1ZUD1

Structure of this-thif protein complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
245
structure length
234
Chain Sequence
b'MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyltransferase thiF
molecule tags Transferase/biosynthetic protein
source organism Escherichia coli
publication title Structure of the Escherichia coli ThiS-ThiF Complex, a Key Component of the Sulfur Transfer System in Thiamin Biosynthesis.
pubmed doi rcsb
total genus 75
structure length 234
sequence length 245
chains with identical sequence 3
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zud100
4L75A 1C1DA 4Y67A 5T6BA 1WMAA 4GI2A 4D3FA 1T1RA 4HKTA 4Q3NA 4IJKA 4OSPA 5F3RA 4P4LA 4WGGA 3RFVA 2HK8A 1NVTA 3GFGA 3QVXA 4Q39A 1LJ8A 4D41A 3OQ6A 4K1LA 3OBBA 3V2UA 1PL8A 2VWHA 3BMNA 3HDJA 3PHJA 3KYDB 1VJ0A 4KQWA 1UZMA 1P0CA 3TNLA 4FFNA 3QVWA 4W82A 3I9LA 1P1JA 2PR2A 3WGZA 2JL1A 4J9UE 3VPXA 5CFZA 5L40A 3U49A 5DCUA 3WWYA 4JLWA 3C24A 3KSUA 5B4VA 4OXYA 1IPEA 1HEUA 2VZ0A 2UV8A 3H5RA 1LLCA 4ITUA 5CEJA 4P4GA 1XQ6A 4RDIA 1JW9B 3B1FA 5EQDA 1GTMA 2AQIA 3JQCA 1B26A 3MJ4A 2RBEA 4TQGA 3ST7A 3MOGA 5TLSA 3C85A 1S7CA 3ONEA 1U3VA 1Y9AA 3FR8A 2X9VA 5IFLA 4IGEA 3DHEA 2G1UA 4E3ZA 1DAOA 3GG9A 1EE2A 9LDTA 3DTYA 1Q1NA 1RM5A 3DHYA 1K89A 3PXXA 3TL2A 4TVBA 2JHFA 4OOEA 3DBRA 5JNLA 4BMNA 3O9ZA 4PLVA 3WGQA 2CDAA 4JBHA 3AJRA 5HS4A 3Q1LA 3H2SA 3EMKA 2A92A 1Y8RA 1ZEMA 1PGJA 1SMKA 2NU9A 4CM9D 2C20A 5G4KB 1HYHA 2PKQP 1V35A 3QA9A 1N2SA 4QFDA 2FSVA 3DEYX 3G0OA 4YJHA 4ZD6A 4GMFA 1E1KA 2C54A 5BQFA 4RL6A 4PZEA 1P1RA 3F1KA 1WNTA 2ZTLA 1PJCA 2GF2A 4PZCA 5BSFA 4RO0A 1DAPA 1Z7BA 1DIAA 4U0KA 2VYVA 4OGWA 4YAKA 3HG7A 4M49A 3ANLA 5KTKA 4NBTA 1A4IA 1PS9A 1GV0A 1ZXBA 2OXIA 3BXXA 3DAFA 3FPCA 3RWBA 4EGFA 1CQJA 2JCXA 2EEZA 1ENPA 1OBFO 4EITA 4NJOA 3KEOA 1UP4A 4WEQA 2HU2A 3VH4A 4B7UA 3B1JA 5DNAA 1ONOA 5JS6A 4YRBA 5L7TA 2AQ8A 1PZFA 1EDZA 3EVNA 1NASA 4YR9A 4BO2A 1U28A 5IXSA 1UXHA 1RWBA 2B83A 1X7GA 2V6MA 3M6IA 3O38A 5IG2A 3F46A 2Q45A 1U8XX 1UR5A 3QSGA 2VRBA 3NV9A 1R6DA 3B6ZA 5I9MA 4BO3A 1DEHA 1B3BA 1O8CA 4BNIA 1WZIA 2GERA 3ZZNA 3AU9A 4JX8A 4G2NA 4RVUA 5AVOA 3JTMA 1NFFA 1U4SA 4CMGA 1MFZA 2DM6A 3S1LA 1KC1A 4PLPA 3PDJA 2VT3A 4FDAA 5MDHA 3BMCA 3TN7A 3FBGA 5DN9A 2BGMA 1E3EA 1XEAA 2Z1NA 2P9GA 4IDDA 3DFUA 3AUTA 3JQ7B 4WASA 3BIOA 4EI2A 3OECA 2VRCD 3WGHA 3INTA 4R16A 4B7CA 3TRIA 3ULKA 2RCYA 1XKQA 4RLSA 1ZSNA 3BMOA 4HADA 1ONNA 3GNTA 4ALJA 2HLPA 3H7AA 3PGXA 4I5DA 5JAZA 2OHXA 4FOSA 5KJ1A 1F14A 4CMHA 1EZ4A 5CG1A 2JAHA 4J9VA 4R9SA 3ITKA 1BXZA 4CLHA 4FB5A 4PRLA 2QYTA 2DVMA 1GCOA 5IXYA 1XU9A 3GK3A 4CV2A 1NAIA 2A4KA 5TX7A 4CQMA 3MEQA 3K92A 1P45A 1PZGA 3FSRA 4UEOA 1BG6A 3U4DA 3DOOA 4L0QA 2B4RO 4XQCA 1AN9A 4BGUA 1M6WA 3Q3CA 2FPGA 4XYEA 3IAHA 2Y1EA 3L6OO 2NTVA 1UAGA 4MVJD 4NU6A 1UZLA 1FF9A 4S3MA 5GZ1A 3FBTA 1E7RA 4YXFA 1R12A 3UICA 3MJCA 1I0ZA 1PGPA 3R6DA 2NVUB 5L45A 3PQFA 2DUWA 3NTOA 1B8VA 3TZCA 4LSMA 4BNHA 3HDYA 2ZYDA 3H3FA 1I10A 2I5PO 2R6JA 4BNYA 1NPDA 1C1XB 1HF3A 3RFTA 2GDZA 2P5YA 1E3WB 3ON5A 5I9NA 2BMAA 3I5MA 2GSDA 3FNFA 2FR0A 2V6GA 3ZI0A 5LDHA 1SO8A 3ZV6A 2YJZA 3H3JA 3RQSA 3VC7A 2EKLA 5BSHA 1GV1A 1DPGA 3OIDA 2EW2A 2BKAA 2GZ3A 1DBVO 4YAJA 1SPXA 3GMSA 4MVJF 1VPDA 1F12A 1A7KA 3HJAA 4BV9A 3GR6A 2YUTA 3QLJA 4N5LA 1GYRA 4ROSA 1PJ4A 1K0UA 1ZJZA 4H15A 4MIOA 4DYDA 3GGOA 4FC7A 1QV7A 4TVOA 1GADO 1YB1A 3DZIA 3NT4A 5IDYA 3S55A 2UUPA 3JQAB 2QHXA 2EG9A 4IQ0A 1PS8A 4OIMA 5GY7A 4MVJE 4J4BA 1KS9A 4ND4A 4IZIA 1E7SA 1CDOA 5A3JA 3VPGA 1VL6A 3WSVA 4IUYA 1EQUA 3LQFA 2PD4A 4E12A 4CM9A 1MP0A 1UXGA 5CEFA 3BMQB 1NPYA 4YA6A 4AG3A 4QUKA 2RH4A 1YS4A 1EK5A 3T4XA 1ZMTA 2Q2WA 2YYYA 2RHCA 2WDZA 3NDJA 2Y0EA 4QEDA 4BO4A 3LC1O 3I1JA 4DQXA 1RM4A 3SJ7A 3MZ0A 4CLOA 2X0IA 3ZHXA 5CDTA 1UP7A 4BOYA 4JJGA 5A9SB 4L73A 4KWHA 1XIVA 1SEVA 1SB9A 3P19A 4FFRA 4MVJA 4E4YA 2PGJA 4IINA 2EV9A 5TRTA 1GFSA 1Q2XA 3AUSA 4IJVA 1AXGA 1R0LA 2P4HX 3DBRB 3NT5A 4J0EA 3MWDB 4E2YA 4Z6KA 3ROMA 4FCCA 3CH6A 3JYOA 1PWXA 2YV2A 2C5EA 1MC5A 3JD4A 4KDFA 3ZW8A 4CMIA 2VHXA 2RAFA 1KOLA 1E6EA 4D3DA 3WG9A 1BW9A 1VC2A 2YW9A 2H1SA 1Q7GA 4M54A 4FJ2A 1N9GA 2B0JA 3H4VA 5JYDA 2OFPA 2GN6A 3M1AA 1RKXA 4CMJA 3WWZA 1JVSA 3WGTA 4CM3A 3FI9A 1PJSA 5H81A 2YHUA 2D2IA 4XGNA 3TZ6A 4WOKA 3LSYA 4PVCA 4Z3KA 4R54A 4NHEA 4OYRA 4XJSA 3FPLA 5KCZA 2LDBA 1ZK1A 1D7OA 2WSBA 4PG6A 4CQMB 3PJEA 4CUKA 3C8MA 3U4IA 4CM5A 4EBFA 4OM8A 4Z3DA 1E3JA 3DZHA 1VI2A 2FP4A 5IZCA 1XG5A 3PQDA 3PWSA 2ZCVA 3EGOA 4TZTA 1Y9EA 2QZZA 4W7HA 4Z0HO 3SC6A 3MTGA 1YBAA 3L9WA 3R3JA 5ER9A 4LMRA 3UOGA 3WJ7A 4E5KA 3IQDB 2DTEA 4Q3DA 1XWFA 4IPTA 2WD7A 4JROA 1ZVMA 1V8BA 5JC8A 3E8XA 4NH4A 1YL7A 2ZYGA 4AL4A 4E31A 3TWOA 5JDIA 4D45A 1CWUA 1HSOA 3M2TA 2PWZA 1PJ3A 3I23A 4CL3A 4IS2A 5MGBA 4OXKA 2ZQZA 1YJQA 2YFQA 3SVTA 4RPHA 1KVQA 1G0NA 2VWPA 4K26A 3TF5A 4Z9XA 5LDGA 1I32A 5CPFA 2Q50A 1M6HA 2P9CA 4QFCA 4B4VA 1KEUA 4BMVA 1PR9A 4ID9A 3C1OA 3RU7A 3QVOA 3RFXA 3OH8A 3GMDA 1E6UA 4IDCA 3V2HA 2DUUA 1BVUA 4NNJA 4ALKA 4RZIA 2BFPA 4QSMA 2HK7A 1V3VA 3KVOA 3ZV4A 4BNFA 3FR7A 1FDWA 4R01A 1W4ZA 4AJEA 2CDBA 4C7JA 1IZ0A 2R00C 3SXPA 3UXYA 3NUGA 3JSAA 1ISGA 4D43A 1LSJA 2V6BA 4HX5A 3PDUA 1H6AA 