1ZTEA

Contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAHVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
molecule keywords Superoxide dismutase [Mn], mitochondrial
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 71
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zteA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zteA02
1D5NA 3LSUA 1MA1A 1AVMA 3DC5A 4JZ2A 1XREA 1ZLZA 4BR6A 2RCVA 5A9GA 1JA8A 3AK3A 2ADPA 1WB7A 1QNMA 1ZTEA 3C3SA 3IC9A 1LUWA 1EN5A 1GN2A 3QVNA 4X9QA 2QKAA 3AK1A 1MNGA 1IXBA 3EVKA 1BT8A 1PL4A 2AW9A 1GN3A 1AR4A 1VEWA 4FFKA 3OT7A 2GDSA 1LUVA 1EM1A 1ZUQA 1GN6A 4C7UA 1MMMA 4GUNA 1SZXA 1VARA 3TJTA 1Y67A 3CEIA 1I08A 1JR9A 1IX9A 2CDYA 3AK2A 4JZGA 1BS3A 2ADQB 1AP6A 1AR5A 1EN6A 1ZSPA 1PM9A 2CE4A 1B06A 1WB8A 1IDSA 3KKYA 1N0NA 1P7GA 1XUQA 5AG2A 1EN4A 1MSDA 3DC6A 4YIOA 1GN4A 3RN4A 1I0HA 1AP5A 4E4EA 1KKCA 1XDCA 4F6EA 3C3TA 1BSMA 3K9SA 4YIPA 2P4KA 2QKCA 3BFRA 1N0JA 4JYYA 1XILA 3MDSA
chains in the Genus database with same CATH superfamily
4DXWA 1O9GA 4KHPB 4JZ2A 1QQCA 2BSKA 3ZRWA 4QJFB 3HKEB 1K73W 1LUWA 4LBEC 2M7WA 1EN5A 2ZDIC 2BTQB 3FYEB 1MSWD 1M56C 2EIKC 1WP8A 5CN0A 5IY5B 3FFQA 4CZZA 3EHBB 4U7NA 3ETEA 5JWPA 2HR3A 4LH6A 3CMEV 2GSMB 1XNRB 1AR4A 5CA0A 1H2LA 5CB4B 3LSSA 4ZHQB 1YEWA 4X1KB 3E8BA 3T1YB 4GUNA 3K59A 2UXBO 4JI4B 4X20A 2JGDB 3CP1A 5JCOC 1M5IA 2Y0PA 5JJJB 3LNMB 4L8JA 5KHIA 3RYIB 4J11A 1NI8A 2F1MA 1E79G 4G27B 1FPOA 2LW7A 1IXMA 4XBFA 2ZE8A 5LGUA 2XUMA 2FTKA 1Z5VA 5EBLC 2WSSG 2RMKB 1AR1B 3K9SA 3UO3A 3CS5A 4I50B 2YS8A 2F66C 1SERA 1HDJA 1R3KC 5HFMA 1T5EA 2EINC 1V9PA 2WLIB 4NXMB 2OT5A 2ZE7A 1DF5A 3DC5A 5KLVH 4W4KA 3STZC 1SA0A 2AZ2A 4OPAA 2Q7EA 3B77A 1XNQO 2JVDA 2K1EA 4UCOA 3JCUZ 1UPGA 3RVYA 1E1QG 1AJQA 4J42A 1XL4A 3LDDA 1SQPH 2EX3A 4TV8B 3JD3A 3QTCA 1XOUA 3ZBHA 2UXCO 2IJHA 4FM2A 4DR6O 3JATB 1PL4A 5DECA 4DR3B 4LF8O 1S77D 3DGEA 3CJHA 5L3GA 3QO5A 1KP2A 2UUCB 4YHHO 1G6UA 2GDSA 4MS2A 1GN6A 1H2GA 3RYHB 4D6TH 3ABUA 1IBLO 3H01A 4DV2B 1NVPB 4O4HB 4AILC 1DLBA 3U0ZA 1NQTA 5LHIA 2Q68A 3DSQA 4OX9B 3SPGA 4JTDB 2V1DA 2UXDO 1L1FA 4WBNA 1FXHA 2JDIG 2A7WA 2JS5A 2W6JG 3OAAG 3LSQA 2DQ3A 3GWKC 4LF6O 3QF7A 4JGSA 4BWAA 1EN6A 5LGNA 2YIDA 1N0NA 4DRXB 1KMIZ 1XUQA 3SYOA 1K7DA 3ABLB 2UXBB 5LA6B 2VQEB 4X89A 1WA8A 5B1AB 1XEQA 2CGNA 1YSCA 4YIOA 2Y0IA 1YVWA 1KUQA 4DYLA 3E86A 4ZKIA 4F6EA 3C3TA 5JH7B 3E22B 1M57B 3OE7G 1NTMH 3ZN0A 2Q73A 4J9ZB 4B08A 1SS3A 1DGSA 2ILMA 1G1XB 1XILA 4TUYB 5L3BA 1FXKC 1HNWO 1KD1W 5H6RA 3F5TA 2JGUA 5J9PC 1N33O 1B6QA 1I94O 2P6JA 3P30A 1D2DA 2YXLA 4QPJA 1ORQC 3CCMV 1GTOA 5E1AC 4EB6A 4NTYA 1GN2A 2LGWA 3QG5A 4DV3O 4LR3A 1VF7A 4WFAV 1EZVH 1GK9A 1BQ0A 2ODMA 1RSOA 2AHZA 1VEWA 2CH7A 4H0LB 3WG7B 1XNQB 1YZBA 3UT5B 3G6BA 3T2MA 2ZKOA 3NR7A 3BY6A 3BA9A 4JV5B 4LFCO 4QPKA 4DV5B 5ITZB 1BMFG 2X0LA 2QTOA 4J7JA 2UXCB 4ZBMA 4K35A 4WFBV 3KZIZ 3ZN1A 3CCUV 3CPWU 4PD4F 2HHHO 2OCHA 1AP6A 4PV1B 1JCHA 4DR2B 1AR5A 4JASA 5LOVB 4YHHB 4DV4B 5IJ9A 1ZSPA 1K4DC 4FJCC 4LF7O 3JD4A 1V55C 4MVMA 3VBBA 4JI8O 3OMIB 5KHKA 2ZXWC 2OYQA 1KBHA 1NTKH 1MABG 4TQFA 3CRQA 2NNUA 3AG1C 1KECA 4LF6B 4QE7A 4WFFA 1AILA 3L71H 1N0JA 4GX1A 5FPRA 2ETNA 2DYSB 1Y6XA 3UO2A 4X66O 3HKDA 4FZ1A 1ZL8B 3OEEG 4O2BB 3W7TA 2IU3A 2KQXA 4O4LB 1VIBA 2A79B 5B5EZ 5C93A 4PJ0Z 2DYRB 1XL6A 4UCVA 2PYJA 4LWSB 3VQWA 5KHJA 1PPJH 3ZHSA 2Q4PA 3K06A 3SDLA 4GX5A 3RWRD 1VF6C 3SR2C 3ABKC 3RYFA 3LUTB 4O4JB 5IT9N 2G38A 1NTZH 3ZEDA 2JEUA 4RQFA 4LNUA 1SF9A 1GM8A 4ZIBA 2DQ0A 2RQ6A 2R72A 1TVKB 2YXHA 2EIJB 3Q4HB 2HG5C 4WFGA 1FXKA 5IE9A 5LMUO 2UUBO 1TUBA 4JYCA 3CXHF 4UFZA 3STLC 1WB8A 2A3QA 1TGOA 1Y76A 5B3SC 4B3RB 2JGDA 4DR5B 2VS0A 2AZ0A 2Z5UA 2H94A 3T1HO 1NH2D 1OCRB 1SETA 5JJNB 4I55B 4XDLA 1J5EB 4CS4A 2KB1A 1F4NA 4LF7B 3OEHG 3MDSA 2QWQB 3ZJZA 1K3EA 3A8TA 4U7OA 1N36O 3JAWA 4JI8B 3TGUH 1M56B 1KU9A 2EIKB 5LYJA 1H2KA 2ADPA 4LFBO 5EC2C 5KMGB 3OTOO 1H5WA 4G28B 4I9QA 4YJ2A 5C8YA 1FFTB 4J7KA 1YTFD 1BCCH 2WLIA 1PNMA 1B3QA 5FPOA 1WNSA 2LO1A 3JAKB 1IBKB 4BIUA 1L0NH 1ZWIC 3FKSG 4MW8A 2NLJC 3AG4C 3N27A 3SJCC 2ZINA 2PUSA 2B1GA 5B1OA 1V54B 3AG2B 1NT2B 3WB0A 1YHQV 4DV7B 2FKXA 2QSAA 3ZMUA 1SZXA 1JPXA 4GKKO 4L87A 1JR9A 