1ZTRA

Solution structure of engrailed homeodomain l16a mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
GDEKRPRTAFSSEQLARAKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Segmentation polarity homeobox protein engrailed
publication title Solution structure of a protein denatured state and folding intermediate.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 14
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ztrA00
3BR1A 1VFCA 3LOCA 5F0FA 3TW6A 3HGYA 3Q0UA 1GV5A 2IAIA 1MBFA 2VPRA 1TWGJ 1F36A 4Y7NJ 5E3LA 2R5YA 4C3JJ 4A3MJ 3S2DJ 1U78A 1W0UA 3HOZJ 1RESA 5E3NA 1POGA 4JYKA 1TWFJ 5GP9A 3S2HJ 2KDZA 3A01B 2LP0A 3B6AA 3L1PA 1TWHJ 2EZHA 2LFBA 2EZKA 3S1RJ 1H8AC 4A3FJ 2L9RA 4B1RA 3D1NI 5IPAA 5EZGA 1YRNA 2E2IJ 2YU9J 4MIMA 1WPKA 1ENHA 4BY7J 1JGGA 3TW7A 3S1NJ 2R5YB 2Y0SN 4MFEA 3ZQFA 1VF9A 3HKZN 2ZB9A 1Z0XA 4A3CJ 3BG9A 2QF7A 3FK7A 3ZOBA 1JUSA 3BTCA 5GPAA 2WV1A 2XGCA 2FJ1A 1LFBA 2L0KA 1OFCX 2JMWA 3TP0A 2XGEA 4QSHA 4QIWN 5EG0B 3O8HA 2DMTA 3LNQA 1HF0A 3TP3A 2XPVA 5EEAA 2JA8J 3H3VK 1T33A 3SJMA 1NK2P 4BBRJ 4W97A 1IRZA 2HOAA 4A3BJ 1GV2A 2Y9YA 4AYBN 4FTHA 5M3FJ 4EEFG 5HODA 2M8GX 2NVQJ 4BKXA 4J19A 5K7FA 2EQRA 1MNMC 4S0HB 3VPRA 3LSRA 5IYBJ 4IHWA 3NARA 5J1RA 3BR5A 4CYCB 1AU7A 1O4XA 2HOSA 3BT9A 3G1MA 4JP0A 3BR3A 1ZTRA 2HXOA 5F0CA 1LE8B 1ETVA 1DU0A 2VI6A 2DA2A 1WI3A 1ETXA 5IP7J 1WGXA 5BNGA 2R0QC 1FEXA 2M34A 3S15J 5DS9A 2XRLA 2O7OA 1CQTA 1OCPA 3ZQLA 4XIDA 4M3EA 4D7MA 2COBA 3Q3SA 1AKHA 3BR6A 1DU6A 2LLKA 2HDDA 2H8RA 2DA5A 2DMQA 5IOYA 3CMYA 4G12A 3I4MJ 3GTKJ 4RBOA 2CJJA 2FX0A 3S16J 2LR8A 1MBGA 2PMZN 5IYCJ 3S17J 4A93J 1B72A 2QCOA 4D5FA 3JREA 2EZIA 3PO3J 3C2BA 5F27A 4MO7A 2MGQA 2JN6A 1B8IB 4UUSB 2K9QA 4FE4A 4M6VA 1ZKGA 2HI3A 3ZQGA 4DYRA 1AKHB 1JTYA 2TCTA 1JTXA 1ETQA 2HOTA 5IP9J 1P7IA 4A69C 2ECBA 3DCFA 1X2NA 2ME6A 5EGOA 1SANA 1JJ8C 4BBSJ 3OIOA 4FCYA 4AUXA 2D5VA 3NAUA 2R93J 1A5JA 4D5CA 1ITYA 2L7MP 2I10A 1QVUA 3W6VA 3LSJA 5C4JJ 3BG3A 1ZR2A 3OSGA 2NS8A 2IBDA 1MSFC 3SDGA 2TRTA 1FIAA 4B4CA 1D5YA 3LSGA 2ME0A 4A3GJ 1IJWC 3JRHA 4ABZA 1K61A 1UMQA 2E2HJ 1LFUP 2E2JJ 1HDPA 5EGOB 1JT6A 3IV5A 1ETWA 3Q0WA 1F43A 2O9LA 4M3GA 4XRMA 2DTZA 3GTJJ 1MBJA 4D7NA 2Y2ZA 2Y31A 3S1QJ 2AHQA 2LTPA 3RZOJ 3WHCA 1U9NA 2VKVA 3FIWA 4XK4A 3PM1A 2Y9ZA 4DZJA 2B63J 2JJ7A 2E1OA 1BL0A 1VI0A 3GTLJ 1H89C 3JRCA 4A3LJ 4X6AJ 3MKLA 5F04A 3HOYJ 2HXIA 4A3JJ 1Q1VA 1YRNB 2JA6J 3A02A 2FD5A 5IOZA 3S1MJ 1MBEA 1Z77A 2LVSA 3ZQHA 1JKPC 3QPLA 2JK3A 2P81A 4GFBA 4MFDA 3JRDA 1K83J 1WH5A 4BXXJ 5F0HA 5EF6A 2OF7A 2NVYJ 3QQAA 3ZQIA 2CUFA 5FKOA 2CUEA 3M4OJ 1QRYA 2EZLA 1HLVA 4XRSG 2NVTJ 2K9NA 1H88C 2ID3A 2R5ZA 4JX4A 2G0EA 1XG1A 1XC5A 1BW6A 1IUFA 3BTIA 5J1YA 3GTMJ 1JJ6C 1MBKA 2CQQA 2M0CA 2W48A 3A03A 4W1UA 4C3HJ 3TEDA 1MBHA 2E19A 1AHDP 5M5YJ 4A3KJ 2GM4A 4DW6A 4A3DJ 2DJNA 5C4XJ 2N8GA 2KT0A 3IH2A 1W0TA 1RETA 1FTZA 4HNVA 4A3EJ 2DMUA 2VUMJ 2IEKA 5F1JA 5FKKA 1QPIA 1JKQC 2R7ZJ 4QTRA 1UG2A 5FLVA 5E3OA 3CQZJ 2R5ZB 2CQXA 3BG5A 1Y1WJ 1QVTA 3K2AA 4BY1J 4JX6A 3WHBA 4C3IJ 3HOUJ 1X58A 3DEWA 2NS7A 2L7FP 2M2EA 3HGGA 1Y1VJ 1PUFA 1MH4A 5M5WJ 1R9TJ 1JUPA 2H1KA 2Y30A 1IV6A 2RAEA 1IC8A 4IHYA 4M3FA 2OPTA 2AO9A 2YUSA 5FJ8J 5J1UA 5C44J 2XB5A 3FKIJ 2WAQN 3HDDA 1MH3A 2YS9A 2L7ZA 3B6CA 2FQ4A 4LOCA 4X1EA 2XPWA 4AC0A 3HB9A 1B72B 3RZDJ 1FTTA 3A01A 2MG4A 2LY9A 1TWAJ 1TC3C 3HBLA 3JRBA 1FJLA 5EDNA 3GTQJ 1JKRC 1PUFB 2LK2A 3S14J 1IGNA 1JT0A 5FLMJ 1TWCJ 4MLOA 3HM5A 1U8BA 4IEJA 3HOVJ 5K7HA 3CCYA 2JA7J 1BW5A 3JRIA 2NOGA 5E3MA 2EBIA 3SFIA 1BA5A 2ELKA 5GPCA 4V2FA 1U9OA 3RQIA 2DA6A 2DA7A 1G2HA 2R92J 1GVDA 1OCTC 1WH7A 2GBYA 1GDTA 3I4NJ 5FKNA 3O8GA 3FISA 2DN0A 5EYRA 2K40A 5EG0A 2DA1A 1SFOJ 4DYCA 2MSYA 4DZPA 2M9HA 2EH3A 4NDLA 2NVXJ 3BQYA 1HDDC 1X2MA 2XPUA 3GTGJ 5EZHA 4JX5A 3RKQA 1NK3P 3Q0VA 1APLC 4V2GA 3QPSA 2HQ5A 2X48A 5J3LA 3JRGA 4A3IJ 5K7ZA 2GLOA 1RKTA 1NTCA 4CYCA 1I50J 4XICA 3M3YJ 1EF4A 1ORKA 2XGDA 3JRFA 1P7JA 1LE8A 2X9DA 1IG7A 3MN2A 5M3MJ 4L5EA 3G1LA 1RR7A 1I3QJ 2VKEA 5JLWA 3BTJA 1RKWA 5JLXA 3GTOJ 1MSEC 1ZGWA 2XB0X 3E7LA 3LSPA 1HCRA 1ETOA 3ZQCA 3UKGA 4RDUA 1E3OC 2ID6A 5M5XJ 3BTLA 4C2MJ 2JA5J 3JR9A 1FIPA 4B3AA 9ANTA 2WB1N 3K7AJ 4M3DA 2JWTA 2O8KA 5C3EJ 1JKOC 2DMNA 1ZK8A 3OOUA 1S7EA 1ETKA 4IHXA 3BR2A 2MW8A 4Y52J 3IH4A 1GUUA 3MVPA 2K9SA 1BJZA 2ECCA 4FISA 1B8IA 1ETYA 5FKLA 2CRGA 4UUSA 1IDZA 1HOMA 5FKMA 2DMPA 3IH3A 3BR0A 3HEFA 3F0CA 3FK6A 4FE7A 3BQZA 3G1OA 1GT0C 3PO2J 5IYDJ 2CU7A 3HOWJ 4IHVA 1ZR4A 1I6HJ 1ZQ3P 5IP6A 3JRAA 4I76A 1XS9A 2DA4A 2X6OA 3GBGA 4DYQA 3HOXJ 1OJLA 1A6IA 2LKXA 4M3BA 4UUTA 1T56A 3CDLA 3H0GJ 1RPWA 5F08A 5DTDA 2LD5A 2XSDC 1WCMJ 4I6ZA 1JUMA 3GTPJ 1VNDA 2HYJA 1IDYA 3OSFA 2DA3A 4XRSA 1UHSA
chains in the Genus database with same CATH superfamily
3BR1A 3U21A 1VFCA 1J75A 1Z3YA 3HGYA 3Q0UA 5D5WB 5CPRB 1HKSA 3AKZA 2R7TA 5E3LA 4XM3A 3JAMZ 3ZMUA 1X19A 1X4PA 1D0XA 2FU4A 2E1CA 3HOZJ 5E3NA 3ASNH 1XN7A 1TWFJ 2KDZA 2RDPA 3A01B 2LP0A 4C2UA 2CMPA 2XAHA 1FOWA 4BJ5C 5FRNA 2LFBA 3OYLA 4PCQA 2NAZA 1E0EA 3FWEA 4B1RA 3D1NI 3C18A 2E2IJ 1U0JA 3KLNA 1REPC 2M0MA 1XSDA 5A2QZ 3H3ZA 4UUVA 3K1PA 5GTHC 4MFEA 1BC8C 2JT1A 2MLKA 5E20A 3BG9A 3Q9VA 5HDKA 3FHNA 1FLIA 2MLGA 4EJUA 3BTCA 4QSHA 1RUOA 1TNTA 3JCUC 3O8HA 2LY2A 3LNQA 3LSIA 4G6QA 2OD5A 5TGTA 2E60A 3TP3A 3ABUA 2RGVA 5J8FA 2IVMA 2YR2A 1XSVA 3L7WA 5HDGA 2IA1A 1YTYA 4UV8A 1IRZA 2HOAA 2R7QA 4Y15A 1G4DA 4I99C 1SD6A 3I55I 4AYBN 3K4MA 4NHJA 5A2QK 4FTHA 1MMGA 2KL4A 2VB6A 2M8GX 3BC8A 3LA2A 3H3UA 1FOXA 2MABA 1YW9A 1W5TA 4G94A 5IYBJ 4I2OA 5J1RA 2XAGA 4CYCB 2JVHA 4FT8A 4V19K 5LGUA 2XROA 2HXOA 1G6NA 1YW7A 2M5WA 2K27A 5AONA 4ENKA 2LSOA 4AVPA 3DKXA 4CZCA 2KISA 1PVEA 1ETXA 5AIPA 2ESHA 3DEEA 5BNGA 5JI6A 1FEXA 3ZCOA 3CC7I 2M34A 3S15J 3AG2H 3HL2A 1CQTA 1I1SA 4WK8F 4CA0A 4R79A 1O3TA 2F2EA 2ZKZA 1XMAA 2CH0A 3Q3SA 1AWCA 2O0YA 5HS7A 1RC9A 1J59A 3RJPA 2H8RA 2DA5A 2F5EA 5IOYA 1OYWA 5KCMA 3RKYA 2A07F 3I4MJ 3QP6A 4B43A 1YLFA 2CJJA 2FX0A 2FXAA 3S16J 1KU9A 1V55H 3CTAA 5F6FA 1S72I 2CFXA 2XV4S 4M9XA 1Y8RB 4M71A 4A93J 1MGTA 4D5FA 3VODA 3E3VA 2EZIA 4E6KG 5GAGJ 5F27A 4MO7A 2FMYA 2GOXB 2MGQA 2ZJ2A 4M9SA 4HYEA 1PUEE 4UUSB 2V1XA 2VE8A 1B4AA 1XMKA 1YS7A 4U0VA 3ZQGA 1AKHB 2DQLA 1YS6A 3EUKL 1YJ9I 4RGXA 2ECBA 1X2NA 2ME6A 4ZTFA 3ZR8X 4U0WA 1UZCA 3I59A 4UVAA 4FCYA 3OIQA 1USTA 3TGNA 4RLQA 3NAUA 5DD8A 2GA2A 2D5VA 3L9FA 1XB4A 4D5CA 2KJBA 3DLLF 1V54H 2BOLA 1YIJI 3OYJA 3VYUB 1IAWA 5HVQC 4BXUA 3CJRB 3WODF 2ZNYA 4CXFA 1O3SA 1D5YA 5FO5A 2P5VA 2X6XA 2ME0A 1JGSA 4KN7X 3JRHA 1K61A 2EV5A 2DYRH 1UMQA 2M7AA 3LFUA 2BYVE 2Q2EA 4KN4X 1FYKA 2O9LA 1ZREA 1NHAA 4XRMA 1H9TA 2DTZA 5TISC 3S1QJ 2Y31A 3FXLA 4FHTA 3GW2A 2EFQA 2ESNA 2LTPA 3OYKA 4L5IA 1E3HA 2RNJA 2Q1ZB 3PM1A 2ZCWA 2QSHX 1ZARA 5D8LB 4G6TB 1VI0A 1YX5A 4KT5C 4A3LJ 3CLQA 4EM2A 4A3JJ 3A02A 4HW0A 2EIJH 4NUBA 1MBEA 2LVSA 3ULQB 3ZQHA 3QPLA 1I27A 4HDVA 1W1WE 4MFDA 3O3KA 1WH5A 2STWA 1TQMA 5F0HA 2M4GA 1A35A 2LC2A 4HX4A 1O57A 3ZQIA 5FKOA 3SZTA 3FBNB 2LREA 3M07A 1E2XA 1Y0UA 1FNNA 2FNAA 3KEQA 1QBJA 1EH7A 1VZ0A 2EWNA 4OAZA 4Y13A 2DFFA 3I71A 4HAMA 1XG1A 5H20A 1XC5A 3CP2A 1XDUA 2FEZA 5J1YA 1ODDA 5CVRA 2OCEA 3HIFA 4BH9A 2K4BA 3F23A 2VBXA 3CP8A 2JRTA 1QZZA 1U3EM 2VJIA 1T98A 4G7HF 4A3KJ 3OWTA 2COMA 4EGZA 2DJNA 1YHQI 5L3CA 3GVAA 3A0BC 2CGPA 2OUMA 1RETA 2GXGA 1Y0NA 3DU5A 4A3EJ 1LVKA 2Z3YA 2DMUA 3FMQA 3H92A 3K4NA 1SFKA 3M8FA 4R1HA 1EV7A 2VJ5A 4H0EA 2KHMA 3QOPA 1BOBA 5E3OA 3J7ZI 5LHHA 4YFKF 1MMAA 3BG5A 1ON2A 3SFZA 2WAEA 3MAJA 3K2AA 2W7NA 4JX6A 5HS8A 2FUG2 3WHBA 3HOUJ 3QOEA 1DP3A 3CZ6A 2PJRA 2QBYA 1R36A 5M5WJ 3SZGA 3ML6A 1IV6A 3HSFA 2A5WA 1T08B 4IHYA 2OPTA 5FGMA 2LBFB 1K78A 5FLXZ 5D6EA 1W36D 2DO7A 2QSFX 1HBXG 1MH3A 4XRFA 2L9VA 2GQQA 4LOCA 1R5ID 2X1DA 3NWTA 1QHGA 4AC0A 2EA2A 4HRIA 3CCUI 1H0MA 3HB9A 3CCLI 3ZMVA 2FA5A 3A01A 1TWAJ 2OQRA 3JSOA 2KZGA 1T2KA 3GTQJ 3EYYA 1JKRC 4NQWB 2V9PA 3TKYA 1PUFB 5JVTA 1ZH5A 2QVOA 1YE9A 2JA2A 2FBKA 5FLMJ 3CCQI 2DLLA 5EJCA 2KP6A 1HKQA 1FP2A 3OYBA 1MNDA 3OYEA 5LLQA 3HOVJ 5K7HA 5FD5A 2BY2A 2DJIA 3F8CA 3JRIA 1ZG5A 4JQFA 3SFIA 2ELKA 2M7BA 5FLXK 2VOOA 3JTHA 1U9OA 4AVZA 3RQIA 2DA6A 2DT6A 1ZHFA 2FMLA 3S93A 1S8NA 2GBYA 3BOQA 1KZHA 2EFNA 5FKNA 3DWLE 3HTUA 2NYXA 4IOCF 1VQ4I 3FISA 2RN7A 4BQNA 5LEKA 2L4MA 2EFPA 4DZPA 4F55A 1YG2A 1Y56A 2NVXJ 3KYLA 1LPQA 2OAZA 2ELHA 2XHKA 1NH3A 3PNVA 1HXDA 3K0LA 4HV5A 4JX5A 2DODA 2E36A 3KZZA 4O6JA 4V2GA 3JRGA 2X48A 1DPRA 2HQAA 4PDKA 1O7FA 1RKTA 2BGCA 1ONVA 3CUQA 5D4RA 3F9KA 1OCOH 3R0AA 1OISA 2A69F 4CYCA 4BYYA 3CESA 4Y3OA 4P55A 2E7XA 1TW2A 1QO0D 2O3FA 2XGDA 1B6AA 3PNTA 1ZG3A 3SQNA 5ICGA 1TNSA 2K9MA 4KICA 3MN2A 4PGGA 4U7DA 1Y39A 4L5EA 2V1UA 4AIJA 3CDIA 1KONA 2VONA 1ETOA 4PJJA 4U87A 1FY7A 3OL3A 3ZQCA 1E3OC 1MDMB 2QUFA 5CVUA 2P5LC 2KRFA 2R3SA 1FIPA 2UUZA 2GOMA 4D1QA 1ZGJA 1D1CA 4NBQA 3SYTA 2H94A 3AG3H 2LMDA 