4DYVA 1MG5A 4CLEA 5KKAA 4NIMA 3MTJA 4J49A 2ZIZA 2IXBA 1HYGA 2I3AA 5A04A 1U4OA 5T64A 3KSZO 3LVFO 3PVZA 1FK8A 1D4FA 5DT9A 3JV7A 4R51A 2Q2VA 1R37A 4IXTA 5ILGA 1CF2O 1F06A 1YDWA 4NMHA 3TJRA 3UF0A 5G4KA 1H5QA 3AY6A 3F5SA 1ADFA 4DC0A 1IB6A 3OJ0A 4ONEA 5K0ZA 3E18A 4H16A 5EMHA 5A9RA 4FPXA 1HE5A 4U0JA 2PTGA 3JQGA 3ZU5A 2YDXA 5I8WA 2W8ZA 3BMQA 1C14A 4R3WA 1SZJG 1DRVA 1DC5A 1NWHA 4EEZA 4JP3A 2X0RA 4YCAA 1MV8A 2PKRA 4FSHA 3ZWBA 4QXMA 4JXKA 1LDNA 4XRRA 5JE8A 1CQIA 1VM6A 3ETGA 1X7DA 2HRBA 4CMKA 5EERA 1NR1A 4ZRNA 3AM3A 2G0TA 4W4TA 1PGQA 5JCXA 1V3TA 5ICSA 3VPSA 5TJ9A 2DBZA 4DMLA 2UVDA 1SBYA 3RBVA 1GD1O 4EYEA 4MVJH 4Y9DA 3KYCA 3CZMA 2EW8A 3O8QB 3HFSA 4A7PA 5H82A 5I7SA 5ITWA 5B37A 2NM0A 1IOLA 4YJFA 4I9HA 4EJMA 1HLDA 3PI7A 4B3JA 3W1VA 1Y81A 4CLRB 4I9UA 4XQEA 4AJNA 2W98A 3ZHBA 3HB5X 1GDHA 1E77A 4ZJUA 1C0LA 4ZHSA 4WLFA 3L07A 4E2WA 1P9LA 3E9QA 2PKQO 1EUCA 3IP1A 1NR7A 4JN6B 4PLTA 4CV1A 1GYPA 3AY3A 4JCOA 5B4UA 5BNIA 2EJWA 4QX6A 4GWKA 1TVEA 2DQ4A 2VZ9A 1PX0A 3KTDA 3L4BA 1HXHA 3VOSA 3G49A 1KERA 3NEPX 3I52A 4YQYA 4MDHA 4FGWA 1NBOA 3C7CB 3QWAA 5A05A 5KJEA 2PZJA 1D3AA 4L4XA 1EEHA 4I5FA 4UVEA 1WP4A 2E37A 3BHMA 4OKNA 4ZQBA 3U4HA 4PIVA 1RM3A 2NUAA 4DLAA 5JC1A 4CM8A 2BD0A 1HWYA 1HDYA 4JBIA 1I2ZA 2VCYA 3PYXA 3ZWVA 3WNQA 5TQVA 4R41A 1O94A 4HV4A 3A28A 1JAXA 1M75A 3LT1A 2X0NA 2PA3A 1NX6A 4IDGA 2X58A 1N9GB 2D8AA 5ENVA 5T8KC 5AOVA 1H93A 5F1OA 3RCBA 2X5OA 3NGXA 5IJZA 4FJ1A 4A26A 4PN3A 2ZATA 4E2ZA 2BHLA 4M8SA 5G0VA 1JU9A 1FXSA 2Q4BA 1I3LA 1O9BA 3HFGA 1ISMA 2Y1DA 1DRWA 1R66A 1AE1A 2VZ8A 2Y05A 4AJ4A 5KJ6A 4PRKA 4AJJA 4E33A 3OFSA 1ZSVA 4J1NA 4MINA 1DFIA 3BA1A 4MVJG 5CAEA 2EERA 3D3WB 2D5CA 3ZH2A 2NVWA 2O50A 4OL9A 4RGBA 5K6AA 1QYDA 4NDNE 5L3ZA 3H2ZA 4UVDA 3PZRA 3H9GA 3PK0A 3WQRA 5I7EA 4PG5A 1PJLA 5DCYA 4BQPA 3U09A 2GZ2A 2BFAA 2Q46A 4MOWA 4J7UA 4GVLA 1U1IA 3VTZA 3H5NA 3F47A 4DA9A 1KEWA 3ZGYA 3L77A 3GVHA 4YPOA 2DU8A 1VSVA 4E30A 3ETDA 3S2FA 3C1TA 1OI7A 1VSUA 4Q9NA 3QVSA 1NVMB 2FMUA 4DGSA 3G3EA 4TRJA 3FWZA 3AY7A 4CQLB 5KOIA 2W2LD 3ZDFA 2ZKLA 3RUCA 2AW5A 2HK9A 2JFHA 2PH3A 1BHSA 4HFRA 2ZYAA 1ZKMA 4PZDA 3WYEA 2FOIA 5BNTA 5LC1A 1WLYA 4I8XA 5L4NA 4Y6PA 3D0OA 4IJUA 1BDBA 1W8DA 5JFOA 3BMNB 1NFQA 3KSDO 3HDHA 3G17A 1YXMA 3GZ4A 4ZA2A 3M1LA 4BGIA 4IM7A 4AJHA 2P2SA 3T7CA 1SEPA 4RV9A 3OA0A 2WE7A 2IZZA 5THQA 3OSUA 5KJCA 5BSEA 2Q1WA 3I9KA 3LLVA 1DIBA 1C1DB 4J2HA 2W4QA 1YQXA 5FYDA 1LDEA 4L8VA 5U1PA 3Q11A 1CYDA 4MJLA 3RC2A 1XSEA 2PGDA 3UCFA 4L76A 4FN4A 4FQ8A 3GOHA 3AFNA 3PIIA 4K28A 3TOZA 2EHDA 1DO8A 2PH5A 1LRJA 1U8FO 5L9AA 2NSDA 2VYVD 5KIAA 4CR6A 4F45A 5IDXA 5KWEA 6ADHA 1B7GO 3ZWXA 1XQ1A 5A5FA 3CINA 1PJTA 4CLDA 1QORA 4Z0TA 2OBYA 2Q4EA 3L6EA 4CMIB 3GFBA 4BO1A 5L51A 4AJPA 4P22A 3RC9A 4BV8A 3G1UA 1J6UA 3ANMA 2BFMA 1HZZA 4MVJM 4DVJA 1HE4A 4MO2A 1LC0A 2BGKA 4NBVA 2X4GA 4YEDA 5F1PA 2XOXA 4WE3A 5BR7A 1LXCA 5A9SA 1YONA 2FHSA 1C0PA 4TRNA 3ZHZA 3ITDA 4NFSA 2GD1O 2AEJA 2CDCA 3AK4A 5TT0A 3NKLA 4WPGA 1PL7A 3PZBA 2CNBA 4CV3A 2CUKA 4JJIA 4L4SA 1I2BA 3GAZA 1I3NA 4CUJA 3S2IA 1BW9B 1EE9A 3V2GA 4FIZA 4A10A 4YT5A 4BNGA 1XYGA 3GUYA 4PLFA 2CVZA 2O3QA 3WFIA 2Q1UA 1WDKA 5H83A 3KYDA 1LRKA 4G81A 1GQYA 4Q3AA 1QLJA 3JQ9A 4JGBA 5EESA 3ZW9A 5AQ1A 5C7LO 3A1NA 1XLTA 2EGGA 3KZVA 1PJQA 3N58A 5TSDA 3HSKA 5TNXA 4WJZA 3QIVA 3UCEA 1HE2A 1PQUA 2C82A 2W2LA 1J5PA 2Z1MA 3IOYA 3BTVA 3CMCO 2PY6A 3HNPA 4I1IA 1GZ4A 4A27A 2BI8A 3QY9A 4Y6SA 1X0XA 3R1IA 4W9NC 2QW8A 4D42A 1P44A 1A71A 3L0DA 4BNLA 4KTVE 1DLIA 1E7MA 2AE1A 1A72A 1I01A 3I6QA 5JY1A 1I3KA 1DLJA 3PFWO 4BO5A 3KOUA 2X9NA 4GKVA 3OJFA 4C4OA 3AI2A 3ZCXA 1D1SA 3V1TC 1B16A 2QX7A 4YVFA 1IL0A 1FDSA 2VHYA 5A5EA 1A9YA 4NK4A 2JHGA 1P3DA 2ZB7A 1OC4A 2WJPA 1Y8QB 4NJMA 4W9NA 3WB9A 5JY6A 1SOWA 4GPD1 2Y0DA 1E3WA 2HO5A 3VPFA 5IN5A 3OM9A 3AFMA 1ZBQA 2BLLA 5GZ6A 1K2WA 3A9WA 3AM4A 3F1LA 3ZWWA 2C0CA 2CMDA 4BNJA 3F3SA 4IQ8A 4ND1A 4P8RA 4DTIA 4R1SA 4FFLA 4L74A 5L53A 1P33A 4YJDA 2CD9A 1WVGA 2JAPA 1GZ3A 4IXWA 2A35A 5G4LA 7MDHA 3CSDA 2X7HA 1DIHA 2JD1A 3I9MA 1EBFA 4DL9A 2GRAA 3VZSA 1MUUA 1VL8A 3FCOA 3GZNA 3KLPX 4IMPA 4TROA 2CF5A 1Z74A 4YRDA 1E92A 1OZAA 2PZKA 3P2YA 5HRUA 2FN7A 2J5KA 2Y66A 4XR9A 3CTMA 2QYSA 3HN7A 4D46A 1LDYA 1LRLA 4YJHB 2VHVA 1J49A 1P74A 3ZNPA 4OQZA 2P9EA 2GUGA 1BXKA 3I9NA 2QRJA 1DJQA 2DAPA 4JJFA 4DIOA 3DTTA 4IDFA 3SEFA 3EUWA 3RIHA 3NT2A 1O5IA 1LLUA 1EK6A 2FPPA 4NPCA 3QWBA 4KP7A 4ZU3A 2J3IA 2EP7A 1BWSA 2DTXA 5B1YA 1G0OA 1A9ZA 1H2BA 1ISJA 1QYVA 2E49A 1DIGA 4EEXA 5ENDA 2C7VA 3H5AA 1YE3A 4J7CA 3E03A 1LDMA 4E13A 3W4KA 2D1YA 2VYNA 4WEOA 1OFGA 4A03A 2AXQA 3AUUA 4QECA 1UDBA 5DOZA 2HJRA 4YWJA 5JAIA 4IS3A 1AGNA 3PHHA 1A7AA 3SC4A 3WBFA 5L4SA 2JD2A 2DC1A 3DMYA 5T67A 1I5RA 3UHAA 1CRWG 3IMFA 4XJTA 4FBGA 4FW8A 4O59O 5GMOA 1O6ZA 3K5PA 4E32A 2CVOA 2G17A 3OHSX 3SX2A 1HDXA 1MA0A 3PLNA 2DFVA 4XYLA 1PIWA 3I4CA 4CLRA 4LISA 5T5QA 1HZJA 5DBGA 3BMOB 2C59A 2O7QA 2FZWA 3WSWA 3I9OA 2PK3A 3TFOA 3VH2A 3ZV3A 4I08A 1ZXLA 4DPKA 4YYZA 1IYZA 1YKFA 1ARZA 1JA9A 4PG8A 4XYBA 1YL5A 4M1QA 3JQ7A 4G65A 1NWCA 4XYMA 1DC4A 1M2WA 1QYWA 3O26A 1IE3A 5COQA 3X2EA 3JYPA 2GNAA 2AQHA 4Z9YA 1ZMOA 3BMCB 3OJEA 2NQ8A 3IC5A 4MIEA 3BZUA 1H6DA 1QV6A 2WMDA 3GEDA 