1ZTRA

Solution structure of engrailed homeodomain l16a mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
GDEKRPRTAFSSEQLARAKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a protein denatured state and folding intermediate.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Segmentation polarity homeobox protein engrailed
total genus 14
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ztrA00
4A3BJ 1Y1WJ 1SFOJ 1VFCA 2JA8J 2DMNA 2B63J 5F0HA 4AC0A 4W97A 1PUFB 2DA4A 1WGXA 2O9LA 3LSJA 3TW6A 3G1MA 4FISA 2PMZN 1IJWC 2P81A 4QTRA 2MW8A 1WH5A 4I76A 2EZLA 2EQRA 5FKKA 1DU0A 3S1MJ 2NVTJ 4UUSA 4BXXJ 1Z0XA 5J1UA 1K83J 4M3DA 3GTMJ 4BBRJ 1OCTC 3GTLJ 9ANTA 1VNDA 3F0CA 3OSGA 2NS7A 1JKOC 1MBKA 2EH3A 1Q1VA 2YUSA 2R5YA 2D5VA 4B3AA 5K7ZA 1RPWA 2TRTA 4FE7A 1MH3A 2QCOA 1EF4A 2JWTA 3OSFA 1I3QJ 2IBDA 2X48A 3G1LA 1JKQC 1I50J 2Y2ZA 5IOYA 1UHSA 4HNVA 2Y9ZA 2HOSA 3PO3J 3TP0A 4S0HB 3FISA 4DYRA 3S15J 1ZK8A 2K9SA 2XPWA 4M3BA 1ZQ3P 1YRNA 1AKHA 4IEJA 2I10A 1LE8A 2DA3A 4Y7NJ 2KDZA 5JLWA 2EZIA 3Q3SA 3JRIA 2NVXJ 1FJLA 3JRCA 2VUMJ 2JK3A 1TWFJ 3ZQHA 1LFBA 1SANA 2M0CA 1R9TJ 1MBGA 4BKXA 1JUPA 5FKOA 2O7OA 3BQYA 1P7IA 3GTJJ 3JR9A 1APLC 3LSGA 1TWAJ 3FK6A 1U9NA 4GFBA 5EZHA 2LR8A 5FKNA 1I6HJ 2IAIA 3DEWA 3RZDJ 4XIDA 4A3KJ 3QPSA 2R5YB 1T56A 5FJ8J 2ECCA 1LFUP 2DTZA 4A3LJ 1ETWA 5F0FA 1IGNA 2EZHA 3BQZA 5GPAA 3I4NJ 5GP9A 1ZR2A 2LKXA 2KT0A 2QF7A 5IP6A 1S7EA 3ZQLA 3IH4A 2MSYA 2WAQN 3WHCA 2GLOA 1T33A 1RKTA 3BTLA 3LOCA 2HQ5A 3UKGA 1MBFA 5IP9J 1P7JA 3W6VA 1JT6A 4JYKA 3QQAA 1K61A 3HEFA 4B4CA 5DTDA 2LY9A 2K9NA 1ORKA 1X2MA 5F27A 3TW7A 1RKWA 4IHVA 4X1EA 5EG0B 2XGCA 1CQTA 2E19A 3O8HA 1ETKA 1FIAA 4ABZA 5M3FJ 4W1UA 1W0UA 2N8GA 2ME0A 2E2IJ 3TEDA 1U9OA 4LOCA 4V2GA 1B72B 1JTYA 1E3OC 5C44J 2HI3A 3S1RJ 3H3VK 1JUMA 2YS9A 1IDYA 1MBEA 5EGOA 5BNGA 1ETYA 2E2HJ 1MH4A 4IHXA 2R92J 3PO2J 5F1JA 2ZB9A 1HDDC 3JRGA 3S17J 2H8RA 1BW5A 2XSDC 2JA5J 3HOUJ 3SJMA 1JT0A 1NK3P 4A3IJ 4IHYA 4BY7J 3LNQA 1JJ8C 1HOMA 3LSRA 5C3EJ 2XPVA 2H1KA 5M5XJ 5K7HA 3VPRA 1MBJA 5FKMA 1HDPA 2NVQJ 2Y31A 1WPKA 2GM4A 5IYDJ 3A01A 4DYCA 1VF9A 1ETOA 2MG4A 3DCFA 3GTQJ 3JRAA 1O4XA 3BT9A 2X6OA 3D1NI 3S14J 2XGEA 3JREA 1WCMJ 2GBYA 3NAUA 1TWHJ 3BG5A 5IYBJ 1U78A 1BJZA 2LP0A 1ITYA 2L9RA 1TC3C 1NK2P 4MFEA 2DN0A 3ZQGA 1MBHA 2XGDA 5F04A 2NOGA 4BY1J 5IP7J 2EBIA 2COBA 4RDUA 3ZQCA 4C3JJ 2XRLA 4JX5A 2HXIA 3SFIA 2CQXA 1MSFC 2LK2A 3M4OJ 2CJJA 3CDLA 4CYCB 4A3CJ 2OPTA 1JUSA 4QIWN 3FKIJ 3G1OA 3BR3A 1Z77A 4A3DJ 2FQ4A 3BR5A 2M9HA 4C3IJ 5IOZA 3A03A 3BTCA 1GVDA 2M34A 4DZPA 4MLOA 1OFCX 4D7NA 3ZOBA 2DA7A 1JGGA 2JMWA 4XRSG 3GBGA 2XB0X 1Y1VJ 1OCPA 2FD5A 4G12A 4XRSA 1FIPA 5K7FA 2R0QC 1QVUA 3IH2A 3K2AA 2CQQA 2JJ7A 3S1NJ 3OOUA 3QPLA 3ZQIA 2R7ZJ 1POGA 3GTPJ 5F08A 4D7MA 3OIOA 2WB1N 2W48A 4UUSB 1GT0C 2Y0SN 1D5YA 3RKQA 2DMQA 1B8IB 3S2DJ 3CCYA 4MFDA 3HB9A 1ZTRA 2CU7A 4DZJA 1IC8A 2HOAA 1A6IA 4A3FJ 2M2EA 4DW6A 4QSHA 5E3OA 2CUFA 2DA2A 1X2NA 1JKPC 1GV2A 1G2HA 2K9QA 3WHBA 4C3HJ 1W0TA 1BW6A 3CMYA 4M3EA 3BTJA 2ME6A 3K7AJ 3I4MJ 1MNMC 2L0KA 2Y9YA 1F36A 3BG9A 2DMPA 3B6CA 2VKVA 1BL0A 5EYRA 1AKHB 1AU7A 5FLMJ 4XICA 4J19A 5E3LA 2VKEA 3A02A 1RESA 2RAEA 1IUFA 5IYCJ 5FKLA 2LTPA 3BR2A 3CQZJ 4Y52J 3HKZN 5M5YJ 4IHWA 3FIWA 1H88C 3C2BA 5E3NA 4RBOA 1JKRC 1IV6A 3BTIA 5C4JJ 2HXOA 1UMQA 2EZKA 1XC5A 3L1PA 5M5WJ 3HOWJ 3A01B 2LVSA 1TWCJ 3BR0A 2HDDA 2AO9A 1QVTA 1WI3A 4FTHA 3SDGA 4A3MJ 1HLVA 1TWGJ 3B6AA 4UUTA 3HOXJ 4A3JJ 2IEKA 2L7ZA 2FJ1A 3HM5A 3NARA 4XRMA 5J1RA 3HDDA 2E2JJ 1ETVA 4A69C 3GTOJ 3JRFA 2XB5A 1ZKGA 3FK7A 5GPCA 4V2FA 1X58A 1XG1A 5C4XJ 2DA5A 4X6AJ 4L5EA 4EEFG 2R93J 4MIMA 2ELKA 3BG3A 1ZGWA 3S1QJ 2NS8A 1JJ6C 1HCRA 4FCYA 1YRNB 1LE8B 5E3MA 1GV5A 4XK4A 4BBSJ 1VI0A 4DYQA 5J3LA 2MGQA 3BR1A 3MVPA 4M3GA 2E1OA 3GTGJ 2LD5A 2AHQA 1DU6A 1WH7A 5EGOB 2VI6A 4M3FA 1OJLA 1ZR4A 4AUXA 1AHDP 1FEXA 4JX6A 3Q0WA 5F0CA 1U8BA 2JA7J 4I6ZA 3HOYJ 4M6VA 4MO7A 2DMTA 4B1RA 4D5FA 3O8GA 2LFBA 2R5ZA 3TP3A 1RR7A 3IV5A 3PM1A 1ETQA 3BR6A 2DJNA 1H89C 3RZOJ 1IRZA 2JA6J 1FTTA 2XPUA 3S2HJ 4D5CA 1H8AC 2L7FP 5FLVA 2G0EA 2JN6A 2HOTA 3MKLA 2LLKA 1FTZA 2X9DA 1MSEC 4JX4A 1GUUA 5J1YA 1IG7A 1B8IA 4FE4A 4C2MJ 5IPAA 1ENHA 5EEAA 2DA1A 5EZGA 2HYJA 1IDZA 1GDTA 3HGYA 1PUFA 4A3GJ 4A3EJ 5JLXA 1HF0A 4JP0A 2DMUA 5EG0A 1QRYA 3H0GJ 3HBLA 5EDNA 3MN2A 1ETXA 3Q0UA 2FX0A 1BA5A 5HODA 4CYCA 2ID6A 2WV1A 3HOZJ 5M3MJ 2K40A 2Y30A 2ID3A 1F43A 1RETA 1XS9A 3IH3A 3S16J 4AYBN 1NTCA 2CRGA 2CUEA 1B72A 2ECBA 3Q0VA 3HOVJ 2NVYJ 1UG2A 3GTKJ 1A5JA 1QPIA 2R5ZB 3JRBA 4NDLA 3E7LA 3HGGA 2DA6A 3M3YJ 3JRHA 1JTXA 3ZQFA 2L7MP 2YU9J 3RQIA 4A93J 2OF7A 2M8GX 5DS9A 2VPRA 3LSPA 5EF6A 2O8KA 2TCTA 3JRDA
chains in the Genus database with same CATH superfamily
3MZ8A 2XAHA 3BG6A 4LD5A 3TO7A 2B9SA 1Y1WJ 4GGGA 2VLAA 1SFOJ 2DMNA 2B63J 4M74A 1XSXA 4XOTA 4PJMA 4W97A 2VQLA 2V6CA 2CV2A 1R5ID 3GLLA 1WGXA 3E0JB 3HTUA 2WTEA 3LSJA 2O9LA 2KFDA 4GYGA 4JOMA 4FISA 2P81A 1W7PA 2MW8A 1WH5A 5TJJA 1P6RA 1LNWA 4YIFA 4PJLA 3K70C 3S1MJ 3BG7A 5H6QA 5J8FA 2NVTJ 2W84A 2O0YA 1WQ2A 4UHTA 2LNBA 1GXPA 5J1UA 2P6TA 1RUOA 3RTRA 3GTMJ 4BBRJ 1UG0A 4FX4A 1OCTC 3OSGA 2UXNA 1JKOC 1MBKA 2EH3A 2JUCA 2ZMEB 3OS2A 2YUSA 2DJIA 1X1CA 2IGKA 1E3HA 1MD0A 3QPTA 2TRTA 4HF1A 4FE7A 1MH3A 4XORA 3F22A 1XMAA 3I0TA 3K10A 4UVBA 1I3QJ 3OOPA 2W7NA 4HX8A 4M71A 5CYVA 4PK4A 1YIJI 1JKQC 1I50J 2Y2ZA 2F5VA 2C6YA 3J81K 2V7FA 4LG0A 2EINH 4L9JA 2ZNYA 3HHHA 3QYEA 1HA8A 3BLYA 3PNTA 3TP0A 4E7LA 4S0HB 3ZMUA 4DYRA 3ZRGA 3JCUC 4LLGF 2VBZA 4HF0A 4G6QA 2MC3A 2XPWA 4MQ9F 3L09A 4M3BA 2H94A 4KUMA 4XKCA 4EM2A 2QSFX 3FM5A 1AKHA 1BM9A 4L0ZB 4HV5A 2DA3A 1ZYRF 4QPOA 3OYKA 3GMEA 1BR2A 3IWZA 4G9YA 4PSXA 3Q3SA 2NVXJ 4EGYA 2GXAA 3O6BB 1LFBA 1SANA 2V9VA 2WAQA 1R9TJ 2DT7B 2OTJI 3T0YA 5FKOA 2K4JA 1P7IA 2M4GA 3BQYA 3GFLA 4HG2A 3JR9A 3DEUA 4U7BA 1IRFA 1U9NA 1XGNA 3FK6A 4GFBA 4KN7X 1MMSA 5FKNA 1I6HJ 2K9LA 2HOEA 3DEWA 4G6DA 2E35A 1I3AA 3HSEA 3PQKA 2DFFA 3ECHA 2ZJQF 5KAIC 5CVUA 3HTSB 2X6WA 2K3PA 2FEZA 3ERMA 3IKVA 3QPHA 5GP9A 2LKXA 2KT0A 2QF7A 1S7EA 1LVKA 1P92A 3IH4A 3GCMA 2MSYA 2GLOA 1RKTA 2GZWA 3UKGA 2P5LC 3C3WA 2ISZA 1R7JA 5JVTA 4V19K 1KU2A 2BGCA 3HEFA 2ZNZA 4M72A 3HRUA 5DTDA 2LY9A 1B1BA 1J5YA 2M8EA 5HDKA 4PZJA 2V26A 5BOXA 2CW7A 2HVQA 3EUAA 1J09A 4XR6A 2CW0F 1RKWA 4L9TA 3KP5A 2Y48A 4RGXA 5EG0B 1WJEA 2CV0A 3FHZA 2XGCA 4HV6A 1XSVA 3MQ0A 5DUKA 2W4SA 5K5OA 1O3TA 4KFCA 2O03A 2XAQA 1W0UA 3FMRA 2Z1DA 3TEDA 1Q1HA 2D45A 2A3SA 1IV8A 1F1ZA 2Q0OA 2R7FA 3AG1H 1G8XA 1B4AA 3Q9VA 3CCUI 4BDZA 3K4MA 3FXQA 5FROA 1JTYA 4KT6A 2QENA 3KLOA 2KRHA 2XKOA 1JUMA 2YS9A 4IOAF 1IDYA 2IS4A 5BPDA 2BXZA 3J7AO 1OYIA 1Z05A 2ACJA 4IHXA 1K6OA 4YELA 3T1BA 1YE9A 2QBYA 2ZB9A 1SVLA 2BHYA 3F21A 3HL2A 3S17J 3VB2A 2H8RA 2JA5J 2PMZA 1MDMB 3HOUJ 3DTKA 1USSA 3U1KA 3FXRA 3WGGA 5ERIA 4LFUA 2NXNB 2PLYA 3HHGA 3R0JA 3SEQA 3WTVC 1QZYA 2Y31A 1WPKA 2RNGA 5IYDJ 5JR3A 3A01A 2KIQA 1ZG3A 4BQQA 4P9UA 2E7WA 3KZZA 4KT5C 4RAYA 4RAFA 5CKTA 2X6OA 3JREA 2R7UA 2VE8A 3BG5A 5IYBJ 1U78A 3N97A 3TOBA 4RGUA 5LBQA 2V79A 2F6CA 3ZQGA 1MBHA 3W6JB 3PQJA 4KICA 4KISA 3WTUC 2TDXA 3DLLF 3PL8A 4XLHA 2XRLA 3DTEA 4GDFA 2DDAA 3SFIA 1V5FA 5IY5H 1MSFC 3VODA 4J00A 2CJJA 3K1MA 4U87A 4CYCB 4A3CJ 2H1LA 1KZHA 1ULYA 4XKWA 5DDGA 1JUSA 2EFQA 1VQOI 3GEZA 4A6DA 3GUDA 4A0YA 4A3DJ 2M30A 3EUHA 2LY1A 4UV8A 3H0DA 3DKYA 2HTJA 2ICWG 2IP2A 5IOZA 2M34A 2M5WA 4BL0B 4DZPA 2IGOA 4XM3A 5TGTA 3ML6A 3DP7A 2L2OA 1X1BA 2Z5UA 2DA7A 1LDJA 2EFPA 4E70A 2HPMA 2JMWA 2XC7A 2A05A 3OYCA 1ACIA 4G12A 2DAOA 4N9HA 2R0QC 1DGWY 1TL8A 2XUBA 4F91B 2CQQA 1LB2A 2EB7A 3UNGC 4FASD 3O2PE 3GTPJ 4L5JA 2QA4I 3F8MA 4OINF 5LFAA 1KU3A 3CC4I 4PJ0C 4UUSB 2D2WA 4B3XA 2LMDA 3RKQA 1B8IB 3S2DJ 2ZCWA 3FWEA 4NBQA 1MNDA 1ZTRA 2IS2A 2PQ8A 1OPCA 2M87A 4ZTJA 3CJTB 2HOAA 1A6IA 4A3FJ 4ZYGA 4D1QA 1D8KA 2CUFA 2FU4A 1SD7A 2NAZA 5ICCA 1XGMA 4PCQA 1X1DA 2K9QA 2HGCA 1PP8F 4Y3OA 4BQNA 1YW8A 3U9GA 1W0TA 4L9NA 1BW6A 1UELB 4BGDA 3V42A 4M3EA 2VXZA 3BTJA 3SFZA 2PMUA 3VYTB 4HOBA 3OL3A 1U8RA 1FT9A 4CDGA 3C18A 3BG9A 2R7DA 3B6CA 4EJOA 3FBNB 2VKVA 1BL0A 2D1VA 2DPDA 2MH2A 3S3OA 2BY2A 2Z9OA 1H9TA 1A35A 2GIZA 1VQ5I 3WG7H 5FLMJ 2HR3A 1T98A 4FQGA 2A6EF 4J19A 1T8IA 1UAAA 3CP2A 2JVHA 2WAEA 3VYRB 2ZXWH 2RAEA 2OA4A 4LK1F 2LTPA 4Y52J 4KMUX 4Y13A 3WTTC 4IHWA 2KJBA 1H88C 5EJCA 3X2QH 2R7OA 5E3NA 2V1DA 4E7JA 5H20A 1KU7A 3SHFA 3M8JA 3OIPA 3WTWC 4YFKF 4NB5A 1ERDA 2QSGX 5J4YA 2QSHX 1W1WE 4NQWA 3TDZC 1BN5A 5M5WJ 2LVSA 2JZYA 3BR0A 2VQGA 2AO9A 1QVTA 4IHTA 1IW7F 1EA3A 3CCLI 5HVQC 1HLVA 2X0LA 2PBIA 2CUZA 2Z3YA 4RB3C 4Y4RA 5L3GA 4F55A 4E4HA 2R7XA 4YFXF 5ICFA 3CC2I 2MABA 3E3VA 3LSMA 4WXHA 3DV8A 4H4KC 2KQRA 2FJ1A 2AS5F 3HM5A 4XBFA 3KEOA 3NARA 3GO5A 4HDVA 3TMOA 1ETVA 4YRVA 1T0FA 4ENNA 2LY2A 2XB5A 1GLNA 3FK7A 4BJ6C 3V8KA 3CCRI 1XG1A 4NC6A 3TOAA 2JA2A 3RIRA 2ZFWA 5C4XJ 3HOTA 