2WB1N 4M3DA 4HQEA 4HOBA 3KX2A 3V7CA 1V5EA 3KE2A 3COAC 1WKMA 3K70C 1YW8A 1G3WA 3I58A 2O8KA 4GYGA 3U9GA 2MH9A 3F8FA 1JKOC 2EIMH 3OOUA 4OOIA 4N4OB 1GUUA 2K9SA 4IRIA 2KDOA 4WF2A 4G7ZF 4HF2A 3HYIA 3I4PA 1WRJA 4UUSA 1HOMA 4HSRA 5HS9A 5ED4A 3WTWC 5L3FA 1YYVA 3MZHA 1IN4A 4HNUA 2GZWA 4BE2A 4AM3A 3G1OA 1GT0C 3DPUA 2K85A 1I6HJ 1ZQ3P 1GXQA 3RIRA 4XKBA 1YQAA 4KNYA 4ESJA 2V79A 2X0LA 2GXBA 3GXOA 1X1BA 3GBGA 4DYQA 1LQ1A 1FX7A 2Z2SB 4EJWA 3OYMA 3CLOA 3BROA 2LKXA 4D0PA 1R7JA 3U2RA 1RPWA 2IJLA 3CCJI 2XKOA 2RV8A 3VSLA 3LSKA 5DTDA 4Y4RA 3S2WA 3FM3A 4BACA 3MWMA 1F9NA 2BVMA 4ITVA 2DBBA 2JQ7A 2P7VB 1IDYA 4A3BJ 3TW6A 5F0FA 3FXKA 1MBFA 4IOAF 2R7SA 1TW3A 1TWGJ 2BE5F 3FXJA 4PFPA 5E79C 3RPUA 2ISYA 4RLFA 4A3MJ 1OQYA 1SMTA 2KFDA 4G9YA 3G4SI 3K2ZA 4JYKA 1FYLA 3GFJA 1ZRFA 5LRRA 3L1PA 2GIVA 4XSXF 1K79A 2DDBA 4RAGA 1W7PD 2EZHA 4M73A 2EZKA 4ETSA 3J7AY 1G3SA 1XSXA 3O2PE 3DKWA 1S5LC 2L9RA 5EZGA 4ZYEA 4OAYA 5D5XB 3PJRA 2IS4A 2VT3A 1WPKA 3TO6A 3ZN1A 3P9IA 1UFMA 2IGOA 2R5YB 2FSWA 3N97A 1OPCA 2Y0SN 1OLTA 3R0JA 1Z9CA 3HKZN 2OU2A 1WVRA 1D1AA 4A3CJ 1Y8QB 5J4VA 1XTAA 4A0YA 4E7SA 2NNYA 1IUYA 2HFHA 5GPAA 3K4BA 3ZMDA 2L0KA 1OFCX 2JMWA 3TP0A 3VWBA 2L9NA 4DBQA 2DMTA 3MCZA 1KA8A 2EJRA 1HF0A 3WU1B 2RQQA 3DBHB 4P9FA 4DJAA 1RZ4A 2R7FA 3OYIA 4RMNA 4PJ0C 2DU9A 1T33A 3CDHA 4BBRJ 2VPLA 5D6FA 1S7OA 3OS2A 1IF1A 4CHUA 1ZYRF 4RGUA 2G7UA 2QEXI 1HKTA 5M3FJ 4TV7A 3NQOA 2IS2A 5B1BH 1K6YA 4HQMA 2NVQJ 2EQRA 5L3DA 3ZQQA 1IRFA 4IX7A 2Z99A 3NARA 4EM0B 3BR5A 2GAUA 2JZYA 5KVRA 3BT9A 5D4SA 4JP0A 3BR3A 2KQRA 3BZCA 5F0CA 1ERDA 1R1TA 2K3FA 2AXLA 3V8LA 4YIFA 2DA2A 2EFOA 4IRGA 1YFHA 1WGXA 2BXYA 1BOAA 3PFYA 1FWZA 4CICA 2XRLA 2STTA 1OCPA 4Q47A 3ZQLA 1OMIA 2XGXA 4M3EA 4L9VA 2ZO4A 2LBFA 3HSEA 3E6CC 3BR6A 4WXCA 1OYYA 1SAUA 2F5DA 1DU6A 2LLKA 4E7KA 3V7RA 4XL9A 2DMQA 2MD5A 3SXYA 3CMYA 4G12A 2RC4A 3GFLA 1X3UA 1YO5C 1XCBA 2PMZN 1P4XA 3J80Z 2XDVA 2BY1A 4KMUX 5B3SH 3S17J 2QCOA 3F6OA 3KP2A 3DPTA 3NEUA 3P5JA 3PO3J 4JOMA 4GDFA 3ZPLA 4RAYA 1I1GA 4NQWA 2KZVA 2IW5A 2JN6A 4XOTA 4M6YA 2DW4A 5E1WA 4M6VA 3OYGA 2MH2A 4DYRA 3ZMZA 1JTYA 3H1CA 2ZC2A 3WGIA 1ETQA 2HOTA 5IP9J 1R22A 1XMXA 1BI0A 4MQ9F 2LG4A 1SANA 1JJ8C 4RA2A 1J9IA 3OIOA 3CF5F 2LOOA 3I9V2 3ASOH 2CWEA 1ITYA 2E5ZA 2F4OB 3QPHA 1QVUA 1MW7A 4GYIA 5HNFA 4BE0A 3ZRGA 3LSJA 4M6XA 5C4JJ 1KYWA 3BG3A 1ZR2A 2FE3A 3ABKH 3J80K 2V7FA 2X4HA 3OSGA 4YIRX 2IBDA 2X6WA 1MSFC 3SDGA 4BXFA 2EV6A 2W24A 3U1DA 4E70A 3MZYA 2UWMA 2K9LA 3KEYA 3TBIA 1HW2A 1IJWC 1TT5B 5EEHA 3FXOA 1A04A 1QQIA 2E2HJ 5BQTA 3H9GA 4ZYGA 1HDPA 2K4JA 3OYCA 5EGOB 1XCVA 5FROA 4IHTA 3V4GA 4ZC3A 3ROUA 1SAXA 2P5KA 2VKHA 2WAQA 2H8WA 3IL2A 1L0OC 1ZRDA 4BHBA 3NRVA 1LEBA 1U9NA 5FB2A 1XGOA 2VJ4A 3TOAA 4HDUA 3S3NA 4IPAA 1TQPA 3EUAA 2B63J 1SEUA 3KYDB 3M8EA 2O6GE 5D8KB 2JJ7A 3REOA 4DNCA 4XBFA 3GTLJ 2Z9OA 1UCRA 4X6AJ 5F04A 2HXIA 1YRNB 1Q1VA 3PSIA 4XONA 3ZP5A 2FD5A 4CCMA 3OYNA 1Z77A 1QPMA 3MKYB 2DPUA 1IRGA 4RB0A 4RM3A 2P81A 4GFBA 1DPUA 1MDMA 1K83J 3TDUC 1W4MA 3F8MA 2OTJI 1WJDA 2WV0A 3HXLA 4OIPF 2NVYJ 2DFIA 2CUEA 3OR2C 1B9NA 3M4OJ 2B9SA 5K1YA 4IF4A 1QRYA 4XKVA 3GUDA 5L3EA 4AIDA 2KIMA 2LY1A 3A0HC 2IGMA 1H88C 1D3YA 4BS9A 4E7ZA 3IRRA 3BPXA 2R5ZA 2HNHA 2GWRA 2X1CA 2KMUA 3WTZA 3IAS2 3GTMJ 1G8XA 3EUHA 5KHDA 1JI8A 2JTVA 4EJOA 2CQQA 3A03A 4W1UA 4XMYA 3TEDA 3GZNB 1MBHA 2E19A 2DXIA 1OCZH 5M5YJ 2GM4A 1IXSB 3A4CA 1HC8A 5ICFA 4CCLA 1W0TA 4LG0B 5LRSA 3L2CA 2K5CA 5CKTA 1K7AA 2YPRA 3FF5A 3LA3A 5F1JA 5F1RA 1BJAA 3V8KA 1QPIA 2R7ZJ 5FLVA 4HLYA 3CO7C 3FXQA 2JVGA 3EUHC 1ULYA 3VOEA 1Z21A 4HF1A 1I39A 3W3CA 5LGNA 1QVTA 2BV6A 2A5YB 4M72A 4BQAA 4C3IJ 3DEWA 3T8RA 4PK4A 4AWXB 2L7FP 4BDYA 1GVJA 3WG9A 1KQ9A 2BY3A 1MH4A 2H1KA 1JUPA 1Y6IA 2DFEA 1IV8A 2LYCA 4I01A 1MMSA 2AO9A 4MQVA 2YUSA 1X4OA 3ISPA 2XB5A 3FKIJ 5DV5A 5EEGA 4HF0A 4BDZA 5FD6A 3HDDA 4AIKA 2YS9A 2P6SA 4CYDA 5KK1A 4J00A 1R4MB 4G6DA 4OWRB 4WX9A 4X1EA 1YJWI 2NS0A 2E35A 3ZMTA 3GLLA 3PFIA 1FPQA 3RZDJ 1FTTA 2MG4A 2LY9A 3LMMA 4R8HA 3H5NA 3F8NA 5D5VB 3WTTC 3J7AO 2UXXA 3HBLA 1FJLA 2CQNA 1SVMA 2PEXA 3E5QA 3S14J 2EV0A 4KYWA 2XRNA 2VIXA 3HUGB 3TMOA 1U8BA 2XC7A 3P9KA 2MBFA 3CCYA 3VYRB 1K4SA 2NOGA 1LDJA 4ASNA 1BA5A 4RGRA 2E7WA 1GXPA 5GPCA 4II2A 2K7LA 2DA7A 2R92J 3K4CA 1R49A 2CV2A 3QYBA 5FFXA 1DGRM 1TZLA 4EJVA 4UVCA 2EK5A 4YG2F 2WWYA 2R7RA 2DN0A 5EYRA 2L01A 3F72A 1SFOJ 4DYCA 2MSYA 3M1CA 2EH3A 2M9HA 4NDLA 2K3PA 4PSXA 2DK8A 2E34A 1HDDC 1LNWA 3DF8A 3ELKA 3RSNA 4DBRA 2WBMA 2YU3A 4RS8A 5DEQA 3OR1C 2HYGD 4WXDA 1S3JA 5J3LA 4M74A 4A3IJ 2MYSA 3IRQA 2ZJQF 2MA3A 2QYOA 4BUPA 4HV6A 5J40A 4XICA 4F52A 2O61A 3M3YJ 1EF4A 2KJCA 3VB2A 3L2VA 3WU0A 1P7JA 1LFPA 2JPBA 1YX3A 2Z16A 3HRMA 3BWGA 4ZYDA 4HX7A 1PP8F 2DI3A 1IG7A 4LG3A 4L0ZB 2IPQX 2CW8A 4PJLA 1I3QJ 1V4RA 1WZ2A 4PUSA 3GTOJ 2NRAC 4BQQA 4LB5A 2BHZA 1HCRA 2XB0X 3W6JB 1BI3A 3MFKA 5DM7F 4RB2C 5M5XJ 1T6SA 3BTLA 3FBIB 3PQKA 2QA4I 2JA5J 4B3AA 3V8JA 2AQFA 2NNNA 4B48A 4L0YB 2J5PA 2QLZA 3HZJA 2QWWA 4DGWB 3CCMI 1TBXA 2HPIA 4MEXF 1B1BA 3E97A 2KRHA 1MMDA 1A36A 3E0JB 1QA6A 1S6LA 3CD6I 2HGCA 3JW4A 1ZK8A 2I8DA 4IHXA 3BR2A 3IH4A 3MVPA 3BJ6A 2KPMA 3CO6C 1USSA 2ECCA 1BN5A 3WTSC 4FISA 4RAFA 4MTDA 1OKRA 4XLEA 2A68F 3BR0A 3HEFA 1RIOH 3F0CA 2R7DA 5J8CA 4AYBA 3TO9A 4LD5A 1YI2I 4S05A 4ZJZA 3PO2J 3TO7A 1FYMA 3HOWJ 1CF7B 3O6BB 5IP6A 3JRAA 1IN5A 2DA4A 2L2OA 2P4WA 2QQAA 3HOXJ 1OJLA 3DU6A 3L00A 2F5FA 3BG6A 4U7BA 2KIQA 4CSWA 1KU2A 1G3YA 2HR3A 5GAEJ 5DCMB 4KT6A 1ZLKA 2XF5A 4I98B 4QPQA 2DCEA 4Q48A 2HZTA 3F6VA 2OV7A 2PG4A 2VQCA 3KP6A 1T39A 4OIOF 3SZPA 2XSDC 1WCMJ 2HPMA 3KPHA 3AAFA 3DV8A 4ESBA 3OSFA 1JXSA 2ZJPF 4EM1A 3LL7A 1GV5A 3B73A 5HOOA 1T95A 2F4MB 5HLHA 2D1HA 2IGKA 1KU7A 3S2DJ 3OV8A 3WU2C 3EQLF 1POGA 4ENMA 3CJTB 2R7VA 4II3A 3S2HJ 2W84A 2ICWG 3B6AA 4JK1X 1Z3XA 1UJ8A 1TWHJ 4H4KC 3C1DA 4KIFA 2X51A 3K1NA 3S1RJ 4A3FJ 1R1VA 1VQ8I 1K78B 1YRNA 2VBZA 2YU9J 2W1OA 5CVVA 1ENHA 1WHUA 2M45A 3FZVA 2L5QA 1JGGA 3S1NJ 1QHHD 2KKOA 1G59A 4F3QA 3ZQFA 1XD7A 1N78A 3SHFA 1KQ8A 2ZB9A 4HLXA 3CMEI 3W2WA 1JHFA 3FK7A 3ZOBA 3QWLA 3W6KB 4RAZA 3MD2A 1JUSA 1D8JA 3RDIA 3LQRA 2XGCA 1Z91A 1LFBA 1HA8A 4QIWN 1YOVB 3P9CA 2UZKA 5LGTA 4A6DA 3GX4X 1D0YA 5EEAA 2JA8J 5E8GA 1QNTA 4AD9A 3F3XA 2HDCA 1KGSA 2G9WA 1N25A 3SJMA 1NK2P 1J2XA 3K9TA 1WWXA 2QQ9A 4W97A 3IAM2 3VYSB 3F21A 1KQ0A 3HHGA 2O8XA 2BY0A 1UAAA 5HODA 2FRHA 1BR2A 1VQOI 4LG0A 4BKXA 4YFXF 4J19A 4IHWA 1MNMC 3LSRA 2B0LA 2EPFA 4FQGA 2DFHA 4GO1A 3AL0B 1K6OA 1AU7A 5DCFA 2M30A 2HOSA 3G1MA 3D0SA 1ZTRA 1SFEA 2LKPA 2D45A 1ETVA 2A3SA 4PSWA 3RYRA 5LHGA 2H6BA 2R7UA 3GCMA 4X0GA 2ZFWA 4XLHA 5L3GA 3D5LA 2R0QC 1PP7U 2ZXIA 4KUMA 3KIOA 1Z05A 5DS9A 3OYDA 2VOPA 3OIPA 1X1PA 1ZLJA 2CUJA 2O7OA 3K4KA 3H0DA 5HLTA 2E71A 3LA7A 2M4KA 4N9IA 3K4LA 3E6MA 1VQ7I 4Q5SF 1Z67A 1AKHA 2RQPA 2FOWA 2BW3B 2HDDA 1BR4A 3OS0A 4RBOA 2R7XA 2MD0A 4LIVA 3RPQA 1IZ1A 1MBGA 1H9GA 4DOZA 2CQ7A 3AG1H 4XNFA 3HHHA 1A6QA 1SVOA 5IYCJ 2EFWA 4EGYA 5CQEA 2V9VA 3HOSA 1I3AA 1X1CA 1DDNA 2A6HF 2E1MB 3J81Z 5H6RA 4QPOA 4RB3C 4ZH4F 5ERIA 4HG2A 3R4KA 3CCVI 2K9QA 4FE4A 3HUGA 1ZKGA 2IRFG 4IVNA 4L18B 4LLGF 1L3LA 2RNGA 3TQNA 5ICCA 3GO5A 1JTXA 2VASA 2X6YA 3LSHA 3S8PA 4A69C 4CCOA 2EA4A 4K2EA 1FP1D 3JTGA 4BBSJ 3W2AA 1FMVA 1EH6A 2H6CA 3MEXA 4FX4A 3ERED 3LFKA 4IO9F 1W7PB 5HLIA 3K1MA 3W6VA 2WA0A 4XN3A 4HZFA 4J01A 1BI2A 3I53A 3RCOA 1ZGAA 4ON0A 3N05A 2VL8A 2DYSH 3FXUA 2P0WA 1U2WA 4EJTA 3I64A 4A3GJ 3J81K 5BPDA 1F4KA 2OCCH 1WJAA 2HYFA 2VT2A 4KJZA 4BJ6C 1ETWA 1YITI 1F43A 4PZJA 3CUOA 3IWFA 1R5HA 3GLXA 1MBJA 3GTJJ 4D7NA 1ZN2A 4KMFA 1TT0A 2UV1A 1UELB 3MQ0A 4F93B 2Y2ZA 4CDGA 4CZZA 2QZ8A 2DOFA 2AHQA 2PX9A 1R5GA 2MC4A 2WAFA 3FX3A 3ZMSA 3OYAA 4IXAA 4DQ2A 3WHCA 2VKVA 3FIWA 1WJ5A 2P6TA 2Y9ZA 1SFXA 4DZJA 3K4JA 4WXHA 5GAHJ 2M3AA 1QZYA 2VQHA 4BE1A 4LK0F 3WTXC 2E1OA 2CFOA 3PQJA 4IJAA 3I3LA 3QYFA 1C0WA 3FMSA 1FC3A 2JA6J 1OCRH 1DQUA 2HU9A 3S1MJ 2MC3A 2G7HA 2W57A 4PFOA 4F7ZA 3JRDA 4BXXJ 3ECHA 3KP3A 2CO5A 4P9UA 3G3ZA 2AS5F 3QQAA 4NC8A 3F22A 1LJ9A 5K5RA 3DEUA 2VN2A 5BPIA 1HLVA 2EZLA 3PL8A 3DFGA 4XRSG 3DP7A 2NVTJ 2X1EA 1VQMI 3KFWX 1VQLI 5CJ9A 3H36A 3EPZA 2DTRA 3ABMH 2ID3A 4BHPA 3T5XA 4WWCA 3MKZA 1D1BA 4P96A 1B9MA 4JX4A 3P7NA 3CCSI 4A6EA 4NNJA 1BW6A 1IUFA 1FBSA 2DPDA 3NWSA 3H9JA 4E7IA 1V3FA 4IQJA 3GMEA 2JPCA 1MBKA 2M0CA 4IQ4A 5GTIC 1AHDP 1PDNC 4U88A 1W5SA 2ZSHB 4A3DJ 1RR8C 2N8GA 3DPLC 1FTZA 4XORA 2AQEA 4ZYHA 3FHZA 1R00A 2IEKA 1CF7A 3LSTA 3OS1A 3LSMA 4Y17A 2Y69H 4YFNF 1JKQC 5CVJA 2FOKA 1UG2A 2HS5A 2PN6A 3BP8A 2XAQA 5IY5H 1ZELA 3L2UA 2V4JC 3CF2A 2CQXA 1W36C 5DCMA 4BU2A 1Y1WJ 4BY1J 4LK1F 3E6DA 1X58A 2XF6A 4UB8C 5FFZA 1Z7LA 4Z6YA 2NS7A 2M2EA 5JHUA 3BZ6A 1XDSA 3HGGA 1PUFA 1P4WA 1PYVA 3GEZA 2Y30A 2LH9A 1IC8A 2V1DA 2F5CA 4PGHA 1BBYA 5FJ8J 2NXNB 5J1UA 3TOBA 3QP5A 4S04A 1QZEA 2W00A 2VC1A 2LDUA 2WY8Q 3RI4A 3I56I 2WB1A 2FQ4A 