1ZUGA

Structure of phage 434 cro protein, nmr, 20 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTKRGKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure and stability of phage 434 Cro protein.
pubmed doi rcsb
source organism Phage 434
molecule tags Transcription regulation
molecule keywords PHAGE 434 CRO PROTEIN
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1997-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zugA00
4X4CA 2AXZA 3OP9A 1BDIA 3LISA 1O4XA 4YG7B 3OQMA 2BNMA 2PIJA 5A7LA 2O49A 1R63A 4X4HA 3BS3A 1WETA 2IU7A 3L1PA 2MEZA 2L8NA 4PU7A 2OR1L 4MCXA 1LCDA 4FN3A 4X4DA 1L1MA 2B5AA 2L49A 1GT0C 2O4AA 2WIUB 2IVBA 3GN5A 4GHJA 1S7EA 2PUAA 1QP4A 2IUOA 4JQDA 1ZZ8A 2AXUA 1ZZCA 3QF3A 3F51A 4IWRA 2BNNA 3SCGA 3OMTA 2IV1A 4O8BA 2XJ3A 3SCFA 4Z59A 1ZAYA 1QP0A 1ZZ7A 3ZHIA 4JCYA 1NEQA 3B7HA 3CLCA 3RZZA 1DWKA 1X2LA 2PUFA 2AXVA 2XCJA 3SCHA 4Z5HA 1ZZ6A 4X4IA 2KZ8A 2LYRA 2WUSR 3KJXA 1ZS4A 2JVLA 2IVGA 1YSEA 1AU7A 4FBIA 2KEJA 4JCXA 3DNVB 2D5VA 1ZZBA 2PUEA 2PUBA 4F8DA 2KPJA 3FMYA 2XSDC 1Y7YA 4YBAA 1RPEL 1QQBA 3F52A 3ZKCA 3MLFA 3KXAA 3QQ6A 3GN5B 3F6WA 3HZIB 2BNOA 1UTXA 1XWRA 1RZRD 1LQCA 4J1XA 2KEIA 3JXCL 2MQKA 3S8QA 1RIOA 3GBFA 3PXPA 3LFPA 2AWIA 4Y42A 2OFYA 1B0NA 3EUSA 3QWGA 5K98B 3CROL 4MCTA 4YARA 1JH9A 2ICPA 3BD1A 1R69A 2GRLA 2GZUA 2AUWA 4IVZA 1WH8A 2LYPA 1NERA 3JXDL 4I8TA 2LYSA 2PUGA 2PPXA 3FYAA 1BDHA 1ZZ9A 1QP7A 3D1NI 1PNRA 4X4FA 2LCVA 2XIUA 2FJRA 2LYQA 4GQMA 4YG1A 4Z5DA 1CQTA 1RZSA 4I6UA 3UFDA 1IC8A 3G5GA 1RZRA 4J1WA 3IVPA 1ZPQA 2CROA 2EBYA 2O38A 3JXBC 1QQAA 1X57A 3VK0A 1PRAA 4X4BA 4Z58A 3QYXA 1ZVVA 1E3OC 1WIZA 1JWLA 1ZUGA 3BDNA 1POUA 3FYMA 2HINA 1VPWA 2CSFA 3O9XA 1HF0A 2R1JL 1JFTA 2PUCA 1UXDA 2HSGA 2LYKA 2LYJA 3R1FA 3KZ3A 2IVQA 4I6TA 2A6CA 2AW6A 4PU4C 4X4EA 1ADRA 3CECA 4Z5CA 3G7DA 2H8RA 1LMB3 3ZHMA 2EWTA 1PRUA 2PUDA 1QPZA 1PERL 1LCCA 2LYLA 1OCTC 4YG4A 2XI8A 3OQNA 3U3WA 1WH6A 2GRMA 4X4GA 2ICTA 2KEKA 4PU3C 2BJCA 1EFAA 2PE5A 1UXCA 1Y9QA 3H5TA 1LLIA 4OB4A 2R63A 3TRBA 1DW9A 2JCGA 4IA8A 1PRVA 4NDWA 3OQOA 1JFSA 1CJGA 2EF8A 4PU8A 4I6RA 1OSLA 1SQ8A
