 2F54A 4Z7UB 2CDFA 3CLFL 1C1EH 4YWGL 3K74B 4LDEB 4WFEE 3MUZ1 2BVPB 1X5XA 4LSUH 3K80A 4Y19D 3RWIA 3B2UD 5HI4C 1ZT4B 4JHWL 1UG9A 3MRGB 3QQ4B 2GT9A 3S35X 4HLZG 4M7KH 1V7NH 2ICCA 1R6VA 4LCUA 3QDJB 2WUCL 3S34H 1TLKA 4RX4D 3H7LA 1RU9L 5DJDB 1N8ZA 3E6FA 1FAIL 3PQYD 2EZ0C 5F3BA 3AVEA 4Z9KB 4ISVB 2HT4D 3FB6A 3PL6A 3IDNB 3KHOA 3V6BR 3MJ9L 1A6PA 2FR4B 2ARJA 4X5WA 2FL5B 5C6TH 5KAQG 3CMOL 3O6FB 5IWLA 4JO2H 1EPFA 5DFWH 1OTSD 1S78D 3ETBF 1NCWL 4GAJL 5DD5H 1A3LL 4NOBA 4AQOA 1AC0A 2WBJB 4TUKH 5DHYB 2FECI 4NQCD 5I8OL 4ZNCD 3ZE2F 2Q7YA 3WHXA 4P9MH 3WO3B 2YA0A 5JO5B 1H3TA 1VPOH 5E6ID 5L8KB 1B0GA 2GIYA 2OJEA 3OPZL 4HK0B 5HY9A 1Z9MA 4LASL 1ZTXH 1WUNT 3FT2A 3ROOA 3LPFA 3NH7H 4W6WB 3PWPA 4AK1A 4NHCH 1BFOB 2GCYB 2AJSL 3FCTB 4OZIA 4PTTB 2YK1L 3D3VD 2NPLX 4MJIA 4JDZB 1JNNH 4IJ3C 3V0WL 1DQLH 3E2HB 3VDCA 3MOAH 1QBLL 5I2IA 4V1DB 4ZOBA 4N1EA 2DYPB 5JPNB 1N64L 2X1XR 1NGXA 1B4JH 4Q2ZB 1UA6H 2AI0L 1FFOA 1L7IL 3PABA 2BFVL 2AV1B 3DI3B 3LIZL 3QPQC 3O2DA 4WHDA 1AQKH 3HR6A 4C4KT 4UT7L 3G9VA 3T2QA 4XCNA 1AGBA 1DBKH 1N4XL 2EH7H 2P1YA 1ZK9A 3GIZL 4YDLB 5IV2A 2OZ4A 4PBWD 2V7NB 4KGLA 1OP3H 3S8WA 1BPVA 4XBGA 3C60B 3OXRA 3WL9B 4MNQD 2MFNA 1RHHB 4G7VL 2JJSA 2PO6D 1Y0LB 1W72L 2XOTA 3VFPA 4N9GA 4LCIL 3B5GA 3MLUH 4IM8A 1KN2H 1M7IB 4QHUA 1FAKT 5TH2B 4U3HA 1J1PH 3O4OB 1NGQH 4FQHB 4MWFB 5DZOA 2J8UE 4U6TA 5GRXG 2F5AH 4UV7L 2UWEA 4AEEA 2APBA 4Z7WF 2CUIA 2OL3H 1A3RL 5KANI 2ORBL 1GGTA 1T0MB 1RIUL 4JM2D 1KPVA 1YPZF 3QWRA 1A6VH 1X6LA 3I2CL 4UB0H 4Y2DC 1VHPA 3RZWA 3VXRB 3ALXA 1K4DA 4CVXB 1M1SA 2W0PA 2X4QB 4UINL 1TVHB 5I1AB 4FNLH 1I7TA 4NPYA 4OZHB 5F8RC 1WK0A 2C3VB 2I5YL 4L8DB 4J1UA 1S7TA 3LKSA 2Q6WA 4WWKC 4HHAB 1NEZA 1T5WB 4KK8D 4P3DB 4PP1D 5GGRY 3VXSB 1YN6B 1P2CA 4I18A 4IEFB 4JANB 5B4MD 4MDIA 3K2MC 43CAB 2FEDD 2OI9A 1HHKB 5E5UB 2BDNH 1K8IB 1R3KB 2AW2A 2IWGA 3DSFH 1GH7A 4FTVB 1UACL 2NXYC 4LSRH 1A5FL 2EKSB 2HRPL 3FTGB 5F9OH 1KENL 1OP3K 3BKJL 1T6VN 4OKDA 3CIQA 5CEYA 4L3ED 4Z7QE 1LE9B 4TSAH 2K9UA 3BKCL 1OARL 1KJMA 3OKOA 4Y8DC 5ALCH 4X6DE 4F9LA 4NO0D 1GCFA 1N5YL 1HSAA 1ETZB 5CS7A 4LSSH 2YPLA 4FZ8L 5AZEL 3QHTC 5JQ6H 1JWMA 4PRAB 5EOCJ 2OR7A 4QXUH 1GIGH 3VD7A 2XZCL 2A74A 3SGEH 2GTZB 1B6DA 5D7JC 3LB6D 5EWIL 3VG9C 2DM2A 3TNNA 5I1JL 4FFYH 5E9DE 1G9NH 2VXTH 3BWAB 2ED8A 1XAUA 1IC1A 4ODXB 1G7HB 2FIRT 4DTGL 3KS0H 4ZMAT 1GGBH 1RVFH 4ETQB 4NQDD 4YXLL 5MI0C 4H5SB 5IHZB 4MJ6B 1HHHA 3PP4H 4BSWA 1W0VB 3CXDL 3MJ7B 1IGJB 4L29A 3SY0B 2ADGB 1QSVA 5CUSL 2YN3A 5T3XD 1KJ2H 4LVOC 2YRZA 5FYLH 3KNBB 5GRVL 4L8SC 4PS4L 2YXFA 4U1KA 3NIGE 1BLNB 2VXVL 4Z7VB 2NY4D 5IVZB 4KV5E 4ELKA 4WFFE 5IUSA 1HCFX 1BZ7B 2VSDA 2XQYG 3MLZL 2YN5A 4L4TA 1CWVA 2CMRH 1EERB 2HJFB 4RFOH 3RTQD 2IAMD 5I16B 1I7ZB 1G7QB 4OCWH 3ZO0A 3WSQL 4WI9A 3WXVH 3LOWA 4Z6AT 3MRMB 1H8OA 2VR4A 3RIAF 5E8PB 4BFGA 5TFSL 3VW3H 3RVWC 3NFNA 7FABH 3X14B 3DETC 3GI9L 4LSVH 5CKAA 2FDBP 1MIEH 4YO0B 1RZFH 4HH9A 3KYNB 4TRPH 2DTML 2HRLA 5DS8A 5K59E 3EJYC 4KAQL 4PRBB 3EO9H 2KZ1B 5SWSB 5F44A 4CJ1A 4QRQA 1T04A 4M6MH 2IF7A 3C09C 4HUUB 2SEBA 4OGYH 2APFA 5I1LB 3CUPB 1OT2A 5EG6C 5CHNA 1Q8MA 5DMKA 4N9OB 4YGVA 1CLCA 4AH2A 3HG1B 3GSXB 4PV9A 4FXKA 5E8DH 4R0LC 4Q9RH 1FGVL 3Q2CA 1AD9A 3O11B 3U46A 1U8NA 2ZNWA 4ODSL 4HF5L 3NMEA 4AEHL 4ORZC 2FGWH 3D9AH 1A4JB 4KI5D 3SE8H 2Z91A 1CL7H 1MPAL 3KR3L 3HI1A 2OP4H 5IG7B 1N6UA 3F6LA 2EDNA 1EO8H 4E41D 1EEYB 1AXTH 1X7QB 4BKLA 2B5IC 3L7EA 4LRIC 4GAYA 5CBAB 2OTWB 4P4KD 3WFBL 4ZFGL 1C16B 1D5IL 4FXGB 1AR1D 1TZGL 2X1OA 2DQIL 3VCLA 3W2DL 1E4KA 1EGJH 2B1HL 2H8PA 3FO0L 3QISA 3CK0H 5KSBF 1D9KD 1QBAA 4RAUA 4JZJB 3W0WA 3B2VH 3QRGL 3DGCR 5DRNA 1DP0A 1P4IL 1P4LB 4EUPG 5F1NB 4X7FC 1FZMB 4GSDL 3VRLF 4BUHA 