5JFRA 2CYYA 5DUKA 2V6EA 3KCCA 4BAYA 3BCAA 3HC7A 1B72B 1AA7A 3H5AA 3V42A 1R71A 1BR1A 4PJMA 2XUBA 3KEOA 4AIHA 3JRBA 4Q4ZF 2PJRB 1S7AA 2L02A 2LK2A 2QBYB 3OMYA 4HX8A 4F91B 4P1WA 1T38A 2EINH 1JT0A 2CV1A 3GZ5A 5HNHA 1FOYA 2XKPA 2VE9A 4Z2YA 2JA7J 2CW7A 3RKXA 4E7LA 2EBIA 3QYEA 4L5JA 3ZN0A 1OR7A 2ZXWH 4V2FA 1TP4A 1ZG1A 4O5VA 2Y75A 1G2HA 1GVDA 1FBUA 3SEQA 1WQ2A 4IL6C 5H6QA 4OMYA 3K10A 3ECOA 4LLLA 2Y48A 1N77A 4FETA 2XAFA 2PI0A 3O8GA 2I5UA 2WC2A 2OTLI 5KNLA 3UR3C 1WFXA 4ENJA 3L09A 4N0BA 5HDNA 1OR7C 5CLSA 1MNEA 4BEHB 3BQYA 2B7EA 1FSHA 1Z6RA 2XPUA 3GTGJ 5EZHA 3HJEA 3VDXA 3J7YJ 3EDPA 2Q8KA 3RKQA 2E5NA 1J7KA 1EKEA 3MKWB 2OJED 3Q0VA 3S32A 2AXTC 3QPSA 3R60A 3OYHA 4BQOA 1WJCA 3HSRA 5K7ZA 1P2FA 3BG7A 3IKTA 3CMMA 2H09A 3GF2A 1N75A 3JAMK 4ENNA 4CCNA 2HQRA 3WGHA 3C7JA 4OU0A 3UNGC 3HG9A 1ORKA 1HW5A 4XOPA 3JRFA 3ONQA 3X2QH 3PUBA 2X9DA 4DIQA 4LLNA 2FNPA 4XSZF 1IO2A 4G8XA 5M3MJ 4HA8A 3RYPA 1MKMA 2VKEA 3RQ4A 4CGZA 1WJEA 1ZGWA 4XN0A 1XGSA 1I5ZA 4ZDPA 3AL0C 1RI7A 2ID6A 2Y0SA 4I09A 3CUQB 1TLHB 2BW3A 4IRHA 4BGDA 4YELA 3HKZA 2R4GA 1DP7P 2KRCA 3DXJF 1PJRA 1T8IA 2JWTA 2CW0F 4O3MA 3L2RA 3DBLB 4F92B 3IKVA 4C9YA 1S7EA 3CC4I 1ZAOA 3G6EI 4Y52J 1AOYA 3BZKA 3CCRI 1BJZA 4UXNA 2OBPA 2IS1A 2ZSIB 1Z7UA 5FKLA 2CRGA 3E6BA 1IDZA 1MJ9A 4E7JA 4BHCA 2F6CA 3K70D 2J5OA 3FK6A 2YX7A 4FE7A 2CSOA 4XQFA 3N4MA 5IYDJ 4EATA 2CU7A 4UVBA 4U0YA 4IHVA 4XLNF 4I76A 3I54A 4HEA2 3ZXSA 3M1EA 3G2BA 2E1MC 4ANJA 4IZZA 2L9SA 3L2QA 4LJZF 1EJ9A 1Q1HA 5F64A 1W7PA 1KU3A 1A6IA 2QM3A 4UUTA 1T56A 2PFBA 3H0GJ 3GYHX 5JHFA 4CUGA 1R23A 2KIUA 2W25A 5LFAA 2LF8A 2DDAA 2LD5A 3DTEA 4NC7A 4A0ZA 2L4AA 3DBRB 3DKYA 1S29A 2JUGA 1JUMA 3WTUC 3GTPJ 2EIKH 1VNDA 2HKXA 2HYJA 3GWZA 3FM5A 1UHSA 3LOCA 3QPTA 3H5RA 2EB7A 2IAIA 1DUXC 3JSPA 2ISZA 2VPRA 1NG6A 1F36A 4Y7NJ 4C30A 2R5YA 2IA2A 4C3JJ 4KIBA 2DK5A 2QQBA 1U78A 1W0UA 1RESA 1KYZA 3E1SA 2PMZA 3ZGKA 4LB6B 5GP9A 1SD4A 4GXOA 4BL0B 2OA4A 2L7KA 2XSJC 1BC7C 1D0ZA 2VLAA 1H8AC 4HPQA 3KYCB 4KIGA 4A0XA 5IPAA 1FBQA 2E1NA 2VXZA 4B09A 4KA4A 1X3ZB 3FXMA 4MIMA 4BY7J 5JVGF 3TW7A 2CS3A 1VQPI 2R7OA 3T8TA 2HOEA 1T0FA 1VF9A 4XLAA 1Z0XA 3ESWB 5J6XA 2QF7A 2A6TA 2W82A 2V6CA 1G3TA 1VQKI 4B3XA 2WV1A 3RPUD 2FJ1A 3I5UA 2VBWA 2VXDA 2XGEA 5EG0B 3HRUA 2M1BA 2H1LA 4CH7A 2H27A 1TQIA 3Q5FA 1X1AA 2XPVA 3H3VK 3HRTA 2QKLB 4OIQF 1T0FC 2LKSA 5IT9Z 4N9HA 2HWVA 2NVUB 3DQVC 2F4IA 2HZDA 1GV2A 2Y9YA 3FKJA 1TTYA 3OOPA 1IW7F 2K86A 3EYIA 4EEFG 2JSCA 3ABTA 1XPXA 5K7FA 4ZYAA 1MZBA 4S0HB 3VPRA 3OY9A 2D1VA 5E1ZB 1X3WB 1UG0A 1VQ6I 1UHWA 2PQ8A 3GZ6A 1O4XA 1SMYF 2CUZA 1QU3A 2ZMEB 2ACJA 3AG4H 1LE8B 1ON1A 3MMYB 4CCKA 1DU0A 2VI6A 2WADA 3VSKA 2HVRA 3KLOA 3H35A 3M9AA 1WI3A 5IP7J 4OMZA 3EETA 4OINF 4E4HA 2IT0A 4XLPF 2D2WA 3FDYA 5D5UB 5IT9K 4XIDA 5ICEA 4D7MA 3QU3A 2GIZA 1HQCA 2COBA 3E5UA 4UV9A 2FBIA 1R6RA 2QKMB 1FSEA 5TRDA 5KAIC 3RKWA 3GTKJ 4KITB 3HTSB 2LR8A 3F8BA 4RB1A 4B47A 4A2UA 4ZZDA 1B72A 3C2HA 3JREA 1EH8A 2DOEA 3C2BA 3OYFA 4MHGA 4MTEA 3GFIA 5CQGA 3BJAA 4EMSA 5JR3A 1B8IB 1SVLA 1BIAA 4ZDLA 2HI3A 2XIGA 4L9TA 2IGNA 2TCTA 3VFZA 5AIQA 4KISA 1W5CC 1MIJA 1P7IA 3DCFA 3M7GA 3WG7H 5EGOA 1U5TB 1J0RA 4ZTJA 4L9JA 1HSJA 4PJNA 1WSUA 4AUXA 3LAJA 3I0TA 5ILVA 1U6GA 3LAPA 2R93J 3V7SA 4NC6A 5E8IA 2KLOA 5K5QA 1A5JA 3WTVC 2V9KA 2L7MP 5E17F 2I10A 3D5SC 3CCEI 2CG4A 2BXZA 3FXRA 3KETA 2DT5A 2NS8A 3S3OA 2TRTA 1FIAA 3QRFF 4I0AA 4B4CA 2IS6A 6PAXA 3LSGA 4A12A 3K6GA 5DDGA 4BEHA 2IA0A 4LITA 3K69A 5ILSA 2JRMA 2QGUA 3W2VA 4ABZA 3BJOA 5BMZA 3U1KA 1LFUP 2E2JJ 1DGWY 3BDDA 1JT6A 3IV5A 1OYIA 2BHYA 3Q0WA 5DM6F 4HNTA 4M3GA 5KAFC 1R58A 2VQLA 3C2GA 4I02A 5B66C 3IWZA 1XX5A 3L2WA 1E3PA 4CCJA 5LHIA 4I7HA 1X1DA 3RZOJ 1MD0A 3S3MA 2ADUA 4LIUA 4E7HA 1MJAA 5DD4A 2VBYA 4XK4A 1B59A 2DOAA 5LD2C 3CJNA 2LRDA 3CC2I 4ZDOA 1SD5A 1JE8A 2DAOA 2O03A 1BL0A 1FOKA 1WI9A 3E5XA 3JRCA 2ZBKA 1NG7A 1H89C 3MKLA 1F5TA 3HOYJ 3G73A 2A05A 1BIBA 1FMWA 3IHUA 4WCGA 2HTSA 1STZA 5IOZA 3PIOF 1JKPC 2JK3A 5BS6A 4ESFA 3SEZA 4HBLA 1O3RA 1IN7A 2M87A 5L3BA 5EF6A 2OF7A 2ZJRF 2CUFA 3PUFA 4YEJA 3R61A 1P92A 1LDDA 3FMRA 1LKXA 1XGMA 2Q0OA 4XR6A 3WGGA 2C6YA 2GA1A 1GHCA 1Z1DA 1IRXA 3D5RC 2K9NA 3QODA 4IHSA 1OCCH 1IN8A 2HVQA 2XASA 4MNUA 4UY8I 1IXCA 2HQNA 4BJTA 3RTRA 2G0EA 5B5EC 1EA3A 1U8RA 3WE3A 3BTIA 1VQ5I 3CUQC 3DTKA 1K4TA 1JJ6C 2W48A 4EQQA 4C3HJ 3B02A 1D5VA 4XKWA 4DW6A 1R1UA 5C4XJ 2KT0A 2OZUA 3IH2A 1S9HA 2ELJA 1SC7A 4HNVA 4MGRA 1HW1A 4FX0A 2VUMJ 2BVLA 3ZQ7A 4UB6C 2OZ6A 2Z5UA 5FKKA 4QTRA 2CV0A 3CQZJ 2UXNA 2WY7Q 2IP2A 2R5ZB 2FF4A 2YX4A 1WJBA 4B44A 3ERMA 4XKCA 3QAHA 5H2FC 4MEYF 4A5NA 4EVIA 1HSTA 1E17A 4AU7A 1Y1VJ 3ABLH 1R9TJ 2RAEA 2P8TA 4KFCA 4M3FA 1RNLA 1ZRCA 4BNCA 5GADJ 5C44J 3DTIA 4EV0A 5B1AH 4RM2A 1UB9A 5ILUA 1J5YA 2EILH 3HRSA 2LNBA 2WAQN 1P6RA 1V5FA 1LUJB 3M8JA 2L7ZA 3B6CA 4LFUA 2PJPA 1UHMA 2F48A 4NB5A 5LBQA 3H9QA 2XPWA 4QWQA 2QSGX 5DYMA 5K5OA 2VC0A 2VQGA 1TC3C 2W4SA 1MMNA 5EDNA 1SFUA 3CMAI 1VQNI 3IC7A 4QLCU 4UNOA 3KP5A 1YJNI 2HKOA 1IGNA 4LGWA 1TWCJ 4MLOA 3HM5A 3HOTA 1MJBA 2VJJA 4IEJA 2ZNZA 2A61A 5TJJA 2V26A 3TL4X 3WE2A 3KZIC 1VQ9I 2V1NA 1BW5A 5E3MA 3KP4A 4GCVA 5FRMA 3I59B 4RGSA 1OCTC 1WH7A 2ZXJA 3AFHA 4C2TA 1VTNC 1GDTA 3BPVA 3PSFA 2PLYA 2WTEA 3I4NJ 3MZ8A 5E18F 2DT7B 5EG0A 2K40A 2W85A 2XVCA 2DA1A 1YIOA 3TDZC 3R6SA 1LEAA 1F1ZA 4XLCA 2XF7A 2JUCA 2R7WA 3SDBA 1X2MA 1D8KA 1QGPA 3C3WA 4ZZLA 5IT3A 1WJFA 1JHHA 4GGGA 4FASD 5CVIA 4L9NA 3T0YA 2O5RA 2Q2EB 1GLNA 1BI1A 3A2KA 1NK3P 2HDWA 4M9ZA 4Y33A 1APLC 2HTJA 2HQ5A 1IXRC 1TL8A 4OIRF 4LMYA 2GLOA 2VODA 3DLAA 1NTCA 1CGPA 1I50J 2M8EA 2MFZA 2QQ8A 2K02A 2ZXHA 4GRIA 2GXAA 2VKDA 2ZMEA 3PNYA 3KP7A 2XAUA 1LE8A 2BZTA 4UHTA 1LB2A 1FZPB 1SD7A 3A1YA 2PMUA 2CQKA 2BBYA 3GFMA 3PIPF 2HVSA 4B8XA 2X85A 1V5GA 1XGNA 3G1LA 1RR7A 4KDPA 5JLWA 2L3DA 3BTJA 1I6XA 1RKWA 3IP4B 3T1BA 5JLXA 2RREA 5J47A 1MSEC 2OC6A 1J09A 3BLYA 4G7OF 3LSPA 3E7LA 3CJQB 5E1XA 1R4NB 2BEOA 1LDKB 3OL4A 3UKGA 2QENA 4RDUA 2PMHA 4XLFA 2ZMEC 4C2MJ 4HSTA 2Z33A 3JR9A 1FT9A 1M1EB 5HLGA 9ANTA 4N4NB 5BOXA 1LVAA 3LWFA 4IKFA 3K7AJ 4P5OA 3KZYA 3VYTB 2F5VA 5C3EJ 1O7LA 2ZFUA 1A31A 2DMNA 1ETKA 3BY6A 4A5MA 2MW8A 2FBHA 3QU6A 2DQRA 2TDXA 1BM9A 1RUNA 3HPGA 1RRJA 1B8IA 1ETYA 1Z6TA 2KIFA 2XAJA 5FKMA 3WTYC 2DMPA 4I0BA 3IH3A 2NOJB 3G71I 4JBAA 2RVCA 3LQQA 3BQZA 5LEJA 3IUOA 1ZR4A 2FQ3A 1ACIA 1U5TA 5DUIA 3HPHA 1XS9A 2LF7A 2X6OA 1P4AA 2A6EF 3VEPA 1O3QA 2Z1DA 5CYVA 2PBIA 4YRVA 2L54A 1P9QC 1IN6A 2Y0MA 4M3BA 2OQGA 3CDLA 2YSRA 4D9JA 3Q9SA 5J4YA 5F08A 2JSPA 4YIIA 3BCBA 2P7CB 4CO8A 4I6ZA 1U5TC 2RKHA 2ETHA 2IXSA 2DA3A 4XRSA 2HEOA
chains in the Genus database with same CATH topology
3BR1A 1VFCA 3LOCA 5F0FA 3TW6A 3HGYA 3Q0UA 1GV5A 2IAIA 1MBFA 2VPRA 1TWGJ 1F36A 4Y7NJ 5E3LA 2R5YA 4C3JJ 4A3MJ 3S2DJ 1U78A 1W0UA 3HOZJ 1RESA 5E3NA 1POGA 4JYKA 1TWFJ 5GP9A 3S2HJ 2KDZA 3A01B 2LP0A 3B6AA 3L1PA 1TWHJ 2EZHA 2LFBA 2EZKA 3S1RJ 1H8AC 4A3FJ 2L9RA 4B1RA 3D1NI 5IPAA 5EZGA 1YRNA 2E2IJ 2YU9J 4MIMA 1WPKA 1ENHA 4BY7J 1JGGA 3TW7A 3S1NJ 2R5YB 2Y0SN 4MFEA 3ZQFA 1VF9A 3HKZN 2ZB9A 1Z0XA 4A3CJ 3BG9A 2QF7A 3FK7A 3ZOBA 1JUSA 3BTCA 5GPAA 2WV1A 2XGCA 2FJ1A 1LFBA 2L0KA 1OFCX 2JMWA 3TP0A 2XGEA 4QSHA 4QIWN 5EG0B 3O8HA 2DMTA 3LNQA 1HF0A 3TP3A 2XPVA 5EEAA 2JA8J 3H3VK 1T33A 3SJMA 1NK2P 4BBRJ 4W97A 1IRZA 2HOAA 4A3BJ 1GV2A 2Y9YA 4AYBN 4FTHA 5M3FJ 4EEFG 5HODA 2M8GX 2NVQJ 4BKXA 4J19A 5K7FA 2EQRA 1MNMC 4S0HB 3VPRA 3LSRA 5IYBJ 4IHWA 3NARA 5J1RA 3BR5A 4CYCB 1AU7A 1O4XA 2HOSA 3BT9A 3G1MA 4JP0A 3BR3A 1ZTRA 2HXOA 5F0CA 1LE8B 1ETVA 1DU0A 2VI6A 2DA2A 1WI3A 1ETXA 5IP7J 1WGXA 5BNGA 2R0QC 1FEXA 2M34A 3S15J 5DS9A 2XRLA 2O7OA 1CQTA 1OCPA 3ZQLA 4XIDA 4M3EA 4D7MA 2COBA 3Q3SA 1AKHA 3BR6A 1DU6A 2LLKA 2HDDA 2H8RA 2DA5A 2DMQA 5IOYA 3CMYA 4G12A 3I4MJ 3GTKJ 4RBOA 2CJJA 2FX0A 3S16J 2LR8A 1MBGA 2PMZN 5IYCJ 3S17J 4A93J 1B72A 2QCOA 4D5FA 3JREA 2EZIA 3PO3J 3C2BA 5F27A 4MO7A 2MGQA 2JN6A 1B8IB 4UUSB 2K9QA 4FE4A 4M6VA 1ZKGA 2HI3A 3ZQGA 4DYRA 1AKHB 1JTYA 2TCTA 1JTXA 1ETQA 2HOTA 5IP9J 1P7IA 4A69C 2ECBA 3DCFA 1X2NA 2ME6A 5EGOA 1SANA 1JJ8C 4BBSJ 3OIOA 4FCYA 4AUXA 2D5VA 3NAUA 2R93J 1A5JA 4D5CA 1ITYA 2L7MP 2I10A 1QVUA 3W6VA 3LSJA 5C4JJ 3BG3A 1ZR2A 3OSGA 2NS8A 2IBDA 1MSFC 3SDGA 2TRTA 1FIAA 4B4CA 1D5YA 3LSGA 2ME0A 4A3GJ 1IJWC 3JRHA 4ABZA 1K61A 1UMQA 2E2HJ 1LFUP 2E2JJ 1HDPA 5EGOB 1JT6A 3IV5A 1ETWA 3Q0WA 1F43A 2O9LA 4M3GA 4XRMA 2DTZA 3GTJJ 1MBJA 4D7NA 2Y2ZA 2Y31A 3S1QJ 2AHQA 2LTPA 3RZOJ 3WHCA 1U9NA 2VKVA 3FIWA 4XK4A 3PM1A 2Y9ZA 4DZJA 2B63J 2JJ7A 2E1OA 1BL0A 1VI0A 3GTLJ 1H89C 3JRCA 4A3LJ 4X6AJ 3MKLA 5F04A 3HOYJ 2HXIA 4A3JJ 1Q1VA 1YRNB 2JA6J 3A02A 2FD5A 5IOZA 3S1MJ 1MBEA 1Z77A 2LVSA 3ZQHA 1JKPC 3QPLA 2JK3A 2P81A 4GFBA 4MFDA 3JRDA 1K83J 1WH5A 4BXXJ 5F0HA 5EF6A 2OF7A 2NVYJ 3QQAA 3ZQIA 2CUFA 5FKOA 2CUEA 3M4OJ 1QRYA 2EZLA 1HLVA 4XRSG 2NVTJ 2K9NA 1H88C 2ID3A 2R5ZA 