1ZTEA

Contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAHVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
total genus 71
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zteA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zteA02
1ZTEA 1LUVA 3TJTA 1IXBA 1N0JA 1BS3A 1EM1A 1ZSPA 2GDSA 3BFRA 5A9GA 1XDCA 2ADPA 4F6EA 1AVMA 2QKCA 1LUWA 2CDYA 1QNMA 1SZXA 1I08A 1GN4A 2RCVA 1VEWA 4C7UA 1IX9A 1I0HA 1XILA 1B06A 1N0NA 1MSDA 1XREA 4FFKA 4JZGA 1GN2A 1EN4A 3AK1A 3EVKA 4E4EA 3OT7A 1Y67A 1JA8A 3IC9A 3C3SA 4YIPA 3C3TA 4JYYA 3DC6A 1GN3A 1MNGA 1BSMA 1JR9A 2AW9A 3LSUA 1ZLZA 3RN4A 1ZUQA 5AG2A 1PM9A 2QKAA 3QVNA 1AP6A 3DC5A 2ADQB 1AP5A 1KKCA 3K9SA 1VARA 4GUNA 2CE4A 3CEIA 1P7GA 2P4KA 1AR4A 1WB8A 3KKYA 1IDSA 4JZ2A 3AK2A 1WB7A 1PL4A 4YIOA 1MMMA 1EN5A 1GN6A 3MDSA 3AK3A 1MA1A 1BT8A 1EN6A 4X9QA 1XUQA 1D5NA 4BR6A 1AR5A
chains in the Genus database with same CATH superfamily
4J10A 1KECA 1YVWA 3VQXA 5JQGA 2BSKB 3K5OA 2VRZA 2WA3A 3SYPA 5BMVA 1SKVA 1TAEA 2YICA 3OM3B 4JI4B 2UU9B 3HKEB 4AHCA 3JAMN 1KU9A 3CB2A 1N34B 1KQSU 4PV1B 1FXKB 2F23A 2ZM6B 4C7UA 1K97A 1L8DA 2A7WA 1MSDA 1XREA 5B1BB 2PI4A 1VF7A 5LYJA 3ZBHA 5J2TA 4JAAA 2F1MA 2X6AA 3K5LA 4TUYB 3OTOO 4JYBA 2AZ2A 3SYOA 2ZR2A 1GKFA 3M99B 4JYYA 5H6RA 5H2FZ 1GN3A 1MNGA 5LP6C 3WG7B 2VS0A 3RYHA 1ZLZA 2Z5UA 2IJKA 3VQWA 2L6LA 3CCUV 4FIPC 4DR7O 4XDLA 3K0GA 4R6ZA 4JAVA 3P32A 4UV8A 1R6KA 4DV7O 4XBFA 4O4LB 1YCIA 3E89A 4NYKA 2ADQB 3PJSK 1GM7A 1O9HA 1P84F 2Y4TA 4DR6O 5GTHZ 4B3TB 3CE2A 5LMUB 2CGNA 1Z2GA 3HKDB 2LQTA 1VIBA 1XL4A 4I7ZB 3GWOA 4HYOA 4IHJB 4BW9A 5KAIZ 2IW5A 3ZIAG 5E79Z 3K5MA 3LDDA 1VF5B 4QE9A 1Z5VA 4WBNA 2N04A 2YXHA 4CH6A 3ZRSA 1VQPV 4UFZA 1RM1B 2EX3A 5KUMA 1RSOA 1WA8A 5L3DA 1TVKA 4PI0A 3HKDA 3ZHUA 5BR8O 2DQ3A 3JATA 3JD4A 1N0JA 4ZOLB 4LCUC 4NKGB 4NVPA 1XEQA 3CJHB 3ZCCA 3CC2V 3BHPA 5CBGA 4HZ3A 3CXHF 4YJ2B 1XDCA 1JQ0A 4JI2B 4JI0O 3BRCA 4FK5C 2RCVA 1I0HA 3TK1A 4O2BB 2YEVA 4FLUA 3H1HH 4E4EA 1HNZB 4PA4A 4KXRA 2ZE8A 5JJNB 1YITV 4JI1B 2W6IG 3C3SA 1S3JA 2QTSA 1JJ2U 4JI5O 4UB6Z 4EFBA 3X2QC 1AJQA 1YEWA 4UCRA 3TGUH 3Q4HB 5HFLA 1AJPA 3H9VA 3RN4A 5KHGA 1NR1A 1P7BA 3ABUA 3RYCA 4LNUB 2X6BA 2ZDIA 4DO2A 1JVMA 1K33A 1AP6A 1AI4A 1M90W 2IH1C 4I55A 5JVDA 4U7NA 3CCEV 3CJHA 2A0LA 2CE4A 5CA1B 5J2UA 4AILC 2RDCA 2ZQMA 3UT5A 3AG4B 3UKMA 1FFXA 2UUAB 2RNBA 2FMLA 2KQXA 3JALA 5LA6A 2Y48A 4EB6B 3SJAC 1MA1A 4DR4B 2WLMA 3D3QA 5KHKA 4LH6A 5CBFA 3PN1A 2BE3A 1SQPH 4FLVA 4MSWC 3AG7A 4DUYO 2OIGA 4G28B 4TV9A 5EZYB 1KKDA 3LSSA 4RO2A 2LGQA 1QU7A 1K92A 3JYCA 2QM8A 3T1CA 3T1YB 2OCCB 4YY3O 1NVPB 2JIZG 2EINB 2JDIG 4E2LA 3N2KB 4K35A 5CBHA 1H5WA 4FVMA 3JAWA 4U3JB 3ZN1A 3OD4A 3I56V 1I94O 4LNUA 5CB4B 4L87A 2ZNIA 3N2GA 2DN9A 3OT7A 3BY6A 4MTGA 2HFEC 1FYJA 4MVSA 5IY5C 1S72V 2EZOA 4IL6Z 3THOA 4YIPA 4R50A 4FJCC 1JJOA 2IJHA 2ZINA 3T1YO 3FAVA 3ETGA 4X1YA 4YJ3B 1BL8A 4O2AB 4WF9V 1X4TA 2EIMB 2PGGA 2QKSA 2RN9A 4PDRA 2NN4A 4X1IA 2ATKC 2ZIOA 1H2KA 4XDJA 1WA8B 3K9SA 3MHHC 1VMGA 4TV9B 5EZYA 3ZMVA 1Y74A 1TUBA 1R73A 1JPXA 3BAAA 1WB8A 3CRQA 2X7RB 1FJGB 4OX9O 1U96A 4GKKB 4O4HA 1OHHG 4MVZA 1IBLB 5EC2C 1GN6A 3JARB 4X1KA 1S77D 5B3SB 4B3SO 1GH6A 3SR2C 3D36A 1JNBA 5LHHA 1AI6A 1PPJH 2EJRA 1Q5OA 1FKAO 2LO1A 1SS3A 1F51A 3CCRV 4BR6A 3OGCC 1Q81W 1BE3H 1Q90D 2HHHB 4BWAA 1UPGA 3G80A 2P90A 3A8TA 5BY1A 3QO5A 3EFFK 3ZS8C 5EBWC 3RWRD 5L3EA 5EIBD 2EIJC 2JGDA 3ABKB 1XMOB 4L8JA 4FZ0A 2M7WA 2ADPA 2YXLA 3OGIB 4NXNO 5EIBC 5FNVB 3RYCB 2UXDB 3JSNA 4PA7A 4MVOA 4TWKA 1VQLV 3RT3C 4UV9A 1M93A 2D3OW 3HKCA 4I50B 3ZX6A 4JI2O 1HDJA 3IAYA 2GUZA 3O65A 4X65B 3CCLV 1HNZO 5CB4A 3K59A 2F95B 3N2GB 2UUBB 1SQBH 1F4MA 1K4CC 1IZ3A 2FL4A 5JH7B 1R6NA 3FYIB 1M57B 2OCCC 1PD3A 1QQCA 3DC5A 4GX1A 4KFMA 4GKJB 5FPOA 1V55B 3ASOC 3B40A 4LP8A 3K03A 3CC4V 4MS2A 2FYUH 1YHQV 4ZBMA 3OAAG 3ABLC 3H1KH 4NXNB 2YUAA 1MZFA 1I5XA 4F4LA 1I7FA 1EN5A 4KL1A 4TSFG 3F7VC 1DTOA 4X88A 5C8YB 3L74H 4DV5O 1F23A 2RJZA 1GAXA 5IT9N 1QLEC 2YI8A 3AG1B 2UXXA 1ZTEA 4NR1A 1NTMH 5IWAB 2CTWA 2E75B 3CCMV 4QJFB 1EM1A 2E3CA 3ICXA 4LFBO 1M56C 1FXKA 3BFRA 3CRRA 2BTQB 2QM7A 4UCVA 3QF7A 3FD9A 3FB6C 1NVPD 3APQA 2QA4V 3QNEA 5A9GA 3CWBH 1SZTA 