1HWYA 1YITV 2HJFC 3N2KB 2GV9A 2EIMC 1BE3H 2OTLV 1M90W 2WWWA 4WFEA 3VQVA 4IHJA 1AJNA 4FLXA 2B1IA 5BMVA 2EZPA 2AGAA 2P4VA 1U97A 1ZAUA 1PP9H 5BY1A 1DF4A 3BPZA 3OUSA 1HNXB 1KC8W 3CWBH 5D5PA 2AHYA 1YJ9V 3CCVV 1Q82W 4X65O 4UCSA 2L6LA 1AP5A 4CC6A 4RUEA 2OWOA 4UCRA 1CP9A 3SYPA 4O4IA 3NXSA 4RQEA 5F2VO 2QKCA 5LMUB 5L3CA 2H3OA 1F51A 2QWPB 4GX0A 4Z2WA 4B3SB 5DEDA 4JI6O 2QWRB 5LA6A 1OCOB 4MVRA 4X64B 1WPXA 4X1IA 1URFA 5CMUA 3UCSC 3JARB 3WU2Z 5IDJA 1QVGU 4FFBB 3E22A 2UUAO 4HAMA 4N23A 4PA3A 1VQ7V 3F5WC 3H1KH 5BR8O 2EJRA 3H1JH 4ZI7B 3TK1A 4NKGB 2QE7G 2C2AA 3O9OA 2YI9A 1MNGA 4GYCB 4F4LA 3DXRB 1XMQB 1GN3A 4GX2A 2EILC 1VQ8V 4LFBB 2YEVB 3HKCA 2Q8VA 3CCJV 2DN9A 3ABMB 1R3LC 3ZIAG 1IX9A 1W0KG 3U11A 1QLNA 4FLYA 1RM1C 3K3WA 3N2GA 4JAVA 1Q6IA 2QDOA 1KB9F 1M93A 1H2MA 3CX5F 3APQA 1K92A 3JSLA 2HKOA 3UQ8A 3APOA 2ZCEA 1S5LZ 4FPPA 3WB1A 1FOUA 1B06A 4NVPA 1RP3B 5ITZA 3ASNC 1SQVH 1Q7YW 3CC2V 2W6IG 3MAQA 1YJNV 3FD9A 1Z5WA 1N4CA 1XDCA 5IWAO 3H1LH 2QEXV 2Q0AA 3KDRA 4YJ3B 2E76B 5LXTB 4HNAA 1AJPA 4NR1A 4PA4A 1P49A 1S76D 2Q5ZA 3C90A 3TETA 4DV6O 1R3JC 3M7MX 1BL8A 1AVMA 4OXSA 2P67A 2H8PC 2HEPA 1S5HC 2ZNIA 3OTFA 1JVMA 4UB8Z 1QLEB 3H9VA 3OR7C 1KYOF 1XHXA 1K97A 3IFXA 2WAMA 3L74H 1JFFB 3HR0A 3CC4V 3W7SA 5JVDA 3JASA 5CA3A 1SZTA 5A2QN 3AK1A 3FB7C 2Q6AA 4JI6B 1VF5B 5EBWC 1KKDA 5IYCO 3SJQC 3K58A 3BHPA 5B66Z 3KCYA 4GCZA 2GTSA 3OT7A 1ZL8A 2JJ1G 3FB5C 4WF9V 2RN9A 3J7AU 1PKXA 4P2ZA 2HVJC 4XDJA 3BEHA 3X2QB 3BAAA 1MMMA 4JI3B 5EBMC 2UUAB 4JI0B 4NXNO 2D3OW 1G8MA 1LR1A 5BR8B 3CEIA 3A0BZ 4CH3A 4JPRA 3CC7V 5LMNB 2X6AA 4DV0O 1V55B 1HNZO 3R66A 5J2TB 2PTMA 4JZGA 2ADQB 2UU9O 3SPJA 3T4DA 4DUYO 3B8NA 4FK5C 1GM7A 3CCSV 1M9NA 5EYPB 1QR9A 1IDSA 2QWNB 1R73A 3A0HZ 3RYCB 1XHZA 3CRRA 1AI5A 3MHHC 2CAZC 2ZT9B 2WLMA 3OW2U 1BGYH 3RN4A 1AROP 4PDVA 4RO2A 1OCZC 5GONB 5H5NA 2CUGA 3GWOA 4O2AA 4K8XA 1EZJA 1SQGA 4ZOLA 2IH3C 4LP8A 2IW5A 3UM7A 2OCCC 4IYIA 4KXRA 2RJZA 2YC0A 4UXNA 3CD6V 3B8MA 4DR1O 2A06H 1N34O 4DK0A 2OTJV 2KKWA 3QO8A 4TV9A 5B1BB 5FNVB 1Y74B 2RCVA 4U3JA 3RVZA 4DO2A 1Q6UA 3CRMA 2ITDC 5IWAB 2ITCC 3CMAV 5H2FZ 1QNMA 3SPIA 3A0RA 5IY5C 5IYDO 4I55A 1ENVA 3C3SA 1OJHA 4J7ZA 4FLVA 4IT5A 3ZHUA 2XT9A 5JQGB 3LNNA 5CA1A 4PHZA 1F23A 2Q7GA 4PA7A 2WLLB 3JD0A 2Q0OC 5LHHA 4I5SA 1NU1H 4R6ZA 1K5QA 5KMGA 5GTHZ 5H9CA 3ETDA 3JALB 4X1YB 4I0XB 3MHSC 3O65A 5J2UA 2P7TC 1FYJA 1XI1A 2DWEC 2WLNA 1JJ2U 2CDYA 3ZHQA 5IYZB 2Y69B 2BSKB 4B7KA 4MVSA 3K03A 1OHHG 4Z1VA 4DR4O 5FLXN 5KA5A 1K8AW 3L75H 1QVFU 3A2FA 2P06A 2DWDC 3IC7A 3KCXA 3D3QA 1HP8A 4CBCA 1EN4A 4PA6A 4I7ZB 3N2KA 2JJ2G 4FLTA 1I0HA 5CA0B 4PI0A 1JNBA 2BOCC 4DR6B 1HNZB 5LP6B 4LF8B 3B40A 2GUZB 3FX7A 1Y4MA 2ZNJA 1XBLA 1GAXA 3BFRA 4CH4A 2Q69A 1HW7A 1TUEB 4X62O 1IBLB 4X8AA 3D36A 1K33A 1VQLV 2BOBC 4X20B 2E5LO 1P84F 4UUJC 3RBZA 3ASOB 2FYUH 3JD2A 4UCUA 4MT8A 5A9GA 2UXDB 1JA8A 1NVPD 3ZMVA 4MVUA 1LNQA 1QHTA 1JX9A 4JI1O 3IC9A 3IAYA 3F7VC 3K04A 5L3DA 4GLXA 2QKAA 1IXBA 5KX5A 3K08A 3RW0A 2XHBA 1FFXA 2GTAA 3RT3C 3B09A 3OMAB 3JAMN 2WA3A 4WCEV 2X6BA 4LF4O 2EIMB 3G6EV 1G4YB 2KG7A 1SRYA 1KQSU 4UCTA 2DOSA 3TJTA 1OCCB 3RGBA 5LGTA 2XAFA 1N32O 3BRCA 2VQFO 1HNWB 1L8DA 1NJIW 4BAYA 2E3CA 2IM9A 1QR8A 4DV1O 3TXSA 3FAVB 4D7TA 2ZM6O 1N33B 2JK5C 1AI7A 1I94B 1UJWB 3ABLC 2VWJA 1US6A 3ZX6A 5EK0A 4B3MO 3HKEA 2PYLA 4PELA 4QE9A 2F4VO 2BTQA 1W0JG 4DV3B 1M57C 3EFFK 3G71V 4B3TO 1WN7A 2V4DA 4EFBA 1IBMO 3L70H 3W7XA 3K5OA 1FAFA 4UVBA 4HYOA 2QM8A 5CB4A 3H1HH 3S3WA 3GVMA 4X88A 4ZHQA 3ICXA 4X1KA 1ZX3A 2LW1A 3ZMSA 4LFCB 3JSNA 1D5NA 4DW1A 1QBZA 2WLJA 4K0KO 4WBNB 2CK3G 1FD9A 1OV9A 3LDCA 1S5JA 4IYHA 2HHHB 3OUFA 5H6QA 4AHCA 4DR7O 4UV9A 5L3EA 1AI4A 3RYIA 4YJ3A 1K34A 4JYAO 5LXTA 2CTRA 4TQDA 1XMOO 4CC5A 4MW3A 1WA8B 4DUZO 2E74B 4X62B 3P32A 1K9MW 4FLZA 2F23A 2RDCA 2B5UA 3WG7C 3D8CA 2CGOA 1MOFA 1GMGA 2F93B 5KA6A 4XDKA 4J80A 2JIZG 4H44B 1VQOV 4JTCB 3CHXA 4LF9O 1WLEA 4YY3O 4I50A 3BCCH 4H13B 1VARA 2Q9LA 1O9HA 4KHPO 3DTUB 1PL0A 1SESA 3S3XA 4DW0A 1MZEA 4Q20A 1CPYA 3W7UA 4MSWC 2Z3YA 5FL7G 3QO7A 4X66B 1PD3A 2YI8A 3VQYA 5KHGA 1IVSA 2N04A 4H33A 4EB6B 2LQTA 4JI5O 1IZ3A 4TV8A 1CXZB 1VQKV 4PDLA 4I4TB 4W4LA 1VQ4V 4LH7A 5B1NA 2ZE6A 2VQFB 1RSOB 2FB5A 