4JX4A 2G0EA 1XG1A 1XC5A 1BW6A 1IUFA 3BTIA 5J1YA 3GTMJ 1JJ6C 1MBKA 2CQQA 2M0CA 2W48A 3A03A 4W1UA 4C3HJ 3TEDA 1MBHA 2E19A 1AHDP 5M5YJ 4A3KJ 2GM4A 4DW6A 4A3DJ 2DJNA 5C4XJ 2N8GA 2KT0A 3IH2A 1W0TA 1RETA 1FTZA 4HNVA 4A3EJ 2DMUA 2VUMJ 2IEKA 5F1JA 5FKKA 1QPIA 1JKQC 2R7ZJ 4QTRA 1UG2A 5FLVA 5E3OA 3CQZJ 2R5ZB 2CQXA 3BG5A 1Y1WJ 1QVTA 3K2AA 4BY1J 4JX6A 3WHBA 4C3IJ 3HOUJ 1X58A 3DEWA 2NS7A 2L7FP 2M2EA 3HGGA 1Y1VJ 1PUFA 1MH4A 5M5WJ 1R9TJ 1JUPA 2H1KA 2Y30A 1IV6A 2RAEA 1IC8A 4IHYA 4M3FA 2OPTA 2AO9A 2YUSA 5FJ8J 5J1UA 5C44J 2XB5A 3FKIJ 2WAQN 3HDDA 1MH3A 2YS9A 2L7ZA 3B6CA 2FQ4A 4LOCA 4X1EA 2XPWA 4AC0A 3HB9A 1B72B 3RZDJ 1FTTA 3A01A 2MG4A 2LY9A 1TWAJ 1TC3C 3HBLA 3JRBA 1FJLA 5EDNA 3GTQJ 1JKRC 1PUFB 2LK2A 3S14J 1IGNA 1JT0A 5FLMJ 1TWCJ 4MLOA 3HM5A 1U8BA 4IEJA 3HOVJ 5K7HA 3CCYA 2JA7J 1BW5A 3JRIA 2NOGA 5E3MA 2EBIA 3SFIA 1BA5A 2ELKA 5GPCA 4V2FA 1U9OA 3RQIA 2DA6A 2DA7A 1G2HA 2R92J 1GVDA 1OCTC 1WH7A 2GBYA 1GDTA 3I4NJ 5FKNA 3O8GA 3FISA 2DN0A 5EYRA 2K40A 5EG0A 2DA1A 1SFOJ 4DYCA 2MSYA 4DZPA 2M9HA 2EH3A 4NDLA 2NVXJ 3BQYA 1HDDC 1X2MA 2XPUA 3GTGJ 5EZHA 4JX5A 3RKQA 1NK3P 3Q0VA 1APLC 4V2GA 3QPSA 2HQ5A 2X48A 5J3LA 3JRGA 4A3IJ 5K7ZA 2GLOA 1RKTA 1NTCA 4CYCA 1I50J 4XICA 3M3YJ 1EF4A 1ORKA 2XGDA 3JRFA 1P7JA 1LE8A 2X9DA 1IG7A 3MN2A 5M3MJ 4L5EA 3G1LA 1RR7A 1I3QJ 2VKEA 5JLWA 3BTJA 1RKWA 5JLXA 3GTOJ 1MSEC 1ZGWA 2XB0X 3E7LA 3LSPA 1HCRA 1ETOA 3ZQCA 3UKGA 4RDUA 1E3OC 2ID6A 5M5XJ 3BTLA 4C2MJ 2JA5J 3JR9A 1FIPA 4B3AA 9ANTA 2WB1N 3K7AJ 4M3DA 2JWTA 2O8KA 5C3EJ 1JKOC 2DMNA 1ZK8A 3OOUA 1S7EA 1ETKA 4IHXA 3BR2A 2MW8A 4Y52J 3IH4A 1GUUA 3MVPA 2K9SA 1BJZA 2ECCA 4FISA 1B8IA 1ETYA 5FKLA 2CRGA 4UUSA 1IDZA 1HOMA 5FKMA 2DMPA 3IH3A 3BR0A 3HEFA 3F0CA 3FK6A 4FE7A 3BQZA 3G1OA 1GT0C 3PO2J 5IYDJ 2CU7A 3HOWJ 4IHVA 1ZR4A 1I6HJ 1ZQ3P 5IP6A 3JRAA 4I76A 1XS9A 2DA4A 2X6OA 3GBGA 4DYQA 3HOXJ 1OJLA 1A6IA 2LKXA 4M3BA 4UUTA 1T56A 3CDLA 3H0GJ 1RPWA 5F08A 5DTDA 2LD5A 2XSDC 1WCMJ 4I6ZA 1JUMA 3GTPJ 1VNDA 2HYJA 1IDYA 3OSFA 2DA3A 4XRSA 1UHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR1 A;  1VFC A;  3LOC A;  5F0F A;  3TW6 A;  3HGY A;  3Q0U A;  1GV5 A;  2IAI A;  1MBF A;  2VPR A;  1TWG J;  1F36 A;  4Y7N J;  5E3L A;  2R5Y A;  4C3J J;  4A3M J;  3S2D J;  1U78 A;  1W0U A;  3HOZ J;  1RES A;  5E3N A;  1POG A;  4JYK A;  1TWF J;  5GP9 A;  3S2H J;  2KDZ A;  3A01 B;  2LP0 A;  3B6A A;  3L1P A;  1TWH J;  2EZH A;  2LFB A;  2EZK A;  3S1R J;  1H8A C;  4A3F J;  2L9R A;  4B1R A;  3D1N I;  5IPA A;  5EZG A;  1YRN A;  2E2I J;  2YU9 J;  4MIM A;  1WPK A;  1ENH A;  4BY7 J;  1JGG A;  3TW7 A;  3S1N J;  2R5Y B;  2Y0S N;  4MFE A;  3ZQF A;  1VF9 A;  3HKZ N;  2ZB9 A;  1Z0X A;  4A3C J;  3BG9 A;  2QF7 A;  3FK7 A;  3ZOB A;  1JUS A;  3BTC A;  5GPA A;  2WV1 A;  2XGC A;  2FJ1 A;  1LFB A;  2L0K A;  1OFC X;  2JMW A;  3TP0 A;  2XGE A;  4QSH A;  4QIW N;  5EG0 B;  3O8H A;  2DMT A;  3LNQ A;  1HF0 A;  3TP3 A;  2XPV A;  5EEA A;  2JA8 J;  3H3V K;  1T33 A;  3SJM A;  1NK2 P;  4BBR J;  4W97 A;  1IRZ A;  2HOA A;  4A3B J;  1GV2 A;  2Y9Y A;  4AYB N;  4FTH A;  5M3F J;  4EEF G;  5HOD A;  2M8G X;  2NVQ J;  4BKX A;  4J19 A;  5K7F A;  2EQR A;  1MNM C;  4S0H B;  3VPR A;  3LSR A;  5IYB J;  4IHW A;  3NAR A;  5J1R A;  3BR5 A;  4CYC B;  1AU7 A;  1O4X A;  2HOS A;  3BT9 A;  3G1M A;  4JP0 A;  3BR3 A;  1ZTR A;  2HXO A;  5F0C A;  1LE8 B;  1ETV A;  1DU0 A;  2VI6 A;  2DA2 A;  1WI3 A;  1ETX A;  5IP7 J;  1WGX A;  5BNG A;  2R0Q C;  1FEX A;  2M34 A;  3S15 J;  5DS9 A;  2XRL A;  2O7O A;  1CQT A;  1OCP A;  3ZQL A;  4XID A;  4M3E A;  4D7M A;  2COB A;  3Q3S A;  1AKH A;  3BR6 A;  1DU6 A;  2LLK A;  2HDD A;  2H8R A;  2DA5 A;  2DMQ A;  5IOY A;  3CMY A;  4G12 A;  3I4M J;  3GTK J;  4RBO A;  2CJJ A;  2FX0 A;  3S16 J;  2LR8 A;  1MBG A;  2PMZ N;  5IYC J;  3S17 J;  4A93 J;  1B72 A;  2QCO A;  4D5F A;  3JRE A;  2EZI A;  3PO3 J;  3C2B A;  5F27 A;  4MO7 A;  2MGQ A;  2JN6 A;  1B8I B;  4UUS B;  2K9Q A;  4FE4 A;  4M6V A;  1ZKG A;  2HI3 A;  3ZQG A;  4DYR A;  1AKH B;  1JTY A;  2TCT A;  1JTX A;  1ETQ A;  2HOT A;  5IP9 J;  1P7I A;  4A69 C;  2ECB A;  3DCF A;  1X2N A;  2ME6 A;  5EGO A;  1SAN A;  1JJ8 C;  4BBS J;  3OIO A;  4FCY A;  4AUX A;  2D5V A;  3NAU A;  2R93 J;  1A5J A;  4D5C A;  1ITY A;  2L7M P;  2I10 A;  1QVU A;  3W6V A;  3LSJ A;  5C4J J;  3BG3 A;  1ZR2 A;  3OSG A;  2NS8 A;  2IBD A;  1MSF C;  3SDG A;  2TRT A;  1FIA A;  4B4C A;  1D5Y A;  3LSG A;  2ME0 A;  4A3G J;  1IJW C;  3JRH A;  4ABZ A;  1K61 A;  1UMQ A;  2E2H J;  1LFU P;  2E2J J;  1HDP A;  5EGO B;  1JT6 A;  3IV5 A;  1ETW A;  3Q0W A;  1F43 A;  2O9L A;  4M3G A;  4XRM A;  2DTZ A;  3GTJ J;  1MBJ A;  4D7N A;  2Y2Z A;  2Y31 A;  3S1Q J;  2AHQ A;  2LTP A;  3RZO J;  3WHC A;  1U9N A;  2VKV A;  3FIW A;  4XK4 A;  3PM1 A;  2Y9Z A;  4DZJ A;  2B63 J;  2JJ7 A;  2E1O A;  1BL0 A;  1VI0 A;  3GTL J;  1H89 C;  3JRC A;  4A3L J;  4X6A J;  3MKL A;  5F04 A;  3HOY J;  2HXI A;  4A3J J;  1Q1V A;  1YRN B;  2JA6 J;  3A02 A;  2FD5 A;  5IOZ A;  3S1M J;  1MBE A;  1Z77 A;  2LVS A;  3ZQH A;  1JKP C;  3QPL A;  2JK3 A;  2P81 A;  4GFB A;  4MFD A;  3JRD A;  1K83 J;  1WH5 A;  4BXX J;  5F0H A;  5EF6 A;  2OF7 A;  2NVY J;  3QQA A;  3ZQI A;  2CUF A;  5FKO A;  2CUE A;  3M4O J;  1QRY A;  2EZL A;  1HLV A;  4XRS G;  2NVT J;  2K9N A;  1H88 C;  2ID3 A;  2R5Z A;  4JX4 A;  2G0E A;  1XG1 A;  1XC5 A;  1BW6 A;  1IUF A;  3BTI A;  5J1Y A;  3GTM J;  1JJ6 C;  1MBK A;  2CQQ A;  2M0C A;  2W48 A;  3A03 A;  4W1U A;  4C3H J;  3TED A;  1MBH A;  2E19 A;  1AHD P;  5M5Y J;  4A3K J;  2GM4 A;  4DW6 A;  4A3D J;  2DJN A;  5C4X J;  2N8G A;  2KT0 A;  3IH2 A;  1W0T A;  1RET A;  1FTZ A;  4HNV A;  4A3E J;  2DMU A;  2VUM J;  2IEK A;  5F1J A;  5FKK A;  1QPI A;  1JKQ C;  2R7Z J;  4QTR A;  1UG2 A;  5FLV A;  5E3O A;  3CQZ J;  2R5Z B;  2CQX A;  3BG5 A;  1Y1W J;  1QVT A;  3K2A A;  4BY1 J;  4JX6 A;  3WHB A;  4C3I J;  3HOU J;  1X58 A;  3DEW A;  2NS7 A;  2L7F P;  2M2E A;  3HGG A;  1Y1V J;  1PUF A;  1MH4 A;  5M5W J;  1R9T J;  1JUP A;  2H1K A;  2Y30 A;  1IV6 A;  2RAE A;  1IC8 A;  4IHY A;  4M3F A;  2OPT A;  2AO9 A;  2YUS A;  5FJ8 J;  5J1U A;  5C44 J;  2XB5 A;  3FKI J;  2WAQ N;  3HDD A;  1MH3 A;  2YS9 A;  2L7Z A;  3B6C A;  2FQ4 A;  4LOC A;  4X1E A;  2XPW A;  4AC0 A;  3HB9 A;  1B72 B;  3RZD J;  1FTT A;  3A01 A;  2MG4 A;  2LY9 A;  1TWA J;  1TC3 C;  3HBL A;  3JRB A;  1FJL A;  5EDN A;  3GTQ J;  1JKR C;  1PUF B;  2LK2 A;  3S14 J;  1IGN A;  1JT0 A;  5FLM J;  1TWC J;  4MLO A;  3HM5 A;  1U8B A;  4IEJ A;  3HOV J;  5K7H A;  3CCY A;  2JA7 J;  1BW5 A;  3JRI A;  2NOG A;  5E3M A;  2EBI A;  3SFI A;  1BA5 A;  2ELK A;  5GPC A;  4V2F A;  1U9O A;  3RQI A;  2DA6 A;  2DA7 A;  1G2H A;  2R92 J;  1GVD A;  1OCT C;  1WH7 A;  2GBY A;  1GDT A;  3I4N J;  5FKN A;  3O8G A;  3FIS A;  2DN0 A;  5EYR A;  2K40 A;  5EG0 A;  2DA1 A;  1SFO J;  4DYC A;  2MSY A;  4DZP A;  2M9H A;  2EH3 A;  4NDL A;  2NVX J;  3BQY A;  1HDD C;  1X2M A;  2XPU A;  3GTG J;  5EZH A;  4JX5 A;  3RKQ A;  1NK3 P;  3Q0V A;  1APL C;  4V2G A;  3QPS A;  2HQ5 A;  2X48 A;  5J3L A;  3JRG A;  4A3I J;  5K7Z A;  2GLO A;  1RKT A;  1NTC A;  4CYC A;  1I50 J;  4XIC A;  3M3Y J;  1EF4 A;  1ORK A;  2XGD A;  3JRF A;  1P7J A;  1LE8 A;  2X9D A;  1IG7 A;  3MN2 A;  5M3M J;  4L5E A;  3G1L A;  1RR7 A;  1I3Q J;  2VKE A;  5JLW A;  3BTJ A;  1RKW A;  5JLX A;  3GTO J;  1MSE C;  1ZGW A;  2XB0 X;  3E7L A;  3LSP A;  1HCR A;  1ETO A;  3ZQC A;  3UKG A;  4RDU A;  1E3O C;  2ID6 A;  5M5X J;  3BTL A;  4C2M J;  2JA5 J;  3JR9 A;  1FIP A;  4B3A A;  9ANT A;  2WB1 N;  3K7A J;  4M3D A;  2JWT A;  2O8K A;  5C3E J;  1JKO C;  2DMN A;  1ZK8 A;  3OOU A;  1S7E A;  1ETK A;  4IHX A;  3BR2 A;  2MW8 A;  4Y52 J;  3IH4 A;  1GUU A;  3MVP A;  2K9S A;  1BJZ A;  2ECC A;  4FIS A;  1B8I A;  1ETY A;  5FKL A;  2CRG A;  4UUS A;  1IDZ A;  1HOM A;  5FKM A;  2DMP A;  3IH3 A;  3BR0 A;  3HEF A;  3F0C A;  3FK6 A;  4FE7 A;  3BQZ A;  3G1O A;  1GT0 C;  3PO2 J;  5IYD J;  2CU7 A;  3HOW J;  4IHV A;  1ZR4 A;  1I6H J;  1ZQ3 P;  5IP6 A;  3JRA A;  4I76 A;  1XS9 A;  2DA4 A;  2X6O A;  3GBG A;  4DYQ A;  3HOX J;  1OJL A;  1A6I A;  2LKX A;  4M3B A;  4UUT A;  1T56 A;  3CDL A;  3H0G J;  1RPW A;  5F08 A;  5DTD A;  2LD5 A;  2XSD C;  1WCM J;  4I6Z A;  1JUM A;  3GTP J;  1VND A;  2HYJ A;  1IDY A;  3OSF A;  2DA3 A;  4XRS A;  1UHS A; 
#chains in the Genus database with same CATH topology