3BSZH 3BAEH 1KJVA 5JOFA 1JFQL 1T21B 1KLGA 5HGBA 1UM6H 3ROLB 3MNWA 4NUGH 4F15C 3OKEB 3RUGF 5JDSB 1Q9OA 2IH1A 5IW6B 3OKNA 1S9XB 1VGEL 4HKZB 1XCQB 1BWMA 1NGZB 5I1KH 3OF6A 1TJIL 1JPGB 1UKSA 4KHTH 4YFLI 1F13A 4P5TD 1TCMA 2X89A 1KCVL 5ISZA 1EHAA 1QUNA 2DQGL 4X80L 4M7ZC 3FB7A 5LCVH 4MSWB 5DFVC 2X1PA 3F8UB 1BQHA 1JYNA 1CVRA 5EZOH 4X9FA 5L0QC 3IU3A 1A7QH 4NSKB 1BBDH 2VRAA 3MRPA 3VE0B 4Y4KC 2W0KA 4PGDA 3UTZA 5ERWB 1TCRB 5HJ3A 1PG7X 5IMKA 4F7MA 4FQQA 4PUBL 2AKRA 4V3EB 1ED3A 3CLEL 4XAWH 2AXFB 2EDJA 4QXTA 1NMBL 4LLQA 3O3AB 4IRJC 3DGGA 4K7FA 3RDTD 4R97C 3HUJE 5I1DA 3CFJA 3RVTD 3SDXE 3WLBB 2DQCH 2XTJE 4NWTH 5J1TC 1HH9B 4QHLB 1HK6A 4OLXL 4YHKL 1ZEAL 4HGWA 2OXGA 4PJ8B 3GSNL 3SKUD 1WWAX 5BV7C 3O4LE 1ND0B 2BNUB 2NY6C 1HILB 4MAYB 3BKML 3M45A 4TUJA 2UZIH 3ZDZF 5I1EL 2HTKC 3RNKA 4WVRA 3SKMA 1INEL 1WWWX 2AQ2A 1T1XA 1MEXH 2ZP0T 1HQRB 5EOCL 4WEBL 2VDML 1KJ2B 1K3IA 5CWSB 2HG5B 4OLVL 5D7IF 2GUOA 2WWMD 4P23D 4RA3A 5MERB 1U8PB 1T89A 2HFGH 2VLJB 4NP4H 5FXCH 4KJPD 2BZDA 3LRSA 4HWEH 3QIUA 3JV5A 3T2OA 3TLRA 3TIDA 4CMMB 3CU1A 3FZUC 4H0GA 1U6AH 1A7OL 1F3RB 2G60H 3DX9B 1FDLH 3MRKA 4M6NH 3NVQA 2X4PB 2UVEA 2XG5A 1B9ZA 3EYFB 4IMKC 1QSFD 1VEPA 4WI2A 4TSBH 4JRXE 3QUZC 1F6AA 4PJ9C 4Q9QH 3IFPA 4Y7MA 1BIHA 2YZ8A 5AUMA 3PJSB 1N5AA 5F1IA 5AYUH 3GMLB 4U1IA 1KIPA 4KC3B 4GMSH 4DOHB 4LCWD 1T2QL 5GRJL 5LBSH 1OPGL 4UNVA 4G3YH 2CKBH 1HSBA 1J1OL 5FF6B 4BQ6A 5M94B 4MNGE 5DJAB 5ESVB 4UI2A 4HWBH 3ZDYE 4XP6L 3QFJE 5KS9E 4RWYH 3PWJA 3O0RL 3R1GL 1IFHL 2CLVB 1NAMH 1LK2A 1CDGA 5HVHB 1EXUB 3V4VH 4NBYB 2DLGA 5CEXB 3BIKB 2FH6A 3U6RA 1T66C 2R9HD 4FQLH 5A1AA 4XPTL 5EZLA 2OS7A 3MRCA 3GRWL 1NBVH 4RGMC 3MYJB 2B2XH 2WUBL 4PJEB 5IB2A 5C0FB 5FA4A 5HYQA 1N2RA 3OGCB 2LABA 2PXYB 3EHBC 3TJHC 2VDOH 3VFVA 2A6DB 1CN4A 4XCFH 1JI2A 4FQCH 5INDA 1IARB 3OAUL 5K9KA 1X5FA 2EDYA 4QF1B 2D7TL 5TE6L 2I25N 4HWNA 5ITFA 3L3JB 2P5EB 3U4EB 4JFOA 4N90D 1J18A 1NGYB 4QYOA 2CSPA 5FIEA 2X44D 1EHXA 1XH3B 2VDQH 1HYSC 2A6IB 2VLRB 3ARED 3HC4H 3T3MF 3BEVB 2DWDB 2Z4QB 3T0EA 3DUSA 1P9MC 1I8LC 4S0SD 3RA7L 2P5WE 3U82B 2B1AL 1FYTA 3A6OA 3LD8C 4NC1E 4U1HA 5TQ0L 5F8QC 1U93B 2YA2A 2F58H 5GGTH 1KCRL 5JORB 3GSNB 3FRPA 3OR7A 3E3QC 1A22B 2DLHA 3C5SB 3GMNA 3VI4F 4L4VA 3L6FA 3DNKA 4GOSA 5INCA 1J0JA 1NLBL 3QG6B 2QV2A 4CMHC 4EI6B 1IC7L 4G6JH 4M43L 2YPKB 3P73B 2YD3A 4OQTL 1MH5B 3HS0B 4ZUTB 4JY4B 1NCCL 4LKXA 5F9WB 1QFWM 3B3IB 3HC3L 1FZOB 3MRRB 4KGJA 3S96B 4Z76A 1V5JA 2DIBA 1AR2A 4MA1C 4J3VA 4U6XA 1LO3L 1G9ML 3UJIL 1AHWA 2X4TA 4MQXD 4Y16C 3UTTA 3W11D 3MZGB 1CFVL 5HYEA 3L5XL 1GVIA 1D5ZB 5T1DL 1LO5A 3BI9X 1ZLWH 2Z31B 4PJBA 5I30L 4JKMA 1DBBH 3NACL 5CSGA 2IPTH 5JUEH 4GLRH 1G7LB 4RFNB 1JHTA 4GXVH 4FQ2H 1DLFL 1YEFL 4HDIB 3KGRA 1DQMH 4Y5VC 2D4DA 1KSRA 4OKVB 3QUYB 1XF2B 2CRMA 1EK3A 4WTWA 3AM8C 4RGNC 2CJUL 4C55A 1NFIB 2A83A 3IVKA 3O6KL 3QCUL 3Q5TA 5HI3C 1MRFH 3DMMC 5FB8A 4P2RB 3ZTJH 4PJGA 4R4FH 2FNBA 3M1BB 1NGPL 2CK0L 1J8HB 1JCKA 4JFEE 2P42B 2EH8H 4TSCH 2A0LC 3LEXA 2NW3A 3ZKQD 4HSQA 1NCDL 4MNHB 3NFPB 2VITA 1FQ9C 2XNAA 3MXWH 3O9WA 4HGMA 1EV2E 4HQQH 5ICYA 2CKBB 2ESVD 1FFRA 4GRLC 1FNLA 4LLYB 4PP2B 4EIZC 2F8XC 4BH7A 1JRHI 3WLWD 5JW4M 2GHWB 3VWKA 2ZG2A 3FT3B 3P11L 3G6JE 4G8EA 2XV6B 1NAMB 3BKYL 2FYYA 3GEWB 4U6VL 4MXWL 2ITDB 4N0UB 3VMOA 1CFQA 1ZLWK 4PGBA 3SDDC 1RZ8B 5EBGA 5DRZB 1KB5A 1F6LL 4WUUB 3EO0B 3HI5L 4YNYB 1AGDB 3KPTA 4OTXL 1BGXH 3FQRB 3UZQA 2GSIB 5ESAA 4EI5B 3QIBD 3TIEA 5EU6D 4OBRA 1S5IH 1RZIB 4JAMB 4N0CA 2V2WB 4BZ1H 2CIKB 4ZAKA 3VFOB 2R23A 1FFNB 2H32H 1F4AA 1IKNA 4XXDB 1KIUA 1U42A 4IRSB 1AO7E 3ULSB 4LCCA 3BQUA 1F3JB 5H94B 1CR9L 4N5ED 2DBJA 1TQCC 2EC8A 2GSGA 4YHPB 4CVUA 1J10A 3QG7L 4KKAC 4UT9L 