1ZTEA

Contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAHVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zteA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zteA02
1KKCA 1Y67A 1BT8A 3LSUA 1MSDA 1EN6A 1N0JA 2ADPA 3DC6A 1LUVA 1P7GA 4F6EA 1VEWA 1GN3A 1AVMA 3KKYA 1GN4A 5AG2A 2CE4A 1PL4A 2P4KA 1GN6A 4FFKA 1AP5A 3AK1A 3EVKA 1BS3A 3K9SA 2QKAA 1EN4A 4X9QA 1I08A 1IXBA 3AK2A 3IC9A 3RN4A 2GDSA 2AW9A 4JYYA 3MDSA 1ZTEA 2QKCA 3BFRA 4JZ2A 3CEIA 4JZGA 1D5NA 1IDSA 3C3TA 3OT7A 1PM9A 1MNGA 1JA8A 2RCVA 1N0NA 5A9GA 1QNMA 3C3SA 1EM1A 1AR5A 1EN5A 4GUNA 2CDYA 1WB8A 4YIPA 4E4EA 3DC5A 3AK3A 1B06A 1LUWA 1XUQA 2ADQB 1AR4A 1JR9A 4YIOA 1GN2A 1ZLZA 1ZUQA 1SZXA 4BR6A 3TJTA 1BSMA 1XILA 1MMMA 1I0HA 1WB7A 1MA1A 1XDCA 1ZSPA 3QVNA 1XREA 1AP6A 1VARA 4C7UA 1IX9A
chains in the Genus database with same CATH superfamily
2UUBB 2WLIB 2IBZH 5JQGA 1MSDA 3CRCA 3APQA 4JI5O 1Q6HA 3H9VA 1PKXA 3OEHG 4PV1B 2XNDG 4JI7B 1PNKA 5IYBO 1FS0G 4DR5B 4FLYA 3EHBB 4UVCA 1NR1A 1K9MW 2Z0AA 3LSSA 4E2LA 2JEUA 4CS2A 2EBOA 1DK1A 3G80A 4RWUA 2H94A 3T4DA 1F4MA 3VOUA 1TA8A 2BSKB 2DWEC 4FLVA 3ZN1A 4X1YB 3CYOA 1I08A 3ZIAG 3AK2A 1QR8A 2ZCEA 3I55V 4I0XB 1TUEB 3ZMZA 3ETQA 1CXZB 1YJNV 2W0XA 4NXMO 1RM1B 2QKCA 4PHZA 2ZE5A 4ZHQB 4JI6O 3E89A 2PTMA 3KCYA 3BAAA 3RGBA 3ZRWB 1FYJA 4K35A 2QM7A 3QG5A 4LFBO 2NNUA 1HW7A 4RQFA 5BR8O 2QDOA 4E4EA 4LF8B 1Z5WA 4BAYA 1E79G 1K97A 2P7TC 1FKAO 5LMNO 2E75B 1WAZA 1O9HA 1KB9F 3E2EA 4K8XA 3AG4B 3HPLC 2E74B 3AG3C 1I0HA 1FD9A 4JAAA 2QWOB 5LP6C 2YUAA 1S3JA 3ZHUA 4DR7B 2LP7A 2WLHA 2H3OA 4MTFA 2YICA 4JI1B 3JATA 2WLMA 1AP6A 3JSNA 4WFEA 4B3SB 1YHQV 1R3KC 5CBGA 4JPRA 1IX9A 2Q0AA 4JAVA 4DUYB 1GK9A 3RYHB 3VQVA 3CX5F 1KBHA 1AI5A 4DYLA 2JS3A 4JYAB 1WA8B 3AG2B 1IZ3A 4TV8B 3JALB 5LXTB 1QQCA 3GWKC 2F93B 1G6UA 2H8PC 3CB2A 2CE4A 4FZ1A 3K04A 4CH4A 1WLEA 2LFRA 4JI5B 3ZMVA 1B3QA 2JIZG 4DV2B 2D3OW 4H13B 4H0LB 1YSCA 2CK3G 1OCCB 2JGDB 2WWWA 3RN4A 1AJPA 1K73W 2DYSB 2N04A 2AW9A 3MHHC 4GX5A 2YSUB 2LQTA 2CAZC 2ITDC 1N36O 2QM4A 3BVOA 2JGUA 3SJAC 4B7KA 2HVJC 1YEWA 1MNGA 3M7MX 1I5YA 3FB7C 3HKBA 4YHHO 2W0FC 1R6NA 2YS8A 3WG7B 1AR5A 2OCCB 2QWQB 4PJ0Z 1OCRC 4O4HA 1JR9A 1QLEC 3K5MA 1YITV 1FXKB 1WP7A 4IHJB 3UQ8A 3HKDB 1XHZA 3RYIB 1VF6A 1JFFB 4UCRA 3ZHVA 3J80N 1Y76A 1RFYA 3N2KA 4HYOA 4WFFA 3CRQA 3QF7A 1KQSU 2Q8VA 5C93A 4I50B 5EYPA 1URFA 5JVDB 1Y67A 5LMNB 3OTOO 5DM6V 5L3GA 4DV0B 3JAMN 2FMLA 4LBEC 1IJGA 2UXDO 1XNRO 1BCCH 1COWG 5D5PA 2BCCH 3B8NA 5IYCO 3OUSA 3CMAV 4BIOA 4BW9A 3HB3B 3TETA 3Q4HA 3X2QC 2CTWA 2UXBB 2QTSA 4DW0A 2Y0PA 5B3SB 2WPDG 2F95B 5LOVA 3O65A 3UM7A 3J7AU 1YTFD 3CCLV 1UFIA 4O4IB 1AI4A 1VQKV 2R70A 4JI8O 1UJWB 2RNBA 3SYCA 3VQXA 2GHYA 1ZTEA 3K3WA 2GTSA 3CEIA 4DV5O 5IYZB 4P9PA 3U11A 1JA8A 2ZR3A 1WP8A 1VQ4V 1MOFA 4IYHA 2CDYA 4KUMA 3JARA 2ZDIA 3K5LA 2P90A 4GKKO 2Q9LA 1HDJA 4IIJA 4MVUA 1N36B 2BOCC 4ZOLA 1SZXA 2XAHA 5BY1A 4I5SA 1AROP 3SYPA 1R6TA 3B8MA 1P49A 5KHGA 3CPWU 3EXAA 5CA0A 5CB4A 3D36A 1RM1C 2HKOA 1NVPB 5J9PC 4Z1MG 3WFVA 2WLLB 4GKJO 2PYJA 2OT5A 1SA0B 2PYLA 2R9IA 1GAXA 4YJ3A 1XQ8A 1SQQH 2BTOA 1KD1W 2ADPA 4ICGA 1M56C 3ZS8C 3W7SA 1R73A 5JCOA 4K8ZA 4FLWA 2LFSA 1SETA 4LP8A 4UUJC 3SDLA 1AVMA 3KKYA 2JS5A 5L3EA 2W6JG 3O9OA 5KUMA 2HG5C 1VQMV 5KHJA 4F6RA 3AK1A 2UUCO 2LW7A 1FOUA 2CH7B 4WFGA 4JI2B 5KUKA 4LNUA 2XAQA 1Q6IA 4FLZA 4UCVA 2UXDB 4BIZA 1EN4A 4GLXA 4J11A 3B09A 4DXWA 1S5HC 4DR4O 1VQPV 3CC4V 3QO7A 4LWSB 2XTAA 1M1KW 4LFAB 4EB6A 1AI7A 4TUYA 3AG2C 4D7TA 3DSQA 1JJOA 2JDIG 2EIJB 3TCUA 1MSWD 2A79B 4JI8B 2BTQB 2IJJA 5LBQA 1IBLB 5LP6B 4F4LA 3GB7C 1US6A 5C8YB 4DV5B 4XDLA 5IJ9A 4EFEA 1Y4MA 4KXRA 2ZM6O 1DTOA 3SPCA 2HVKC 4CH6A 3AG7A 3J81N 5BMVA 2KKWA 1L0NH 4RUEA 1WB7A 1TVKA 2DYRB 4I4TB 3T1CA 4ZIBA 2NN4A 4GKKB 1IURA 2V1DA 1DGSA 5J2TB 4DV4O 2CUGA 5B66Z 2QA4V 1K4CC 1XOUA 2UUBO 2ZKOA 4B3MO 1GO3F 1XMQB 4W4LA 5B1AC 3WG7C 3DC6A 4N23A 2IM9A 1ORQC 4JYBA 3MD0A 4YJ2A 3CCRV 2Q4PA 4GT1A 5EBWC 2NR5A 3N2GA 4O4JB 3TXSA 2EJRA 4DO2A 4NB5A 2JEXA 5JCOC 1Y74A 3JASA 2QGNA 3L71H 1NKDA 4OPAA 1PNMA 2QM8A 2X6BA 5FL7G 4PA6A 3THOA 2OWOA 1MABG 4MVRA 3SPJA 2GDSA 2Q6AA 5BXZA 2OIEA 4DV3O 2YDEA 2FTKA 2Q68A 2UUCB 