2UXCO 1Q8IA 5DM6V 1HNWO 1WP7A 5LMNO 3SPHA 1N0NA 1S5LZ 4CH3A 3RGBA 2WAMA 4YHHO 1R1BA 4DR7B 1KBHA 3J7AU 3E8BA 3W7WA 3U0ZA 4H13B 3SPIA 2ZNJA 2MK3A 4X65O 2DMXA 4J42A 3AG1C 2EBOA 5IYZB 1OCRC 1XMQB 1RPRA 5DEDA 3L72H 4DV4B 4I9QA 4DUZB 4X8AA 2QGNA 1VQ9V 3LSQA 5DN6G 1WAZA 2GTAA 4O4IA 1NKDA 1PM9A 2LFSA 2JRIA 1N8RW 4CC6A 2YIBD 4X89A 2UXBB 1ENVA 4DK1A 3A0HZ 2E74B 2VWJA 2Q4PA 4DR4O 2ZDIC 2WLIA 4JAUA 3T1HB 1NT2B 1BHAA 5CA3A 3K06A 1XNRO 2XAHA 1YDXA 1RM1C 2CTQA 2ZD9A 1FXVA 1TGOA 5H9CA 1Q3EA 1HWYA 2DW4A 1T5EA 2YSUB 3K58A 2KSDA 3FFQA 3X2QB 2EULA 5KA5A 1MZEA 4UUJC 3WB0A 1XUQA 1AR1B 2V7QG 1D5AA 4GKKO 2HVJC 2UUCO 3JALB 3OTFA 3OMAB 4PD4F 1GM8A 4BAYA 4DV6B 4D6TH 4DV1O 1K7DA 2WSSG 3IJ4A 3DGEA 3CRCA 2PF4E 2K1EA 1IURA 4LF5B 2OTJV 2P06A 4X66O 2UUAO 4IIJA 4MTOA 1KC8W 2AXTZ 3W7UA 2H94A 3M7MX 4QGPA 3RYHB 2PY5A 2W0FC 4ZIBA 4ZI7B 5EBLC 1Q86W 2JJ2G 4B3RO 3JD3A 1GK9A 4HAMA 4B08A 4BW5A 2P6JA 5KMGA 4EKWA 3W7TA 1YF2A 4OGQB 2A06H 3G6EV 4MW8A 1ORQC 2F43G 5AG2A 1GO3F 2ITCC 3CD6V 3H1LH 1GMGA 4KP4A 3F7YC 2P67A 3I5DA 1KKCA 2DQ0A 2HVKC 3U11A 2AHYA 2QWNB 4JI8O 1K4DC 1P7GA 2P4KA 2ZE6A 4DV1B 4FZ1A 1S5HC 1IDSA 4JV5O 4JZ2A 4Z1MG 3RFRA 1SF9A 1PL4A 4RUFA 1NU1H 3RYIA 1TVKB 2L35A 2VQFO 4F6RB 4MVRA 2XHBA 4Q6GA 4DV0O 5ITZA 1MSWD 4WFFA 3KCYA 1AILA 1HP8A 2PTMA 1O9GA 4MTFA 3AG3B 3OFNG 1Y76A 2Y0IA 3D36C 1HNWB 3EHBB 4CBCA 4K0KB 2Q7GA 1SRYA 1DGSA 1H2LA 1MABG 2QEXV 3TJTA 1W0JG 1K9MW 3P3PA 3ZEDA 1QVFU 4X62O 2JS5A 4P9OA 2K9PA 4QPKA 3OTOB 2HJFC 5CN0A 4BIZA 1VEWA 1SERA 1JFFB 4KUMA 2V4DA 1EN4A 2Z3YA 1YTFD 2BSKA 4U3JA 1I5YA 3DXRB 3JAWB 3E83A 1Y66A 1M4UA 1JOYA 3ZMZA 4ASUG 4X1YB 4BIUA 4ZKIA 4JI7O 4JF3A 1NJIW 1WP8A 4YY3B 1QR9A 2JVDA 4GT1A 1XMOO 3KCXA 3CCVV 1BSMA 1RFYA 1XHXA 4WFGA 4X1KB 3OMIB 2Q7EA 3QVNA 1OCCB 5J2TB 1VARA 3R65A 4XDKA 3CRAA 3HB3B 2YXYA 2EZPA 3UO3A 3C90A 1OCZB 2Q67A 5B5EZ 2HHHO 2P22C 3LNMB 1HNXB 3QO8A 2Q5ZA 2ZT9B 1VQ8V 3AK2A 1R3LC 5LOVB 2DYRC 1AROP 4YIOA 3CPWU 1YI2V 3SPGA 5EYPB 2DJVA 4B3TO 3AK3A 5LGNA 2BCCH 2D2CB 2MW2B 3MHSC 3FKSG 4O4JB 4PDMA 2JK5C 4G27B 2JJ1G 3TETA 1IVSA 4UVBA 3W7XA 1QLEB 1OCOB 4JGSA 1FFXB 3G67A 2EILB 3A2FA 3S3WA 5L3BA 4PDVA 1HNXO 1SQFA 4X64B 4FLXA 4G2KA 3ASNC 3SPJA 5KMGB 2GHYA 2DYSC 1KYOF 1YXBA 4B7EA 4I50A 2EINC 1FXKC 1KMIZ 2V1DA 5CMUA 4FFBA 4J9YB 2ZKOA 3CP1A 2VQEO 2KG7B 4DR5O 1BQ0A 2IU0A 3AK1A 4O2AA 3ZHTA 5FNVA 1UJWB 2EIMC 4QIWF 5LMNB 2XAJA 2WPDG 2H8PC 2IJJA 4YJ2A 3CX5F 2PYLA 4Z2WA 3T2MA 5LHGA 3KG2A 2DYSB 1V54C 4I0XB 4O2BA 5LYJB 2DWEC 5FL7G 2H3OA 1AP5A 4JYAB 2YC0A 2Y69C 3JARA 5B1OA 3B4SA 4DV0B 1AR4A 2LJ2A 2RQ6A 4PJ0Z 4DV2B 3BA8A 5JCOA 1WN7A 2ZR3A 3GVMA 1VF6C 5F2VO 2QM4A 4MT8A 2R72A 1TA8A 1NTKH 1K5QA 2PUSA 2F4VB 4RUEA 2FTKA 4OPAA 2ZM6O 4X9QA 1N32B 1E1QG 5GTIZ 3BVOA 1D5NA 1L0LH 1UFIA 1XHZA 4TV8B 3B09A 2KB1A 3E8GA 4FLWA 4DR5B 2QKCA 4LF9O 1LUWA 5HFMA 2XASA 4GLXA 1CP9A 2Q0AA 3B2EE 2QWPB 1IBKB 4QE7A 3SDLA 4AQYO 1FPOA 3VQVA 1N4CA 1KP3A 2X6CA 1M9NA 1E1RG 3F5TA 3IGAC 3HR0A 4DR3B 3GB7C 3CS5A 1YTFB 1ZX3A 1JA8A 4LFCB 3O9OA 4EEQA 2XAGA 3UQ8A 2FB5A 3WG7C 4JI6O 2B1IA 4FFBB 1SQQH 2DWDC 5EBMC 1QVGU 3DC6A 4UCUA 3L70H 1JR9A 3CCSV 4FM2A 3N27A 4FLTA 1M5IA 4IYIA 2NR5A 4AQYB 2HJDA 4D7SA 3BABA 4OX9B 5KHIA 2QWQB 4KHPO 3L73H 5JJEB 3CHXA 5D5PA 4O4JA 2ETNA 1GM9A 2DE0X 2LFRA 4U7OA 5EK0A 3WU2Z 3JASA 1K5SA 2PZSA 2QDOA 3KKYA 1Q43A 5BR8B 3ZRWA 4DXWA 3JATB 1OCZC 3CRMA 1H8EG 5LXTB 4DV5B 1NQTA 1P4RA 2R9RB 5B66Z 1B04A 2XAFA 1QR8A 3HKBB 4D7TA 4JV5B 1G6UA 4X64O 3CYOA 4YHHB 4X1IB 2A9HA 1IBLO 3ETQA 1LUVA 4DV2O 4IHJA 1PL0A 2LP7A 5EC1C 3B77A 5D5QA 1Y6XA 3WB2A 1NZ6A 3ML0A 4H33A 2OTLV 2YIBA 4QNHB 2CUGA 1I08A 4NB5A 3STLC 1OZ0A 5L3GA 4FLZA 3UM7A 1IBMB 1A32A 3T4ZA 1WLEA 1RPOA 3BEHA 4FFKA 3B8MA 4NXMO 2PI5A 1GN2A 3ASOB 1MG1A 2BOCC 1N36O 4B3MO 2WLNA 4WFHA 4DUZO 4DV6O 1COWG 4IIJB 2LW7A 3J81N 4I4TB 3MD0A 2CTRA 3U10A 4X20B 2YIDA 3D8CA 1SETA 2YS8A 4B7KA 2YEVB 2R70A 1OCCC 1OCRB 3E22A 3ABMB 1OV9A 2WA4A 1Q6HA 4LF4B 2UUCB 4LF8O 4DRXB 1S76D 2XUMA 3ABMC 4DR1O 4DW0A 2R9AA 1FOUA 5B1BC 2Q8VA 2OYQA 1Q82W 5BMVB 3K0DA 5LP6A 2CAZC 5JQGB 4X20A 3LDEA 2QTOA 4ZOLA 4GCZA 4N23A 1MMMA 2B5UA 1M1KW 1US6A 4PHZA 2N05A 5KUKA 