1ZTEA

Contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAHVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
total genus 71
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zteA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zteA02
1MSDA 1JA8A 1XUQA 3AK3A 3OT7A 3MDSA 1LUVA 3C3SA 1SZXA 4FFKA 3KKYA 1JR9A 1LUWA 1Y67A 4C7UA 1VARA 4JZ2A 5AG2A 3IC9A 2CDYA 1I08A 1ZUQA 1GN3A 1IX9A 1IXBA 1ZTEA 1VEWA 3RN4A 1N0JA 3LSUA 1WB7A 3BFRA 3EVKA 3TJTA 1AR4A 1GN6A 1XDCA 2QKCA 1GN4A 4X9QA 1B06A 1XILA 1EN5A 1MNGA 1PM9A 3DC6A 1EM1A 1GN2A 4BR6A 1AR5A 1BS3A 1KKCA 2P4KA 1AVMA 3K9SA 1N0NA 2ADQB 5A9GA 3CEIA 4F6EA 3AK2A 4YIPA 1BSMA 1ZSPA 1AP6A 1D5NA 1QNMA 2GDSA 4JYYA 1EN6A 2RCVA 1IDSA 3QVNA 1MA1A 3C3TA 3DC5A 1BT8A 2AW9A 1P7GA 1PL4A 1WB8A 1XREA 1AP5A 1EN4A 3AK1A 1I0HA 1MMMA 2CE4A 2ADPA 4JZGA 2QKAA 4E4EA 1ZLZA 4YIOA 4GUNA
chains in the Genus database with same CATH superfamily
1KU9A 1XUQA 1S5LZ 3J80N 1YZBA 2XT9A 3TCUA 3AG7A 5BXZA 5DM6V 1N36B 2ZQMA 4NYKA 2A0LA 2ZNIA 3E89A 5EIBD 3A0HZ 1GKFA 3OEEG 1A32A 2A79B 2IH3C 5IJ9B 5CBHA 5DEDA 3E2EA 3FX7A 1MG1A 4MTFA 4QIWF 4JV5B 4A5UB 4NTYA 1Y74A 4NXMO 4K8ZA 5CA1B 1O9HA 2EIJC 5KA6A 2F66C 4H13B 1AI6A 3ZBHA 1H2NA 3H1JH 1M57C 3N2KB 4JI8O 1QU7A 5H6QA 3RFRA 3AG3C 2DWEC 1W0KG 3AK2A 3E8FA 3CXHF 1RM1B 2XASA 4DV6B 4GX0A 2XNDG 4UCTA 2UUCB 3BCCH 2QM7A 4UV9A 4J7JA 1EFRG 2UU9O 3AG2C 1YHQV 1SERA 3RGBA 1IBKO 2DYSB 1PL4A 1BZKA 4G27B 2XTAA 4W4LA 3TK1A 3KCYA 2L6LA 3ZIAG 5JCOA 1V54B 2YEVB 2ZXWB 1IBLB 2EINC 4D7TA 1QLNA 3L9DA 3HPLC 2OCCC 3LNNA 4P30A 3AK3A 3OT7A 2EZOA 4K3AA 1HW7A 3KKYA 1B3QA 2PYJA 4I4TA 4JI3B 1IURA 1S77D 4J9YB 5IYZA 1VQ7V 3IC9A 2QR4A 3HKCA 3E8BA 4UXNA 1HNZO 1JFFA 4EB6B 3LDCA 1IX9A 2UUBO 4DK1A 1ZWIC 1O9GA 1R3LC 2ZCEA 2X6AA 2EINB 1AR4A 3ZMVA 2FKXA 4O2AA 4ABMA 4K8XA 1XDCA 2DN9A 1Q82W 1SA0A 3JD3A 5FPRA 4KHPO 2IM9A 1D5AA 3ZEDA 4D7SA 1AR5A 4JI3O 1V54C 4FLZA 1Q3EA 3Q4HA 4LH7A 4JTAB 4JTDB 2RMKB 3JCZA 4F6EA 3ABLB 3OD4A 1H2MA 1ZSPA 2UXBO 1G8MA 1Q86W 1SA0B 1XQ8A 1Z2GA 4FMTA 1KC8W 2GTSA 1IBLO 2F4VO 1K7DA 1IJGA 1OCOC 3RYHB 5KUKA 2P4VA 3SJAC 3AG4C 3WG7C 5H2FZ 5JQGA 3PJSK 5LMNO 4FLTA 5C8YB 2X6BA 2JIZG 1UFIA 3CB2A 1YTFB 4OXSA 5EZYB 4YY3B 2WWWA 4ICGA 1VP7A 3K57A 4CC5A 1GMGA 1KECA 4WFAV 5LYJA 4YJ2B 2OIGA 5LGTA 1JQ0A 4JI6B 2UXDB 4Z1VA 4QGPA 5GONA 1SZTA 4LFBB 5KUMA 1JA8A 1M56B 1NTZH 3G6EV 1LUVA 3HKBB 1K73W 2ODMA 4O4HA 2RN9A 5CMUA 4Q6GA 2UUAO 3CRRA 1VQNV 3ZHVA 1YJWV 3IJ4A 5FL7G 2JJ2G 2IH1C 4WBNA 1M57B 4OX9O 4NKGB 1WLEA 2IU3A 2R9RB 4MW3A 4P9PA 1N8RW 4YHHB 1H38A 1RM1C 2Y0PA 4LWSB 2VWKA 4H0LB 1PKXA 2LJ2A 2E74B 3OM3B 2GUZB 3FYIB 1M93A 3BABA 4Q20A 1DLBA 1NH2B 3FB5C 2OTLV 2WLLB 2RQ6A 4AHCA 3CMEV 4B3RO 4G2KA 5IT9N 5CA0A 3JD4A 2EILC 4BR6A 3JATA 4X1KB 4BAYA 2QWNB 1VIBA 3KG2A 3WB2A 4B3MO 4DR6O 2WLMA 1MZEA 3VQVA 4PELA 3WB1A 3B77A 2A9HA 1P7BA 1N36O 2YIAA 3K06A 5IE9A 2ILMA 3CC4V 3JD0A 3DXRB 3S3WA 3U11A 4B7KA 3CWBH 2Q0OC 3LNMB 3QVNA 1RPOA 1K4CC 3KCXA 2DQ0A 3P3NA 3DC5A 3B40A 4LFCB 5GW7A 4NVPA 1YVWA 3ZRWB 4R6ZA 2B1IA 1XREA 4BWAA 4FM2A 1V55B 1GRJA 2WLKA 5EZYA 4WF9V 4P9OA 1B6QA 4UB6Z 1FFTB 3ABKC 1WNSA 1VF7A 2QKAA 2A3QA 5KHGA 3CC2V 5LMNB 3L75H 1GH6A 1XL6A 3W7WA 4R7CA 2KG7A 1YJNV 1AJNA 3O9OA 2ZR2A 5JCOC 1JR9A 4GKJB 3AG1B 3SPHA 2KQXA 4KL1A 5LOVA 5J9PC 1CPYA 4R8CA 2ZE7A 2ZT9B 2QKSA 3M7MX 5GTHZ 4UCSA 2LO1A 2OTJV 3E35A 3RVYA 3T1YO 3JAMN 2GTAA 3T1HB 4KHPB 4DV3O 1JPXA 3LSUA 1OCOB 3THOA 2BOCC 1BCCH 1FXHA 4LF8B 3I55V 1HWYA 4J9ZB 1NKDA 3CRQA 3DC6A 4YJ3A 3ABLC 4DV6O 2OYQA 1UJWB 3JD2A 1Y4MA 2MW2B 4U7OA 1XMOB 1XNQO 4JI1O 4TV8A 2CGOA 4IHJA 3B2EE 3SYPA 2ADQB 5EYPB 1GAXA 4IYHA 3ZMUA 1YSCA 2WLLA 1OCCC 2VRZA 3ETQA 4UVAA 1RSOB 1D5NA 4NTXA 4B3TO 4X1KA 2GUZA 4DV2B 1YXBA 3CCRV 5LL6Y 2JDIG 1VF6A 2ZNJA 2QGNA 4JI6O 1VQMV 4L87A 4MVZA 5L3BA 4K0KB 3VQXA 1P7GA 2ZM6O 1NR1A 4ZI7B 3RBZA 4JYBA 4DV7O 3J7AU 3K5MA 2O57A 5GONB 4JV5O 2EZPA 2L35A 5FNVB 3WFVA 3CCMV 4ASUG 1BSMA 3QG5A 3ASNC 4X62B 4GCZA 2CGNA 5CBGA 4KXRA 2X7RB 3FB7C 1OJHA 1ZAUA 4OX9B 4DV2O 1L0LH 3C90A 2ZKOA 2V1DA 2YI8A 4I9WA 2DWDC 3K5LA 3ML0A 1VQPV 1QLEB 4UCOA 2JVDA 3MD0A 3LSQA 3A0RA 4TV9B 2Q7EA 2H8PC 1XNRB 