1ZUUA

Crystal structure of the yeast bzz1 first sh3 domain at 0.97-a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
b'ENKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of yeast SH3 domains
rcsb
molecule keywords BZZ1 protein
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zuuA00
4ZNXA 3VS2A 1E6GA 1M3AA 2PNIA 1X2QA 3REBB 1FYNA 1NEGA 4AFQC 2YUQA 4LNPA 3H0HA 1OOTA 2L3PA 4LE9A 1CKBA 2EGCA 3RBBB 1KSWA 3KFVA 2JMCA 1J3TA 1MV0B 5IXBA 2X3WD 1QWFA 4OMQA 3QWYA 2K2MA 2P4RA 4GBQA 1CSKA 1SSHA 1AWXA 2A28A 1GL5A 1CKAA 1UUEA 5GJWB 1N5ZA 1QKWA 2O88A 2C0TA 1VYTA 1UGVA 2DL5A 3R6NA 2K3BA 4OMOA 3VRZA 2D8JA 2RF0A 2ENMA 2RMOA 2KT1A 3REAB 2AZSA 1AEYA 4AFZC 3RNJA 3PVQA 2DLPA 1AOJA 2JMAA 2G6FX 4J9HA 2VKNA 3EG0A 5IH2A 1ABOA 5HCKA 3I35A 1W70A 2W0ZA 2RPNA 4RTWA 2DL3A 2H8HA 3PE0A 2KE9A 3NHNA 4CC3A 2RN8A 2DBMA 3M0SA 4RTXA 1UJ0A 3QWXX 1BU1A 3TSZA 2O9SA 3VS3A 1NLPC 1WDXA 2MIOA 3M0QA 1OV3A 1PRMC 1Y0MA 1YCSB 2HCKA 3C0CA 1SHFA 4JJCA 2KT8A 4J9FA 1QCFA 4D8DA 1UE9A 3ZL7C 2C0IA 2DF6A 2BZYA 1WA7A 2GTOA 2K79A 2M51A 4J9EA 4RTVA 4Z89A 1ZSGA 4HVWA 2FPDA 1JU5C 2GQIA 3VRYA 2GGRA 1G83A 2AZVA 2KBTA 1GBQA 4CC7A 2EYYA 1BK2A 1M8MA 1ZUYA 2D8HA 2YT6A 2J6KA 1NLOC 2DE0X 2DA9A 2K7AA 2EPDA 4RTUA 2O9VA 4DEXA 1AWOA 1Y57A 1GRIA 1BB9A 2SRCA 2J05A 1H8KA 1HJDA 4DEYA 1VA7A 1K0XA 2KXDA 2LQNA 4E6RA 5I22A 3U23A 2J6OA 2C0OA 2A37A 1ZUKA 2DVJA 2RQVA 2O31A 1E7OA 1VYUA 4HVUA 1U3OA 3EG3A 1AVZC 2V1QA 4RTZA 1M27C 3EG1A 1GCQC 1WXBA 2K6DA 3H0FA 2ESWA 3H41A 5IXFA 2ROLA 1PWTA 2JTEA 2YUNA 4D8KA 1PKSA 2XMFA 2OAWA 4Y92A 2YUPA 1E6HA 4X1VA 1GCQA 1AD5A 1X43A 5IHIA 2M0YA 1K0SA 1YWPA 4RTTA 4Z88A 3JV3A 4JJBA 3CQTA 1FMKA 1JXOA 1JQQA 1W6XA 2L0AA 2RQTA 4R0KA 1TG0A 2I0NA 2CT3A 4Z8AA 2ROTA 4OMNA 3PVLA 2HSPA 1PKTA 2W10A 4JJDA 4RUGA 4IIOA 1WXUA 2X3XD 1B07A 3TVTA 2FPFA 1T0HA 2LNHB 2DBKA 2DL7A 4HXJA 1X27A 2FEIA 1IO6A 1X69A 1GFCA 1HD3A 1AZGB 2NUZA 1HSQA 2KROA 2L3QA 4LUDA 3M0UA 3UF4A 2DRKA 2E5KA 1UHFA 1ZUUA 2EBPA 1K4US 1M3BA 2BZXA 2JXBA 3I5SA 4F16A 1T3SA 1K76A 2OI3A 2D0NA 3GBQA 1Z9QA 1K9AA 1KJWA 4LUEA 3LH5A 5FWBA 2J7IA 3SEMA 1OEBA 1AWWA 2DJQA 1AZEA 1UG1A 2JS2A 2EGEA 1MV3A 1NYGA 2OJ2A 3I5RA 2YDLA 2LMJA 1ZX6A 2GTJA 2LCSA 1JO8A 1EFNA 3I9QA 2BZ8A 3NMZC 1W1FA 1NM7A 