 3BR1 A;  3U21 A;  1VFC A;  1J75 A;  1Z3Y A;  3HGY A;  3Q0U A;  5D5W B;  5CPR B;  1HKS A;  3AKZ A;  2R7T A;  5E3L A;  4XM3 A;  3JAM Z;  3ZMU A;  1X19 A;  1X4P A;  1D0X A;  2FU4 A;  2E1C A;  3HOZ J;  5E3N A;  3ASN H;  1XN7 A;  1TWF J;  2KDZ A;  2RDP A;  3A01 B;  2LP0 A;  4C2U A;  2CMP A;  2XAH A;  1FOW A;  4BJ5 C;  5FRN A;  2LFB A;  3OYL A;  4PCQ A;  2NAZ A;  1E0E A;  3FWE A;  4B1R A;  3D1N I;  3C18 A;  2E2I J;  1U0J A;  3KLN A;  1REP C;  2M0M A;  1XSD A;  5A2Q Z;  3H3Z A;  4UUV A;  3K1P A;  5GTH C;  4MFE A;  1BC8 C;  2JT1 A;  2MLK A;  5E20 A;  3BG9 A;  3Q9V A;  5HDK A;  3FHN A;  1FLI A;  2MLG A;  4EJU A;  3BTC A;  4QSH A;  1RUO A;  1TNT A;  3JCU C;  3O8H A;  2LY2 A;  3LNQ A;  3LSI A;  4G6Q A;  2OD5 A;  5TGT A;  2E60 A;  3TP3 A;  3ABU A;  2RGV A;  5J8F A;  2IVM A;  2YR2 A;  1XSV A;  3L7W A;  5HDG A;  2IA1 A;  1YTY A;  4UV8 A;  1IRZ A;  2HOA A;  2R7Q A;  4Y15 A;  1G4D A;  4I99 C;  1SD6 A;  3I55 I;  4AYB N;  3K4M A;  4NHJ A;  5A2Q K;  4FTH A;  1MMG A;  2KL4 A;  2VB6 A;  2M8G X;  3BC8 A;  3LA2 A;  3H3U A;  1FOX A;  2MAB A;  1YW9 A;  1W5T A;  4G94 A;  5IYB J;  4I2O A;  5J1R A;  2XAG A;  4CYC B;  2JVH A;  4FT8 A;  4V19 K;  5LGU A;  2XRO A;  2HXO A;  1G6N A;  1YW7 A;  2M5W A;  2K27 A;  5AON A;  4ENK A;  2LSO A;  4AVP A;  3DKX A;  4CZC A;  2KIS A;  1PVE A;  1ETX A;  5AIP A;  2ESH A;  3DEE A;  5BNG A;  5JI6 A;  1FEX A;  3ZCO A;  3CC7 I;  2M34 A;  3S15 J;  3AG2 H;  3HL2 A;  1CQT A;  1I1S A;  4WK8 F;  4CA0 A;  4R79 A;  1O3T A;  2F2E A;  2ZKZ A;  1XMA A;  2CH0 A;  3Q3S A;  1AWC A;  2O0Y A;  5HS7 A;  1RC9 A;  1J59 A;  3RJP A;  2H8R A;  2DA5 A;  2F5E A;  5IOY A;  1OYW A;  5KCM A;  3RKY A;  2A07 F;  3I4M J;  3QP6 A;  4B43 A;  1YLF A;  2CJJ A;  2FX0 A;  2FXA A;  3S16 J;  1KU9 A;  1V55 H;  3CTA A;  5F6F A;  1S72 I;  2CFX A;  2XV4 S;  4M9X A;  1Y8R B;  4M71 A;  4A93 J;  1MGT A;  4D5F A;  3VOD A;  3E3V A;  2EZI A;  4E6K G;  5GAG J;  5F27 A;  4MO7 A;  2FMY A;  2GOX B;  2MGQ A;  2ZJ2 A;  4M9S A;  4HYE A;  1PUE E;  4UUS B;  2V1X A;  2VE8 A;  1B4A A;  1XMK A;  1YS7 A;  4U0V A;  3ZQG A;  1AKH B;  2DQL A;  1YS6 A;  3EUK L;  1YJ9 I;  4RGX A;  2ECB A;  1X2N A;  2ME6 A;  4ZTF A;  3ZR8 X;  4U0W A;  1UZC A;  3I59 A;  4UVA A;  4FCY A;  3OIQ A;  1UST A;  3TGN A;  4RLQ A;  3NAU A;  5DD8 A;  2GA2 A;  2D5V A;  3L9F A;  1XB4 A;  4D5C A;  2KJB A;  3DLL F;  1V54 H;  2BOL A;  1YIJ I;  3OYJ A;  3VYU B;  1IAW A;  5HVQ C;  4BXU A;  3CJR B;  3WOD F;  2ZNY A;  4CXF A;  1O3S A;  1D5Y A;  5FO5 A;  2P5V A;  2X6X A;  2ME0 A;  1JGS A;  4KN7 X;  3JRH A;  1K61 A;  2EV5 A;  2DYR H;  1UMQ A;  2M7A A;  3LFU A;  2BYV E;  2Q2E A;  4KN4 X;  1FYK A;  2O9L A;  1ZRE A;  1NHA A;  4XRM A;  1H9T A;  2DTZ A;  5TIS C;  3S1Q J;  2Y31 A;  3FXL A;  4FHT A;  3GW2 A;  2EFQ A;  2ESN A;  2LTP A;  3OYK A;  4L5I A;  1E3H A;  2RNJ A;  2Q1Z B;  3PM1 A;  2ZCW A;  2QSH X;  1ZAR A;  5D8L B;  4G6T B;  1VI0 A;  1YX5 A;  4KT5 C;  4A3L J;  3CLQ A;  4EM2 A;  4A3J J;  3A02 A;  4HW0 A;  2EIJ H;  4NUB A;  1MBE A;  2LVS A;  3ULQ B;  3ZQH A;  3QPL A;  1I27 A;  4HDV A;  1W1W E;  4MFD A;  3O3K A;  1WH5 A;  2STW A;  1TQM A;  5F0H A;  2M4G A;  1A35 A;  2LC2 A;  4HX4 A;  1O57 A;  3ZQI A;  5FKO A;  3SZT A;  3FBN B;  2LRE A;  3M07 A;  1E2X A;  1Y0U A;  1FNN A;  2FNA A;  3KEQ A;  1QBJ A;  1EH7 A;  1VZ0 A;  2EWN A;  4OAZ A;  4Y13 A;  2DFF A;  3I71 A;  4HAM A;  1XG1 A;  5H20 A;  1XC5 A;  3CP2 A;  1XDU A;  2FEZ A;  5J1Y A;  1ODD A;  5CVR A;  2OCE A;  3HIF A;  4BH9 A;  2K4B A;  3F23 A;  2VBX A;  3CP8 A;  2JRT A;  1QZZ A;  1U3E M;  2VJI A;  1T98 A;  4G7H F;  4A3K J;  3OWT A;  2COM A;  4EGZ A;  2DJN A;  1YHQ I;  5L3C A;  3GVA A;  3A0B C;  2CGP A;  2OUM A;  1RET A;  2GXG A;  1Y0N A;  3DU5 A;  4A3E J;  1LVK A;  2Z3Y A;  2DMU A;  3FMQ A;  3H92 A;  3K4N A;  1SFK A;  3M8F A;  4R1H A;  1EV7 A;  2VJ5 A;  4H0E A;  2KHM A;  3QOP A;  1BOB A;  5E3O A;  3J7Z I;  5LHH A;  4YFK F;  1MMA A;  3BG5 A;  1ON2 A;  3SFZ A;  2WAE A;  3MAJ A;  3K2A A;  2W7N A;  4JX6 A;  5HS8 A;  2FUG 2;  3WHB A;  3HOU J;  3QOE A;  1DP3 A;  3CZ6 A;  2PJR A;  2QBY A;  1R36 A;  5M5W J;  3SZG A;  3ML6 A;  1IV6 A;  3HSF A;  2A5W A;  1T08 B;  4IHY A;  2OPT A;  5FGM A;  2LBF B;  1K78 A;  5FLX Z;  5D6E A;  1W36 D;  2DO7 A;  2QSF X;  1HBX G;  1MH3 A;  4XRF A;  2L9V A;  2GQQ A;  4LOC A;  1R5I D;  2X1D A;  3NWT A;  1QHG A;  4AC0 A;  2EA2 A;  4HRI A;  3CCU I;  1H0M A;  3HB9 A;  3CCL I;  3ZMV A;  2FA5 A;  3A01 A;  1TWA J;  2OQR A;  3JSO A;  2KZG A;  1T2K A;  3GTQ J;  3EYY A;  1JKR C;  4NQW B;  2V9P A;  3TKY A;  1PUF B;  5JVT A;  1ZH5 A;  2QVO A;  1YE9 A;  2JA2 A;  2FBK A;  5FLM J;  3CCQ I;  2DLL A;  5EJC A;  2KP6 A;  1HKQ A;  1FP2 A;  3OYB A;  1MND A;  3OYE A;  5LLQ A;  3HOV J;  5K7H A;  5FD5 A;  2BY2 A;  2DJI A;  3F8C A;  3JRI A;  1ZG5 A;  4JQF A;  3SFI A;  2ELK A;  2M7B A;  5FLX K;  2VOO A;  3JTH A;  1U9O A;  4AVZ A;  3RQI A;  2DA6 A;  2DT6 A;  1ZHF A;  2FML A;  3S93 A;  1S8N A;  2GBY A;  3BOQ A;  1KZH A;  2EFN A;  5FKN A;  3DWL E;  3HTU A;  2NYX A;  4IOC F;  1VQ4 I;  3FIS A;  2RN7 A;  4BQN A;  5LEK A;  2L4M A;  2EFP A;  4DZP A;  4F55 A;  1YG2 A;  1Y56 A;  2NVX J;  3KYL A;  1LPQ A;  2OAZ A;  2ELH A;  2XHK A;  1NH3 A;  3PNV A;  1HXD A;  3K0L A;  4HV5 A;  4JX5 A;  2DOD A;  2E36 A;  3KZZ A;  4O6J A;  4V2G A;  3JRG A;  2X48 A;  1DPR A;  2HQA A;  4PDK A;  1O7F A;  1RKT A;  2BGC A;  1ONV A;  3CUQ A;  5D4R A;  3F9K A;  1OCO H;  3R0A A;  1OIS A;  2A69 F;  4CYC A;  4BYY A;  3CES A;  4Y3O A;  4P55 A;  2E7X A;  1TW2 A;  1QO0 D;  2O3F A;  2XGD A;  1B6A A;  3PNT A;  1ZG3 A;  3SQN A;  5ICG A;  1TNS A;  2K9M A;  4KIC A;  3MN2 A;  4PGG A;  4U7D A;  1Y39 A;  4L5E A;  2V1U A;  4AIJ A;  3CDI A;  1KON A;  2VON A;  1ETO A;  4PJJ A;  4U87 A;  1FY7 A;  3OL3 A;  3ZQC A;  1E3O C;  1MDM B;  2QUF A;  5CVU A;  2P5L C;  2KRF A;  2R3S A;  1FIP A;  2UUZ A;  2GOM A;  4D1Q A;  1ZGJ A;  1D1C A;  4NBQ A;  3SYT A;  2H94 A;  3AG3 H;  2LMD A;  2WB1 N;  4M3D A;  4HQE A;  4HOB A;  3KX2 A;  3V7C A;  1V5E A;  3KE2 A;  3COA C;  1WKM A;  3K70 C;  1YW8 A;  1G3W A;  3I58 A;  2O8K A;  4GYG A;  3U9G A;  2MH9 A;  3F8F A;  1JKO C;  2EIM H;  3OOU A;  4OOI A;  4N4O B;  1GUU A;  2K9S A;  4IRI A;  2KDO A;  4WF2 A;  4G7Z F;  4HF2 A;  3HYI A;  3I4P A;  1WRJ A;  4UUS A;  1HOM A;  4HSR A;  5HS9 A;  5ED4 A;  3WTW C;  5L3F A;  1YYV A;  3MZH A;  1IN4 A;  4HNU A;  2GZW A;  4BE2 A;  4AM3 A;  3G1O A;  1GT0 C;  3DPU A;  2K85 A;  1I6H J;  1ZQ3 P;  1GXQ A;  3RIR A;  4XKB A;  1YQA A;  4KNY A;  4ESJ A;  2V79 A;  2X0L A;  2GXB A;  3GXO A;  1X1B A;  3GBG A;  4DYQ A;  1LQ1 A;  1FX7 A;  2Z2S B;  4EJW A;  3OYM A;  3CLO A;  3BRO A;  2LKX A;  4D0P A;  1R7J A;  3U2R A;  1RPW A;  2IJL A;  3CCJ I;  2XKO A;  2RV8 A;  3VSL A;  3LSK A;  5DTD A;  4Y4R A;  3S2W A;  3FM3 A;  4BAC A;  3MWM A;  1F9N A;  2BVM A;  4ITV A;  2DBB A;  2JQ7 A;  2P7V B;  1IDY A;  4A3B J;  3TW6 A;  5F0F A;  3FXK A;  1MBF A;  4IOA F;  2R7S A;  1TW3 A;  1TWG J;  2BE5 F;  3FXJ A;  4PFP A;  5E79 C;  3RPU A;  2ISY A;  4RLF A;  4A3M J;  1OQY A;  1SMT A;  2KFD A;  4G9Y A;  3G4S I;  3K2Z A;  4JYK A;  1FYL A;  3GFJ A;  1ZRF A;  5LRR A;  3L1P A;  2GIV A;  4XSX F;  1K79 A;  2DDB A;  4RAG A;  1W7P D;  2EZH A;  4M73 A;  2EZK A;  4ETS A;  3J7A Y;  1G3S A;  1XSX A;  3O2P E;  3DKW A;  1S5L C;  2L9R A;  5EZG A;  4ZYE A;  4OAY A;  5D5X B;  3PJR A;  2IS4 A;  2VT3 A;  1WPK A;  3TO6 A;  3ZN1 A;  3P9I A;  1UFM A;  2IGO A;  2R5Y B;  2FSW A;  3N97 A;  1OPC A;  2Y0S N;  1OLT A;  3R0J A;  1Z9C A;  3HKZ N;  2OU2 A;  1WVR A;  1D1A A;  4A3C J;  1Y8Q B;  5J4V A;  1XTA A;  4A0Y A;  4E7S A;  2NNY A;  1IUY A;  2HFH A;  5GPA A;  3K4B A;  3ZMD A;  2L0K A;  1OFC X;  2JMW A;  3TP0 A;  3VWB A;  2L9N A;  4DBQ A;  2DMT A;  3MCZ A;  1KA8 A;  2EJR A;  1HF0 A;  3WU1 B;  2RQQ A;  3DBH B;  4P9F A;  4DJA A;  1RZ4 A;  2R7F A;  3OYI A;  4RMN A;  4PJ0 C;  2DU9 A;  1T33 A;  3CDH A;  4BBR J;  2VPL A;  5D6F A;  1S7O A;  3OS2 A;  1IF1 A;  4CHU A;  1ZYR F;  4RGU A;  2G7U A;  2QEX I;  1HKT A;  5M3F J;  4TV7 A;  3NQO A;  2IS2 A;  5B1B H;  1K6Y A;  4HQM A;  2NVQ J;  2EQR A;  5L3D A;  3ZQQ A;  1IRF A;  4IX7 A;  2Z99 A;  3NAR A;  4EM0 B;  3BR5 A;  2GAU A;  2JZY A;  5KVR A;  3BT9 A;  5D4S A;  4JP0 A;  3BR3 A;  2KQR A;  3BZC A;  5F0C A;  1ERD A;  1R1T A;  2K3F A;  2AXL A;  3V8L A;  4YIF A;  2DA2 A;  2EFO A;  4IRG A;  1YFH A;  1WGX A;  2BXY A;  1BOA A;  3PFY A;  1FWZ A;  4CIC A;  2XRL A;  2STT A;  1OCP A;  4Q47 A;  3ZQL A;  1OMI A;  2XGX A;  4M3E A;  4L9V A;  2ZO4 A;  2LBF A;  3HSE A;  3E6C C;  3BR6 A;  4WXC A;  1OYY A;  1SAU A;  2F5D A;  1DU6 A;  2LLK A;  4E7K A;  3V7R A;  4XL9 A;  2DMQ A;  2MD5 A;  3SXY A;  3CMY A;  4G12 A;  2RC4 A;  3GFL A;  1X3U A;  1YO5 C;  1XCB A;  2PMZ N;  1P4X A;  3J80 Z;  2XDV A;  2BY1 A;  4KMU X;  5B3S H;  3S17 J;  2QCO A;  3F6O A;  3KP2 A;  3DPT A;  3NEU A;  3P5J A;  3PO3 J;  4JOM A;  4GDF A;  3ZPL A;  4RAY A;  1I1G A;  4NQW A;  2KZV A;  