3BPOC 3L3IB 3LZFH 1NSNH 3P77B 4MD0A 4TNWF 1SJHA 2FCBA 5T5NF 3SE9L 1Q9KA 3C6SA 4LPTA 1I7UA 1A6ZA 1FVDB 3PWNA 5F7DA 4XPHH 4AIZA 4WHYG 1JRHL 4PJXF 3TBTA 4KKLC 1CCZA 3CSYB 3WKNA 3KYAA 8FABA 4LPUA 1MRDH 4QTIL 5GS0D 4ZUWB 1XMWA 4HS3A 2J8UA 1PLGH 2BNRD 4ZO8A 1KEGH 3HCVA 4HIJB 4JFYB 4ELMA 3T1WA 2CLRB 1KCUL 2XN9B 4Y5YA 2JJTC 5IVXF 3HE6A 3HB3D 3VXMB 2VYRE 4AEFA 3DTXB 4YDKH 2DIJA 4RIRA 4L8CB 1AFVH 3X3GL 4W4OA 2HH0H 4HS8L 4FABL 2AAVA 4MZ3A 1NC4A 5FO8A 1D3CA 5I75B 1H8NA 5HHPB 2EDDA 2QLVB 4P3CL 4IOSD 4MJ5B 4D2NA 1J0ZA 2UY6A 1ZWIA 1EFXA 2D31B 4KMTH 4LLMA 3VRIA 4HJ0C 3LMJH 4NQED 1JGEB 2B4CH 3RIAK 1YQVL 3PHOB 3HPLA 4O4YL 1I8MA 3QDMB 4RISL 1BJ1J 4HEME 4K7PX 1BBJB 2HA1A 4KK9C 5GGRB 5EOQL 4NO5B 2V2TB 2O93L 2DQEH 4Y89A 4PD4J 3HNSL 3RHWF 4G6AD 4JFZH 1KIRA 1QHOA 3H9SE 2F53D 4UU9A 1WJ3A 1R5WB 1WZKA 4I4WA 1ZLSL 1PY4A 3GI8H 3NCYS 1A7RL 4PRHE 5IK3A 1DBJL 4U1JB 3G6DL 2DI9A 2H6PA 5IMLB 4AM0A 5DR5L 1AQDA 2A9ML 3TO4C 5AAMA 4LCYB 5E4EB 3MRFB 4PJ7E 3GIVA 4X6DA 4NO3B 3GUTB 4DKDC 2WWKT 5F93C 2C4FU 5FYJU 4NWUH 1AGEA 5E9DA 4JFDE 3BMVA 3RPIB 4G43B 1QFUH 3RGVC 4P4RB 2R1YB 3QAZB 2FJGA 1P7KB 4HFWB 5HPMA 4EN3B 3X11A 1I8IB 3BPNB 4TPRL 1SQ2N 1ADQL 4IHOB 5FYKH 5KVMC 5KANG 3PL6D 15C8H 2EE3A 5HGAA 4JPVL 2X41A 3KXFA 4FG6C 1XGYH 2EYTA 4HIXH 4JFXA 4ZDHB 3N0PB 1M71B 5CEZD 1MRCH 1VEMA 1I9JH 5T1KB 3NTCH 1DQQB 1Q72L 4XPFL 2R15A 3BP6A 3VJ6A 4QRRA 4GS7B 3BZEB 1GPOL 3MCKB 5SX4I 3QXDB 4BFIB 3L95B 5CINL 4RNRB 1WC7A 2X70A 3SGDH 4F7TB 2R69H 1ZVSA 1NKRA 2BRRL 4TVSa 3CFCH 5D5MF 3D0LB 4M61B 4OZGE 3TBSB 1A1NA 2QADB 4NZJA 4PJIE 2WLZA 5LAXA 5FGSA 1OM3H 5SX4H 3U2SB 1DL7H 1KEML 3D6GA 4L3AA 5K9OA 4MS8A 4WWKB 1NLDH 4R4BB 4E0RB 3OV6A 1XR9A 3PWPD 4XH2A 3GSUB 2YMXH 2H32B 3GNML 2VLKA 2LU4A 5L6YL 5E1HB 4V3DB 2VKXA 4JG0H 5BS0D 3X17A 4U05A 1I1YA 1R5VA 3N9GL 4XVTL 1ZV5A 3MRLA 4P2QE 3VXUE 4OF8A 1EAJA 1AGCB 3SCMB 4UQ2B 5EC1B 4Y4HD 3BRFA 2XG4A 5D2NB 1ONQA 3RZCB 2PN5A 2NXZC 2OK0L 1X4YA 5DI8B 3TCLB 4BSVA 1Y18B 1C7TA 4DUVA 4DUXA 4JRYD 3S35L 3GSVB 5I8EB 1QRNE 3T1FB 4NZUL 1TZHA 3F7PC 4J6RH 4FN0A 1CXFA 1NFDB 4ZNEE 1GGCL 5C0AD 1LE5B 2BNQA 1MCWM 5K9QI 5SV4A 5J1AA 5D7SL 5DJ2A 5IP4A 4YXHH 1X5AA 5DC0A 4LNRA 5I1IH 4IOIB 5BV7H 1HEZA 2XFXB 2EIDA 2LTQC 1OW0A 1UWEL 2YPVH 4LHQB 4R2GB 4YPJA 3DLQR 1DN0A 4GBXA 2CLZA 3QBTB 4L8SB 5CD3A 2IADB 2NXYD 4NRXA 3C8KB 4X7TB 1RZJC 3RUGB 5FA3B 4K3DL 2WW8A 4QXGL 1CK0H 1LO4H 4ONFL 3DX8B 3DX6B 5L88H 4HPOH 4DVRH 4ZO7A 1KG0A 4XBPA 5DO2C 5TPWL 3MLSL 4IOFD 1OAZL 4KUCD 5D7JD 3BIAX 1W8OA 3Q48A 4MQTB 2WP3O 4LFHG 1E0OB 4HKBA 2XWJA 4MD4A 5DMGC 3CFKB 3VXTB 5D72H 1IGYB 4I2XB 5GIRA 5HHQA 1KCGC 4XC3L 3GSWB 3UC0L 1X44A 4LPVA 5EORL 4AT6A 4BQ9A 4BFEA 4O9HL 3QUML 1DUYA 2VSCA 4LKCB 5T3ZE 1H3GA 3ES6A 3TWCH 4MLSA 1PYWB 1RJLB 5DJ8B 4D9LL 2PCPB 1MFAH 2F74B 1F3DJ 5JHDE 4WV1A 1XZ0A 4XX1G 3LV3B 4HIEA 3EYVA 5FM5O 3HNTL 2EKJA 3HUJA 1JNHB 5CILL 5C09E 3WFEH 4DKFL 1OAQH 1ZVHA 3PGDB 5HHOE 3PQYB 3O6ML 3MQIA 4U2ZA 2N7BA 3MJ9A 3LRHA 4LQ1A 2A6JB 4X7SL 5MEOA 1NAKH 3P2TA 4QRTA 3ZL4L 5HBBA 1QA9B 3VWJB 4KUZH 5F3HB 3PWUB 4I77H 1G0DA 2YPLD 5IB5A 1YEKH 1H0DA 5B8CC 5D7IB 2R0LH 5IM7B 2NY3C 4NCDA 1E6JH 1ZANL 2ADJB 4KJYA 3S36H 4S1SH 1MELA 4PY7A 3RVWD 5D6CB 1LHZA 4JJ5B 3WO4B 3FN9A 1OQXA 1WAAE 4NQCB 1DQJA 2HTLD 1XT5A 5I1HH 5AYQA 4LRNH 5F7UA 1OAKH 1QLFB 5DWUH 5B38B 1CDIA 3M8OL 1CT8A 5ACZA 3U0WH 1WEJL 2OR9H 4XXCA 3ELAT 4JRXA 1U8LB 5DSCA 4X4ME 2W92A 4NYLA 3UCRA 3IDYC 4TVPD 1KN4L 3MRDB 5EIIA 5GJTL 5A16A 3TBYA 3M17A 1L9MA 5ANME 3TO2A 5BRZE 1V3MA 2ZOLB 4YDIL 4L4TD 4KVCH 4BSJA 3QUKA 4MNGA 1HINH 3RWHA 3TEUA 4S2SB 2BSRA 3LSOA 2VXUH 3FL7A 3JWOC 4HAGA 3QFJA 2MOVA 4OLZL 2Z9TA 3BVNA 3LPGA 