4LIUA 2LG4A 2OUMA 3GW2A 3SQNA 2WV0A 4X6AJ 1T39A 1WWXA 2A61A 4IXAA 4P96A 3CCVI 3S1QJ 2NS8A 5K1YA 4FCYA 3R4KA 1HBXG 3BCAA 3DBLB 2HU9A 1B6AA 2E1OA 3GYHX 2Y0MA 3EUKL 1LFPA 1SEUA 3A0HC 2JTVA 2HS5A 2VI6A 5EGOB 2QBYB 2IA0A 1ZR4A 3E6CC 2BW3A 4Q5SF 5F0CA 2Y0SA 2IGMA 2W00A 1TT5B 2X85A 2DFEA 2PJRA 4DNCA 3H36A 1U0JA 5CLSA 4D5FA 3QAHA 5CPRB 3O8GA 2R5ZA 5D8LB 3OV8A 2CGPA 3IV5A 2ZFUA 3EUHC 4AU7A 4KJZA 4CCMA 2DJNA 2NNYA 3RZOJ 1IRZA 4HX7A 4CH7A 2MA3A 3HG9A 5BMZA 2KLOA 1H8AC 2P6SA 2DQRA 1TBXA 1WZ2A 2XAFA 3FXLA 1IG7A 3CMEI 2AXTC 4PFPA 1B8IA 4KMFA 2VBYA 4CUGA 2P4WA 3D5RC 2DA1A 4DBQA 1OYWA 3LFUA 2HYJA 1SD4A 4XL9A 4N9IA 2GXBA 1QNTA 3KIOA 1HF0A 4JQFA 3BZCA 3PJRA 5DCFA 2KZVA 4OOIA 2QUFA 5EDNA 3MN2A 2FX0A 4EJUA 1R6RA 2ID6A 2JPCA 5DM7F 2K40A 5D4RA 1AWCA 4CSWA 2XF5A 1R36A 3MAJA 4HLYA 2CV1A 1I6XA 2DODA 1OYYA 1FSEA 3S16J 1NTCA 4R8HA 4XLFA 2CUEA 1MW7A 4Q47A 2ECBA 2GOMA 2NOJB 2NVYJ 1T0FC 1QQIA 2HZTA 3MKZA 2M1BA 3F9KA 1YI2I 2O61A 1PVEA 4ENMA 3FMSA 5KVRA 3ZQFA 5GADJ 4A93J 2OF7A 3ULQB 4G7ZF 4I98B 3L2WA 3LSPA 2O8KA 1OR7A 1QZEA 1QBJA 1VTNC 4BQOA 5F0HA 4HQMA 1ZRFA 1JXSA 2E7XA 3LSIA 2EFWA 4NNJA 3FKJA 3IL2A 3G1MA 2KP6A 1XCBA 2G9WA 2PMZN 1YS7A 1E0EA 4C2UA 4I76A 4NQWB 2I8DA 4QLCU 1SAUA 3E6DA 4UUSA 1Z0XA 4O5VA 2OV7A 5L3DA 3J7AY 2K86A 3GTLJ 2CQ7A 1VNDA 1FC3A 2NS7A 2LF8A 4IJAA 1FPQA 2BXYA 2MD5A 1WJCA 2XHKA 3DPTA 4PJJA 3TBIA 1NHAA 2FNPA 1TZLA 2KIFA 2JWTA 2F5CA 3OSFA 2IBDA 4ZDOA 2HDWA 3H3ZA 3G1LA 5IOYA 3CDIA 3I55I 4M73A 3WODF 5K5RA 3G71I 2HOSA 1TTYA 3FISA 1ZK8A 1KYZA 2G7UA 2Z99A 5E17F 3H5RA 4XSZF 1ZQ3P 2OQGA 4S05A 3CESA 2A07F 3BY6A 2V1UA 3P9KA 1ZG1A 1FJLA 1VQ6I 3KYDB 3BC8A 3DPUA 4FT8A 3ZCOA 3ZQHA 2M0CA 1KYWA 2LH9A 4AM3A 1WJ5A 4ENKA 1TWAJ 3RI4A 3CO7C 2IAIA 4NC7A 3RZDJ 4L0YB 1S29A 2MC4A 4A3KJ 4RAGA 4BXFA 2F5DA 2X4HA 3E1SA 4RMNA 4E7ZA 2CQNA 2ECCA 1J7KA 2G7HA 4A3LJ 1LEBA 4ON0A 3I54A 1ETWA 1V4RA 1QZZA 3RYRA 1DDNA 1IGNA 3DU5A 2EZHA 1YOVB 3M07A 4GYIA 4ZDPA 2MD0A 2WAQN 3L2VA 1ZLJA 4ZJZA 2VONA 1EH8A 1G3WA 2JSCA 3LOCA 4XSXF 2VC1A 1SMYF 1MBFA 4RLQA 3GZ6A 1JT6A 4JYKA 1K61A 2VODA 4Y15A 5CVIA 1G4DA 4ZYDA 1D3YA 3VYUB 1Z1DA 2K9NA 3PFYA 3ECOA 4JBAA 4EJVA 5HOOA 3QOPA 1UCRA 5F27A 4DOZA 3M8EA 1RIOH 2XF6A 4IHVA 3CJQB 1YYVA 1T08B 2DK8A 4A5NA 1OCRH 3L9FA 3KP6A 2FUG2 2N8GA 1J0RA 4XLCA 3MMYB 1U9OA 5KNLA 1V54H 1A36A 4F52A 3T8RA 4P9FA 1VQNI 4V2GA 2H27A 2BE5F 2HZDA 2YSRA 5ILVA 2FOKA 3DBRB 3I58A 5EGOA 4IQ4A 3RSNA 3RCOA 5BNGA 4UY8I 1K78A 4WXDA 4IX7A 2R92J 3M8FA 3S3MA 5F1JA 4KIGA 1BI0A 2XV4S 3W6KB 2F4IA 3ASOH 1R49A 5D5VB 2QWWA 4XN0A 2RN7A 1BW5A 3RPQA 4I0BA 3SJMA 3NWTA 1XSDA 1JT0A 1NK3P 2VBXA 1TQPA 3LNQA 3TO9A 4A0XA 3TQNA 1HOMA 1BI3A 5B3SH 2OCEA 3DPLC 2CUJA 2XPVA 1Z21A 4HAMA 3F3XA 3MZYA 5B66C 1KONA 1MBJA 2ZO4A 1HDPA 2NVQJ 5D5UB 2EJRA 4DYCA 1U2WA 4BJ5C 2JRTA 1ETOA 3ROUA 1AA7A 3T5XA 5B1AH 3DCFA 5EEHA 4EJTA 2IXSA 3GFJA 1YX5A 2CWEA 1BBYA 2XASA 3KP7A 3AAFA 2IGNA 3NAUA 5GAGJ 1BJZA 2GWRA 2GA2A 2K7LA 1ITYA 3DFGA 2IS6A 1R4NB 3PSFA 1TC3C 3ZMZA 4MFEA 2DN0A 5DV5A 5HNFA 1U5TC 3HIFA 3ZQQA 5FB2A 2IJLA 1K4TA 3W2AA 5IP7J 1RUNA 3ZQCA 3FXMA 5DM6F 2E36A 4JX5A 1E17A 2HXIA 2EK5A 3K4CA 2F4OB 3R61A 2KDOA 3CDLA 4YEJA 3UR3C 1LVAA 4WWCA 1G6NA 4BEHB 2OZ6A 5E18F 3FKIJ 2K5CA 3E5UA 4OIPF 3K4KA 5LHHA 3BR5A 4BBSJ 1HSTA 1MMAA 4C3IJ 3FF5A 3C7JA 2DFIA 4MQVA 3OIQA 4XRSG 2AXLA 2VB6A 3GBGA 1UZCA 1TQIA 5E8IA 2XROA 5BQTA 1Y1VJ 2VXDA 1OCPA 3DF8A 3DKXA 4XRSA 5K7FA 4B09A 1W5SA 3K2AA 4KIBA 3IUOA 5LGTA 1FWZA 3D0SA 3ZQIA 2LSOA 4MHGA 3KETA 2R7ZJ 4LMYA 3I59A 2QZ8A 3G2BA 3H9JA 3RKWA 2W48A 5EEGA 4AD9A 1GT0C 5FD6A 1OQYA 4I0AA 4OWRB 1QHGA 2W85A 4UV9A 5IT9K 1J2XA 1XTAA 1E2XA 4MFDA 3TDUC 4BE1A 5IT3A 4DZJA 3E6BA 1R1TA 1P4AA 3KPHA 2DYRH 2M3AA 1ZELA 2H8WA 3PUBA 2CW8A 3ZGKA 4DW6A 3C1DA 2L9SA 2ZC2A 3COAC 2FBKA 4OMYA 1S8NA 2LF7A 1SFEA 3A0BC 2XDVA 2COMA 4S04A 2DTRA 1G2HA 3WHBA 4BNCA 2YU3A 4O6JA 1ZRCA 2ZXJA 4LGWA 1IN6A 2A5YB 2ME6A 4E6KG 3I4MJ 1J9IA 1MNMC 2R7RA 2L0KA 4MTDA 3LMMA 1TLHB 1F36A 3K9TA 4ZZLA 4IRHA 4TV7A 2Q8KA 1S7OA 2EPFA 1J75A 4CCNA 5EYRA 1FYKA 1MJBA 2NVUB 1AU7A 1Z67A 4PDKA 1MJAA 1AKHB 2F5EA 1ZARA 2BVLA 1D0XA 2WY8Q 2XVCA 1UB9A 4XLAA 5FO5A 2FMLA 5HLHA 4F7ZA 5IYCJ 2DLLA 2EV6A 3CQZJ 3LL7A 4ESBA 5DD8A 4BS9A 4N4OB 4F3QA 2BZTA 1IN4A 1G3YA 3V8LA 1MJ9A 3C2BA 1BR4A 3PIPF 1S72I 2XSJC 4Q4ZF 4QPQA 1GHCA 5LD2C 1Y6IA 1N77A 3GLXA 2KHMA 4G94A 4F93B 4KA4A 1YJ9I 2MYSA 2W24A 1SD6A 3HOWJ 3A01B 4QWQA 2HDDA 2WADA 1WI3A 3LSTA 3OYGA 2EFOA 4I02A 1TP4A 4A3MJ 2Y69H 4BXUA 3H35A 4EM0B 3JTHA 2IEKA 3LSKA 2HNHA 2UV1A 2L7ZA 3VEPA 3ERED 2AQEA 3LQRA 2JVGA 1J59A 1WFXA 3HDDA 2E2JJ 3GTOJ 5GPCA 2MH9A 1X58A 1IXSB 2HVRA 3GX4X 4IHSA 2QQBA 1JE8A 5AIQA 3P9CA 1BR1A 2I5UA 1LUJB 4L5EA 4EEFG 2R93J 4ZYAA 4R1HA 1TW3A 2FRHA 4MIMA 2ELKA 1YRNB 3AFHA 3VWBA 4Z2YA 1GV5A 2STTA 3AG3H 4L18B 2DK5A 3MVPA 3QU6A 3CCEI 2FQ3A 4HEA2 2AHQA 4RLFA 5HNHA 5D6EA 1R22A 2JRMA 3FXOA 4BE2A 4AUXA 2KRFA 1NH3A 4JX6A 1O3QA 2M45A 3KEQA 2PEXA 1SFUA 2OZUA 2RGVA 2PFBA 2WB1A 4UVAA 1NG7A 1A31A 4I6ZA 1LDDA 3I56I 2JA7J 4LIVA 4M6VA 1HSJA 2FBIA 2DMTA 2KISA 2WWYA 3OYHA 5DD4A 3QODA 1CF7A 1ETQA 1D5VA 3BR6A 3L00A 2CS3A 3IAS2 3CD6I 1GXQA 1H89C 2JA6J 1FTTA 2MBFA 2R7TA 2XPUA 2HWVA 4CA0A 5FLVA 4E7IA 2JN6A 5D5WB 3S3NA 1DP7P 1S3JA 4HA8A 1FTZA 2QKLB 2O5RA 5J1YA 1GUUA 1O57A 5CQEA 5HLIA 4DQ2A 5IPAA 1QA6A 2ISYA 5JVGF 4I09A 1NG6A 2LBFB 2O8XA 4ESJA 1IDZA 3PUFA 1GDTA 4A3GJ 2K02A 3IP4B 3K1NA 3LWFA 2DMUA 2V1NA 1YO5C 3CUQA 2ZJ2A 3VSLA 1QRYA 3H0GJ 1ETXA 3PFIA 3CC7I 3H5NA 2WV1A 3I64A 2W57A 1YITI 2V9PA 2Y30A 1IAWA 1RETA 2F5FA 3VDXA 2W25A 3CCSI 2J5PA 1P2FA 1Y0NA 4M9SA 4P55A 1X3UA 3M1EA 1K79A 2Z2SB 3HOVJ 1LPQA 1UG2A 3ZN0A 1A6QA 3ZMTA 1N78A 1QHHD 3OYEA 1A5JA 3HXLA 2ZJRF 3JRBA 2R5ZB 3I71A 4CZZA 1M1EB 2BVMA 2HVSA 3JRHA 4RGSA 1YW7A 1USTA 1X4OA 4ZC3A 4NHJA 3CDHA 2QKMB 4U88A 3RQIA 5DS9A 1LEAA 1XDUA 3ABKH 3K6GA 2LOOA 3GZNB 3JRDA 3BWGA 1ZH5A 1UJ8A 4A3BJ 3CO6C 4IKFA 2EIKH 1RR8C 2JA8J 2ZKZA 3TO6A 3CCMI 4AC0A 3H9QA 1PUFB 3NRVA 3F8CA 2WC2A 3FDYA 2BOLA 3BPVA 3TW6A 1FSHA 2E1NA 2KIUA 4QTRA 4RB2C 2DT5A 5DCMB 2EQRA 1VQPI 2HYFA 1V55H 1KU9A 3OYJA 2FXAA 3TGNA 3L2UA 2F4MB 2XAUA 2QQ9A 3F0CA 3NEUA 3JSOA 1TNSA 1XD7A 4HX4A 4B3AA 1RPWA 1XN7A 4E7SA 1D8JA 4XMYA 2IRFG 3LAJA 4WX9A 2PI0A 1Y8QB 4HNVA 2DYSH 2QM3A 5FLXZ 3OYLA 3G4SI 2ELJA 5E79C 2Y9ZA 3HYIA 3PO3J 1X3ZB 5HDNA 3IRQA 1ZHFA 2BBYA 4BHCA 1JI8A 2K9SA 2BY3A 3OYFA 5FRMA 1F9NA 1YRNA 3OL4A 4IEJA 2I10A 1LE8A 1HW5A 4Y7NJ 1FP2A 4ETSA 2KDZA 5JLWA 2EZIA 4A5MA 1JHHA 4ESFA 2K85A 3JRCA 2JK3A 1TWFJ 2KKOA 3BPXA 4BKXA 4II2A 4PGGA 2M7BA 3E5QA 4UXNA 1SFKA 3OYDA 4CGZA 5GAEJ 3AL0B 4HNUA 5EZHA 1Y0UA 5L3CA 4WK8F 4G7OF 4XRFA 4F92B 2EILH 3G6EI 4WF2A 2V4JC 3GFMA 1W5TA 2YX4A 4CCLA 3OYMA 2FE3A 5LGNA 2R5YB 1T56A 2IPQX 4DGWB 2L9VA 1YJNI 5FJ8J 2DTZA 2DXIA 5F0FA 1BOAA 2LRDA 1XCVA 3VYSB 4ZYEA 3I4NJ 1ZR2A 5IP6A 3LFKA 3ZQLA 3F8FA 1R58A 4FX0A 1T33A 2V9KA 2RQQA 4CO8A 3JTGA 1EKEA 3BTLA 3NQOA 5AIPA 2ZJPF 3QU3A 3HJEA 4LLNA 1IZ1A 1P7JA 3W6VA 1PJRA 3QQAA 3KLNA 2PX9A 1ORKA 3V7RA 5CVVA 4I2OA 1TW2A 1FMVA 4MTEA 1ONVA 4X1EA 1FOYA 2JUGA 1QPMA 3CUQB 5HDGA 4O3MA 5J6XA 1CQTA 4KN4X 3O8HA 4KYWA 2YR2A 4IZZA 1ETKA 2JSPA 3N05A 3D5SC 2L54A 3BZ6A 4ABZA 1IUYA 5D8KB 1HKSA 2Q2EA 4A6EA 4XQFA 1HKTA 3MCZA 2W1OA 1B72B 2BYVE 2HDCA 3RKXA 2VJ5A 3S1RJ 3H3VK 4M9ZA 1I39A 2BV6A 3OMYA 1SMTA 3ESWB 4XN3A 1MBEA 4MGRA 5GTHC 4IRIA 2UWMA 2DCEA 3L2CA 2F48A 3CLOA 2STWA 5H6RA 2NRAC 1ETYA 3HRTA 2E2HJ 1MH4A 1S6LA 4XLPF 3PO2J 4HW0A 1WSUA 2OC6A 2V6EA 1HDDC 1OISA 4MEYF 4M9XA 4LLLA 2CSOA 2VKDA 3RYPA 5LHIA 3SZTA 3IHUA 2KMUA 1FBUA 4BY7J 2O3FA 2XGXA 5C3EJ 1FBQA 2H1KA 1WJDA 3FZVA 3B73A 4HF2A 5M5XJ 4C9YA 4D9JA 1WJFA 3RKYA 4B44A 2IT0A 1VF9A 2DU9A 1WJAA 2A6HF 2UZKA 3GTQJ 1O4XA 1W4MA 3D1NI 3KP3A 2XGEA 3HRMA 5ED4A 1WCMJ 2GBYA 4N4NB 1TWHJ 1OKRA 2Q2EB 3WTZA 1VQ7I 4AVZA 1WVRA 2A5WA 3ABMH 1YHQI 4ENJA 1FBSA 2L01A 2L9RA 2FMYA 2VASA 2XGDA 5F04A 2DOFA 3K0LA 2NOGA 5E1ZB 4BY1J 2EBIA 2P0WA 3KP2A 4RA2A 4AYBA 2HYGD 3QP6A 3IRRA 2LK2A 4A0ZA 3M4OJ 4B43A 1R5GA 3OYIA 1WKMA 2LKPA 2OPTA 3GWZA 1BC8C 4QIWN 2OJED 3FHNA 2KZGA 4X0GA 2ETHA 4HBLA 2JT1A 2E1MB 1D1CA 2BY0A 3A03A 3BTCA 4MLOA 4EV0A 2DO7A 1SFXA 3PNVA 2M4KA 4D7NA 5BPIA 3ZOBA 2GIVA 2VL8A 1FP1D 2VT2A 3CF2A 5FRNA 3TKYA 2VBWA 2FD5A 3U2RA 1S5LC 5DUIA 1O3RA 2ZSHB 1QVUA 2NNNA 2RNJA 2X1CA 3IH2A 1CF7B 3WE3A 4BQAA 1MMNA 1U5TA 2JJ7A 3HSRA 3QPLA 2ZMEC 1RRJA 3VOEA 4D7MA 4P5OA 1V5EA 2Y0SN 3DTIA 3WE2A 1D5YA 3O3KA 2DFHA 1H0MA 3K4BA 2GQQA 1YLFA 3J81Z 5FD5A 5D6FA 4OIQF 1BI1A 1YW9A 1BI2A 1IC8A 4L5IA 4EATA 2M2EA 2ZXHA 1B59A 3PIOF 1XGOA 3HC7A 2BHZA 5L3BA 4QSHA 5E3OA 1AOYA 2DA2A 1X2NA 2IVMA 1R1UA 1VQMI 3KYLA 3W2VA 4LG0B 2RV8A 3MZHA 3H9GA 3P5JA 1FZPB 1LQ1A 3WG9A 3ABTA 3CMYA 5JHFA 1SD5A 3K7AJ 2R7WA 1U3EM 4RGRA 4YG2F 5ILSA 