2IW5 A;  2JN6 A;  4XOT A;  4M6Y A;  2DW4 A;  5E1W A;  4M6V A;  3OYG A;  2MH2 A;  4DYR A;  3ZMZ A;  1JTY A;  3H1C A;  2ZC2 A;  3WGI A;  1ETQ A;  2HOT A;  5IP9 J;  1R22 A;  1XMX A;  1BI0 A;  4MQ9 F;  2LG4 A;  1SAN A;  1JJ8 C;  4RA2 A;  1J9I A;  3OIO A;  3CF5 F;  2LOO A;  3I9V 2;  3ASO H;  2CWE A;  1ITY A;  2E5Z A;  2F4O B;  3QPH A;  1QVU A;  1MW7 A;  4GYI A;  5HNF A;  4BE0 A;  3ZRG A;  3LSJ A;  4M6X A;  5C4J J;  1KYW A;  3BG3 A;  1ZR2 A;  2FE3 A;  3ABK H;  3J80 K;  2V7F A;  2X4H A;  3OSG A;  4YIR X;  2IBD A;  2X6W A;  1MSF C;  3SDG A;  4BXF A;  2EV6 A;  2W24 A;  3U1D A;  4E70 A;  3MZY A;  2UWM A;  2K9L A;  3KEY A;  3TBI A;  1HW2 A;  1IJW C;  1TT5 B;  5EEH A;  3FXO A;  1A04 A;  1QQI A;  2E2H J;  5BQT A;  3H9G A;  4ZYG A;  1HDP A;  2K4J A;  3OYC A;  5EGO B;  1XCV A;  5FRO A;  4IHT A;  3V4G A;  4ZC3 A;  3ROU A;  1SAX A;  2P5K A;  2VKH A;  2WAQ A;  2H8W A;  3IL2 A;  1L0O C;  1ZRD A;  4BHB A;  3NRV A;  1LEB A;  1U9N A;  5FB2 A;  1XGO A;  2VJ4 A;  3TOA A;  4HDU A;  3S3N A;  4IPA A;  1TQP A;  3EUA A;  2B63 J;  1SEU A;  3KYD B;  3M8E A;  2O6G E;  5D8K B;  2JJ7 A;  3REO A;  4DNC A;  4XBF A;  3GTL J;  2Z9O A;  1UCR A;  4X6A J;  5F04 A;  2HXI A;  1YRN B;  1Q1V A;  3PSI A;  4XON A;  3ZP5 A;  2FD5 A;  4CCM A;  3OYN A;  1Z77 A;  1QPM A;  3MKY B;  2DPU A;  1IRG A;  4RB0 A;  4RM3 A;  2P81 A;  4GFB A;  1DPU A;  1MDM A;  1K83 J;  3TDU C;  1W4M A;  3F8M A;  2OTJ I;  1WJD A;  2WV0 A;  3HXL A;  4OIP F;  2NVY J;  2DFI A;  2CUE A;  3OR2 C;  1B9N A;  3M4O J;  2B9S A;  5K1Y A;  4IF4 A;  1QRY A;  4XKV A;  3GUD A;  5L3E A;  4AID A;  2KIM A;  2LY1 A;  3A0H C;  2IGM A;  1H88 C;  1D3Y A;  4BS9 A;  4E7Z A;  3IRR A;  3BPX A;  2R5Z A;  2HNH A;  2GWR A;  2X1C A;  2KMU A;  3WTZ A;  3IAS 2;  3GTM J;  1G8X A;  3EUH A;  5KHD A;  1JI8 A;  2JTV A;  4EJO A;  2CQQ A;  3A03 A;  4W1U A;  4XMY A;  3TED A;  3GZN B;  1MBH A;  2E19 A;  2DXI A;  1OCZ H;  5M5Y J;  2GM4 A;  1IXS B;  3A4C A;  1HC8 A;  5ICF A;  4CCL A;  1W0T A;  4LG0 B;  5LRS A;  3L2C A;  2K5C A;  5CKT A;  1K7A A;  2YPR A;  3FF5 A;  3LA3 A;  5F1J A;  5F1R A;  1BJA A;  3V8K A;  1QPI A;  2R7Z J;  5FLV A;  4HLY A;  3CO7 C;  3FXQ A;  2JVG A;  3EUH C;  1ULY A;  3VOE A;  1Z21 A;  4HF1 A;  1I39 A;  3W3C A;  5LGN A;  1QVT A;  2BV6 A;  2A5Y B;  4M72 A;  4BQA A;  4C3I J;  3DEW A;  3T8R A;  4PK4 A;  4AWX B;  2L7F P;  4BDY A;  1GVJ A;  3WG9 A;  1KQ9 A;  2BY3 A;  1MH4 A;  2H1K A;  1JUP A;  1Y6I A;  2DFE A;  1IV8 A;  2LYC A;  4I01 A;  1MMS A;  2AO9 A;  4MQV A;  2YUS A;  1X4O A;  3ISP A;  2XB5 A;  3FKI J;  5DV5 A;  5EEG A;  4HF0 A;  4BDZ A;  5FD6 A;  3HDD A;  4AIK A;  2YS9 A;  2P6S A;  4CYD A;  5KK1 A;  4J00 A;  1R4M B;  4G6D A;  4OWR B;  4WX9 A;  4X1E A;  1YJW I;  2NS0 A;  2E35 A;  3ZMT A;  3GLL A;  3PFI A;  1FPQ A;  3RZD J;  1FTT A;  2MG4 A;  2LY9 A;  3LMM A;  4R8H A;  3H5N A;  3F8N A;  5D5V B;  3WTT C;  3J7A O;  2UXX A;  3HBL A;  1FJL A;  2CQN A;  1SVM A;  2PEX A;  3E5Q A;  3S14 J;  2EV0 A;  4KYW A;  2XRN A;  2VIX A;  3HUG B;  3TMO A;  1U8B A;  2XC7 A;  3P9K A;  2MBF A;  3CCY A;  3VYR B;  1K4S A;  2NOG A;  1LDJ A;  4ASN A;  1BA5 A;  4RGR A;  2E7W A;  1GXP A;  5GPC A;  4II2 A;  2K7L A;  2DA7 A;  2R92 J;  3K4C A;  1R49 A;  2CV2 A;  3QYB A;  5FFX A;  1DGR M;  1TZL A;  4EJV A;  4UVC A;  2EK5 A;  4YG2 F;  2WWY A;  2R7R A;  2DN0 A;  5EYR A;  2L01 A;  3F72 A;  1SFO J;  4DYC A;  2MSY A;  3M1C A;  2EH3 A;  2M9H A;  4NDL A;  2K3P A;  4PSX A;  2DK8 A;  2E34 A;  1HDD C;  1LNW A;  3DF8 A;  3ELK A;  3RSN A;  4DBR A;  2WBM A;  2YU3 A;  4RS8 A;  5DEQ A;  3OR1 C;  2HYG D;  4WXD A;  1S3J A;  5J3L A;  4M74 A;  4A3I J;  2MYS A;  3IRQ A;  2ZJQ F;  2MA3 A;  2QYO A;  4BUP A;  4HV6 A;  5J40 A;  4XIC A;  4F52 A;  2O61 A;  3M3Y J;  1EF4 A;  2KJC A;  3VB2 A;  3L2V A;  3WU0 A;  1P7J A;  1LFP A;  2JPB A;  1YX3 A;  2Z16 A;  3HRM A;  3BWG A;  4ZYD A;  4HX7 A;  1PP8 F;  2DI3 A;  1IG7 A;  4LG3 A;  4L0Z B;  2IPQ X;  2CW8 A;  4PJL A;  1I3Q J;  1V4R A;  1WZ2 A;  4PUS A;  3GTO J;  2NRA C;  4BQQ A;  4LB5 A;  2BHZ A;  1HCR A;  2XB0 X;  3W6J B;  1BI3 A;  3MFK A;  5DM7 F;  4RB2 C;  5M5X J;  1T6S A;  3BTL A;  3FBI B;  3PQK A;  2QA4 I;  2JA5 J;  4B3A A;  3V8J A;  2AQF A;  2NNN A;  4B48 A;  4L0Y B;  2J5P A;  2QLZ A;  3HZJ A;  2QWW A;  4DGW B;  3CCM I;  1TBX A;  2HPI A;  4MEX F;  1B1B A;  3E97 A;  2KRH A;  1MMD A;  1A36 A;  3E0J B;  1QA6 A;  1S6L A;  3CD6 I;  2HGC A;  3JW4 A;  1ZK8 A;  2I8D A;  4IHX A;  3BR2 A;  3IH4 A;  3MVP A;  3BJ6 A;  2KPM A;  3CO6 C;  1USS A;  2ECC A;  1BN5 A;  3WTS C;  4FIS A;  4RAF A;  4MTD A;  1OKR A;  4XLE A;  2A68 F;  3BR0 A;  3HEF A;  1RIO H;  3F0C A;  2R7D A;  5J8C A;  4AYB A;  3TO9 A;  4LD5 A;  1YI2 I;  4S05 A;  4ZJZ A;  3PO2 J;  3TO7 A;  1FYM A;  3HOW J;  1CF7 B;  3O6B B;  5IP6 A;  3JRA A;  1IN5 A;  2DA4 A;  2L2O A;  2P4W A;  2QQA A;  3HOX J;  1OJL A;  3DU6 A;  3L00 A;  2F5F A;  3BG6 A;  4U7B A;  2KIQ A;  4CSW A;  1KU2 A;  1G3Y A;  2HR3 A;  5GAE J;  5DCM B;  4KT6 A;  1ZLK A;  2XF5 A;  4I98 B;  4QPQ A;  2DCE A;  4Q48 A;  2HZT A;  3F6V A;  2OV7 A;  2PG4 A;  2VQC A;  3KP6 A;  1T39 A;  4OIO F;  3SZP A;  2XSD C;  1WCM J;  2HPM A;  3KPH A;  3AAF A;  3DV8 A;  4ESB A;  3OSF A;  1JXS A;  2ZJP F;  4EM1 A;  3LL7 A;  1GV5 A;  3B73 A;  5HOO A;  1T95 A;  2F4M B;  5HLH A;  2D1H A;  2IGK A;  1KU7 A;  3S2D J;  3OV8 A;  3WU2 C;  3EQL F;  1POG A;  4ENM A;  3CJT B;  2R7V A;  4II3 A;  3S2H J;  2W84 A;  2ICW G;  3B6A A;  4JK1 X;  1Z3X A;  1UJ8 A;  1TWH J;  4H4K C;  3C1D A;  4KIF A;  2X51 A;  3K1N A;  3S1R J;  4A3F J;  1R1V A;  1VQ8 I;  1K78 B;  1YRN A;  2VBZ A;  2YU9 J;  2W1O A;  5CVV A;  1ENH A;  1WHU A;  2M45 A;  3FZV A;  2L5Q A;  1JGG A;  3S1N J;  1QHH D;  2KKO A;  1G59 A;  4F3Q A;  3ZQF A;  1XD7 A;  1N78 A;  3SHF A;  1KQ8 A;  2ZB9 A;  4HLX A;  3CME I;  3W2W A;  1JHF A;  3FK7 A;  3ZOB A;  3QWL A;  3W6K B;  4RAZ A;  3MD2 A;  1JUS A;  1D8J A;  3RDI A;  3LQR A;  2XGC A;  1Z91 A;  1LFB A;  1HA8 A;  4QIW N;  1YOV B;  3P9C A;  2UZK A;  5LGT A;  4A6D A;  3GX4 X;  1D0Y A;  5EEA A;  2JA8 J;  5E8G A;  1QNT A;  4AD9 A;  3F3X A;  2HDC A;  1KGS A;  2G9W A;  1N25 A;  3SJM A;  1NK2 P;  1J2X A;  3K9T A;  1WWX A;  2QQ9 A;  4W97 A;  3IAM 2;  3VYS B;  3F21 A;  1KQ0 A;  3HHG A;  2O8X A;  2BY0 A;  1UAA A;  5HOD A;  2FRH A;  1BR2 A;  1VQO I;  4LG0 A;  4BKX A;  4YFX F;  4J19 A;  4IHW A;  1MNM C;  3LSR A;  2B0L A;  2EPF A;  4FQG A;  2DFH A;  4GO1 A;  3AL0 B;  1K6O A;  1AU7 A;  5DCF A;  2M30 A;  2HOS A;  3G1M A;  3D0S A;  1ZTR A;  1SFE A;  2LKP A;  2D45 A;  1ETV A;  2A3S A;  4PSW A;  3RYR A;  5LHG A;  2H6B A;  2R7U A;  3GCM A;  4X0G A;  2ZFW A;  4XLH A;  5L3G A;  3D5L A;  2R0Q C;  1PP7 U;  2ZXI A;  4KUM A;  3KIO A;  1Z05 A;  5DS9 A;  3OYD A;  2VOP A;  3OIP A;  1X1P A;  1ZLJ A;  2CUJ A;  2O7O A;  3K4K A;  3H0D A;  5HLT A;  2E71 A;  3LA7 A;  2M4K A;  4N9I A;  3K4L A;  3E6M A;  1VQ7 I;  4Q5S F;  1Z67 A;  1AKH A;  2RQP A;  2FOW A;  2BW3 B;  2HDD A;  1BR4 A;  3OS0 A;  4RBO A;  2R7X A;  2MD0 A;  4LIV A;  3RPQ A;  1IZ1 A;  1MBG A;  1H9G A;  4DOZ A;  2CQ7 A;  3AG1 H;  4XNF A;  3HHH A;  1A6Q A;  1SVO A;  5IYC J;  2EFW A;  4EGY A;  5CQE A;  2V9V A;  3HOS A;  1I3A A;  1X1C A;  1DDN A;  2A6H F;  2E1M B;  3J81 Z;  5H6R A;  4QPO A;  4RB3 C;  4ZH4 F;  5ERI A;  4HG2 A;  3R4K A;  3CCV I;  2K9Q A;  4FE4 A;  3HUG A;  1ZKG A;  2IRF G;  4IVN A;  4L18 B;  4LLG F;  1L3L A;  2RNG A;  3TQN A;  5ICC A;  3GO5 A;  1JTX A;  2VAS A;  2X6Y A;  3LSH A;  3S8P A;  4A69 C;  4CCO A;  2EA4 A;  4K2E A;  1FP1 D;  3JTG A;  4BBS J;  3W2A A;  1FMV A;  1EH6 A;  2H6C A;  3MEX A;  4FX4 A;  3ERE D;  3LFK A;  4IO9 F;  1W7P B;  5HLI A;  3K1M A;  3W6V A;  2WA0 A;  4XN3 A;  4HZF A;  4J01 A;  1BI2 A;  3I53 A;  3RCO A;  1ZGA A;  4ON0 A;  3N05 A;  2VL8 A;  2DYS H;  3FXU A;  2P0W A;  1U2W A;  4EJT A;  3I64 A;  4A3G J;  3J81 K;  5BPD A;  1F4K A;  2OCC H;  1WJA A;  2HYF A;  2VT2 A;  4KJZ A;  4BJ6 C;  1ETW A;  1YIT I;  1F43 A;  4PZJ A;  3CUO A;  3IWF A;  1R5H A;  3GLX A;  1MBJ A;  3GTJ J;  4D7N A;  1ZN2 A;  4KMF A;  1TT0 A;  2UV1 A;  1UEL B;  3MQ0 A;  4F93 B;  2Y2Z A;  4CDG A;  4CZZ A;  2QZ8 A;  2DOF A;  2AHQ A;  2PX9 A;  1R5G A;  2MC4 A;  2WAF A;  3FX3 A;  3ZMS A;  3OYA A;  4IXA A;  4DQ2 A;  3WHC A;  2VKV A;  3FIW A;  1WJ5 A;  2P6T A;  2Y9Z A;  1SFX A;  4DZJ A;  3K4J A;  4WXH A;  5GAH J;  2M3A A;  1QZY A;  2VQH A;  4BE1 A;  4LK0 F;  3WTX C;  2E1O A;  2CFO A;  3PQJ A;  4IJA A;  3I3L A;  3QYF A;  1C0W A;  3FMS A;  1FC3 A;  2JA6 J;  1OCR H;  1DQU A;  2HU9 A;  3S1M J;  2MC3 A;  2G7H A;  2W57 A;  4PFO A;  4F7Z A;  3JRD A;  4BXX J;  3ECH A;  3KP3 