chains in the Genus database with same CATH superfamily
2AXZA 3OP9A 2O49A 4X4HA 3L1PA 2FFHA 2J7WA 2HCSA 1LCDA 1QZXA 1L1MA 2LNMA 1S7EA 2PUAA 1QP4A 2IUOA 1ZZ8A 2AXUA 1ZZCA 4IWRA 2BNNA 3GZCA 2IV1A 4Z59A 4JCYA 3B7HA 4WVLA 2PUFA 2KZ8A 2JQEA 1ZS4A 1YSEA 3LQXA 2KEJA 4JCXA 4F8DA 2MXDA 2PXKA 1Y7YA 3MLFA 3A9YA 2KEIA 3JXCL 1RIOA 3S8QA 2PXLA 1B0NA 3CROL 4ER3A 1JH9A 4IVZA 1NERA 1BDHA 2FJRA 1RZSA 3G5GA 2EBYA 3VK0A 1PRAA 4X4BA 4Z58A 3GZDC 1POUA 3FYMA 1VPWA 1HF0A 3TEPA 4PU4C 1ADRA 3NXHA 3CECA 4Q2JA 3G7DA 3SR4A 2EWTA 2HCNA 3ME5A 1OCTC 2ODRD 5JUWA 1Y9QA 2PXPA 4OB4A 2R63A 3TRBA 4IA8A 2EF8A 4I6RA 1OSLA 1SQ8A 3GUUA 2LLVA 3M9LA 5A7LA 2YBDA 3BS3A 1NW3A 2IU7A 3QOWA 3NROA 2OR1L 2L49A 2O4AA 2IVBA 3QF3A 3F51A 3SCGA 3OMTA 1NEQA 3A9XA 2M4HA 3SCHA 4Z5HA 2LYRA 5DSXA 2JVLA 2IVGA 4FBIA 2XXQA 3DNVB 5DTRA 4YBAA 3F52A 3KXAA 3QQ6A 3GN5B 3F6WA 2BNOA 1UTXA 1HQ1A 3PXPA 3LFPA 3QWGA 5K98B 2GRLA 2LYPA 3ZPXA 4EK9A 1ZZ9A 1IC8A 4I6UA 3UFDA 4J1WA 3JXBC 3DM5A 2HINA 2CSFA 1JFTA 2PUCA 5GAGi 2A6CA 3ZHMA 1PRUA 1QPZA 1PERL 1LCCA 2LYLA 3GZDA 2PXEA 4X4GA 2BJCA 1UXCA 5DRTA 3PE5A 1DULA 2JCGA 3OQOA 1PRVA 1JFSA 1CJGA 4X4CA 1BDIA 4YG7B 3OQMA 2BNMA 2PIJA 1WETA 4PU7A 4FN3A 2HFZA 1GT0C 2WIUB 4JQDA 2PXVA 3NZLA 3SCFA 4O8BA 1ZAYA 1QB2A 3CLCA 3G0TA 3RZZA 2L1PA 2AXVA 2XCJA 2WUSR 3KJXA 1AU7A 2D5VA 4EKIA 1ZZBA 2PUEA 2PUBA 2KPJA 2XSDC 1RPEL 1U2ZA 2J7UA 1QQBA 5DTQA 3HZIB 3UWPA 4J1XA 3GBFA 4EQZA 3EUSA 4ER6A 2ICPA 3BD1A 4EZIA 1WH8A 3JXDL 5DRYA 2LYSA 4DE8A 3D1NI 2PXUA 4X4FA 2XIUA 2LYQA 3OKZA 4EKGA 2PXQA 3IVPA 2CROA 1QQAA 1X57A 1E3OC 1WIZA 3BDNA 3A9ZA 3O9XA 2HSGA 2LYKA 2LYJA 3R1FA 4I6TA 2IVQA 2AW6A 4X4EA 4Z5CA 5DT2A 1LMB3 2PUDA 1MFQC 4DE9A 4YG4A 2XI8A 3U3WA 2ICTA 2KEKA 4PU3C 1EFAA 1LLIA 2V3CC 4NDWA 4PU8A 3VWSA 3LISA 1O4XA 1R63A 3QOXA 3R09A 2MEZA 2L8NA 4MCXA 4X4DA 2B5AA 3NDBB 4GHJA 3GN5A 2PXFA 2XJ3A 1QP0A 1ZZ7A 3ZHIA 1DWKA 1X2LA 1ZZ6A 4X4IA 3MEJA 3QFIA 2LLWA 3FMYA 4OBMA 3KL4A 3ZKCA 2PXDA 3OWQA 1XWRA 1RZRD 1LQCA 2MQKA 3TELA 2AWIA 4Y42A 2OFYA 5GAHi 4MCTA 4YARA 2XXAA 1R69A 2GZUA 4ER5A 2AUWA 4I8TA 2PUGA 2PPXA 3FYAA 1QP7A 1PNRA 2LCVA 4GQMA 2VEOA 4YG1A 4Z5DA 1CQTA 4ER7A 1RZRA 1ZPQA 2O38A 3QYXA 1ZVVA 1JWLA 1ZUGA 5DTMA 4ER0A 2R1JL 1UXDA 3KZ3A 3TFLA 3SX0A 2XXPA 2H8RA 2PXBA 3OQNA 1WH6A 2GRMA 2PXTA 4HRAA 2PE5A 3H5TA 1DW9A