4MTFA 3SJBC 2CH7B 3JATA 5J2TA 3AG3C 4PDMA 2DYSC 2DJVA 1EBOA 4NTXA 4H37A 4EFEA 5EYPA 3LDEA 3RYHA 3OM3B 4OPHA 3SPHA 4O4HA 1N8RW 1H2NA 2XAJA 4J41A 1H8HG 1TAEA 3TXQA 2EINB 1K4CC 4MVQA 4LC1A 1IBMB 2DYRC 2GBOA 2IJIA 2WLKA 3KG2A 1S72V 1R6KA 5IJ9B 1WB7A 2EBOA 3E8GA 1QU7A 1NKDA 1Z2GA 5IYBO 4E2LA 2YIBA 4PDRA 2PZSA 2UUBB 2Y48A 3CYOA 5K1PA 3TCUA 4DRXA 1M1KW 1Q90D 4QNHB 2QJ1A 5KHHA 5EC1C 4K0KB 1IJGA 4JAAA 1VQ5V 2ZE5A 3G67A 1K5SA 1LUVA 4FVMA 3JCZA 5JH7A 3T1HB 1VP7A 2ARHA 1Y67A 2EIJC 3CXCU 2OIEA 4TUYA 2R9RB 3ABTA 3AK2A 2QR4A 4DUZB 3HKDB 2PI5A 1Q6HA 2IBZH 3ETGA 2O57A 3BA8A 4CS2A 1FXVA 3E2EA 1N36B 1CEZA 2WLLA 1THZA 5D5QA 2MW2B 3I55V 4ABMA 4YY3B 5K1XA 1NS1A 2PGGA 3OTOB 2MK3A 3JALA 3EXAA 4X1YA 3ZCCA 2NR5A 1WPBA 3B2EE 1R6TA 4DR3O 2OCCB 4ICGA 2Z0AA 1PNKA 1OCRC 5IYZA 2UUCO 1GN4A 2ATKC 4E4EA 5DM6V 1R6NA 3RYFB 1I7FA 5EZYB 2R9IA 4DV2O 3UT5A 1QCEA 3G4SV 3OMNB 3PJSK 4GZRB 4NYKA 3CCQV 4LNUB 4JI5B 4OX9O 4QIWF 4GKKB 1AI6A 2LP7A 2AXTZ 1F7YA 2ZIOA 3HB3B 1FXKB 3K57A 2P90A 3IGAC 5LP6A 1TUBB 2GUZA 1Q43A 1ZTEA 4EEQA 5LOVA 4LF5O 1SQBH 3VOUA 1Y76B 2XAQA 2VQEO 2XTAA 4X9QA 4F6RB 1BT8A 1V54C 3AG2C 4LFAO 1BZKA 1VQ9V 4X65B 4BW5A 2YIAA 2M6YA 4J9YB 4IGGA 2QA4V 4MTOA 4TWKA 4FMTA 4JI2O 3CRAA 3L73H 1I08A 4UV8A 3JAWB 3B4SA 3G80A 1W2BU 2LGQA 1Q8IA 2FMLA 5LYJB 2KSDA 1BS3A 1UFIA 2Y4UA 4B7EA 3D36C 3ZRVA 4PA9A 2YSUB 1YCIA 2FL4A 5L3FA 4YJ2B 4O2BA 5C8YB 4GKJO 1KP3A 4IL6Z 4O4LA 4A5UB 2QKSA 4ASUG 4JTAB 3F7YC 4RUFA 1MG1A 3ZHTA 3ZS8C 3K5NA 3CCLV 4LWSA 1OZ0A 2DMXA 4IIJB 5TISZ 5IJ0B 3FAVA 4TT3G 4OGQB 2P4KA 4AI8A 4JV5O 2XAHA 4DV5O 2ZXWB 3SJAC 4JAUA 1SQXH 4O4JA 1IURA 1YIJV 4JYYA 1OCOC 1Q5OA 1GM9A 1W59A 3ZHRA 3AG1B 2BTOA 2Y4TA 1GO3F 5CBHA 3E83A 3K79A 3L9DA 4FM1A 4IHJB 2XOKG 1XREA 4DR2O 5BMVB 1TVKA 5CBGA 4DV4O 5LBQA 1VQMV 3Q4HA 4K8ZA 1BHBA 4RWUA 4HZ3A 3CCEV 2YDEA 3PN1A 3JYCA 1MZFA 2F43G 1WP7A 3CE2A 4KP4A 4JYBA 4CH6A 2BCCH 2UXNA 4O4IB 2ZQMA 1EM1A 2K9PA 3ABMC 3HKBB 1ZUQA 1PV0A 4U3FH 4LF5B 2DE0X 1JMKC 3ABKB 5DN6G 5BXZA 3OGCC 1F4MA 2CTQA 3E35A 4DV6B 4X1IB 4JI7O 4CS3A 4LFAB 2CTPA 2ZDIA 4KFMA 3ZMTA 1M4UA 2N05A 3BVOA 1A32A 5GTIZ 3FB8C 2CE4A 1Q81W 4JI2B 3T4ZA 3P3NA 3CRCA 1FJGO 2P22C 4R8CA 4BIOA 1BHAA 3FB6C 1B04A 4EKWA 5E79Z 3WB2A 5AG2A 2YUAA 3DC6A 3ZRXA 1YI2V 3H1IH 4DK1A 3JAKA 4FZ0A 2GHYA 4HBNA 3ZRWB 3P3PA 3HKCB 5B3SB 1BSMA 1H38A 1SQQH 3FYIB 5JCOA 4FIPC 2A0LA 2E75B 4NB5A 2PI4A 4GKJB 2D2CB 4NXNB 2NN4A 3LSUA 3N2GB 1QLEC 2JRIA 2IU0A 4I4TA 1U96A 1RFYA 1ZLZA 4BR6A 2EJ7A 1SQFA 2WLHA 4DV0B 3ETQA 2QM4A 4AQYO 1YF2A 2UU9B 4NTWA 4DUYB 3BABA 1S3JA 4J10A 3ZMZA 1VQPV 1NH2B 4WFHA 2ZIMA 1HR0O 4B3RO 1WAZA 3EVKA 3R65A 3VQXA 5HFLA 1WJZA 4DR5O 1GKFA 1J95A 3K9AA 3X2QC 3K5MA 5KAFZ 1J5EO 4HNAB 3SYCA 2IJKA 4C7UA 2WPDG 3AG4B 1YJWV 3JD1A 3GB7C 4GT1A 4I9WA 2ZR2A 4DR1B 1N34B 1NR1A 4Z1MG 2YIBD 1I5XA 1YTFB 2PF4E 3CCRV 2F95B 1RPOA 4UVAA 3JARA 1BQZA 5JVDB 2JEXA 4FFBA 4FLUA 3AG3B 1E1RG 3JASB 3KKYA 1NR7A 4ZI7A 1NZ6A 1Q86W 4FM0A 2RNBA 3SPCA 1VQNV 1IBKO 1YXBA 1JOYA 3MD0A 4MVOA 1SA0B 3OR6C 3DXRA 4JI7B 1P7BA 2DW4A 3E89A 4DV7O 4YIPA 2YEVA 1JJOA 5LHGA 2X7RB 5B1AC 3UKMA 2QGNA 5B1BC 2OIGA 2VWKA 1FJGB 3E8FA 4P9OA 1MA1A 1DK1A 2EZOA 4D7SA 3SYAA 4Q6GA 3CJHB 3ZRSA 3AK3A 4PI2A 4DR4B 5EZYA 2HJDA 1R3IC 3M8AA 3K5LA 1HNXO 2XASA 3T1CA 5KUMA 2VRZA 3QVNA 3HPLC 1Q3EA 2HP8A 1P4RA 1EFRG 2CTWA 2UXXA 3W7WA 1AB3A 4O2AB 4FFKA 4ZOLB 4AQYB 1I5YA 2IH1C 5LL6Y 1PNLA 3J80N 1ROPA 4R50A 4K3AA 2EILB 2Y69C 4B3SO 2LJ2A 2HVKC 2QTSA 1COWG 2B9ZA 4X64O 5CBFA 1HR0B 4TV9B 4F6RA 3K0DA 2E5LB 4U3JB 3M99B 2HFEC 5JJEB 4FLWA 4R7CA 1RM1B 3I56V 2ZR3A 1X59A 4UVCA 1JFFA 4JF3A 4JI1B 5CA1B 4QGPA 2YXYA 5LP6C 2LFSA 1GRJA 3K0GA 1XMQO 3I5DA 3OD4A 2QM7A 1YDXA 1H8EG 3ASNB 5EIBD 2XNDG 2IJJA 4BW9A 4LF4B 1DTOA 5J2UB 3WFVA 3RFRA 4TOIA 3ASOC 1Y66A 2P5OA 3QNEA 2JS3A 1SKVA 5GW7A 2PY5A 2LFRA 2R9AA 1N32B 1XNRO 2W0FC 3OFNG 1FS0G 1FKAO 5EIBC 4IIJA 3OGIB 3E8HA 5IJ0A 4DV1B 2ZM6B 3AG7A 1XQ8A 3T1YO 4KUMA 2Q67A 4B3MB 4P9PA 4JI4O 2A9HA 3SYQA 3RYCA 2QWOB 2W0XA 2F4VB 2AW9A 4BIZA 1D5AA 2Q7HA 4CH5A 3CB2A 1VQ6V 4N21A 2BE3A 1L0LH 4B3TB 5BZBA 5GONA 1OCCC 3L72H 4MVZA 4TSFG 5KAIZ 3ML0A 2V7QG 4KL1A 1X4TA 2WA4A 2X6CA 2ZD9A 2HLDG 4MTXA 3SGIA 4RAIA 1TA8A 4UB6Z 3IJ4A 5FNVA 3ZHVA 1Y74A 2N74A 1VMGA 4YXWG 2L35A 3THOA 3HKBA 1PM9A 4DR7B 1SC5B 2XAGA 5KUKA 1R1BA 1P7GA 4JYAB 1VF6A 4NXMO 1JQ0A 5KX5B 3CSXA 5JQGA 1H2SB 2EULA 1XMOB 3J81N 1FFXB 1GH6A 4LCUC 1MSDA 1NBMG 4MTGA 2R70A 3AEIA 1KKCA 1S0VA 2KG7B 4JI3O 4G2KA 4JI0O 2YICA 1OCZB 4P30A 4LF9B 3D3IA 5LMNO 1RPRA 3U10A 4I0XA