3WGGA 3QE3A 2JFFA 5AYVA 3E5MA 4Z0PA 4ZQHA 1H9BA 2HJSA 4E5PA 1WW8A 3IDSA 4XD2A 4XB2A 4IIVA 3DZKA 3RU9A 4HFJA 5JDCA 3KUXA 1BSVA 1DOHA 3KV3O 4DREA 4IBOA 3KO8A 2J5RA 1VL0A 1R0KA 4GX1A 4BNNA 4ALLA 2G5CA 4HY3A 1FJHA 2JD0A 2W2KB 2XXJA 3ETEA 3GRPA 1SAYA 2G82A 4DLLA 3D4PA 3OETA 3TZHA 3MJTA 3K73O 4GLLA 2DBRA 3M2PA 3JQ9C 3A14A 4D3SA 5AXDA 5L4LA 3H8VA 2P91A 2OBNA 4XDYA 3BHJA 4PLWA 5COAA 1DFHA 2A9FA 4WECA 4WK6A 5F21A 5JMPA 2VWQA 1NQAO 4GBJA 4QT0A 4BO0A 3R3SA 2J3JA 1U2GA 4L9RA 4MKZA 4PG4A 2CSUA 2J3KA 3D5QA 1KVTA 1M67A 3DDNA 2I66A 1X15A 3ENKA 3QWIA 4XEHA 4I5EA 4RORA 1T4BA 4WUVA 3ZN2A 1KY5A 2O7SA 4OSOA 4B7XA 2NQTA 2BI7A 5JW6A 2AQKA 4U8GA 2GGSA 5JXWA 3ZWCA 1E7YA 2X5JO 4DC1A 1Y8RB 3PEFA 4PLCA 1UH5A 4XRGA 2AA3A 3OICA 2PV7A 1QKIA 5IF3A 3Q2IA 3PHLA 3D4NA 3F5QA 4FFMA 1UP6A 3PYMA 2X9GA 5FF9A 4NFYA 4J43A 1LTHR 1OOEA 2F1KA 4YDRA 3DC2A 1I2CA 5JDIC 2I76A 4WLUA 1R4MA 3CKYA 3HB4X 3QP9A 1XR3A 3LYLA 2Q1SA 1QG6A 1QP8A 4IQGA 1KVUA 2GN4A 5ER6A 3OP4A 3RJ5A 4DLBA 4YAEA 5U9CA 4MVJI 5IAAA 1DC6A 3FHLA 1TEHA 3CEAA 3NAQA 1RJWA 4CMEA 3KRTA 3PQEA 4ALMA 5LCXA 1PSDA 3GPIA 4GAEA 5CDYA 1T2FA 1HRDA 4FFOA 4PLHA 4XQGA 3U4CA 3HZZA 3UKOA 3KEQA 4NG5A 1OC2A 3I6IA 3DAPA 2PZMA 2X1HA 3LF2A 3JD3A 1EDOA 1P1FA 2EXXA 4YQZA 4QO7A 4CQMD 4YRAA 3EAGA 4ZQGA 3TQHA 1E1LA 2B37A 1OAAA 3PP8A 2OORA 3C7DB 4UVIA 2QRKA 2AMFA 1XCBA 1M66A 2EGHA 5IDQA 1ZIDA 4GGPA 1H94A 1Y5MA 1H0KA 3F9IA 1SNYA 1VE9A 3FTNA 4YJGA 1PWZA 2NWQA 3GLQA 3E9MA 4GQAA 4JIGA 3ZU2A 5FWNA 1EUZA 4JBGA 2JCVA 3C7AA 3D5TA 1GUYA 1YQDA 1QRRA 4TMFA 1Y6JA 3TZKA 5GZ3A 4ZQEA 1IY8A 3ZNQA 1ULSA 1LQTA 4E6PA 3FF4A 4U5QA 3LDHA 4U7WA 5I9LA 4GL4A 1NM5A 2B5VA 4PGFA 4NZ9A 1LUAA 2HMUA 4NBRA 4A73A 4XA8A 1VJTA 2AHRA 3DBVO 5F1KA 5TF4A 1V6AA 3VVCA 4L4RA 1ZK2A 4XR4A 3PWKA 2EJVA 2BGLA 4MKXA 1UDAA 4O1MA 1DHTA 1NAHA 3T7EA 1U3WA 5T57A 5BSGA 4D0SA 1N1EA 1LNQA 1JLLA 3V8BA 3WFJA 4WLNA 3NRCA 1GPDG 3FD8A 3PJGA 4J7XA 3ZWAA 2ZB4A 1F0YA 5JLAA 3IJPA 2CZCA 5KVVA 1BXGA 1KY4A 3JQBC 3O4RA 5A4DA 1WZEA 4DUPA 4IMRA 2YQ5A 2BH9A 2ZTVA 2DKNA 1Z45A 2NADA 4JK3A 5DCWA 3PPIA 3E5RA 1MB4A 2C5AA 3HWRA 3BAZA 3ASUA 3WR5A 4YACA 4F6CA 2RHRA 2P5UA 4N54A 3C3XA 3GC6A 1HE3A 3ONDA 1PR3A 3DONA 3GT0A 1EVZA 1XA0A 2IE0A 4GX2A 4UEJA 3ZNNA 4B3IA 2FPIA 1HDOA 2WE8A 4N18A 5CDGA 4DQUA 1R4NB 1R15A 4RQTA 3BYZA 5BNFA 5I8ZA 4AJIA 4YT8A 1ZCJA 2GR9A 1T4DA 3Q9NA 4BHTA 2NACA 5JDCC 3WTCA 4S1VA 5A02A 3IS3A 5JBIA 5AXAA 3KYCB 3HADA 3WNVA 4XYGA 4AJKA 4URFA 3CPSA 1QYCA 2BELA 1MXHA 4FJ0A 4O5OA 4BL5A 4WNIA 5DZSA 3ZHYA 3IL2A 1N8KA 5FI5A 3B70A 2B4TO 2Z5LA 1YDEA 3WDSA 4BO7A 5IZCC 1VRWA 4GMGA 3GDFA 2HCTA 3KLMX 1YO6A 5TS3A 4AVYA 5C37A 2XXBA 3H6KA 3VTFA 1ADGA 1VKOA 2WYUA 3UAGA 3DL2A 2FR1A 1K6XA 1KYQA 3DZJA 3I3OA 3U3XA 1ENZA 1ZK4A 4HUJA 2B4QA 4YAIA 4XCVA 3EZLA 2VQ3A 1YL6A 1ENYA 2O3UA 4LCJA 8ADHA 2Y1FA 1UUFA 3DR3A 5A9TA 2YV1A 2B5WA 1PQWA 4RVHA 2FRDA 4RPGA 4XIJA 3WJAA 3JQFC 4J4TA 3WLEA 2O3JA 4XX0A 3MJVA 1KC3A 4MKRA 3WTBA 1WWKA 4QTZA 3FNGA 1DDOA 1LLQA 3ABIA 3WQSB 1ZO8A 3EK2A 1DRUA 3PIDA 2NVUA 2IYPA 4UREA 3VKVA 5JPIA 1KETA 5EQFA 2QZ9A 1UXJA 3GAFA 4IJWA 3JCZA 4H7PA 4LRSB 1HSZA 1A4UA 4TRRA 3RUFA 3VZRA 2O48X 4ZN6A 2H63A 1QLHA 4AJ2A 2GASA 4ZQFA 1J0XO 4AJLA 4LMPA 4NFHA 3UVEA 3I4FA 2VN8A 1DC3A 3HE3A 2ZCUA 4KUHA 4YAGA 1TT5B 3JD2A 3INGA 1I30A 2ZJ0A 2OOSA 3GDGA 2X6TA 3RUAA 4B4WA 1CJCA 4K9DA 1HTBA 1C0KA 4CM4B 3WYBA 1YB5A 1WPQA 2GYYA 3AWDA 4CPDA 4O63O 1ID1A 3UH1A 4NK5A 1WDLA 4M55A 1MLDA 4BNUA 1L1FA 5K9ZA 3E6AA 4JNKA 1E7WA 3MWEB 4BNMA 4CJXA 1H6BA 3VHRA 3S2EA 3ENNA 2EF1A 2OO5A 3LC7O 4EW6A 4WCDA 5EIOA 4HNHA 2IDZA 3VAZA 1JDJA 2DBVO 2GO1A 4P38A 1HT0A 3GGPA 3H65A 2XPCA 5JAQA 4CODB 1NQOA 4ND3A 4F46A 1DSSG 1NP3A 1K6IA 1P77A 3K2EA 1NYTA 1ORRA 2HMVA 2X5KO 5K6AC 3TL3A 1FDVA 2D3TA 4RPKA 4IDEA 1JAYA 4EUFA 4J1SA 2EP5A 5BT9A 4YT2A 1NHWA 3W8FA 1U5AA 4UUPA 5EINA 4N5MA 3GY0A 5HTOA 3DO5A 3DZBA 1K5HA 2UDPA 2J5QA 3NJ8A 4YJFB 1LC3A 3RUDA 2O3RA 1E5QA 3ADOA 3NX4A 2Q99A 4DIBA 3A06A 3WLFA 1E5LA 2DFDA 4M87A 3RUEA 4INAA 2PD3A 2D59A 2DTDA 2FWMX 3GRKA 1ULUA 2BFOA 1YOVB 4PCVA 3ZWOA 2ZQYA 4ZRMA 1LEHA 1ZUD1 1G6KA 3AI1A 3OQBA 3FNHA 5EPOA 3INRA 2ET6A 4RDHA 3HDQA 3WXBA 3JQBA 1B14A 4YBZA 5C7IO 1Q7BA 4XKJA 3LT2A 4OHUA 4RJTA 1Q0QA 3RBXA 4BUCA 1JWAB 4Y98A 3QVTA 4Q3CA 2Q3EA 5ES3A 4CL8A 1K3TA 3RUIA 1H2HA 5ITVA 3SLKA 4BNZA 1U9JA 4BKOA 1E3LA 3MCVA 4EUEA 2OGUA 3VVBA 4NI5A 1N7GA 1UJMA 2A94A 8LDHA 4QQRA 3OEWA 3LK7A 3LT0A 4IIUA 4PVDA 4RZHA 4WCFC 4AFNA 4A2CA 3ANNA 3RC7A 1WDMA 1GEEA 2O4UX 1P31A 3OMLA 3EYWA 1QMGA 1F17A 3VH3A 3G1TA 2GZ1A 4II3A 2VYND 5DF1A 1TB4A 1B0AA 3HQ4O 1EFLA 1TT5A 3Q6IA 5KVQA 4WLOA 2UAGA 1ZSYA 4HBGA 5F5LA 1Z6ZA 1J4AA 4EDFA 3K9QO 3PGJA 5L7YA 5CG2A 4EJ0A 4F3YA 3GNSA 2V7PA 4KOAA 3ASVA 3CIFA 2VUSA 3H9UA 4WOJA 2WYVA 5G0SA 3PFFA 5G2OA 5FEUA 2TMGA 3GDOA 3FTPA 3JYLA 1ENOA 4BNVA 5KVCA 4RVDA 1TT7A 4KQXA 4ALNA 1FMCA 1GCUA 3WIEA 4HXYA 4CM8B 3Q9UA 4RLHA 3ROKA 1MC4A 3NTRA 2YY7A 3RUHA 3IUSA 4R4JA 3NYWA 3N74A 1GUFA 4RPLA 3EW7A 3RASA 3MOIA 3UUWA 7ADHA 3JQAA 3ZWNA 1E3IA 4FD3A 2JJYA 3CUKA 2GN9A 3GEMA 3AI3A 2WM3A 4TZKA 3VDQA 4D79A 5TJHA 1QYXA 4UVGA 3JQFA 1O95A 1JQBA 2V6FA 1TI7A 1TLTA 4IGFA 1PS0A 1X0VA 