5CBFA 1VP7A 1RPRA 1D5NA 4CH5A 3L72H 4FVMA 3C3TA 3HKEA 1KUQA 3H1LH 4X1KA 5B5EZ 2Q67A 1QNMA 2OTLV 4DR4B 3SPGA 4LF8O 5DN6G 2ADQB 5KHKA 4NVPA 1MZEA 4WFBV 3MHSC 3CRMA 3W7UA 1ZLZA 2ZINA 3OR7C 5B1BC 4MW3A 2DQ0A 2ZXWB 5H6QA 4FK5C 3BA9A 1JPXA 1GKFA 4TOIA 1G1XB 4ASUG 2KSDA 4J9YB 1BHBA 3HR0A 5CN0A 3JATB 3JSLA 5ITZB 3RWRD 1NTMH 3LNNA 1SQFA 4MVSA 4DR7O 2IU0A 4DV7O 4LF9O 3F7YC 5J2UA 1SRYA 1NTKH 2Q0OC 2JJ1G 2ZM6B 4TV9B 5JJJB 1HNXO 1S76D 1R3IC 3X2QB 2E76B 5KA6A 3RYCA 1KYOF 4TWKA 4WF9V 4JTCB 5JH7A 4JYAO 3TXQA 4DV4B 1PL4A 1GN6A 4FFKA 1S5LZ 3BABA 3CCSV 4B3MB 1BS3A 3CRAA 3T4ZA 1N32B 1H38A 3CMEV 2ZIOA 3LUTB 4JAUA 1Q8IA 3K58A 3ML0A 5KLVH 5GONA 4DV2O 3ABLB 4QPJA 1XEQA 4UV9A 2ODMA 5EBMC 4UVAA 3CXCU 4LF7O 3CWBH 4GX0A 4B3RO 4I9QA 3DTUB 3ZX6A 4JV5O 4MVQA 4QGPA 3K57A 1P4RA 4R7CA 3LNMB 1HP8A 1IVSA 2KQXA 2ATKC 2F1MA 3H1IH 4MVOA 3L9DA 1V9PA 3R65A 2JRIA 1YCIA 1KKDA 1BL8A 4O4HB 3E22A 1K34A 1M90W 4DV3B 2LGWA 3E8HA 3A0RA 1Q81W 1EBOA 3C90A 1H2SB 5KX5B 4DW1A 3UT5A 1BQ0A 1NR7A 1J95A 2DE0X 3N2KB 1S77D 3OMNB 2P6JA 1M5IA 1MZFA 1PP9H 2EX3A 1S72V 1M56B 2YIDA 2QWRB 1I5XA 1U97A 1YIJV 4HNAB 1T5EA 2PI4A 5JJNB 4X66B 1N4CA 2UU9B 5GW7A 4GYCB 3T1HB 2EIJC 2F23A 1IBMO 2ZQMA 5L3FA 5FLXN 4OX9B 3E8GA 4JI3O 4UV8A 5LYJB 4DV0O 2XASA 3E35A 2E5LB 4NKGB 3KZIZ 3Q4HB 4DV7B 4LF9B 1IBKO 1Q7YW 4PA9A 3TGUH 1HNXB 1W59A 5LOVB 2UXBO 1BQZA 3HKCA 2B9ZA 1QU7A 4EFBA 1F7YA 2X0LA 1X4TA 2DYRC 4DV6B 3CD6V 4FFBA 1SERA 2OTJV 1FFTB 2A3QA 1BZKA 1Y6XA 4LF4B 4X9QA 3ASNB 1QHTA 1IXBA 4CBCA 4CC6A 1PD3A 1N8RW 2M7WA 4U7OA 4X1IB 1HR0B 4PELA 1GM8A 1OJHA 4OXSA 4O4LB 2CGNA 3OM3B 3FB8C 1AILA 4DR2B 4WBNA 3JAKA 4X62B 1ZWIC 2ZNIA 3A0BZ 3L74H 1SQPH 3JARB 5BZBA 3C3SA 4GUNA 1ZAUA 2IH1C 2R9AA 2K1EA 4LF7B 1XUQA 3KG2A 4B3RB 1AR4A 2WLNA 3A2FA 4JV5B 2DJVA 4ZOLB 1ZX3A 1B04A 1QLNA 3MAQA 1NJIW 4LH6A 2WLIA 4X89A 4PDVA 3L75H 4QE9A 3K03A 2QEXV 5LA6A 5CB4B 4AQYB 1R6KA 4TQFA 2PUSA 4Z1VA 3FAVA 5CA1A 1BMFG 3VQWA 5B1AB 1SKVA 2GBOA 4XDKA 4JYCA 2AZ2A 2JVDA 3WB1A 1BT8A 4QIWF 1N34B 1SQXH 1TGOA 4FM1A 1U96A 1NT2B 4UCUA 4NTXA 4X1YA 3S3WA 1D5AA 2A0LA 2HJDA 3IFXA 3QNEA 3H01A 1MG1A 4I9WA 5DECA 1M9NA 4F6RB 2XAJA 4QJFB 2F66C 2Y69B 1GM9A 1H2KA 1H2NA 4U3FH 2V4DA 2RMKB 2ZXWC 3K79A 1IBMB 4YY3O 5L3CA 2Y4UA 4JI3B 5JJEB 2PY5A 1M4UA 4JI2O 1VF5B 5GTHZ 1L8DA 4TSFG 5KHHA 4JF3A 1Q6UA 4KP4A 1IBKB 2ITCC 1VQ7V 3BA8A 3QO5A 3CCJV 1SQBH 4MS2A 5D5QA 5HFMA 2IH3C 4TUYB 2QJ1A 4LFAO 4JZ2A 1JVMA 3B77A 1R1BA 5KHIA 4PI0A 4O2AA 1LNQA 3KDRA 1YVWA 5B1BB 3UO2A 4BWAA 3SPIA 5FPOA 5IY5C 3FFQA 5F2VO 5FNVA 1IBLO 1SF9A 3JAWB 5LGTA 5BMVB 1XMOB 2Q5ZA 3ABLC 3ABMB 1VQLV 1GRJA 3A8TA 1BSMA 1MMMA 3ZRVA 2B5UA 1H5WA 4LF5B 4IT5A 3ABTA 2XAFA 4J7ZA 4KL1A 4TV8A 3JALA 5LXTA 4PA3A 1XREA 3K06A 2YI8A 4MTOA 5FPRA 1SQVH 1AB3A 1EFRG 2ZE6A 3L70H 2YXLA 2A06H 4JASA 5LMUO 4NXNO 4YJ2B 1NU1H 1XMQO 3OE7G 3CJHB 4CS4A 3N2GB 2VQFO 1OCZC 2VWKA 2JGDA 2Q69A 3JCZA 4HAMA 1VF6C 1Y74B 3JASB 1W2BU 2P4VA 3L73H 2XT9A 4W4KA 1P84F 1SESA 1CEZA 4DR1B 4I7ZB 3IGAC 2BE3A 4JI0O 2OIGA 3R66A 4J7JA 4O2BA 1FFXB 1SS3A 1ZL8A 2YEVA 3MDSA 2BOBC 4YY3B 2HFEC 3HKEB 4DRXA 1FXKA 1H8HG 4IHJA 1IDSA 2GV9A 3JD1A 4X1KB 3GVMA 5A2QN 3HKDA 3OT7A 1OCOC 3RYIA 3RT3C 3U0ZA 1RPOA 4FJCC 4PI2A 1JNBA 3OGCC 3DGEA 1HNZB 1THZA 1ENVA 4D6TH 5H9CA 3RFRA 4LFCO 3B4SA 1F51A 3ZHTA 1TUBA 1YXBA 5CMUA 5KMGA 1ZUQA 5JVDA 2EINB 3N27A 5EIBD 4J80A 3ASNC 1QVFU 1OV9A 4A5UB 1XILA 2KG7B 4DV1O 3DXRB 3RVYA 5IJ0A 2C2AA 4QPKA 2FL4A 4UXNA 1YJWV 2DQ3A 2YIBA 3BY6A 4DUZO 1K3EA 3RYCB 4DK1A 1N0JA 3K0DA 1Y66A 2ZDIC 4B7EA 1LUVA 5JH7B 3JD0A 1O9GA 2K9PA 2L35A 4ZI7A 2L6LA 4PA4A 2ETNA 4O4IA 4G27B 2B1IA 2VRZA 2LO1A 1GH6A 1G4YB 1OZ0A 4NR1A 3JD4A 3ZHSA 3CHXA 3P32A 5JQGB 1QR9A 1AP5A 1NI8A 2HHHB 3D36C 5LMUB 1FAFA 4NXNB 4B3TO 5GONB 1N32O 5EIBC 3K9SA 5L3BA 2XOKG 2VQFB 4I55A 3ZCCA 3IC9A 3OAAG 4FLUA 1OHHG 2JK5C 2WAMA 3D8CA 1H2GA 1DLBA 2DW4A 4J7KA 1F4NA 2F4VB 3ZN0A 2Y48A 4BIUA 4JI0B 1K7DA 4N21A 1M93A 3SGIA 3E22B 2DWDC 4WCEV 4R8CA 4X8AA 1EN5A 3FD9A 1VQ8V 1KP3A 2UXCB 1WB8A 1AR1B 2YI9A 3ZRXA 2Y69C 4EEQA 3ZBHA 1PPJH 4Q6GA 3UT5B 4UB6Z 2IU3A 4HZ3A 2RJZA 1K5QA 4NTYA 3S3XA 4BR6A 3QO8A 2X6AA 5IT9N 