1ZTDA

Hypothetical protein pfu-631545-001 from pyrococcus furiosus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
SEIDKGLAKFGDSLINFLYSLALTEFLGKPTGDRVPNASLAIALELTGLSKNLRRVDKHAKGDYAEALIAKAWLMGLISEREAVEIIKKNLYPEVLDFSKKKEAIGRALAPLLVIISERLYSSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein Pfu-631545-001
publication title Hypothetical Protein Pfu-631545-001 From Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 47
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11469 Ribonucleas_3_2 Ribonuclease III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.20 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease iii, N-terminal Endonuclease Domain; Chain A 1ztdA00
1ZTDA
chains in the Genus database with same CATH superfamily
2QVWA 3RV0A 1YYKA 3O2RA 3C4BA 4M2ZA 2NUGA 1O0WA 4M30A 2GSLA 2NUFA 1YYWA 1U61A 2EB1A 1YYOA 1YZ9A 1ZTDA 2A11A 1RC7A 2NUEA 3C4TA 3RV1A 2FFLA 4OOGC 1RC5A 2EZ6A 1JFZA 4OUNA 3N3WA 3O2RB 1I4SA
chains in the Genus database with same CATH topology
1ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTD A; 
#chains in the Genus database with same CATH topology
 2QVW A;  3RV0 A;  1YYK A;  3O2R A;  3C4B A;  4M2Z A;  2NUG A;  1O0W A;  4M30 A;  2GSL A;  2NUF A;  1YYW A;  1U61 A;  2EB1 A;  1YYO A;  1YZ9 A;  1ZTD A;  2A11 A;  1RC7 A;  2NUE A;  3C4T A;  3RV1 A;  2FFL A;  4OOG C;  1RC5 A;  2EZ6 A;  1JFZ A;  4OUN A;  3N3W A;  3O2R B;  1I4S A; 
#chains in the Genus database with same CATH homology
 1ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...