2AEMA 3L9XA 3UN1A 1Y1PA 3SLGA 3CE6A 4UUNA 4OQYA 5B4TA 1LQUA 4XGIA 1NPTO 4R1NA 1R16A 1E3SA 1YWGO 3GF4A 3QHAA 3ZWMA 3GA0A 4ZICA 1YBMA 4RVGA 1PU2A 2NU7A 2I99A 4DBVO 2FR8A 2QRLA 1FDTA 3VDRA 1B2LA 1LBEA 3MJEA 1LLDA 2NV6A 3E48A 4BMSA 2OL4A 1FDUA 2RIRA 3PWZA 3MJSA 5KKCA 4HWKA 3AOEC 3T4EA 2HKIA 1NQTA 1TXGA 3W4IA 3PJFA 2W90A 1ML3A 2HAEA 5JO9A 3ZV5A 4R68A 3G79A 2DT5A 4E5MA 2AG5A 3JQDA 4ZVVA 3ZWPA 3RC1A 1L7EA 2DBQA 2WTBA 1GPJA 5HM8A 5TT1A 2POQX 1XU7A 4IDBA 5ICMA 2VOEA 1ZFNA 3PTZA 4KTTE 3NJ4A 1HETA 2FY8A 4NR0A 2E4AA 3V5NA 3U9LA 1NQ5A 4FC6A 1KBZA 3KB6A 1LDGA 3I83A 1WXDA 2DLDA 6LDHA 3RAJA 3DZGA 1IUKA 2D4AA 4M86A 1Y5RA 4PG7A 3WS7A 1R0SA 1U7TA 3TZQA 4CMAA 1B3RA 1YBVA 2W2KA 3VKUA 3IKTA 5KVSA 1U2DA 2IZ0A 4GX5A 3QRWA 1XELA 3GVCA 4DIFA 4EZBA 3JYQA 1Q0HA 2JKVA 5A3VA 1BTOA 1IULA 4P4NA 4MP6A 4E21A 1NXQA 2Y1GA 4CM4A 5HWSA 5COBA 3BHIA 1EMDA 3DHNA 1EUDA 4ND2A 4J1TA 2Q2QA 1B8PA 2HMSA 4LVCA 4K6CA 1DIRA 4RVSA 5DDIP 3JQ8B 4OMUA 4RCVA 3GVPA 2VT2A 3VZQA 1SOVA 5J23A 2B35A 1O89A 3OIGA 5DP2A 3KXDA 2C29D 3DOCA 5C3MA 3K31A 1JN0A 3PYLA 4DWVA 1KIFA 1WAMA 9LDBA 3IJRA 2ZK7A 3JQ6A 3OJOA 1H9AA 5TC4A 1HDCA 4MPDA 1NNUA 1LU9A 1F8GA 3RD5A 1V3UA 4CQLA 1TA4A 4F6LA 2B36A 2O23A 2VHWA 4J16A 1E0DA 2TMDA 3P5SA 3ZNOA 3B20A 1Q0LA 4XWYA 3UCXA 2C7GA 4WCFA 1JKIA 3UGKA 2ZTUA 3B1KA 3ORFA 1UDCA 2B69A 4UUMA 3S8MA 3F4LA 1X1TA 2I9PA 3EDMA 5KJFA 1DJNA 4BB5A 3D64A 4HFMA 3K2BA 4WCFB 4LK3A 2VUUA 2HUNA 3BTUA 1UXKA 1YB4A 3WICA 3K6JA 3D3EA 3DBLB 4NU5A 4G5HA 2OMEA 5TGDA 2ZTMA 5KNLA 2JFGA 2WYWA 3DBHA 5JCJA 3WIDA 4BKPA 4AICA 3L4SO 4J6FA 1JWBB 1ZK3A 2R2GA 1R4MB 3GVXA 4XGKA 1IPFA 4NBUA 4OH1A 3W8DA 4OOFA 4CMBA 1Z7EA 3GHYA 4UUOA 3QJ5A 2PD6A 2HMTA 3WBBA 2P68A 1N1GA 3LLSA 5JCJD 1MFPA 1SB8A 4BGVA 2HQ1A 4R1UA 1AUPA 4TKMA 4OKIA 1CETA 5EL0A 1ISIA 3ZU3A 3GZNB 4FR5A 4LW8A 4XDZA 1IHYA 1P0FA 2FSSA 3ADPA 2IEDA 3OJLA 2PNFA 1ZJYA 3AW9A 3GGGA 2WEKA 4FS3A 3WGYA 3A4VA 4DQVA 3I9JA 4TRMA 3Q2KA 3TOXA 5CDSA 1BGVA 1JVBA 4LSWA 3X2FA 4J4HA 3WQQA 4CM7A 3WGOA 2X8LA 3U0BA 4JP2A 3UW3A 3AM5A 4RF4A 2NLOA 2Y0CA 4GSKA 2Q1TA 1T26A 1P1HA 2OP0A 1LI4A 4K6FA 1S6YA 2AG8A 1QR6A 4BO8A 3DZFA 3BTSA 4Q3EA 2EWMA 1X14A 1I8TA 1W73A 1V0JA 3HHPA 1LDBA 1ZNQO 2VTDA 3DOJA 1T2AA 4DRYA 3NGLA 1P1KA 2ZB8A 3FN4A 4XB1A 2P4QA 1L7DA 1RYDA 3H9EO 1I24A 4NQZA 4CLOB 1VJ1A 5A03A 1GY8A 1YRLA 1A5ZA 4GH5A 4KMSA 3OEYA 1ONPA 4ZGWA 1XHLA 2PFGA 1A27A 3DAGA 2WD7B 4RVFA 4MVJP 1C3VA 5JAMA 2Y68A 1XDWA 4OJNA 5HBRA 1RYEA 1YOVA 4LN1A 3P7MA 4B4OA 2GCGA 5G0UA 3VZPA 1U3TA 2I3GA 4KDEA 3LU1A 3TSCA 3O03A 2VHZA 1O0SA 4N7RA 2IZ1A 1MX3A 5C5IA 2IODA 1GZ6A 1MGOA 4LVUA 3ZWYA 2C2XA 2CF6A 1NFRA 4PLYA 4B3HA 3CMMA 2X23A 1YJ8A 2XAAA 1U3UA 4II2A 1T2DA 3V1YA 3RSHA 1UXIA 5AXCA 5IZ4A 2ZB3A 3NDRA 4W99A 2YQ4A 2I65A 4GGOA 3W6UA 4N5NA 1LX6A 3WYCA 4TWRA 4W6ZA 3SJUA 4IZHA 1HDGO 4DPLA 3DFZA 4R1TA 3OQ1A 1HYEA 4RPJA 1BMDA 4J3FA 3H9JA 1X13A 3RKRA 3WMXA 2HDHA 3EC7A 4OAQA 3HN2A 3JQGB 2HSDA 2IEBA 1ZH8A 1CEQA 4ILKA 3GG2A 2QG4A 3JD0A 3OIFA 3RJ9A 1C0IA 1HLPA 3EVTA 4B8ZA 1JKJA 3E1KA 3GH3A 1D8AA 2O4CA 3ICCA 3KBOA 3KM0A 1SC6A 3EY4A 5ILOA 1ZZEA 4D0RA 1YH3A 3ZU4A 1GU7A 3F6YA 4UVHA 3D3WA 3ROQA 3RKUA 5IDWA 4RF5A 1T2EA 3VH1A 1ZK0A 5B12A 2LDXA 3DWFA 2FZEA 1VLLA 4GSLA 1GQ2A 1EVIA 2G76A 4BIIA 2IYOA 4R5MA 4I9NA 1PL6A 3BTOA 4CR7A 2YZ7A 1KEPA 1P1IA 3RROA 2YFHA 3LZ6A 4A5OA 1T1SA 2J6IA 4LRTB 3IKVA 4MP3A 4YJGB 5HS6A 3R0IA 2WD8A 5A06A 3TDKA 4WKGA 3L6DA 3VPHA 3FNEA 3P2OA 1HDRA 1NTOA 3GUCA 3N7UA 3AOGA 1E1MA 3IP3A 2H6EA 3OA2A 2XF8A 3UFXA 2QIOA 4KUEA 2JCYA 2Q49A 5ADHA 5DBIA 2E6UX 5FI3A 5JYEA 3CXRA 1Y7TA 4GKBA 2YV3A 5HA5A 4J0FA 4AJOA 3QV1A 1GR0A 1EVYA 4GWGA 4IDAA 4LGVA 3V1UA 3DBHB 1GYQA 3E82A 4ALIA 4Q3BA 4BO9A 1BRMA 4WLEA 3DBLA 3PHIA 5C7OO 4BB6A 2PZLA 4R5HA 2Z95A 4A0SA 1K6JA 3PLRA 3D1LA 3QQPA 3KHUA 3RBZA 1AXEA 4UAGA 4RQUA 2UYYA 1I36A 4B79A 2YHIB 5T8KA 1IHXA 4RF2A 1PTJA 4NBWA 3QWFA 1Z75A 2EKQA 2O2SA 5A1TA 1X7HA 1T25A 4DPMA 4Y8VA 1ISHA 1M76A 3LF1A 4FGSA 2E82A 4CV0A 2E48A 1W0CA 4PLZA 1AHHA 3F4BA 1WMBA 2X86A 3AU8A 1PJBA 1MXFA 1C1XA 2OP1A 2NU8A 2AE2A 2DPGA 5FFFA 2R00A 2RH8A 5EJ2A 4CUZA 1NVGA 2Y1OA 2V65A 4RF3A 1UZNA 2NU6A 1KEVA 5CP8A 1IZ9A 3KYBA 1GEGA 2O3TA 3CZRA 3O8QA 2GN8A 4EUHA 1HKUA 4C7KA 1JKFA 1N5DA 2O2YA 4XZ3A 4E0BA 3S2GA 1PJ2A 4YT4A 1X1EA 4BVAA 4GVXA 1EVJA 4EJ6A 4LCEA 3DQPA 3IIEA 3K96A 2HRZA 1B8UA 1G1AA 1LA2A 1YQGA 2OZPA 3GQVA 2PLAA 2C2YA 3JQ8A 2VWGA 1XGKA 4PFJA 1PGNA 1PZHA 1MG0A 4QO8A 2H5LA 4XQ9A 3STHA 4WNCA 3QWHA 4O0LA 4CMEC 1GQQA 2VOJA 3DXFA 4TKLA 2AEFA 1DHRA 1GAEO 2EIHA 4BNWA 3K8ZA 5IN4A 4D44A 4ND5A 2VUTA 1BXGB 1V9LA 3GPDG 1H6CA 1JTVA 2X0JA 3DB2A 4YB8A 4CLXA 3HUDA 2NVBA 2VTEA 3W6ZA 2I67A 3C1AA 1RPNA 2D5AA 2BF7A 4I5GA 3DMTA 4R69A 3RI3A 4H3VA 4J90A 2PGLA 1N7HA 2C07A 4X54A 5CHEA 2Y1CA 3U62A 4BO6A 3ONFA 1Q7CA 3EHEA 5DOVA 5JSFA 1AHIA 3EZYA 2QQ5A 5TIIA 3RVDA 3W4JA 3SBOA 4BKQA 1PZEA 3JYNA 3JD1A 4HFNA 2D0IA 1DB3A 1EQ2A 2CY0A 4UEKA 1ADCA 2CFCA 3IUPA 2I6TA 4CMCA 3DMTC 1Z73A 4BKRA 1GUZA 5G0TA 3WOHA 3LC2O 4UULA 1KVRA 1F8FA 4XIYA 3TFQA 4IY1A 1HL3A 1N92A 3ICPA 3K30A 1ZW1A 2J3HA 1B15A 1Y8QA 4NJMB 4R9RA 3TPCA 4B8WA 2ILTA 4BNXA 4ESOA 1U5CA 1E6WA 1QXSA 1U7HA 