2Y75A 3L2QA 4I99C 4GRIA 2DMPA 2OBPA 1ZAOA 3U1DA 1N75A 2ZSIB 3G3ZA 2R4GA 3S8PA 4KDPA 4G7HF 3M1CA 3I59B 1K78B 2GAUA 4XICA 5E3LA 4A2UA 3M7GA 2IS1A 1WHUA 1RESA 3K69A 4IO9F 2K3FA 3BJOA 1MMGA 3BR2A 3U21A 3J7YJ 5KK1A 3HKZN 5M5YJ 2J5OA 1MDMA 3I5UA 1R23A 1DUXC 3BROA 1IO2A 3F6VA 5C4JJ 1UMQA 2VKHA 3Q5FA 1XC5A 3DEEA 5CQGA 1X1PA 1IN8A 3S2WA 3CTAA 3L1PA 5KHDA 1ZN2A 1TWCJ 4PGHA 1EV7A 3VSKA 5E20A 4FTHA 2E5NA 3SDGA 1FOXA 3ELKA 1S7AA 1CGPA 2PJRB 1TWGJ 3B6AA 4RM2A 2ADUA 4DIQA 2ZMEA 4A3JJ 2H6CA 2E1MC 4AIDA 4LB5A 3OYBA 5J1RA 1MNEA 1Z3YA 5F1RA 5JI6A 2BY1A 1ZKGA 4V2FA 3MKWB 3FMQA 3WU0A 3RPUD 3L7WA 3C2GA 4LITA 1KGSA 3RPUA 2DA5A 4BEHA 1SVOA 1ZGWA 3OYNA 1JJ6C 1HCRA 2FSWA 1HQCA 5KCMA 1LE8B 1E3PA 5J3LA 2MGQA 3DQVC 3H5AA 1XMXA 4M3GA 4YFNF 1KQ0A 1FLIA 4ZTFA 4BE0A 3CUQC 3RDIA 3GTGJ 3J7ZI 4M3FA 2HKXA 3ONQA 1AHDP 1FEXA 1R5HA 2HFHA 2YX7A 2EFNA 3QRFF 1U8BA 2HQRA 2EV0A 1OLTA 2VOPA 5CJ9A 3HOYJ 4MO7A 4RAZA 2B0LA 1DP3A 3CJRB 4KITB 1IXRC 2L02A 2E60A 5FLXK 2WY7Q 3S2HJ 4D5CA 2HKOA 2L7FP 5J40A 1RI7A 3OYAA 3RQ4A 3MFKA 2X9DA 5J8CA 1MSEC 4HPQA 5GTIC 2YPRA 1G3TA 5L3EA 2P8TA 3LQQA 2QVOA 1A04A 3ZN1A 4DJAA 4YIIA 1FMWA 5EEAA 3KX2A 4BJTA 2DBBA 5EZGA 5FFXA 5LGUA 1S9HA 3WGIA 2P5VA 1FOWA 3FXUA 3IKTA 1PUFA 4XKBA 4A3EJ 2KJCA 1ON2A 5FFZA 3HBLA 2F2EA 1YFHA 4ZH4F 1L0OC 3W3CA 1Y39A 1QO0D 3HOZJ 2WBMA 5M3MJ 2KPMA 2E34A 3KE2A 2QQ8A 4U7DA 1MKMA 4AYBN 2WAFA 5A2QK 2CRGA 2OCCH 4E7HA 5F6FA 2H6BA 1IRXA 1O7LA 2M7AA 3KYCB 4Q48A 5K5QA 2QEXI 1QPIA 3E7LA 3JSPA 3HGGA 3M3YJ 4OU0A 1IF1A 1X3WB 1Y8RB 3IWFA 2A68F 3MEXA 4B8XA 5ILUA 3EYIA 2CFOA 2JQ7A 1REPC 4BAYA 2M8GX 1O7FA 2VPRA 3I53A 3ZQ7A 3MWMA 2DQLA 1G59A 1W7PD 2XKPA 2VPLA 3LAPA 3WGHA 1VFCA 1HKQA 4CHUA 2NYXA 2DW4A 4AIKA 3N4MA 2DA4A 4KNYA 1WRJA 1I1GA 1EH6A 3EQLF 2Q1ZB 4RS8A 3H3UA 1W36D 1IJWC 2FOWA 2HPIA 2V1XA 3K4NA 2VQHA 3E5XA 3LA2A 1BIBA 2EZLA 5FKKA 1D0YA 1DU0A 1W5CC 4BXXJ 2UXXA 4CZCA 2ELHA 1K83J 4M3DA 1D1BA 4KIFA 3V7SA 5J4VA 2PG4A 3SDBA 4OAZA 3CCQI 9ANTA 2X6XA 1Q1VA 3F8BA 4FHTA 2DOEA 2X1DA 4U0WA 2R5YA 4UB8C 2D5VA 1V3FA 5K7ZA 4UVCA 3T8TA 3BOQA 1LKXA 1WI9A 2QCOA 3MD2A 4PSWA 4Y17A 5DCMA 1OMIA 1EF4A 2H09A 2IA1A 2R3SA 4WCGA 6PAXA 1PDNC 2MFZA 4R79A 2X48A 3ZMSA 1F4KA 5IT9Z 1OCCH 1UHSA 5HLTA 2NS0A 3CP8A 4M6YA 2JPBA 3E6MA 4II3A 5CVJA 3R6SA 3S15J 3KFWX 4H0EA 2PN6A 3JAMK 3Q9SA 4CICA 1EJ9A 3JAMZ 1LJ9A 2VN2A 3WTYC 2DT6A 4BUPA 3GZ5A 2E71A 1G3SA 3DKWA 5AONA 1VQLI 2LKSA 4AIHA 3S93A 3JRIA 1D0ZA 2VUMJ 3EPZA 1T95A 1XMKA 5LEKA 1MBGA 1JUPA 3GVAA 4I01A 2O7OA 3HUGB 3GTJJ 2DPUA 4C30A 1APLC 3LSGA 3OS0A 2LR8A 1QU3A 5TISC 3V4GA 4P1WA 1Z9CA 3R60A 2B7EA 4XIDA 2PMHA 4IQJA 3QPSA 2HEOA 3DWLE 3IAM2 4G8XA 1LFUP 3F23A 2OD5A 3QYBA 3CUOA 4XKVA 3BQZA 2QYOA 5GPAA 3AL0C 3VFZA 5DEQA 3FM3A 3WHCA 3WTXC 1B9NA 1FYMA 2X51A 2HQ5A 2LDUA 5JHUA 3A4CA 5IP9J 1XB4A 4XNFA 3C2HA 2BEOA 3OY9A 3QOEA 4B4CA 2ESNA 3DXJF 3GFIA 1L3LA 1BIAA 1X2MA 1UFMA 2EWNA 5L3FA 1ZRDA 2MLKA 3TW7A 5F64A 1HW1A 1QGPA 2CMPA 2R7QA 1ZLKA 2E5ZA 2E19A 1OCOH 4CCOA 1FIAA 4ANJA 5M3FJ 1Y56A 4W1UA 4Y33A 2ME0A 1R1VA 2E2IJ 3J80K 3SZGA 4LOCA 3J80Z 2R7SA 3K4LA 4NC8A 2EA2A 1E3OC 2AQFA 5C44J 5BS6A 2HI3A 3JW4A 1EH7A 2VE9A 2KL4A 1PUEE 3HKZA 2QLZA 1HC8A 1I5ZA 1FX7A 3K70D 3CMMA 3H1CA 4BHPA 2L5QA 2DDBA 3QYFA 4B48A 1ZG5A 1XPXA 3OS1A 3R0AA 3JRGA 2FA5A 2XSDC 1H9GA 2LC2A 4UNOA 4EM1A 5D5XB 1YJWI 4A3IJ 4IHYA 2VOOA 1JJ8C 2XIGA 4RB1A 3LSRA 2L3DA 3IC7A 3M9AA 5K7HA 3VPRA 2GA1A 5FKMA 1PP7U 3AG2H 2GM4A 1XX5A 4L9VA 3REOA 2MG4A 3JRAA 5KAFC 3WU1B 2Z33A 3BT9A 5HS8A 4HYEA 3S14J 4XOPA 2ZXIA 4D0PA 3EYYA 3ZMDA 1IRGA 2LP0A 3F72A 2X6YA 1NK2P 3OWTA 3HPGA 4ZDLA 1N25A 2IW5A 4HRIA 4HZFA 5LLQA 3FXKA 2COBA 4IRGA 4RDUA 2DI3A 4C3JJ 2OTLI 3GF2A 2CQXA 3LA7A 1RNLA 2HQAA 5ICGA 1SAXA 1KA8A 4E7KA 3G1OA 4EQQA 3BR3A 3P9IA 1Z77A 2CYYA 2FQ4A 3B02A 4DBRA 2M9HA 1YS6A 1GVDA 3F8NA 3WTSC 1OFCX 4OAYA 3GXOA 1U5TB 2M0MA 4HSRA 2A69F 1FNNA 1T38A 2R7VA 1X4PA 3E97A 2XF7A 1MIJA 1JGGA 3ISPA 4OIOF 2XB0X 3FXJA 4GCVA 5LHGA 2VT3A 5HS7A 1YX3A 2HQNA 3HZJA 1FIPA 4PFOA 4JK1X 3G73A 2HTSA 2ZBKA 2LYCA 2IA2A 1V5GA 3KEYA 4MNUA 3S1NJ 3OOUA 3CLQA 1POGA 2GXGA 2K27A 3KZIC 5F08A 1F5TA 2CO5A 3OIOA 1ZGJA 4AVPA 1DGRM 2WB1N 4XONA 1K4SA 3CZ6A 2DMQA 5B5EC 1Z6TA 2P5KA 2LREA 3CCYA 1FOKA 3HB9A 2VC0A 2CFXA 3RJPA 2CG4A 2LBFA 2CU7A 3DU6A 3TL4X 4HNTA 1MZBA 5D4SA 4FETA 4AIJA 3CJNA 1B9MA 1P4WA 4Z6YA 2CH0A 3K4JA 1K6YA 4PJNA 2K4BA 3ASNH 1JKPC 1Z3XA 3HPHA 4HSTA 4CCKA 3EETA 5GAHJ 1GV2A 3OR2C 1FYLA 1YQAA 4K2EA 1Z6RA 2XRNA 5CVRA 5E8GA 1I27A 4C3HJ 3CF5F 4MEXF 2XAJA 2RQPA 2RKHA 4M6XA 3KCCA 2GOXB 1UHWA 3W2WA 4LK0F 1ZGAA 4EJWA 2Y9YA 5DYMA 3ABLH 1JHFA 2EIJH 3A2KA 2W82A 2RVCA 4PUSA 1ZREA 3AKZA 2VJIA 2UUZA 3NWSA 1ON1A 1HXDA 2FF4A 3K2ZA 2VKEA 3A02A 1VQKI 1TT0A 4G6TB 4NUBA 4U0YA 5E1WA 4BHBA 1IUFA 1Z7UA 3F6OA 2VIXA 5FKLA 4AWXB 1R4MB 3PNYA 4IL6C 2VJJA 3QP5A 3HSFA 5LRRA 3FIWA 4XLNF 1IN5A 3PSIA 3ZXSA 2OQRA 4HLXA 3DLAA 2EA4A 3OR1C 1I1SA 4RBOA 1STZA 2A6TA 4ASNA 4UB6C 4BACA 1O3SA 1LDKB 1JKRC 1IV6A 4LJZF 3BTIA 4YIRX 2HXOA 1P9QC 3LA3A 2EZKA 2XAGA 4A12A 3EDPA 1W7PB 1OR7C 5A2QZ 3HOSA 3BJAA 3H92A 4LB6B 5FGMA 3CCJI 1YTYA 3ZMVA 1XGSA 4BH9A 4UUTA 3HOXJ 2MLGA 3ZP5A 3QWLA 4OIRF 2EIMH 1DQUA 2KRCA 4HDUA 3CMAI 5ICEA 3BCBA 4N0BA 1SC7A 3AG4H 2E1CA 4XRMA 1IN7A 4A69C 1T6SA 1Z7LA 3JRFA 2O6GE 5HS9A 1BC7C 4EVIA 2L4AA 4RM3A 4IOCF 3P7NA 2EV5A 1K7AA 1SVMA 3SEZA 2QGUA 4BDYA 4HQEA 3BG3A 3HRSA 1WJBA 1IXCA 3ABUA 5E3MA 4XK4A 3I4PA 2L4MA 1VI0A 2L9NA 4IF4A 4DYQA 2DOAA 4GO1A 5JFRA 1P4XA 3BR1A 3SZPA 4UUVA 4XLEA 1Z91A 1W36C 3KZYA 3L2RA 3ZPLA 4C2TA 1HW2A 2LD5A 1DU6A 1WH7A 3FX3A 4ZYHA 1OJLA 2FNAA 3BJ6A 1KQ8A 3D5LA 3HUGA 3Q0WA 2X1EA 1T2KA 1YG2A 5J47A 1D1AA 1BJAA 4ITVA 4B1RA 2WA0A 1R00A 2LFBA 2KIMA 3TP3A 4J01A 1RR7A 3PM1A 1PYVA 2BW3B 2CQKA 3K1PA 4ZZDA 1JGSA 3LSHA 2G0EA 4EGZA 1U6GA 1TQMA 3WU2C 1MMDA 2HOTA 3ZR8X 3MKLA 2PJPA 2LLKA 4WXCA 4JX4A 4U0VA 1VQ8I 4FE4A 1FY7A 4C2MJ 1MGTA 1ENHA 1RZ4A 4EMSA 4CXFA 1VQ9I 2RREA 3DBHB 3MKYB 1ODDA 3I9V2 5LEJA 3HGYA 4B47A 5HLGA 4CCJA 3A1YA 5JLXA 4RB0A 2ESHA 5E1XA 4JP0A 4LG3A 2L7KA 5EG0A 1VZ0A 4CYDA 3BZKA 3BP8A 1OCZH 2VQCA 3Q0UA 3FBIB 2Z16A 5HODA 2RC4A 3SXYA 4CYCA 2OU2A 1BA5A 1BOBA 1R71A 2ID3A 2P7CB 1KQ9A 1F43A 4IVNA 3BDDA 1UHMA 1XS9A 1C0WA 3IH3A 3V8JA 1B72A 4BYYA 3Q0VA 3SYTA 2VJ4A 2K9MA 3S32A 3GTKJ 1YIOA 3V7CA 5TRDA 5LRSA 4BU2A 1GVJA 1X19A 2P7VB 4OMZA 4NDLA 1RC9A 2DA6A 4GXOA 1DPRA 2FBHA 3KP4A 3I3LA 1XDSA 2D1HA 1JTXA 4I7HA 2QQAA 1DPUA 2L7MP 4IPAA 2YU9J 1TNTA 2RDPA 5B1BH 1VQ4I 5H2FC 1X1AA 5EF6A 2TCTA 2OAZA
chains in the Genus database with same CATH topology
4A3BJ 1Y1WJ 1SFOJ 1VFCA 2JA8J 2DMNA 2B63J 5F0HA 4AC0A 4W97A 1PUFB 2DA4A 1WGXA 2O9LA 3LSJA 3TW6A 3G1MA 4FISA 2PMZN 1IJWC 2P81A 4QTRA 2MW8A 1WH5A 4I76A 2EZLA 2EQRA 5FKKA 1DU0A 3S1MJ 2NVTJ 4UUSA 4BXXJ 1Z0XA 5J1UA 1K83J 4M3DA 3GTMJ 4BBRJ 1OCTC 3GTLJ 9ANTA 1VNDA 3F0CA 3OSGA 2NS7A 1JKOC 1MBKA 2EH3A 1Q1VA 2YUSA 2R5YA 2D5VA 4B3AA 5K7ZA 1RPWA 2TRTA 4FE7A 1MH3A 2QCOA 1EF4A 2JWTA 3OSFA 1I3QJ 2IBDA 2X48A 3G1LA 1JKQC 1I50J 2Y2ZA 5IOYA 1UHSA 4HNVA 2Y9ZA 2HOSA 3PO3J 3TP0A 4S0HB 3FISA 4DYRA 3S15J 1ZK8A 2K9SA 2XPWA 4M3BA 1ZQ3P 1YRNA 1AKHA 4IEJA 2I10A 1LE8A 2DA3A 4Y7NJ 2KDZA 5JLWA 2EZIA 3Q3SA 3JRIA 2NVXJ 1FJLA 3JRCA 2VUMJ 2JK3A 1TWFJ 3ZQHA 1LFBA 1SANA 2M0CA 1R9TJ 1MBGA 4BKXA 1JUPA 5FKOA 2O7OA 3BQYA 1P7IA 3GTJJ 3JR9A 1APLC 3LSGA 1TWAJ 3FK6A 1U9NA 4GFBA 5EZHA 2LR8A 5FKNA 1I6HJ 2IAIA 3DEWA 3RZDJ 4XIDA 4A3KJ 3QPSA 2R5YB 1T56A 5FJ8J 2ECCA 1LFUP 2DTZA 4A3LJ 1ETWA 5F0FA 1IGNA 2EZHA 3BQZA 5GPAA 3I4NJ 5GP9A 1ZR2A 2LKXA 2KT0A 2QF7A 5IP6A 1S7EA 3ZQLA 3IH4A 2MSYA 2WAQN 3WHCA 2GLOA 1T33A 1RKTA 3BTLA 3LOCA 2HQ5A 3UKGA 1MBFA 5IP9J 1P7JA 3W6VA 1JT6A 4JYKA 3QQAA 1K61A 3HEFA 4B4CA 5DTDA 2LY9A 2K9NA 1ORKA 1X2MA 5F27A 3TW7A 1RKWA 4IHVA 4X1EA 5EG0B 2XGCA 1CQTA 2E19A 3O8HA 1ETKA 1FIAA 4ABZA 5M3FJ 4W1UA 1W0UA 2N8GA 2ME0A 2E2IJ 3TEDA 1U9OA 4LOCA 4V2GA 1B72B 1JTYA 1E3OC 5C44J 2HI3A 3S1RJ 3H3VK 1JUMA 2YS9A 1IDYA 1MBEA 5EGOA 5BNGA 1ETYA 2E2HJ 1MH4A 4IHXA 2R92J 3PO2J 5F1JA 2ZB9A 1HDDC 3JRGA 3S17J 2H8RA 1BW5A 2XSDC 2JA5J 3HOUJ 3SJMA 1JT0A 1NK3P 4A3IJ 4IHYA 4BY7J 3LNQA 1JJ8C 1HOMA 3LSRA 5C3EJ 2XPVA 2H1KA 5M5XJ 5K7HA 3VPRA 1MBJA 5FKMA 1HDPA 2NVQJ 2Y31A 1WPKA 2GM4A 5IYDJ 3A01A 4DYCA 1VF9A 1ETOA 2MG4A 3DCFA 3GTQJ 3JRAA 1O4XA 3BT9A 2X6OA 3D1NI 3S14J 2XGEA 3JREA 1WCMJ 2GBYA 3NAUA 1TWHJ 3BG5A 5IYBJ 1U78A 1BJZA 2LP0A 1ITYA 2L9RA 1TC3C 1NK2P 4MFEA 2DN0A 3ZQGA 1MBHA 2XGDA 5F04A 2NOGA 4BY1J 5IP7J 2EBIA 2COBA 4RDUA 3ZQCA 4C3JJ 2XRLA 4JX5A 2HXIA 3SFIA 2CQXA 1MSFC 2LK2A 3M4OJ 2CJJA 3CDLA 4CYCB 4A3CJ 2OPTA 1JUSA 4QIWN 3FKIJ 3G1OA 3BR3A 1Z77A 4A3DJ 2FQ4A 3BR5A 2M9HA 4C3IJ 5IOZA 3A03A 3BTCA 1GVDA 2M34A 4DZPA 4MLOA 1OFCX 4D7NA 3ZOBA 2DA7A 1JGGA 2JMWA 4XRSG 3GBGA 2XB0X 1Y1VJ 1OCPA 