2Q9LA 2PZSA 4NXNB 2ITDC 3QO5A 3N2GB 4HAMA 1RPRA 4DV3B 1VQOV 3W7UA 1P84F 1E79G 3U10A 4DRXA 1FXKC 5B1BB 4NR1A 1OHHG 4DV5B 2M7WA 3HKEB 2QA4V 2Z5UA 1D2DA 5JVDB 1S3JA 4GKKO 3P30A 4CH5A 4GKJO 1K3EA 4MVQA 4TSFG 4HYOA 1OCZB 1FAFA 3CE2A 3FFQA 4YXWG 4X64O 2YXLA 4UUJC 5E79Z 4O4JA 1RSOA 4QPKA 1Q6HA 1NZ6A 1MOFA 3K58A 3SPCA 2NR5A 2HJFC 4BIZA 1AB3A 3C3TA 2Y69C 4HBNA 3K08A 4ZOLB 3MAQA 3ASOC 4DV5O 1JVMA 3A2FA 2KSDA 2XAQA 2QWOB 3ZRWA 4WFGA 3HKBA 1L8DA 1HNWB 2CE4A 3N2KA 3QO8A 4I5SA 4JPRA 5CA3A 4AILC 4XDKA 4PA4A 3AG1C 1QVFU 1WA8B 5IJ0B 4DV0O 3MDSA 2HHHO 4N21A 4NB5A 2EX3A 3ICXA 2Q67A 1H5WA 1I94B 4JYAO 4LFBO 2PI5A 2OWOA 2DOSA 3APQA 4IT5A 2Y69B 4DK0A 4Z1MG 3BVOA 4WFFA 1TA8A 4MTGA 4TUYA 2F43G 3ABTA 3JATB 1GN3A 2VS0A 3CRAA 3CXCU 4JI7O 1NVPD 3K5OA 3FAVA 3ABMC 1ZTEA 1MSWD 1VEWA 1NTKH 4WFBV 1VQ6V 2ATKC 4DV7B 1R73A 4IL6Z 1N33O 2Q7GA 1DF5A 2Q7HA 1KKDA 2HEPA 4X9QA 4DR1B 3B4SA 2CH7A 4O4LB 2UU9B 2ZIOA 2W0XA 3E8GA 4BW9A 1YJ9V 1I94O 3E22B 2ITCC 1NBMG 2BE3A 2QE7G 3L72H 3SPIA 3H9VA 1W0JG 2DE0X 4JYCA 3ZS8C 5BR8O 2QTSA 5CB4A 1AI5A 4UCVA 1Z5VA 4IHJB 4JAVA 4MTOA 2RDCA 4CS2A 2YIBA 1Y66A 4DR2B 3HR0A 3T1HO 5CN0A 4K35A 3DGEA 4JI0O 4B3SB 4X89A 4JTCB 1R3KC 5L3CA 4WCEV 5FPOA 2R9AA 4LFAB 4DR3O 4YIOA 3T1CA 3RYHA 3UO3A 2YEVA 2FB5A 1BGYH 2V7QG 2CTRA 1FXKB 4PI0A 4FFKA 4XDJA 3T4DA 3JARB 3UCSC 4LF7B 2M6YA 4BIOA 2X0LA 3CJHA 2E3CA 4JZ2A 1VQLV 2QWRB 4DV1B 4DYLA 5LHGA 3CPWU 2ZDIA 4LF4O 3HKEA 4CBCA 1QQCA 5JVDA 5L3EA 2K9PA 3G80A 2AHZA 1XBLA 1THZA 3W7TA 1RP3B 1WB7A 2KKWA 1W2BU 2NN4A 4FLWA 1S76D 1PPJH 1FFXB 1L0NH 1JCHA 4KP4A 4DRXB 1BQZA 2UUCO 3D36A 1KMIZ 4YJ2A 1HR0B 5B1BC 1K5QA 1TGOA 1KKCA 3OMNB 2PYLA 2P7TC 1N34B 2PY5A 1P4RA 2E76B 1DTOA 5A9GA 4JI8B 3JALB 1KP2A 4JAUA 1ZX3A 3RYIB 1PV0A 4EFEA 4RO2A 1XMQB 4LF7O 2ARHA 3JAWB 2PGGA 1EZJA 2GDSA 3OE7G 3H1KH 2RJZA 4UCRA 1AJQA 1SQQH 2BOBC 3ZRVA 4TQFA 4J80A 4P2ZA 5CA0B 2QEXV 4NXMB 3ZRSA 1K9MW 1F23A 4UVCA 4LFAO 3SJBC 2EILB 3K9AA 5BMVA 3K5NA 4B3SO 4I50B 3ASOB 4O4JB 3T1YB 4I0XB 4FLXA 4DXWA 1ZLZA 3RYFA 4I9QA 4UFZA 2JJ1G 5KMGB 3G71V 2EIJB 2R70A 4JGSA 4X1YA 2EIMC 4PA9A 4MSWC 1UPGA 3ZHRA 2Q73A 1ORQC 3K59A 2WLHA 4FLUA 3SYOA 5LHIA 4DV0B 4NTWA 4O4HB 5AG2A 4AQYB 5KX5A 3JSLA 3S3XA 4ZHQB 1N34O 4YJ3B 5H5NA 3CCEV 2IJHA 3QF7A 3ZHTA 3E22A 1BHBA 1FKAO 2XAJA 4Z2WA 1IZ3A 5LMUB 4O4LA 2WLIB 2AHYA 2WLNA 4FM1A 3I56V 1MNGA 2ZE8A 4DV1O 2F4VB 1HDJA 2CAZC 3JAKA 2LFSA 4N23A 4X20B 2AZ2A 1BS3A 4GX2A 5H6RA 1AVMA 2PTMA 2F23A 4GZRB 5FNVA 2EULA 5IY5B 3CEIA 5IWAO 4RWUA 4F6RA 2IW5A 1YEWA 1P49A 4DW1A 3GWOA 1AP6A 5B3SB 1F51A 2DJVA 3OTFA 4HNAA 2XAFA 2HVKC 3ABUA 3H1HH 2W6JG 4JASA 5B1AB 3LUTB 5EBLC 3JAKB 3ZN1A 1KUQA 2UXNA 4MW8A 1QVGU 5LMUO 2A06H 1XEQA 4DUYB 3CD6V 1WP8A 5KHHA 4F6RB 4JI5B 1FD9A 1J95A 3RW0A 3CX5F 4RQFA 2FL4A 4CC6A 1PNKA 4O2BA 5J2TA 2Q68A 3VQYA 1R6NA 5IY5C 3UKMA 4DW0A 2R9IA 3CCQV 3ZMTA 3W7SA 1HNZB 5ITZA 1YIJV 1K4DC 4EB6A 1Y76B 2KB1A 3RYCB 4X64B 5LGUA 4ZKIA 4FIPC 2H94A 4B3MB 3K03A 4TWKA 3ZHQA 4LC1A 1S72V 1M4UA 3K0DA 4ZHQA 1FOUA 3OTOB 1QHTA 3RN4A 3VBBA 3KZIZ 4O4IA 3CCJV 3AG4B 1JJOA 3D36C 4YHHO 3DSQA 1PL0A 2HFEC 2HVJC 3FB6C 2IJIA 5HFLA 3GB7C 4JI7B 1F7YA 3ABMB 1IBKB 1M90W 1JX9A 1VMGA 1GN2A 4PDLA 2QM8A 4LWSA 3FYEB 2E5LO 1G6UA 3SYCA 1GM9A 1SF9A 3KDRA 4OPAA 4FFBA 3SJQC 3OMIB 1JJ2U 1OCRC 1M9NA 3F7VC 4JI2O 1WPXA 2FYUH 3M99B 5JJEB 3A8TA 4LH6A 1TAEA 4GT1A 1NTMH 2F95B 2P06A 1YDXA 1QNMA 2YI9A 4JYYA 1SQVH 2CTQA 3IAYA 4I4TB 2VQFB 4X62O 3QO7A 4PA6A 1BT8A 4MVMA 5BY1A 2P90A 3JALA 1JFFB 1QCEA 1YTFD 1OV9A 4FJCC 2ZDIC 2EJRA 2OIEA 3E86A 3ZCCA 3QNEA 2DYSC 2DQ3A 4PV1B 2EIMB 2G38A 2OCCB 3VQWA 4FFBB 4KUMA 3CCUV 2UXXA 5TISZ 4MVOA 3T4ZA 5IWAB 1SZXA 4I50A 1MZFA 3HB3B 1OCCB 5B5EZ 1CXZB 2Q4PA 3Q4HB 2D3OW 3P32A 3VOUA 4XDLA 2LW1A 1ZUQA 1IBMB 3EHBB 5LXTB 3N27A 5L3GA 1YCIA 1VQ4V 1BQ0A 3NXSA 3JASA 3F7YC 5K1PA 3G67A 4DR5B 3CRMA 1EZVH 3CC7V 1N0JA 1HP8A 4LF5B 5EYPA 4PA7A 5ITZB 2YSUB 4JAAA 3SGIA 4LF4B 1EN5A 1Y6XA 3N2GA 5B1NA 4X20A 4LFCO 1QR8A 2IJKA 2LW7A 1XHZA 1BMFG 4X65B 1N0NA 1WAZA 4RUFA 5KA5A 3R65A 5JH7B 1KP3A 1QLEC 3HKCB 2CTWA 2QDOA 2Y4UA 3BPZA 1NQTA 4RUEA 5EIBC 1MA1A 4E2LA 4U3FH 3WB0A 4QJFB 4WFEA 