2YHIA 4R3NA 1LSSA 1PQPA 1R4NA 4BNKA 4B4UA 1CIVA 4BKUA 2Y99A 4J91A 1ISFA 2GPTA 5DP1A 5I7VA 2F00A 1YGYA 3FRJA 4CM6A 3U5TA 2VNAA 1QSGA 1RM0A 2H9IA 3GNQA 3PJDA 3FWNA 4MP8A 3WGIA 1BDMA 4KZPA 4O6VA 1I3MA 3E9NA 5L7WA 1YVEI 3GN2A 3JQAD 3NTQA 5G0WA 1GL3A 5U4QA 3WMWA 4BQRA 2SCUA 5AXBA 1PEDA 5CDUA 3WX0A 1EFKA 4PLGA 2YDYA 4MIYA 3Q0EA 5DBFA 3OF2A 4CR8A 4JQCA 1NHGA 5JMWA 4GLOA 1DXYA 2OUIA 4CM1A 4E2XA 4E5YA 3NDIA 4M89A 1HDZA 1Z82A 4OXNA 3H9QA 1BVRA 5JO0A 3KETA 5EN4A 3LT4A 1VKNA 2EKPA 1EBUA 3GEGA 4J1QA 2X22A 1PGOA 2NTJA 4J2OA 3AOEA 3GVIA 4TSKA 4U6SA 1CERA 4GX0A 1DFGA 1LSOA 2GLXA 2NTNA 4YTEA 1OMOA 5L95A 1SCUA 1W6UA 2J8ZA 1E7QA 4FOOA 4D7AA 4Y6RA 2O3SA 5F5NA 2VRCA 3COSA 3AUAA 3ROPA 4BGEA 4WLVA 2UUOA 4AJ1A 3PRJA 3W8EA 1E1NA 2HMWA 3QW2A 4DXHA 4HP8A 2Y67A 4KWIA 3D4OA 4U6QA 5CEEA 1T24A 4OO3A 2CVQA 4BS9A 4E5NA 1D1TA 3GN1A 2Y93A 4HNGA 4Z9FA 2DPHA 1KVSA 4DMMA 4FFPA 2BRUA 3JQEA 4DBZA 4BNTA 2IXAA 2ZJ1A 1I33A 3GHHA 1ADBA 1ZEJA 1LSUA 3D7LA 1T2CA 5CPBA 3PHGA 1UAYA 4W7IA 3L4BC 2NNLD 5DULA 5I7FA 5THKA 2IRWA 2WWRA 4KUGA 2VNSA
chains in the Genus database with same CATH superfamily
2I34A 2IHVA 5FBVB 3FPHA 5BRJA 2RK6A 4A5SA 4Q3NA 4FNOA 4IJKA 1Z8NA 2IVFA 2AFHE 4OSPA 2B7BA 1XZBA 4P4LA 4PGAA 3LBHA 3RHZA 4AZVA 1NVTA 2WVGA 3GFGA 3QEMB 4US0R 3KKQA 2JDIA 3OQ6A 4JZKA 5F76A 2P4UA 4B83A 2V1XA 3EVBA 3OBBA 4L15A 2HRQA 3ELBA 1QZ3A 4Q1BA 1LK0A 5HKKA 3ML1A 1PL8A 1PJZA 2GD6A 5CBPB 2IH2A 1VE5A 1GVNB 3M70A 1P4HA 5FHQA 3M5WA 4FFNA 4Z1OA 3PC7A 3UMYA 3I9LA 1TKCA 1P1JA 4HUTA 4CU2A 2PJUA 2HO4A 1RWWA 4O4LA 3SJZA 1BX0A 4J9UE 4L8YA 5H9WA 5GZ3A 1EFTA 3LJKA 3N0VA 4R2JA 3WWYA 5B4VA 4H08A 2NNWB 4KPYA 1HEUA 2W43A 2AWNA 4YMTA 4XW2A 1AZWA 3R9IA 4XVRA 4OJTA 2CV2A 3T06B 1AKNA 3FDZA 1E6CA 1TW3A 3B1FA 4HZUB 2X3YA 3NHSA 4M6WA 1B26A 1L5SA 2RBEA 4JIMA 4TQGA 3MOGA 3C85A 4GO1A 4GRDA 3SIXA 1S7CA 3ONEA 1QE5A 2QMEA 2GD2A 4H0FA 1Y9AA 1QO7A 4PO1A 2X9VA 1UOQA 3TYXA 4IGEA 1QF9A 2RAVA 4BCBA 2D7CA 2VT6A 4DKXA 3IVCA 4K86A 4ZZ0A 1NLYA 4F5DA 1K86A 1Q1NA 1RM5A 1K89A 2BMEA 2JHFA 4V2IA 4UXIA 1Z06A 3FTCA 4IIBA 4DC9A 4NOLA 3RRFA 4GKJB 5CB4B 3DWGA 4COKA 2CDAA 2FLVA 4JVNA 4DYHA 4FQ7A 5CA1F 3CO0S 4TWBA 4EI7A 5TMEA 1WSAA 3RTDA 1H65A 1PGJA 2NU9A 3B6JA 4RJIA 1YQEA 1EE1A 1HYHA 5I5EA 1Y63A 4OIFA 1XLWA 1N2SA 1JHYA 1JDTA 1AS0A 1CKEA 4GMFA 1E1KA 4XVHA 4DE5A 1HBJA 3FA2A 3C48A 1KFJB 5BQFA 4Q9AA 5E0OA 2QX4A 2I4NA 3CR3C 3D4BA 1SWVA 2GF2A 3EOAI 4MZXA 2HI0A 1EXNA 1Z7BA 4F11A 2LUOA 3H11B 4M6WB 2CCKA 1GGMA 1SG6A 4O2BF 4TTSA 3NNNA 2B8WA 5L3SA 5ECDA 1RP7A 3HG7A 1AMUA 3Q0IA 4NBTA 2WFLB 4UUBA 1GV0A 3CLKA 1TMGE 2IHBA 1ITZA 4AZ3B 1YI1A 1W8IA 3LWZA 1CQJA 2JVKA 2VUHB 3UEOA 4C76A 5ISMA 3I6BA 3FKSA 2HU2A 2I6UA 3FYCA 3V8PA 1ONOA 1M34A 3EVZA 4INZA 1CZHA 3I39X 4LXXA 1RYNA 2ZJ3A 3SI7A 3UAVA 2QTHA 2IBMA 4KRGA 1U28A 4OJMX 5IXSA 2GS9A 3NFRA 2B83A 3HVUA 1XFDA 4OGFA 1U6KA 4YJ3A 3M7IA 3M6IA 3TRHA 4AY4A 4EKIA 3EBLA 5IVKA 4K9NA 2NO4A 3JSXA 3D6AA 3VR3A 2WTEA 3NV9A 1WSDA 1C3JA 1GCAA 1BZYA 1VG8A 4DG5A 4Q93A 4ZPXA 1G5PA 5AR1A 2Z83A 3LL4A 1GCIA 2FEMA 3AU9A 4I3HA 3ZZNA 3QPAA 4LDRA 2GPNA 2OZLA 4FINA 2VNJA 3EXAA 1QHEA 1MFZA 1XYVA 1J42A 3S1LA 1NKVA 2FEWB 3PDJA 4FDAA 4ZAZA 5MDHA 1ECCA 2VKQA 2CKDA 1ORWA 2WUGA 3A3PA 3RK0A 1E3EA 1RWPA 1XEAA 3NM4A 5KAMA 4BDSA 2C9ZA 3JQ7B 4DN6A 5BWLA 3KSBC 4P1ZA 5C4IA 2RG1A 1U2SA 1J23A 2QL5A 3SYRA 5HJ2A 1O95C 3WYDA 3HU3A 5BN5B 2VHTA 3EPHA 1ZD4A 3VYRB 3V8MA 1N1MA 2IZ6A 3OTIA 3C6ZA 1XKQA 5GTDA 2WYOA 5CIWA 6YASA 1K6EA 2I3DA 2NP6A 2JI9A 5TY0A 1C9JA 2HLPA 2IUSA 4KH0A 1Z5UA 2Q6OA 1KK1A 1QZUA 8ATCA 4FOSA 2QX6A 1II8A 2BHTA 2V45A 4LEIA 2BM8A 1ESDA 3QPVA 2JGDB 1JSCA 2JAHA 3D9QX 4CLHA 1XX6A 1G63A 3O74A 2ZRCA 4FE3A 3PS9A 3UV7A 2WW8A 5DM70 1R6XA 1ZUHA 3GK3A 1NAIA 2FPSA 2O6HA 5K3FB 5ESXA 1WPGA 2QZSA 3GNLA 4BX3A 1PZGA 2GPWA 1BG6A 1NULA 4L0QA 2GARA 3TDMA 2DUNA 3ZHVA 4XQCA 1AKQA 5JWRA 4BGUA 1M6WA 4A36A 1QQ6A 3IP8A 4Q4AA 3RRYA 4FT2A 4XYEA 4X66B 3U61B 4W1RA 2L18A 1RABA 1Z8FA 4NU6A 2A1TS 3AV0B 3GJTA 3F6PA 3CB4A 3W3AA 4GIBA 3WWOA 3KE8A 4YXFA 2IX9A 1X3SA 1QQ5A 5FLKA 3VPAA 5BVHB 2FOXA 1VJGA 4ZP1A 1U0RA 2QL7A 4UCQA 5LJIA 2NVUB 3CEPB 1MJGA 1MX9A 1OLSB 2PWYA 4QLOA 4ZI7B 3F49S 4ZDIA 1GGFA 4OXRA 4G0XA 3TPFA 4BNHA 3KKLA 3Q7QA 2ZYDA 4DHWA 2B2NA 3H3FA 4NAVA 3W2FA 4EQ6B 4JZYA 1GR1A 4P92A 4KKXB 1S3FA 2NSYA 1AXRA 1VJRA 5K8TA 2DQKA 5CK4A 1YZGA 2ZKIA 2P5YA 4NCAA 1WMEA 1EX7A 3WGLA 5I9NA 3W79A 3B8EA 3IQZA 2ETXA 2GSDA 4QU9A 1V37A 1WXGA 1KDZA 1G8YA 1T6XA 4BATA 1SO8A 3MG9A 4RXMA 3ZV6A 3H3JA 3OCWA 2OVBA 5AM3A 5GONA 1HOTA 5FOQA 4OX9B 4BASA 4BP8A 4QUIA 4QVKA 4G67A 3HZOA 3IVMA 2H7YA 3OIWA 4C0JA 4ML3A 4RTSA 2BKAA 2J7PD 1ORIA 2X0FA 3JALA 4MMZB 2H57A 3ADBA 1Z6YA 1A7KA 1EYZA 5AI6A 3ISTA 3PXDA 1V9SA 3H05A 4QYMA 3TW4A 4AY3A 4C1BA 1Z0AA 2DFPA 4G1BA 1GYRA 2YRFA 4C4YA 1L1RA 4F06A 4TOIA 1UODA 4MUYA 4FC7A 3T3GA 2R5NA 3V4FA 4WZZA 3KJGA 4C04A 3NT4A 3IA7A 1FUEA 4FHGA 2AOVA 4QASA 4URZR 3BD8A 1LZLA 5CVJA 3ZK8A 2QHXA 1P91A 3A1CA 5DLQC 2G4LA 2JEYA 4OIMA 2Q5QA 4EPVA 4F8YA 1XPRA 3AHHA 3JWIA 3SZOA 1P2VA 1Q17A 3BXHA 4QG3A 1D9XA 1CQIB 4EVRA 4ND4A 2R79A 5DNDA 3VO2A 1E7SA 4PZZA 3VHXB 5IH3A 5IM5A 3RRJA 5A3JA 3WSVA 