chains in the Genus database with same CATH topology
1D5NA 3LSUA 1MA1A 1AVMA 3DC5A 4JZ2A 1XREA 1ZLZA 4BR6A 2RCVA 5A9GA 1JA8A 3AK3A 2ADPA 1WB7A 1QNMA 1ZTEA 3C3SA 3IC9A 1LUWA 1EN5A 1GN2A 3QVNA 4X9QA 2QKAA 3AK1A 1MNGA 1IXBA 3EVKA 1BT8A 1PL4A 2AW9A 1GN3A 1AR4A 1VEWA 4FFKA 3OT7A 2GDSA 1LUVA 1EM1A 1ZUQA 1GN6A 4C7UA 1MMMA 4GUNA 1SZXA 1VARA 3TJTA 1Y67A 3CEIA 1I08A 1JR9A 1IX9A 2CDYA 3AK2A 4JZGA 1BS3A 2ADQB 1AP6A 1AR5A 1EN6A 1ZSPA 1PM9A 2CE4A 1B06A 1WB8A 1IDSA 3KKYA 1N0NA 1P7GA 1XUQA 5AG2A 1EN4A 1MSDA 3DC6A 4YIOA 1GN4A 3RN4A 1I0HA 1AP5A 4E4EA 1KKCA 1XDCA 4F6EA 3C3TA 1BSMA 3K9SA 4YIPA 3KDRA 2P4KA 2QKCA 3BFRA 1N0JA 4JYYA 1XILA 3MDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5N A;  3LSU A;  1MA1 A;  1AVM A;  3DC5 A;  4JZ2 A;  1XRE A;  1ZLZ A;  4BR6 A;  2RCV A;  5A9G A;  1JA8 A;  3AK3 A;  2ADP A;  1WB7 A;  1QNM A;  1ZTE A;  3C3S A;  3IC9 A;  1LUW A;  1EN5 A;  1GN2 A;  3QVN A;  4X9Q A;  2QKA A;  3AK1 A;  1MNG A;  1IXB A;  3EVK A;  1BT8 A;  1PL4 A;  2AW9 A;  1GN3 A;  1AR4 A;  1VEW A;  4FFK A;  3OT7 A;  2GDS A;  1LUV A;  1EM1 A;  1ZUQ A;  1GN6 A;  4C7U A;  1MMM A;  4GUN A;  1SZX A;  1VAR A;  3TJT A;  1Y67 A;  3CEI A;  1I08 A;  1JR9 A;  1IX9 A;  2CDY A;  3AK2 A;  4JZG A;  1BS3 A;  2ADQ B;  1AP6 A;  1AR5 A;  1EN6 A;  1ZSP A;  1PM9 A;  2CE4 A;  1B06 A;  1WB8 A;  1IDS A;  3KKY A;  1N0N A;  1P7G A;  1XUQ A;  5AG2 A;  1EN4 A;  1MSD A;  3DC6 A;  4YIO A;  1GN4 A;  3RN4 A;  1I0H A;  1AP5 A;  4E4E A;  1KKC A;  1XDC A;  4F6E A;  3C3T A;  1BSM A;  3K9S A;  4YIP A;  2P4K A;  2QKC A;  3BFR A;  1N0J A;  4JYY A;  1XIL A;  3MDS A; 
#chains in the Genus database with same CATH topology
 4DXW A;  1O9G A;  4KHP B;  4JZ2 A;  1QQC A;  2BSK A;  3ZRW A;  4QJF B;  3HKE B;  1K73 W;  1LUW A;  4LBE C;  2M7W A;  1EN5 A;  2ZDI C;  2BTQ B;  3FYE B;  1MSW D;  1M56 C;  2EIK C;  1WP8 A;  5CN0 A;  5IY5 B;  3FFQ A;  4CZZ A;  3EHB B;  4U7N A;  3ETE A;  5JWP A;  2HR3 A;  4LH6 A;  3CME V;  2GSM B;  1XNR B;  1AR4 A;  5CA0 A;  1H2L A;  5CB4 B;  3LSS A;  4ZHQ B;  1YEW A;  4X1K B;  3E8B A;  3T1Y B;  4GUN A;  3K59 A;  2UXB O;  4JI4 B;  4X20 A;  2JGD B;  3CP1 A;  5JCO C;  1M5I A;  2Y0P A;  5JJJ B;  3LNM B;  4L8J A;  5KHI A;  3RYI B;  4J11 A;  1NI8 A;  2F1M A;  1E79 G;  4G27 B;  1FPO A;  2LW7 A;  1IXM A;  4XBF A;  2ZE8 A;  5LGU A;  2XUM A;  2FTK A;  1Z5V A;  5EBL C;  2WSS G;  2RMK B;  1AR1 B;  3K9S A;  3UO3 A;  3CS5 A;  4I50 B;  2YS8 A;  2F66 C;  1SER A;  1HDJ A;  1R3K C;  5HFM A;  1T5E A;  2EIN C;  1V9P A;  2WLI B;  4NXM B;  2OT5 A;  2ZE7 A;  1DF5 A;  3DC5 A;  5KLV H;  4W4K A;  3STZ C;  1SA0 A;  2AZ2 A;  4OPA A;  2Q7E A;  3B77 A;  1XNQ O;  2JVD A;  2K1E A;  4UCO A;  3JCU Z;  1UPG A;  3RVY A;  1E1Q G;  1AJQ A;  4J42 A;  1XL4 A;  3LDD A;  1SQP H;  2EX3 A;  4TV8 B;  3JD3 A;  3QTC A;  1XOU A;  3ZBH A;  2UXC O;  2IJH A;  4FM2 A;  4DR6 O;  3JAT B;  1PL4 A;  5DEC A;  4DR3 B;  4LF8 O;  1S77 D;  3DGE A;  3CJH A;  5L3G A;  3QO5 A;  1KP2 A;  2UUC B;  4YHH O;  1G6U A;  2GDS A;  4MS2 A;  1GN6 A;  1H2G A;  3RYH B;  4D6T H;  3ABU A;  1IBL O;  3H01 A;  4DV2 B;  1NVP B;  4O4H B;  4AIL C;  1DLB A;  3U0Z A;  1NQT A;  5LHI A;  2Q68 A;  3DSQ A;  4OX9 B;  3SPG A;  4JTD B;  2V1D A;  2UXD O;  1L1F A;  4WBN A;  1FXH A;  2JDI G;  2A7W A;  2JS5 A;  2W6J G;  3OAA G;  3LSQ A;  2DQ3 A;  3GWK C;  4LF6 O;  3QF7 A;  4JGS A;  4BWA A;  1EN6 A;  5LGN A;  2YID A;  1N0N A;  4DRX B;  1KMI Z;  1XUQ A;  3SYO A;  1K7D A;  3ABL B;  2UXB B;  5LA6 B;  2VQE B;  4X89 A;  1WA8 A;  5B1A B;  1XEQ A;  2CGN A;  1YSC A;  4YIO A;  2Y0I A;  1YVW A;  1KUQ A;  4DYL A;  3E86 A;  4ZKI A;  4F6E A;  3C3T A;  5JH7 B;  3E22 B;  1M57 B;  3OE7 G;  1NTM H;  3ZN0 A;  2Q73 A;  4J9Z B;  4B08 A;  1SS3 A;  1DGS