3L71H 1K5SA 2V4DA 3CCLV 1Q5OA 3TGUH 1AP5A 4FLYA 2VQEO 2QWPB 5B66Z 2ZM6B 4U7NA 3ZHSA 1Q6IA 2ETNA 5KMGA 4DV4O 1U96A 1ENVA 5CBFA 2VQFO 2JEUA 2UUAB 4AI8A 4QE9A 5KAFZ 1LUWA 4FZ0A 1H2KA 2WAMA 2W6IG 4TOIA 1RFYA 5LP6C 4IIJA 1WA8A 1HNXO 4J41A 5IJ0A 2HJDA 4JI1B 3UM7A 2K1EA 4BW5A 5EC1C 4TUYB 2VQEB 1AI4A 3JAWA 4FK5C 3A0BZ 4LCUC 2F93B 4LBEC 4FVMA 4CH6A 1Q8IA 4LF9O 3OTOO 5H9CA 1QR9A 3G4SV 4QPJA 2IJJA 1E1RG 1N33B 2Q8VA 2X6CA 1E1QG 1GN6A 4IIJB 1GN4A 4LF9B 1G4YB 4I55B 1ZL8A 2RNBA 1SS3A 1VF5B 1EM1A 4H33A 1L1FA 1SQPH 4MVRA 2QJ1A 2P4KA 5LP6B 4B7EA 1TVKB 3JARA 4F4LA 4GKKB 2BCCH 1R3IC 5B3SC 4LR3A 1WN7A 1FJGB 4JI4O 4H44B 2WSSG 4OGQB 2N74A 1IDSA 1GO3F 1AILA 1GTOA 2BTOA 3F5TA 5KAIZ 3TXSA 1GK9A 3W7XA 4DR2O 2AW9A 1DK1A 1WB8A 4G28B 1KYOF 4PHZA 1VQ5V 1COWG 3SPJA 5E1AC 1NT2B 3OGIB 3P3PA 3SR2C 2ADPA 2HLDG 3DTUB 5BR8B 4TT3G 2EBOA 3K04A 4MT8A 3C3SA 4TQDA 1WP7A 1NVPB 5JQGB 2UXCB 5B1OA 3AG3B 4J7KA 3SJCC 3D3IA 3F5WC 2ZD9A 1W59A 2BTQA 1R6TA 4DUZB 2CDYA 1I5XA 3CSXA 2W0FC 3BAAA 4IYIA 3OFNG 1ROPA 4MVSA 1NI8A 1IXBA 2ZR3A 3MHSC 5EC2C 3MHHC 1YF2A 4DR7O 5LOVB 2A7WA 1K34A 5JJJB 1K97A 1XNRO 3JSNA 1B06A 4LF5O 1NH2D 4X1YB 3CJHB 3D3QA 3B09A 3OR7C 4QE7A 4XBFA 2CH7B 2GHYA 1AJPA 4JYAB 4DR4O 1PNLA 3T2MA 2YXYA 2Z0AA 2C2AA 3L73H 1LR1A 4W4KA 1I5YA 1XL4A 1ZL8B 2PI4A 4PI2A 1TVKA 3I5DA 3B8NA 1TUBA 4GX1A 4PDVA 1KB9F 3X2QB 5IYBO 3EXAA 2B5UA 2WA3A 1LNQA 5LYJB 1YI2V 4TV8B 4YY3O 1K92A 4DO2A 2YC0A 2AXTZ 5DN6G 2E75B 1H2SB 3OUFA 2WPDG 4K0KO 3ETEA 3OMAB 1Y76A 3IC7A 1MMMA 1JNBA 2WLJA 2DYRC 2EIKB 4UCUA 5CA1A 4GYCB 1DGSA 4JZGA 2QWQB 2HG5C 3IGAC 1S0VA 1IVSA 3E8HA 3ETGA 5IJ9A 5BMVB 1R1BA 1KQSU 1H8HG 2XUMA 4X66O 2CUGA 2QSAA 1GM8A 3ZJZA 4DR4B 1Y67A 3CYOA 2Y48A 3NR7A 1BHAA 1VARA 2GV9A 2Q0AA 2YUAA 3CMAV 1I7FA 1Q81W 2YIDA 1F4NA 1B04A 3CP1A 5B1AC 3AEIA 3E83A 1NS1A 1HR0O 1FXKA 3SPGA 1T5EA 3SYQA 4DR7B 1Q7YW 1N32O 5GTIZ 1XOUA 1PD3A 1GM7A 1HNWO 4LNUB 3TJTA 2EJ7A 4CS4A 4PD4F 4H37A 3JCUZ 4MTXA 2YIBD 5KLVH 2BSKB 4DUZO 3D8CA 4PDRA 3FD9A 3HKDA 3UT5B 4UB8Z 3ETDA 5JWPA 2R72A 4FLVA 2ZINA 4J42A 3CS5A 3K3WA 3STZC 3BA8A 4FM0A 4ZOLA 2XHBA 3OEHG 3STLC 2GBOA 2LQTA 3K79A 1XI1A 1DF4A 3AG2B 2UXCO 4RQEA 4U3JA 4X8AA 1OCRB 4LF6B 3HKDB 3UT5A 1KD1W 3BEHA 1SQBH 4B08A 4EFBA 1S5HC 3APOA 1TUBB 4LP8A 3L70H 3ZX6A 2KG7B 3CCSV 5LXTA 2YICA 1K33A 4WFHA 4I7ZB 5K1XA 5KHJA 3AK1A 2AGAA 3LSSA 3ZMZA 3BA9A 2Z3YA 4L8JA 1PP9H 1OZ0A 2LGQA 4J7ZA 5C93A 4JF3A 2P5OA 1X59A 2JK5C 1NJIW 1SQFA 5EBMC 4FZ1A 1H2GA 4I55A 5BZBA 2GSMB 4B3RB 3CRCA 4MVUA 3M8AA 3PN1A 4R50A 4EEQA 5D5PA 4X66B 3IFXA 4DR1O 1Q43A 2LGWA 2NLJC 4QNHB 2E5LB 1SESA 5LA6B 3FKSG 2DMXA 2IU0A 3RYIA 3OAAG 3OW2U 1M1KW 5J2UA 5JJNB 5LHHA 1FFXA 4LF6O 3SDLA 4X1IA 1TUEB 1CEZA 2LFRA 1PM9A 4B3TB 4HZ3A 1J5EO 1IXMA 3K9SA 3CHXA 1PNMA 5LBQA 2JS3A 2HHHB 4X65O 1HNXB 1CP9A 2P67A 4O4IB 2PF4E 5L3DA 3H1IH 2QTOA 2RCVA 1XMOO 4GX5A 4OPHA 1XNQB 1URFA 1XHXA 4IGGA 4WBNB 2YS8A 1Q90D 4O2AB 2EIKC 1SETA 1WJZA 2JRIA 4RAIA 5LGNA 2F1MA 5KHKA 4HNAB 1SKVA 1M56C 1BE3H 1K8AW 2OCHA 4BIUA 2DW4A 1R3JC 3RT3C 1KBHA 2P6JA 2UXBB 4UVBA 1NU1H 4X88A 5F2VO 5LP6A 2XAHA 2PUSA 1FYJA 2Q69A 5C8YA 3R66A 2IBZH 2LP7A 4MS2A 3ZMSA 4PJ0Z 2OT5A 1XMQO 5FLXN 2ZXWC 5J2TB 1X4TA 3TXQA 1NR7A 5CB4B 3QTCA 5IYDO 4DR3B 5IYZB 3GVMA 3CCVV 3L74H 2BSKA 5DECA 3OR6C 1AR1B 2QM4A 5LA6A 2H3OA 3JASB 1MABG 4CZZA 3FB8C 2HR3A 3BFRA 3EVKA 1VQ8V 4NXNO 4UV8A 3ABKB 1IBMO 3OUSA 5A2QN 2WA4A 4JI4B 3BY6A 3ZN0A 3BHPA 4JI2B 1M5IA 4DR6B 5L3FA 3FAVB 4ZI7A 2AZ0A 1FJGO 2HP8A 1V9PA 4YIPA 2JEXA 1JOYA 1SQGA 4U3JB 1J5EB 3J81N 1AI7A 3K0GA 1BL8A 3RWRD 3EFFK 4J10A 4X1IB 2JGUA 1SRYA 5EK0A 5KX5B 2N05A 1FPOA 1AROP 2FMLA 1Q6UA 2ZE5A 3H1LH 1S5JA 2NNUA 3X2QC 1EN4A 1F4MA 2BTQB 3WG7B 1US6A 3TETA 2DYRB 1SC5B 3ZHUA 4E4EA 5IYCO 3RYCA 1VQ9V 2YDEA 1MSDA 3H01A 3ZRXA 2P22C 2JGDB 1SQXH 1Y74B 1FXVA 3O65A 3U0ZA 1YITV 1OCZC 4ZBMA 3BRCA 1VF6C 4C7UA 1H2LA 4ZIBA 3JYCA 2CK3G 2XOKG 2Y0IA 4PA3A 3WU2Z 3G6BA 2Y4TA 1I08A 3RYFB 3JD1A 2Q6AA 2XAGA 5HFMA 2JS5A 5EBWC 2UXDO 3LDEA 4DV4B 3UQ8A 1G1XB 4CH4A 1H8EG 2JGDA 2ZIMA 3GWKC 4I0XA 2ZE6A 5D5QA 4GLXA 3UO2A 4DR5O 3SYAA 1N4CA 2UUBB 1QBZA 3LDDA 1WPBA 2B9ZA 2QKCA 1Z5WA 1XILA 5JH7A 1JMKC 2MK3A 4KFMA 2D2CB 2Q5ZA 4O2BB 3OGCC 5J2UB 3B8MA 4D6TH 2B1GA 2VWJA 4CS3A 2WLIA 3ASNB 2YXHA 1V55C 1EN6A 3DXRA 1VQKV 4JI0B 5KHIA 1U97A 4FPPA 4LF8O 4TV9A 2N04A 4DUYO 1EBOA 2FTKA 4PDMA 4EKWA 1I0HA 5IDJA 1FS0G 4JI5O 1R6KA 1N32B 4LNUA 2HKOA 4AQYO 4CH3A 2CTPA 4J11A 3RVZA 4GUNA