3Q7IA 1Y6GA 1EQUA 1HNNA 2PEZA 3LQFA 3UHOA 2P27A 3AF3A 4C0HA 3LUDA 1E1QD 2CE2X 4E12A 1UBLS 2ZRLA 3CVUA 4JBLA 2ZXEA 2GAFA 3T4XA 1YS4A 3PJRA 2R1TA 4ARIA 4A23A 2YYYA 3RLFA 4QARA 1X42A 2H7VA 2WDZA 3NDJA 2Y0EA 2ZRQA 5IKOA 1NJ5A 5FADA 3LOQA 4ENSA 3S8EA 1P1BA 4ETWA 4GLJA 5CK5A 5DTQA 5FLYA 4NY1A 2VSOA 3CX3A 5H0IA 4BLUA 2D0OB 1DWPA 1O3YA 5AJVB 2XVXA 2X0IA 3L7JA 1FTYA 2A9QA 3W5IA 4BOYA 1PDOA 1AV6A 3KV1A 4IIJA 1SEVA 2UZIR 1GZSA 2EV9A 4RS3A 1E2PA 2BCGY 5B3AA 621PA 1Q2XA 2HUPA 3AUSA 4IJVA 4ENQA 1R0LA 4R6WA 4Z6KA 4ODIA 3MWDB 5FTLA 4FCCA 3CH6A 3UJDA 1L4HA 2JHAA 1PWXA 2Q3LA 2YV2A 2I7TA 1E2EA 2X13A 1Z0FA 2BBSA 4G36A 3GT7A 4CMIA 4L02A 1SC9A 2VHXA 3NM5A 3U4MA 4UFPA 3S99A 2I91A 1ODCA 1BW9A 1SD2A 1N0VC 2R751 3LWNA 2JLZA 5ALQA 1JA1A 1U1DA 1N9GA 3LKDA 3C3WA 3Q8XB 3H6GA 5EJEA 1RKXA 2FZGA 2QRPA 3F7OA 4JHXA 3T9AA 2PRSA 4IV5A 3WGTA 3MXTA 3HEBA 5HBGA 2FFRA 2ODTX 2WIFA 4EKNB 2D2IA 4XGNA 1R2QA 1U11A 3WZMA 4GOJA 4WOKA 1TK2A 3LSYA 3L0PA 1CR0A 3A11A 3BFVA 1ZJWA 4NHEA 4OYRA 1YR6A 1J5EB 4D9GA 5KCZA 1ZK1A 1HLFA 4CQMB 3F6RA 1BJRE 1DQZA 2I78A 3GARA 5HK8A 2FFAA 3M0EA 5CB0A 1W0KD 2O8CB 5EUMA 1XVUA 4K8OA 4A2WA 3IT0A 2FG6C 4M38A 3PQDA 1LBHA 3GLHB 5JOQA 3Q3VA 3KHKA 4NC9A 3MW8A 4X1KA 3V6LA 1MCZA 4PBRA 1ZGHA 1FRNA 2LCIA 2SKEA 2QZZA 2XH8A 3H5IA 2CXQA 2IYSA 3MTGA 2C1XA 4NULA 2VJOA 1OI3A 1UKCA 5ER9A 3NBFA 4M9QA 4XOUA 4TT3A 1JFFB 2JFUA 1FLNA 1TLFA 1Y82A 1U0FA 1NUQA 4WESA 3UT6A 1CB0A 1PN3A 1GDTA 4EAAA 3HWX1 1W85A 1X80A 1V8BA 5IUJC 1Y1QA 1AQLA 3IVAA 4AL4A 4E31A 1K8QA 4Z4QA 3ZQ6A 1R8YA 1WZCA 3O7WA 2YYSA 1T9DA 3THXA 4TSFA 3X1XA 4E7OA 1JFFA 5IVDA 1P4SA 3TGWA 4X20B 1F2UB 1NP6A 1W44A 4UOQA 1A96A 3FAZA 4LC1A 3RR2A 2J6BA 3M6VA 2ZQZA 1YJQA 2H2FA 5BSRA 3PE4A 5F7XA 1YTLA 1T5DX 3O90A 3I62A 3SVTA 3D6FA 4O1HA 2Q9UA 3WLPA 1TUBA 2A5DA 3BB1A 4FR2A 4NPAA 1US8B 4Z9XA 3KVYA 1OIXA 2VHQA 1OX4B 3W9BA 3NH9A 4WD3A 3M89A 2VZLA 4RWZA 4BMVA 3AZQA 4ID9A 4H2DA 4TWIA 3P9SA 2XXAB 3D8BA 3Q5EA 5CLFA 1M1NA 3OH8A 4AAYA 4DCMA 2YMLA 3K16A 2DUUA 2C1EA 4L5IA 2O0LA 4BP9A 2CZQA 3C14C 1VSBA 3PC6A 5JCZA 1O08A 2REQB 2OD9A 1MHPA 4NCJA 4QSMA 4UHJA 3T5CA 4QXRA 1USKA 2X2PA 1TJPB 4AG5A 4BNFA 1C2TA 2BIFA 4EFMA 3A3OA 3FR7A 1YC5A 1N6RA 2NTYC 1AHNA 1Y6QA 3SJAA 3BRSA 3NUGA 3UXYA 3U7GA 3E2IA 3NJRA 4G09A 3TZBA 3IVRA 2ZUDA 3R4CA 1TADA 3FLMA 4MLPA 4I50A 4ZO8A 3KR2A 4B3SB 4CLEA 4YV0A 4OFXA 3N5CA 4LC9A 1SIBE 2YZNA 9MHTA 4QYWA 3CLTC 1HTWA 4LWPA 4M0FA 4BVHA 3KSZO 3LVFO 2J7PA 3PVZA 1FK8A 3Q7PA 3T7SA 1D4FA 3WIOA 5FLXA 1Z34A 1SXJD 1FTQA 2GX6A 2R7AA 2WHYA 3JV7A 1M0TA 2ODAA 2Q2VA 5ILGA 3LMKA 2PVSA 1M2GA 1CF2O 3VPCA 3KYJB 4C0SA 3D31A 1H5QA 3N8KA 4MI9A 4DC0A 2PUTA 4P84A 3AVUA 1U04A 4MR7B 1UKEA 3OJ0A 4PO3X 5K0ZA 3E18A 3UMCA 1NW9B 1X1QA 2FE4A 1XVIA 4H16A 5HVNA 5A9RA 3PXAA 2SHKA 2PTGA 3JQGA 3IUNA 2YDXA 4HRVA 1UWVA 5I8WA 3WYAA 5LP6C 3MTBA 4HGNA 1P18A 1C14A 1YIOA 3WL7A 3B38A 1KP2A 2Z3WA 3K20A 2PG3A 1GZ5A 5DK6A 4EEZA 2B8TA 1XXHB 3EN0A 1QG2A 3X0DA 4FIDA 3KQPA 2XQKA 2X0RA 4UD2A 2FPGB 4V0KA 3BD9A 4YCAA 4RX1A 4QXMA 1UMCA 3UT5B 1V2HE 1WW3A 4XRRA 5DLDA 3CRMA 3AR6A 5LOVB 4JXZA 4NVRA 3TLMA 4EZEA 1GGNA 1ZW6A 1X7DA 2PH1A 3PNVA 4CMKA 1SUSA 5EERA 1OILA 1RPJA 4AP5A 5GM1A 3R7NA 3GJ8A 2XCLA 1CR1A 4G8DA 4B73A 5JCXA 3FHTA 3FDZB 3ND9A 3OF3A 3RSQA 4ZDJA 1LJLA 3CEMA 4JT9A 2C5FA 2WJJA 1UBCA 1EG2A 3T3NA 1RHUA 3UWKA 4IG9A 3WYNA 4OQDA 1AX9A 5LWHA 4DMLA 4GYJA 5HEKA 1Q92A 5AFSA 5BQ3A 4D25A 3WRVA 1RRGA 2UVDA 3NALA 3RBVA 1GD1O 1M3SA 3LBIA 1UFOA 5DM2A 2PPVA 3RVLA 4HRAA 3HO1A 4PM4A 3DMGA 3R9KA 1T13A 1S2DA 2XNKA 2Z2KA 2ZYIA 4I9HA 4EJMA 4WSOA 3RSSA 3E3OA 3IUQA 5KQMA 3GCGA 5KSOA 3D7RA 4QJBA 4JJZA 1YACA 3MIIA 4CLRB 5CCXA 5AOAA 3B6EA 4FYJA 4X6XA 4G07A 4X3OA 2CV1A 1BU5A 1K7SN 1GDHA 4DV2B 1ZIPA 1XD2B 1OAOC 4OYHA 2GK7A 1UBJS 5DM60 1ZD9A 1QZTA 1Z18A 1IY0A 3HU2A 1EUCA 3JR7A 2L19A 2Q7OE 3H5OA 3LHKA 1ZH4A 3AY3A 4JCOA 2AL7A 5LP6A 4MTLA 2RGAA 4OV6B 3KVRA 3FPFA 4BZQA 3RTEA 2C3MA 2O7NA 4NU0A 3CZ9A 1ABBA 1N6LA 3SQWA 2WJGA 1IOVA 2HIHA 4C0XA 1SBNE 2ZFUA 3QA3E 4BBJA 5I7UA 4JUFA 5IC6A 4ESEA 5EZ5A 3N6RA 3NEPX 2QMQA 3OOSA 4UKDA 1X1SA 1DBSA 1I1OA 1IEWA 3LOUA 2FJUA 1NBOA 1Y4ZA 3C7CB 3QWAA 4Y2YA 1TF7A 1TK3A 5A05A 5KJEA 3ZHSA 2PZJA 2J0SA 4I5FA 1FX0B 4KN5A 3ZLVA 2AFIE 3R23A 1EJ0A 1V11B 1WP4A 3BHMA 4O4JA 4GOXA 4QAJA 3U4HA 1NYRA 4DRZA 1RLIA 2NUAA 4FTWA 4QOSA 3MWGA 5DEOA 1OTXA 1T5LA 5SYAA 4DLTA 1JR6A 1M7BA 5TS2A 1BX3A 1R0RE 1RRPA 1YMUA 2X8BA 4CM8A 4JBIA 5KQRA 2AFHB 4G85A 4G0OA 5E7MA 2Q28A 2RI6A 1RWOA 4HXGA 1GPYA 2D2VA 3ZIAA 1R5OA 4HV4A 3A28A 1KDYA 5BV7A 1I7NA 1CW2B 1TYEB 5CVEA 3P9NA 3LT1A 2IDJA 4IRXA 3O8NA 4IDGA 4N48A 2JI4A 5ENVA 3EXIA 3WK4A 1TKAA 2PMDA 1H93A 1KOFA 2QL6A 4POAA 1YMVA 1Z22A 2FPXA 2P8SA 1ESEA 2YV4A 5K0BA 3NGXA 5IJZA 4A26A 2ZATA 2JEOA 1S02A 3D5EA 4DVGA 2JKYA 1K4KA 1ODIA 2BP7A 2QLFA 2E5WA 3AUYA 1YR7A 4E2ZA 3ZDAA 2Q4BA 2IV2X 3CUWA 3A1DA 4ZV9A 4DLZA 2N0SA 1DX4A 2WQ6A 2Y1DA 2VZ8A 1R66A 3DDZX 2WWGA 2M98A 4HAYA 3PFBA 4R8KA 4AJJA 4FGUA 2AFIA 4J07A 3WKEA 4J1NA 2IOFK 1DFIA 3BA1A 5CAEA 2Q9BA 2O50A 1TVMA 4MS3B 5L3ZA 2ZAMA 5BSKA 4URVR 4MV1A 3ZGOA 1JL3A 3H0CA 1LPOA 1MJGM 3IAM6 3O9VA 4RA6A 4ER3A 2R62A 1PJLA 1PR0A 2HPHA 