A;  2ILM A;  1G1X B;  1XIL A;  4TUY B;  5L3B A;  1FXK C;  1HNW O;  1KD1 W;  5H6R A;  3F5T A;  2JGU A;  5J9P C;  1N33 O;  1B6Q A;  1I94 O;  2P6J A;  3P30 A;  1D2D A;  2YXL A;  4QPJ A;  1ORQ C;  3CCM V;  1GTO A;  5E1A C;  4EB6 A;  4NTY A;  1GN2 A;  2LGW A;  3QG5 A;  4DV3 O;  4LR3 A;  1VF7 A;  4WFA V;  1EZV H;  1GK9 A;  1BQ0 A;  2ODM A;  1RSO A;  2AHZ A;  1VEW A;  2CH7 A;  4H0L B;  3WG7 B;  1XNQ B;  1YZB A;  3UT5 B;  3G6B A;  3T2M A;  2ZKO A;  3NR7 A;  3BY6 A;  3BA9 A;  4JV5 B;  4LFC O;  4QPK A;  4DV5 B;  5ITZ B;  1BMF G;  2X0L A;  2QTO A;  4J7J A;  2UXC B;  4ZBM A;  4K35 A;  4WFB V;  3KZI Z;  3ZN1 A;  3CCU V;  3CPW U;  4PD4 F;  2HHH O;  2OCH A;  1AP6 A;  4PV1 B;  1JCH A;  4DR2 B;  1AR5 A;  4JAS A;  5LOV B;  4YHH B;  4DV4 B;  5IJ9 A;  1ZSP A;  1K4D C;  4FJC C;  4LF7 O;  3JD4 A;  1V55 C;  4MVM A;  3VBB A;  4JI8 O;  3OMI B;  5KHK A;  2ZXW C;  2OYQ A;  1KBH A;  1NTK H;  1MAB G;  4TQF A;  3CRQ A;  2NNU A;  3AG1 C;  1KEC A;  4LF6 B;  4QE7 A;  4WFF A;  1AIL A;  3L71 H;  1N0J A;  4GX1 A;  5FPR A;  2ETN A;  2DYS B;  1Y6X A;  3UO2 A;  4X66 O;  3HKD A;  4FZ1 A;  1ZL8 B;  3OEE G;  4O2B B;  3W7T A;  2IU3 A;  2KQX A;  4O4L B;  1VIB A;  2A79 B;  5B5E Z;  5C93 A;  4PJ0 Z;  2DYR B;  1XL6 A;  4UCV A;  2PYJ A;  4LWS B;  3VQW A;  5KHJ A;  1PPJ H;  3ZHS A;  2Q4P A;  3K06 A;  3SDL A;  4GX5 A;  3RWR D;  1VF6 C;  3SR2 C;  3ABK C;  3RYF A;  3LUT B;  4O4J B;  5IT9 N;  2G38 A;  1NTZ H;  3ZED A;  2JEU A;  4RQF A;  4LNU A;  1SF9 A;  1GM8 A;  4ZIB A;  2DQ0 A;  2RQ6 A;  2R72 A;  1TVK B;  2YXH A;  2EIJ B;  3Q4H B;  2HG5 C;  4WFG A;  1FXK A;  5IE9 A;  5LMU O;  2UUB O;  1TUB A;  4JYC A;  3CXH F;  4UFZ A;  3STL C;  1WB8 A;  2A3Q A;  1TGO A;  1Y76 A;  5B3S C;  4B3R B;  2JGD A;  4DR5 B;  2VS0 A;  2AZ0 A;  2Z5U A;  2H94 A;  3T1H O;  1NH2 D;  1OCR B;  1SET A;  5JJN B;  4I55 B;  4XDL A;  1J5E B;  4CS4 A;  2KB1 A;  1F4N A;  4LF7 B;  3OEH G;  3MDS A;  2QWQ B;  3ZJZ A;  1K3E A;  3A8T A;  4U7O A;  1N36 O;  3JAW A;  4JI8 B;  3TGU H;  1M56 B;  1KU9 A;  2EIK B;  5LYJ A;  1H2K A;  2ADP A;  4LFB O;  5EC2 C;  5KMG B;  3OTO O;  1H5W A;  4G28 B;  4I9Q A;  4YJ2 A;  5C8Y A;  1FFT B;  4J7K A;  1YTF D;  1BCC H;  2WLI A;  1PNM A;  1B3Q A;  5FPO A;  1WNS A;  2LO1 A;  3JAK B;  1IBK B;  4BIU A;  1L0N H;  1ZWI C;  3FKS G;  4MW8 A;  2NLJ C;  3AG4 C;  3N27 A;  3SJC C;  2ZIN A;  2PUS A;  2B1G A;  5B1O A;  1V54 B;  3AG2 B;  1NT2 B;  3WB0 A;  1YHQ V;  4DV7 B;  2FKX A;  2QSA A;  3ZMU A;  1SZX A;  1JPX A;  4GKK O;  4L87 A;  1JR9 A;  1HWY A;  1YIT V;  2HJF C;  3N2K B;  2GV9 A;  2EIM C;  1BE3 H;  2OTL V;  1M90 W;  2WWW A;  4WFE A;  3VQV A;  4IHJ A;  1AJN A;  4FLX A;  2B1I A;  5BMV A;  2EZP A;  2AGA A;  2P4V A;  1U97 A;  1ZAU A;  1PP9 H;  5BY1 A;  1DF4 A;  3BPZ A;  3OUS A;  1HNX B;  1KC8 W;  3CWB H;  5D5P A;  2AHY A;  1YJ9 V;  3CCV V;  1Q82 W;  4X65 O;  4UCS A;  2L6L A;  1AP5 A;  4CC6 A;  4RUE A;  2OWO A;  4UCR A;  1CP9 A;  3SYP A;  4O4I A;  3NXS A;  4RQE A;  5F2V O;  2QKC A;  5LMU B;  5L3C A;  2H3O A;  1F51 A;  2QWP B;  4GX0 A;  4Z2W A;  4B3S B;  5DED A;  4JI6 O;  2QWR B;  5LA6 A;  1OCO B;  4MVR A;  4X64 B;  1WPX A;  4X1I A;  1URF A;  5CMU A;  3UCS C;  3JAR B;  3WU2 Z;  5IDJ A;  1QVG U;  4FFB B;  3E22 A;  2UUA O;  4HAM A;  4N23 A;  4PA3 A;  1VQ7 V;  3F5W C;  3H1K H;  5BR8 O;  2EJR A;  3H1J H;  4ZI7 B;  3TK1 A;  4NKG B;  2QE7 G;  2C2A A;  3O9O A;  2YI9 A;  1MNG A;  4GYC B;  4F4L A;  3DXR B;  1XMQ B;  1GN3 A;  4GX2 A;  2EIL C;  1VQ8 V;  4LFB B;  2YEV B;  3HKC A;  2Q8V A;  3CCJ V;  2DN9 A;  3ABM B;  1R3L C;  3ZIA G;  1IX9 A;  1W0K G;  3U11 A;  1QLN A;  4FLY A;  1RM1 C;  3K3W A;  3N2G A;  4JAV A;  1Q6I A;  2QDO A;  1KB9 F;  1M93 A;  1H2M A;  3CX5 F;  3APQ A;  1K92 A;  3JSL A;  2HKO A;  3UQ8 A;  3APO A;  2ZCE A;  1S5L Z;  4FPP A;  3WB1 A;  1FOU A;  1B06 A;  4NVP A;  1RP3 B;  5ITZ A;  3ASN C;  1SQV H;  1Q7Y W;  3CC2 V;  2W6I G;  3MAQ A;  1YJN V;  3FD9 A;  1Z5W A;  1N4C A;  1XDC A;  5IWA O;  3H1L H;  2QEX V;  2Q0A A;  3KDR A;  4YJ3 B;  2E76 B;  5LXT B;  4HNA A;  1AJP A;  4NR1 A;  4PA4 A;  1P49 A;  1S76 