chains in the Genus database with same CATH topology
1MSDA 1JA8A 1XUQA 3AK3A 3OT7A 3MDSA 1LUVA 3C3SA 1SZXA 4FFKA 3KKYA 1JR9A 1LUWA 1Y67A 4C7UA 1VARA 4JZ2A 5AG2A 3IC9A 2CDYA 1I08A 1ZUQA 1GN3A 1IX9A 1IXBA 1ZTEA 1VEWA 3RN4A 1N0JA 3LSUA 1WB7A 3BFRA 3EVKA 3TJTA 1AR4A 1GN6A 1XDCA 2QKCA 1GN4A 4X9QA 1B06A 1XILA 1EN5A 1MNGA 1PM9A 3DC6A 1EM1A 1GN2A 4BR6A 1AR5A 1BS3A 1KKCA 2P4KA 1AVMA 3K9SA 1N0NA 2ADQB 3KDRA 5A9GA 3CEIA 4F6EA 3AK2A 4YIPA 1BSMA 1ZSPA 1AP6A 1D5NA 1QNMA 2GDSA 4JYYA 1EN6A 2RCVA 1IDSA 3QVNA 1MA1A 3C3TA 3DC5A 1BT8A 2AW9A 1P7GA 1PL4A 1WB8A 1XREA 1AP5A 1EN4A 3AK1A 1I0HA 1MMMA 2CE4A 2ADPA 4JZGA 2QKAA 4E4EA 1ZLZA 4YIOA 4GUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSD A;  1JA8 A;  1XUQ A;  3AK3 A;  3OT7 A;  3MDS A;  1LUV A;  3C3S A;  1SZX A;  4FFK A;  3KKY A;  1JR9 A;  1LUW A;  1Y67 A;  4C7U A;  1VAR A;  4JZ2 A;  5AG2 A;  3IC9 A;  2CDY A;  1I08 A;  1ZUQ A;  1GN3 A;  1IX9 A;  1IXB A;  1ZTE A;  1VEW A;  3RN4 A;  1N0J A;  3LSU A;  1WB7 A;  3BFR A;  3EVK A;  3TJT A;  1AR4 A;  1GN6 A;  1XDC A;  2QKC A;  1GN4 A;  4X9Q A;  1B06 A;  1XIL A;  1EN5 A;  1MNG A;  1PM9 A;  3DC6 A;  1EM1 A;  1GN2 A;  4BR6 A;  1AR5 A;  1BS3 A;  1KKC A;  2P4K A;  1AVM A;  3K9S A;  1N0N A;  2ADQ B;  5A9G A;  3CEI A;  4F6E A;  3AK2 A;  4YIP A;  1BSM A;  1ZSP A;  1AP6 A;  1D5N A;  1QNM A;  2GDS A;  4JYY A;  1EN6 A;  2RCV A;  1IDS A;  3QVN A;  1MA1 A;  3C3T A;  3DC5 A;  1BT8 A;  2AW9 A;  1P7G A;  1PL4 A;  1WB8 A;  1XRE A;  1AP5 A;  1EN4 A;  3AK1 A;  1I0H A;  1MMM A;  2CE4 A;  2ADP A;  4JZG A;  2QKA A;  4E4E A;  1ZLZ A;  4YIO A;  4GUN A; 
#chains in the Genus database with same CATH topology
 1KU9 A;  1XUQ A;  1S5L Z;  3J80 N;  1YZB A;  2XT9 A;  3TCU A;  3AG7 A;  5BXZ A;  5DM6 V;  1N36 B;  2ZQM A;  4NYK A;  2A0L A;  2ZNI A;  3E89 A;  5EIB D;  3A0H Z;  1GKF A;  3OEE G;  1A32 A;  2A79 B;  2IH3 C;  5IJ9 B;  5CBH A;  5DED A;  3E2E A;  3FX7 A;  1MG1 A;  4MTF A;  4QIW F;  4JV5 B;  4A5U B;  4NTY A;  1Y74 A;  4NXM O;  4K8Z A;  5CA1 B;  1O9H A;  2EIJ C;  5KA6 A;  2F66 C;  4H13 B;  1AI6 A;  3ZBH A;  1H2N A;  3H1J H;  1M57 C;  3N2K B;  4JI8 O;  1QU7 A;  5H6Q A;  3RFR A;  3AG3 C;  2DWE C;  1W0K G;  3AK2 A;  3E8F A;  3CXH F;  1RM1 B;  2XAS A;  4DV6 B;  4GX0 A;  2XND G;  4UCT A;  2UUC B;  3BCC H;  2QM7 A;  4UV9 A;  4J7J A;  1EFR G;  2UU9 O;  3AG2 C;  1YHQ V;  1SER A;  3RGB A;  1IBK O;  2DYS B;  1PL4 A;  1BZK A;  4G27 B;  2XTA A;  4W4L A;  3TK1 A;  3KCY A;  2L6L A;  3ZIA G;  5JCO A;  1V54 B;  2YEV B;  2ZXW B;  1IBL B;  2EIN C;  4D7T A;  1QLN A;  3L9D A;  3HPL C;  2OCC C;  3LNN A;  4P30 A;  3AK3 A;  3OT7 A;  2EZO A;  4K3A A;  1HW7 A;  3KKY A;  1B3Q A;  2PYJ A;  4I4T A;  4JI3 B;  1IUR A;  1S77 D;  4J9Y B;  5IYZ A;  1VQ7 V;  3IC9 A;  2QR4 A;  3HKC A;  3E8B A;  4UXN A;  1HNZ O;  1JFF A;  4EB6 B;  3LDC A;  1IX9 A;  2UUB O;  4DK1 A;  1ZWI C;  1O9G A;  1R3L C;  2ZCE A;  2X6A A;  2EIN B;  1AR4 A;  3ZMV A;  2FKX A;  4O2A A;  4ABM A;  4K8X A;  1XDC A;  2DN9 A;  1Q82 W;  1SA0 A;  3JD3 A;  5FPR A;  4KHP O;  2IM9 A;  1D5A A;  3ZED A;  4D7S A;  1AR5 A;  4JI3 O;  1V54 C;  4FLZ A;  1Q3E A;  3Q4H A;  4LH7 A;  4JTA B;  4JTD B;  2RMK B;  3JCZ A;  4F6E A;  3ABL B;  3OD4 A;  1H2M A;  1ZSP A;  2UXB O;  1G8M A;  1Q86 W;  1SA0 B;  1XQ8 A;  1Z2G A;  4FMT A;  1KC8 W;  2GTS A;  1IBL O;  2F4V O;  1K7D A;  1IJG A;  1OCO C;  3RYH B;  5KUK A;  2P4V A;  3SJA C;  3AG4 C;  3WG7 C;  5H2F Z;  5JQG A;  3PJS K;  5LMN O;  4FLT A;  5C8Y B;  2X6B A;  2JIZ G;  1UFI A;  3CB2 A;  1YTF B;  4OXS A;  5EZY B;  4YY3 B;  2WWW A;  4ICG A;  1VP7 A;  3K57 A;  4CC5 A;  1GMG A;  1KEC A;  4WFA V;  5LYJ A;  4YJ2 B;  2OIG A;  5LGT A;  1JQ0 A;  4JI6 B;  2UXD B;  4Z1V A;  4QGP A;  5GON A;  1SZT A;  4LFB B;  5KUM A;  1JA8 A;  1M56 B;  1NTZ H;  