2FD5A 4G12A 4XRSA 1FIPA 5K7FA 2R0QC 1QVUA 3IH2A 3K2AA 2CQQA 2JJ7A 3S1NJ 3OOUA 3QPLA 3ZQIA 2R7ZJ 1POGA 3GTPJ 5F08A 4D7MA 3OIOA 2WB1N 2W48A 4UUSB 1GT0C 2Y0SN 1D5YA 3RKQA 2DMQA 1B8IB 3S2DJ 3CCYA 4MFDA 3HB9A 1ZTRA 2CU7A 4DZJA 1IC8A 2HOAA 1A6IA 4A3FJ 2M2EA 4DW6A 4QSHA 5E3OA 2CUFA 2DA2A 1X2NA 1JKPC 1GV2A 1G2HA 2K9QA 3WHBA 4C3HJ 1W0TA 1BW6A 3CMYA 4M3EA 3BTJA 2ME6A 3K7AJ 3I4MJ 1MNMC 2L0KA 2Y9YA 1F36A 3BG9A 2DMPA 3B6CA 2VKVA 1BL0A 5EYRA 1AKHB 1AU7A 5FLMJ 4XICA 4J19A 5E3LA 2VKEA 3A02A 1RESA 2RAEA 1IUFA 5IYCJ 5FKLA 2LTPA 3BR2A 3CQZJ 4Y52J 3HKZN 5M5YJ 4IHWA 3FIWA 1H88C 3C2BA 5E3NA 4RBOA 1JKRC 1IV6A 3BTIA 5C4JJ 2HXOA 1UMQA 2EZKA 1XC5A 3L1PA 5M5WJ 3HOWJ 3A01B 2LVSA 1TWCJ 3BR0A 2HDDA 2AO9A 1QVTA 1WI3A 4FTHA 3SDGA 4A3MJ 1HLVA 1TWGJ 3B6AA 4UUTA 3HOXJ 4A3JJ 2IEKA 2L7ZA 2FJ1A 3HM5A 3NARA 4XRMA 5J1RA 3HDDA 2E2JJ 1ETVA 4A69C 3GTOJ 3JRFA 2XB5A 1ZKGA 3FK7A 5GPCA 4V2FA 1X58A 1XG1A 5C4XJ 2DA5A 4X6AJ 4L5EA 4EEFG 2R93J 4MIMA 2ELKA 3BG3A 1ZGWA 3S1QJ 2NS8A 1JJ6C 1HCRA 4FCYA 1YRNB 1LE8B 5E3MA 1GV5A 4XK4A 4BBSJ 1VI0A 4DYQA 5J3LA 2MGQA 3BR1A 3MVPA 4M3GA 2E1OA 3GTGJ 2LD5A 2AHQA 1DU6A 1WH7A 5EGOB 2VI6A 4M3FA 1OJLA 1ZR4A 4AUXA 1AHDP 1FEXA 4JX6A 3Q0WA 5F0CA 1U8BA 2JA7J 4I6ZA 3HOYJ 4M6VA 4MO7A 2DMTA 4B1RA 4D5FA 3O8GA 2LFBA 2R5ZA 3TP3A 1RR7A 3IV5A 3PM1A 1ETQA 3BR6A 2DJNA 1H89C 3RZOJ 1IRZA 2JA6J 1FTTA 2XPUA 3S2HJ 4D5CA 1H8AC 2L7FP 5FLVA 2G0EA 2JN6A 2HOTA 3MKLA 2LLKA 1FTZA 2X9DA 1MSEC 4JX4A 1GUUA 5J1YA 1IG7A 1B8IA 4FE4A 4C2MJ 5IPAA 1ENHA 5EEAA 2DA1A 5EZGA 2HYJA 1IDZA 1GDTA 3HGYA 1PUFA 4A3GJ 4A3EJ 5JLXA 1HF0A 4JP0A 2DMUA 5EG0A 1QRYA 3H0GJ 3HBLA 5EDNA 3MN2A 1ETXA 3Q0UA 2FX0A 1BA5A 5HODA 4CYCA 2ID6A 2WV1A 3HOZJ 5M3MJ 2K40A 2Y30A 2ID3A 1F43A 1RETA 1XS9A 3IH3A 3S16J 4AYBN 1NTCA 2CRGA 2CUEA 1B72A 2ECBA 3Q0VA 3HOVJ 2NVYJ 1UG2A 3GTKJ 1A5JA 1QPIA 2R5ZB 3JRBA 4NDLA 3E7LA 3HGGA 2DA6A 3M3YJ 3JRHA 1JTXA 3ZQFA 2L7MP 2YU9J 3RQIA 4A93J 2OF7A 2M8GX 5DS9A 2VPRA 3LSPA 5EF6A 2O8KA 2TCTA 3JRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B J;  1Y1W J;  1SFO J;  1VFC A;  2JA8 J;  2DMN A;  2B63 J;  5F0H A;  4AC0 A;  4W97 A;  1PUF B;  2DA4 A;  1WGX A;  2O9L A;  3LSJ A;  3TW6 A;  3G1M A;  4FIS A;  2PMZ N;  1IJW C;  2P81 A;  4QTR A;  2MW8 A;  1WH5 A;  4I76 A;  2EZL A;  2EQR A;  5FKK A;  1DU0 A;  3S1M J;  2NVT J;  4UUS A;  4BXX J;  1Z0X A;  5J1U A;  1K83 J;  4M3D A;  3GTM J;  4BBR J;  1OCT C;  3GTL J;  9ANT A;  1VND A;  3F0C A;  3OSG A;  2NS7 A;  1JKO C;  1MBK A;  2EH3 A;  1Q1V A;  2YUS A;  2R5Y A;  2D5V A;  4B3A A;  5K7Z A;  1RPW A;  2TRT A;  4FE7 A;  1MH3 A;  2QCO A;  1EF4 A;  2JWT A;  3OSF A;  1I3Q J;  2IBD A;  2X48 A;  3G1L A;  1JKQ C;  1I50 J;  2Y2Z A;  5IOY A;  1UHS A;  4HNV A;  2Y9Z A;  2HOS A;  3PO3 J;  3TP0 A;  4S0H B;  3FIS A;  4DYR A;  3S15 J;  1ZK8 A;  2K9S A;  2XPW A;  4M3B A;  1ZQ3 P;  1YRN A;  1AKH A;  4IEJ A;  2I10 A;  1LE8 A;  2DA3 A;  4Y7N J;  2KDZ A;  5JLW A;  2EZI A;  3Q3S A;  3JRI A;  2NVX J;  1FJL A;  3JRC A;  2VUM J;  2JK3 A;  1TWF J;  3ZQH A;  1LFB A;  1SAN A;  2M0C A;  1R9T J;  1MBG A;  4BKX A;  1JUP A;  5FKO A;  2O7O A;  3BQY A;  1P7I A;  3GTJ J;  3JR9 A;  1APL C;  3LSG A;  1TWA J;  3FK6 A;  1U9N A;  4GFB A;  5EZH A;  2LR8 A;  5FKN A;  1I6H J;  2IAI A;  3DEW A;  3RZD J;  4XID A;  4A3K J;  3QPS A;  2R5Y B;  1T56 A;  5FJ8 J;  2ECC A;  1LFU P;  2DTZ A;  4A3L J;  1ETW A;  5F0F A;  1IGN A;  2EZH A;  3BQZ A;  5GPA A;  3I4N J;  5GP9 A;  1ZR2 A;  2LKX A;  2KT0 A;  2QF7 A;  5IP6 A;  1S7E A;  3ZQL A;  3IH4 A;  2MSY A;  2WAQ N;  3WHC A;  2GLO A;  1T33 A;  1RKT A;  3BTL A;  3LOC A;  2HQ5 A;  3UKG A;  1MBF A;  5IP9 J;  1P7J A;  3W6V A;  1JT6 A;  4JYK A;  3QQA A;  1K61 A;  3HEF A;  4B4C A;  5DTD A;  2LY9 A;  2K9N A;  1ORK A;  1X2M A;  5F27 A;  3TW7 A;  1RKW A;  4IHV A;  4X1E A;  5EG0 B;  2XGC A;  1CQT A;  2E19 A;  3O8H A;  1ETK A;  1FIA A;  4ABZ A;  5M3F J;  4W1U A;  1W0U A;  2N8G A;  2ME0 A;  2E2I J;  3TED A;  1U9O A;  4LOC A;  4V2G A;  1B72 B;  1JTY A;  1E3O C;  5C44 J;  2HI3 A;  3S1R J;  3H3V K;  1JUM A;  2YS9 A;  1IDY A;  1MBE A;  5EGO A;  5BNG A;  1ETY A;  2E2H J;  1MH4 A;  4IHX A;  2R92 J;  3PO2 J;  5F1J A;  2ZB9 A;  1HDD C;  3JRG A;  3S17 J;  2H8R A;  1BW5 A;  2XSD C;  2JA5 J;  3HOU J;  3SJM A;  1JT0 A;  1NK3 P;  4A3I J;  4IHY A;  4BY7 J;  3LNQ A;  1JJ8 C;  1HOM A;  3LSR A;  5C3E J;  2XPV A;  2H1K A;  5M5X J;  5K7H A;  3VPR A;  1MBJ A;  5FKM A;  1HDP A;  2NVQ J;  2Y31 A;  1WPK A;  2GM4 A;  5IYD J;  3A01 A;  4DYC A;  1VF9 A;  1ETO A;  2MG4 A;  3DCF A;  3GTQ J;  3JRA A;  1O4X A;  3BT9 A;  2X6O A;  3D1N I;  3S14 J;  2XGE A;  3JRE A;  1WCM J;  2GBY A;  3NAU A;  1TWH J;  3BG5 A;  5IYB J;  1U78 A;  1BJZ A;  2LP0 A;  1ITY A;  2L9R A;  1TC3 C;  1NK2 P;  4MFE A;  2DN0 A;  3ZQG A;  1MBH A;  2XGD A;  5F04 A;  2NOG A;  4BY1 J;  5IP7 J;  2EBI A;  2COB A;  4RDU A;  3ZQC A;  4C3J J;  2XRL A;  4JX5 A;  2HXI A;  3SFI A;  2CQX A;  1MSF C;  2LK2 A;  3M4O J;  2CJJ A;  3CDL A;  4CYC B;  4A3C J;  2OPT A;  1JUS A;  4QIW N;  3FKI J;  3G1O A;  3BR3 A;  1Z77 A;  4A3D J;  2FQ4 A;  3BR5 A;  2M9H A;  4C3I J;  5IOZ A;  3A03 A;  3BTC A;  1GVD A;  2M34 A;  4DZP A;  4MLO A;  1OFC X;  4D7N A;  3ZOB A;  2DA7 A;  1JGG A;  2JMW A;  4XRS G;  3GBG A;  2XB0 X;  1Y1V J;  1OCP A;  2FD5 A;  4G12 A;  4XRS A;  1FIP A;  5K7F A;  2R0Q C;  1QVU A;  3IH2 A;  3K2A A;  2CQQ A;  2JJ7 A;  3S1N J;  3OOU A;  3QPL A;  3ZQI A;  2R7Z J;  1POG A;  3GTP J;  5F08 A;  4D7M A;  3OIO A;  2WB1 N;  2W48 A;  4UUS B;  1GT0 C;  2Y0S N;  1D5Y A;  3RKQ A;  2DMQ A;  1B8I B;  3S2D J;  3CCY A;  4MFD A;  3HB9 A;  1ZTR A;  2CU7 A;  4DZJ A;  1IC8 A;  2HOA A;  1A6I A;  4A3F J;  2M2E A;  4DW6 A;  4QSH A;  5E3O A;  2CUF A;  2DA2 A;  1X2N A;  1JKP C;  1GV2 A;  1G2H A;  2K9Q A;  3WHB A;  4C3H J;  1W0T A;  1BW6 A;  3CMY A;  4M3E A;  3BTJ A;  2ME6 A;  3K7A J;  3I4M J;  1MNM C;  2L0K A;  2Y9Y A;  1F36 A;  3BG9 A;  2DMP A;  3B6C A;  2VKV A;  1BL0 A;  5EYR A;  1AKH B;  1AU7 A;  5FLM J;  4XIC A;  4J19 A;  5E3L A;  2VKE A;  3A02 A;  1RES A;  2RAE A;  1IUF A;  5IYC J;  5FKL A;  2LTP A;  3BR2 A;  3CQZ J;  4Y52 J;  3HKZ N;  5M5Y J;  4IHW A;  3FIW A;  1H88 C;  3C2B A;  5E3N A;  4RBO A;  1JKR C;  1IV6 A;  3BTI A;  5C4J J;  2HXO A;  1UMQ A;  2EZK A;  1XC5 A;  3L1P A;  5M5W J;  3HOW J;  3A01 B;  2LVS A;  1TWC J;  3BR0 A;  2HDD A;  2AO9 A;  1QVT A;  1WI3 A;  4FTH A;  3SDG A;  4A3M J;  1HLV A;  1TWG J;  3B6A A;  4UUT A;  3HOX J;  4A3J J;  2IEK A;  2L7Z A;  2FJ1 A;  3HM5 A;  3NAR A;  4XRM A;  5J1R A;  3HDD A;  2E2J J;  1ETV A;  4A69 C;  3GTO J;  3JRF A;  2XB5 A;  1ZKG A;  3FK7 A;  5GPC A;  4V2F A;  1X58 A;  1XG1 A;  5C4X J;  2DA5 A;  4X6A J;  4L5E A;  4EEF G;  2R93 J;  4MIM A;  2ELK A;  3BG3 A;  1ZGW A;  3S1Q J;  2NS8 A;  1JJ6 C;  1HCR A;  4FCY A;  1YRN B;  1LE8 B;  5E3M A;  1GV5 A;  4XK4 A;  4BBS J;  1VI0 A;  4DYQ A;  5J3L A;  2MGQ A;  3BR1 A;  3MVP A;  4M3G A;  2E1O A;  3GTG J;  2LD5 A;  2AHQ A;  1DU6 A;  1WH7 A;  5EGO B;  2VI6 A;  4M3F A;  1OJL A;  1ZR4 A;  4AUX A;  1AHD P;  1FEX A;  4JX6 A;  3Q0W A;  5F0C A;  1U8B A;  2JA7 J;  4I6Z A;  3HOY J;  4M6V A;  4MO7 A;  2DMT A;  4B1R A;  4D5F A;  3O8G A;  2LFB A;  2R5Z A;  3TP3 A;  1RR7 A;  3IV5 A;  3PM1 A;  1ETQ A;  3BR6 A;  2DJN A;  1H89 C;  3RZO J;  1IRZ A;  2JA6 J;  1FTT A;  2XPU A;  3S2H J;  4D5C A;  1H8A C;  2L7F P;  5FLV A;  2G0E A;  2JN6 A;  2HOT A;  3MKL A;  2LLK A;  1FTZ A;  2X9D A;  1MSE C;  4JX4 A;  1GUU A;  5J1Y A;  1IG7 A;  1B8I A;  4FE4 A;  4C2M J;  5IPA A;  1ENH A;  5EEA A;  2DA1 A;  5EZG A;  2HYJ A;  1IDZ A;  1GDT A;  3HGY A;  1PUF A;  4A3G J;  4A3E J;  5JLX A;  1HF0 A;  4JP0 A;  2DMU A;  5EG0 A;  1QRY A;  3H0G J;  3HBL A;  5EDN A;  3MN2 A;  1ETX A;  3Q0U A;  2FX0 A;  1BA5 A;  5HOD A;  4CYC A;  2ID6 A;  2WV1 A;  3HOZ J;  5M3M J;  2K40 A;  2Y30 A;  2ID3 A;  1F43 A;  1RET A;  1XS9 A;  3IH3 A;  3S16 J;  4AYB N;  1NTC A;  2CRG A;  2CUE A;  1B72 A;  2ECB A;  3Q0V A;  3HOV J;  2NVY J;  1UG2 A;  3GTK J;  1A5J A;  1QPI A;  2R5Z B;  3JRB A;  4NDL A;  3E7L A;  3HGG A;  2DA6 A;  3M3Y J;  3JRH A;  1JTX A;  3ZQF A;  2L7M P;  2YU9 J;  3RQI A;  4A93 J;  2OF7 A;  2M8G X;  5DS9 A;  2VPR A;  3LSP A;  5EF6 A;  2O8K A;  2TCT A;  3JRD A; 
#chains in the Genus database with same CATH topology