D;  2Q5Z A;  3C90 A;  3TET A;  4DV6 O;  1R3J C;  3M7M X;  1BL8 A;  1AVM A;  4OXS A;  2P67 A;  2H8P C;  2HEP A;  1S5H C;  2ZNI A;  3OTF A;  1JVM A;  4UB8 Z;  1QLE B;  3H9V A;  3OR7 C;  1KYO F;  1XHX A;  1K97 A;  3IFX A;  2WAM A;  3L74 H;  1JFF B;  3HR0 A;  3CC4 V;  3W7S A;  5JVD A;  3JAS A;  5CA3 A;  1SZT A;  5A2Q N;  3AK1 A;  3FB7 C;  2Q6A A;  4JI6 B;  1VF5 B;  5EBW C;  1KKD A;  5IYC O;  3SJQ C;  3K58 A;  3BHP A;  5B66 Z;  3KCY A;  4GCZ A;  2GTS A;  3OT7 A;  1ZL8 A;  2JJ1 G;  3FB5 C;  4WF9 V;  2RN9 A;  3J7A U;  1PKX A;  4P2Z A;  2HVJ C;  4XDJ A;  3BEH A;  3X2Q B;  3BAA A;  1MMM A;  4JI3 B;  5EBM C;  2UUA B;  4JI0 B;  4NXN O;  2D3O W;  1G8M A;  1LR1 A;  5BR8 B;  3CEI A;  3A0B Z;  4CH3 A;  4JPR A;  3CC7 V;  5LMN B;  2X6A A;  4DV0 O;  1V55 B;  1HNZ O;  3R66 A;  5J2T B;  2PTM A;  4JZG A;  2ADQ B;  2UU9 O;  3SPJ A;  3T4D A;  4DUY O;  3B8N A;  4FK5 C;  1GM7 A;  3CCS V;  1M9N A;  5EYP B;  1QR9 A;  1IDS A;  2QWN B;  1R73 A;  3A0H Z;  3RYC B;  1XHZ A;  3CRR A;  1AI5 A;  3MHH C;  2CAZ C;  2ZT9 B;  2WLM A;  3OW2 U;  1BGY H;  3RN4 A;  1ARO P;  4PDV A;  4RO2 A;  1OCZ C;  5GON B;  5H5N A;  2CUG A;  3GWO A;  4O2A A;  4K8X A;  1EZJ A;  1SQG A;  4ZOL A;  2IH3 C;  4LP8 A;  2IW5 A;  3UM7 A;  2OCC C;  4IYI A;  4KXR A;  2RJZ A;  2YC0 A;  4UXN A;  3CD6 V;  3B8M A;  4DR1 O;  2A06 H;  1N34 O;  4DK0 A;  2OTJ V;  2KKW A;  3QO8 A;  4TV9 A;  5B1B B;  5FNV B;  1Y74 B;  2RCV A;  4U3J A;  3RVZ A;  4DO2 A;  1Q6U A;  3CRM A;  2ITD C;  5IWA B;  2ITC C;  3CMA V;  5H2F Z;  1QNM A;  3SPI A;  3A0R A;  5IY5 C;  5IYD O;  4I55 A;  1ENV A;  3C3S A;  1OJH A;  4J7Z A;  4FLV A;  4IT5 A;  3ZHU A;  2XT9 A;  5JQG B;  3LNN A;  5CA1 A;  4PHZ A;  1F23 A;  2Q7G A;  4PA7 A;  2WLL B;  3JD0 A;  2Q0O C;  5LHH A;  4I5S A;  1NU1 H;  4R6Z A;  1K5Q A;  5KMG A;  5GTH Z;  5H9C A;  3ETD A;  3JAL B;  4X1Y B;  4I0X B;  3MHS C;  3O65 A;  5J2U A;  2P7T C;  1FYJ A;  1XI1 A;  2DWE C;  2WLN A;  1JJ2 U;  2CDY A;  3ZHQ A;  5IYZ B;  2Y69 B;  2BSK B;  4B7K A;  4MVS A;  3K03 A;  1OHH G;  4Z1V A;  4DR4 O;  5FLX N;  5KA5 A;  1K8A W;  3L75 H;  1QVF U;  3A2F A;  2P06 A;  2DWD C;  3IC7 A;  3KCX A;  3D3Q A;  1HP8 A;  4CBC A;  1EN4 A;  4PA6 A;  4I7Z B;  3N2K A;  2JJ2 G;  4FLT A;  1I0H A;  5CA0 B;  4PI0 A;  1JNB A;  2BOC C;  4DR6 B;  1HNZ B;  5LP6 B;  4LF8 B;  3B40 A;  2GUZ B;  3FX7 A;  1Y4M A;  2ZNJ A;  1XBL A;  1GAX A;  3BFR A;  4CH4 A;  2Q69 A;  1HW7 A;  1TUE B;  4X62 O;  1IBL B;  4X8A A;  3D36 A;  1K33 A;  1VQL V;  2BOB C;  4X20 B;  2E5L O;  1P84 F;  4UUJ C;  3RBZ A;  3ASO B;  2FYU H;  3JD2 A;  4UCU A;  4MT8 A;  5A9G A;  2UXD B;  1JA8 A;  1NVP D;  3ZMV A;  4MVU A;  1LNQ A;  1QHT A;  1JX9 A;  4JI1 O;  3IC9 A;  3IAY A;  3F7V C;  3K04 A;  5L3D A;  4GLX A;  2QKA A;  1IXB A;  5KX5 A;  3K08 A;  3RW0 A;  2XHB A;  1FFX A;  2GTA A;  3RT3 C;  3B09 A;  3OMA B;  3JAM N;  2WA3 A;  4WCE V;  2X6B A;  4LF4 O;  2EIM B;  3G6E V;  1G4Y B;  2KG7 A;  1SRY A;  1KQS U;  4UCT A;  2DOS A;  3TJT A;  1OCC B;  3RGB A;  5LGT A;  2XAF A;  1N32 O;  3BRC A;  2VQF O;  1HNW B;  1L8D A;  1NJI W;  4BAY A;  2E3C A;  2IM9 A;  1QR8 A;  4DV1 O;  3TXS A;  3FAV B;  4D7T A;  2ZM6 O;  1N33 B;  2JK5 C;  1AI7 A;  1I94 B;  1UJW B;  3ABL C;  2VWJ A;  1US6 A;  3ZX6 A;  5EK0 A;  4B3M O;  3HKE A;  2PYL A;  4PEL A;  4QE9 A;  2F4V O;  2BTQ A;  1W0J G;  4DV3 B;  1M57 C;  3EFF K;  3G71 V;  4B3T O;  1WN7 A;  2V4D A;  4EFB A;  1IBM O;  3L70 H;  3W7X A;  3K5O A;  1FAF A;  4UVB A;  4HYO A;  2QM8 A;  5CB4 A;  3H1H H;  3S3W A;  3GVM A;  4X88 A;  4ZHQ A;  3ICX A;  4X1K A;  1ZX3 A;  2LW1 A;  3ZMS A;  4LFC B;  3JSN A;  1D5N A;  4DW1 A;  1QBZ A;  2WLJ A;  4K0K O;  4WBN B;  2CK3 G;  1FD9 A;  1OV9 A;  3LDC A;  1S5J A;  4IYH A;  2HHH B;  3OUF A;  5H6Q A;  4AHC A;  4DR7 O;  4UV9 A;  5L3E A;  1AI4 A;  3RYI A;  4YJ3 A;  1K34 A;  4JYA O;  5LXT A;  2CTR A;  4TQD A;  1XMO O;  4CC5 A;  4MW3 A;  1WA8 B;  4DUZ O;  2E74 B;  4X62 B;  3P32 A;  1K9M W;  4FLZ A;  2F23 A;  2RDC A;  2B5U A;  3WG7 C;  3D8C A;  2CGO A;  1MOF A;  1GMG A;  2F93 B;  5KA6 A;  4XDK A;  4J80 A;  2JIZ G;  4H44 