4KZDH 1FC1A 1DN2A 3DURA 5DVMA 1BOGB 4JPKH 4PB9L 4TQEL 1UYWH 1C1EL 1ROWA 1OF2B 3DRQB 1JGLL 5T3XL 4QHMA 3ZTNH 4JY5H 2EDXA 7CGTA 5LJYH 1UM4L 4MNQB 1JZ7A 3UTPE 1DVFB 2PO6B 4R97B 3JWDL 5TDNB 3W39B 2B8OT 1IGTB 3QCTL 3O8XA 5DK2B 2XRAH 4L9DA 4UOW0 3ZKXC 3ULUC 1FRGH 4OT1H 4OAWB 4U6HA 4LLUB 2BSSA 2YD1A 4ZPTB 1OGTA 1Y6MR 3U1SH 2VO5A 1PEZA 5CSZA 3QUMB 1D6EB 1NMAH 3RWJA 4DW2H 2Z35B 1E4XL 3MV9D 3QSKB 3C5ZC 1JGUH 2P5WA 4PGEA 5MENA 5K9JH 4XBEH 3FO1B 3STLB 4EBQH 4C4KO 2F19H 1IC5L 1IEAB 2MCPH 4NUJA 2BVUA 4MDJB 5D1ZD 1KACB 4A2MA 2O5XH 4C57C 4Z7OE 4Q0XH 1G7MB 1JTTA 2YS4A 1IGMH 3QUZB 4ALAL 5T1MA 2NTFB 3WIFA 1C12B 4JFQA 5DVNA 5DJCB 5FOBA 2Q76B 2EDTA 3EZ8A 4PTUA 3WNNA 1E28A 2LQRA 4OUOA 3SDXF 1YEJL 5C07E 2BCKB 1FVCA 2VIRB 5DUBA 5DQ9A 1INQA 4JFFB 4LGSB 3HE7A 3L5WA 2DRUA 3UTOA 4JKLA 4XGZB 4XNZC 1IM3A 3FO2A 3OF6D 3L3DA 1A9EA 4O58H 3GHEL 2CO7B 4ZSOB 3SJVB 5HHXH 1DUZA 3D39B 1H15B 4M7JH 2X89D 4YHNA 4QRUB 3GBNH 1BFSA 4POYA 1K6QH 4F3FB 3BPCA 5F1KC 4NKIH 3SGKA 4NC1C 2A73B 2DQJH 3NA9H 4RAHA 1OAXH 3LAFA 1D5MA 5BOPA 2VXQH 5TGBB 4HXAL 3B9AA 4G5ZL 2DMBA 1YDPA 3ORJA 3FZUD 2CDEB 4MD5B 4B5EA 5IB4A 3H9YA 1TZIB 3ARDA 4RGMB 3T77B 4OD1H 2YSSB 2FX8L 3UP1A 2ICEA 1N26A 5B21A 3IGAA 2BJMH 3KPRE 4LVHC 4K7PY 3GGWA 2XI9A 3IU4H 3Q3GB 3ULUF 4PJ9D 5C0CD 3A67H 2Q20A 4DJMA 1TPXC 5SWQB 2FO4A 3RFZC 4NQDB 4XC1H 4U31A 1JHKL 1MHHB 4TNWK 5DD6B 4K9EL 3IDMB 3VFSA 1BM3L 3CSBA 5ADPL 4R6UA 1PKQE 4QXWA 2YUZA 3KDMA 4JFEA 2BXYA 3T2NL 3PWLA 2B7DT 1CFTA 4G8IB 4UILH 3FRUA 1N3NA 4TTDD 2BVQB 4G42B 4I0CC 2LAAA 3TT3H 1DDHA 3EOAA 4WNQA 3ZYZA 3U9UB 1J86A 3WD5L 3L3GA 4GG6F 3QNZB 4EVNA 3OGOE 2FIKA 4KQ4L 3RTQB 3RL1B 2IAMB 1QVOB 5HYJA 2J8OA 4IIQA 5B3JE 1T66D 5D1XA 5C0DB 4X98B 4FNLL 2A6KB 4CW1B 4ODHL 1N0LA 4CU6A 3BRDA 4WU7B 5B22A 4M6OL 5TE7H 5C6PB 5J06A 3D25A 1F58H 6FABL 5KJRL 5I15H 3ZSTA 1R24A 5IJVA 3G6JA 3IT8D 1RUKL 1JF1B 3EHBD 3TJHD 2BVOB 1U92B 5JZ7C 3GHBL 1H5BA 3Q6FB 1EHLH 1MCNA 3TFKA 4I18C 1EJOH 3QEUA 1MI5E 5GS1C 5ID0B 4NHUA 3WFCH 1U8MA 1KT2A 4L9LB 3K8KA 3RHWK 2OSLA 5AWNL 2NNAA 1PG7L 3MROB 4PRNB 3RWDA 3W9EA 4Z7UE 5IIEA 1SYVA 3GB7B 2NY1C 3EYSL 3JTSA 3AB0C 3ZTJG 3BDYL 2EC9U 3WUWB 3MV8A 4H88L 2ATKB 3O81A 4F8TA 5I6XB 3QO1B 1G0XA 4LSSL 3OL2A 2P7TA 4PIRF 2WNGA 4ETYA 3QDJE 1V8HA 1NCAL 1CICC 1WBYB 4XMLH 2VWEC 3I84A 4P4KB 4U1GB 1D6VL 1V05A 1YECL 2DL9A 2BHUA 3TVMA 4QY8A 4HCRL 3IFNH 4K2UL 1QEWA 4U7MA 1D9KB 3BHBA 4OB5L 3GSOA 1T6WA 4EZMA 3SDYH 3ZYIA 2Q86B 5GGSA 1NKOA 3WN5C 5F9JB 1QACA 4G9DA 3L3OB 4Y16D 3CGTA 1F90H 4MXVF 5JW4R 3T0ED 3UTSB 1SY6A 3EGSA 3D69A 4HH8A 2FX7L 4PJAB 3WJLC 5HHVL 3ZT5A 2YRPA 4D0BA 3I3BA 3GMRA 4GMTH 5GRZA 3DROA 3MBEA 5F21B 3LKOA 4LAQH 4EIGB 5C0BE 12E8H 2ITCA 3I75B 1CXIA 1QOKA 4MA8L 1IAOA 1M7DA 1SMOA 3ULVE 4PGCB 4ZO9A 2R29H 4D9RE 3VW3L 4RGND 5FYJE 2DF3A 4Z18A 2VJXA 3HZKA 4ODTH 2W0LA 3EFFA 1OSZA 1NGWB 1GOGA 5HI3D 2VAAB 5K93A 4YC2C 2ZCKL 2HT3D 2MKWA 4JGUA 3U30B 3ILQD 4V2CB 1CDHA 1U58B 4PBVC 3I02A 2DI7A 3T0DA 2E9IA 4M1DH 2JB6A 4BA8A 1KGCE 3QYCA 2XY2A 3H9SA 5BO1L 3CPLA 1AP2B 4YK4C 3UYOD 4MZ2A 4PRHA 4URTB 1A7PL 3H2WA 2J8HA 4QHKJ 4GW4A 3DOSA 2XPGA 5D70L 5KVFH 4PJ7A 5EUOB 4NO2B 3B9KA 4EDWL 1F2XK 1ZHBA 3CC5B 3FB5B 4PV8A 3MLRL 5DUPH 5EU5B 1EO8L 1HDMB 1MWAH 5DJXA 1CXEA 2FBOJ 3MSPA 2J2ZA 2FSEA 3WS6A 5I8KH 3OZ9H 3V5HA 3HAEH 4LSQH 3RWEB 4P46C 3LQAL 5KW9H 2QR0A 4HV8A 4PYHA 1VFUA 3MRQA 3L3KA 3SDDD 1QSFB 4WW2A 4IDJH 5IJKC 4I1NB 4RAVB 4JZOB 3LY6A 3U4BL 3FN3A 3VDBA 1N59A 3CDGA 4GAFB 1UM5H 2OMBA 3DVFA 3KYKH 5CMAB 4FQXA 4ZFZA 1OWWA 2EO9A 3VXRE 5E2WH 2WINA 3I6KB 3LKNA 1XGPB 3TA3A 2NY0D 4I0PC 4EEEA 3PIQB 4LCWB 4ZQKA 1KYOJ 1NDGB 2OJZL 2Y5TB 4OZHE 4Y5XC 5DEGB 