chains in the Genus database with same CATH topology
4X4CA 2AXZA 3OP9A 1BDIA 3LISA 1O4XA 4YG7B 3OQMA 2BNMA 2PIJA 5A7LA 2O49A 1R63A 4X4HA 3BS3A 1WETA 2IU7A 3L1PA 2MEZA 2L8NA 4PU7A 2OR1L 4MCXA 1LCDA 4FN3A 4X4DA 1L1MA 2B5AA 2L49A 1GT0C 2O4AA 2WIUB 2IVBA 3GN5A 4GHJA 1S7EA 2PUAA 1QP4A 2IUOA 4JQDA 1ZZ8A 2AXUA 1ZZCA 3QF3A 3F51A 4IWRA 2BNNA 3SCGA 3OMTA 2IV1A 4O8BA 2XJ3A 3SCFA 4Z59A 1ZAYA 1QP0A 1ZZ7A 3ZHIA 4JCYA 1NEQA 3B7HA 3CLCA 3RZZA 1DWKA 1X2LA 2PUFA 2AXVA 2XCJA 3SCHA 4Z5HA 1ZZ6A 4X4IA 2KZ8A 2LYRA 2WUSR 3KJXA 1ZS4A 2JVLA 2IVGA 1YSEA 1AU7A 4FBIA 2KEJA 4JCXA 3DNVB 2D5VA 1ZZBA 2PUEA 2PUBA 4F8DA 2KPJA 3FMYA 2XSDC 1Y7YA 4YBAA 1RPEL 1QQBA 3F52A 3ZKCA 3MLFA 3KXAA 3QQ6A 3GN5B 3F6WA 3HZIB 2BNOA 1UTXA 1XWRA 1RZRD 1LQCA 4J1XA 2KEIA 3JXCL 2MQKA 3S8QA 1RIOA 3GBFA 3PXPA 3LFPA 2AWIA 4Y42A 2OFYA 1B0NA 3EUSA 3QWGA 5K98B 3CROL 4MCTA 4YARA 1JH9A 2ICPA 3BD1A 1R69A 2GRLA 2GZUA 2AUWA 4IVZA 1WH8A 2LYPA 1NERA 3JXDL 4I8TA 2LYSA 2PUGA 2PPXA 3FYAA 1BDHA 1ZZ9A 1QP7A 3D1NI 1PNRA 4X4FA 2LCVA 2XIUA 2FJRA 2LYQA 4GQMA 4YG1A 4Z5DA 1CQTA 1RZSA 4I6UA 3UFDA 1IC8A 3G5GA 1RZRA 4J1WA 3IVPA 1ZPQA 2CROA 2EBYA 2O38A 3JXBC 1QQAA 1X57A 3VK0A 1PRAA 4X4BA 4Z58A 3QYXA 1ZVVA 1E3OC 1WIZA 1JWLA 1ZUGA 3BDNA 1POUA 3FYMA 2HINA 1VPWA 2CSFA 3O9XA 1HF0A 2R1JL 1JFTA 2PUCA 1UXDA 2HSGA 2LYKA 2LYJA 3R1FA 3KZ3A 2IVQA 4I6TA 2A6CA 2AW6A 4PU4C 4X4EA 1ADRA 3CECA 4Z5CA 3G7DA 2H8RA 1LMB3 3ZHMA 2EWTA 1PRUA 2PUDA 1QPZA 1PERL 1LCCA 2LYLA 1OCTC 4YG4A 2XI8A 3OQNA 3U3WA 1WH6A 2GRMA 4X4GA 2ICTA 2KEKA 4PU3C 2BJCA 1EFAA 2PE5A 1UXCA 1Y9QA 3H5TA 1LLIA 4OB4A 2R63A 3TRBA 1DW9A 2JCGA 4IA8A 1PRVA 4NDWA 3OQOA 1JFSA 1CJGA 2EF8A 4PU8A 4I6RA 1OSLA 1SQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4C A;  2AXZ A;  3OP9 A;  1BDI A;  3LIS A;  1O4X A;  4YG7 B;  3OQM A;  2BNM A;  2PIJ A;  5A7L