3G6E V;  1LUV A;  3HKB B;  1K73 W;  2ODM A;  4O4H A;  2RN9 A;  5CMU A;  4Q6G A;  2UUA O;  3CRR A;  1VQN V;  3ZHV A;  1YJW V;  3IJ4 A;  5FL7 G;  2JJ2 G;  2IH1 C;  4WBN A;  1M57 B;  4OX9 O;  4NKG B;  1WLE A;  2IU3 A;  2R9R B;  4MW3 A;  4P9P A;  1N8R W;  4YHH B;  1H38 A;  1RM1 C;  2Y0P A;  4LWS B;  2VWK A;  4H0L B;  1PKX A;  2LJ2 A;  2E74 B;  3OM3 B;  2GUZ B;  3FYI B;  1M93 A;  3BAB A;  4Q20 A;  1DLB A;  1NH2 B;  3FB5 C;  2OTL V;  2WLL B;  2RQ6 A;  4AHC A;  3CME V;  4B3R O;  4G2K A;  5IT9 N;  5CA0 A;  3JD4 A;  2EIL C;  4BR6 A;  3JAT A;  4X1K B;  4BAY A;  2QWN B;  1VIB A;  3KG2 A;  3WB2 A;  4B3M O;  4DR6 O;  2WLM A;  1MZE A;  3VQV A;  4PEL A;  3WB1 A;  3B77 A;  2A9H A;  1P7B A;  1N36 O;  2YIA A;  3K06 A;  5IE9 A;  2ILM A;  3CC4 V;  3JD0 A;  3DXR B;  3S3W A;  3U11 A;  4B7K A;  3CWB H;  2Q0O C;  3LNM B;  3QVN A;  1RPO A;  1K4C C;  3KCX A;  2DQ0 A;  3P3N A;  3DC5 A;  3B40 A;  4LFC B;  5GW7 A;  4NVP A;  1YVW A;  3ZRW B;  4R6Z A;  2B1I A;  1XRE A;  4BWA A;  4FM2 A;  1V55 B;  1GRJ A;  2WLK A;  5EZY A;  4WF9 V;  4P9O A;  1B6Q A;  4UB6 Z;  1FFT B;  3ABK C;  1WNS A;  1VF7 A;  2QKA A;  2A3Q A;  5KHG A;  3CC2 V;  5LMN B;  3L75 H;  1GH6 A;  1XL6 A;  3W7W A;  4R7C A;  2KG7 A;  1YJN V;  1AJN A;  3O9O A;  2ZR2 A;  5JCO C;  1JR9 A;  4GKJ B;  3AG1 B;  3SPH A;  2KQX A;  4KL1 A;  5LOV A;  5J9P C;  1CPY A;  4R8C A;  2ZE7 A;  2ZT9 B;  2QKS A;  3M7M X;  5GTH Z;  4UCS A;  2LO1 A;  2OTJ V;  3E35 A;  3RVY A;  3T1Y O;  3JAM N;  2GTA A;  3T1H B;  4KHP B;  4DV3 O;  1JPX A;  3LSU A;  1OCO B;  3THO A;  2BOC C;  1BCC H;  1FXH A;  4LF8 B;  3I55 V;  1HWY A;  4J9Z B;  1NKD A;  3CRQ A;  3DC6 A;  4YJ3 A;  3ABL C;  4DV6 O;  2OYQ A;  1UJW B;  3JD2 A;  1Y4M A;  2MW2 B;  4U7O A;  1XMO B;  1XNQ O;  4JI1 O;  4TV8 A;  2CGO A;  4IHJ A;  3B2E E;  3SYP A;  2ADQ B;  5EYP B;  1GAX A;  4IYH A;  3ZMU A;  1YSC A;  2WLL A;  1OCC C;  2VRZ A;  3ETQ A;  4UVA A;  1RSO B;  1D5N A;  4NTX A;  4B3T O;  4X1K A;  2GUZ A;  4DV2 B;  1YXB A;  3CCR V;  5LL6 Y;  2JDI G;  1VF6 A;  2ZNJ A;  2QGN A;  4JI6 O;  1VQM V;  4L87 A;  4MVZ A;  5L3B A;  4K0K B;  3VQX A;  1P7G A;  2ZM6 O;  1NR1 A;  4ZI7 B;  3RBZ A;  4JYB A;  4DV7 O;  3J7A U;  3K5M A;  2O57 A;  5GON B;  4JV5 O;  2EZP A;  2L35 A;  5FNV B;  3WFV A;  3CCM V;  4ASU G;  1BSM A;  3QG5 A;  3ASN C;  4X62 B;  4GCZ A;  2CGN A;  5CBG A;  4KXR A;  2X7R B;  3FB7 C;  1OJH A;  1ZAU A;  4OX9 B;  4DV2 O;  1L0L H;  3C90 A;  2ZKO A;  2V1D A;  2YI8 A;  4I9W A;  2DWD C;  3K5L A;  3ML0 A;  1VQP V;  1QLE B;  4UCO A;  2JVD A;  3MD0 A;  3LSQ A;  3A0R A;  4TV9 B;  2Q7E A;  2H8P C;  1XNR B;  2Q9L A;  2PZS A;  4NXN B;  2ITD C;  3QO5 A;  3N2G B;  4HAM A;  1RPR A;  4DV3 B;  1VQO V;  3W7U A;  1P84 F;  1E79 G;  3U10 A;  4DRX A;  1FXK C;  5B1B B;  4NR1 A;  1OHH G;  4DV5 B;  2M7W A;  3HKE B;  2QA4 V;  2Z5U A;  1D2D A;  5JVD B;  1S3J A;  4GKK O;  3P30 A;  4CH5 A;  4GKJ O;  1K3E A;  4MVQ A;  4TSF G;  4HYO A;  1OCZ B;  1FAF A;  3CE2 A;  3FFQ A;  4YXW G;  4X64 O;  2YXL A;  4UUJ C;  5E79 Z;  4O4J A;  1RSO A;  4QPK A;  1Q6H A;  1NZ6 A;  1MOF A;  3K58 A;  3SPC A;  2NR5 A;  2HJF C;  4BIZ A;  1AB3 A;  3C3T A;  2Y69 C;  4HBN A;  3K08 A;  4ZOL B;  3MAQ A;  3ASO C;  4DV5 O;  1JVM A;  3A2F A;  2KSD A;  2XAQ A;  2QWO B;  3ZRW A;  4WFG A;  3HKB A;  1L8D A;  1HNW B;  2CE4 A;  3N2K A;  3QO8 A;  4I5S A;  4JPR A;  5CA3 A;  4AIL C;  4XDK A;  4PA4 A;  3AG1 C;  1QVF U;  1WA8 B;  5IJ0 B;  4DV0 O;  3MDS A;  2HHH O;  4N21 A;  4NB5 A;  2EX3 A;  3ICX A;  2Q67 A;  1H5W A;  1I94 B;  4JYA O;  4LFB O;  2PI5 A;  2OWO A;  2DOS A;  3APQ A;  4IT5 A;  2Y69 B;  4DK0 A;  4Z1M G;  3BVO A;  4WFF A;  1TA8 A;  4MTG A;  4TUY A;  2F43 G;  3ABT A;  3JAT B;  1GN3 A;  2VS0 A;  3CRA A;  3CXC U;  4JI7 O;  1NVP D;  3K5O A;  3FAV A;  3ABM C;  1ZTE A;  1MSW D;  1VEW A;  1NTK H;  4WFB V;  1VQ6 V;  2ATK C;  4DV7 B;  1R73 A;  4IL6 Z;  1N33 O;  2Q7G A;  1DF5 A;  2Q7H A;  1KKD A;  2HEP A;  4X9Q A;  4DR1 B;  3B4S A;  2CH7 A;  4O4L B;  2UU9 B;  2ZIO A;  2W0X A;  3E8G A;  4BW9 A;  1YJ9 V;  1I94 O;  3E22 B;  2ITC C;  1NBM