2QE7G 4L8JA 2PZSA 4LFCB 1SQGA 4XBFA 3QTCA 3D3QA 5E1AC 3WB2A 3LSUA 4UCSA 1EN6A 3GWOA 5H6RA 4X66O 2UU9O 3IAYA 3ABKB 3T1HO 3A0HZ 2Z3YA 4OX9O 1YI2V 3RYFA 1NVPD 4DV1B 5CA3A 3F7VC 2YXHA 3BEHA 3FYIB 3IJ4A 2E5LO 1H2LA 2UXNA 2N05A 1YZBA 3ABMC 3ZRSA 4DUZB 2B1GA 1B6QA 4H33A 4MTGA 2LGQA 2ZR2A 2GUZA 4FM2A 1G8MA 4DK0A 5LHGA 1K5SA 3P30A 2UUAB 2ZNJA 3CSXA 4NTWA 4DV6O 2ARHA 3M99B 2EULA 5IYDO 1N33B 4LF4O 4P9OA 2BTQA 3JD2A 1QCEA 2MW2B 2XHBA 1YJ9V 3AG1C 4H44B 3OD4A 2NLJC 1DF4A 1M57C 5LP6A 5IY5B 4X20A 1HR0O 1JX9A 5C8YA 4JZGA 4B3TB 2QWNB 3JAKB 4Z2WA 1PM9A 1K92A 1SZTA 4ABMA 4DR2O 4K0KB 4RAIA 5A9GA 4TT3G 4X62O 5EC1C 2XAGA 2WLJA 4FIPC 1JMKC 2G38A 2PI5A 2Z5UA 4FMTA 4EKWA 2HLDG 4D7SA 5LA6B 2R72A 3OUFA 1FPOA 5KAIZ 5DEDA 5LGUA 3HKBB 3FAVB 5CA1B 1XL4A 2HEPA 1MA1A 4X64O 4AQYO 3SJBC 3W7XA 3FX7A 3QVNA 2PF4E 4O4JA 1OCZB 4ZKIA 4JGSA 3E83A 1HNWB 3LDEA 2ZE7A 3BCCH 1QVGU 5K1XA 1N34O 1WNSA 2KB1A 1K33A 2QR4A 2FKXA 1Y76B 1KP2A 1P7GA 5EZYA 3OMIB 1WJZA 1GN3A 5B1OA 1YTFB 5EYPB 2EINC 4GZRB 4MT8A 1BGYH 2QSAA 3BRCA 3SJCC 2EIMB 4PDMA 1JJ2U 4R50A 2P5OA 4MSWC 4RQEA 4U3JA 3CP1A 4UB8Z 4Q20A 2WA4A 3RW0A 2Y0IA 1OCOB 3ZMUA 1V54B 4JYYA 5HFLA 1JQ0A 3CCMV 5K1PA 2VQEB 2JJ2G 4KFMA 1NQTA 5EK0A 2CTQA 4CH3A 1E1QG 4O2AB 5L3DA 1JCHA 2QWPB 1FXHA 3CS5A 1FJGB 3UO3A 5KAFZ 3I5DA 2P06A 4KHPO 4FM0A 2IW5A 5FNVB 1XHXA 2DMXA 5ITZA 3LSQA 3NR7A 5EC2C 3B2EE 1GN2A 4TV9A 4H37A 1XMOO 1AJNA 3CRRA 2EJ7A 3SJQC 4MVZA 2EIKC 3G71V 4LF5O 1GMGA 2EILB 3SR2C 4IIJB 2VWJA 3ZEDA 3IC7A 1WPBA 1V55B 3BHPA 3OMAB 1LR1A 1RSOA 1XI1A 1L0LH 1GM7A 1D2DA 1BE3H 2YXYA 4X64B 5CA0B 4IGGA 5E79Z 1F23A 2AXTZ 4FPPA 1K4DC 2GTAA 2VS0A 1W0JG 2LJ2A 3CE2A 2EZOA 4YJ3B 1NBMG 1EZJA 4DR1O 4O2BB 4XDJA 2W6IG 2BSKA 2V7QG 2GSMB 3T1YO 2RDCA 2YEVB 1ZL8B 5IE9A 1FXVA 1VF7A 1R3JC 4NXMB 4I0XA 4FZ0A 4DRXB 3JCUZ 3I56V 3ABKC 1PV0A 4DR3O 3OR6C 4JI6B 1Q43A 4L87A 2FB5A 5KX5A 1ROPA 4LNUB 2P22C 4ZHQA 3G6BA 4MW8A 4LFBB 3ZRWA 3SYQA 1N0NA 5BR8B 5LHIA 5CBHA 3BPZA 3ZMSA 1K8AW 1HNZO 2IJIA 1B06A 1TUBB 4LH7A 2Q73A 3FYEB 2AZ0A 5KMGB 3ASOB 4U7NA 3LDDA 2F43G 4J9ZB 4EB6B 2RQ6A 4HNAA 2D2CB 1PL0A 2Q7EA 3TJTA 3ETGA 2OCHA 1KECA 1HWYA 4KHPB 4UCTA 5LYJA 5IJ0B 1PNLA 4X65O 4ZBMA 3T2MA 4P30A 4G2KA 4NYKA 3VBBA 5IJ9B 2ZE8A 2IJKA 4C7UA 4TQDA 3D3IA 2AHZA 5LL6Y 2XUMA 1JOYA 2IJHA 4CZZA 4LCUC 4WFHA 4ZI7B 1TVKB 2ZD9A 3F5WC 3RYHA 1E1RG 1WA8A 2HP8A 4IYIA 2ZIMA 3CCUV 4PA7A 1GN4A 4LC1A 4X1IA 1Q82W 1GTOA 2OYQA 3AG1B 3ZHQA 1WN7A 3G4SV 4O4LA 1H2MA 3OW2U 1M57B 2HHHO 2PGGA 1WPXA 4I55B 1P7BA 4UFZA 1Q90D 4YXWG 2Q7GA 2X6CA 1NZ6A 2Y4TA 1L1FA 4J41A 4MVMA 4JTDB 2M6YA 3ICXA 2Q7HA 4HBNA 5LHHA 2UXXA 3NXSA 5H2FZ 4R6ZA 2O57A 1VQ6V 2F4VO 4YHHB 4RUFA 1XNQO 2RCVA 4JI4O 3T1YB 1Z2GA 5IDJA 4B08A 4YIPA 5JWPA 1S0VA 4GCZA 3AK3A 3W7TA 2EIMC 2UXCO 4AILC 4DR3B 1Z5VA 4G28B 1I7FA 3W7WA 3F5TA 3P3NA 1VQ5V 3SYOA 1JFFA 1V54C 2E3CA 4GX1A 4PDRA 3EFFK 3OTFA 3E8BA 3STZC 3OTOB 1NH2B 3VQYA 3AG4C 1KKCA 3K5NA 4I50A 2YIAA 3WB0A 2ZT9B 4JTAB 3RYFB 3U10A 1XNRB 5EBLC 4CS3A 3CCEV 4F6EA 4X65B 3CXHF 2DN9A 4IL6Z 3RBZA 1RP3B 3PN1A 1SC5B 3SYAA 5J2UB 5AG2A 4LF6O 2EZPA 2AHYA 1DF5A 2GUZB 3K0GA 3H1HH 3EVKA 1QBZA 3H1JH 1YF2A 3FB5C 3WU2Z 2CTRA 3CCQV 4OPHA 1I94O 2EILC 2UUAO 4GX2A 1UPGA 1V55C 3AG3B 2WA3A 1N33O 4CC5A 1Q3EA 5IWAO 4X20B 3BFRA 2ILMA 1W0KG 1A32A 2WSSG 3E8FA 3JAWA 1Q5OA 5GTIZ 1OCCC 3JD3A 4J42A 3SPHA 4AI8A 1NTZH 2QTOA 5IYZA 3FKSG 2DYSC 4QNHB 4LR3A 2QKSA 2YC0A 3ZJZA 4K0KO 3ZMTA 1VMGA 3OEEG 1LUWA 4DR6O 2A7WA 2EIKB 1VQOV 3E86A 1J5EO 4YIOA 5B1NA 1X59A 1KC8W 1S5JA 3M8AA 2AGAA 2OCCC 4OGQB 1XNQB 4JI4B 5H5NA 2YIBD 4PD4F 1BHAA 3CJHA 1XDCA 4JI7O 2P67A 1FXKC 4GKJB 1ZSPA 1VQ9V 3P3PA 4PDLA 4DR5O 3STLC 1VARA 3APOA 3KCXA 3AEIA 2WLLA 4BW5A 1Q86W 3CC2V 1SA0A 4FLTA 1HNWO 2N74A 5EZYB 3TK1A 4RO2A 3LDCA 2RN9A 3ASOC 1VEWA 3G67A 4MTXA 1FFXA 2A9HA 3ETDA 3G6EV 2P4KA 1YDXA 3JYCA 1OCRB 1IXMA 4J10A 4QE7A 3FB6C 3OGIB 4U3JB 1QLEB 5TISZ 3K5OA 2CH7A 1R3LC 2QKAA 4UCOA 1CP9A 1KMIZ 3PJSK 3K08A 5LGNA 5KA5A 4LF6B 5B3SC 3B40A 2HR3A 2FYUH 4P2ZA 4X88A 3ETEA 2VQEO 3HKCB 4LWSA 2DOSA 2R9RB 4WFAV 1VIBA 4FFBB 1I94B 1KU9A 4K3AA 1AI6A 2CTPA 3UKMA 1AJQA 3ZHRA 2MK3A 1FJGO 1EM1A 2CGOA 2KG7A 1VQNV 3DC5A 3DXRA 3K9AA 5IWAB 3UCSC 4JI1O 3H1KH 1XBLA 3ABUA 4B3SO 4AHCA 1NS1A 2X7RB 2LW1A 2HJFC 3K59A 1TAEA 1EZVH 4WBNB 4DUYO 1H8EG 4FLXA 4UVBA 3OFNG 3CC7V 1XL6A 1NH2D 1CPYA 2WLKA 4DR6B 4I4TA 3RVZA 3CCVV 1J5EB 1RSOB 5J2TA