4ZO6A 3H0TA 5D5MB 3GJEA 3V0VA 5I73C 1OB1A 3WXWH 5HGDB 2DM3A 1ZMYA 4OZGA 5GPRA 1R3IH 4MX7A 4MAUL 3UZVB 4PJIA 2Y72A 3U7YH 3VXSE 5IKCA 3KPOA 4GRMA 5E8NB 4LEXL 4OM1H 3OG4B 1MFDL 4YPGA 2YZ1A 3WE6A 1UQSA 3Q5OA 3UBXA 1SEQH 3O41B 5HHME 3T0WA 2NY5L 4GW1A 4FTVE 3MRIB 2Q8AL 4XP1L 3L9RA 5C7XL 2DIAA 3EOBA 3UZEA 1VGKA 3P9MB 5EUKB 4MQ7B 3BYTA 1C5CL 4WEUD 1KB9J 4LSPH 3DYOA 1DBMH 1PZ5A 1JZ8A 4FQJL 4P2QA 3VXUA 4HUVA 3QDGE 4P2YA 1WQVT 3C2SA 1TMCA 4XCEA 2JB5L 1KTRL 25C8L 4YXKH 3O2WL 5KG9A 3TPUB 5C0JA 1A1OB 3PGFL 3C6LA 4N0CD 4S1DD 4R9HA 3RAJH 4ZAKD 1SYSA 4JDTL 2B0SL 5F88B 3MA7A 4ZNEA 1F4XL 1TFHA 4PGZA 5DA4A 1LD9B 5FO9A 2D2OA 1MCIA 4ACPA 3SGJC 1I8KB 1RJZB 3UJTH 1UJ3A 2C3XA 4HWEL 2V17H 4D3CH 2D7NA 1UXSA 3QHFL 1T1ZA 2YXMA 5EN2A 2AXGB 2QKIA 1EO5A 1SBSL 4Z8FH 1FDLL 2FJHA 1B2WL 1MVUA 5B38G 1IGFL 2DB8A 1VACB 1HI6A 1NCTA 1N7MH 4UIMB 2ZPKH 4OQTA 5F1OB 1DSFL 4MCZA 4GAGH 3KJ6L 1JK8A 4NNPL 2X4UB 3F7VA 4Z7VE 4Q9QL 5I71C 3AY4A 2IG2L 1EBAA 2DMKA 3DX7B 1P7QB 4QRPB 3RGHA 4XMKL 4BH8B 5CP3H 3QIWB 5CD5D 3HE6D 3SOBH 2DLFH 4LDOB 4PRIA 5ALBH 2GITB 5BCAA 2WIIA 1UH3A 2P43B 4P2OA 4NZRL 1RIVH 4D8PA 4JM4H 3O3BB 3IXAB 4RMTA 1NC4D 2X4NB 2J4WL 4Q9BA 1LP9E 1T83C 3GO1H 1CFNB 1JWUA 3GMPA 3KG5A 5BQ7B 5GRUH 3C9NA 3G5XB 1EFXD 5ELIA 4P2CG 3V4VL 3Q1SH 1K2DA 3RGVD 4JO4H 4XP5L 2ENYA 1U8OA 4BQ8A 3BYYA 3UJJH 1RMFH 3R06A 3TBVA 2D03L 5KAQF 2E9WA 5D93B 2D0HA 3JWOH 4U1NB 3S4SA 4KFZC 3HG1E 3JTTB 5JNYA 1MWAB 2VR9A 3VXOA 5JHDA 4XWGL 4ZS7L 1KPRB 2R56L 4XI5D 4FFZH 1BECA 3P4OA 4X4ZA 4NNXB 4X4XA 4XTRC 2J1KA 5C2BL 3CX5J 2BP3A 2LVEA 2Y36H 4I5BA 3BE1L 1T20A 2V9RA 1RZ7H 5K9QG 4D0DB 4IMLB 5IB3B 2ZSVB 4XRCB 4G8GE 3VFNB 5IR1B 3E8UL 1XF3B 3LEVH 1EO7A 1A7NL 5L2KA 5BZWA 3ULUH 3SQOL 3KPNB 4K94C 1MCRA 3HPJB 2VN4A 5E9DD 2GTWA 5AD0B 4YHLH 5E2TL 2LTQB 2X09A 5DTFA 3C08L 2JCCE 2F8OA 5DK0A 1WAAA 4XZUA 5I0ZA 1BWWA 4YHML 1P84K 2GJZA 4S1QH 3QZWA 3DV4B 2AP2A 2ZCLL 3ABZA 1S9WA 3ARGA 1CD8A 4QWWC 1MF2L 4X4MA 1SJEB 3H3PL 1NANI 5TF0A 5D2LF 4ODVH 4PJDA 1KTKE 1N0XH 1SEBB 5E2JA 5BRZA 4QRRD 4YHZH 4WFFD 3V7AG 4N5UA 1U3JA 5F6IC 4DGVH 1J5OL 4R3SB 5F7KC 4AZ8A 4JQIH 5KSAA 1NJ9A 4RMRA 4K7PL 1IQDA 3CVHL 5L7XL 2Y23A 4YQXL 3NBNA 4KK5C 5JOPE 1ZHLB 4HJGB 4MS8D 3OX8B 2AGJL 1U8JA 4GXVL 5SWZA 3CH1A 1J0KA 1B3JA 3ARZA 3HZYA 1DQML 5EU3A 4RWHA 3VXPB 3MNZA 2VLKD 5CEZL 4NKMA 1HHGA 2OX5A 2W0FA 4RFEA 4Y4FA 1MFEH 1FZKA 1I9RL 1FLTX 4DZ8B 4KVNL 5ADOH 2DLTA 1CGSH 2I60H 3O2DH 5LKNA 3QEQE 4OM0L 1NBZA 3F65A 4WO4A 4ZUUB 4I3RL 3JXAA 2FATL 4XNUH 5E8OA 3EYQD 2FLBT 5FYLE 2BNRB 5DO2D 1A14H 3TH3T 4PR5A 3J7HA 3GKZA 4JFHD 5B8CB 1BEYL 1AC6A 5L8LB 4BQCA 1RUQH 4PBXA 4MXQA 1CXKA 1LEIB 5E24E 1LO0H 5DMYA 3TF7C 2HWZH 5LXGL 5JW4N 3MTRA 2I26N 4HT1L 3RNQA 3MFGB 3MREB 5KN5A 1Z9SA 2AK1H 2DICA 3I50H 4JB9H 4OD2A 5GZOD 1HXMA 4ZXBC 3KPMB 3SDCA 3ARUA 1Z3GH 1G7IB 2DN7A 3ARBC 4MVBA 1RULH 3T0AA 4HIHB 1UCTA 3CZJA 1EUTA 1J7VR 3X3FH 4GBXD 4X99B 2W9EH 3QULA 2VE6B 4DOHE 5FYKU 2YBRA 5C07A 4LPWA 4XPBL 1JPST 5E8EB 2CXKA 2X42A 2IMMA 2RAMA 3GK8L 1RK0B 3K8MA 3CFBA 2HYMA 5DT1H 5M7QA 2OZ4L 2EIZA 2A77H 3R0NA 5J11C 4NFDA 1U9KA 2F53B 1QBML 4AG4H 3RVXC 1S7RA 3MA9L 1MHCB 4X9BA 3QNXB 2Y07L 1ZGLB 4S1RH 4YHIB 1T3FA 2ZOKB 4X7CC 3T4AB 3ARRA 2QQKH 1RZGA 4GKZB 4JVPA 1AJ7L 4NNYA 1MSPA 3JVGC 3P0VL 5MHSE 3QUXC 5KZCD 3QI9A 2F54B 3GSQA 2CDFB 4QCIA 4PJEE 5M95B 2ICWA 1EBPA 3V8OA 5DGQA 1MNUL 1EIBA 2VZSA 3RWIB 3H8NA 1TENA 1F4YH 2GT9B 4PLKD 3ZKXB 2EXWD 4LCUB 3DUUA 1CLYL 2R0KL 3RVVD 3ALWA 4PJCF 1N8ZB 3E6FB 2XTJD 5C0IA 5F3BB 1MQ8A 3FB6B 2CH8A 3PL6B 3O4LD 2BK8A 1WWCA 3CNKA 4HKJA 1TXKA 5GJSH 1PKQA 2ARJB 2IPUG 1U8HA 4X5WB 2AEWA 3SDAC 1YEIL 2NW2A 1I1AC 2L7JA 5J0BA 