G;  2BE3 A;  2QE7 G;  3L72 H;  3SPI A;  3H9V A;  1W0J G;  2DE0 X;  4JYC A;  3ZS8 C;  5BR8 O;  2QTS A;  5CB4 A;  1AI5 A;  4UCV A;  1Z5V A;  4IHJ B;  4JAV A;  4MTO A;  2RDC A;  4CS2 A;  2YIB A;  1Y66 A;  4DR2 B;  3HR0 A;  3T1H O;  5CN0 A;  4K35 A;  3DGE A;  4JI0 O;  4B3S B;  4X89 A;  4JTC B;  1R3K C;  5L3C A;  4WCE V;  5FPO A;  2R9A A;  4LFA B;  4DR3 O;  4YIO A;  3T1C A;  3RYH A;  3UO3 A;  2YEV A;  2FB5 A;  1BGY H;  2V7Q G;  2CTR A;  1FXK B;  4PI0 A;  4FFK A;  4XDJ A;  3T4D A;  3JAR B;  3UCS C;  4LF7 B;  2M6Y A;  4BIO A;  2X0L A;  3CJH A;  2E3C A;  4JZ2 A;  1VQL V;  2QWR B;  4DV1 B;  4DYL A;  5LHG A;  3CPW U;  2ZDI A;  4LF4 O;  3HKE A;  4CBC A;  1QQC A;  5JVD A;  5L3E A;  2K9P A;  3G80 A;  2AHZ A;  1XBL A;  1THZ A;  3W7T A;  1RP3 B;  1WB7 A;  2KKW A;  1W2B U;  2NN4 A;  4FLW A;  1S76 D;  1PPJ H;  1FFX B;  1L0N H;  1JCH A;  4KP4 A;  4DRX B;  1BQZ A;  2UUC O;  3D36 A;  1KMI Z;  4YJ2 A;  1HR0 B;  5B1B C;  1K5Q A;  1TGO A;  1KKC A;  3OMN B;  2PYL A;  2P7T C;  1N34 B;  2PY5 A;  1P4R A;  2E76 B;  1DTO A;  5A9G A;  4JI8 B;  3JAL B;  1KP2 A;  4JAU A;  1ZX3 A;  3RYI B;  1PV0 A;  4EFE A;  4RO2 A;  1XMQ B;  4LF7 O;  2ARH A;  3JAW B;  2PGG A;  1EZJ A;  2GDS A;  3OE7 G;  3H1K H;  2RJZ A;  4UCR A;  1AJQ A;  1SQQ H;  2BOB C;  3ZRV A;  4TQF A;  4J80 A;  4P2Z A;  5CA0 B;  2QEX V;  4NXM B;  3ZRS A;  1K9M W;  1F23 A;  4UVC A;  4LFA O;  3SJB C;  2EIL B;  3K9A A;  5BMV A;  3K5N A;  4B3S O;  4I50 B;  3ASO B;  4O4J B;  3T1Y B;  4I0X B;  4FLX A;  4DXW A;  1ZLZ A;  3RYF A;  4I9Q A;  4UFZ A;  2JJ1 G;  5KMG B;  3G71 V;  2EIJ B;  2R70 A;  4JGS A;  4X1Y A;  2EIM C;  4PA9 A;  4MSW C;  1UPG A;  3ZHR A;  2Q73 A;  1ORQ C;  3K59 A;  2WLH A;  4FLU A;  3SYO A;  5LHI A;  4DV0 B;  4NTW A;  4O4H B;  5AG2 A;  4AQY B;  5KX5 A;  3JSL A;  3S3X A;  4ZHQ B;  1N34 O;  4YJ3 B;  5H5N A;  3CCE V;  2IJH A;  3QF7 A;  3ZHT A;  3E22 A;  1BHB A;  1FKA O;  2XAJ A;  4Z2W A;  1IZ3 A;  5LMU B;  4O4L A;  2WLI B;  2AHY A;  2WLN A;  4FM1 A;  3I56 V;  1MNG A;  2ZE8 A;  4DV1 O;  2F4V B;  1HDJ A;  2CAZ C;  3JAK A;  2LFS A;  4N23 A;  4X20 B;  2AZ2 A;  1BS3 A;  4GX2 A;  5H6R A;  1AVM A;  2PTM A;  2F23 A;  4GZR B;  5FNV A;  2EUL A;  5IY5 B;  3CEI A;  5IWA O;  4RWU A;  4F6R A;  2IW5 A;  1YEW A;  1P49 A;  4DW1 A;  3GWO A;  1AP6 A;  5B3S B;  1F51 A;  2DJV A;  3OTF A;  4HNA A;  2XAF A;  2HVK C;  3ABU A;  3H1H H;  2W6J G;  4JAS A;  5B1A B;  3LUT B;  5EBL C;  3JAK B;  3ZN1 A;  1KUQ A;  2UXN A;  4MW8 A;  1QVG U;  5LMU O;  2A06 H;  1XEQ A;  4DUY B;  3CD6 V;  1WP8 A;  5KHH A;  4F6R B;  4JI5 B;  1FD9 A;  1J95 A;  3RW0 A;  3CX5 F;  4RQF A;  2FL4 A;  4CC6 A;  1PNK A;  4O2B A;  5J2T A;  2Q68 A;  3VQY A;  1R6N A;  5IY5 C;  3UKM A;  4DW0 A;  2R9I A;  3CCQ V;  3ZMT A;  3W7S A;  1HNZ B;  5ITZ A;  1YIJ V;  1K4D C;  4EB6 A;  1Y76 B;  2KB1 A;  3RYC B;  4X64 B;  5LGU A;  4ZKI A;  4FIP C;  2H94 A;  4B3M B;  3K03 A;  4TWK A;  3ZHQ A;  4LC1 A;  1S72 V;  1M4U A;  3K0D A;  4ZHQ A;  1FOU A;  3OTO B;  1QHT A;  3RN4 A;  3VBB A;  3KZI Z;  4O4I A;  3CCJ V;  3AG4 B;  1JJO A;  3D36 C;  4YHH O;  3DSQ A;  1PL0 A;  2HFE C;  2HVJ C;  3FB6 C;  2IJI A;  5HFL A;  3GB7 C;  4JI7 B;  1F7Y A;  3ABM B;  1IBK B;  1M90 W;  1JX9 A;  1VMG A;  1GN2 A;  4PDL A;  2QM8 A;  4LWS A;  3FYE B;  2E5L O;  1G6U A;  3SYC A;  1GM9 A;  1SF9 A;  3KDR A;  4OPA A;  4FFB A;  3SJQ C;  3OMI B;  1JJ2 U;  1OCR C;  1M9N A;  3F7V C;  4JI2 O;  1WPX A;  2FYU H;  3M99 B;  5JJE B;  3A8T A;  4LH6 A;  1TAE A;  4GT1 A;  1NTM H;  2F95 B;  2P06 A;  1YDX A;  1QNM A;  2YI9 A;  4JYY A;  1SQV H;  2CTQ A;  3IAY A;  4I4T B;  2VQF B;  4X62 O;  3QO7 A;  4PA6 A;  1BT8 A;  4MVM A;  5BY1 A;  2P90 A;  3JAL A;  1JFF B;  1QCE A;  1YTF D;  1OV9 A;  4FJC C;  2ZDI C;  2EJR A;  2OIE A;  3E86 A;  3ZCC A;  3QNE A;  2DYS C;  2DQ3 A;  4PV1 B;  2EIM B;  2G38 A;  2OCC B;  3VQW A;  4FFB B;  4KUM A;  3CCU V;  2UXX A;  5TIS Z;  4MVO A;  3T4Z A;  5IWA B;  1SZX A;  4I50 A;  1MZF A;  3HB3 B;  1OCC B;  5B5E Z;  1CXZ B;  2Q4P A;  3Q4H B;  2D3O W;  3P32 A;  3VOU A;  4XDL A;  2LW1 A;  1ZUQ A;  1IBM