 3MZ8 A;  2XAH A;  3BG6 A;  4LD5 A;  3TO7 A;  2B9S A;  1Y1W J;  4GGG A;  2VLA A;  1SFO J;  2DMN A;  2B63 J;  4M74 A;  1XSX A;  4XOT A;  4PJM A;  4W97 A;  2VQL A;  2V6C A;  2CV2 A;  1R5I D;  3GLL A;  1WGX A;  3E0J B;  3HTU A;  2WTE A;  3LSJ A;  2O9L A;  2KFD A;  4GYG A;  4JOM A;  4FIS A;  2P81 A;  1W7P A;  2MW8 A;  1WH5 A;  5TJJ A;  1P6R A;  1LNW A;  4YIF A;  4PJL A;  3K70 C;  3S1M J;  3BG7 A;  5H6Q A;  5J8F A;  2NVT J;  2W84 A;  2O0Y A;  1WQ2 A;  4UHT A;  2LNB A;  1GXP A;  5J1U A;  2P6T A;  1RUO A;  3RTR A;  3GTM J;  4BBR J;  1UG0 A;  4FX4 A;  1OCT C;  3OSG A;  2UXN A;  1JKO C;  1MBK A;  2EH3 A;  2JUC A;  2ZME B;  3OS2 A;  2YUS A;  2DJI A;  1X1C A;  2IGK A;  1E3H A;  1MD0 A;  3QPT A;  2TRT A;  4HF1 A;  4FE7 A;  1MH3 A;  4XOR A;  3F22 A;  1XMA A;  3I0T A;  3K10 A;  4UVB A;  1I3Q J;  3OOP A;  2W7N A;  4HX8 A;  4M71 A;  5CYV A;  4PK4 A;  1YIJ I;  1JKQ C;  1I50 J;  2Y2Z A;  2F5V A;  2C6Y A;  3J81 K;  2V7F A;  4LG0 A;  2EIN H;  4L9J A;  2ZNY A;  3HHH A;  3QYE A;  1HA8 A;  3BLY A;  3PNT A;  3TP0 A;  4E7L A;  4S0H B;  3ZMU A;  4DYR A;  3ZRG A;  3JCU C;  4LLG F;  2VBZ A;  4HF0 A;  4G6Q A;  2MC3 A;  2XPW A;  4MQ9 F;  3L09 A;  4M3B A;  2H94 A;  4KUM A;  4XKC A;  4EM2 A;  2QSF X;  3FM5 A;  1AKH A;  1BM9 A;  4L0Z B;  4HV5 A;  2DA3 A;  1ZYR F;  4QPO A;  3OYK A;  3GME A;  1BR2 A;  3IWZ A;  4G9Y A;  4PSX A;  3Q3S A;  2NVX J;  4EGY A;  2GXA A;  3O6B B;  1LFB A;  1SAN A;  2V9V A;  2WAQ A;  1R9T J;  2DT7 B;  2OTJ I;  3T0Y A;  5FKO A;  2K4J A;  1P7I A;  2M4G A;  3BQY A;  3GFL A;  4HG2 A;  3JR9 A;  3DEU A;  4U7B A;  1IRF A;  1U9N A;  1XGN A;  3FK6 A;  4GFB A;  4KN7 X;  1MMS A;  5FKN A;  1I6H J;  2K9L A;  2HOE A;  3DEW A;  4G6D A;  2E35 A;  1I3A A;  3HSE A;  3PQK A;  2DFF A;  3ECH A;  2ZJQ F;  5KAI C;  5CVU A;  3HTS B;  2X6W A;  2K3P A;  2FEZ A;  3ERM A;  3IKV A;  3QPH A;  5GP9 A;  2LKX A;  2KT0 A;  2QF7 A;  1S7E A;  1LVK A;  1P92 A;  3IH4 A;  3GCM A;  2MSY A;  2GLO A;  1RKT A;  2GZW A;  3UKG A;  2P5L C;  3C3W A;  2ISZ A;  1R7J A;  5JVT A;  4V19 K;  1KU2 A;  2BGC A;  3HEF A;  2ZNZ A;  4M72 A;  3HRU A;  5DTD A;  2LY9 A;  1B1B A;  1J5Y A;  2M8E A;  5HDK A;  4PZJ A;  2V26 A;  5BOX A;  2CW7 A;  2HVQ A;  3EUA A;  1J09 A;  4XR6 A;  2CW0 F;  1RKW A;  4L9T A;  3KP5 A;  2Y48 A;  4RGX A;  5EG0 B;  1WJE A;  2CV0 A;  3FHZ A;  2XGC A;  4HV6 A;  1XSV A;  3MQ0 A;  5DUK A;  2W4S A;  5K5O A;  1O3T A;  4KFC A;  2O03 A;  2XAQ A;  1W0U A;  3FMR A;  2Z1D A;  3TED A;  1Q1H A;  2D45 A;  2A3S A;  1IV8 A;  1F1Z A;  2Q0O A;  2R7F A;  3AG1 H;  1G8X A;  1B4A A;  3Q9V A;  3CCU I;  4BDZ A;  3K4M A;  3FXQ A;  5FRO A;  1JTY A;  4KT6 A;  2QEN A;  3KLO A;  2KRH A;  2XKO A;  1JUM A;  2YS9 A;  4IOA F;  1IDY A;  2IS4 A;  5BPD A;  2BXZ A;  3J7A O;  1OYI A;  1Z05 A;  2ACJ A;  4IHX A;  1K6O A;  4YEL A;  3T1B A;  1YE9 A;  2QBY A;  2ZB9 A;  1SVL A;  2BHY A;  3F21 A;  3HL2 A;  3S17 J;  3VB2 A;  2H8R A;  2JA5 J;  2PMZ A;  1MDM B;  3HOU J;  3DTK A;  1USS A;  3U1K A;  3FXR A;  3WGG A;  5ERI A;  4LFU A;  2NXN B;  2PLY A;  3HHG A;  3R0J A;  3SEQ A;  3WTV C;  1QZY A;  2Y31 A;  1WPK A;  2RNG A;  5IYD J;  5JR3 A;  3A01 A;  2KIQ A;  1ZG3 A;  4BQQ A;  4P9U A;  2E7W A;  3KZZ A;  4KT5 C;  4RAY A;  4RAF A;  5CKT A;  2X6O A;  3JRE A;  2R7U A;  2VE8 A;  3BG5 A;  5IYB J;  1U78 A;  3N97 A;  3TOB A;  4RGU A;  5LBQ A;  2V79 A;  2F6C A;  3ZQG A;  1MBH A;  3W6J B;  3PQJ A;  4KIC A;  4KIS A;  3WTU C;  2TDX A;  3DLL F;  3PL8 A;  4XLH A;  2XRL A;  3DTE A;  4GDF A;  2DDA A;  3SFI A;  1V5F A;  5IY5 H;  1MSF C;  3VOD A;  4J00 A;  2CJJ A;  3K1M A;  4U87 A;  4CYC B;  4A3C J;  2H1L A;  1KZH A;  1ULY A;  4XKW A;  5DDG A;  1JUS A;  2EFQ A;  1VQO I;  3GEZ A;  4A6D A;  3GUD A;  4A0Y A;  4A3D J;  2M30 A;  3EUH A;  2LY1 A;  4UV8 A;  3H0D A;  3DKY A;  2HTJ A;  2ICW G;  2IP2 A;  5IOZ A;  2M34 A;  2M5W A;  4BL0 B;  4DZP A;  2IGO A;  4XM3 A;  5TGT A;  3ML6 A;  3DP7 A;  2L2O A;  1X1B A;  2Z5U A;  2DA7 A;  1LDJ A;  2EFP A;  4E70 A;  2HPM A;  2JMW A;  2XC7 A;  2A05 A;  3OYC A;  1ACI A;  4G12 A;  2DAO A;  4N9H A;  2R0Q C;  1DGW Y;  1TL8 A;  2XUB A;  4F91 B;  2CQQ A;  1LB2 A;  2EB7 A;  3UNG C;  4FAS D;  3O2P E;  3GTP J;  4L5J A;  2QA4 I;  3F8M A;  4OIN F;  5LFA A;  1KU3 A;  3CC4 I;  4PJ0 C;  4UUS B;  2D2W A;  4B3X A;  2LMD A;  3RKQ A;  1B8I B;  3S2D J;  2ZCW A;  3FWE A;  4NBQ A;  1MND A;  1ZTR A;  2IS2 A;  2PQ8 A;  1OPC A;  2M87 A;  4ZTJ A;  3CJT B;  2HOA A;  1A6I A;  4A3F J;  4ZYG A;  4D1Q A;  1D8K A;  2CUF A;  2FU4 A;  1SD7 A;  2NAZ A;  5ICC A;  1XGM A;  4PCQ A;  1X1D A;  2K9Q A;  2HGC A;  1PP8 F;  4Y3O A;  4BQN A;  1YW8 A;  3U9G A;  1W0T A;  4L9N A;  1BW6 A;  1UEL B;  4BGD A;  3V42 A;  4M3E A;  2VXZ A;  3BTJ A;  3SFZ A;  2PMU A;  3VYT B;  4HOB A;  3OL3 A;  1U8R A;  1FT9 A;  4CDG A;  3C18 A;  3BG9 A;  2R7D A;  3B6C A;  4EJO A;  3FBN B;  2VKV A;  1BL0 A;  2D1V A;  2DPD A;  2MH2 A;  3S3O A;  2BY2 A;  2Z9O A;  1H9T A;  1A35 A;  2GIZ A;  1VQ5 I;  3WG7 H;  5FLM J;  2HR3 A;  1T98 A;  4FQG A;  2A6E F;  4J19 A;  1T8I A;  1UAA A;  3CP2 A;  2JVH A;  2WAE A;  3VYR B;  2ZXW H;  2RAE A;  2OA4 A;  4LK1 F;  2LTP A;  4Y52 J;  4KMU X;  4Y13 A;  3WTT C;  4IHW A;  2KJB A;  1H88 C;  5EJC A;  3X2Q H;  2R7O A;  5E3N A;  2V1D A;  4E7J A;  5H20 A;  1KU7 A;  3SHF A;  3M8J A;  3OIP A;  3WTW C;  4YFK F;  4NB5 A;  1ERD A;  2QSG X;  5J4Y A;  2QSH X;  1W1W E;  4NQW A;  3TDZ C;  1BN5 A;  5M5W J;  2LVS A;  2JZY A;  3BR0 A;  2VQG A;  2AO9 A;  1QVT A;  4IHT A;  1IW7 F;  1EA3 A;  3CCL I;  5HVQ C;  1HLV A;  2X0L A;  2PBI A;  2CUZ A;  2Z3Y A;  4RB3 C;  4Y4R A;  5L3G A;  4F55 A;  4E4H A;  2R7X A;  4YFX F;  5ICF A;  3CC2 I;  2MAB A;  3E3V A;  3LSM A;  4WXH A;  3DV8 A;  4H4K C;  2KQR A;  2FJ1 A;  2AS5 F;  3HM5 A;  4XBF A;  3KEO A;  3NAR A;  3GO5 A;  4HDV A;  3TMO A;  1ETV A;  4YRV A;  1T0F A;  4ENN A;  2LY2 A;  2XB5 A;  1GLN A;  3FK7 A;  4BJ6 C;  3V8K A;  3CCR I;  1XG1 A;  4NC6 A;  3TOA A;  2JA2 A;  3RIR A;  2ZFW A;  5C4X J;  3HOT A;  4LIU A;  2LG4 A;  2OUM A;  3GW2 A;  3SQN A;  2WV0 A;  4X6A J;  1T39 A;  1WWX A;  2A61 A;  4IXA A;  4P96 A;  3CCV I;  3S1Q J;  2NS8 A;  5K1Y A;  4FCY A;  3R4K A;  1HBX G;  3BCA A;  3DBL B;  2HU9 A;  1B6A A;  2E1O A;  3GYH X;  2Y0M A;  3EUK L;  1LFP A;  1SEU A;  3A0H C;  2JTV A;  2HS5 A;  2VI6 A;  5EGO B;  2QBY B;  2IA0 A;  1ZR4 A;  3E6C C;  2BW3 A;  4Q5S F;  5F0C A;  2Y0S A;  2IGM A;  2W00 A;  1TT5 B;  2X85 A;  2DFE A;  2PJR A;  4DNC A;  3H36 A;  1U0J A;  5CLS A;  4D5F A;  3QAH A;  5CPR B;  3O8G A;  2R5Z A;  5D8L B;  3OV8 A;  2CGP A;  3IV5 A;  2ZFU A;  3EUH C;  4AU7 A;  4KJZ A;  4CCM A;  2DJN A;  2NNY A;  3RZO J;  1IRZ A;  4HX7 A;  4CH7 A;  2MA3 A;  3HG9 A;  5BMZ A;  2KLO A;  1H8A C;  2P6S A;  2DQR A;  1TBX A;  1WZ2 A;  2XAF A;  3FXL A;  1IG7 A;  3CME I;  2AXT C;  4PFP A;  1B8I A;  4KMF A;  2VBY A;  4CUG A;  2P4W A;  3D5R C;  2DA1 A;  4DBQ A;  1OYW A;  3LFU A;  2HYJ A;  1SD4 A;  4XL9 A;  4N9I A;  2GXB A;  1QNT A;  3KIO A;  1HF0 A;  4JQF A;  3BZC A;  3PJR A;  5DCF A;  2KZV A;  4OOI A;  2QUF A;  5EDN A;  3MN2 A;  2FX0 A;  4EJU A;  1R6R A;  2ID6 A;  2JPC A;  5DM7 F;  2K40 A;  5D4R A;  1AWC A;  4CSW A;  2XF5 A;  1R36 A;  3MAJ A;  4HLY A;  2CV1 A;  1I6X A;  2DOD A;  1OYY A;  1FSE A;  3S16 J;  1NTC A;  4R8H A;  4XLF A;  2CUE A;  1MW7 A;  4Q47 A;  2ECB A;  2GOM A;  2NOJ B;  2NVY J;  1T0F C;  1QQI A;  2HZT A;  3MKZ A;  2M1B A;  3F9K A;  1YI2 I;  2O61 A;  1PVE A;  4ENM A;  3FMS A;  5KVR A;  3ZQF A;  5GAD J;  4A93 J;  2OF7 A;  3ULQ B;  4G7Z F;  4I98 B;  3L2W A;  3LSP A;  2O8K A;  1OR7 A;  1QZE A;  1QBJ A;  1VTN C;  4BQO A;  5F0H A;  4HQM A;  1ZRF A;  1JXS A;  2E7X A;  3LSI A;  2EFW A;  4NNJ A;  3FKJ A;  3IL2 A;  3G1M A;  2KP6 A;  1XCB A;  2G9W A;  2PMZ N;  1YS7 A;  1E0E A;  4C2U A;  4I76 A;  4NQW B;  2I8D A;  4QLC U;  1SAU A;  3E6D A;  4UUS A;  1Z0X A;  4O5V A;  2OV7 A;  5L3D A;  3J7A Y;  2K86 A;  3GTL J;  2CQ7 A;  1VND A;  1FC3 A;  2NS7 A;  2LF8 A;  4IJA A;  1FPQ A;  2BXY A;  2MD5 A;  1WJC A;  2XHK A;  3DPT A;  4PJJ A;  3TBI A;  1NHA A;  2FNP A;  1TZL A;  2KIF A;  2JWT A;  2F5C A;  3OSF A;  2IBD A;  4ZDO A;  2HDW A;  3H3Z A;  3G1L A;  5IOY A;  3CDI A;  3I55 I;  4M73 A;  3WOD F;  5K5R A;  3G71 I;  2HOS A;  1TTY A;  3FIS A;  1ZK8 A;  1KYZ A;  2G7U A;  2Z99 A;  5E17 F;  3H5R A;  4XSZ F;  1ZQ3 P;  2OQG A;  4S05 A;  3CES A;  2A07 F;  3BY6 A;  2V1U A;  3P9K A;  1ZG1 A;  1FJL A;  1VQ6 I;  3KYD B;  3BC8 A;  3DPU A;  4FT8 A;  3ZCO A;  3ZQH A;  2M0C A;  1KYW A;  2LH9 A;  4AM3 A;  1WJ5 A;  4ENK A;  1TWA J;  3RI4 A;  3CO7 C;  2IAI A;  4NC7 A;  3RZD J;  4L0Y B;  1S29 A;  2MC4 A;  4A3K J;  4RAG A;  4BXF A;  2F5D A;  2X4H A;  3E1S A;  4RMN A;  4E7Z A;  2CQN A;  2ECC A;  1J7K A;  2G7H A;  4A3L J;  1LEB A;  4ON0 A;  3I54 A;  1ETW A;  1V4R A;  1QZZ A;  3RYR A;  1DDN A;  1IGN A;  3DU5 A;  2EZH A;  1YOV B;  3M07 A;  4GYI A;  4ZDP A;  2MD0 A;  2WAQ N;  3L2V A;  1ZLJ A;  4ZJZ A;  2VON A;  1EH8 A;  1G3W