3HMWL 3WIIL 2APWA 3EOTL 3TBWA 5FEBA 4POZC 2Q8BH 3MACH 2KQNA 2PUQT 2O5YL 4XWOD 2VH5H 4Y19A 4F58H 3MYZA 1P1ZA 2HFEA 1BQSA 1RUML 3C5JA 1FLRH 2WWKO 1L6XA 3ZKMD 2P24A 3WHXB 2YEZA 4WGWB 5FUCE 3ZE1E 3IAGC 1OD9A 1MFCL 1B0GB 3V6FA 2A9NH 2OJEB 3HC0A 5HY9B 4TVPH 3FT2B 1Q9WA 4JRXD 4NRYA 3ROOB 3ZHKA 3TZVA 3PWPB 4NKDA 5EA0L 5GGQH 4OZIB 2PR4L 1Q94A 4MJIB 3V6ZA 2ZUTA 3S5LG 1QR1A 2DKSA 4RQQA 1YNKH 5J4MA 4JCLA 5IBLC 2O61A 2C4FT 5I2IB 1H8SA 4JFZL 1NGXB 1DQDL 5C0ND 2R4RH 1L0YA 3FOMA 3EYUH 3C5ZD 1FFOB 5FK9A 3PABB 4D0CA 4P9HC 3QFJD 4PB0L 4PJHA 5DQDH 4XPAL 1CGTA 4XCNB 1AGBB 5E6IA 2XXCB 3LS4L 4M7LL 3TT1L 4OLUL 5IV2B 3GZKA 1OLZA 3QQ4A 1QQDA 1K8DA 2DQHH 1Q0XH 3BZDA 4NKOA 1H3PH 4XBGB 5JR1L 5I1GL 3OXRB 1FZJA 3D3VA 2EXYD 1TPXB 3O2VH 4H1LA 1Q1JL 4P2RE 3O8XD 2E7BA 4KRPD 3VFPB 4JR9L 1YC8A 4N9GB 4APQA 3AMLA 1I3RA 2R2HA 4QRSA 5IROC 4UTAH 1SBBA 2CDGA 1J8HE 2ZG1A 4QHUB 5JXEA 2WMPA 4K8RH 4NN7B 2PW2A 4JHZA 4H20H 2GEEA 3O6FA 2UWEB 1P7HL 4EOWH 1J8KA 2D9CA 4U33A 2NY2D 4ELMF 3CFDA 2P49B 2P5WD 5IFAL 1KPVB 4GW5A 3ZE2E 2HMIC 1GJIA 1MY7A 2KH2B 4LMQI 4F57L 1K4DB 4NQVA 2XZZA 2BSTA 3DVIA 3EDJA 1Q9LB 1CD1A 1I7TB 4NPYB 4J4PC 3BH9A 5C0BA 3MX0A 4NBXB 2UV3A 1OM3L 1BVLA 1F6FB 3DXAE 4N0RA 4J1UB 5DEZA 1S7TB 4OF6A 3FQTA 4YIQA 3LKSB 5FO7A 2Q6WB 3PV6A 1LQSR 1NEZB 1YNLH 2O5ZL 1P2CB 4I18B 5L8JB 3NPZB 3HE7D 4MDIB 3WFZA 3MOBL 2OI9B 2ATPA 2AJXH 3KYOA 4HLZH 4LVNB 4AL8L 3L1OL 3LH2H 3CMGA 1A3QA 4X6BA 1XGRA 5CCKL 3ARVA 3GBLA 2WBJC 1U8QA 5CEYB 1G9EA 1UB5A 1YEGH 4CN6A 2VDPH 2BY0A 4PJFF 4H0HB 3MLPA 5ILTH 4RDQF 1KJMB 3S37X 3OKOB 1TJGH 4HBCL 5F72S 3B9EA 4OGAD 5D7LE 1HSAB 1U0QA 2YPLB 1JWMB 3BGFB 3BT2H 2A74B 4AENA 4JY6A 3ARDD 4JQXA 3TNNB 2ZUQB 2VZVA 5DJZA 3MLWH 3ULVC 4HUNB 3BX7C 3QPXH 3SKJH 3ZLQC 1O7SA 2XZAL 4YDJA 3E2HC 4NFBA 3VG0H 1OW0C 1HHHB 5E99L 4BSWB 3PG2A 4GUPB 3KLHC 4L29B 1YZZA 4L3EA 4R7DA 4JFED 4ERSL 1H3VA 2QQQA 4U1KB 3RY5A 1ACYH 1E6OL 1OD7A 5IVOA 2DDQL 3BDXA 1LK3H 5C0RL 1QD0A 2W60A 4Z7UF 3MLYH 1UWGL 2NY1D 2J88H 3HN3A 4RRPG 4FP8L 4YDLC 5JXAH 1JE6A 4L4TB 5CLTA 4JZNA 3VD9A 3C60C 5DMIH 1D7FA 4NGHH 2DQDH 5D1XD 3VFWA 3TN0A 1FG2A 3K0WA 3QDME 2P8LA 3NFNB 3QJFA 4U3XA 4LGPB 1OP5H 4HH9B 4LGRB 2W1NA 3I9GL 1FNAA 4L3CA 2D7OA 5DS8B 1JFMA 3O4OC 5HHMA 3VFTA 4XNXH 4R8WL 1CE1L 2PTTA 4QRQB 1T04B 1IAKA 2I07A 5FM8A 1YEHH 2SEBB 1MFAL 4W6XB 1YEEH 4GKOA 5EZIH 3LKQA 4J12A 5CHNB 4WRLA 3ET9F 3OHXA 3WFEL 4YGVB 5JHLL 3QDGA 1H3WM 2NX5E 4AH2B 4PV9B 3V52H 4FXKB 2H2SD 4LAJH 3MGTA 4WFGE 1AD9B 3MCLL 4NCC1 3U46B 1U8NB 2NZIA 4XHJC 3MJ6A 3N85L 1OCWH 1P4BL 5EZJA 3HI1B 4Q74A 4E5XA 2F5BL 5DJ6A 3OR6A 4LIQH 4BYHA 4ESKA 3QCVH 3PHSA 2GFBA 3QH3A 1E6JL 4WUKL 2FHBA 4MMXC 5D71L 1B4RA 5F7EL 3ULVF 4BKLB 1EUUA 3L7EB 4OCSH 4GAYB 5LGHL 3RJDA 1RURH 4A6YL 3GKWH 2R1XA 1VA9A 1BD2E 3TVMD 3VCLB 5I66A 4X6CA 3RIFF 1W0VA 4PDCE 1GGIH 2H8PB 4TOYL 2MJWA 4EDXA 4XVJL 4RAUB 2VL5A 3F7YA 3HR5A 5DRNB 3S3JA 3W0WB 4WTZG 2ZCHL 1KJVB 5JOFB 1FL3A 3UPRA 1KLGB 5JW3L 1PDKA 4GH7B 4NJAL 4K94H 4PRDA 1K4CA 5HGBB 3MNWB 5J6GA 1Q9OB 2IH1B 5EBMA 2PYEB 3MPCA 3OKNB 4I3GA 5DA0B 1IGIL 4E41A 1WWBX 4HK3J 5E2UH 1OP5K 1OAUL 2DMCA 2DQUL 5ISZB 3MBED 3B9VA 3SKNA 1F2QA 3FB7B 4G6ML 4HS6A 1FE8H 1LP9A 5DD0L 1BQHB 2EDEA 2R2BA 3JV6A 4DGYH 4FQIL 3IU3B 5CJOL 2ADFL 2MQ3A 2YKLL 1A6WH 2E6PA 3MRPB 2NQCA 4PGDB 4BFBD 3UTZB 1A6UL 5HJ3B 4F7MB 2P8MB 1FSKB 3BJ91 3CZFA 5ACLA 5IMKB 3ZDXF 4FQQB 4ZTOH 2AKRB 1ED3B 1VESA 4QXTB 1MAMH 1EMTL 4LLQB 2BSED 3BDBA 3DGGB 4K7FB 3GSXA 4ZFOA 1OOAA 2VQTA 4DVBA 5I1DB 3H9SD 4P5TA 2IQ9H 4PRHD 4HGWB 2FD6L 4I0PD 1NFDE 3JV4A 3MR9A 4ZTPL 2W9DL 4ENEC 2YD6A 4OZHF 4TUJB 1IQWL 3RNKB 2OL3A 4G8GA 4PRPB 3SKMB 3B9KD 4EXKA 3H42L 