B;  3EHB B;  5LXT B;  3N27 A;  5L3G A;  1YCI A;  1VQ4 V;  1BQ0 A;  3NXS A;  3JAS A;  3F7Y C;  5K1P A;  3G67 A;  4DR5 B;  3CRM A;  1EZV H;  3CC7 V;  1N0J A;  1HP8 A;  4LF5 B;  5EYP A;  4PA7 A;  5ITZ B;  2YSU B;  4JAA A;  3SGI A;  4LF4 B;  1EN5 A;  1Y6X A;  3N2G A;  5B1N A;  4X20 A;  4LFC O;  1QR8 A;  2IJK A;  2LW7 A;  1XHZ A;  1BMF G;  4X65 B;  1N0N A;  1WAZ A;  4RUF A;  5KA5 A;  3R65 A;  5JH7 B;  1KP3 A;  1QLE C;  3HKC B;  2CTW A;  2QDO A;  2Y4U A;  3BPZ A;  1NQT A;  4RUE A;  5EIB C;  1MA1 A;  4E2L A;  4U3F H;  3WB0 A;  4QJF B;  4WFE A;  3L71 H;  1K5S A;  2V4D A;  3CCL V;  1Q5O A;  3TGU H;  1AP5 A;  4FLY A;  2VQE O;  2QWP B;  5B66 Z;  2ZM6 B;  4U7N A;  3ZHS A;  1Q6I A;  2ETN A;  5KMG A;  4DV4 O;  1U96 A;  1ENV A;  5CBF A;  2VQF O;  2JEU A;  2UUA B;  4AI8 A;  4QE9 A;  5KAF Z;  1LUW A;  4FZ0 A;  1H2K A;  2WAM A;  2W6I G;  4TOI A;  1RFY A;  5LP6 C;  4IIJ A;  1WA8 A;  1HNX O;  4J41 A;  5IJ0 A;  2HJD A;  4JI1 B;  3UM7 A;  2K1E A;  4BW5 A;  5EC1 C;  4TUY B;  2VQE B;  1AI4 A;  3JAW A;  4FK5 C;  3A0B Z;  4LCU C;  2F93 B;  4LBE C;  4FVM A;  4CH6 A;  1Q8I A;  4LF9 O;  3OTO O;  5H9C A;  1QR9 A;  3G4S V;  4QPJ A;  2IJJ A;  1E1R G;  1N33 B;  2Q8V A;  2X6C A;  1E1Q G;  1GN6 A;  4IIJ B;  1GN4 A;  4LF9 B;  1G4Y B;  4I55 B;  1ZL8 A;  2RNB A;  1SS3 A;  1VF5 B;  1EM1 A;  4H33 A;  1L1F A;  1SQP H;  4MVR A;  2QJ1 A;  2P4K A;  5LP6 B;  4B7E A;  1TVK B;  3JAR A;  4F4L A;  4GKK B;  2BCC H;  1R3I C;  5B3S C;  4LR3 A;  1WN7 A;  1FJG B;  4JI4 O;  4H44 B;  2WSS G;  4OGQ B;  2N74 A;  1IDS A;  1GO3 F;  1AIL A;  1GTO A;  2BTO A;  3F5T A;  5KAI Z;  3TXS A;  1GK9 A;  3W7X A;  4DR2 O;  2AW9 A;  1DK1 A;  1WB8 A;  4G28 B;  1KYO F;  4PHZ A;  1VQ5 V;  1COW G;  3SPJ A;  5E1A C;  1NT2 B;  3OGI B;  3P3P A;  3SR2 C;  2ADP A;  2HLD G;  3DTU B;  5BR8 B;  4TT3 G;  2EBO A;  3K04 A;  4MT8 A;  3C3S A;  4TQD A;  1WP7 A;  1NVP B;  5JQG B;  2UXC B;  5B1O A;  3AG3 B;  4J7K A;  3SJC C;  3D3I A;  3F5W C;  2ZD9 A;  1W59 A;  2BTQ A;  1R6T A;  4DUZ B;  2CDY A;  1I5X A;  3CSX A;  2W0F C;  3BAA A;  4IYI A;  3OFN G;  1ROP A;  4MVS A;  1NI8 A;  1IXB A;  2ZR3 A;  3MHS C;  5EC2 C;  3MHH C;  1YF2 A;  4DR7 O;  5LOV B;  2A7W A;  1K34 A;  5JJJ B;  1K97 A;  1XNR O;  3JSN A;  1B06 A;  4LF5 O;  1NH2 D;  4X1Y B;  3CJH B;  3D3Q A;  3B09 A;  3OR7 C;  4QE7 A;  4XBF A;  2CH7 B;  2GHY A;  1AJP A;  4JYA B;  4DR4 O;  1PNL A;  3T2M A;  2YXY A;  2Z0A A;  2C2A A;  3L73 H;  1LR1 A;  4W4K A;  1I5Y A;  1XL4 A;  1ZL8 B;  2PI4 A;  4PI2 A;  1TVK A;  3I5D A;  3B8N A;  1TUB A;  4GX1 A;  4PDV A;  1KB9 F;  3X2Q B;  5IYB O;  3EXA A;  2B5U A;  2WA3 A;  1LNQ A;  5LYJ B;  1YI2 V;  4TV8 B;  4YY3 O;  1K92 A;  4DO2 A;  2YC0 A;  2AXT Z;  5DN6 G;  2E75 B;  1H2S B;  3OUF A;  2WPD G;  4K0K O;  3ETE A;  3OMA B;  1Y76 A;  3IC7 A;  1MMM A;  1JNB A;  2WLJ A;  2DYR C;  2EIK B;  4UCU A;  5CA1 A;  4GYC B;  1DGS A;  4JZG A;  2QWQ B;  2HG5 C;  3IGA C;  1S0V A;  1IVS A;  3E8H A;  3ETG A;  5IJ9 A;  5BMV B;  1R1B A;  1KQS U;  1H8H G;  2XUM A;  4X66 O;  2CUG A;  2QSA A;  1GM8 A;  3ZJZ A;  4DR4 B;  1Y67 A;  3CYO A;  2Y48 A;  3NR7 A;  1BHA A;  1VAR A;  2GV9 A;  2Q0A A;  2YUA A;  3CMA V;  1I7F A;  1Q81 W;  2YID A;  1F4N A;  1B04 A;  3CP1 A;  5B1A C;  3AEI A;  3E83 A;  1NS1 A;  1HR0 O;  1FXK A;  3SPG A;  1T5E A;  3SYQ A;  4DR7 B;  1Q7Y W;  1N32 O;  5GTI Z;  1XOU A;  1PD3 A;  1GM7 A;  1HNW O;  4LNU B;  3TJT A;  2EJ7 A;  4CS4 A;  4PD4 F;  4H37 A;  3JCU Z;  4MTX A;  2YIB D;  5KLV H;  2BSK B;  4DUZ O;  3D8C A;  4PDR A;  3FD9 A;  3HKD A;  3UT5 B;  4UB8 Z;  3ETD A;  5JWP A;  2R72 A;  4FLV A;  2ZIN A;  4J42 A;  3CS5 A;  3K3W A;  3STZ C;  3BA8 A;  4FM0 A;  4ZOL A;  2XHB A;  3OEH G;  3STL C;  2GBO A;  2LQT A;  3K79 A;  1XI1 A;  1DF4 A;  3AG2 B;  2UXC O;  4RQE A;  4U3J A;  4X8A A;  1OCR B;  4LF6 B;  3HKD B;  3UT5 A;  1KD1 W;  3BEH A;  1SQB H;  4B08 A;  4EFB A;  1S5H C;  3APO A;  1TUB B;  4LP8 A;  3L70 H;  3ZX6 A;  2KG7 B;  3CCS V;  5LXT A;  2YIC A;  1K33 A;  4WFH A;  4I7Z B;  5K1X A;  5KHJ A;  3AK1 A;  2AGA A;  3LSS A;  3ZMZ A;  3BA9 A;  