3MDSA 1VQ6V 4JI4O 2AZ0A 5DECA 4LF8B 1WPBA 5KLVH 3JD2A 1YJNV 1K73W 4JI1O 1AI5A 1K3EA 3ZHQA 4RWUA 4B3RB 1SQXH 3AG2C 1ZSPA 2LGWA 1WPXA 1EZJA 3CMAV 5B3SC 4PI2A 1SESA 1QCEA 1JX9A 2CH7B 1NH2D 3J80N 2PYJA 4I4TA 2EILC 1G4YB 4O4HB 1KD1W 4H0LB 4JI8B 4LFBB 2Q6AA 4DR1B 4MVMA 5GONA 5IJ0B 3UCSC 2Y0PA 1Y67A 3E8FA 2QSAA 4DK0A 3IC9A 4GX0A 5H6QA 4DYLA 3OUFA 3HPLC 1Q6IA 3E2EA 1HR0O 2VWKA 5LXTA 1FJGO 3VQYA 3L71H 1K8AW 3OE7G 3P3NA 5FPRA 5B1AC 2OWOA 1PNKA 3P30A 3ABKC 4R8CA 2GBOA 5CA0B 1QLNA 3OMNB 4UVAA 2VQEB 3K5NA 5IYCO 1L1FA 1H2GA 3SYQA 1VQMV 2GUZB 4CH5A 2E76B 1YIJV 4NTYA 2NLJC 2GSMB 3RW0A 5IJ9A 4MW3A 1Q7YW 5IWAO 3JSLA 1BZKA 1S5JA 4JPRA 3KZIZ 4P30A 3EXAA 5JVDB 4WFAV 2HEPA 5E1AC 2UXDO 1V55C 3JCZA 3TXSA 4CS3A 1XNRB 5IYDO 1XNQB 5IJ9B 4UB8Z 3SPCA 3JCUZ 4O4IB 3I55V 1P49A 4WCEV 1AJNA 4LWSA 2A79B 5IDJA 4J7ZA 1U97A 4B3SB 1R3IC 1W59A 2Z0AA 2XTAA 4H37A 1SA0A 3AG3C 1J5EB 1AB3A 4W4LA 1QNMA 2ZIMA 3SYAA 2XNDG 4JTCB 3RBZA 3SJBC 1TUEB 3BCCH 5CA0A 1DLBA 1D2DA 1K34A 4ZHQB 5GW7A 2DOSA 4TQDA 2UXBO 3Q4HA 4KHPB 4PA6A 4CS2A 3OR6C 2HP8A 4LC1A 3VBBA 2QWOB 3SYCA 4EFEA 1BMFG 4DR2B 4DW1A 4LF6B 4W4KA 1N36B 3ZN0A 1YJWV 4J11A 2UXCB 4IT5A 3LUTB 1SC5B 2CH7A 1LR1A 3RVYA 4GX5A 3AG4C 3E8HA 5IYBO 5IYZA 3CCQV 1SA0B 1ZL8A 2E5LO 3OUSA 1R6TA 2EJ7A 5JJJB 1EFRG 3E22B 4MTXA 1XMQO 4UXNA 4K0KO 2B9ZA 3FX7A 3ZHVA 1J5EO 3T1HO 1OJHA 4I55B 4P9PA 3ZMTA 2M6YA 2JGUA 4JYAO 5J9PC 3RYIB 1W0KG 3NXSA 3K57A 2G38A 3IC7A 3OEHG 1G8MA 3WB1A 1B6QA 5K1PA 5LOVA 3ETDA 2OIEA 1WNSA 5LMUO 1IXBA 1Z5WA 2F66C 4B3MB 1BS3A 2GDSA 4PDLA 1H2NA 2IJIA 3F5WC 2IU3A 1I94B 3FAVB 1NH2B 4WFBV 1GRJA 4PA9A 1AVMA 4WFEA 5LGUA 2Q69A 2EIKB 4LH7A 1YZBA 2WLJA 2N74A 1PNLA 5IY5B 1NBMG 4R7CA 3K9AA 2EIKC 4GZRB 5LHIA 3ETEA 2P7TC 3EVKA 1NTZH 1Y74B 4OXSA 1FXHA 3ZMUA 4FLYA 1NR7A 1NI8A 1JCHA 3E86A 3N2KA 2XOKG 2HG5C 1TUBB 2UUBO 2ODMA 1DF4A 2WLKA 3QTCA 2Y69B 3LSUA 2YDEA 1F7YA 1H38A 3L9DA 2JGDB 5L3CA 4K8XA 2QKAA 1ZWIC 4JI5B 1RP3B 1PP9H 2OT5A 3QO7A 3ZHRA 1EBOA 4RQFA 4FM0A 2P5OA 3L75H 4NXMB 1XQ8A 1G1XB 3UO2A 3CEIA 4TUYA 3M8AA 5C8YA 2WLLA 1R3KC 2ZE5A 4PELA 3R66A 1DK1A 4OPHA 4I0XA 4JTAB 5KX5A 1URFA 4MVUA 2GTSA 2R9IA 5LGTA 2W6JG 3RYFB 2A3QA 4GKJO 1BT8A 3S3XA 4CS4A 1L0NH 4K3AA 4JASA 1IJGA 3A0BZ 1KP2A 1Y4MA 1N33B 3HKBA 1B3QA 3OEEG 4MVQA 1H2SB 4BIOA 3FB7C 1CEZA 1ROPA 1M57C 3G6BA 2WLHA 1SQVH 5BXZA 1BGYH 3JD0A 4J9ZB 5ITZB 3H01A 1OCOC 4IYHA 4F6RA 3ZRXA 4DV3B 1SZXA 1R3JC 4DV7B 3ABLB 3E35A 4FMTA 1XI1A 3LNNA 1VQ5V 1IX9A 4K8ZA 1AI7A 1XILA 1WJZA 4HBNA 3K04A 4GYCB 4IGGA 1Y76B 1YSCA 1Q6UA 2HKOA 1QBZA 3A0RA 1NS1A 3G4SV 4DR6B 5J2UB 2NNUA 3CSXA 4NTWA 2JEXA 4JTDB 4LF4O 1E79G 1J95A 3H1JH 2YI9A 2BOBC 1IXMA 3DTUB 3JAKB 4JI3O 4JI0B 2X0LA 2AW9A 1IBMO 1ZUQA 4ZHQA 2KG7A 2LW1A 3DXRA 1VP7A 5KHJA 5L3FA 3JASB 4ICGA 1FFTB 3TCUA 1H2MA 4UCSA 1N33O 5KAFZ 1SQGA 4GUNA 5K1XA 3MAQA 2CTPA 2RMKB 2F4VO 4JI3B 2AGAA 4RQEA 1LNQA 5LA6B 4EB6A 2O57A 2QWRB 2YIAA 2Q9LA 3JD1A 2ZCEA 4J41A 2GV9A 4LF5O 1VQ7V 1QHTA 5CA1A 3BA9A 4LBEC 2WLIB 3UT5B 2ZE7A 1F4NA 2EIJB 1CXZB 2XAQA 4YXWG 4PA3A 4P2ZA 1ZAUA 2BTOA 5IJ0A 1N34O 1VQ4V 4NTXA 5IE9A 3ZRWB 1X59A 4QPJA 4I9WA 1FS0G 5KHHA 3STZC 1PNMA 3CMEV 2Q7HA 4AI8A 1CPYA 4J7JA 5A2QN 2VQFB 1RSOB 2OCHA 3KDRA 1PKXA 2ZXWB 4JI6B 1M56B 3AG2B 4LFCO 5H5NA 2CDYA 2Y4UA 2W0XA 1H8HG 3IFXA 2CK3G 1VQOV 5JWPA 1GN4A 4I5SA 2FKXA 3WFVA 3G71V 3ZJZA 4UCTA 4LF9B 1XL6A 3ZRVA 3CC7V 1FAFA 1S0VA 2ARHA 4DV3O 4X62B 3SGIA 3OR7C 2P4VA 2E5LB 1BHBA 3FYEB 5JCOC 1W2BU 3SJCC 1VF6A 5KX5B 4TOIA 1FD9A 4LF6O 3RVZA 5FLXN 2WLLB 4TT3G 4JYCA 2JEUA 3ABTA 1BCCH 1DF5A 5LBQA 4CZZA 2KKWA 3T4DA 3H1IH 3BPZA 4GX2A 2ZXWC 4LWSB 1XNQO 4LF7B 3W7SA 2CGOA 3SJQC 3CCJV 2WWWA 4DR2O 3K79A 4RAIA 2Q68A 1MOFA 4LFAO 4HNAA 2DYRB 4DRXA 3FB8C 1HW7A 1EN6A 4DUYB 5C93A 3TXQA 5BZBA 4CH4A 2QR4A 3CXCU 2ITDC 4TQFA 4ZI7A 1AR5A 3NR7A 4JI7B 5LP6B 5KA6A 4LR3A 3FB5C 4DR3O 1N32O 2JS3A 1HR0B 4LFAB 4A5UB 4Q20A 3K08A 4UCOA 2Q73A 1GTOA 4F6EA 3JAKA 3ASNB 2XT9A 3OW2U 5TISZ 2ILMA 4WBNB 3ZHSA 2HLDG 1KB9F 1B06A 2QE7G 2IH3C 5LL6Y 3QG5A 4JZGA 4YJ3A 4TV8A 2IBZH 4H44B 1PV0A 3B8NA 3VOUA 3GWKC 2UXNA 3D3IA 4J80A 4X66B 3C3TA 4O4LA 3HKEA 5EYPA 1YJ9V 1JMKC 3HKCB 5JH7A 5B1NA 1KUQA 5GONB 5B1AB 2Q0OC 2AHZA 1BQZA 4J7KA 1VQNV 3K3WA 3DSQA 4DV4O 1ZL8B 4LF7O 4HNAB 2QJ1A 3APOA 1XBLA 2IM9A 1XOUA 1V9PA 4U3FH 2HR3A 4UVCA 3RYFA 1THZA 3AEIA 4CC5A 2F93B 2BTQA 3LDCA 2C2AA 1WB7A 4ABMA 4FM1A 2UU9O 4Z1VA 1V54B 2B1GA 1EZVH 4N21A 1IBKO 4FPPA 1VQKV 3ZMSA 1JFFA