2CRZA 1T1XB 4OLEA 5HD8C 1CQKA 1FPTL 2GUOB 5DRXA 3E6HB 5E5RB 5KSBE 1QSEB 4CADA 2Y6SC 3LRSB 1NDMA 1FO0H 5C86A 3QIUB 3S5LA 4JFDD 1MHPH 3VRLE 1LDPL 3PXJA 5IEKA 3TIDB 1C5BH 2JCCA 1UH2A 4I9WE 4JO3H 3RDTA 2XWTA 3K4ZA 3RUGE 4G7YL 4YHOH 1CXHA 2CR6A 2DQFA 5F6HJ 4UDUA 1MFBL 3V6OA 1F6AB 2M2DA 2ZKHL 3IFPB 3NFSH 4HKZA 3EZJB 1NBQA 3P0YL 5AUMB 4FQXD 3FN0L 4HW6A 3WDJA 1F42A 1N5AB 2DJ4A 5F1IB 4U1IB 1PBYA 1F11B 1KIPB 3TA3D 3NPSB 3VGGA 1X5IA 3PWVA 3MBXH 4P23A 1HSBB 4KTDH 4MSWA 1MOEA 4MYWB 5BMFH 2CGRL 35C8L 4NM8H 3NABL 3VXNA 1HIMH 4FQ1L 3PWJB 3MUJA 5FUZL 1CXLA 2VN7A 2WQRA 4GG8A 1LK2B 4GXUM 4ORGA 4JO1L 1JGVL 4JZJC 2NYYC 3ARQA 5H2BA 4Z0BL 2AXFA 3U6RB 1MCEA 2EDFA 3EW3B 5GISH 3MRCB 1JI1A 2CO6B 4KDTC 1CGXA 3HI6H 3WHE1 3QDAA 2Z93A 5IB2B 3UDWC 1FNSL 4R26H 5FA4B 5HYQB 1AE6H 1QNZL 2HJKA 1WT5A 3PQYE 1N2RB 5KVDL 2BX5A 3VFVB 4Z7VF 2WSKA 5INDB 5K9KB 1VFAA 4P2QD 3THML 1HILA 3VXUD 5E56A 3RQ3A 4OI8A 3FQWA 5ITFB 3ZDZE 4YE4H 2E9BA 5FYKE 4EUPH 3QEQA 1RIHH 4FXLA 4QYOB 2XQYK 5D7IE 1CGVA 4UMGA 3HZVA 2QSQA 2J3SA 3QEGH 3T0EB 3DUSB 4ONOA 4OCRL 3LKRA 4U1HB 1FYTB 4OD3H 1XIWA 1K9TA 2FBJH 2DD8L 5IT2H 1GOHA 5GGUA 1FORL 2C26A 4DKEH 3IJHA 3IJSA 3OR7B 5B39G 3GMNB 4IIQC 4L4VB 3L6FB 5INCB 2E7HA 1F8TH 4S0TD 1VADA 1T03H 1G9NC 4LLWA 1P6FA 4CN1A 3HRPA 3IDXH 3A6CL 4PJ8C 4WI3A 3AREA 3I85A 3WFDH 3MV7E 4LKXB 4MAYC 1J11A 3CFEA 3ZSSA 2EC9T 3VFGH 4Z76B 4U6XB 3WFHA 5D8JH 5T5FH 3TFKC 3UAJC 1AHWB 4E42A 2HT2D 3UTTB 4P2OD 3SBWA 3EBAA 1LO5B 4RCAA 4PJBB 5FCUL 1JHTB 1S3KL 4LARH 5E00A 1U3HA 4K3EH 4Q6IA 3N50A 4XVUD 4DAGH 1WIOA 1G6RH 3MRJA 1NUGA 1AI1H 1WIPA 1CQYA 3G04A 2H26A 4P9HH 3CXHK 2EE6A 3WNKA 3L3JA 1EGJA 4C58B 3NAAH 5JHDD 2FB4H 2A83B 2VZ3A 4QWWD 5EOTA 3IVKB 5A2IH 4R90H 5C09D 1MFNA 5E2VH 3T3ME 1OTTC 5FB8B 5HHOD 4PJGB 3G08A 1DQTA 2QQNL 5C0GA 5KVEL 5IBTL 4ZD3L 5IFHH 5BJTA 2XQBL 2IGFL 2AJ3A 2XTLA 1U93A 3QWOA 3LEXB 2NW3B 5HVHC 3LQZA 2VITB 5L2KD 3KLSA 2R0ZH 4P59L 1CF8L 2XNAB 3VI4E 1M05A 3TJEL 1YMME 3PGCA 5I17A 3MV11 3O9WB 4HC1H 4KK5D 4OLYH 4X83A 3IRZA 1MY5A 4M02A 5ICYB 2Z8VC 4KQ3H 4Z0XA 4LU5L 4D9QE 1WCBA 4BH7B 1ZT7A 2PXYC 3HS0A 3PDOA 3VWKB 1EFQA 4JFFE 1KOAA 4G8EB 2FYYB 2XZQL 2HVKA 3W9DA 2R2EA 1NEZG 3V7AE 2J6EL 4JDVB 1HQ4A 1IAIH 3SJVE 5CJQL 5EO0A 4PGBB 1YYLH 3D39E 1H3UA 2AJYL 2VLME 1KB5B 2WIMA 5BRZD 3UO1H 3IAQA 1FBIH 4HEPG 4YHYB 2BRQA 3BIBX 3QXTA 2CXGA 3ARFA 1UWXH 2J5LB 5KSAD 4JHAL 1MVFA 1CZ8L 3QQ3A 5DFTA 5ESAB 3TIEB 3FJTA 1OTUC 2YR3A 4HDIA 3G5VA 5FDWB 1FIGL 4C56E 5IESL 4ZAKB 5FHAH 2R23B 3QUYA 3INUL 1L0XA 4YZFE 3U0TA 2WLYA 3EJZC 1B0WA 3BQUB 1JTPA 4LCCB 1FYHB 5I8CA 2GSGB 1IBGL 3EDFA 3QQ9C 4OV5A 3AU1A 4HJJL 3F7QA 3UTPD 5F9WC 1KCKA 4HMEA 4MD0B 3VGEA 1SJHB 1QFPA 4NRZA 4DUWA 3K46A 1Q9KB 3C6SB 5F7DB 1I7UB 1A6ZB 1DE4A 3PWNB 4AIZB 3TBTB 3L3HA 1MJUL 1WBZA 4M48H 3BD5A 8FABB 4KTEH 3QIBA 5GGSY 4HS3B 2J8UB 1I1AB 4XB8A 2Z31C 2VMFA 1A7BA 3RVXD 4HUXA 4NZTL 3HCVB 4KK6C 4KH2A 4HUWA 4MXQD 4ELMB 1JJUA 4RFNC 2QSCL 5BW7A 4KPHL 1V3KA 1XGUA 1A8JH 2VXSH 3LPWA 4Y5YB 3LVEA 5TF1L 3HE6B 2M26A 4XVSH 5GZNC 4RIRB 5D1QA 2NZ9C 1BQLL 3SDCD 1X5YA 4UUJB 3ZZ1A 4PLJC 4HWBA 4HXBL 3TV3H 5FO8B 1NC4B 4M5YH 4MVBD 2E7LE 5EBLA 3K4DA 1NAMA 1RZJL 1ZWIB 1EFXB 1ZA6A 4M4PA 4LLMB 4LQFH 3VRIB 4M1CD 4UZGA 1NCBL 3DXAA 1I9IH 2XYCA 3HPLB 5CZXC 1FIEA 1FNGA 1I8MB 1A4KA 3FO9A 4KMQA 5C07D 4O5LL 5DJ0A 3U36A 3F5WA 1MREH 3H9HA 3VDAA 3AS1A 1TVBB 1ZLUK 1KIRB 2KZWA 2ICES 4J3TA 4I4WB 4XB7A 4XP4L 5CJBA 4BZ2H 1U95A 5IK3B 3DPBA 4POZD 5FHBL 3VFOA 3CLFH 4YWGH 3B5HA 2H6PB 4AM0B 1AQDB 3UEZA 2JE8A 2VISA 1INDH 1RUAL 3GIVB 1ZS8B 3QI9D 5D7LA 4NQEA 4JHWH 4JN1L 2OXHA 3ZT7A 4CUCA 4XAKE 4QLRA 2WUCH 4JG1L 5GGTA 4YFLF 4PJXE 