4KLZA 5DCYA 4OHYA 4F6RA 1L5YA 1POWA 2YV5A 3NM6B 2BFAA 3HYTA 4CKCA 4MOWA 4JHLA 4Q7KA 5A4AA 1ZMRA 2PO5A 4F4JA 3H5NA 3F47A 4DA9A 2F9LA 4YPOA 1DO2A 2VQ6A 1YZKA 1ZD2P 2JBHA 4ZTBA 4E30A 3CX8A 3H2HA 1JIJA 3ETDA 1HK7A 4XAQA 3S2FA 3U80A 3C1TA 4CG2A 4FLEA 3VDXA 4M1WA 3H75A 1C30A 1OI7A 1VSUA 2VP6A 5LBTA 3N0WA 1Z63A 3NRJA 2NUBA 2PKEA 5JQGB 3DMRA 4O3FA 5B2EA 4RKFA 4L4UA 4EENA 5KOIA 2FX3A 2NN3C 4CTKA 1W75A 3KQSA 1KBOA 2GK3A 3UOWA 1X92A 2AW5A 2PH3A 3MBOA 2ZYAA 1ZKMA 3NAZA 1KMHB 2VXOA 1M54A 1TCUA 2I4MA 2X4DA 2X8AA 5EVJA 5LC1A 2HZ7A 2VHJA 1FBTA 1OIWA 3A2NA 3D1VA 4ED9A 1W5EA 1W59A 4PV7A 2ST1A 1YF3A 4IJUA 1NT4A 2C4VA 3BFJA 2F48A 1KDTA 2Z0MA 4EEKA 3RYCA 1ZNYA 1GSHA 1YXMA 3MNFA 2QR3A 2VS1A 4P54A 5IUKC 1L7QA 4EHIA 1YFJA 4BGIA 4CKXA 4Z2AA 2XWSA 1JH8A 4PSUA 3T7CA 3I30X 5HZKA 5T41A 4YDQA 2Z8YM 2WOJA 3I2YX 2NYUA 4D02A 1YHYA 1H85A 1L3BA 1JG2A 2Q1WA 3MVEA 1W52X 1DIBA 1I14A 1VLZA 4MRPA 3O2NA 3P2EA 1FP2A 4OCZA 2X2FA 4PYIA 5U1PA 1ORDA 3CONA 4LECA 3L7BA 1J06A 3X1ZA 4D8UA 3UCFA 2FYTA 3C5CA 2ZPAA 3PIIA 4UW9A 2WKWA 3TOZA 3KOZA 4ZC8A 1XYYA 4FYKA 2QSZA 1U8FO 1C8BA 2VSQA 3QFTA 4OQ4A 2VYVD 4B2PA 1ZXXA 5KIAA 3PD1A 2ZUCA 4CR6A 4F45A 4M98A 3ZGXA 2H48A 2YICA 1B7GO 2CMKA 3LY5A 1O9HA 1XQ1A 1N9KA 5JLJA 3QXHA 1GPLA 4MQFB 5FUYA 4Z0TA 5JDIC 2R4UA 1FS4A 4P22A 1JHRA 2H8GA 4CZ2A 1FX1A 3BILA 2AC4A 1Z4JA 5DGXA 2QXTA 4JR0A 1DX6A 2YIDA 1L7MA 3BGIA 5AK0A 2ID8A 1OWLA 2Q41A 2ONJA 4NBVA 2W6OA 2X4GA 4OI2A 4YEDA 2XOXA 3GEIA 3UMGA 3X2SA 4EB8A 5B6PA 5BR7A 1LXCA 2P5SA 1NSFA 3MFQA 4L6CA 5A9SA 1E79D 2V4MA 1TECE 2AEJA 2CDCA 3AK4A 3HXKA 2BBWA 4OQPA 1D4OA 3NKLA 5EJGA 4B82A 3M8KA 7AT1A 1QPGA 2CYCA 4JJIA 2WJAA 1I2BA 1I3NA 1TM4E 2B1JA 4GZLA 3QU4A 4G25A 1SHKA 1QAQA 3I1IA 4UNIA 4X71A 5D6NA 5A0FA 4A10A 4BV3A 2QN8A 4RWEA 2Q0XA 5HR5A 1JXQA 1XYGA 4QFMA 5JH7F 4QREA 1JQLB 2R8EA 3E15A 1NXVA 4MGKR 3WFIA 4C78A 5E1OA 4DSNA 5FV4A 1MBZA 5B1DA 1U94A 1UPXA 2NZWA 3RQIA 5HDQA 4G81A 4NE9A 3SZGA 1LS6A 1XZIA 3JQ9A 4JGBA 2QLTA 2HXGA 3MAAC 1EFPA 1J0EA 2EGGA 4EO9A 3L93A 1WXIA 1L9KA 3U1BA 4BAUA 2YVKA 1ULZA 3IA2A 4F5EA 3R0VA 5EY5B 1J5PA 3IOYA 5K4HA 3P4UA 4YHHB 3BSSA 2XUZA 1IJEA 2WIKA 1HNXB 1X74A 3HNPA 1ZIXA 2VSYA 5G1PA 3NHRA 2BI8A 4F9EA 4PE5B 1VECA 4UZEA 2GI4A 3PX2A 3RF6A 4DEVA 4XUCA 4BVBA 5BVGA 1YJBA 1A9SA 2PWPA 4RD6A 1AZSC 4QU8A 1A71A 1JQ3A 2OPBA 3OZXA 4RHFA 5FTKA 1DLIA 1E7MA 5FTJA 3I6QA 3TAHA 2D06A 1V5WA 3ZQ4A 3ASYA 4ARVA 1EWTA 2HA2A 3DYBA 3VNQA 5CFNA 4GKVA 3T1TA 3UFBA 3DWIA 2GSWA 1VLJA 5FBZA 4J0CA 4C0QC 5AUOB 5C5EA 3AI2A 4HPXB 2C42A 3DV0A 1Y9ZA 2G77B 1B16A 2QX7A 3C98A 1SCBA 1SKBA 1JSRA 2VHYA 3P2KA 1A9YA 2ATEA 4NK4A 1MO3A 5H3HA 1EGAA 5TDHA 1OD6A 2R9VA 1Y8QB 3NB0A 4A3SA 5ITSA 2AC7A 1P62B 4LQDA 1SBQA 4OUKX 1SOWA 5KCMA 2QM8A 2DR0A 1N2HA 2EBUA 2PX2A 1SCUB 3OM9A 3EQ8A 4L0MA 4RNDB 1XE3A 2IUTA 4LXIA 3A9WA 1JA0A 5GZ6A 4QEZA 1U9YA 2GVDC 2B9VA 1IWPB 5JZSA 1TGVA 2J0QA 2LP4Y 4BNJA 4IQ8A 4IR7A 1L7AA 1O58A 1P2DA 3SJBA 4YXWD 1VIYA 4FFLA 1QUFA 4EY5A 3AR9A 2V9ZA 1G8FA 2A59A 3VKHA 3KYIB 1XMXA 4IIDA 5IAOA 1P33A 2F3RA 3FHOA 1CS4C 1WVGA 1PP4A 5G4LA 4ZWNA 4B81A 1J22A 4RIHA 5JVDB 4NE7A 3Q9LA 3V8VA 3QY0A 1MO4A 3OZBA 4IMPA 4MUXA 2C9CA 1BWQA 3OFKA 4CI9A 1VXRA 4YRDA 1XVLA 2PZKA 3BICA 4BPBA 1XHEA 2OA0A 5HRUA 2FN7A 4CEIB 1VZ3A 4XR9A 4E6EA 1NDHA 1IZ8A 3H97A 3B1XA 5GVSA 1SHJA 3LQRA 4YJHB 2QP3A 1J49A 4MCIA 4OHFA 3L8ZA 4GNKA 3H17A 4LYFA 2GUGA 2YQZA 3SQOA 4ERXA 1QDLB 3GPBA 3QGMA 3MYYA 3FWYA 4HWGA 3TQQA 1RKVA 3CBGA 1U7XA 2DAPA 5DGCA 5JD6A 4LG1A 3DTTA 5MN5A 3FLAA 3K72B 5LD2B 4DF3A 1O5IA 1G42A 5LBIA 3UMVA 4BZXA 2IF2A 3C6QA 3IQEA 3SMVA 1RLOA 4LF8B 1R9NA 1TC2A 2A0FA 2PUHA 2EP7A 3W1WA 1ZYUA 3LKZA 2CYBA 5JSQA 4EEXA 1GRQA 1T1JA 2IPNA 1RJDA 1XJQA 2C7VA 3H5AA 2WJ4A 3E03A 4I1RA 3UA3A 3B9BA 3NONA 1HNZB 1QP4A 4E13A 1R6TA 1TD9A 2BFWA 2BUAA 3M9LA 2D5LA 3Q5DA 3SEQA 3T7TA 3VGPA 1L5FA 1GLNA 1OFTA 3VX4A 5AW6A 3AUUA 4EBBA 2HJRA 5JAIA 4IQFA 2PXCA 5IAKA 3SC4A 1YA8A 5FTWA 4J0GA 3NQ41 4UNPA 3PR1A 3DMYA 5SZKB 3VC1A 1MU0A 5T67A 1RI3A 1I5RA 4RW0A 1CRWG 5FO0A 1GKUB 5EHIA 3H0EA 4FBGA 3LCVB 4DCUA 4FW8A 4ITRC 4EG0A 1QP0A 1PT5A 5GMOA 1DAHA 1LQ2A 2CVOA 3OHSX 4W63A 1YQQA 4J94A 2YY6A 5D7NA 2GYVA 1PIWA 2DKOA 2J09A 4E2FA 1DEAA 2RGDA 5T5QA 1Z37A 1SVUA 4PR0A 2PXHA 5DBGA 2ZBFA 2C59A 4PWZA 3TLCA 5SZIA 2Q5CA 3A27A 1M74A 3BQNB 2DERA 3I9OA 1T6YA 3AEKA 4RKYA 1ZC4A 2BI4A 4CVNA 4W5RA 1CQXA 4DPKA 2AOTB 3G5AA 2QRGA 1Z33A 3T5TA 1WO8A 3N2LA 5DRTA 4DV6B 4MRRA 5I7HA 4DM3A 1Z8DA 1TYDE 3DCIA 3OOJA 5DT2A 4G65A 4YRGA 1KORA 5LOVF 3A6PC 3DZ8A 4F93B 2C96A 4L7VA 1E4OA 1QYWA 3NTUA 4HMQA 2G70A 4PXSA 3X2EA 5DBHX 3HCPA 3BMCB 5YASA 4RTRA 4RM2A 1L4NA 4Y18A 4ENWA 3HLYA 2XBLA 4PW0A 1QV6A 2JBAA 4ZCPA 4QTYA 2OWDA 1X7ZA 1THGA 4W7SA 3UMBA 4HDRA 4Z0PA 3RAEC 1PQ4A 1QIDA 3ZTWA 2GEKA 4Q7QA 1FSGA 4LFCB 1WW8A 5C9ZA 3IDSA 5FQNA 1TO2E 4B2IA 4AY2A 3EGWA 2XEXA 3KUXA 4B3TB 1DOHA 4ZOBA 1M5RA 2BZGA 1SUWA 3KV3O 4K9SA 4UHCA 3VRHA 3GIDA 1K8ZB 4S2EA 3EZ9A 4KK3A 3WAGA 3HJFA 1UPTA 3CRQA 1B4DA 2X42A 4GX1A 1MVOA 1NE2A 4MWEA 4ALLA 1LB1B 2G5CA 3MCUA 4HY3A 2HB6A 5BN4B 2JD0A 2B82A 2W2KB 2XXJA 3PI6A 4EX6A 4OQEA 1SAYA 4IW3B 1RHRA 4CG3A 3D4PA 1W35A 2WUVA 3MJTA 