chains in the Genus database with same CATH topology
1ZTEA 1LUVA 3TJTA 1IXBA 1N0JA 1BS3A 1EM1A 1ZSPA 2GDSA 3BFRA 3KDRA 5A9GA 1XDCA 2ADPA 4F6EA 1AVMA 2QKCA 1LUWA 2CDYA 1QNMA 1SZXA 1I08A 1GN4A 2RCVA 1VEWA 4C7UA 1IX9A 1I0HA 1XILA 1B06A 1N0NA 1MSDA 1XREA 4FFKA 4JZGA 1GN2A 1EN4A 3AK1A 3EVKA 4E4EA 3OT7A 1Y67A 1JA8A 3IC9A 3C3SA 4YIPA 3C3TA 4JYYA 3DC6A 1GN3A 1MNGA 1BSMA 1JR9A 2AW9A 3LSUA 1ZLZA 3RN4A 1ZUQA 5AG2A 1PM9A 2QKAA 3QVNA 1AP6A 3DC5A 2ADQB 1AP5A 1KKCA 3K9SA 1VARA 4GUNA 2CE4A 3CEIA 1P7GA 2P4KA 1AR4A 1WB8A 3KKYA 1IDSA 4JZ2A 3AK2A 1WB7A 1PL4A 4YIOA 1MMMA 1EN5A 1GN6A 3MDSA 3AK3A 1MA1A 1BT8A 1EN6A 4X9QA 1XUQA 1D5NA 4BR6A 1AR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTE A;  1LUV A;  3TJT A;  1IXB A;  1N0J A;  1BS3 A;  1EM1 A;  1ZSP A;  2GDS A;  3BFR A;  5A9G A;  1XDC A;  2ADP A;  4F6E A;  1AVM A;  2QKC A;  1LUW A;  2CDY A;  1QNM A;  1SZX A;  1I08 A;  1GN4 A;  2RCV A;  1VEW A;  4C7U A;  1IX9 A;  1I0H A;  1XIL A;  1B06 A;  1N0N A;  1MSD A;  1XRE A;  4FFK A;  4JZG A;  1GN2 A;  1EN4 A;  3AK1 A;  3EVK A;  4E4E A;  3OT7 A;  1Y67 A;  1JA8 A;  3IC9 A;  3C3S A;  4YIP A;  3C3T A;  4JYY A;  3DC6 A;  1GN3 A;  1MNG A;  1BSM A;  1JR9 A;  2AW9 A;  3LSU A;  1ZLZ A;  3RN4 A;  1ZUQ A;  5AG2 A;  1PM9 A;  2QKA A;  3QVN A;  1AP6 A;  3DC5 A;  2ADQ B;  1AP5 A;  1KKC A;  3K9S A;  1VAR A;  4GUN A;  2CE4 A;  3CEI A;  1P7G A;  2P4K A;  1AR4 A;  1WB8 A;  3KKY A;  1IDS A;  4JZ2 A;  3AK2 A;  1WB7 A;  1PL4 A;  4YIO A;  1MMM A;  1EN5 A;  1GN6 A;  3MDS A;  3AK3 A;  1MA1 A;  1BT8 A;  1EN6 A;  4X9Q A;  1XUQ A;  1D5N A;  4BR6 A;  1AR5 A; 
#chains in the Genus database with same CATH topology
 4J10 A;  1KEC A;  1YVW A;  3VQX A;  5JQG A;  2BSK B;  3K5O A;  2VRZ A;  2WA3 A;  3SYP A;  5BMV A;  1SKV A;  1TAE A;  2YIC A;  3OM3 B;  4JI4 B;  2UU9 B;  3HKE B;  4AHC A;  3JAM N;  1KU9 A;  3CB2 A;  1N34 B;  1KQS U;  4PV1 B;  1FXK B;  2F23 A;  2ZM6 B;  4C7U A;  1K97 A;  1L8D A;  2A7W A;  1MSD A;  1XRE A;  5B1B B;  2PI4 A;  1VF7 A;  5LYJ A;  3ZBH A;  5J2T A;  4JAA A;  2F1M A;  2X6A A;  3K5L A;  4TUY B;  3OTO O;  4JYB A;  2AZ2 A;  3SYO A;  2ZR2 A;  1GKF A;  3M99 B;  4JYY A;  5H6R A;  5H2F Z;  1GN3 A;  1MNG A;  5LP6 C;  3WG7 B;  2VS0 A;  3RYH A;  1ZLZ A;  2Z5U A;  2IJK A;  3VQW A;  2L6L A;  3CCU V;  4FIP C;  4DR7 O;  4XDL A;  3K0G A;  4R6Z A;  4JAV A;  3P32 A;  4UV8 A;  1R6K A;  4DV7 O;  4XBF A;  4O4L B;  1YCI A;  3E89 A;  4NYK A;  2ADQ B;  3PJS K;  1GM7 A;  1O9H A;  1P84 F;  2Y4T A;  4DR6 O;  5GTH Z;  4B3T B;  3CE2 A;  5LMU B;  2CGN A;  1Z2G A;  3HKD B;  2LQT A;  1VIB A;  1XL4 A;  4I7Z B;  3GWO A;  4HYO A;  4IHJ B;  4BW9 A;  5KAI Z;  2IW5 A;  3ZIA G;  5E79 Z;  3K5M A;  3LDD A;  1VF5 B;  4QE9 A;  1Z5V A;  4WBN A;  2N04 A;  2YXH A;  4CH6 A;  3ZRS A;  1VQP V;  4UFZ A;  1RM1 B;  2EX3 A;  5KUM A;  1RSO A;  1WA8 A;  5L3D A;  1TVK A;  4PI0 A;  3HKD A;  3ZHU A;  5BR8 O;  2DQ3 A;  3JAT A;  3JD4 A;  1N0J A;  4ZOL B;  4LCU C;  4NKG B;  4NVP A;  1XEQ A;  3CJH B;  3ZCC A;  3CC2 V;  3BHP A;  5CBG A;  4HZ3 A;  3CXH F;  4YJ2 B;  1XDC A;  1JQ0 A;  4JI2 B;  4JI0 O;  3BRC A;  4FK5 C;  2RCV A;  1I0H A;  3TK1 A;  4O2B B;  2YEV A;  4FLU A;  3H1H H;  4E4E A;  1HNZ B;  4PA4 A;  4KXR A;  2ZE8 A;  5JJN B;  1YIT V;  4JI1 B;  2W6I G;  3C3S A;  1S3J A;  2QTS A;  1JJ2 U;  4JI5 O;  4UB6 Z;  4EFB A;  3X2Q C;  1AJQ A;  1YEW A;  4UCR A;  3TGU H;  3Q4H B;  5HFL A;  1AJP A;  3H9V A;  3RN4 A;  5KHG A;  1NR1 A;  1P7B A;  3ABU A;  3RYC A;  4LNU B;  2X6B A;  2ZDI A;  4DO2 A;  1JVM A;  1K33 A;  1AP6 A;  1AI4 A;  1M90 W;  2IH1 C;  4I55 A;  5JVD A;  4U7N A;  3CCE V;  3CJH A;  2A0L A;  2CE4 A;  5CA1 B;  5J2U A;  4AIL C;  2RDC A;  2ZQM A;  3UT5 A;  3AG4 B;  3UKM A;  1FFX A;  2UUA B;  2RNB A;  2FML A;  2KQX A;  3JAL A;  5LA6 A;  