3VS7A 2PTKA 2DX1A 1WYXA 2CSIA 1YWOA 2A36A 1WI7A 3THKA 1A0NB 2FO0A 4HVVA 2EKHA 1B3QA 3A98A 2LJ1A 1YP5A 1SEMA 1V1CA 4OMLA 3UATA 2FG0A 3EHQA 3M0PA 4F14A 2EYWA 2LJ3A 1TUDA 2K9GA 4JZ3A 3NPFA 2FPEA 1KIKA 1YN8A 4AG1C 2NWMA 3FJ5A 1S1NA 1NEBA 1QWEA 4EIKA 1I0CA 2RQRA 4JZ4A 1MUZA 4J9CA 2CUDA 2B86A 2EYXA 2GNCA 1ZLMA 2AKKA 5IHKA 2BTTA 4J9BA 1UTIA 1UHCA 2DNUA 2FRWA 4JPBW 2KRSA 2RNAA 2LJ0A 1ZBJA 3UA7A 2CSQA 2D1XA 2ED0A 4IIMA 1SRLA 1H3HA 2CH4W 1T3LA 2KEAA 3EGUA 5L23A 2VVKA 2DILA 2V1RA 3VS6A 4OMPA 2JM9A 3H0IA 3SHWA 1WXTA 1TUCA 2EVRA 3O5ZA 2ED1A 1ABQA 1OPKA 1U5SA 2HBWA 2KXCA 2HDAA 2F2VA 3IQLA 4J9IA 1GBRA 1QLYA 1PRLC 2PZ1A 4AG2C 1UECA 4CC4B 2DL4A 5FWCA 1X2KA 1NG2A 3VS1A 4CC2A 1I07A 3M0TA 5FW9A 2RQUA 2KR3A 5IHNA 1WLPB 2LP5A 1GFDA 3UA6A 1X6GA 2DM1A 5GJVB 2KYBA 2KRNA 2J6FA 2DMOA 4J9DA 1WX6A 1JEGA 5EC7A 2QDLA 2CDTA 4J9GA 1KFZA 1BBZA 2CREA 2LZ6B 1VYVA 2ECZA 2L2PA 1M30A 1M3CA 1UFFA 1RUWA 3VS4A 2CH4A 1PHTA 1Z9ZA 4HCKA 1T0JA 1YNZA 2FRYA 2MCNA 1JXMA 2EW3A 2ABLA 4RTYA 4K11A 4FSSA 1UJYA 2EQIA 1GCPA 3VS5A 1QKXA 1RI9A 1RLPC 2DRMA 4ORZA 2CT4A 2O2OA 2SEMA 2EGAA 1PNJA 4ESRA 1I1JA 2JM8A 2JW4A 4A63B 3M0RA 2KRMA 3VS0A 2A08A 2MOXA 2KYMA 4AFUC 4AFSC 4QT7A 1WFWA 3EHRA 1ARKA 1NYFA 2DL8A 2F2WA 2LQWA 3EG2A 1RLQC 2EYZA 2YSQA 1SHGA 2JT4A 2CUBA 3ULRB 2JS0A 2J06A 5ECAA 2GBQA 4M4ZA 1K1ZA 1XOVA 2RQWA 1G2BA 1WIEA 2VWFA 4GLMA 4KRTA 2IIMA 2AKLA 1SRMA 2AK5A 1AWJA 1U06A 4WCIA 2F2XA 1SPKA 2HEQA 3NGPA 4LN2A 5I11A 4OMMA 1OPLA 1X6BA 2L3SA 2LX7A 3TSWA 1H92A 2YUOA 1LCKA 2DYBA 2KGTA 4F17A 2KNBB 1UDLA
chains in the Genus database with same CATH superfamily
1YJNA 3OS1A 3M55A 4IUQA 3VS2A 1E6GA 2PNIA 4HT9A 3CC4A 1KQ2A 4DBRA 3JCMe 3KXTA 2YUQA 2EQUA 1ZSZA 5IT9E 4LNPA 3VJPA 1K8AU 2L3PA 2P0KA 4LE9A 1QVFP 2RJCA 4BD3A 2QEXT 5EG2A 4HKEA 3I56Q 2DD5A 1AWXA 1UUEA 5GJWB 1QKWA 4A4KA 4M75B 1G3WA 3VUZA 2DL5A 1M2OA 4NL2A 4IUUA 3JAME 1UGQB 4C92E 4M78G 2OTLT 5FU6C 1TU0B 2R5AA 3RKXA 5LJ5g 3LWIA 2ENMA 3OMGA 3REAB 1Q82U 1AEYA 4AFZC 1KC8R 2DLPA 1RABB 4J9HA 5IH2A 4C8QG 2KVQG 5HCKA 2NUTA 2W0ZA 2JNGA 5LJ3f 1TTHB 2KE9A 2KK4A 5CQYA 5DM7R 4RTXA 1UJ0A 2QEXQ 4DOWA 2O9SA 3MEWA 2MIOA 1BI2A 2BE9B 1PRMC 1Y0MA 5KCOA 4KT0E 1D0ZA 2PUKB 2YRVA 4J9FA 2QDYB 3Q1JA 4M78E 2DF6A 2BZYA 1N8RU 