A;  2CO5 A;  4P9U A;  3G3Z A;  2AS5 F;  3QQA A;  4NC8 A;  3F22 A;  1LJ9 A;  5K5R A;  3DEU A;  2VN2 A;  5BPI A;  1HLV A;  2EZL A;  3PL8 A;  3DFG A;  4XRS G;  3DP7 A;  2NVT J;  2X1E A;  1VQM I;  3KFW X;  1VQL I;  5CJ9 A;  3H36 A;  3EPZ A;  2DTR A;  3ABM H;  2ID3 A;  4BHP A;  3T5X A;  4WWC A;  3MKZ A;  1D1B A;  4P96 A;  1B9M A;  4JX4 A;  3P7N A;  3CCS I;  4A6E A;  4NNJ A;  1BW6 A;  1IUF A;  1FBS A;  2DPD A;  3NWS A;  3H9J A;  4E7I A;  1V3F A;  4IQJ A;  3GME A;  2JPC A;  1MBK A;  2M0C A;  4IQ4 A;  5GTI C;  1AHD P;  1PDN C;  4U88 A;  1W5S A;  2ZSH B;  4A3D J;  1RR8 C;  2N8G A;  3DPL C;  1FTZ A;  4XOR A;  2AQE A;  4ZYH A;  3FHZ A;  1R00 A;  2IEK A;  1CF7 A;  3LST A;  3OS1 A;  3LSM A;  4Y17 A;  2Y69 H;  4YFN F;  1JKQ C;  5CVJ A;  2FOK A;  1UG2 A;  2HS5 A;  2PN6 A;  3BP8 A;  2XAQ A;  5IY5 H;  1ZEL A;  3L2U A;  2V4J C;  3CF2 A;  2CQX A;  1W36 C;  5DCM A;  4BU2 A;  1Y1W J;  4BY1 J;  4LK1 F;  3E6D A;  1X58 A;  2XF6 A;  4UB8 C;  5FFZ A;  1Z7L A;  4Z6Y A;  2NS7 A;  2M2E A;  5JHU A;  3BZ6 A;  1XDS A;  3HGG A;  1PUF A;  1P4W A;  1PYV A;  3GEZ A;  2Y30 A;  2LH9 A;  1IC8 A;  2V1D A;  2F5C A;  4PGH A;  1BBY A;  5FJ8 J;  2NXN B;  5J1U A;  3TOB A;  3QP5 A;  4S04 A;  1QZE A;  2W00 A;  2VC1 A;  2LDU A;  2WY8 Q;  3RI4 A;  3I56 I;  2WB1 A;  2FQ4 A;  5JFR A;  2CYY A;  5DUK A;  2V6E A;  3KCC A;  4BAY A;  3BCA A;  3HC7 A;  1B72 B;  1AA7 A;  3H5A A;  3V42 A;  1R71 A;  1BR1 A;  4PJM A;  2XUB A;  3KEO A;  4AIH A;  3JRB A;  4Q4Z F;  2PJR B;  1S7A A;  2L02 A;  2LK2 A;  2QBY B;  3OMY A;  4HX8 A;  4F91 B;  4P1W A;  1T38 A;  2EIN H;  1JT0 A;  2CV1 A;  3GZ5 A;  5HNH A;  1FOY A;  2XKP A;  2VE9 A;  4Z2Y A;  2JA7 J;  2CW7 A;  3RKX A;  4E7L A;  2EBI A;  3QYE A;  4L5J A;  3ZN0 A;  1OR7 A;  2ZXW H;  4V2F A;  1TP4 A;  1ZG1 A;  4O5V A;  2Y75 A;  1G2H A;  1GVD A;  1FBU A;  3SEQ A;  1WQ2 A;  4IL6 C;  5H6Q A;  4OMY A;  3K10 A;  3ECO A;  4LLL A;  2Y48 A;  1N77 A;  4FET A;  2XAF A;  2PI0 A;  3O8G A;  2I5U A;  2WC2 A;  2OTL I;  5KNL A;  3UR3 C;  1WFX A;  4ENJ A;  3L09 A;  4N0B A;  5HDN A;  1OR7 C;  5CLS A;  1MNE A;  4BEH B;  3BQY A;  2B7E A;  1FSH A;  1Z6R A;  2XPU A;  3GTG J;  5EZH A;  3HJE A;  3VDX A;  3J7Y J;  3EDP A;  2Q8K A;  3RKQ A;  2E5N A;  1J7K A;  1EKE A;  3MKW B;  2OJE D;  3Q0V A;  3S32 A;  2AXT C;  3QPS A;  3R60 A;  3OYH A;  4BQO A;  1WJC A;  3HSR A;  5K7Z A;  1P2F A;  3BG7 A;  3IKT A;  3CMM A;  2H09 A;  3GF2 A;  1N75 A;  3JAM K;  4ENN A;  4CCN A;  2HQR A;  3WGH A;  3C7J A;  4OU0 A;  3UNG C;  3HG9 A;  1ORK A;  1HW5 A;  4XOP A;  3JRF A;  3ONQ A;  3X2Q H;  3PUB A;  2X9D A;  4DIQ A;  4LLN A;  2FNP A;  4XSZ F;  1IO2 A;  4G8X A;  5M3M J;  4HA8 A;  3RYP A;  1MKM A;  2VKE A;  3RQ4 A;  4CGZ A;  1WJE A;  1ZGW A;  4XN0 A;  1XGS A;  1I5Z A;  4ZDP A;  3AL0 C;  1RI7 A;  2ID6 A;  2Y0S A;  4I09 A;  3CUQ B;  1TLH B;  2BW3 A;  4IRH A;  4BGD A;  4YEL A;  3HKZ A;  2R4G A;  1DP7 P;  2KRC A;  3DXJ F;  1PJR A;  1T8I A;  2JWT A;  2CW0 F;  4O3M A;  3L2R A;  3DBL B;  4F92 B;  3IKV A;  4C9Y A;  1S7E A;  3CC4 I;  1ZAO A;  3G6E I;  4Y52 J;  1AOY A;  3BZK A;  3CCR I;  1BJZ A;  4UXN A;  2OBP A;  2IS1 A;  2ZSI B;  1Z7U A;  5FKL A;  2CRG A;  3E6B A;  1IDZ A;  1MJ9 A;  4E7J A;  4BHC A;  2F6C A;  3K70 D;  2J5O A;  3FK6 A;  2YX7 A;  4FE7 A;  2CSO A;  4XQF A;  3N4M A;  5IYD J;  4EAT A;  2CU7 A;  4UVB A;  4U0Y A;  4IHV A;  4XLN F;  4I76 A;  3I54 A;  4HEA 2;  3ZXS A;  3M1E A;  3G2B A;  2E1M C;  4ANJ A;  4IZZ A;  2L9S A;  3L2Q A;  4LJZ F;  1EJ9 A;  1Q1H A;  5F64 A;  1W7P A;  1KU3 A;  1A6I A;  2QM3 A;  4UUT A;  1T56 A;  2PFB A;  3H0G J;  3GYH X;  5JHF A;  4CUG A;  1R23 A;  2KIU A;  2W25 A;  5LFA A;  2LF8 A;  2DDA A;  2LD5 A;  3DTE A;  4NC7 A;  4A0Z A;  2L4A A;  3DBR B;  3DKY A;  1S29 A;  2JUG A;  1JUM A;  3WTU C;  3GTP J;  2EIK H;  1VND A;  2HKX A;  2HYJ A;  3GWZ A;  3FM5 A;  1UHS A;  3LOC A;  3QPT A;  3H5R A;  2EB7 A;  2IAI A;  1DUX C;  3JSP A;  2ISZ A;  2VPR A;  1NG6 A;  1F36 A;  4Y7N J;  4C30 A;  2R5Y A;  2IA2 A;  4C3J J;  4KIB A;  2DK5 A;  2QQB A;  1U78 A;  1W0U A;  1RES A;  1KYZ A;  3E1S A;  2PMZ A;  3ZGK A;  4LB6 B;  5GP9 A;  1SD4 A;  4GXO A;  4BL0 B;  2OA4 A;  2L7K A;  2XSJ C;  1BC7 C;  1D0Z A;  2VLA A;  1H8A C;  4HPQ A;  3KYC B;  4KIG A;  4A0X A;  5IPA A;  1FBQ A;  2E1N A;  2VXZ A;  4B09 A;  4KA4 A;  1X3Z B;  3FXM A;  4MIM A;  4BY7 J;  5JVG F;  3TW7 A;  2CS3 A;  1VQP I;  2R7O A;  3T8T A;  2HOE A;  1T0F A;  1VF9 A;  4XLA A;  1Z0X A;  3ESW B;  5J6X A;  2QF7 A;  2A6T A;  2W82 A;  2V6C A;  1G3T A;  1VQK I;  4B3X A;  2WV1 A;  3RPU D;  2FJ1 A;  3I5U A;  2VBW A;  2VXD A;  2XGE A;  5EG0 B;  3HRU A;  2M1B A;  2H1L A;  4CH7 A;  2H27 A;  1TQI A;  3Q5F A;  1X1A A;  2XPV A;  3H3V K;  3HRT A;  2QKL B;  4OIQ F;  1T0F C;  2LKS A;  5IT9 Z;  4N9H A;  2HWV A;  2NVU B;  3DQV C;  2F4I A;  2HZD A;  1GV2 A;  2Y9Y A;  3FKJ A;  1TTY A;  3OOP A;  1IW7 F;  2K86 A;  3EYI A;  4EEF G;  2JSC A;  3ABT A;  1XPX A;  5K7F A;  4ZYA A;  1MZB A;  4S0H B;  3VPR A;  3OY9 A;  2D1V A;  5E1Z B;  1X3W B;  1UG0 A;  1VQ6 I;  1UHW A;  2PQ8 A;  3GZ6 A;  1O4X A;  1SMY F;  2CUZ A;  1QU3 A;  2ZME B;  2ACJ A;  3AG4 H;  1LE8 B;  1ON1 A;  3MMY B;  4CCK A;  1DU0 A;  2VI6 A;  2WAD A;  3VSK A;  2HVR A;  3KLO A;  3H35 A;  3M9A A;  1WI3 A;  5IP7 J;  4OMZ A;  3EET A;  4OIN F;  4E4H A;  2IT0 A;  4XLP F;  2D2W A;  3FDY A;  5D5U B;  5IT9 K;  4XID A;  5ICE A;  4D7M A;  3QU3 A;  2GIZ A;  1HQC A;  2COB A;  3E5U A;  4UV9 A;  2FBI A;  1R6R A;  2QKM B;  1FSE A;  5TRD A;  5KAI C;  3RKW A;  3GTK J;  4KIT B;  3HTS B;  2LR8 A;  3F8B A;  4RB1 A;  4B47 A;  4A2U A;  4ZZD A;  1B72 A;  3C2H A;  3JRE A;  1EH8 A;  2DOE A;  3C2B A;  3OYF A;  4MHG A;  4MTE A;  3GFI A;  5CQG A;  3BJA A;  4EMS A;  5JR3 A;  1B8I B;  1SVL A;  1BIA A;  4ZDL A;  2HI3 A;  2XIG A;  4L9T A;  2IGN A;  2TCT A;  3VFZ A;  5AIQ A;  4KIS A;  1W5C C;  1MIJ A;  1P7I A;  3DCF A;  3M7G A;  3WG7 H;  5EGO A;  1U5T B;  1J0R A;  4ZTJ A;  4L9J A;  1HSJ A;  4PJN A;  1WSU A;  4AUX A;  3LAJ A;  3I0T A;  5ILV A;  1U6G A;  3LAP A;  2R93 J;  3V7S A;  4NC6 A;  5E8I A;  2KLO A;  5K5Q A;  1A5J A;  3WTV C;  2V9K A;  2L7M P;  5E17 F;  2I10 A;  3D5S C;  3CCE I;  2CG4 A;  2BXZ A;  3FXR A;  3KET A;  2DT5 A;  2NS8 A;  3S3O A;  2TRT A;  1FIA A;  3QRF F;  4I0A A;  4B4C A;  2IS6 A;  6PAX A;  3LSG A;  4A12 A;  3K6G A;  5DDG A;  4BEH A;  2IA0 A;  4LIT A;  3K69 A;  5ILS A;  2JRM A;  2QGU A;  3W2V A;  4ABZ A;  3BJO A;  5BMZ A;  3U1K A;  1LFU P;  2E2J J;  1DGW Y;  3BDD A;  1JT6 A;  3IV5 A;  1OYI A;  2BHY A;  3Q0W A;  5DM6 F;  4HNT A;  4M3G A;  5KAF C;  1R58 A;  2VQL A;  3C2G A;  4I02 A;  5B66 C;  3IWZ A;  1XX5 A;  3L2W A;  1E3P A;  4CCJ A;  5LHI A;  4I7H A;  1X1D A;  3RZO J;  1MD0 A;  3S3M A;  2ADU A;  4LIU A;  4E7H A;  1MJA A;  5DD4 A;  2VBY A;  4XK4 A;  1B59 A;  2DOA A;  5LD2 C;  3CJN A;  2LRD A;  3CC2 I;  4ZDO A;  1SD5 A;  1JE8 A;  2DAO A;  2O03 A;  1BL0 A;  1FOK A;  1WI9 A;  3E5X A;  3JRC A;  2ZBK A;  1NG7 A;  1H89 C;  3MKL A;  1F5T A;  3HOY J;  3G73 A;  2A05 A;  1BIB A;  1FMW A;  3IHU A;  4WCG A;  2HTS A;  1STZ A;  5IOZ A;  3PIO F;  1JKP C;  2JK3 A;  5BS6 A;  4ESF A;  3SEZ A;  4HBL A;  1O3R A;  1IN7 A;  2M87 A;  5L3B A;  5EF6 A;  2OF7 A;  2ZJR F;  2CUF A;  3PUF A;  4YEJ A;  3R61 A;  1P92 A;  1LDD A;  3FMR A;  1LKX A;  1XGM A;  2Q0O A;  4XR6 A;  3WGG A;  2C6Y A;  2GA1 A;  1GHC A;  1Z1D A;  1IRX A;  3D5R C;  2K9N A;  3QOD A;  4IHS A;  1OCC H;  1IN8 A;  2HVQ A;  2XAS A;  4MNU A;  4UY8 I;  1IXC A;  2HQN A;  4BJT A;  3RTR A;  2G0E A;  5B5E C;  1EA3 A;  1U8R A;  3WE3 A;  3BTI A;  1VQ5 I;  3CUQ C;  3DTK A;  1K4T A;  1JJ6 C;  2W48 A;  4EQQ A;  4C3H J;  3B02 A;  1D5V A;  4XKW A;  4DW6 A;  1R1U A;  5C4X J;  2KT0 A;  2OZU A;  3IH2 A;  1S9H A;  2ELJ A;  1SC7 A;  4HNV A;  4MGR A;  1HW1 A;  4FX0 A;  2VUM J;  2BVL A;  3ZQ7 A;  4UB6 C;  2OZ6 A;  2Z5U A;  5FKK A;  4QTR A;  2CV0 A;  3CQZ J;  2UXN A;  2WY7 Q;  2IP2 A;  2R5Z B;  2FF4 A;  2YX4 A;  1WJB A;  4B44 A;  3ERM A;  4XKC A;  3QAH A;  5H2F C;  4MEY F;  4A5N A;  4EVI A;  1HST A;  1E17 A;  4AU7 A;  1Y1V J;  3ABL H;  1R9T J;  2RAE A;  2P8T A;  4KFC A;  4M3F A;  1RNL A;  1ZRC A;  4BNC A;  5GAD J;  5C44 J;  3DTI A;  4EV0 A;  5B1A H;  4RM2 A;  1UB9 A;  5ILU A;  1J5Y A;  2EIL H;  3HRS A;  2LNB A;  2WAQ N;  1P6R A;  1V5F A;  1LUJ B;  3M8J A;  2L7Z A;  3B6C A;  4LFU A;  2PJP A;  1UHM A;  2F48 A;  4NB5 A;  5LBQ A;  3H9Q A;  2XPW A;  4QWQ A;  2QSG X;  5DYM A;  5K5O A;  2VC0 A;  2VQG A;  1TC3 C;  2W4S A;  1MMN A;  5EDN A;  1SFU A;  3CMA I;  1VQN I;  3IC7 A;  4QLC U;  4UNO A;  3KP5 A;  1YJN I;  2HKO A;  1IGN A;  