2Y48 A;  4EB6 B;  3SJA C;  1MA1 A;  4DR4 B;  2WLM A;  3D3Q A;  5KHK A;  4LH6 A;  5CBF A;  3PN1 A;  2BE3 A;  1SQP H;  4FLV A;  4MSW C;  3AG7 A;  4DUY O;  2OIG A;  4G28 B;  4TV9 A;  5EZY B;  1KKD A;  3LSS A;  4RO2 A;  2LGQ A;  1QU7 A;  1K92 A;  3JYC A;  2QM8 A;  3T1C A;  3T1Y B;  2OCC B;  4YY3 O;  1NVP B;  2JIZ G;  2EIN B;  2JDI G;  4E2L A;  3N2K B;  4K35 A;  5CBH A;  1H5W A;  4FVM A;  3JAW A;  4U3J B;  3ZN1 A;  3OD4 A;  3I56 V;  1I94 O;  4LNU A;  5CB4 B;  4L87 A;  2ZNI A;  3N2G A;  2DN9 A;  3OT7 A;  3BY6 A;  4MTG A;  2HFE C;  1FYJ A;  4MVS A;  5IY5 C;  1S72 V;  2EZO A;  4IL6 Z;  3THO A;  4YIP A;  4R50 A;  4FJC C;  1JJO A;  2IJH A;  2ZIN A;  3T1Y O;  3FAV A;  3ETG A;  4X1Y A;  4YJ3 B;  1BL8 A;  4O2A B;  4WF9 V;  1X4T A;  2EIM B;  2PGG A;  2QKS A;  2RN9 A;  4PDR A;  2NN4 A;  4X1I A;  2ATK C;  2ZIO A;  1H2K A;  4XDJ A;  1WA8 B;  3K9S A;  3MHH C;  1VMG A;  4TV9 B;  5EZY A;  3ZMV A;  1Y74 A;  1TUB A;  1R73 A;  1JPX A;  3BAA A;  1WB8 A;  3CRQ A;  2X7R B;  1FJG B;  4OX9 O;  1U96 A;  4GKK B;  4O4H A;  1OHH G;  4MVZ A;  1IBL B;  5EC2 C;  1GN6 A;  3JAR B;  4X1K A;  1S77 D;  5B3S B;  4B3S O;  1GH6 A;  3SR2 C;  3D36 A;  1JNB A;  5LHH A;  1AI6 A;  1PPJ H;  2EJR A;  1Q5O A;  1FKA O;  2LO1 A;  1SS3 A;  1F51 A;  3CCR V;  4BR6 A;  3OGC C;  1Q81 W;  1BE3 H;  1Q90 D;  2HHH B;  4BWA A;  1UPG A;  3G80 A;  2P90 A;  3A8T A;  5BY1 A;  3QO5 A;  3EFF K;  3ZS8 C;  5EBW C;  3RWR D;  5L3E A;  5EIB D;  2EIJ C;  2JGD A;  3ABK B;  1XMO B;  4L8J A;  4FZ0 A;  2M7W A;  2ADP A;  2YXL A;  3OGI B;  4NXN O;  5EIB C;  5FNV B;  3RYC B;  2UXD B;  3JSN A;  4PA7 A;  4MVO A;  4TWK A;  1VQL V;  3RT3 C;  4UV9 A;  1M93 A;  2D3O W;  3HKC A;  4I50 B;  3ZX6 A;  4JI2 O;  1HDJ A;  3IAY A;  2GUZ A;  3O65 A;  4X65 B;  3CCL V;  1HNZ O;  5CB4 A;  3K59 A;  2F95 B;  3N2G B;  2UUB B;  1SQB H;  1F4M A;  1K4C C;  1IZ3 A;  2FL4 A;  5JH7 B;  1R6N A;  3FYI B;  1M57 B;  2OCC C;  1PD3 A;  1QQC A;  3DC5 A;  4GX1 A;  4KFM A;  4GKJ B;  5FPO A;  1V55 B;  3ASO C;  3B40 A;  4LP8 A;  3K03 A;  3CC4 V;  4MS2 A;  2FYU H;  1YHQ V;  4ZBM A;  3OAA G;  3ABL C;  3H1K H;  4NXN B;  2YUA A;  1MZF A;  1I5X A;  4F4L A;  1I7F A;  1EN5 A;  4KL1 A;  4TSF G;  3F7V C;  1DTO A;  4X88 A;  5C8Y B;  3L74 H;  4DV5 O;  1F23 A;  2RJZ A;  1GAX A;  5IT9 N;  1QLE C;  2YI8 A;  3AG1 B;  2UXX A;  1ZTE A;  4NR1 A;  1NTM H;  5IWA B;  2CTW A;  2E75 B;  3CCM V;  4QJF B;  1EM1 A;  2E3C A;  3ICX A;  4LFB O;  1M56 C;  1FXK A;  3BFR A;  3CRR A;  2BTQ B;  2QM7 A;  4UCV A;  3QF7 A;  3FD9 A;  3FB6 C;  1NVP D;  3APQ A;  2QA4 V;  3QNE A;  5A9G A;  3CWB H;  1SZT A;  2UXC O;  1Q8I A;  5DM6 V;  1HNW O;  1WP7 A;  5LMN O;  3SPH A;  1N0N A;  1S5L Z;  4CH3 A;  3RGB A;  2WAM A;  4YHH O;  1R1B A;  4DR7 B;  1KBH A;  3J7A U;  3E8B A;  3W7W A;  3U0Z A;  4H13 B;  3SPI A;  2ZNJ A;  2MK3 A;  4X65 O;  2DMX A;  4J42 A;  3AG1 C;  2EBO A;  5IYZ B;  1OCR C;  1XMQ B;  1RPR A;  5DED A;  3L72 H;  4DV4 B;  4I9Q A;  4DUZ B;  4X8A A;  2QGN A;  1VQ9 V;  3LSQ A;  5DN6 G;  1WAZ A;  2GTA A;  4O4I A;  1NKD A;  1PM9 A;  2LFS A;  2JRI A;  1N8R W;  4CC6 A;  2YIB D;  4X89 A;  2UXB B;  1ENV A;  4DK1 A;  3A0H Z;  2E74 B;  2VWJ A;  2Q4P A;  4DR4 O;  2ZDI C;  2WLI A;  4JAU A;  3T1H B;  1NT2 B;  1BHA A;  5CA3 A;  3K06 A;  1XNR O;  2XAH A;  1YDX A;  1RM1 C;  2CTQ A;  2ZD9 A;  1FXV A;  1TGO A;  5H9C A;  1Q3E A;  1HWY A;  2DW4 A;  1T5E A;  2YSU B;  3K58 A;  2KSD A;  3FFQ A;  3X2Q B;  2EUL A;  5KA5 A;  1MZE A;  4UUJ C;  3WB0 A;  1XUQ A;  1AR1 B;  2V7Q G;  1D5A A;  4GKK O;  2HVJ C;  2UUC O;  3JAL B;  3OTF A;  3OMA B;  4PD4 F;  1GM8 A;  4BAY A;  4DV6 B;  4D6T H;  4DV1 O;  1K7D A;  2WSS G;  3IJ4 A;  3DGE A;  3CRC A;  2PF4 E;  2K1E A;  1IUR A;  4LF5 B;  2OTJ V;  2P06 A;  4X66 O;  2UUA O;  4IIJ A;  4MTO A;  1KC8 W;  2AXT Z;  3W7U A;  2H94 A;  3M7M X;  4QGP A;  3RYH B;  2PY5 A;  2W0F C;  4ZIB A;  4ZI7 B;  5EBL C;  1Q86 W;  2JJ2 G;  4B3R O;  3JD3 A;  1GK9 A;  4HAM A;  4B08 A;  4BW5 A;  2P6J A;  5KMG A;  4EKW A;  3W7T A;  1YF2 A;  4OGQ B;  2A06 H;  3G6E V;  4MW8 A;  1ORQ C;  2F43 