chains in the Genus database with same CATH topology
1KKCA 1Y67A 1BT8A 3LSUA 1MSDA 1EN6A 1N0JA 2ADPA 3DC6A 1LUVA 1P7GA 4F6EA 1VEWA 1GN3A 1AVMA 3KKYA 1GN4A 5AG2A 2CE4A 1PL4A 2P4KA 1GN6A 4FFKA 1AP5A 3AK1A 3EVKA 1BS3A 3K9SA 2QKAA 1EN4A 4X9QA 1I08A 1IXBA 3AK2A 3IC9A 3RN4A 2GDSA 2AW9A 4JYYA 3MDSA 1ZTEA 2QKCA 3BFRA 4JZ2A 3CEIA 4JZGA 1D5NA 1IDSA 3C3TA 3OT7A 1PM9A 1MNGA 3KDRA 1JA8A 2RCVA 1N0NA 5A9GA 1QNMA 3C3SA 1EM1A 1AR5A 1EN5A 4GUNA 2CDYA 1WB8A 4YIPA 4E4EA 3DC5A 3AK3A 1B06A 1LUWA 1XUQA 2ADQB 1AR4A 1JR9A 4YIOA 1GN2A 1ZLZA 1ZUQA 1SZXA 4BR6A 3TJTA 1BSMA 1XILA 1MMMA 1I0HA 1WB7A 1MA1A 1XDCA 1ZSPA 3QVNA 1XREA 1AP6A 1VARA 4C7UA 1IX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKC A;  1Y67 A;  1BT8 A;  3LSU A;  1MSD A;  1EN6 A;  1N0J A;  2ADP A;  3DC6 A;  1LUV A;  1P7G A;  4F6E A;  1VEW A;  1GN3 A;  1AVM A;  3KKY A;  1GN4 A;  5AG2 A;  2CE4 A;  1PL4 A;  2P4K A;  1GN6 A;  4FFK A;  1AP5 A;  3AK1 A;  3EVK A;  1BS3 A;  3K9S A;  2QKA A;  1EN4 A;  4X9Q A;  1I08 A;  1IXB A;  3AK2 A;  3IC9 A;  3RN4 A;  2GDS A;  2AW9 A;  4JYY A;  3MDS A;  1ZTE A;  2QKC A;  3BFR A;  4JZ2 A;  3CEI A;  4JZG A;  1D5N A;  1IDS A;  3C3T A;  3OT7 A;  1PM9 A;  1MNG A;  1JA8 A;  2RCV A;  1N0N A;  5A9G A;  1QNM A;  3C3S A;  1EM1 A;  1AR5 A;  1EN5 A;  4GUN A;  2CDY A;  1WB8 A;  4YIP A;  4E4E A;  3DC5 A;  3AK3 A;  1B06 A;  1LUW A;  1XUQ A;  2ADQ B;  1AR4 A;  1JR9 A;  4YIO A;  1GN2 A;  1ZLZ A;  1ZUQ A;  1SZX A;  4BR6 A;  3TJT A;  1BSM A;  1XIL A;  1MMM A;  1I0H A;  1WB7 A;  1MA1 A;  1XDC A;  1ZSP A;  3QVN A;  1XRE A;  1AP6 A;  1VAR A;  4C7U A;  1IX9 A; 
#chains in the Genus database with same CATH topology
 2UUB B;  2WLI B;  2IBZ H;  5JQG A;  1MSD A;  3CRC A;  3APQ A;  4JI5 O;  1Q6H A;  3H9V A;  1PKX A;  3OEH G;  4PV1 B;  2XND G;  4JI7 B;  1PNK A;  5IYB O;  1FS0 G;  4DR5 B;  4FLY A;  3EHB B;  4UVC A;  1NR1 A;  1K9M W;  2Z0A A;  3LSS A;  4E2L A;  2JEU A;  4CS2 A;  2EBO A;  1DK1 A;  3G80 A;  4RWU A;  2H94 A;  3T4D A;  1F4M A;  3VOU A;  1TA8 A;  2BSK B;  2DWE C;  4FLV A;  3ZN1 A;  4X1Y B;  3CYO A;  1I08 A;  3ZIA G;  3AK2 A;  1QR8 A;  2ZCE A;  3I55 V;  4I0X B;  1TUE B;  3ZMZ A;  3ETQ A;  1CXZ B;  1YJN V;  2W0X A;  4NXM O;  1RM1 B;  2QKC A;  4PHZ A;  2ZE5 A;  4ZHQ B;  4JI6 O;  3E89 A;  2PTM A;  3KCY A;  3BAA A;  3RGB A;  3ZRW B;  1FYJ A;  4K35 A;  2QM7 A;  3QG5 A;  4LFB O;  2NNU A;  1HW7 A;  4RQF A;  5BR8 O;  2QDO A;  4E4E A;  4LF8 B;  1Z5W A;  4BAY A;  1E79 G;  1K97 A;  2P7T C;  1FKA O;  5LMN O;  2E75 B;  1WAZ A;  1O9H A;  1KB9 F;  3E2E A;  4K8X A;  3AG4 B;  3HPL C;  2E74 B;  3AG3 C;  1I0H A;  1FD9 A;  4JAA A;  2QWO B;  5LP6 C;  2YUA A;  1S3J A;  3ZHU A;  4DR7 B;  2LP7 A;  2WLH A;  2H3O A;  4MTF A;  2YIC A;  4JI1 B;  3JAT A;  2WLM A;  1AP6 A;  3JSN A;  4WFE A;  4B3S B;  1YHQ V;  1R3K C;  5CBG A;  4JPR A;  1IX9 A;  2Q0A A;  4JAV A;  4DUY B;  1GK9 A;  3RYH B;  3VQV A;  3CX5 F;  1KBH A;  1AI5 A;  4DYL A;  2JS3 A;  4JYA B;  1WA8 B;  3AG2 B;  1IZ3 A;  4TV8 B;  3JAL B;  5LXT B;  1QQC A;  3GWK C;  2F93 B;  1G6U A;  2H8P C;  3CB2 A;  2CE4 A;  4FZ1 A;  3K04 A;  4CH4 A;  1WLE A;  2LFR A;  4JI5 B;  3ZMV A;  1B3Q A;  2JIZ G;  4DV2 B;  2D3O W;  4H13 B;  4H0L B;  1YSC A;  2CK3 G;  1OCC B;  2JGD B;  2WWW A;  3RN4 A;  1AJP A;  1K73 W;  2DYS B;  2N04 A;  2AW9 A;  3MHH C;  4GX5 A;  2YSU B;  2LQT A;  2CAZ C;  2ITD C;  1N36 O;  2QM4 A;  3BVO A;  2JGU A;  3SJA C;  4B7K A;  2HVJ C;  1YEW A;  1MNG A;  3M7M X;  1I5Y A;  3FB7 C;  3HKB A;  4YHH O;  2W0F C;  1R6N A;  2YS8 A;  3WG7 B;  1AR5 A;  2OCC B;  2QWQ B;  4PJ0 Z;  1OCR C;  4O4H A;  1JR9 A;  1QLE C;  3K5M A;  1YIT V;  1FXK B;  1WP7 A;  4IHJ B;  3UQ8 A;  3HKD B;  1XHZ A;  3RYI B;  1VF6 A;  1JFF B;  4UCR A;  3ZHV A;  3J80 N;  1Y76 A;  1RFY A;  3N2K A;  4HYO A;  4WFF A;  3CRQ A;  3QF7 A;  1KQS U;  