A;  2O49 A;  1R63 A;  4X4H A;  3BS3 A;  1WET A;  2IU7 A;  3L1P A;  2MEZ A;  2L8N A;  4PU7 A;  2OR1 L;  4MCX A;  1LCD A;  4FN3 A;  4X4D A;  1L1M A;  2B5A A;  2L49 A;  1GT0 C;  2O4A A;  2WIU B;  2IVB A;  3GN5 A;  4GHJ A;  1S7E A;  2PUA A;  1QP4 A;  2IUO A;  4JQD A;  1ZZ8 A;  2AXU A;  1ZZC A;  3QF3 A;  3F51 A;  4IWR A;  2BNN A;  3SCG A;  3OMT A;  2IV1 A;  4O8B A;  2XJ3 A;  3SCF A;  4Z59 A;  1ZAY A;  1QP0 A;  1ZZ7 A;  3ZHI A;  4JCY A;  1NEQ A;  3B7H A;  3CLC A;  3RZZ A;  1DWK A;  1X2L A;  2PUF A;  2AXV A;  2XCJ A;  3SCH A;  4Z5H A;  1ZZ6 A;  4X4I A;  2KZ8 A;  2LYR A;  2WUS R;  3KJX A;  1ZS4 A;  2JVL A;  2IVG A;  1YSE A;  1AU7 A;  4FBI A;  2KEJ A;  4JCX A;  3DNV B;  2D5V A;  1ZZB A;  2PUE A;  2PUB A;  4F8D A;  2KPJ A;  3FMY A;  2XSD C;  1Y7Y A;  4YBA A;  1RPE L;  1QQB A;  3F52 A;  3ZKC A;  3MLF A;  3KXA A;  3QQ6 A;  3GN5 B;  3F6W A;  3HZI B;  2BNO A;  1UTX A;  1XWR A;  1RZR D;  1LQC A;  4J1X A;  2KEI A;  3JXC L;  2MQK A;  3S8Q A;  1RIO A;  3GBF A;  3PXP A;  3LFP A;  2AWI A;  4Y42 A;  2OFY A;  1B0N A;  3EUS A;  3QWG A;  5K98 B;  3CRO L;  4MCT A;  4YAR A;  1JH9 A;  2ICP A;  3BD1 A;  1R69 A;  2GRL A;  2GZU A;  2AUW A;  4IVZ A;  1WH8 A;  2LYP A;  1NER A;  3JXD L;  4I8T A;  2LYS A;  2PUG A;  2PPX A;  3FYA A;  1BDH A;  1ZZ9 A;  1QP7 A;  3D1N I;  1PNR A;  4X4F A;  2LCV A;  2XIU A;  2FJR A;  2LYQ A;  4GQM A;  4YG1 A;  4Z5D A;  1CQT A;  1RZS A;  4I6U A;  3UFD A;  1IC8 A;  3G5G A;  1RZR A;  4J1W A;  3IVP A;  1ZPQ A;  2CRO A;  2EBY A;  2O38 A;  3JXB C;  1QQA A;  1X57 A;  3VK0 A;  1PRA A;  4X4B A;  4Z58 A;  3QYX A;  1ZVV A;  1E3O C;  1WIZ A;  1JWL A;  1ZUG A;  3BDN A;  1POU A;  3FYM A;  2HIN A;  1VPW A;  2CSF A;  3O9X A;  1HF0 A;  2R1J L;  1JFT A;  2PUC A;  1UXD A;  2HSG A;  2LYK A;  2LYJ A;  3R1F A;  3KZ3 A;  2IVQ A;  4I6T A;  2A6C A;  2AW6 A;  4PU4 C;  4X4E A;  1ADR A;  3CEC A;  4Z5C A;  3G7D A;  2H8R A;  1LMB 3;  3ZHM A;  2EWT A;  1PRU A;  2PUD A;  1QPZ A;  1PER L;  1LCC A;  2LYL A;  1OCT C;  4YG4 A;  2XI8 A;  3OQN A;  3U3W A;  1WH6 A;  2GRM A;  4X4G A;  2ICT A;  2KEK A;  4PU3 C;  2BJC A;  1EFA A;  2PE5 A;  1UXC A;  1Y9Q A;  3H5T A;  1LLI A;  4OB4 A;  2R63 A;  3TRB A;  1DW9 A;  2JCG A;  4IA8 A;  1PRV A;  4NDW A;  3OQO A;  1JFS A;  1CJG A;  2EF8 A;  4PU8 A;  4I6R A;  1OSL A;  1SQ8 A; 