G;  5AG2 A;  1GO3 F;  2ITC C;  3CD6 V;  3H1L H;  1GMG A;  4KP4 A;  3F7Y C;  2P67 A;  3I5D A;  1KKC A;  2DQ0 A;  2HVK C;  3U11 A;  2AHY A;  2QWN B;  4JI8 O;  1K4D C;  1P7G A;  2P4K A;  2ZE6 A;  4DV1 B;  4FZ1 A;  1S5H C;  1IDS A;  4JV5 O;  4JZ2 A;  4Z1M G;  3RFR A;  1SF9 A;  1PL4 A;  4RUF A;  1NU1 H;  3RYI A;  1TVK B;  2L35 A;  2VQF O;  4F6R B;  4MVR A;  2XHB A;  4Q6G A;  4DV0 O;  5ITZ A;  1MSW D;  4WFF A;  3KCY A;  1AIL A;  1HP8 A;  2PTM A;  1O9G A;  4MTF A;  3AG3 B;  3OFN G;  1Y76 A;  2Y0I A;  3D36 C;  1HNW B;  3EHB B;  4CBC A;  4K0K B;  2Q7G A;  1SRY A;  1DGS A;  1H2L A;  1MAB G;  2QEX V;  3TJT A;  1W0J G;  1K9M W;  3P3P A;  3ZED A;  1QVF U;  4X62 O;  2JS5 A;  4P9O A;  2K9P A;  4QPK A;  3OTO B;  2HJF C;  5CN0 A;  4BIZ A;  1VEW A;  1SER A;  1JFF B;  4KUM A;  2V4D A;  1EN4 A;  2Z3Y A;  1YTF D;  2BSK A;  4U3J A;  1I5Y A;  3DXR B;  3JAW B;  3E83 A;  1Y66 A;  1M4U A;  1JOY A;  3ZMZ A;  4ASU G;  4X1Y B;  4BIU A;  4ZKI A;  4JI7 O;  4JF3 A;  1NJI W;  1WP8 A;  4YY3 B;  1QR9 A;  2JVD A;  4GT1 A;  1XMO O;  3KCX A;  3CCV V;  1BSM A;  1RFY A;  1XHX A;  4WFG A;  4X1K B;  3OMI B;  2Q7E A;  3QVN A;  1OCC B;  5J2T B;  1VAR A;  3R65 A;  4XDK A;  3CRA A;  3HB3 B;  2YXY A;  2EZP A;  3UO3 A;  3C90 A;  1OCZ B;  2Q67 A;  5B5E Z;  2HHH O;  2P22 C;  3LNM B;  1HNX B;  3QO8 A;  2Q5Z A;  2ZT9 B;  1VQ8 V;  3AK2 A;  1R3L C;  5LOV B;  2DYR C;  1ARO P;  4YIO A;  3CPW U;  1YI2 V;  3SPG A;  5EYP B;  2DJV A;  4B3T O;  3AK3 A;  5LGN A;  2BCC H;  2D2C B;  2MW2 B;  3MHS C;  3FKS G;  4O4J B;  4PDM A;  2JK5 C;  4G27 B;  2JJ1 G;  3TET A;  1IVS A;  4UVB A;  3W7X A;  1QLE B;  1OCO B;  4JGS A;  1FFX B;  3G67 A;  2EIL B;  3A2F A;  3S3W A;  5L3B A;  4PDV A;  1HNX O;  1SQF A;  4X64 B;  4FLX A;  4G2K A;  3ASN C;  3SPJ A;  5KMG B;  2GHY A;  2DYS C;  1KYO F;  1YXB A;  4B7E A;  4I50 A;  2EIN C;  1FXK C;  1KMI Z;  2V1D A;  5CMU A;  4FFB A;  4J9Y B;  2ZKO A;  3CP1 A;  2VQE O;  2KG7 B;  4DR5 O;  1BQ0 A;  2IU0 A;  3AK1 A;  4O2A A;  3ZHT A;  5FNV A;  1UJW B;  2EIM C;  4QIW F;  5LMN B;  2XAJ A;  2WPD G;  2H8P C;  2IJJ A;  4YJ2 A;  3CX5 F;  2PYL A;  4Z2W A;  3T2M A;  5LHG A;  3KG2 A;  2DYS B;  1V54 C;  4I0X B;  4O2B A;  5LYJ B;  2DWE C;  5FL7 G;  2H3O A;  1AP5 A;  4JYA B;  2YC0 A;  2Y69 C;  3JAR A;  5B1O A;  3B4S A;  4DV0 B;  1AR4 A;  2LJ2 A;  2RQ6 A;  4PJ0 Z;  4DV2 B;  3BA8 A;  5JCO A;  1WN7 A;  2ZR3 A;  3GVM A;  1VF6 C;  5F2V O;  2QM4 A;  4MT8 A;  2R72 A;  1TA8 A;  1NTK H;  1K5Q A;  2PUS A;  2F4V B;  4RUE A;  2FTK A;  4OPA A;  2ZM6 O;  4X9Q A;  1N32 B;  1E1Q G;  5GTI Z;  3BVO A;  1D5N A;  1L0L H;  1UFI A;  1XHZ A;  4TV8 B;  3B09 A;  2KB1 A;  3E8G A;  4FLW A;  4DR5 B;  2QKC A;  4LF9 O;  1LUW A;  5HFM A;  2XAS A;  4GLX A;  1CP9 A;  2Q0A A;  3B2E E;  2QWP B;  1IBK B;  4QE7 A;  3SDL A;  4AQY O;  1FPO A;  3VQV A;  1N4C A;  1KP3 A;  2X6C A;  1M9N A;  1E1R G;  3F5T A;  3IGA C;  3HR0 A;  4DR3 B;  3GB7 C;  3CS5 A;  1YTF B;  1ZX3 A;  1JA8 A;  4LFC B;  3O9O A;  4EEQ A;  2XAG A;  3UQ8 A;  2FB5 A;  3WG7 C;  4JI6 O;  2B1I A;  4FFB B;  1SQQ H;  2DWD C;  5EBM C;  1QVG U;  3DC6 A;  4UCU A;  3L70 H;  1JR9 A;  3CCS V;  4FM2 A;  3N27 A;  4FLT A;  1M5I A;  4IYI A;  2NR5 A;  4AQY B;  2HJD A;  4D7S A;  3BAB A;  4OX9 B;  5KHI A;  2QWQ B;  4KHP O;  3L73 H;  5JJE B;  3CHX A;  5D5P A;  4O4J A;  2ETN A;  1GM9 A;  2DE0 X;  2LFR A;  4U7O A;  5EK0 A;  3WU2 Z;  3JAS A;  1K5S A;  2PZS A;  2QDO A;  3KKY A;  1Q43 A;  5BR8 B;  3ZRW A;  4DXW A;  3JAT B;  1OCZ C;  3CRM A;  1H8E G;  5LXT B;  4DV5 B;  1NQT A;  1P4R A;  2R9R B;  5B66 Z;  1B04 A;  2XAF A;  1QR8 A;  3HKB B;  4D7T A;  4JV5 B;  1G6U A;  4X64 O;  3CYO A;  4YHH B;  4X1I B;  2A9H A;  1IBL O;  3ETQ A;  1LUV A;  4DV2 O;  4IHJ A;  1PL0 A;  2LP7 A;  5EC1 C;  3B77 A;  5D5Q A;  1Y6X A;  3WB2 A;  1NZ6 A;  3ML0 A;  4H33 A;  2OTL V;  2YIB A;  4QNH B;  2CUG A;  1I08 A;  4NB5 A;  3STL C;  1OZ0 A;  5L3G A;  4FLZ A;  3UM7 A;  1IBM B;  1A32 A;  3T4Z A;  1WLE A;  1RPO A;  3BEH A;  4FFK A;  3B8M A;  4NXM O;  2PI5 A;  1GN2 A;  3ASO B;  1MG1 A;  2BOC C;  1N36 O;  4B3M