B;  1VQO V;  4JTC B;  3CHX A;  4LF9 O;  1WLE A;  4YY3 O;  4I50 A;  3BCC H;  4H13 B;  1VAR A;  2Q9L A;  1O9H A;  4KHP O;  3DTU B;  1PL0 A;  1SES A;  3S3X A;  4DW0 A;  1MZE A;  4Q20 A;  1CPY A;  3W7U A;  4MSW C;  2Z3Y A;  5FL7 G;  3QO7 A;  4X66 B;  1PD3 A;  2YI8 A;  3VQY A;  5KHG A;  1IVS A;  2N04 A;  4H33 A;  4EB6 B;  2LQT A;  4JI5 O;  1IZ3 A;  4TV8 A;  1CXZ B;  1VQK V;  4PDL A;  4I4T B;  4W4L A;  1VQ4 V;  4LH7 A;  5B1N A;  2ZE6 A;  2VQF B;  1RSO B;  2FB5 A;  4MTF A;  3SJB C;  2CH7 B;  3JAT A;  5J2T A;  3AG3 C;  4PDM A;  2DYS C;  2DJV A;  1EBO A;  4NTX A;  4H37 A;  4EFE A;  5EYP A;  3LDE A;  3RYH A;  3OM3 B;  4OPH A;  3SPH A;  4O4H A;  1N8R W;  1H2N A;  2XAJ A;  4J41 A;  1H8H G;  1TAE A;  3TXQ A;  2EIN B;  1K4C C;  4MVQ A;  4LC1 A;  1IBM B;  2DYR C;  2GBO A;  2IJI A;  2WLK A;  3KG2 A;  1S72 V;  1R6K A;  5IJ9 B;  1WB7 A;  2EBO A;  3E8G A;  1QU7 A;  1NKD A;  1Z2G A;  5IYB O;  4E2L A;  2YIB A;  4PDR A;  2PZS A;  2UUB B;  2Y48 A;  3CYO A;  5K1P A;  3TCU A;  4DRX A;  1M1K W;  1Q90 D;  4QNH B;  2QJ1 A;  5KHH A;  5EC1 C;  4K0K B;  1IJG A;  4JAA A;  1VQ5 V;  2ZE5 A;  3G67 A;  1K5S A;  1LUV A;  4FVM A;  3JCZ A;  5JH7 A;  3T1H B;  1VP7 A;  2ARH A;  1Y67 A;  2EIJ C;  3CXC U;  2OIE A;  4TUY A;  2R9R B;  3ABT A;  3AK2 A;  2QR4 A;  4DUZ B;  3HKD B;  2PI5 A;  1Q6H A;  2IBZ H;  3ETG A;  2O57 A;  3BA8 A;  4CS2 A;  1FXV A;  3E2E A;  1N36 B;  1CEZ A;  2WLL A;  1THZ A;  5D5Q A;  2MW2 B;  3I55 V;  4ABM A;  4YY3 B;  5K1X A;  1NS1 A;  2PGG A;  3OTO B;  2MK3 A;  3JAL A;  3EXA A;  4X1Y A;  3ZCC A;  2NR5 A;  1WPB A;  3B2E E;  1R6T A;  4DR3 O;  2OCC B;  4ICG A;  2Z0A A;  1PNK A;  1OCR C;  5IYZ A;  2UUC O;  1GN4 A;  2ATK C;  4E4E A;  5DM6 V;  1R6N A;  3RYF B;  1I7F A;  5EZY B;  2R9I A;  4DV2 O;  3UT5 A;  1QCE A;  3G4S V;  3OMN B;  3PJS K;  4GZR B;  4NYK A;  3CCQ V;  4LNU B;  4JI5 B;  4OX9 O;  4QIW F;  4GKK B;  1AI6 A;  2LP7 A;  2AXT Z;  1F7Y A;  2ZIO A;  3HB3 B;  1FXK B;  3K57 A;  2P90 A;  3IGA C;  5LP6 A;  1TUB B;  2GUZ A;  1Q43 A;  1ZTE A;  4EEQ A;  5LOV A;  4LF5 O;  1SQB H;  3VOU A;  1Y76 B;  2XAQ A;  2VQE O;  2XTA A;  4X9Q A;  4F6R B;  1BT8 A;  1V54 C;  3AG2 C;  4LFA O;  1BZK A;  1VQ9 V;  4X65 B;  4BW5 A;  2YIA A;  2M6Y A;  4J9Y B;  4IGG A;  2QA4 V;  4MTO A;  4TWK A;  4FMT A;  4JI2 O;  3CRA A;  3L73 H;  1I08 A;  4UV8 A;  3JAW B;  3B4S A;  3G80 A;  1W2B U;  2LGQ A;  1Q8I A;  2FML A;  5LYJ B;  2KSD A;  1BS3 A;  1UFI A;  2Y4U A;  4B7E A;  3D36 C;  3ZRV A;  4PA9 A;  2YSU B;  1YCI A;  2FL4 A;  5L3F A;  4YJ2 B;  4O2B A;  5C8Y B;  4GKJ O;  1KP3 A;  4IL6 Z;  4O4L A;  4A5U B;  2QKS A;  4ASU G;  4JTA B;  3F7Y C;  4RUF A;  1MG1 A;  3ZHT A;  3ZS8 C;  3K5N A;  3CCL V;  4LWS A;  1OZ0 A;  2DMX A;  4IIJ B;  5TIS Z;  5IJ0 B;  3FAV A;  4TT3 G;  4OGQ B;  2P4K A;  4AI8 A;  4JV5 O;  2XAH A;  4DV5 O;  2ZXW B;  3SJA C;  4JAU A;  1SQX H;  4O4J A;  1IUR A;  1YIJ V;  4JYY A;  1OCO C;  1Q5O A;  1GM9 A;  1W59 A;  3ZHR A;  3AG1 B;  2BTO A;  2Y4T A;  1GO3 F;  5CBH A;  3E83 A;  3K79 A;  3L9D A;  4FM1 A;  4IHJ B;  2XOK G;  1XRE A;  4DR2 O;  5BMV B;  1TVK A;  5CBG A;  4DV4 O;  5LBQ A;  1VQM V;  3Q4H A;  4K8Z A;  1BHB A;  4RWU A;  4HZ3 A;  3CCE V;  2YDE A;  3PN1 A;  3JYC A;  1MZF A;  2F43 G;  1WP7 A;  3CE2 A;  4KP4 A;  4JYB A;  4CH6 A;  2BCC H;  2UXN A;  4O4I B;  2ZQM A;  1EM1 A;  2K9P A;  3ABM C;  3HKB B;  1ZUQ A;  1PV0 A;  4U3F H;  4LF5 B;  2DE0 X;  1JMK C;  3ABK B;  5DN6 G;  5BXZ A;  3OGC C;  1F4M A;  2CTQ A;  3E35 A;  4DV6 B;  4X1I B;  4JI7 O;  4CS3 A;  4LFA B;  2CTP A;  2ZDI A;  4KFM A;  3ZMT A;  1M4U A;  2N05 A;  3BVO A;  1A32 A;  5GTI Z;  3FB8 C;  2CE4 A;  1Q81 W;  4JI2 B;  3T4Z A;  3P3N A;  3CRC A;  1FJG O;  2P22 C;  4R8C A;  4BIO A;  1BHA A;  3FB6 C;  1B04 A;  4EKW A;  5E79 Z;  3WB2 A;  5AG2 A;  2YUA A;  3DC6 A;  3ZRX A;  1YI2 V;  3H1I H;  4DK1 A;  3JAK A;  4FZ0 A;  2GHY A;  4HBN A;  3ZRW B;  3P3P A;  3HKC B;  5B3S B;  1BSM A;  1H38 A;  1SQQ H;  3FYI B;  5JCO A;  4FIP C;  2A0L A;  2E75 B;  4NB5 A;  2PI4 A;  4GKJ B;  2D2C B;  4NXN B;  2NN4 A;  3LSU A;  3N2G B;  1QLE C;  2JRI