2I2XB 1CQWA 2X4IA 4LZNA 3EOZA 3M2PA 4HB3A 4J2TA 3REOA 1OSNA 4D9BA 3MN1A 3WLOA 3D8UA 1XBTA 2P91A 3H8VA 1O03A 3TCXB 2XUDA 1P0QA 2QUJA 4PLWA 3AR7A 4YDSA 1J39A 1ZOLA 4WECA 3HBLA 3TNYA 3JZAA 3OX3A 4CN8A 4PYJA 1G8AA 1YS2X 3R3SA 3HPQA 4A8TA 1BEZA 2BGJA 1KVTA 1M67A 3VYSB 1XMPA 3QYFA 2AN9A 5IARA 4Y2TA 4WVLA 1D9ZA 5DMHA 4B45A 1QHYA 4OGLA 3FUVA 5F51A 3G82C 4OHVA 1RADA 4KQ1A 1G3MA 3FDIA 3ABZA 5C51B 3U4QB 4AKIA 1THMA 2O7SA 3LX8A 4OSOA 4DJAA 1OHHD 1OT5A 1N36B 5HGJA 1VGVA 5HF5A 2PYDA 1QHHA 1RKBA 1M2KA 5H4GA 2AGVA 1YKSA 2X5JO 3G88A 2XUJA 3LUPA 1MTOA 3PEFA 1QFSA 1NN0A 2Z2IA 4M1YA 4C7VA 3E3AA 3AINA 4LF4B 2BKLA 4NBKA 3U48A 3QZUA 4Q34A 4ENTA 5IF3A 3PHLA 1IVYA 3F5QA 3EZ7A 4L9WA 2FFJA 5KPJA 3PYMA 2YWFA 1TF5A 1RPZA 1LTHR 5CLHA 2F1KA 1GILA 2WU0A 1RWVA 1NG1A 3COYA 3DC2A 4LQ4A 1R4MA 3CKYA 4TS1A 5BUCA 4YP7A 3L8DA 3R7LA 4L72A 5K6TA 5LXTA 3OP4A 1LBIA 3EIQA 3G0BA 3PV0A 3LHFA 3PXUA 4GHWA 4MVJI 4OBXA 4TLMB 3HM9A 3CEAA 1RJWA 4ALMA 2YUIA 3AB3A 4TQ9A 3BKXA 1T2FA 3CR7A 4Q1EA 3TZEA 3GRZA 2XB2A 4GPTA 3RJMA 3HZZA 1E3TA 2R5FA 1WG8A 3KEQA 3KU1A 1Q6ZA 3LBNA 3ORQA 4IEFB 4KKVA 3RV4A 2PZMA 4O8CA 3FSGD 1CSEE 3LBYA 4DMFA 4KLRA 5EJIA 2PQ6A 4GKAA 3DTVB 2EXXA 2J7KA 4QO7A 2IIVA 4YS6A 4YQZA 3RIMA 1TOAA 5BMVF 2OQVA 1L6RA 3GJRA 5DK4A 3H2YA 1N34B 1M2OB 2MR6A 3FIJA 8GPBA 3UM9A 2VHEA 2XJ4A 1FJGB 4OFBA 1OAAA 3NGMA 4RHTA 4Y1RA 1VLQA 3PP8A 1V8DA 4RPCA 2CXPA 1EFPB 5FBRB 4EHJA 3C5EA 2DPXA 1KAGA 5C8XA 1M66A 1ZRSA 3EDRA 1V1RB 3NXSA 4NENB 3EEOA 1DAFA 4LJ8A 3VOBA 1G7SA 1NW7A 1MQAA 1SNYA 4KDCA 4K9LA 1N32B 3FTNA 4KIGA 3LYUA 4BTEA 3CM0A 2AVDA 5K7SA 1EUZA 5A4IS 1PD1A 5ALLA 1GUYA 1T6BY 2G1KA 1XXLA 1M5UA 1ZRHA 3GI1A 1RWKA 3NHWA 4HZIA 3KT3A 4PNHA 5IBQA 3TZKA 3WLIA 1HOXA 1USWA 2ZR9A 2Z2ZA 4ZQEA 3HXQA 1ZQ9A 5IJ9A 2PUVA 3R4VA 1CIJA 2GFHA 1P29A 1IWOA 2WBLC 3FF4A 4PYRA 3EF3A 3N2EA 3O5AA 3MMSA 3D0RA 4OQQA 1E9EA 3C45A 1D4AA 1VJTA 2AHRA 4M1ZA 5HJ5A 3VVCA 3AI7A 3MQFA 1QB7A 1RFGE 1QIMA 4PQFA 4QXQA 2A3NA 2PGOA 4MKXA 1L5HA 3ZI4A 4O1MA 4MI3A 1DHTA 1NAHA 1U8UA 4DA7A 3B5EA 3PC8A 5T57A 4Y2XA 1S96A 2VQFB 1N1EA 1XOIA 1LNQA 3BH0A 4H9GA 4JB2A 5BMVA 4S04A 2C0PA 3LQ4A 4N0DA 1GPDG 3MUOA 1NLFA 3PJGA 2HADA 3ZWAA 4AW9A 3ECCA 4JLUA 4BVJA 3BE8A 3JQBC 5ALDA 5HK9A 5A4DA 3ZJVA 4UOZA 1TAHA 4NCBA 4IMRA 1NF9A 3RV3A 4RL4A 2OQRA 4JKIA 4MCJA 4R1PA 4D4JA 4OQFA 1Z45A 1UWLA 2XMDA 3PNOA 5AW8A 3IIJA 3H04A 5ADWA 5LP6B 3IESA 2FMIA 2QN9A 3GGCA 2CJYA 3PPIA 4MH0R 4C07A 1I7QB 1OI4A 4UU7A 2QB5A 1R6AA 3BAZA 3G2QA 1KH1A 3ASUA 4YACA 3UAZA 2P5UA 2WA1A 1A9RA 1OFHA 4PR3A 4MUMA 5L6LB 1EWRA 1HE3A 2MOKA 1TU0A 1NXPA 2PSFA 2VR1A 1MB9A 3RIEA 5BV2P 3DONA 3LYHA 1TTTA 1EVZA 2XCTB 3ZNNA 4GX2A 4UEJA 3H2BA 3W04A 2HHJA 2D6FA 3AVVA 1II8B 4FN5A 1JFRA 4N18A 4NJEA 1YMQA 3I76A 4B87A 1PW7A 5CDGA 4JI5B 1JHUA 3WQHA 2AS0A 4RQTA 2C8KA 3B2QA 4AJIA 4G41A 1J07A 1ZCJA 1T4DA 2Q6VA 3EG5A 3Q9NA 3C3BA 4F9TA 2QPLA 4Y2HA 3BRWA 3L01A 2XKAA 4RD3A 5AXAA 5JAHA 4S24A 8AT1A 1ZD3A 3B78A 3J7TA 3CPSA 4RY0A 4URFA 3DE6X 2FF5A 4WNIA 1P6UA 1N8KA 4MLZA 4HQFA 2QD1A 2WZCA 1APBA 4BO7A 4E51A 3T34A 1VRWA 3OZAA 3GDFA 5IZCC 3QEAZ 5MFZA 3OF5A 1R5NA 4M8LA 5AVTA 2BFBB 3SFTA 2FXIA 3NEJA 3WL3A 1XVVA 4UUAA 5K3DA 2Z4RA 4G5OA 1FFAA 4WA8A 2IS1A 3ZDBA 3A26A 1JEJA 2WYUA 4BMDA 3UAGA 3ZGNA 3PFNA 3FSEA 4U2DA 4Y2JA 2FQXA 2AF4C 3EQ9A 4QQKA 4MB2A 4FWTA 1K6XA 1PR4A 1QCYA 4QUAA 2BISA 4QJIA 4TL6A 3U3XA 4Q9DA 5KSYA 2VDWB 4HUJA 4AS2A 4YAIA 2PGXA 2VQ3A 4N3AA 1ENYA 1GGVA 2O3UA 1AKMA 4ZZ3A 2AB0A 5P8WA 1H23A 3BJIC 3E27A 3L1VA 1OXTA 1RVDA 1UUFA 1YZ3A 2PLWA 3D2CA 3KLOA 1DXHA 1IN5A 3H18A 2OC4A 5ALNA 2B5WA 4CIDA 1E9DA 2B7LA 3F6CA 2QE7A 1PQWA 1OUMA 2VPYA 3GJQA 4HWOA 2WVJA 2ALJA 3MB8A 4RPGA 4EI8A 3W2TA 4IIXA 1XRRA 1S2MA 1JGTA 2ECQA 2O3JA 1JAIA 2YY5A 3DDHA 3DLCA 3R09A 1H5NA 1SH7A 5E38A 4XDHA 1WWKA 1JJ7A 2OR3A 3LV8A 4G24A 4IIGA 4CTJA 1DDOA 1LLQA 4Q16A 5A62A 2XUAA 5LLTA 2IYPA 5GM2A 5J63A 3VKVA 2QP9X 5EQFA 4RULA 2FN3A 4RIFA 1GNQA 1JB1A 3PFCA 3DEAA 3ENVA 2QJRA 1NVKA 2QZ9A 4K2AA 3JCZA 4MV0A 4NZPA 1CP3A 3NVKI 2C3PA 3RUFA 1FMTA 5JJCA 1JBQA 4DLRA 3T5DA 3MM4A 1DEXA 1QJ4A 5AJTA 1S8AA 1JT2A 1T3LA 3UVEA 5CH3A 3ZBQA 1WVMA 3OLXA 2FRDC 2ZT5A 2HJ9A 1IXRC 4BN5A 2FX5A 1WOMA 1P7CA 2PIDA 4KUHA 4TMZA 5DKFA 4YAGA 6REQA 1GXSB 3A70A 1GTG1 3O3OB 3RC3A 1KO5A 3NHUA 2OOSA 3OPMA 1QNFA 5HMLA 3GRCA 5EQJB 4CHTA 2C4TA 3LZCA 1OXXK 1XRMA 3FFWA 1YB5A 1DIOB 3NLLA 4CWAA 4IO1A 2GYYA 1FFDA 3A6HA 1ID1A 2J4FA 1N2BA 4N41A 2IU6A 4NK5A 4BNUA 1MLDA 3TNJA 3EIHA 1C2YA 1L1FA 5K9ZA 1XN4A 5K0FA 4BNMA 4KFCA 3KQLA 1THZA 1H6BA 2NO9A 5JD3A 3S2EA 4ISBA 2VLBA 4Q9KA 5I7AA 3VHRA 3LC7O 2EKDA 1E9AA 1P6XA 4Q12A 5CH8A 2CE7A 2H2HA 3UKJA 4CIYA 5E9QA 2UZAA 1XJ5A 2D7JA 3IB6A 1A77A 1R6UA 3RAFC 4MB0A 3C15C 4M7WA 4IF6A 4AS1A 1JDJA 1EX1A 1O96B 2DBVO 1TYCA 2GO1A 2IF0A 2YINC 3GGPA 4P38A 1EUCB 4YCDA 5JAQA 4ND3A 1RIIA 4M9SA 1CY1A 1I7PA 4CODB 3CKLA 1K6IA 1XC7A 4I19A 4MWZA 1QR2A 3KB2A 3IJEB 2DFTA 1G21E 2JGKA 3OCZA 4AO6A 2HMVA 2H17A 3LOPA 4CKEB 5K6AC 3KFVA 4RPKA 1VPWA 4HVCA 3L8HA 4AP9A 1A5AB 2FUCA 3STWA 4IGIA 5BNWA 3HHEA 4YT2A 3L18A 4JUDX 1HM5A 1E4EA 1U5AA 2O20A 2Q29A 3GFOA 4N5MA 1ORHA 4UUPA 4DILA 3GY0A 5HTOA 3DO5A 2A1UA