A;  2JSC A;  3LOC A;  4XSX F;  2VC1 A;  1SMY F;  1MBF A;  4RLQ A;  3GZ6 A;  1JT6 A;  4JYK A;  1K61 A;  2VOD A;  4Y15 A;  5CVI A;  1G4D A;  4ZYD A;  1D3Y A;  3VYU B;  1Z1D A;  2K9N A;  3PFY A;  3ECO A;  4JBA A;  4EJV A;  5HOO A;  3QOP A;  1UCR A;  5F27 A;  4DOZ A;  3M8E A;  1RIO H;  2XF6 A;  4IHV A;  3CJQ B;  1YYV A;  1T08 B;  2DK8 A;  4A5N A;  1OCR H;  3L9F A;  3KP6 A;  2FUG 2;  2N8G A;  1J0R A;  4XLC A;  3MMY B;  1U9O A;  5KNL A;  1V54 H;  1A36 A;  4F52 A;  3T8R A;  4P9F A;  1VQN I;  4V2G A;  2H27 A;  2BE5 F;  2HZD A;  2YSR A;  5ILV A;  2FOK A;  3DBR B;  3I58 A;  5EGO A;  4IQ4 A;  3RSN A;  3RCO A;  5BNG A;  4UY8 I;  1K78 A;  4WXD A;  4IX7 A;  2R92 J;  3M8F A;  3S3M A;  5F1J A;  4KIG A;  1BI0 A;  2XV4 S;  3W6K B;  2F4I A;  3ASO H;  1R49 A;  5D5V B;  2QWW A;  4XN0 A;  2RN7 A;  1BW5 A;  3RPQ A;  4I0B A;  3SJM A;  3NWT A;  1XSD A;  1JT0 A;  1NK3 P;  2VBX A;  1TQP A;  3LNQ A;  3TO9 A;  4A0X A;  3TQN A;  1HOM A;  1BI3 A;  5B3S H;  2OCE A;  3DPL C;  2CUJ A;  2XPV A;  1Z21 A;  4HAM A;  3F3X A;  3MZY A;  5B66 C;  1KON A;  1MBJ A;  2ZO4 A;  1HDP A;  2NVQ J;  5D5U B;  2EJR A;  4DYC A;  1U2W A;  4BJ5 C;  2JRT A;  1ETO A;  3ROU A;  1AA7 A;  3T5X A;  5B1A H;  3DCF A;  5EEH A;  4EJT A;  2IXS A;  3GFJ A;  1YX5 A;  2CWE A;  1BBY A;  2XAS A;  3KP7 A;  3AAF A;  2IGN A;  3NAU A;  5GAG J;  1BJZ A;  2GWR A;  2GA2 A;  2K7L A;  1ITY A;  3DFG A;  2IS6 A;  1R4N B;  3PSF A;  1TC3 C;  3ZMZ A;  4MFE A;  2DN0 A;  5DV5 A;  5HNF A;  1U5T C;  3HIF A;  3ZQQ A;  5FB2 A;  2IJL A;  1K4T A;  3W2A A;  5IP7 J;  1RUN A;  3ZQC A;  3FXM A;  5DM6 F;  2E36 A;  4JX5 A;  1E17 A;  2HXI A;  2EK5 A;  3K4C A;  2F4O B;  3R61 A;  2KDO A;  3CDL A;  4YEJ A;  3UR3 C;  1LVA A;  4WWC A;  1G6N A;  4BEH B;  2OZ6 A;  5E18 F;  3FKI J;  2K5C A;  3E5U A;  4OIP F;  3K4K A;  5LHH A;  3BR5 A;  4BBS J;  1HST A;  1MMA A;  4C3I J;  3FF5 A;  3C7J A;  2DFI A;  4MQV A;  3OIQ A;  4XRS G;  2AXL A;  2VB6 A;  3GBG A;  1UZC A;  1TQI A;  5E8I A;  2XRO A;  5BQT A;  1Y1V J;  2VXD A;  1OCP A;  3DF8 A;  3DKX A;  4XRS A;  5K7F A;  4B09 A;  1W5S A;  3K2A A;  4KIB A;  3IUO A;  5LGT A;  1FWZ A;  3D0S A;  3ZQI A;  2LSO A;  4MHG A;  3KET A;  2R7Z J;  4LMY A;  3I59 A;  2QZ8 A;  3G2B A;  3H9J A;  3RKW A;  2W48 A;  5EEG A;  4AD9 A;  1GT0 C;  5FD6 A;  1OQY A;  4I0A A;  4OWR B;  1QHG A;  2W85 A;  4UV9 A;  5IT9 K;  1J2X A;  1XTA A;  1E2X A;  4MFD A;  3TDU C;  4BE1 A;  5IT3 A;  4DZJ A;  3E6B A;  1R1T A;  1P4A A;  3KPH A;  2DYR H;  2M3A A;  1ZEL A;  2H8W A;  3PUB A;  2CW8 A;  3ZGK A;  4DW6 A;  3C1D A;  2L9S A;  2ZC2 A;  3COA C;  2FBK A;  4OMY A;  1S8N A;  2LF7 A;  1SFE A;  3A0B C;  2XDV A;  2COM A;  4S04 A;  2DTR A;  1G2H A;  3WHB A;  4BNC A;  2YU3 A;  4O6J A;  1ZRC A;  2ZXJ A;  4LGW A;  1IN6 A;  2A5Y B;  2ME6 A;  4E6K G;  3I4M J;  1J9I A;  1MNM C;  2R7R A;  2L0K A;  4MTD A;  3LMM A;  1TLH B;  1F36 A;  3K9T A;  4ZZL A;  4IRH A;  4TV7 A;  2Q8K A;  1S7O A;  2EPF A;  1J75 A;  4CCN A;  5EYR A;  1FYK A;  1MJB A;  2NVU B;  1AU7 A;  1Z67 A;  4PDK A;  1MJA A;  1AKH B;  2F5E A;  1ZAR A;  2BVL A;  1D0X A;  2WY8 Q;  2XVC A;  1UB9 A;  4XLA A;  5FO5 A;  2FML A;  5HLH A;  4F7Z A;  5IYC J;  2DLL A;  2EV6 A;  3CQZ J;  3LL7 A;  4ESB A;  5DD8 A;  4BS9 A;  4N4O B;  4F3Q A;  2BZT A;  1IN4 A;  1G3Y A;  3V8L A;  1MJ9 A;  3C2B A;  1BR4 A;  3PIP F;  1S72 I;  2XSJ C;  4Q4Z F;  4QPQ A;  1GHC A;  5LD2 C;  1Y6I A;  1N77 A;  3GLX A;  2KHM A;  4G94 A;  4F93 B;  4KA4 A;  1YJ9 I;  2MYS A;  2W24 A;  1SD6 A;  3HOW J;  3A01 B;  4QWQ A;  2HDD A;  2WAD A;  1WI3 A;  3LST A;  3OYG A;  2EFO A;  4I02 A;  1TP4 A;  4A3M J;  2Y69 H;  4BXU A;  3H35 A;  4EM0 B;  3JTH A;  2IEK A;  3LSK A;  2HNH A;  2UV1 A;  2L7Z A;  3VEP A;  3ERE D;  2AQE A;  3LQR A;  2JVG A;  1J59 A;  1WFX A;  3HDD A;  2E2J J;  3GTO J;  5GPC A;  2MH9 A;  1X58 A;  1IXS B;  2HVR A;  3GX4 X;  4IHS A;  2QQB A;  1JE8 A;  5AIQ A;  3P9C A;  1BR1 A;  2I5U A;  1LUJ B;  4L5E A;  4EEF G;  2R93 J;  4ZYA A;  4R1H A;  1TW3 A;  2FRH A;  4MIM A;  2ELK A;  1YRN B;  3AFH A;  3VWB A;  4Z2Y A;  1GV5 A;  2STT A;  3AG3 H;  4L18 B;  2DK5 A;  3MVP A;  3QU6 A;  3CCE I;  2FQ3 A;  4HEA 2;  2AHQ A;  4RLF A;  5HNH A;  5D6E A;  1R22 A;  2JRM A;  3FXO A;  4BE2 A;  4AUX A;  2KRF A;  1NH3 A;  4JX6 A;  1O3Q A;  2M45 A;  3KEQ A;  2PEX A;  1SFU A;  2OZU A;  2RGV A;  2PFB A;  2WB1 A;  4UVA A;  1NG7 A;  1A31 A;  4I6Z A;  1LDD A;  3I56 I;  2JA7 J;  4LIV A;  4M6V A;  1HSJ A;  2FBI A;  2DMT A;  2KIS A;  2WWY A;  3OYH A;  5DD4 A;  3QOD A;  1CF7 A;  1ETQ A;  1D5V A;  3BR6 A;  3L00 A;  2CS3 A;  3IAS 2;  3CD6 I;  1GXQ A;  1H89 C;  2JA6 J;  1FTT A;  2MBF A;  2R7T A;  2XPU A;  2HWV A;  4CA0 A;  5FLV A;  4E7I A;  2JN6 A;  5D5W B;  3S3N A;  1DP7 P;  1S3J A;  4HA8 A;  1FTZ A;  2QKL B;  2O5R A;  5J1Y A;  1GUU A;  1O57 A;  5CQE A;  5HLI A;  4DQ2 A;  5IPA A;  1QA6 A;  2ISY A;  5JVG F;  4I09 A;  1NG6 A;  2LBF B;  2O8X A;  4ESJ A;  1IDZ A;  3PUF A;  1GDT A;  4A3G J;  2K02 A;  3IP4 B;  3K1N A;  3LWF A;  2DMU A;  2V1N A;  1YO5 C;  3CUQ A;  2ZJ2 A;  3VSL A;  1QRY A;  3H0G J;  1ETX A;  3PFI A;  3CC7 I;  3H5N A;  2WV1 A;  3I64 A;  2W57 A;  1YIT I;  2V9P A;  2Y30 A;  1IAW A;  1RET A;  2F5F A;  3VDX A;  2W25 A;  3CCS I;  2J5P A;  1P2F A;  1Y0N A;  4M9S A;  4P55 A;  1X3U A;  3M1E A;  1K79 A;  2Z2S B;  3HOV J;  1LPQ A;  1UG2 A;  3ZN0 A;  1A6Q A;  3ZMT A;  1N78 A;  1QHH D;  3OYE A;  1A5J A;  3HXL A;  2ZJR F;  3JRB A;  2R5Z B;  3I71 A;  4CZZ A;  1M1E B;  2BVM A;  2HVS A;  3JRH A;  4RGS A;  1YW7 A;  1UST A;  1X4O A;  4ZC3 A;  4NHJ A;  3CDH A;  2QKM B;  4U88 A;  3RQI A;  5DS9 A;  1LEA A;  1XDU A;  3ABK H;  3K6G A;  2LOO A;  3GZN B;  3JRD A;  3BWG A;  1ZH5 A;  1UJ8 A;  4A3B J;  3CO6 C;  4IKF A;  2EIK H;  1RR8 C;  2JA8 J;  2ZKZ A;  3TO6 A;  3CCM I;  4AC0 A;  3H9Q A;  1PUF B;  3NRV A;  3F8C A;  2WC2 A;  3FDY A;  2BOL A;  3BPV A;  3TW6 A;  1FSH A;  2E1N A;  2KIU A;  4QTR A;  4RB2 C;  2DT5 A;  5DCM B;  2EQR A;  1VQP I;  2HYF A;  1V55 H;  1KU9 A;  3OYJ A;  2FXA A;  3TGN A;  3L2U A;  2F4M B;  2XAU A;  2QQ9 A;  3F0C A;  3NEU A;  3JSO A;  1TNS A;  1XD7 A;  4HX4 A;  4B3A A;  1RPW A;  1XN7 A;  4E7S A;  1D8J A;  4XMY A;  2IRF G;  3LAJ A;  4WX9 A;  2PI0 A;  1Y8Q B;  4HNV A;  2DYS H;  2QM3 A;  5FLX Z;  3OYL A;  3G4S I;  2ELJ A;  5E79 C;  2Y9Z A;  3HYI A;  3PO3 J;  1X3Z B;  5HDN A;  3IRQ A;  1ZHF A;  2BBY A;  4BHC A;  1JI8 A;  2K9S A;  2BY3 A;  3OYF A;  5FRM A;  1F9N A;  1YRN A;  3OL4 A;  4IEJ A;  2I10 A;  1LE8 A;  1HW5 A;  4Y7N J;  1FP2 A;  4ETS A;  2KDZ A;  5JLW A;  2EZI A;  4A5M A;  1JHH A;  4ESF A;  2K85 A;  3JRC A;  2JK3 A;  1TWF J;  2KKO A;  3BPX A;  4BKX A;  4II2 A;  4PGG A;  2M7B A;  3E5Q A;  4UXN A;  1SFK A;  3OYD A;  4CGZ A;  5GAE J;  3AL0 B;  4HNU A;  5EZH A;  1Y0U A;  5L3C A;  4WK8 F;  4G7O F;  4XRF A;  4F92 B;  2EIL H;  3G6E I;  4WF2 A;  2V4J C;  3GFM A;  1W5T A;  2YX4 A;  4CCL A;  3OYM A;  2FE3 A;  5LGN A;  2R5Y B;  1T56 A;  2IPQ X;  4DGW B;  2L9V A;  1YJN I;  5FJ8 J;  2DTZ A;  2DXI A;  5F0F A;  1BOA A;  2LRD A;  1XCV A;  3VYS B;  4ZYE A;  3I4N J;  1ZR2 A;  5IP6 A;  3LFK A;  3ZQL A;  3F8F A;  1R58 A;  4FX0 A;  1T33 A;  2V9K A;  2RQQ A;  4CO8 A;  3JTG A;  1EKE A;  3BTL A;  3NQO A;  5AIP A;  2ZJP F;  3QU3 A;  3HJE A;  4LLN A;  1IZ1 A;  1P7J A;  3W6V A;  1PJR A;  3QQA A;  3KLN A;  2PX9 A;  1ORK A;  3V7R A;  5CVV A;  4I2O A;  1TW2 A;  1FMV A;  4MTE A;  1ONV A;  4X1E A;  1FOY A;  2JUG A;  1QPM A;  3CUQ B;  5HDG A;  4O3M A;  5J6X A;  1CQT A;  4KN4 X;  3O8H A;  4KYW A;  2YR2 A;  4IZZ A;  1ETK A;  2JSP A;  3N05 A;  3D5S C;  2L54 A;  3BZ6 A;  4ABZ A;  1IUY A;  5D8K B;  1HKS A;  2Q2E A;  4A6E A;  4XQF A;  1HKT A;  3MCZ A;  2W1O A;  1B72 B;  2BYV E;  2HDC A;  3RKX A;  2VJ5 A;  3S1R J;  3H3V K;  4M9Z A;  1I39 A;  2BV6 A;  3OMY A;  1SMT A;  3ESW B;  4XN3 A;  1MBE A;  4MGR A;  5GTH C;  4IRI A;  2UWM A;  2DCE A;  3L2C A;  2F48 A;  3CLO A;  2STW A;  5H6R A;  2NRA C;  1ETY A;  3HRT A;  2E2H J;  1MH4 A;  1S6L A;  4XLP F;  3PO2 J;  4HW0 A;  1WSU A;  2OC6 A;  2V6E A;  1HDD C;  1OIS A;  4MEY F;  4M9X A;  4LLL A;  2CSO A;  2VKD A;  3RYP A;  5LHI A;  3SZT A;  3IHU A;  2KMU A;  1FBU A;  4BY7 J;  2O3F A;  2XGX A;  5C3E J;  1FBQ A;  2H1K A;  1WJD A;  3FZV A;  3B73 A;  4HF2 A;  5M5X J;  4C9Y A;  4D9J A;  1WJF A;  3RKY A;  4B44 A;  2IT0 A;  1VF9 A;  2DU9 A;  1WJA A;  2A6H F;  2UZK A;  3GTQ J;  1O4X A;  1W4M A;  3D1N I;  3KP3 A;  2XGE A;  3HRM A;  5ED4 A;  1WCM J;  2GBY A;  4N4N B;  1TWH J;  1OKR A;  2Q2E B;  3WTZ A;  1VQ7 I;  4AVZ A;  1WVR A;  2A5W A;  3ABM H;  1YHQ I;  4ENJ A;  1FBS A;  2L01 