2Z3Y A;  4L8J A;  1PP9 H;  1OZ0 A;  2LGQ A;  4J7Z A;  5C93 A;  4JF3 A;  2P5O A;  1X59 A;  2JK5 C;  1NJI W;  1SQF A;  5EBM C;  4FZ1 A;  1H2G A;  4I55 A;  5BZB A;  2GSM B;  4B3R B;  3CRC A;  4MVU A;  3M8A A;  3PN1 A;  4R50 A;  4EEQ A;  5D5P A;  4X66 B;  3IFX A;  4DR1 O;  1Q43 A;  2LGW A;  2NLJ C;  4QNH B;  2E5L B;  1SES A;  5LA6 B;  3FKS G;  2DMX A;  2IU0 A;  3RYI A;  3OAA G;  3OW2 U;  1M1K W;  5J2U A;  5JJN B;  5LHH A;  1FFX A;  4LF6 O;  3SDL A;  4X1I A;  1TUE B;  1CEZ A;  2LFR A;  1PM9 A;  4B3T B;  4HZ3 A;  1J5E O;  1IXM A;  3K9S A;  3CHX A;  1PNM A;  5LBQ A;  2JS3 A;  2HHH B;  4X65 O;  1HNX B;  1CP9 A;  2P67 A;  4O4I B;  2PF4 E;  5L3D A;  3H1I H;  2QTO A;  2RCV A;  1XMO O;  4GX5 A;  4OPH A;  1XNQ B;  1URF A;  1XHX A;  4IGG A;  4WBN B;  2YS8 A;  1Q90 D;  4O2A B;  2EIK C;  1SET A;  1WJZ A;  2JRI A;  4RAI A;  5LGN A;  2F1M A;  5KHK A;  4HNA B;  1SKV A;  1M56 C;  1BE3 H;  1K8A W;  2OCH A;  4BIU A;  2DW4 A;  1R3J C;  3RT3 C;  1KBH A;  2P6J A;  2UXB B;  4UVB A;  1NU1 H;  4X88 A;  5F2V O;  5LP6 A;  2XAH A;  2PUS A;  1FYJ A;  2Q69 A;  5C8Y A;  3R66 A;  2IBZ H;  2LP7 A;  4MS2 A;  3ZMS A;  4PJ0 Z;  2OT5 A;  1XMQ O;  5FLX N;  2ZXW C;  5J2T B;  1X4T A;  3TXQ A;  1NR7 A;  5CB4 B;  3QTC A;  5IYD O;  4DR3 B;  5IYZ B;  3GVM A;  3CCV V;  3L74 H;  2BSK A;  5DEC A;  3OR6 C;  1AR1 B;  2QM4 A;  5LA6 A;  2H3O A;  3JAS B;  1MAB G;  4CZZ A;  3FB8 C;  2HR3 A;  3BFR A;  3EVK A;  1VQ8 V;  4NXN O;  4UV8 A;  3ABK B;  1IBM O;  3OUS A;  5A2Q N;  2WA4 A;  4JI4 B;  3BY6 A;  3ZN0 A;  3BHP A;  4JI2 B;  1M5I A;  4DR6 B;  5L3F A;  3FAV B;  4ZI7 A;  2AZ0 A;  1FJG O;  2HP8 A;  1V9P A;  4YIP A;  2JEX A;  1JOY A;  1SQG A;  4U3J B;  1J5E B;  3J81 N;  1AI7 A;  3K0G A;  1BL8 A;  3RWR D;  3EFF K;  4J10 A;  4X1I B;  2JGU A;  1SRY A;  5EK0 A;  5KX5 B;  2N05 A;  1FPO A;  1ARO P;  2FML A;  1Q6U A;  2ZE5 A;  3H1L H;  1S5J A;  2NNU A;  3X2Q C;  1EN4 A;  1F4M A;  2BTQ B;  3WG7 B;  1US6 A;  3TET A;  2DYR B;  1SC5 B;  3ZHU A;  4E4E A;  5IYC O;  3RYC A;  1VQ9 V;  2YDE A;  1MSD A;  3H01 A;  3ZRX A;  2P22 C;  2JGD B;  1SQX H;  1Y74 B;  1FXV A;  3O65 A;  3U0Z A;  1YIT V;  1OCZ C;  4ZBM A;  3BRC A;  1VF6 C;  4C7U A;  1H2L A;  4ZIB A;  3JYC A;  2CK3 G;  2XOK G;  2Y0I A;  4PA3 A;  3WU2 Z;  3G6B A;  2Y4T A;  1I08 A;  3RYF B;  3JD1 A;  2Q6A A;  2XAG A;  5HFM A;  2JS5 A;  5EBW C;  2UXD O;  3LDE A;  4DV4 B;  3UQ8 A;  1G1X B;  4CH4 A;  1H8E G;  2JGD A;  2ZIM A;  3GWK C;  4I0X A;  2ZE6 A;  5D5Q A;  4GLX A;  3UO2 A;  4DR5 O;  3SYA A;  1N4C A;  2UUB B;  1QBZ A;  3LDD A;  1WPB A;  2B9Z A;  2QKC A;  1Z5W A;  1XIL A;  5JH7 A;  1JMK C;  2MK3 A;  4KFM A;  2D2C B;  2Q5Z A;  4O2B B;  3OGC C;  5J2U B;  3B8M A;  4D6T H;  2B1G A;  2VWJ A;  4CS3 A;  2WLI A;  3ASN B;  2YXH A;  1V55 C;  1EN6 A;  3DXR A;  1VQK V;  4JI0 B;  5KHI A;  1U97 A;  4FPP A;  4LF8 O;  4TV9 A;  2N04 A;  4DUY O;  1EBO A;  2FTK A;  4PDM A;  4EKW A;  1I0H A;  5IDJ A;  1FS0 G;  4JI5 O;  1R6K A;  1N32 B;  4LNU A;  2HKO A;  4AQY O;  4CH3 A;  2CTP A;  4J11 A;  3RVZ A;  4GUN A; 
#chains in the Genus database with same CATH homology
 1MSD A;  1JA8 A;  1XUQ A;  3AK3 A;  3OT7 A;  3MDS A;  1LUV A;  3C3S A;  1SZX A;  4FFK A;  3KKY A;  1JR9 A;  1LUW A;  1Y67 A;  4C7U A;  1VAR A;  4JZ2 A;  5AG2 A;  3IC9 A;  2CDY A;  1I08 A;  1ZUQ A;  1GN3 A;  1IX9 A;  1IXB A;  1ZTE A;  1VEW A;  3RN4 A;  1N0J A;  3LSU A;  1WB7 A;  3BFR A;  3EVK A;  3TJT A;  1AR4 A;  1GN6 A;  1XDC A;  2QKC A;  1GN4 A;  4X9Q A;  1B06 A;  1XIL A;  1EN5 A;  1MNG A;  1PM9 A;  3DC6 A;  1EM1 A;  1GN2 A;  4BR6 A;  1AR5 A;  1BS3 A;  1KKC A;  2P4K A;  1AVM A;  3K9S A;  1N0N A;  2ADQ B;  3KDR A;  5A9G A;  3CEI A;  4F6E A;  3AK2 A;  4YIP A;  1BSM A;  1ZSP A;  1AP6 A;  1D5N A;  1QNM A;  2GDS A;  4JYY A;  1EN6 A;  2RCV A;  1IDS A;  3QVN A;  1MA1 A;  3C3T A;  3DC5 A;  1BT8 A;  2AW9 A;  1P7G A;  1PL4 A;  1WB8 A;  1XRE A;  1AP5 A;  1EN4 A;  3AK1 A;  1I0H A;  1MMM A;  2CE4 A;  2ADP A;  4JZG A;  2QKA A;  4E4E A;  1ZLZ A;  4YIO A;  4GUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...