4LGW A;  1TWC J;  4MLO A;  3HM5 A;  3HOT A;  1MJB A;  2VJJ A;  4IEJ A;  2ZNZ A;  2A61 A;  5TJJ A;  2V26 A;  3TL4 X;  3WE2 A;  3KZI C;  1VQ9 I;  2V1N A;  1BW5 A;  5E3M A;  3KP4 A;  4GCV A;  5FRM A;  3I59 B;  4RGS A;  1OCT C;  1WH7 A;  2ZXJ A;  3AFH A;  4C2T A;  1VTN C;  1GDT A;  3BPV A;  3PSF A;  2PLY A;  2WTE A;  3I4N J;  3MZ8 A;  5E18 F;  2DT7 B;  5EG0 A;  2K40 A;  2W85 A;  2XVC A;  2DA1 A;  1YIO A;  3TDZ C;  3R6S A;  1LEA A;  1F1Z A;  4XLC A;  2XF7 A;  2JUC A;  2R7W A;  3SDB A;  1X2M A;  1D8K A;  1QGP A;  3C3W A;  4ZZL A;  5IT3 A;  1WJF A;  1JHH A;  4GGG A;  4FAS D;  5CVI A;  4L9N A;  3T0Y A;  2O5R A;  2Q2E B;  1GLN A;  1BI1 A;  3A2K A;  1NK3 P;  2HDW A;  4M9Z A;  4Y33 A;  1APL C;  2HTJ A;  2HQ5 A;  1IXR C;  1TL8 A;  4OIR F;  4LMY A;  2GLO A;  2VOD A;  3DLA A;  1NTC A;  1CGP A;  1I50 J;  2M8E A;  2MFZ A;  2QQ8 A;  2K02 A;  2ZXH A;  4GRI A;  2GXA A;  2VKD A;  2ZME A;  3PNY A;  3KP7 A;  2XAU A;  1LE8 A;  2BZT A;  4UHT A;  1LB2 A;  1FZP B;  1SD7 A;  3A1Y A;  2PMU A;  2CQK A;  2BBY A;  3GFM A;  3PIP F;  2HVS A;  4B8X A;  2X85 A;  1V5G A;  1XGN A;  3G1L A;  1RR7 A;  4KDP A;  5JLW A;  2L3D A;  3BTJ A;  1I6X A;  1RKW A;  3IP4 B;  3T1B A;  5JLX A;  2RRE A;  5J47 A;  1MSE C;  2OC6 A;  1J09 A;  3BLY A;  4G7O F;  3LSP A;  3E7L A;  3CJQ B;  5E1X A;  1R4N B;  2BEO A;  1LDK B;  3OL4 A;  3UKG A;  2QEN A;  4RDU A;  2PMH A;  4XLF A;  2ZME C;  4C2M J;  4HST A;  2Z33 A;  3JR9 A;  1FT9 A;  1M1E B;  5HLG A;  9ANT A;  4N4N B;  5BOX A;  1LVA A;  3LWF A;  4IKF A;  3K7A J;  4P5O A;  3KZY A;  3VYT B;  2F5V A;  5C3E J;  1O7L A;  2ZFU A;  1A31 A;  2DMN A;  1ETK A;  3BY6 A;  4A5M A;  2MW8 A;  2FBH A;  3QU6 A;  2DQR A;  2TDX A;  1BM9 A;  1RUN A;  3HPG A;  1RRJ A;  1B8I A;  1ETY A;  1Z6T A;  2KIF A;  2XAJ A;  5FKM A;  3WTY C;  2DMP A;  4I0B A;  3IH3 A;  2NOJ B;  3G71 I;  4JBA A;  2RVC A;  3LQQ A;  3BQZ A;  5LEJ A;  3IUO A;  1ZR4 A;  2FQ3 A;  1ACI A;  1U5T A;  5DUI A;  3HPH A;  1XS9 A;  2LF7 A;  2X6O A;  1P4A A;  2A6E F;  3VEP A;  1O3Q A;  2Z1D A;  5CYV A;  2PBI A;  4YRV A;  2L54 A;  1P9Q C;  1IN6 A;  2Y0M A;  4M3B A;  2OQG A;  3CDL A;  2YSR A;  4D9J A;  3Q9S A;  5J4Y A;  5F08 A;  2JSP A;  4YII A;  3BCB A;  2P7C B;  4CO8 A;  4I6Z A;  1U5T C;  2RKH A;  2ETH A;  2IXS A;  2DA3 A;  4XRS A;  2HEO A; 
#chains in the Genus database with same CATH homology
 3BR1 A;  1VFC A;  3LOC A;  5F0F A;  3TW6 A;  3HGY A;  3Q0U A;  1GV5 A;  2IAI A;  1MBF A;  2VPR A;  1TWG J;  1F36 A;  4Y7N J;  5E3L A;  2R5Y A;  4C3J J;  4A3M J;  3S2D J;  1U78 A;  1W0U A;  3HOZ J;  1RES A;  5E3N A;  1POG A;  4JYK A;  1TWF J;  5GP9 A;  3S2H J;  2KDZ A;  3A01 B;  2LP0 A;  3B6A A;  3L1P A;  1TWH J;  2EZH A;  2LFB A;  2EZK A;  3S1R J;  1H8A C;  4A3F J;  2L9R A;  4B1R A;  3D1N I;  5IPA A;  5EZG A;  1YRN A;  2E2I J;  2YU9 J;  4MIM A;  1WPK A;  1ENH A;  4BY7 J;  1JGG A;  3TW7 A;  3S1N J;  2R5Y B;  2Y0S N;  4MFE A;  3ZQF A;  1VF9 A;  3HKZ N;  2ZB9 A;  1Z0X A;  4A3C J;  3BG9 A;  2QF7 A;  3FK7 A;  3ZOB A;  1JUS A;  3BTC A;  5GPA A;  2WV1 A;  2XGC A;  2FJ1 A;  1LFB A;  2L0K A;  1OFC X;  2JMW A;  3TP0 A;  2XGE A;  4QSH A;  4QIW N;  5EG0 B;  3O8H A;  2DMT A;  3LNQ A;  1HF0 A;  3TP3 A;  2XPV A;  5EEA A;  2JA8 J;  3H3V K;  1T33 A;  3SJM A;  1NK2 P;  4BBR J;  4W97 A;  1IRZ A;  2HOA A;  4A3B J;  1GV2 A;  2Y9Y A;  4AYB N;  4FTH A;  5M3F J;  4EEF G;  5HOD A;  2M8G X;  2NVQ J;  4BKX A;  4J19 A;  5K7F A;  2EQR A;  1MNM C;  4S0H B;  3VPR A;  3LSR A;  5IYB J;  4IHW A;  3NAR A;  5J1R A;  3BR5 A;  4CYC B;  1AU7 A;  1O4X A;  2HOS A;  3BT9 A;  3G1M A;  4JP0 A;  3BR3 A;  1ZTR A;  2HXO A;  5F0C A;  1LE8 B;  1ETV A;  1DU0 A;  2VI6 A;  2DA2 A;  1WI3 A;  1ETX A;  5IP7 J;  1WGX A;  5BNG A;  2R0Q C;  1FEX A;  2M34 A;  3S15 J;  5DS9 A;  2XRL A;  2O7O A;  1CQT A;  1OCP A;  3ZQL A;  4XID A;  4M3E A;  4D7M A;  2COB A;  3Q3S A;  1AKH A;  3BR6 A;  1DU6 A;  2LLK A;  2HDD A;  2H8R A;  2DA5 A;  2DMQ A;  5IOY A;  3CMY A;  4G12 A;  3I4M J;  3GTK J;  4RBO A;  2CJJ A;  2FX0 A;  3S16 J;  2LR8 A;  1MBG A;  2PMZ N;  5IYC J;  3S17 J;  4A93 J;  1B72 A;  2QCO A;  4D5F A;  3JRE A;  2EZI A;  3PO3 J;  3C2B A;  5F27 A;  4MO7 A;  2MGQ A;  2JN6 A;  1B8I B;  4UUS B;  2K9Q A;  4FE4 A;  4M6V A;  1ZKG A;  2HI3 A;  3ZQG A;  4DYR A;  1AKH B;  1JTY A;  2TCT A;  1JTX A;  1ETQ A;  2HOT A;  5IP9 J;  1P7I A;  4A69 C;  2ECB A;  3DCF A;  1X2N A;  2ME6 A;  5EGO A;  1SAN A;  1JJ8 C;  4BBS J;  3OIO A;  4FCY A;  4AUX A;  2D5V A;  3NAU A;  2R93 J;  1A5J A;  4D5C A;  1ITY A;  2L7M P;  2I10 A;  1QVU A;  3W6V A;  3LSJ A;  5C4J J;  3BG3 A;  1ZR2 A;  3OSG A;  2NS8 A;  2IBD A;  1MSF C;  3SDG A;  2TRT A;  1FIA A;  4B4C A;  1D5Y A;  3LSG A;  2ME0 A;  4A3G J;  1IJW C;  3JRH A;  4ABZ A;  1K61 A;  1UMQ A;  2E2H J;  1LFU P;  2E2J J;  1HDP A;  5EGO B;  1JT6 A;  3IV5 A;  1ETW A;  3Q0W A;  1F43 A;  2O9L A;  4M3G A;  4XRM A;  2DTZ A;  3GTJ J;  1MBJ A;  4D7N A;  2Y2Z A;  2Y31 A;  3S1Q J;  2AHQ A;  2LTP A;  3RZO J;  3WHC A;  1U9N A;  2VKV A;  3FIW A;  4XK4 A;  3PM1 A;  2Y9Z A;  4DZJ A;  2B63 J;  2JJ7 A;  2E1O A;  1BL0 A;  1VI0 A;  3GTL J;  1H89 C;  3JRC A;  4A3L J;  4X6A J;  3MKL A;  5F04 A;  3HOY J;  2HXI A;  4A3J J;  1Q1V A;  1YRN B;  2JA6 J;  3A02 A;  2FD5 A;  5IOZ A;  3S1M J;  1MBE A;  1Z77 A;  2LVS A;  3ZQH A;  1JKP C;  3QPL A;  2JK3 A;  2P81 A;  4GFB A;  4MFD A;  3JRD A;  1K83 J;  1WH5 A;  4BXX J;  5F0H A;  5EF6 A;  2OF7 A;  2NVY J;  3QQA A;  3ZQI A;  2CUF A;  5FKO A;  2CUE A;  3M4O J;  1QRY A;  2EZL A;  1HLV A;  4XRS G;  2NVT J;  2K9N A;  1H88 C;  2ID3 A;  2R5Z A;  4JX4 A;  2G0E A;  1XG1 A;  1XC5 A;  1BW6 A;  1IUF A;  3BTI A;  5J1Y A;  3GTM J;  1JJ6 C;  1MBK A;  2CQQ A;  2M0C A;  2W48 A;  3A03 A;  4W1U A;  4C3H J;  3TED A;  1MBH A;  2E19 A;  1AHD P;  5M5Y J;  4A3K J;  2GM4 A;  4DW6 A;  4A3D J;  2DJN A;  5C4X J;  2N8G A;  2KT0 A;  3IH2 A;  1W0T A;  1RET A;  1FTZ A;  4HNV A;  4A3E J;  2DMU A;  2VUM J;  2IEK A;  5F1J A;  5FKK A;  1QPI A;  1JKQ C;  2R7Z J;  4QTR A;  1UG2 A;  5FLV A;  5E3O A;  3CQZ J;  2R5Z B;  2CQX A;  3BG5 A;  1Y1W J;  1QVT A;  3K2A A;  4BY1 J;  4JX6 A;  3WHB A;  4C3I J;  3HOU J;  1X58 A;  3DEW A;  2NS7 A;  2L7F P;  2M2E A;  3HGG A;  1Y1V J;  1PUF A;  1MH4 A;  5M5W J;  1R9T J;  1JUP A;  2H1K A;  2Y30 A;  1IV6 A;  2RAE A;  1IC8 A;  4IHY A;  4M3F A;  2OPT A;  2AO9 A;  2YUS A;  5FJ8 J;  5J1U A;  5C44 J;  2XB5 A;  3FKI J;  2WAQ N;  3HDD A;  1MH3 A;  2YS9 A;  2L7Z A;  3B6C A;  2FQ4 A;  4LOC A;  4X1E A;  2XPW A;  4AC0 A;  3HB9 A;  1B72 B;  3RZD J;  1FTT A;  3A01 A;  2MG4 A;  2LY9 A;  1TWA J;  1TC3 C;  3HBL A;  3JRB A;  1FJL A;  5EDN A;  3GTQ J;  1JKR C;  1PUF B;  2LK2 A;  3S14 J;  1IGN A;  1JT0 A;  5FLM J;  1TWC J;  4MLO A;  3HM5 A;  1U8B A;  4IEJ A;  3HOV J;  5K7H A;  3CCY A;  2JA7 J;  1BW5 A;  3JRI A;  2NOG A;  5E3M A;  2EBI A;  3SFI A;  1BA5 A;  2ELK A;  5GPC A;  4V2F A;  1U9O A;  3RQI A;  2DA6 A;  2DA7 A;  1G2H A;  2R92 J;  1GVD A;  1OCT C;  1WH7 A;  2GBY A;  1GDT A;  3I4N J;  5FKN A;  3O8G A;  3FIS A;  2DN0 A;  5EYR A;  2K40 A;  5EG0 A;  2DA1 A;  1SFO J;  4DYC A;  2MSY A;  4DZP A;  2M9H A;  2EH3 A;  4NDL A;  2NVX J;  3BQY A;  1HDD C;  1X2M A;  2XPU A;  3GTG J;  5EZH A;  4JX5 A;  3RKQ A;  1NK3 P;  3Q0V A;  1APL C;  4V2G A;  3QPS A;  2HQ5 A;  2X48 A;  5J3L A;  3JRG A;  4A3I J;  5K7Z A;  2GLO A;  1RKT A;  1NTC A;  4CYC A;  1I50 J;  4XIC A;  3M3Y J;  1EF4 A;  1ORK A;  2XGD A;  3JRF A;  1P7J A;  1LE8 A;  2X9D A;  1IG7 A;  3MN2 A;  5M3M J;  4L5E A;  3G1L A;  1RR7 A;  1I3Q J;  2VKE A;  5JLW A;  3BTJ A;  1RKW A;  5JLX A;  3GTO J;  1MSE C;  1ZGW A;  2XB0 X;  3E7L A;  3LSP A;  1HCR A;  1ETO A;  3ZQC A;  3UKG A;  4RDU A;  1E3O C;  2ID6 A;  5M5X J;  3BTL A;  4C2M J;  2JA5 J;  3JR9 A;  1FIP A;  4B3A A;  9ANT A;  2WB1 N;  3K7A J;  4M3D A;  2JWT A;  2O8K A;  5C3E J;  1JKO C;  2DMN A;  1ZK8 A;  3OOU A;  1S7E A;  1ETK A;  4IHX A;  3BR2 A;  2MW8 A;  4Y52 J;  3IH4 A;  1GUU A;  3MVP A;  2K9S A;  1BJZ A;  2ECC A;  4FIS A;  1B8I A;  1ETY A;  5FKL A;  2CRG A;  4UUS A;  1IDZ A;  1HOM A;  5FKM A;  2DMP A;  3IH3 A;  3BR0 A;  3HEF A;  3F0C A;  3FK6 A;  4FE7 A;  3BQZ A;  3G1O A;  1GT0 C;  3PO2 J;  5IYD J;  2CU7 A;  3HOW J;  4IHV A;  1ZR4 A;  1I6H J;  1ZQ3 P;  5IP6 A;  3JRA A;  4I76 A;  1XS9 A;  2DA4 A;  2X6O A;  3GBG A;  4DYQ A;  3HOX J;  1OJL A;  1A6I A;  2LKX A;  4M3B A;  4UUT A;  1T56 A;  3CDL A;  3H0G J;  1RPW A;  5F08 A;  5DTD A;  2LD5 A;  2XSD C;  1WCM J;  4I6Z A;  1JUM A;  3GTP J;  1VND A;  2HYJ A;  1IDY A;  3OSF A;  2DA3 A;  4XRS A;  1UHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...