2Q8V A;  5C93 A;  4I50 B;  5EYP A;  1URF A;  5JVD B;  1Y67 A;  5LMN B;  3OTO O;  5DM6 V;  5L3G A;  4DV0 B;  3JAM N;  2FML A;  4LBE C;  1IJG A;  2UXD O;  1XNR O;  1BCC H;  1COW G;  5D5P A;  2BCC H;  3B8N A;  5IYC O;  3OUS A;  3CMA V;  4BIO A;  4BW9 A;  3HB3 B;  3TET A;  3Q4H A;  3X2Q C;  2CTW A;  2UXB B;  2QTS A;  4DW0 A;  2Y0P A;  5B3S B;  2WPD G;  2F95 B;  5LOV A;  3O65 A;  3UM7 A;  3J7A U;  1YTF D;  3CCL V;  1UFI A;  4O4I B;  1AI4 A;  1VQK V;  2R70 A;  4JI8 O;  1UJW B;  2RNB A;  3SYC A;  3VQX A;  2GHY A;  1ZTE A;  3K3W A;  2GTS A;  3CEI A;  4DV5 O;  5IYZ B;  4P9P A;  3U11 A;  1JA8 A;  2ZR3 A;  1WP8 A;  1VQ4 V;  1MOF A;  4IYH A;  2CDY A;  4KUM A;  3JAR A;  2ZDI A;  3K5L A;  2P90 A;  4GKK O;  2Q9L A;  1HDJ A;  4IIJ A;  4MVU A;  1N36 B;  2BOC C;  4ZOL A;  1SZX A;  2XAH A;  5BY1 A;  4I5S A;  1ARO P;  3SYP A;  1R6T A;  3B8M A;  1P49 A;  5KHG A;  3CPW U;  3EXA A;  5CA0 A;  5CB4 A;  3D36 A;  1RM1 C;  2HKO A;  1NVP B;  5J9P C;  4Z1M G;  3WFV A;  2WLL B;  4GKJ O;  2PYJ A;  2OT5 A;  1SA0 B;  2PYL A;  2R9I A;  1GAX A;  4YJ3 A;  1XQ8 A;  1SQQ H;  2BTO A;  1KD1 W;  2ADP A;  4ICG A;  1M56 C;  3ZS8 C;  3W7S A;  1R73 A;  5JCO A;  4K8Z A;  4FLW A;  2LFS A;  1SET A;  4LP8 A;  4UUJ C;  3SDL A;  1AVM A;  3KKY A;  2JS5 A;  5L3E A;  2W6J G;  3O9O A;  5KUM A;  2HG5 C;  1VQM V;  5KHJ A;  4F6R A;  3AK1 A;  2UUC O;  2LW7 A;  1FOU A;  2CH7 B;  4WFG A;  4JI2 B;  5KUK A;  4LNU A;  2XAQ A;  1Q6I A;  4FLZ A;  4UCV A;  2UXD B;  4BIZ A;  1EN4 A;  4GLX A;  4J11 A;  3B09 A;  4DXW A;  1S5H C;  4DR4 O;  1VQP V;  3CC4 V;  3QO7 A;  4LWS B;  2XTA A;  1M1K W;  4LFA B;  4EB6 A;  1AI7 A;  4TUY A;  3AG2 C;  4D7T A;  3DSQ A;  1JJO A;  2JDI G;  2EIJ B;  3TCU A;  1MSW D;  2A79 B;  4JI8 B;  2BTQ B;  2IJJ A;  5LBQ A;  1IBL B;  5LP6 B;  4F4L A;  3GB7 C;  1US6 A;  5C8Y B;  4DV5 B;  4XDL A;  5IJ9 A;  4EFE A;  1Y4M A;  4KXR A;  2ZM6 O;  1DTO A;  3SPC A;  2HVK C;  4CH6 A;  3AG7 A;  3J81 N;  5BMV A;  2KKW A;  1L0N H;  4RUE A;  1WB7 A;  1TVK A;  2DYR B;  4I4T B;  3T1C A;  4ZIB A;  2NN4 A;  4GKK B;  1IUR A;  2V1D A;  1DGS A;  5J2T B;  4DV4 O;  2CUG A;  5B66 Z;  2QA4 V;  1K4C C;  1XOU A;  2UUB O;  2ZKO A;  4B3M O;  1GO3 F;  1XMQ B;  4W4L A;  5B1A C;  3WG7 C;  3DC6 A;  4N23 A;  2IM9 A;  1ORQ C;  4JYB A;  3MD0 A;  4YJ2 A;  3CCR V;  2Q4P A;  4GT1 A;  5EBW C;  2NR5 A;  3N2G A;  4O4J B;  3TXS A;  2EJR A;  4DO2 A;  4NB5 A;  2JEX A;  5JCO C;  1Y74 A;  3JAS A;  2QGN A;  3L71 H;  1NKD A;  4OPA A;  1PNM A;  2QM8 A;  2X6B A;  5FL7 G;  4PA6 A;  3THO A;  2OWO A;  1MAB G;  4MVR A;  3SPJ A;  2GDS A;  2Q6A A;  5BXZ A;  2OIE A;  4DV3 O;  2YDE A;  2FTK A;  2Q68 A;  2UUC B;  5CBF A;  1VP7 A;  1RPR A;  1D5N A;  4CH5 A;  3L72 H;  4FVM A;  3C3T A;  3HKE A;  1KUQ A;  3H1L H;  4X1K A;  5B5E Z;  2Q67 A;  1QNM A;  2OTL V;  4DR4 B;  3SPG A;  4LF8 O;  5DN6 G;  2ADQ B;  5KHK A;  4NVP A;  1MZE A;  4WFB V;  3MHS C;  3CRM A;  3W7U A;  1ZLZ A;  2ZIN A;  3OR7 C;  5B1B C;  4MW3 A;  2DQ0 A;  2ZXW B;  5H6Q A;  4FK5 C;  3BA9 A;  1JPX A;  1GKF A;  4TOI A;  1G1X B;  4ASU G;  2KSD A;  4J9Y B;  1BHB A;  3HR0 A;  5CN0 A;  3JAT B;  3JSL A;  5ITZ B;  3RWR D;  1NTM H;  3LNN A;  1SQF A;  4MVS A;  4DR7 O;  2IU0 A;  4DV7 O;  4LF9 O;  3F7Y C;  5J2U A;  1SRY A;  1NTK H;  2Q0O C;  2JJ1 G;  2ZM6 B;  4TV9 B;  5JJJ B;  1HNX O;  1S76 D;  1R3I C;  3X2Q B;  2E76 B;  5KA6 A;  3RYC A;  1KYO F;  4TWK A;  4WF9 V;  4JTC B;  5JH7 A;  4JYA O;  3TXQ A;  4DV4 B;  1PL4 A;  1GN6 A;  4FFK A;  1S5L Z;  3BAB A;  3CCS V;  4B3M B;  1BS3 A;  3CRA A;  3T4Z A;  1N32 B;  1H38 A;  3CME V;  2ZIO A;  3LUT B;  4JAU A;  1Q8I A;  3K58 A;  3ML0 A;  5KLV H;  5GON A;  4DV2 O;  3ABL B;  4QPJ A;  1XEQ A;  4UV9 A;  2ODM A;  5EBM C;  4UVA A;  3CXC U;  4LF7 O;  3CWB H;  4GX0 A;  4B3R O;  4I9Q A;  3DTU B;  3ZX6 A;  4JV5 O;  4MVQ A;  4QGP A;  3K57 A;  1P4R A;  4R7C A;  3LNM B;  1HP8 A;  1IVS A;  2KQX A;  2ATK C;  2F1M A;  3H1I H;  4MVO A;  3L9D A;  1V9P A;  3R65 A;  2JRI A;  1YCI A;  1KKD A;  1BL8 A;  4O4H B;  3E22 A;  1K34 A;  1M90 W;  4DV3 B;  2LGW