A;  2L9R A;  2FMY A;  2VAS A;  2XGD A;  5F04 A;  2DOF A;  3K0L A;  2NOG A;  5E1Z B;  4BY1 J;  2EBI A;  2P0W A;  3KP2 A;  4RA2 A;  4AYB A;  2HYG D;  3QP6 A;  3IRR A;  2LK2 A;  4A0Z A;  3M4O J;  4B43 A;  1R5G A;  3OYI A;  1WKM A;  2LKP A;  2OPT A;  3GWZ A;  1BC8 C;  4QIW N;  2OJE D;  3FHN A;  2KZG A;  4X0G A;  2ETH A;  4HBL A;  2JT1 A;  2E1M B;  1D1C A;  2BY0 A;  3A03 A;  3BTC A;  4MLO A;  4EV0 A;  2DO7 A;  1SFX A;  3PNV A;  2M4K A;  4D7N A;  5BPI A;  3ZOB A;  2GIV A;  2VL8 A;  1FP1 D;  2VT2 A;  3CF2 A;  5FRN A;  3TKY A;  2VBW A;  2FD5 A;  3U2R A;  1S5L C;  5DUI A;  1O3R A;  2ZSH B;  1QVU A;  2NNN A;  2RNJ A;  2X1C A;  3IH2 A;  1CF7 B;  3WE3 A;  4BQA A;  1MMN A;  1U5T A;  2JJ7 A;  3HSR A;  3QPL A;  2ZME C;  1RRJ A;  3VOE A;  4D7M A;  4P5O A;  1V5E A;  2Y0S N;  3DTI A;  3WE2 A;  1D5Y A;  3O3K A;  2DFH A;  1H0M A;  3K4B A;  2GQQ A;  1YLF A;  3J81 Z;  5FD5 A;  5D6F A;  4OIQ F;  1BI1 A;  1YW9 A;  1BI2 A;  1IC8 A;  4L5I A;  4EAT A;  2M2E A;  2ZXH A;  1B59 A;  3PIO F;  1XGO A;  3HC7 A;  2BHZ A;  5L3B A;  4QSH A;  5E3O A;  1AOY A;  2DA2 A;  1X2N A;  2IVM A;  1R1U A;  1VQM I;  3KYL A;  3W2V A;  4LG0 B;  2RV8 A;  3MZH A;  3H9G A;  3P5J A;  1FZP B;  1LQ1 A;  3WG9 A;  3ABT A;  3CMY A;  5JHF A;  1SD5 A;  3K7A J;  2R7W A;  1U3E M;  4RGR A;  4YG2 F;  5ILS A;  2Y75 A;  3L2Q A;  4I99 C;  4GRI A;  2DMP A;  2OBP A;  1ZAO A;  3U1D A;  1N75 A;  2ZSI B;  3G3Z A;  2R4G A;  3S8P A;  4KDP A;  4G7H F;  3M1C A;  3I59 B;  1K78 B;  2GAU A;  4XIC A;  5E3L A;  4A2U A;  3M7G A;  2IS1 A;  1WHU A;  1RES A;  3K69 A;  4IO9 F;  2K3F A;  3BJO A;  1MMG A;  3BR2 A;  3U21 A;  3J7Y J;  5KK1 A;  3HKZ N;  5M5Y J;  2J5O A;  1MDM A;  3I5U A;  1R23 A;  1DUX C;  3BRO A;  1IO2 A;  3F6V A;  5C4J J;  1UMQ A;  2VKH A;  3Q5F A;  1XC5 A;  3DEE A;  5CQG A;  1X1P A;  1IN8 A;  3S2W A;  3CTA A;  3L1P A;  5KHD A;  1ZN2 A;  1TWC J;  4PGH A;  1EV7 A;  3VSK A;  5E20 A;  4FTH A;  2E5N A;  3SDG A;  1FOX A;  3ELK A;  1S7A A;  1CGP A;  2PJR B;  1TWG J;  3B6A A;  4RM2 A;  2ADU A;  4DIQ A;  2ZME A;  4A3J J;  2H6C A;  2E1M C;  4AID A;  4LB5 A;  3OYB A;  5J1R A;  1MNE A;  1Z3Y A;  5F1R A;  5JI6 A;  2BY1 A;  1ZKG A;  4V2F A;  3MKW B;  3FMQ A;  3WU0 A;  3RPU D;  3L7W A;  3C2G A;  4LIT A;  1KGS A;  3RPU A;  2DA5 A;  4BEH A;  1SVO A;  1ZGW A;  3OYN A;  1JJ6 C;  1HCR A;  2FSW A;  1HQC A;  5KCM A;  1LE8 B;  1E3P A;  5J3L A;  2MGQ A;  3DQV C;  3H5A A;  1XMX A;  4M3G A;  4YFN F;  1KQ0 A;  1FLI A;  4ZTF A;  4BE0 A;  3CUQ C;  3RDI A;  3GTG J;  3J7Z I;  4M3F A;  2HKX A;  3ONQ A;  1AHD P;  1FEX A;  1R5H A;  2HFH A;  2YX7 A;  2EFN A;  3QRF F;  1U8B A;  2HQR A;  2EV0 A;  1OLT A;  2VOP A;  5CJ9 A;  3HOY J;  4MO7 A;  4RAZ A;  2B0L A;  1DP3 A;  3CJR B;  4KIT B;  1IXR C;  2L02 A;  2E60 A;  5FLX K;  2WY7 Q;  3S2H J;  4D5C A;  2HKO A;  2L7F P;  5J40 A;  1RI7 A;  3OYA A;  3RQ4 A;  3MFK A;  2X9D A;  5J8C A;  1MSE C;  4HPQ A;  5GTI C;  2YPR A;  1G3T A;  5L3E A;  2P8T A;  3LQQ A;  2QVO A;  1A04 A;  3ZN1 A;  4DJA A;  4YII A;  1FMW A;  5EEA A;  3KX2 A;  4BJT A;  2DBB A;  5EZG A;  5FFX A;  5LGU A;  1S9H A;  3WGI A;  2P5V A;  1FOW A;  3FXU A;  3IKT A;  1PUF A;  4XKB A;  4A3E J;  2KJC A;  1ON2 A;  5FFZ A;  3HBL A;  2F2E A;  1YFH A;  4ZH4 F;  1L0O C;  3W3C A;  1Y39 A;  1QO0 D;  3HOZ J;  2WBM A;  5M3M J;  2KPM A;  2E34 A;  3KE2 A;  2QQ8 A;  4U7D A;  1MKM A;  4AYB N;  2WAF A;  5A2Q K;  2CRG A;  2OCC H;  4E7H A;  5F6F A;  2H6B A;  1IRX A;  1O7L A;  2M7A A;  3KYC B;  4Q48 A;  5K5Q A;  2QEX I;  1QPI A;  3E7L A;  3JSP A;  3HGG A;  3M3Y J;  4OU0 A;  1IF1 A;  1X3W B;  1Y8R B;  3IWF A;  2A68 F;  3MEX A;  4B8X A;  5ILU A;  3EYI A;  2CFO A;  2JQ7 A;  1REP C;  4BAY A;  2M8G X;  1O7F A;  2VPR A;  3I53 A;  3ZQ7 A;  3MWM A;  2DQL A;  1G59 A;  1W7P D;  2XKP A;  2VPL A;  3LAP A;  3WGH A;  1VFC A;  1HKQ A;  4CHU A;  2NYX A;  2DW4 A;  4AIK A;  3N4M A;  2DA4 A;  4KNY A;  1WRJ A;  1I1G A;  1EH6 A;  3EQL F;  2Q1Z B;  4RS8 A;  3H3U A;  1W36 D;  1IJW C;  2FOW A;  2HPI A;  2V1X A;  3K4N A;  2VQH A;  3E5X A;  3LA2 A;  1BIB A;  2EZL A;  5FKK A;  1D0Y A;  1DU0 A;  1W5C C;  4BXX J;  2UXX A;  4CZC A;  2ELH A;  1K83 J;  4M3D A;  1D1B A;  4KIF A;  3V7S A;  5J4V A;  2PG4 A;  3SDB A;  4OAZ A;  3CCQ I;  9ANT A;  2X6X A;  1Q1V A;  3F8B A;  4FHT A;  2DOE A;  2X1D A;  4U0W A;  2R5Y A;  4UB8 C;  2D5V A;  1V3F A;  5K7Z A;  4UVC A;  3T8T A;  3BOQ A;  1LKX A;  1WI9 A;  2QCO A;  3MD2 A;  4PSW A;  4Y17 A;  5DCM A;  1OMI A;  1EF4 A;  2H09 A;  2IA1 A;  2R3S A;  4WCG A;  6PAX A;  1PDN C;  2MFZ A;  4R79 A;  2X48 A;  3ZMS A;  1F4K A;  5IT9 Z;  1OCC H;  1UHS A;  5HLT A;  2NS0 A;  3CP8 A;  4M6Y A;  2JPB A;  3E6M A;  4II3 A;  5CVJ A;  3R6S A;  3S15 J;  3KFW X;  4H0E A;  2PN6 A;  3JAM K;  3Q9S A;  4CIC A;  1EJ9 A;  3JAM Z;  1LJ9 A;  2VN2 A;  3WTY C;  2DT6 A;  4BUP A;  3GZ5 A;  2E71 A;  1G3S A;  3DKW A;  5AON A;  1VQL I;  2LKS A;  4AIH A;  3S93 A;  3JRI A;  1D0Z A;  2VUM J;  3EPZ A;  1T95 A;  1XMK A;  5LEK A;  1MBG A;  1JUP A;  3GVA A;  4I01 A;  2O7O A;  3HUG B;  3GTJ J;  2DPU A;  4C30 A;  1APL C;  3LSG A;  3OS0 A;  2LR8 A;  1QU3 A;  5TIS C;  3V4G A;  4P1W A;  1Z9C A;  3R60 A;  2B7E A;  4XID A;  2PMH A;  4IQJ A;  3QPS A;  2HEO A;  3DWL E;  3IAM 2;  4G8X A;  1LFU P;  3F23 A;  2OD5 A;  3QYB A;  3CUO A;  4XKV A;  3BQZ A;  2QYO A;  5GPA A;  3AL0 C;  3VFZ A;  5DEQ A;  3FM3 A;  3WHC A;  3WTX C;  1B9N A;  1FYM A;  2X51 A;  2HQ5 A;  2LDU A;  5JHU A;  3A4C A;  5IP9 J;  1XB4 A;  4XNF A;  3C2H A;  2BEO A;  3OY9 A;  3QOE A;  4B4C A;  2ESN A;  3DXJ F;  3GFI A;  1L3L A;  1BIA A;  1X2M A;  1UFM A;  2EWN A;  5L3F A;  1ZRD A;  2MLK A;  3TW7 A;  5F64 A;  1HW1 A;  1QGP A;  2CMP A;  2R7Q A;  1ZLK A;  2E5Z A;  2E19 A;  1OCO H;  4CCO A;  1FIA A;  4ANJ A;  5M3F J;  1Y56 A;  4W1U A;  4Y33 A;  2ME0 A;  1R1V A;  2E2I J;  3J80 K;  3SZG A;  4LOC A;  3J80 Z;  2R7S A;  3K4L A;  4NC8 A;  2EA2 A;  1E3O C;  2AQF A;  5C44 J;  5BS6 A;  2HI3 A;  3JW4 A;  1EH7 A;  2VE9 A;  2KL4 A;  1PUE E;  3HKZ A;  2QLZ A;  1HC8 A;  1I5Z A;  1FX7 A;  3K70 D;  3CMM A;  3H1C A;  4BHP A;  2L5Q A;  2DDB A;  3QYF A;  4B48 A;  1ZG5 A;  1XPX A;  3OS1 A;  3R0A A;  3JRG A;  2FA5 A;  2XSD C;  1H9G A;  2LC2 A;  4UNO A;  4EM1 A;  5D5X B;  1YJW I;  4A3I J;  4IHY A;  2VOO A;  1JJ8 C;  2XIG A;  4RB1 A;  3LSR A;  2L3D A;  3IC7 A;  3M9A A;  5K7H A;  3VPR A;  2GA1 A;  5FKM A;  1PP7 U;  3AG2 H;  2GM4 A;  1XX5 A;  4L9V A;  3REO A;  2MG4 A;  3JRA A;  5KAF C;  3WU1 B;  2Z33 A;  3BT9 A;  5HS8 A;  4HYE A;  3S14 J;  4XOP A;  2ZXI A;  4D0P A;  3EYY A;  3ZMD A;  1IRG A;  2LP0 A;  3F72 A;  2X6Y A;  1NK2 P;  3OWT A;  3HPG A;  4ZDL A;  1N25 A;  2IW5 A;  4HRI A;  4HZF A;  5LLQ A;  3FXK A;  2COB A;  4IRG A;  4RDU A;  2DI3 A;  4C3J J;  2OTL I;  3GF2 A;  2CQX A;  3LA7 A;  1RNL A;  2HQA A;  5ICG A;  1SAX A;  1KA8 A;  4E7K A;  3G1O A;  4EQQ A;  3BR3 A;  3P9I A;  1Z77 A;  2CYY A;  2FQ4 A;  3B02 A;  4DBR A;  2M9H A;  1YS6 A;  1GVD A;  3F8N A;  3WTS C;  1OFC X;  4OAY A;  3GXO A;  1U5T B;  2M0M A;  4HSR A;  2A69 F;  1FNN A;  1T38 A;  2R7V A;  1X4P A;  3E97 A;  2XF7 A;  1MIJ A;  1JGG A;  3ISP A;  4OIO F;  2XB0 X;  3FXJ A;  4GCV A;  5LHG A;  2VT3 A;  5HS7 A;  1YX3 A;  2HQN A;  3HZJ A;  1FIP A;  4PFO A;  4JK1 X;  3G73 A;  2HTS A;  2ZBK A;  2LYC A;  2IA2 A;  1V5G A;  3KEY A;  4MNU A;  3S1N J;  3OOU A;  3CLQ A;  1POG A;  2GXG A;  2K27 A;  3KZI C;  5F08 A;  1F5T A;  2CO5 A;  3OIO A;  1ZGJ A;  4AVP A;  1DGR M;  2WB1 N;  4XON A;  1K4S A;  3CZ6 A;  2DMQ A;  5B5E C;  1Z6T A;  2P5K A;  2LRE A;  3CCY A;  1FOK A;  3HB9 A;  2VC0 A;  2CFX A;  3RJP A;  2CG4 A;  2LBF A;  2CU7 A;  3DU6 A;  3TL4 X;  4HNT A;  1MZB A;  5D4S A;  4FET A;  4AIJ A;  3CJN A;  1B9M A;  1P4W A;  4Z6Y A;  2CH0 A;  3K4J A;  1K6Y A;  4PJN A;  2K4B A;  3ASN H;  1JKP C;  1Z3X A;  3HPH A;  4HST A;  4CCK A;  3EET A;  5GAH J;  1GV2 A;  3OR2 C;  1FYL A;  1YQA A;  4K2E A;  1Z6R A;  2XRN A;  5CVR A;  5E8G A;  1I27 A;  4C3H J;  3CF5 F;  4MEX F;  2XAJ A;  2RQP A;  2RKH A;  4M6X A;  3KCC A;  2GOX B;  1UHW A;  3W2W A;  4LK0 F;  1ZGA A;  4EJW A;  2Y9Y A;  5DYM A;  3ABL H;  1JHF A;  2EIJ H;  3A2K A;  2W82 A;  2RVC A;  4PUS A;  1ZRE A;  3AKZ A;  2VJI A;  2UUZ A;  3NWS A;  1ON1 A;  1HXD A;  2FF4 A;  3K2Z A;  2VKE A;  3A02 A;  1VQK I;  1TT0 A;  4G6T B;  4NUB A;  4U0Y A;  5E1W A;  4BHB A;  1IUF A;  1Z7U A;  3F6O A;  2VIX A;  5FKL A;  4AWX B;  1R4M B;  3PNY A;  4IL6 C;  2VJJ A;  3QP5 A;  3HSF A;  5LRR A;  3FIW A;  4XLN F;  1IN5 A;  3PSI A;  3ZXS A;  2OQR A;  4HLX A;  3DLA A;  2EA4 A;  3OR1 C;  1I1S A;  4RBO A;  1STZ A;  2A6T A;  4ASN