A;  2IU0 A;  4I4T A;  1U96 A;  1RFY A;  1ZLZ A;  4BR6 A;  2EJ7 A;  1SQF A;  2WLH A;  4DV0 B;  3ETQ A;  2QM4 A;  4AQY O;  1YF2 A;  2UU9 B;  4NTW A;  4DUY B;  3BAB A;  1S3J A;  4J10 A;  3ZMZ A;  1VQP V;  1NH2 B;  4WFH A;  2ZIM A;  1HR0 O;  4B3R O;  1WAZ A;  3EVK A;  3R65 A;  3VQX A;  5HFL A;  1WJZ A;  4DR5 O;  1GKF A;  1J95 A;  3K9A A;  3X2Q C;  3K5M A;  5KAF Z;  1J5E O;  4HNA B;  3SYC A;  2IJK A;  4C7U A;  2WPD G;  3AG4 B;  1YJW V;  3JD1 A;  3GB7 C;  4GT1 A;  4I9W A;  2ZR2 A;  4DR1 B;  1N34 B;  1NR1 A;  4Z1M G;  2YIB D;  1I5X A;  1YTF B;  2PF4 E;  3CCR V;  2F95 B;  1RPO A;  4UVA A;  3JAR A;  1BQZ A;  5JVD B;  2JEX A;  4FFB A;  4FLU A;  3AG3 B;  1E1R G;  3JAS B;  3KKY A;  1NR7 A;  4ZI7 A;  1NZ6 A;  1Q86 W;  4FM0 A;  2RNB A;  3SPC A;  1VQN V;  1IBK O;  1YXB A;  1JOY A;  3MD0 A;  4MVO A;  1SA0 B;  3OR6 C;  3DXR A;  4JI7 B;  1P7B A;  2DW4 A;  3E89 A;  4DV7 O;  4YIP A;  2YEV A;  1JJO A;  5LHG A;  2X7R B;  5B1A C;  3UKM A;  2QGN A;  5B1B C;  2OIG A;  2VWK A;  1FJG B;  3E8F A;  4P9O A;  1MA1 A;  1DK1 A;  2EZO A;  4D7S A;  3SYA A;  4Q6G A;  3CJH B;  3ZRS A;  3AK3 A;  4PI2 A;  4DR4 B;  5EZY A;  2HJD A;  1R3I C;  3M8A A;  3K5L A;  1HNX O;  2XAS A;  3T1C A;  5KUM A;  2VRZ A;  3QVN A;  3HPL C;  1Q3E A;  2HP8 A;  1P4R A;  1EFR G;  2CTW A;  2UXX A;  3W7W A;  1AB3 A;  4O2A B;  4FFK A;  4ZOL B;  4AQY B;  1I5Y A;  2IH1 C;  5LL6 Y;  1PNL A;  3J80 N;  1ROP A;  4R50 A;  4K3A A;  2EIL B;  2Y69 C;  4B3S O;  2LJ2 A;  2HVK C;  2QTS A;  1COW G;  2B9Z A;  4X64 O;  5CBF A;  1HR0 B;  4TV9 B;  4F6R A;  3K0D A;  2E5L B;  4U3J B;  3M99 B;  2HFE C;  5JJE B;  4FLW A;  4R7C A;  1RM1 B;  3I56 V;  2ZR3 A;  1X59 A;  4UVC A;  1JFF A;  4JF3 A;  4JI1 B;  5CA1 B;  4QGP A;  2YXY A;  5LP6 C;  2LFS A;  1GRJ A;  3K0G A;  1XMQ O;  3I5D A;  3OD4 A;  2QM7 A;  1YDX A;  1H8E G;  3ASN B;  5EIB D;  2XND G;  2IJJ A;  4BW9 A;  4LF4 B;  1DTO A;  5J2U B;  3WFV A;  3RFR A;  4TOI A;  3ASO C;  1Y66 A;  2P5O A;  3QNE A;  2JS3 A;  1SKV A;  5GW7 A;  2PY5 A;  2LFR A;  2R9A A;  1N32 B;  1XNR O;  2W0F C;  3OFN G;  1FS0 G;  1FKA O;  5EIB C;  4IIJ A;  3OGI B;  3E8H A;  5IJ0 A;  4DV1 B;  2ZM6 B;  3AG7 A;  1XQ8 A;  3T1Y O;  4KUM A;  2Q67 A;  4B3M B;  4P9P A;  4JI4 O;  2A9H A;  3SYQ A;  3RYC A;  2QWO B;  2W0X A;  2F4V B;  2AW9 A;  4BIZ A;  1D5A A;  2Q7H A;  4CH5 A;  3CB2 A;  1VQ6 V;  4N21 A;  2BE3 A;  1L0L H;  4B3T B;  5BZB A;  5GON A;  1OCC C;  3L72 H;  4MVZ A;  4TSF G;  5KAI Z;  3ML0 A;  2V7Q G;  4KL1 A;  1X4T A;  2WA4 A;  2X6C A;  2ZD9 A;  2HLD G;  4MTX A;  3SGI A;  4RAI A;  1TA8 A;  4UB6 Z;  3IJ4 A;  5FNV A;  3ZHV A;  1Y74 A;  2N74 A;  1VMG A;  4YXW G;  2L35 A;  3THO A;  3HKB A;  1PM9 A;  4DR7 B;  1SC5 B;  2XAG A;  5KUK A;  1R1B A;  1P7G A;  4JYA B;  1VF6 A;  4NXM O;  1JQ0 A;  5KX5 B;  3CSX A;  5JQG A;  1H2S B;  2EUL A;  1XMO B;  3J81 N;  1FFX B;  1GH6 A;  4LCU C;  1MSD A;  1NBM G;  4MTG A;  2R70 A;  3AEI A;  1KKC A;  1S0V A;  2KG7 B;  4JI3 O;  4G2K A;  4JI0 O;  2YIC A;  1OCZ B;  4P30 A;  4LF9 B;  3D3I A;  5LMN O;  1RPR A;  3U10 A;  4I0X A; 
#chains in the Genus database with same CATH homology
 1D5N A;  3LSU A;  1MA1 A;  1AVM A;  3DC5 A;  4JZ2 A;  1XRE A;  1ZLZ A;  4BR6 A;  2RCV A;  5A9G A;  1JA8 A;  3AK3 A;  2ADP A;  1WB7 A;  1QNM A;  1ZTE A;  3C3S A;  3IC9 A;  1LUW A;  1EN5 A;  1GN2 A;  3QVN A;  4X9Q A;  2QKA A;  3AK1 A;  1MNG A;  1IXB A;  3EVK A;  1BT8 A;  1PL4 A;  2AW9 A;  1GN3 A;  1AR4 A;  1VEW A;  4FFK A;  3OT7 A;  2GDS A;  1LUV A;  1EM1 A;  1ZUQ A;  1GN6 A;  4C7U A;  1MMM A;  4GUN A;  1SZX A;  1VAR A;  3TJT A;  1Y67 A;  3CEI A;  1I08 A;  1JR9 A;  1IX9 A;  2CDY A;  3AK2 A;  4JZG A;  1BS3 A;  2ADQ B;  1AP6 A;  1AR5 A;  1EN6 A;  1ZSP A;  1PM9 A;  2CE4 A;  1B06 A;  1WB8 A;  1IDS A;  3KKY A;  1N0N A;  1P7G A;  1XUQ A;  5AG2 A;  1EN4 A;  1MSD A;  3DC6 A;  4YIO A;  1GN4 A;  3RN4 A;  1I0H A;  1AP5 A;  4E4E A;  1KKC A;  1XDC A;  4F6E A;  3C3T A;  1BSM A;  3K9S A;  4YIP A;  3KDR A;  2P4K A;  2QKC A;  3BFR A;  1N0J A;  4JYY A;  1XIL A;  3MDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...