#chains in the Genus database with same CATH topology
 2AXZ A;  3OP9 A;  2O49 A;  4X4H A;  3L1P A;  2FFH A;  2J7W A;  2HCS A;  1LCD A;  1QZX A;  1L1M A;  2LNM A;  1S7E A;  2PUA A;  1QP4 A;  2IUO A;  1ZZ8 A;  2AXU A;  1ZZC A;  4IWR A;  2BNN A;  3GZC A;  2IV1 A;  4Z59 A;  4JCY A;  3B7H A;  4WVL A;  2PUF A;  2KZ8 A;  2JQE A;  1ZS4 A;  1YSE A;  3LQX A;  2KEJ A;  4JCX A;  4F8D A;  2MXD A;  2PXK A;  1Y7Y A;  3MLF A;  3A9Y A;  2KEI A;  3JXC L;  1RIO A;  3S8Q A;  2PXL A;  1B0N A;  3CRO L;  4ER3 A;  1JH9 A;  4IVZ A;  1NER A;  1BDH A;  2FJR A;  1RZS A;  3G5G A;  2EBY A;  3VK0 A;  1PRA A;  4X4B A;  4Z58 A;  3GZD C;  1POU A;  3FYM A;  1VPW A;  1HF0 A;  3TEP A;  4PU4 C;  1ADR A;  3NXH A;  3CEC A;  4Q2J A;  3G7D A;  3SR4 A;  2EWT A;  2HCN A;  3ME5 A;  1OCT C;  2ODR D;  5JUW A;  1Y9Q A;  2PXP A;  4OB4 A;  2R63 A;  3TRB A;  4IA8 A;  2EF8 A;  4I6R A;  1OSL A;  1SQ8 A;  3GUU A;  2LLV A;  3M9L A;  5A7L A;  2YBD A;  3BS3 A;  1NW3 A;  2IU7 A;  3QOW A;  3NRO A;  2OR1 L;  2L49 A;  2O4A A;  2IVB A;  3QF3 A;  3F51 A;  3SCG A;  3OMT A;  1NEQ A;  3A9X A;  2M4H A;  3SCH A;  4Z5H A;  2LYR A;  5DSX A;  2JVL A;  2IVG A;  4FBI A;  2XXQ A;  3DNV B;  5DTR A;  4YBA A;  3F52 A;  3KXA A;  3QQ6 A;  3GN5 B;  3F6W A;  2BNO A;  1UTX A;  1HQ1 A;  3PXP A;  3LFP A;  3QWG A;  5K98 B;  2GRL A;  2LYP A;  3ZPX A;  4EK9 A;  1ZZ9 A;  1IC8 A;  4I6U A;  3UFD A;  4J1W A;  3JXB C;  3DM5 A;  2HIN A;  2CSF A;  1JFT A;  2PUC A;  5GAG i;  2A6C A;  3ZHM A;  1PRU A;  1QPZ A;  1PER L;  1LCC A;  2LYL A;  3GZD A;  2PXE A;  4X4G A;  2BJC A;  1UXC A;  5DRT A;  3PE5 A;  1DUL A;  2JCG A;  3OQO A;  1PRV A;  1JFS A;  1CJG A;  4X4C A;  1BDI A;  4YG7 B;  3OQM A;  2BNM A;  2PIJ A;  1WET A;  4PU7 A;  4FN3 A;  2HFZ A;  1GT0 C;  2WIU B;  4JQD A;  2PXV A;  3NZL