O;  2WLN A;  4WFH A;  4DUZ O;  4DV6 O;  1COW G;  4IIJ B;  2LW7 A;  3J81 N;  4I4T B;  3MD0 A;  2CTR A;  3U10 A;  4X20 B;  2YID A;  3D8C A;  1SET A;  2YS8 A;  4B7K A;  2YEV B;  2R70 A;  1OCC C;  1OCR B;  3E22 A;  3ABM B;  1OV9 A;  2WA4 A;  1Q6H A;  4LF4 B;  2UUC B;  4LF8 O;  4DRX B;  1S76 D;  2XUM A;  3ABM C;  4DR1 O;  4DW0 A;  2R9A A;  1FOU A;  5B1B C;  2Q8V A;  2OYQ A;  1Q82 W;  5BMV B;  3K0D A;  5LP6 A;  2CAZ C;  5JQG B;  4X20 A;  3LDE A;  2QTO A;  4ZOL A;  4GCZ A;  4N23 A;  1MMM A;  2B5U A;  1M1K W;  1US6 A;  4PHZ A;  2N05 A;  5KUK A;  3MDS A;  1VQ6 V;  4JI4 O;  2AZ0 A;  5DEC A;  4LF8 B;  1WPB A;  5KLV H;  3JD2 A;  1YJN V;  1K73 W;  4JI1 O;  1AI5 A;  1K3E A;  3ZHQ A;  4RWU A;  4B3R B;  1SQX H;  3AG2 C;  1ZSP A;  2LGW A;  1WPX A;  1EZJ A;  3CMA V;  5B3S C;  4PI2 A;  1SES A;  1QCE A;  1JX9 A;  2CH7 B;  1NH2 D;  3J80 N;  2PYJ A;  4I4T A;  2EIL C;  1G4Y B;  4O4H B;  1KD1 W;  4H0L B;  4JI8 B;  4LFB B;  2Q6A A;  4DR1 B;  4MVM A;  5GON A;  5IJ0 B;  3UCS C;  2Y0P A;  1Y67 A;  3E8F A;  2QSA A;  4DK0 A;  3IC9 A;  4GX0 A;  5H6Q A;  4DYL A;  3OUF A;  3HPL C;  1Q6I A;  3E2E A;  1HR0 O;  2VWK A;  5LXT A;  1FJG O;  3VQY A;  3L71 H;  1K8A W;  3OE7 G;  3P3N A;  5FPR A;  5B1A C;  2OWO A;  1PNK A;  3P30 A;  3ABK C;  4R8C A;  2GBO A;  5CA0 B;  1QLN A;  3OMN B;  4UVA A;  2VQE B;  3K5N A;  5IYC O;  1L1F A;  1H2G A;  3SYQ A;  1VQM V;  2GUZ B;  4CH5 A;  2E76 B;  1YIJ V;  4NTY A;  2NLJ C;  2GSM B;  3RW0 A;  5IJ9 A;  4MW3 A;  1Q7Y W;  5IWA O;  3JSL A;  1BZK A;  1S5J A;  4JPR A;  3KZI Z;  4P30 A;  3EXA A;  5JVD B;  4WFA V;  2HEP A;  5E1A C;  2UXD O;  1V55 C;  3JCZ A;  3TXS A;  4CS3 A;  1XNR B;  5IYD O;  1XNQ B;  5IJ9 B;  4UB8 Z;  3SPC A;  3JCU Z;  4O4I B;  3I55 V;  1P49 A;  4WCE V;  1AJN A;  4LWS A;  2A79 B;  5IDJ A;  4J7Z A;  1U97 A;  4B3S B;  1R3I C;  1W59 A;  2Z0A A;  2XTA A;  4H37 A;  1SA0 A;  3AG3 C;  1J5E B;  1AB3 A;  4W4L A;  1QNM A;  2ZIM A;  3SYA A;  2XND G;  4JTC B;  3RBZ A;  3SJB C;  1TUE B;  3BCC H;  5CA0 A;  1DLB A;  1D2D A;  1K34 A;  4ZHQ B;  5GW7 A;  2DOS A;  4TQD A;  2UXB O;  3Q4H A;  4KHP B;  4PA6 A;  4CS2 A;  3OR6 C;  2HP8 A;  4LC1 A;  3VBB A;  2QWO B;  3SYC A;  4EFE A;  1BMF G;  4DR2 B;  4DW1 A;  4LF6 B;  4W4K A;  1N36 B;  3ZN0 A;  1YJW V;  4J11 A;  2UXC B;  4IT5 A;  3LUT B;  1SC5 B;  2CH7 A;  1LR1 A;  3RVY A;  4GX5 A;  3AG4 C;  3E8H A;  5IYB O;  5IYZ A;  3CCQ V;  1SA0 B;  1ZL8 A;  2E5L O;  3OUS A;  1R6T A;  2EJ7 A;  5JJJ B;  1EFR G;  3E22 B;  4MTX A;  1XMQ O;  4UXN A;  4K0K O;  2B9Z A;  3FX7 A;  3ZHV A;  1J5E O;  3T1H O;  1OJH A;  4I55 B;  4P9P A;  3ZMT A;  2M6Y A;  2JGU A;  4JYA O;  5J9P C;  3RYI B;  1W0K G;  3NXS A;  3K57 A;  2G38 A;  3IC7 A;  3OEH G;  1G8M A;  3WB1 A;  1B6Q A;  5K1P A;  5LOV A;  3ETD A;  2OIE A;  1WNS A;  5LMU O;  1IXB A;  1Z5W A;  2F66 C;  4B3M B;  1BS3 A;  2GDS A;  4PDL A;  1H2N A;  2IJI A;  3F5W C;  2IU3 A;  1I94 B;  3FAV B;  1NH2 B;  4WFB V;  1GRJ A;  4PA9 A;  1AVM A;  4WFE A;  5LGU A;  2Q69 A;  2EIK B;  4LH7 A;  1YZB A;  2WLJ A;  2N74 A;  1PNL A;  5IY5 B;  1NBM G;  4R7C A;  3K9A A;  2EIK C;  4GZR B;  5LHI A;  3ETE A;  2P7T C;  3EVK A;  1NTZ H;  1Y74 B;  4OXS A;  1FXH A;  3ZMU A;  4FLY A;  1NR7 A;  1NI8 A;  1JCH A;  3E86 A;  3N2K A;  2XOK G;  2HG5 C;  1TUB B;  2UUB O;  2ODM A;  1DF4 A;  2WLK A;  3QTC A;  2Y69 B;  3LSU A;  2YDE A;  1F7Y A;  1H38 A;  3L9D A;  2JGD B;  5L3C A;  4K8X A;  2QKA A;  1ZWI C;  4JI5 B;  1RP3 B;  1PP9 H;  2OT5 A;  3QO7 A;  3ZHR A;  1EBO A;  4RQF A;  4FM0 A;  2P5O A;  3L75 H;  4NXM B;  1XQ8 A;  1G1X B;  3UO2 A;  3CEI A;  4TUY A;  3M8A A;  5C8Y A;  2WLL A;  1R3K C;  2ZE5 A;  4PEL A;  3R66 A;  1DK1 A;  4OPH A;  4I0X A;  4JTA B;  5KX5 A;  1URF A;  4MVU A;  2GTS A;  2R9I A;  5LGT A;  2W6J G;  3RYF B;  2A3Q A;  4GKJ O;  1BT8 A;  3S3X A;  4CS4 A;  1L0N H;  4K3A A;  4JAS A;  1IJG A;  3A0B Z;  1KP2 A;  1Y4M A;  1N33 B;  3HKB A;  1B3Q A;  3OEE G;  4MVQ A;  1H2S B;  4BIO A;  3FB7 C;  1CEZ A;  1ROP A;  1M57 C;  3G6B A;  2WLH A;  1SQV H;  5BXZ A;  1BGY H;  3JD0 A;  4J9Z B;  5ITZ B;  