5E9DB 1RU9H 3IS0X 3KPRD 1FAIH 2VDNL 2B39A 3M07A 3UXFA 2FJGB 2ED7A 1JNJA 2VLLA 5HPMB 3X11B 3WBDA 4Z7WA 3RIFK 1DLHA 1MIML 4M03A 3CMOH 3UTSE 5HGAB 4WW2F 1N7ML 4JFYA 3KXFB 5F7WC 5CBEA 4DN3H 1YPZA 5IVXE 2EYTB 4EI5C 4JFXB 2AABL 3BZFA 1NCWH 1HHJA 4GAJH 1A3LH 2YD9A 1HZHL 3BP6B 5I8OH 2NCMA 3VJ6B 4QRRB 1BVKA 3JBG7 5F97E 4IRSC 1G9MC 1WC7B 2X70B 5C71A 1ZVSB 3O45A 1UB6A 4MLIA 5I74B 1X9QA 5J57B 2IPKA 1A1NB 3OPZH 4WENB 4LASH 4X0KA 3CVHA 3PHOA 5LAXB 1BQHG 2BY2A 2JIXA 2AJSH 1QZ1A 3EO1A 5BZDA 5K9OB 2YK1H 3E1F1 4O00A 1MJ8L 1XR9B 3TZVD 3RPKA 4XH2B 3V0WH 2Y1VA 1P5VA 1QBLH 5IQ9B 1N64H 4HPYL 2VLKB 1CU4L 1WITA 4LLVA 4X6EA 2AI0H 1MI5D 1L7IH 1I1YB 1R5VB 2BFVH 3U7WH 1LO2L 3BP4A 3IB4A 3LIZH 3MRLB 3V0AC 4ZFFA 4UT7H 4JHBA 4WHYH 2W59A 2NX5A 5B39A 1N4XH 3GIZH 4BSVB 2HMID 1CG9A 4X6FA 2RFXA 1EDQA 3LKPA 1BVZA 5I75C 1TZHB 4G7VH 5GHWL 4J4PD 2BNQB 4NZDA 1W72H 5J1AB 1HCVA 5DJ2B 4LCIH 3Q6GL 3QDJD 4LNRB 1EEZA 1BD2A 1HEZB 3D2UA 5BS0A 2ERJB 2R0WL 4APQD 4OFYD 4UV7H 1EA9C 2F15A 5A3IC 5JXED 4Y4HA 3WCYA 3I6LE 1DN0B 2Q7NA 4GBXB 2CLZB 1A3RH 1QTYT 2ORBH 1QP1A 2V5RA 4HUKB 3O6FD 1RIUH 5CD3B 1DQQA 3NIDF 4NRXB 1MCQA 4Y2DA 5JIPA 4Z77B 4JRYA 4OCMC 4GT7A 5D5ME 5DVLA 1UKTA 2WBJD 5E4EC 3V9FA 5C0AA 4UINH 1RUPL 1S7QA 2RCSL 1KG0B 4XBPB 3QXVA 5B3NA 3IKKA 2I5YH 3U2SA 4K3JL 1GAFL 5C0BD 2DM7A 1I3GL 1UC6A 1UCBL 3QAZC 4HKBB 2XWJB 4MD4B 5HHQB 5GIRB 4OGXL 4D9RD 2IFFL 1FCCA 5FYJD 4EN3C 3BPNC 3IFOA 4RGOL 4AT6B 4N8VG 2GJ6E 4X7EC 3UYRL 2V5YA 1MCLA 1DUYB 3A6BL 1UACH 2KL6A 1A5FH 5DUML 2HRPH 3ES6B 1KENH 2IBZX 3BKJH 2UYLA 4M7LT 4WV1B 1XZ0B 3S3SA 2R8SL 3REWA 1KGCD 4DGIL 4HIEB 3EYVB 1EHNA 3HUJB 3BKCH 1PZUB 2XKUA 4GS7C 1OARH 1MCPL 1X5GA 2XTJB 5FGBC 4LLAA 1N5YH 4KJWC 1OWRM 3DHJA 5AZEH 5I0DA 1T0NA 1TQBB 3EOYG 5MEOB 4QOKE 5D7JA 4QRTB 2XZCH 1Z0NA 4R7NA 2QADC 5EWIH 1J88A 4YBHA 1OHQA 5I1JH 1TNMA 3MODL 5IB5B 1O7VA 3ECBA 1H0DB 3GSRA 4YEEA 1FNEA 1TETL 4U49A 1XR8A 3WMSA 4KJYB 2HFFA 4PY7B 3VI3F 4DQOL 5KSBA 4YXLH 4KKCD 3KVQA 4M9OA 4YDVA 4Y1AE 3FRPG 3CXDH 1DQJB 4F7CA 3BEWA 3V5DA 4UIKL 1I85C 5CUSH 4CBPA 1JMXA 1B88A 2HVJA 8CGTA 4PS4H 1PQZA 1CT8B 2YUVA 4V2BA 5ACZB 2RJMA 1KIQA 4G8FA 4RA0C 3SCMC 4J3SA 4NQTA 4ONHA 3KPQA 4JRXB 4QRPE 5D2NC 2VXVH 5DSCB 3RZCC 4H8WL 3TH4T 3VGAB 3I6GA 4NYLB 3KWWA 4O02L 3MLZH 3VXRD 3B4NA 5EIIB 5A16B 3TBYB 3M17B 5TDOA 1QPPA 3TO2B 3U0PA 1JIBA 4PJDF 1OVZA 3WSQH 4XHJD 5DQJA 5TJWK 2A38A 4FFWC 4LOUD 5HVWA 1JPFA 4HFUL 3QUKB 4MNGB 5TFSH 3RWHB 4EQ2A 2IFGA 1UXWA 2BSRB 3GI9H 3LSOB 3VXTA 3TN0D 3QFJB 1YJDL 5TQ2L 3BVNB 2EDLA 2DTMH 2EIBA 4ZPVA 1JUFA 2I9TA 1YC7A 5L9DL 3DURB 3VFRA 4KAQH 2ED9A 4OCXL 4R2GC 2G5BA 4I8DA 3OAYH 5HYSA 5E94A 5HHMD 4QHMB 3IAPA 3QXAA 4FTVD 1XF1A 4KMLB 3RVUC 4R0LA 1W72B 4TUOA 2B4CC 5GQBA 3V95A 3O8XB 1FGVH 4KRPB 3OJDA 3S37L 4F80A 3RKDC 4B7IA 1ZOXA 4OLWL 4ODSH 4HF5H 4AEHH 3K7UA 4M62L 4U6HB 3QDGD 4KKBC 1DTUA 2BSSB 1OGTB 1MPAH 4OFPA 3QXUA 3KR3H 1HKLL 4FFVD 5CSZB 1ZXQA 5D7IA 3RWJB 4LRIA 1X6NA 1GSMA 2IH3A 2NY2B 4ZFGH 3WFBH 1D5IH 2P5WB 4PGEB 2G9HA 1FV1A 4P57A 5MENB 5BVPL 5GRVK 1TZGH 3W2DH 2B1HH 3FO0H 5DLML 5T1LA 1E4WL 4NUJB 3QRGH 1FHGA 1P4IH 5CJXC 4GSDH 3B2UC 3VA6A 1JFQH 2XXMB 4GRWH 2VC2L 1FFPA 1IRAY 2DBLL 2HKFL 4U1SA 5T1MB 3K2UL 3EFDL 3WIFB 4JFQB 2XY1A 3TP4A 5FOBB 1U8KA 1VGEH 4PTUB 1E28B 2HT4C 1FVCB 5DUBB 3MV7A 4X8XA 5DQ9B 4K71B 1INQB 5DVKA 3HE7B 4Z78B 5C0EA 3MV9A 3EDDA 3VWJC 2WBKA 1KCVH 1NFDF 2DQGH 1NL0H 2C3GA 4X80H 2JLLA 1IM3B 3FO2B 3B8SA 1A9EB 3L3DB 1DUZB 2VR5A 2C1PA 1OTSC 1S78C 5HSFA 5AZ2L 5D1ZA 4YHNB 2A1WL 4X8JA 5J7CC 3BPCB 5TE4L 4OV6F 4Y4KA 1DFBH 3UPAA 1PSKL 5HDQL 3WO4C 4K23L 5C9KA 5C08E 3ZHDA 5IOPA 3NCJL 2Y6SD 2EYSA 1D5MB 2HKHL