A;  3SCF A;  4O8B A;  1ZAY A;  1QB2 A;  3CLC A;  3G0T A;  3RZZ A;  2L1P A;  2AXV A;  2XCJ A;  2WUS R;  3KJX A;  1AU7 A;  2D5V A;  4EKI A;  1ZZB A;  2PUE A;  2PUB A;  2KPJ A;  2XSD C;  1RPE L;  1U2Z A;  2J7U A;  1QQB A;  5DTQ A;  3HZI B;  3UWP A;  4J1X A;  3GBF A;  4EQZ A;  3EUS A;  4ER6 A;  2ICP A;  3BD1 A;  4EZI A;  1WH8 A;  3JXD L;  5DRY A;  2LYS A;  4DE8 A;  3D1N I;  2PXU A;  4X4F A;  2XIU A;  2LYQ A;  3OKZ A;  4EKG A;  2PXQ A;  3IVP A;  2CRO A;  1QQA A;  1X57 A;  1E3O C;  1WIZ A;  3BDN A;  3A9Z A;  3O9X A;  2HSG A;  2LYK A;  2LYJ A;  3R1F A;  4I6T A;  2IVQ A;  2AW6 A;  4X4E A;  4Z5C A;  5DT2 A;  1LMB 3;  2PUD A;  1MFQ C;  4DE9 A;  4YG4 A;  2XI8 A;  3U3W A;  2ICT A;  2KEK A;  4PU3 C;  1EFA A;  1LLI A;  2V3C C;  4NDW A;  4PU8 A;  3VWS A;  3LIS A;  1O4X A;  1R63 A;  3QOX A;  3R09 A;  2MEZ A;  2L8N A;  4MCX A;  4X4D A;  2B5A A;  3NDB B;  4GHJ A;  3GN5 A;  2PXF A;  2XJ3 A;  1QP0 A;  1ZZ7 A;  3ZHI A;  1DWK A;  1X2L A;  1ZZ6 A;  4X4I A;  3MEJ A;  3QFI A;  2LLW A;  3FMY A;  4OBM A;  3KL4 A;  3ZKC A;  2PXD A;  3OWQ A;  1XWR A;  1RZR D;  1LQC A;  2MQK A;  3TEL A;  2AWI A;  4Y42 A;  2OFY A;  5GAH i;  4MCT A;  4YAR A;  2XXA A;  1R69 A;  2GZU A;  4ER5 A;  2AUW A;  4I8T A;  2PUG A;  2PPX A;  3FYA A;  1QP7 A;  1PNR A;  2LCV A;  4GQM A;  2VEO A;  4YG1 A;  4Z5D A;  1CQT A;  4ER7 A;  1RZR A;  1ZPQ A;  2O38 A;  3QYX A;  1ZVV A;  1JWL A;  1ZUG A;  5DTM A;  4ER0 A;  2R1J L;  1UXD A;  3KZ3 A;  3TFL A;  3SX0 A;  2XXP A;  2H8R A;  2PXB A;  3OQN A;  1WH6 A;  2GRM A;  2PXT A;  4HRA A;  2PE5 A;  3H5T A;  1DW9 A; 
#chains in the Genus database with same CATH homology
 4X4C A;  2AXZ A;  3OP9 A;  1BDI A;  3LIS A;  1O4X A;  4YG7 B;  3OQM A;  2BNM A;  2PIJ A;  5A7L A;  2O49 A;  1R63 A;  4X4H A;  3BS3 A;  1WET A;  2IU7 A;  3L1P A;  2MEZ A;  2L8N A;  4PU7 A;  2OR1 L;  4MCX A;  1LCD A;  4FN3 A;  4X4D A;  1L1M A;  2B5A A;  2L49 A;  1GT0 C;  2O4A A;  2WIU B;  2IVB A;  3GN5 A;  4GHJ A;  1S7E A;  2PUA A;  1QP4 A;  2IUO A;  4JQD A;  1ZZ8 A;  2AXU A;  1ZZC A;  3QF3 