A;  3E8H A;  3A0R A;  1Q81 W;  1EBO A;  3C90 A;  1H2S B;  5KX5 B;  4DW1 A;  3UT5 A;  1BQ0 A;  1NR7 A;  1J95 A;  2DE0 X;  3N2K B;  1S77 D;  3OMN B;  2P6J A;  1M5I A;  1MZF A;  1PP9 H;  2EX3 A;  1S72 V;  1M56 B;  2YID A;  2QWR B;  1I5X A;  1U97 A;  1YIJ V;  4HNA B;  1T5E A;  2PI4 A;  5JJN B;  4X66 B;  1N4C A;  2UU9 B;  5GW7 A;  4GYC B;  3T1H B;  2EIJ C;  2F23 A;  1IBM O;  2ZQM A;  5L3F A;  5FLX N;  4OX9 B;  3E8G A;  4JI3 O;  4UV8 A;  5LYJ B;  4DV0 O;  2XAS A;  3E35 A;  2E5L B;  4NKG B;  3KZI Z;  3Q4H B;  4DV7 B;  4LF9 B;  1IBK O;  1Q7Y W;  4PA9 A;  3TGU H;  1HNX B;  1W59 A;  5LOV B;  2UXB O;  1BQZ A;  3HKC A;  2B9Z A;  1QU7 A;  4EFB A;  1F7Y A;  2X0L A;  1X4T A;  2DYR C;  4DV6 B;  3CD6 V;  4FFB A;  1SER A;  2OTJ V;  1FFT B;  2A3Q A;  1BZK A;  1Y6X A;  4LF4 B;  4X9Q A;  3ASN B;  1QHT A;  1IXB A;  4CBC A;  4CC6 A;  1PD3 A;  1N8R W;  2M7W A;  4U7O A;  4X1I B;  1HR0 B;  4PEL A;  1GM8 A;  1OJH A;  4OXS A;  4O4L B;  2CGN A;  3OM3 B;  3FB8 C;  1AIL A;  4DR2 B;  4WBN A;  3JAK A;  4X62 B;  1ZWI C;  2ZNI A;  3A0B Z;  3L74 H;  1SQP H;  3JAR B;  5BZB A;  3C3S A;  4GUN A;  1ZAU A;  2IH1 C;  2R9A A;  2K1E A;  4LF7 B;  1XUQ A;  3KG2 A;  4B3R B;  1AR4 A;  2WLN A;  3A2F A;  4JV5 B;  2DJV A;  4ZOL B;  1ZX3 A;  1B04 A;  1QLN A;  3MAQ A;  1NJI W;  4LH6 A;  2WLI A;  4X89 A;  4PDV A;  3L75 H;  4QE9 A;  3K03 A;  2QEX V;  5LA6 A;  5CB4 B;  4AQY B;  1R6K A;  4TQF A;  2PUS A;  4Z1V A;  3FAV A;  5CA1 A;  1BMF G;  3VQW A;  5B1A B;  1SKV A;  2GBO A;  4XDK A;  4JYC A;  2AZ2 A;  2JVD A;  3WB1 A;  1BT8 A;  4QIW F;  1N34 B;  1SQX H;  1TGO A;  4FM1 A;  1U96 A;  1NT2 B;  4UCU A;  4NTX A;  4X1Y A;  3S3W A;  1D5A A;  2A0L A;  2HJD A;  3IFX A;  3QNE A;  3H01 A;  1MG1 A;  4I9W A;  5DEC A;  1M9N A;  4F6R B;  2XAJ A;  4QJF B;  2F66 C;  2Y69 B;  1GM9 A;  1H2K A;  1H2N A;  4U3F H;  2V4D A;  2RMK B;  2ZXW C;  3K79 A;  1IBM B;  4YY3 O;  5L3C A;  2Y4U A;  4JI3 B;  5JJE B;  2PY5 A;  1M4U A;  4JI2 O;  1VF5 B;  5GTH Z;  1L8D A;  4TSF G;  5KHH A;  4JF3 A;  1Q6U A;  4KP4 A;  1IBK B;  2ITC C;  1VQ7 V;  3BA8 A;  3QO5 A;  3CCJ V;  1SQB H;  4MS2 A;  5D5Q A;  5HFM A;  2IH3 C;  4TUY B;  2QJ1 A;  4LFA O;  4JZ2 A;  1JVM A;  3B77 A;  1R1B A;  5KHI A;  4PI0 A;  4O2A A;  1LNQ A;  3KDR A;  1YVW A;  5B1B B;  3UO2 A;  4BWA A;  3SPI A;  5FPO A;  5IY5 C;  3FFQ A;  5F2V O;  5FNV A;  1IBL O;  1SF9 A;  3JAW B;  5LGT A;  5BMV B;  1XMO B;  2Q5Z A;  3ABL C;  3ABM B;  1VQL V;  1GRJ A;  3A8T A;  1BSM A;  1MMM A;  3ZRV A;  2B5U A;  1H5W A;  4LF5 B;  4IT5 A;  3ABT A;  2XAF A;  4J7Z A;  4KL1 A;  4TV8 A;  3JAL A;  5LXT A;  4PA3 A;  1XRE A;  3K06 A;  2YI8 A;  4MTO A;  5FPR A;  1SQV H;  1AB3 A;  1EFR G;  2ZE6 A;  3L70 H;  2YXL A;  2A06 H;  4JAS A;  5LMU O;  4NXN O;  4YJ2 B;  1NU1 H;  1XMQ O;  3OE7 G;  3CJH B;  4CS4 A;  3N2G B;  2VQF O;  1OCZ C;  2VWK A;  2JGD A;  2Q69 A;  3JCZ A;  4HAM A;  1VF6 C;  1Y74 B;  3JAS B;  1W2B U;  2P4V A;  3L73 H;  2XT9 A;  4W4K A;  1P84 F;  1SES A;  1CEZ A;  4DR1 B;  4I7Z B;  3IGA C;  2BE3 A;  4JI0 O;  2OIG A;  3R66 A;  4J7J A;  4O2B A;  1FFX B;  1SS3 A;  1ZL8 A;  2YEV A;  3MDS A;  2BOB C;  4YY3 B;  2HFE C;  3HKE B;  4DRX A;  1FXK A;  1H8H G;  4IHJ A;  1IDS A;  2GV9 A;  3JD1 A;  4X1K B;  3GVM A;  5A2Q N;  3HKD A;  3OT7 A;  1OCO C;  3RYI A;  3RT3 C;  3U0Z A;  1RPO A;  4FJC C;  4PI2 A;  1JNB A;  3OGC C;  3DGE A;  1HNZ B;  1THZ A;  1ENV A;  4D6T H;  5H9C A;  3RFR A;  4LFC O;  3B4S A;  1F51 A;  3ZHT A;  1TUB A;  1YXB A;  5CMU A;  5KMG A;  1ZUQ A;  5JVD A;  2EIN B;  3N27 A;  5EIB D;  4J80 A;  3ASN C;  1QVF U;  1OV9 A;  4A5U B;  1XIL A;  2KG7 B;  4DV1 O;  3DXR B;  3RVY A;  5IJ0 A;  2C2A A;  4QPK A;  2FL4 A;  4UXN A;  1YJW V;  2DQ3 A;  2YIB A;  3BY6 A;  4DUZ O;  1K3E A;  3RYC B;  4DK1 A;  1N0J A;  3K0D A;  1Y66 A;  2ZDI C;  4B7E A;  1LUV A;  5JH7 B;  3JD0 A;  1O9G A;  2K9P A;  2L35 A;  4ZI7 A;  2L6L A;  4PA4 A;  2ETN A;  4O4I A;  4G27 B;  2B1I A;  2VRZ A;  2LO1 A;  1GH6 A;  1G4Y B;  1OZ0 A;  4NR1 A;  3JD4 A;  3ZHS A;  3CHX A;  3P32 A;  5JQG B;  1QR9 A;  1AP5 A;  