A;  4UB6 C;  4BAC A;  1O3S A;  1LDK B;  1JKR C;  1IV6 A;  4LJZ F;  3BTI A;  4YIR X;  2HXO A;  1P9Q C;  3LA3 A;  2EZK A;  2XAG A;  4A12 A;  3EDP A;  1W7P B;  1OR7 C;  5A2Q Z;  3HOS A;  3BJA A;  3H92 A;  4LB6 B;  5FGM A;  3CCJ I;  1YTY A;  3ZMV A;  1XGS A;  4BH9 A;  4UUT A;  3HOX J;  2MLG A;  3ZP5 A;  3QWL A;  4OIR F;  2EIM H;  1DQU A;  2KRC A;  4HDU A;  3CMA I;  5ICE A;  3BCB A;  4N0B A;  1SC7 A;  3AG4 H;  2E1C A;  4XRM A;  1IN7 A;  4A69 C;  1T6S A;  1Z7L A;  3JRF A;  2O6G E;  5HS9 A;  1BC7 C;  4EVI A;  2L4A A;  4RM3 A;  4IOC F;  3P7N A;  2EV5 A;  1K7A A;  1SVM A;  3SEZ A;  2QGU A;  4BDY A;  4HQE A;  3BG3 A;  3HRS A;  1WJB A;  1IXC A;  3ABU A;  5E3M A;  4XK4 A;  3I4P A;  2L4M A;  1VI0 A;  2L9N A;  4IF4 A;  4DYQ A;  2DOA A;  4GO1 A;  5JFR A;  1P4X A;  3BR1 A;  3SZP A;  4UUV A;  4XLE A;  1Z91 A;  1W36 C;  3KZY A;  3L2R A;  3ZPL A;  4C2T A;  1HW2 A;  2LD5 A;  1DU6 A;  1WH7 A;  3FX3 A;  4ZYH A;  1OJL A;  2FNA A;  3BJ6 A;  1KQ8 A;  3D5L A;  3HUG A;  3Q0W A;  2X1E A;  1T2K A;  1YG2 A;  5J47 A;  1D1A A;  1BJA A;  4ITV A;  4B1R A;  2WA0 A;  1R00 A;  2LFB A;  2KIM A;  3TP3 A;  4J01 A;  1RR7 A;  3PM1 A;  1PYV A;  2BW3 B;  2CQK A;  3K1P A;  4ZZD A;  1JGS A;  3LSH A;  2G0E A;  4EGZ A;  1U6G A;  1TQM A;  3WU2 C;  1MMD A;  2HOT A;  3ZR8 X;  3MKL A;  2PJP A;  2LLK A;  4WXC A;  4JX4 A;  4U0V A;  1VQ8 I;  4FE4 A;  1FY7 A;  4C2M J;  1MGT A;  1ENH A;  1RZ4 A;  4EMS A;  4CXF A;  1VQ9 I;  2RRE A;  3DBH B;  3MKY B;  1ODD A;  3I9V 2;  5LEJ A;  3HGY A;  4B47 A;  5HLG A;  4CCJ A;  3A1Y A;  5JLX A;  4RB0 A;  2ESH A;  5E1X A;  4JP0 A;  4LG3 A;  2L7K A;  5EG0 A;  1VZ0 A;  4CYD A;  3BZK A;  3BP8 A;  1OCZ H;  2VQC A;  3Q0U A;  3FBI B;  2Z16 A;  5HOD A;  2RC4 A;  3SXY A;  4CYC A;  2OU2 A;  1BA5 A;  1BOB A;  1R71 A;  2ID3 A;  2P7C B;  1KQ9 A;  1F43 A;  4IVN A;  3BDD A;  1UHM A;  1XS9 A;  1C0W A;  3IH3 A;  3V8J A;  1B72 A;  4BYY A;  3Q0V A;  3SYT A;  2VJ4 A;  2K9M A;  3S32 A;  3GTK J;  1YIO A;  3V7C A;  5TRD A;  5LRS A;  4BU2 A;  1GVJ A;  1X19 A;  2P7V B;  4OMZ A;  4NDL A;  1RC9 A;  2DA6 A;  4GXO A;  1DPR A;  2FBH A;  3KP4 A;  3I3L A;  1XDS A;  2D1H A;  1JTX A;  4I7H A;  2QQA A;  1DPU A;  2L7M P;  4IPA A;  2YU9 J;  1TNT A;  2RDP A;  5B1B H;  1VQ4 I;  5H2F C;  1X1A A;  5EF6 A;  2TCT A;  2OAZ A; 
#chains in the Genus database with same CATH homology
 4A3B J;  1Y1W J;  1SFO J;  1VFC A;  2JA8 J;  2DMN A;  2B63 J;  5F0H A;  4AC0 A;  4W97 A;  1PUF B;  2DA4 A;  1WGX A;  2O9L A;  3LSJ A;  3TW6 A;  3G1M A;  4FIS A;  2PMZ N;  1IJW C;  2P81 A;  4QTR A;  2MW8 A;  1WH5 A;  4I76 A;  2EZL A;  2EQR A;  5FKK A;  1DU0 A;  3S1M J;  2NVT J;  4UUS A;  4BXX J;  1Z0X A;  5J1U A;  1K83 J;  4M3D A;  3GTM J;  4BBR J;  1OCT C;  3GTL J;  9ANT A;  1VND A;  3F0C A;  3OSG A;  2NS7 A;  1JKO C;  1MBK A;  2EH3 A;  1Q1V A;  2YUS A;  2R5Y A;  2D5V A;  4B3A A;  5K7Z A;  1RPW A;  2TRT A;  4FE7 A;  1MH3 A;  2QCO A;  1EF4 A;  2JWT A;  3OSF A;  1I3Q J;  2IBD A;  2X48 A;  3G1L A;  1JKQ C;  1I50 J;  2Y2Z A;  5IOY A;  1UHS A;  4HNV A;  2Y9Z A;  2HOS A;  3PO3 J;  3TP0 A;  4S0H B;  3FIS A;  4DYR A;  3S15 J;  1ZK8 A;  2K9S A;  2XPW A;  4M3B A;  1ZQ3 P;  1YRN A;  1AKH A;  4IEJ A;  2I10 A;  1LE8 A;  2DA3 A;  4Y7N J;  2KDZ A;  5JLW A;  2EZI A;  3Q3S A;  3JRI A;  2NVX J;  1FJL A;  3JRC A;  2VUM J;  2JK3 A;  1TWF J;  3ZQH A;  1LFB A;  1SAN A;  2M0C A;  1R9T J;  1MBG A;  4BKX A;  1JUP A;  5FKO A;  2O7O A;  3BQY A;  1P7I A;  3GTJ J;  3JR9 A;  1APL C;  3LSG A;  1TWA J;  3FK6 A;  1U9N A;  4GFB A;  5EZH A;  2LR8 A;  5FKN A;  1I6H J;  2IAI A;  3DEW A;  3RZD J;  4XID A;  4A3K J;  3QPS A;  2R5Y B;  1T56 A;  5FJ8 J;  2ECC A;  1LFU P;  2DTZ A;  4A3L J;  1ETW A;  5F0F A;  1IGN A;  2EZH A;  3BQZ A;  5GPA A;  3I4N J;  5GP9 A;  1ZR2 A;  2LKX A;  2KT0 A;  2QF7 A;  5IP6 A;  1S7E A;  3ZQL A;  3IH4 A;  2MSY A;  2WAQ N;  3WHC A;  2GLO A;  1T33 A;  1RKT A;  3BTL A;  3LOC A;  2HQ5 A;  3UKG A;  1MBF A;  5IP9 J;  1P7J A;  3W6V A;  1JT6 A;  4JYK A;  3QQA A;  1K61 A;  3HEF A;  4B4C A;  5DTD A;  2LY9 A;  2K9N A;  1ORK A;  1X2M A;  5F27 A;  3TW7 A;  1RKW A;  4IHV A;  4X1E A;  5EG0 B;  2XGC A;  1CQT A;  2E19 A;  3O8H A;  1ETK A;  1FIA A;  4ABZ A;  5M3F J;  4W1U A;  1W0U A;  2N8G A;  2ME0 A;  2E2I J;  3TED A;  1U9O A;  4LOC A;  4V2G A;  1B72 B;  1JTY A;  1E3O C;  5C44 J;  2HI3 A;  3S1R J;  3H3V K;  1JUM A;  2YS9 A;  1IDY A;  1MBE A;  5EGO A;  5BNG A;  1ETY A;  2E2H J;  1MH4 A;  4IHX A;  2R92 J;  3PO2 J;  5F1J A;  2ZB9 A;  1HDD C;  3JRG A;  3S17 J;  2H8R A;  1BW5 A;  2XSD C;  2JA5 J;  3HOU J;  3SJM A;  1JT0 A;  1NK3 P;  4A3I J;  4IHY A;  4BY7 J;  3LNQ A;  1JJ8 C;  1HOM A;  3LSR A;  5C3E J;  2XPV A;  2H1K A;  5M5X J;  5K7H A;  3VPR A;  1MBJ A;  5FKM A;  1HDP A;  2NVQ J;  2Y31 A;  1WPK A;  2GM4 A;  5IYD J;  3A01 A;  4DYC A;  1VF9 A;  1ETO A;  2MG4 A;  3DCF A;  3GTQ J;  3JRA A;  1O4X A;  3BT9 A;  2X6O A;  3D1N I;  3S14 J;  2XGE A;  3JRE A;  1WCM J;  2GBY A;  3NAU A;  1TWH J;  3BG5 A;  5IYB J;  1U78 A;  1BJZ A;  2LP0 A;  1ITY A;  2L9R A;  1TC3 C;  1NK2 P;  4MFE A;  2DN0 A;  3ZQG A;  1MBH A;  2XGD A;  5F04 A;  2NOG A;  4BY1 J;  5IP7 J;  2EBI A;  2COB A;  4RDU A;  3ZQC A;  4C3J J;  2XRL A;  4JX5 A;  2HXI A;  3SFI A;  2CQX A;  1MSF C;  2LK2 A;  3M4O J;  2CJJ A;  3CDL A;  4CYC B;  4A3C J;  2OPT A;  1JUS A;  4QIW N;  3FKI J;  3G1O A;  3BR3 A;  1Z77 A;  4A3D J;  2FQ4 A;  3BR5 A;  2M9H A;  4C3I J;  5IOZ A;  3A03 A;  3BTC A;  1GVD A;  2M34 A;  4DZP A;  4MLO A;  1OFC X;  4D7N A;  3ZOB A;  2DA7 A;  1JGG A;  2JMW A;  4XRS G;  3GBG A;  2XB0 X;  1Y1V J;  1OCP A;  2FD5 A;  4G12 A;  4XRS A;  1FIP A;  5K7F A;  2R0Q C;  1QVU A;  3IH2 A;  3K2A A;  2CQQ A;  2JJ7 A;  3S1N J;  3OOU A;  3QPL A;  3ZQI A;  2R7Z J;  1POG A;  3GTP J;  5F08 A;  4D7M A;  3OIO A;  2WB1 N;  2W48 A;  4UUS B;  1GT0 C;  2Y0S N;  1D5Y A;  3RKQ A;  2DMQ A;  1B8I B;  3S2D J;  3CCY A;  4MFD A;  3HB9 A;  1ZTR A;  2CU7 A;  4DZJ A;  1IC8 A;  2HOA A;  1A6I A;  4A3F J;  2M2E A;  4DW6 A;  4QSH A;  5E3O A;  2CUF A;  2DA2 A;  1X2N A;  1JKP C;  1GV2 A;  1G2H A;  2K9Q A;  3WHB A;  4C3H J;  1W0T A;  1BW6 A;  3CMY A;  4M3E A;  3BTJ A;  2ME6 A;  3K7A J;  3I4M J;  1MNM C;  2L0K A;  2Y9Y A;  1F36 A;  3BG9 A;  2DMP A;  3B6C A;  2VKV A;  1BL0 A;  5EYR A;  1AKH B;  1AU7 A;  5FLM J;  4XIC A;  4J19 A;  5E3L A;  2VKE A;  3A02 A;  1RES A;  2RAE A;  1IUF A;  5IYC J;  5FKL A;  2LTP A;  3BR2 A;  3CQZ J;  4Y52 J;  3HKZ N;  5M5Y J;  4IHW A;  3FIW A;  1H88 C;  3C2B A;  5E3N A;  4RBO A;  1JKR C;  1IV6 A;  3BTI A;  5C4J J;  2HXO A;  1UMQ A;  2EZK A;  1XC5 A;  3L1P A;  5M5W J;  3HOW J;  3A01 B;  2LVS A;  1TWC J;  3BR0 A;  2HDD A;  2AO9 A;  1QVT A;  1WI3 A;  4FTH A;  3SDG A;  4A3M J;  1HLV A;  1TWG J;  3B6A A;  4UUT A;  3HOX J;  4A3J J;  2IEK A;  2L7Z A;  2FJ1 A;  3HM5 A;  3NAR A;  4XRM A;  5J1R A;  3HDD A;  2E2J J;  1ETV A;  4A69 C;  3GTO J;  3JRF A;  2XB5 A;  1ZKG A;  3FK7 A;  5GPC A;  4V2F A;  1X58 A;  1XG1 A;  5C4X J;  2DA5 A;  4X6A J;  4L5E A;  4EEF G;  2R93 J;  4MIM A;  2ELK A;  3BG3 A;  1ZGW A;  3S1Q J;  2NS8 A;  1JJ6 C;  1HCR A;  4FCY A;  1YRN B;  1LE8 B;  5E3M A;  1GV5 A;  4XK4 A;  4BBS J;  1VI0 A;  4DYQ A;  5J3L A;  2MGQ A;  3BR1 A;  3MVP A;  4M3G A;  2E1O A;  3GTG J;  2LD5 A;  2AHQ A;  1DU6 A;  1WH7 A;  5EGO B;  2VI6 A;  4M3F A;  1OJL A;  1ZR4 A;  4AUX A;  1AHD P;  1FEX A;  4JX6 A;  3Q0W A;  5F0C A;  1U8B A;  2JA7 J;  4I6Z A;  3HOY J;  4M6V A;  4MO7 A;  2DMT A;  4B1R A;  4D5F A;  3O8G A;  2LFB A;  2R5Z A;  3TP3 A;  1RR7 A;  3IV5 A;  3PM1 A;  1ETQ A;  3BR6 A;  2DJN A;  1H89 C;  3RZO J;  1IRZ A;  2JA6 J;  1FTT A;  2XPU A;  3S2H J;  4D5C A;  1H8A C;  2L7F P;  5FLV A;  2G0E A;  2JN6 A;  2HOT A;  3MKL A;  2LLK A;  1FTZ A;  2X9D A;  1MSE C;  4JX4 A;  1GUU A;  5J1Y A;  1IG7 A;  1B8I A;  4FE4 A;  4C2M J;  5IPA A;  1ENH A;  5EEA A;  2DA1 A;  5EZG A;  2HYJ A;  1IDZ A;  1GDT A;  3HGY A;  1PUF A;  4A3G J;  4A3E J;  5JLX A;  1HF0 A;  4JP0 A;  2DMU A;  5EG0 A;  1QRY A;  3H0G J;  3HBL A;  5EDN A;  3MN2 A;  1ETX A;  3Q0U A;  2FX0 A;  1BA5 A;  5HOD A;  4CYC A;  2ID6 A;  2WV1 A;  3HOZ J;  5M3M J;  2K40 A;  2Y30 A;  2ID3 A;  1F43 A;  1RET A;  1XS9 A;  3IH3 A;  3S16 J;  4AYB N;  1NTC A;  2CRG A;  2CUE A;  1B72 A;  2ECB A;  3Q0V A;  3HOV J;  2NVY J;  1UG2 A;  3GTK J;  1A5J A;  1QPI A;  2R5Z B;  3JRB A;  4NDL A;  3E7L A;  3HGG A;  2DA6 A;  3M3Y J;  3JRH A;  1JTX A;  3ZQF A;  2L7M P;  2YU9 J;  3RQI A;  4A93 J;  2OF7 A;  2M8G X;  5DS9 A;  2VPR A;  3LSP A;  5EF6 A;  2O8K A;  2TCT A;  3JRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...