A;  3F51 A;  4IWR A;  2BNN A;  3SCG A;  3OMT A;  2IV1 A;  4O8B A;  2XJ3 A;  3SCF A;  4Z59 A;  1ZAY A;  1QP0 A;  1ZZ7 A;  3ZHI A;  4JCY A;  1NEQ A;  3B7H A;  3CLC A;  3RZZ A;  1DWK A;  1X2L A;  2PUF A;  2AXV A;  2XCJ A;  3SCH A;  4Z5H A;  1ZZ6 A;  4X4I A;  2KZ8 A;  2LYR A;  2WUS R;  3KJX A;  1ZS4 A;  2JVL A;  2IVG A;  1YSE A;  1AU7 A;  4FBI A;  2KEJ A;  4JCX A;  3DNV B;  2D5V A;  1ZZB A;  2PUE A;  2PUB A;  4F8D A;  2KPJ A;  3FMY A;  2XSD C;  1Y7Y A;  4YBA A;  1RPE L;  1QQB A;  3F52 A;  3ZKC A;  3MLF A;  3KXA A;  3QQ6 A;  3GN5 B;  3F6W A;  3HZI B;  2BNO A;  1UTX A;  1XWR A;  1RZR D;  1LQC A;  4J1X A;  2KEI A;  3JXC L;  2MQK A;  3S8Q A;  1RIO A;  3GBF A;  3PXP A;  3LFP A;  2AWI A;  4Y42 A;  2OFY A;  1B0N A;  3EUS A;  3QWG A;  5K98 B;  3CRO L;  4MCT A;  4YAR A;  1JH9 A;  2ICP A;  3BD1 A;  1R69 A;  2GRL A;  2GZU A;  2AUW A;  4IVZ A;  1WH8 A;  2LYP A;  1NER A;  3JXD L;  4I8T A;  2LYS A;  2PUG A;  2PPX A;  3FYA A;  1BDH A;  1ZZ9 A;  1QP7 A;  3D1N I;  1PNR A;  4X4F A;  2LCV A;  2XIU A;  2FJR A;  2LYQ A;  4GQM A;  4YG1 A;  4Z5D A;  1CQT A;  1RZS A;  4I6U A;  3UFD A;  1IC8 A;  3G5G A;  1RZR A;  4J1W A;  3IVP A;  1ZPQ A;  2CRO A;  2EBY A;  2O38 A;  3JXB C;  1QQA A;  1X57 A;  3VK0 A;  1PRA A;  4X4B A;  4Z58 A;  3QYX A;  1ZVV A;  1E3O C;  1WIZ A;  1JWL A;  1ZUG A;  3BDN A;  1POU A;  3FYM A;  2HIN A;  1VPW A;  2CSF A;  3O9X A;  1HF0 A;  2R1J L;  1JFT A;  2PUC A;  1UXD A;  2HSG A;  2LYK A;  2LYJ A;  3R1F A;  3KZ3 A;  2IVQ A;  4I6T A;  2A6C A;  2AW6 A;  4PU4 C;  4X4E A;  1ADR A;  3CEC A;  4Z5C A;  3G7D A;  2H8R A;  1LMB 3;  3ZHM A;  2EWT A;  1PRU A;  2PUD A;  1QPZ A;  1PER L;  1LCC A;  2LYL A;  1OCT C;  4YG4 A;  2XI8 A;  3OQN A;  3U3W A;  1WH6 A;  2GRM A;  4X4G A;  2ICT A;  2KEK A;  4PU3 C;  2BJC A;  1EFA A;  2PE5 A;  1UXC A;  1Y9Q A;  3H5T A;  1LLI A;  4OB4 A;  2R63 A;  3TRB A;  1DW9 A;  2JCG A;  4IA8 A;  1PRV A;  4NDW A;  3OQO A;  1JFS A;  1CJG A;  2EF8 A;  4PU8 A;  4I6R A;  1OSL A;  1SQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...