1NI8 A;  2HHH B;  3D36 C;  5LMU B;  1FAF A;  4NXN B;  4B3T O;  5GON B;  1N32 O;  5EIB C;  3K9S A;  5L3B A;  2XOK G;  2VQF B;  4I55 A;  3ZCC A;  3IC9 A;  3OAA G;  4FLU A;  1OHH G;  2JK5 C;  2WAM A;  3D8C A;  1H2G A;  1DLB A;  2DW4 A;  4J7K A;  1F4N A;  2F4V B;  3ZN0 A;  2Y48 A;  4BIU A;  4JI0 B;  1K7D A;  4N21 A;  1M93 A;  3SGI A;  3E22 B;  2DWD C;  4WCE V;  4R8C A;  4X8A A;  1EN5 A;  3FD9 A;  1VQ8 V;  1KP3 A;  2UXC B;  1WB8 A;  1AR1 B;  2YI9 A;  3ZRX A;  2Y69 C;  4EEQ A;  3ZBH A;  1PPJ H;  4Q6G A;  3UT5 B;  4UB6 Z;  2IU3 A;  4HZ3 A;  2RJZ A;  1K5Q A;  4NTY A;  3S3X A;  4BR6 A;  3QO8 A;  2X6A A;  5IT9 N;  2QE7 G;  4L8J A;  2PZS A;  4LFC B;  1SQG A;  4XBF A;  3QTC A;  3D3Q A;  5E1A C;  3WB2 A;  3LSU A;  4UCS A;  1EN6 A;  3GWO A;  5H6R A;  4X66 O;  2UU9 O;  3IAY A;  3ABK B;  3T1H O;  3A0H Z;  2Z3Y A;  4OX9 O;  1YI2 V;  3RYF A;  1NVP D;  4DV1 B;  5CA3 A;  3F7V C;  2YXH A;  3BEH A;  3FYI B;  3IJ4 A;  2E5L O;  1H2L A;  2UXN A;  2N05 A;  1YZB A;  3ABM C;  3ZRS A;  4DUZ B;  2B1G A;  1B6Q A;  4H33 A;  4MTG A;  2LGQ A;  2ZR2 A;  2GUZ A;  4FM2 A;  1G8M A;  4DK0 A;  5LHG A;  1K5S A;  3P30 A;  2UUA B;  2ZNJ A;  3CSX A;  4NTW A;  4DV6 O;  2ARH A;  3M99 B;  2EUL A;  5IYD O;  1N33 B;  4LF4 O;  4P9O A;  2BTQ A;  3JD2 A;  1QCE A;  2MW2 B;  2XHB A;  1YJ9 V;  3AG1 C;  4H44 B;  3OD4 A;  2NLJ C;  1DF4 A;  1M57 C;  5LP6 A;  5IY5 B;  4X20 A;  1HR0 O;  1JX9 A;  5C8Y A;  4JZG A;  4B3T B;  2QWN B;  3JAK B;  4Z2W A;  1PM9 A;  1K92 A;  1SZT A;  4ABM A;  4DR2 O;  4K0K B;  4RAI A;  5A9G A;  4TT3 G;  4X62 O;  5EC1 C;  2XAG A;  2WLJ A;  4FIP C;  1JMK C;  2G38 A;  2PI5 A;  2Z5U A;  4FMT A;  4EKW A;  2HLD G;  4D7S A;  5LA6 B;  2R72 A;  3OUF A;  1FPO A;  5KAI Z;  5DED A;  5LGU A;  3HKB B;  3FAV B;  5CA1 B;  1XL4 A;  2HEP A;  1MA1 A;  4X64 O;  4AQY O;  3SJB C;  3W7X A;  3FX7 A;  3QVN A;  2PF4 E;  4O4J A;  1OCZ B;  4ZKI A;  4JGS A;  3E83 A;  1HNW B;  3LDE A;  2ZE7 A;  3BCC H;  1QVG U;  5K1X A;  1N34 O;  1WNS A;  2KB1 A;  1K33 A;  2QR4 A;  2FKX A;  1Y76 B;  1KP2 A;  1P7G A;  5EZY A;  3OMI B;  1WJZ A;  1GN3 A;  5B1O A;  1YTF B;  5EYP B;  2EIN C;  4GZR B;  4MT8 A;  1BGY H;  2QSA A;  3BRC A;  3SJC C;  2EIM B;  4PDM A;  1JJ2 U;  4R50 A;  2P5O A;  4MSW C;  4RQE A;  4U3J A;  3CP1 A;  4UB8 Z;  4Q20 A;  2WA4 A;  3RW0 A;  2Y0I A;  1OCO B;  3ZMU A;  1V54 B;  4JYY A;  5HFL A;  1JQ0 A;  3CCM V;  5K1P A;  2VQE B;  2JJ2 G;  4KFM A;  1NQT A;  5EK0 A;  2CTQ A;  4CH3 A;  1E1Q G;  4O2A B;  5L3D A;  1JCH A;  2QWP B;  1FXH A;  3CS5 A;  1FJG B;  3UO3 A;  5KAF Z;  3I5D A;  2P06 A;  4KHP O;  4FM0 A;  2IW5 A;  5FNV B;  1XHX A;  2DMX A;  5ITZ A;  3LSQ A;  3NR7 A;  5EC2 C;  3B2E E;  1GN2 A;  4TV9 A;  4H37 A;  1XMO O;  1AJN A;  3CRR A;  2EJ7 A;  3SJQ C;  4MVZ A;  2EIK C;  3G71 V;  4LF5 O;  1GMG A;  2EIL B;  3SR2 C;  4IIJ B;  2VWJ A;  3ZED A;  3IC7 A;  1WPB A;  1V55 B;  3BHP A;  3OMA B;  1LR1 A;  1RSO A;  1XI1 A;  1L0L H;  1GM7 A;  1D2D A;  1BE3 H;  2YXY A;  4X64 B;  5CA0 B;  4IGG A;  5E79 Z;  1F23 A;  2AXT Z;  4FPP A;  1K4D C;  2GTA A;  2VS0 A;  1W0J G;  2LJ2 A;  3CE2 A;  2EZO A;  4YJ3 B;  1NBM G;  1EZJ A;  4DR1 O;  4O2B B;  4XDJ A;  2W6I G;  2BSK A;  2V7Q G;  2GSM B;  3T1Y O;  2RDC A;  2YEV B;  1ZL8 B;  5IE9 A;  1FXV A;  1VF7 A;  1R3J C;  4NXM B;  4I0X A;  4FZ0 A;  4DRX B;  3JCU Z;  3I56 V;  3ABK C;  1PV0 A;  4DR3 O;  3OR6 C;  4JI6 B;  1Q43 A;  4L87 A;  2FB5 A;  5KX5 A;  1ROP A;  4LNU B;  2P22 C;  4ZHQ A;  3G6B A;  4MW8 A;  4LFB B;  3ZRW A;  3SYQ A;  1N0N A;  5BR8 B;  5LHI A;  5CBH A;  3BPZ A;  3ZMS A;  1K8A W;  1HNZ O;  2IJI A;  1B06 A;  1TUB B;  4LH7 A;  2Q73 A;  3FYE B;  2AZ0 A;  5KMG B;  3ASO B;  4U7N A;  3LDD A;  2F43 G;  4J9Z B;  4EB6 B;  2RQ6 A;  4HNA A;  2D2C B;  1PL0 A;  2Q7E A;  3TJT A;  3ETG A;  2OCH A;  1KEC A;  1HWY A;  4KHP B;  4UCT A;  5LYJ A;  5IJ0 B;  1PNL A;  4X65 O;  4ZBM A;  3T2M A;  4P30 A;  4G2K A;  4NYK A;  3VBB A;  5IJ9 B;  2ZE8 A;  2IJK A;  4C7U A;  4TQD A;  3D3I A;  2AHZ A;  5LL6 Y;  2XUM A;  1JOY A;  2IJH A;  4CZZ A;  4LCU C;  4WFH A;  4ZI7 B;  