3H01 A;  1OCO C;  4IYH A;  4F6R A;  3ZRX A;  4DV3 B;  1SZX A;  1R3J C;  4DV7 B;  3ABL B;  3E35 A;  4FMT A;  1XI1 A;  3LNN A;  1VQ5 V;  1IX9 A;  4K8Z A;  1AI7 A;  1XIL A;  1WJZ A;  4HBN A;  3K04 A;  4GYC B;  4IGG A;  1Y76 B;  1YSC A;  1Q6U A;  2HKO A;  1QBZ A;  3A0R A;  1NS1 A;  3G4S V;  4DR6 B;  5J2U B;  2NNU A;  3CSX A;  4NTW A;  2JEX A;  4JTD B;  4LF4 O;  1E79 G;  1J95 A;  3H1J H;  2YI9 A;  2BOB C;  1IXM A;  3DTU B;  3JAK B;  4JI3 O;  4JI0 B;  2X0L A;  2AW9 A;  1IBM O;  1ZUQ A;  4ZHQ A;  2KG7 A;  2LW1 A;  3DXR A;  1VP7 A;  5KHJ A;  5L3F A;  3JAS B;  4ICG A;  1FFT B;  3TCU A;  1H2M A;  4UCS A;  1N33 O;  5KAF Z;  1SQG A;  4GUN A;  5K1X A;  3MAQ A;  2CTP A;  2RMK B;  2F4V O;  4JI3 B;  2AGA A;  4RQE A;  1LNQ A;  5LA6 B;  4EB6 A;  2O57 A;  2QWR B;  2YIA A;  2Q9L A;  3JD1 A;  2ZCE A;  4J41 A;  2GV9 A;  4LF5 O;  1VQ7 V;  1QHT A;  5CA1 A;  3BA9 A;  4LBE C;  2WLI B;  3UT5 B;  2ZE7 A;  1F4N A;  2EIJ B;  1CXZ B;  2XAQ A;  4YXW G;  4PA3 A;  4P2Z A;  1ZAU A;  2BTO A;  5IJ0 A;  1N34 O;  1VQ4 V;  4NTX A;  5IE9 A;  3ZRW B;  1X59 A;  4QPJ A;  4I9W A;  1FS0 G;  5KHH A;  3STZ C;  1PNM A;  3CME V;  2Q7H A;  4AI8 A;  1CPY A;  4J7J A;  5A2Q N;  2VQF B;  1RSO B;  2OCH A;  3KDR A;  1PKX A;  2ZXW B;  4JI6 B;  1M56 B;  3AG2 B;  4LFC O;  5H5N A;  2CDY A;  2Y4U A;  2W0X A;  1H8H G;  3IFX A;  2CK3 G;  1VQO V;  5JWP A;  1GN4 A;  4I5S A;  2FKX A;  3WFV A;  3G71 V;  3ZJZ A;  4UCT A;  4LF9 B;  1XL6 A;  3ZRV A;  3CC7 V;  1FAF A;  1S0V A;  2ARH A;  4DV3 O;  4X62 B;  3SGI A;  3OR7 C;  2P4V A;  2E5L B;  1BHB A;  3FYE B;  5JCO C;  1W2B U;  3SJC C;  1VF6 A;  5KX5 B;  4TOI A;  1FD9 A;  4LF6 O;  3RVZ A;  5FLX N;  2WLL B;  4TT3 G;  4JYC A;  2JEU A;  3ABT A;  1BCC H;  1DF5 A;  5LBQ A;  4CZZ A;  2KKW A;  3T4D A;  3H1I H;  3BPZ A;  4GX2 A;  2ZXW C;  4LWS B;  1XNQ O;  4LF7 B;  3W7S A;  2CGO A;  3SJQ C;  3CCJ V;  2WWW A;  4DR2 O;  3K79 A;  4RAI A;  2Q68 A;  1MOF A;  4LFA O;  4HNA A;  2DYR B;  4DRX A;  3FB8 C;  1HW7 A;  1EN6 A;  4DUY B;  5C93 A;  3TXQ A;  5BZB A;  4CH4 A;  2QR4 A;  3CXC U;  2ITD C;  4TQF A;  4ZI7 A;  1AR5 A;  3NR7 A;  4JI7 B;  5LP6 B;  5KA6 A;  4LR3 A;  3FB5 C;  4DR3 O;  1N32 O;  2JS3 A;  1HR0 B;  4LFA B;  4A5U B;  4Q20 A;  3K08 A;  4UCO A;  2Q73 A;  1GTO A;  4F6E A;  3JAK A;  3ASN B;  2XT9 A;  3OW2 U;  5TIS Z;  2ILM A;  4WBN B;  3ZHS A;  2HLD G;  1KB9 F;  1B06 A;  2QE7 G;  2IH3 C;  5LL6 Y;  3QG5 A;  4JZG A;  4YJ3 A;  4TV8 A;  2IBZ H;  4H44 B;  1PV0 A;  3B8N A;  3VOU A;  3GWK C;  2UXN A;  3D3I A;  4J80 A;  4X66 B;  3C3T A;  4O4L A;  3HKE A;  5EYP A;  1YJ9 V;  1JMK C;  3HKC B;  5JH7 A;  5B1N A;  1KUQ A;  5GON B;  5B1A B;  2Q0O C;  2AHZ A;  1BQZ A;  4J7K A;  1VQN V;  3K3W A;  3DSQ A;  4DV4 O;  1ZL8 B;  4LF7 O;  4HNA B;  2QJ1 A;  3APO A;  1XBL A;  2IM9 A;  1XOU A;  1V9P A;  4U3F H;  2HR3 A;  4UVC A;  3RYF A;  1THZ A;  3AEI A;  4CC5 A;  2F93 B;  2BTQ A;  3LDC A;  2C2A A;  1WB7 A;  4ABM A;  4FM1 A;  2UU9 O;  4Z1V A;  1V54 B;  2B1G A;  1EZV H;  4N21 A;  1IBK O;  4FPP A;  1VQK V;  3ZMS A;  1JFF A; 
#chains in the Genus database with same CATH homology
 1ZTE A;  1LUV A;  3TJT A;  1IXB A;  1N0J A;  1BS3 A;  1EM1 A;  1ZSP A;  2GDS A;  3BFR A;  3KDR A;  5A9G A;  1XDC A;  2ADP A;  4F6E A;  1AVM A;  2QKC A;  1LUW A;  2CDY A;  1QNM A;  1SZX A;  1I08 A;  1GN4 A;  2RCV A;  1VEW A;  4C7U A;  1IX9 A;  1I0H A;  1XIL A;  1B06 A;  1N0N A;  1MSD A;  1XRE A;  4FFK A;  4JZG A;  1GN2 A;  1EN4 A;  3AK1 A;  3EVK A;  4E4E A;  3OT7 A;  1Y67 A;  1JA8 A;  3IC9 A;  3C3S A;  4YIP A;  3C3T A;  4JYY A;  3DC6 A;  1GN3 A;  1MNG A;  1BSM A;  1JR9 A;  2AW9 A;  3LSU A;  1ZLZ A;  3RN4 A;  1ZUQ A;  5AG2 A;  1PM9 A;  2QKA A;  3QVN A;  1AP6 A;  3DC5 A;  2ADQ B;  1AP5 A;  1KKC A;  3K9S A;  1VAR A;  4GUN A;  2CE4 A;  3CEI A;  1P7G A;  2P4K A;  1AR4 A;  1WB8 A;  3KKY A;  1IDS A;  4JZ2 A;  3AK2 A;  1WB7 A;  1PL4 A;  4YIO A;  1MMM A;  1EN5 A;  1GN6 A;  3MDS A;  3AK3 A;  1MA1 A;  1BT8 A;  1EN6 A;  4X9Q A;  1XUQ A;  1D5N A;  4BR6 A;  1AR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...