1TVK B;  2ZD9 A;  3F5W C;  3RYH A;  1E1R G;  1WA8 A;  2HP8 A;  4IYI A;  2ZIM A;  3CCU V;  4PA7 A;  1GN4 A;  4LC1 A;  4X1I A;  1Q82 W;  1GTO A;  2OYQ A;  3AG1 B;  3ZHQ A;  1WN7 A;  3G4S V;  4O4L A;  1H2M A;  3OW2 U;  1M57 B;  2HHH O;  2PGG A;  1WPX A;  4I55 B;  1P7B A;  4UFZ A;  1Q90 D;  4YXW G;  2Q7G A;  2X6C A;  1NZ6 A;  2Y4T A;  1L1F A;  4J41 A;  4MVM A;  4JTD B;  2M6Y A;  3ICX A;  2Q7H A;  4HBN A;  5LHH A;  2UXX A;  3NXS A;  5H2F Z;  4R6Z A;  2O57 A;  1VQ6 V;  2F4V O;  4YHH B;  4RUF A;  1XNQ O;  2RCV A;  4JI4 O;  3T1Y B;  1Z2G A;  5IDJ A;  4B08 A;  4YIP A;  5JWP A;  1S0V A;  4GCZ A;  3AK3 A;  3W7T A;  2EIM C;  2UXC O;  4AIL C;  4DR3 B;  1Z5V A;  4G28 B;  1I7F A;  3W7W A;  3F5T A;  3P3N A;  1VQ5 V;  3SYO A;  1JFF A;  1V54 C;  2E3C A;  4GX1 A;  4PDR A;  3EFF K;  3OTF A;  3E8B A;  3STZ C;  3OTO B;  1NH2 B;  3VQY A;  3AG4 C;  1KKC A;  3K5N A;  4I50 A;  2YIA A;  3WB0 A;  2ZT9 B;  4JTA B;  3RYF B;  3U10 A;  1XNR B;  5EBL C;  4CS3 A;  3CCE V;  4F6E A;  4X65 B;  3CXH F;  2DN9 A;  4IL6 Z;  3RBZ A;  1RP3 B;  3PN1 A;  1SC5 B;  3SYA A;  5J2U B;  5AG2 A;  4LF6 O;  2EZP A;  2AHY A;  1DF5 A;  2GUZ B;  3K0G A;  3H1H H;  3EVK A;  1QBZ A;  3H1J H;  1YF2 A;  3FB5 C;  3WU2 Z;  2CTR A;  3CCQ V;  4OPH A;  1I94 O;  2EIL C;  2UUA O;  4GX2 A;  1UPG A;  1V55 C;  3AG3 B;  2WA3 A;  1N33 O;  4CC5 A;  1Q3E A;  5IWA O;  4X20 B;  3BFR A;  2ILM A;  1W0K G;  1A32 A;  2WSS G;  3E8F A;  3JAW A;  1Q5O A;  5GTI Z;  1OCC C;  3JD3 A;  4J42 A;  3SPH A;  4AI8 A;  1NTZ H;  2QTO A;  5IYZ A;  3FKS G;  2DYS C;  4QNH B;  4LR3 A;  2QKS A;  2YC0 A;  3ZJZ A;  4K0K O;  3ZMT A;  1VMG A;  3OEE G;  1LUW A;  4DR6 O;  2A7W A;  2EIK B;  1VQO V;  3E86 A;  1J5E O;  4YIO A;  5B1N A;  1X59 A;  1KC8 W;  1S5J A;  3M8A A;  2AGA A;  2OCC C;  4OGQ B;  1XNQ B;  4JI4 B;  5H5N A;  2YIB D;  4PD4 F;  1BHA A;  3CJH A;  1XDC A;  4JI7 O;  2P67 A;  1FXK C;  4GKJ B;  1ZSP A;  1VQ9 V;  3P3P A;  4PDL A;  4DR5 O;  3STL C;  1VAR A;  3APO A;  3KCX A;  3AEI A;  2WLL A;  4BW5 A;  1Q86 W;  3CC2 V;  1SA0 A;  4FLT A;  1HNW O;  2N74 A;  5EZY B;  3TK1 A;  4RO2 A;  3LDC A;  2RN9 A;  3ASO C;  1VEW A;  3G67 A;  4MTX A;  1FFX A;  2A9H A;  3ETD A;  3G6E V;  2P4K A;  1YDX A;  3JYC A;  1OCR B;  1IXM A;  4J10 A;  4QE7 A;  3FB6 C;  3OGI B;  4U3J B;  1QLE B;  5TIS Z;  3K5O A;  2CH7 A;  1R3L C;  2QKA A;  4UCO A;  1CP9 A;  1KMI Z;  3PJS K;  3K08 A;  5LGN A;  5KA5 A;  4LF6 B;  5B3S C;  3B40 A;  2HR3 A;  2FYU H;  4P2Z A;  4X88 A;  3ETE A;  2VQE O;  3HKC B;  4LWS A;  2DOS A;  2R9R B;  4WFA V;  1VIB A;  4FFB B;  1I94 B;  1KU9 A;  4K3A A;  1AI6 A;  2CTP A;  3UKM A;  1AJQ A;  3ZHR A;  2MK3 A;  1FJG O;  1EM1 A;  2CGO A;  2KG7 A;  1VQN V;  3DC5 A;  3DXR A;  3K9A A;  5IWA B;  3UCS C;  4JI1 O;  3H1K H;  1XBL A;  3ABU A;  4B3S O;  4AHC A;  1NS1 A;  2X7R B;  2LW1 A;  2HJF C;  3K59 A;  1TAE A;  1EZV H;  4WBN B;  4DUY O;  1H8E G;  4FLX A;  4UVB A;  3OFN G;  3CC7 V;  1XL6 A;  1NH2 D;  1CPY A;  2WLK A;  4DR6 B;  4I4T A;  3RVZ A;  3CCV V;  1J5E B;  1RSO B;  5J2T A; 
#chains in the Genus database with same CATH homology
 1KKC A;  1Y67 A;  1BT8 A;  3LSU A;  1MSD A;  1EN6 A;  1N0J A;  2ADP A;  3DC6 A;  1LUV A;  1P7G A;  4F6E A;  1VEW A;  1GN3 A;  1AVM A;  3KKY A;  1GN4 A;  5AG2 A;  2CE4 A;  1PL4 A;  2P4K A;  1GN6 A;  4FFK A;  1AP5 A;  3AK1 A;  3EVK A;  1BS3 A;  3K9S A;  2QKA A;  1EN4 A;  4X9Q A;  1I08 A;  1IXB A;  3AK2 A;  3IC9 A;  3RN4 A;  2GDS A;  2AW9 A;  4JYY A;  3MDS A;  1ZTE A;  2QKC A;  3BFR A;  4JZ2 A;  3CEI A;  4JZG A;  1D5N A;  1IDS A;  3C3T A;  3OT7 A;  1PM9 A;  1MNG A;  3KDR A;  1JA8 A;  2RCV A;  1N0N A;  5A9G A;  1QNM A;  3C3S A;  1EM1 A;  1AR5 A;  1EN5 A;  4GUN A;  2CDY A;  1WB8 A;  4YIP A;  4E4E A;  3DC5 A;  3AK3 A;  1B06 A;  1LUW A;  1XUQ A;  2ADQ B;  1AR4 A;  1JR9 A;  4YIO A;  1GN2 A;  1ZLZ A;  1ZUQ A;  1SZX A;  4BR6 A;  3TJT A;  1BSM A;  1XIL A;  1MMM A;  1I0H A;  1WB7 A;  1MA1 A;  1XDC A;  1ZSP A;  3QVN A;  1XRE A;  1AP6 A;  1VAR A;  4C7U A;  1IX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...