1Y96A 4PJMA 3SFMA 5DLOA 3S3NA 2CP6A 5CKBA 2OTLQ 4M77C 4OB2B 1O75A 1G83A 3S6WA 1OQKA 1GBQA 3NTKA 2EYYA 1G3YA 3R6OA 4C8QE 2COWA 4DA4A 1D1CA 2HMAA 5GAMj 1Y57A 2H3EB 2SRCA 2RH2A 2LTOA 4DEYA 4F04B 3M53A 1WHLA 1VQKA 4E6RA 3OYAA 3U23A 4IKFA 2C0OA 2E1HA 1E7OA 1VYUA 1AT1B 3HRTA 4A4HA 3EG3A 1AVZC 2ZPHB 4RTZA 4EMGA 4JRPA 3CXCS 4RCBA 3EH1A 1GCQC 4OGCA 2FB7A 2CP7A 1SSFA 1WHGA 2K6DA 1VQ5T 2RK2A 3H41A 3X24B 2YUNA 5J3BA 2F5KA 4FYYB 2QTXA 2RJEA 1FMWA 1R77A 3FDRA 1KD1R 1X43A 3AT1B 2RHUA 1Q95G 3CQTA 1JXOA 5FU7B 3JCMg 3D7SB 3EH2A 1YI2T 1JQQA 2ZZDA 1RAEB 4R0KA 2IG0A 2M02A 1TG0A 5CKEA 3GF5A 1QVFA 2I0NA 4Z8AA 2KSSA 4OMNA 4MDXA 3FRNA 3KUFA 5GAN6 1WZOA 4IIOA 1VQ5Q 1BCMA 4XQ3A 4BDZA 2DEQA 2QQ9A 4DOVA 1IREB 1T0HA 4FU6A 1X27A 1TS9A 2DAQA 1AZGB 3M0UA 2GCXA 2E5KA 1UHFA 2JTMA 3UT1A 3CC7T 2BZXA 3SWNB 1BIBA 1YI2Q 1YJWA 4M7AG 3A5ZB 2RM4A 3GBQA 1Z9QA 1KJWA 4LUEA 3RESA 2PVDB 1BI1A 2DJQA 1JB0E 4RG8A 4FYVB 3OYIA 1JJ2S 4JDSA 2LT1A 2QASA 2OJ2A 4C92A 3I5RA 5LJ3d 4XU3A 4OMFB 2GTJA 4D6WA 1EFNA 2BZ8A 2M9UA 2LNVA 5GAOn 1IZ6A 2PTKA 2DX1A 2R57A 1IHVA 3L2RA 2A36A 3MEVA 3ZFJA 1A0NB 3QJ6A 4C5IA 1G5VA 1ZBXA 2LQ8A 3LH0A 5GAN5 3CC7Q 4M7AE 4ZGJB 3OMCA 5GAN7 3SWNC 2A0FB 1WNLA 5KYWB 3DLLA 3CCLQ 1Q86C 1SEMA 1V1CA 3UATA 1U1SA 1IB8A 1YITA 3I55T 1TUDA 4M78A 2R5MA 1KIKA 2PVOB 1M4ZA 3E9GA 1WJRA 4TVRA 1VQ4A 4BI4A 1D1BA 4JLGA 2RQRA 4JUVA 1KQ1A 1H3ZA 1VIEA 4PKCC 3G6ET 4FT2A 3V8KA 4C8QA 3CCJA 2NUTB 1PM3A 2MYSA 2AKKA 1ZSZC 4N4GA 3LLRA 2OTJA 1FXXA 1UTIA 1MMNA 2E5QA 2KRSA 4M7DE 3H8ZA 5FRMA 4CI0C 3MJXA 1M1KC 4KH0B 3DB4A 4XTWA 1H3HA 3WVEB 2DO3A 4QVCA 5C0MA 3QYHB 3VS6A 2CP5A 4OMPA 3I55Q 2EFIA 4BACA 1WXTA 3O5ZA 4LXCA 1WHJA 3ZBDA 2KY9A 5IN1A 2G3RA 2KXCA 3G1JA 3IQLA 1GBRA 1QP2A 1QLYA 2RHXA 3BW1A 1M90C 1RAIB 4AG2C 3G6EQ 2DL4A 5FWCA 4M75D 4QQ6A 5GANj 3QHSA 2LCLA 5FW9A 1PC0A 2KR3A 5IHNA 2E3IA 1WLPB 1GFDA 3EFOB 3M54A 5LJ3h 1GXIE 1X6GA 3HFNA 5GJVB 1WX6A 3C94A 4E7IA 2QDLA 4E7HA 4PJOE 1TXQA 4UC4A 1VYVA 2XHCA 4BE0A 2FYKA 2ECZA 2L3RA 1UFFA 3VS4A 4HCKA 3JRZA 1T0JA 3V7SA 1OU9A 1W2BS 2MCNA 1NPPA 2EW3A 4RTYA 4K11A 4B9XA 4FSSA 1OYXA 4XTZA 3QKJA 1GCPA 2DRMA 4L5GA 4ORZA 3MP6A 2CT4A 3CCQT 1PNJA 2Y4XA 2ZPFB 3G4SA 2L5QA 3SB2A 4ESRA 2RJFA 5LJ5f 1VQOA 4OF1A 1IHWA 5GMKh 1PSFA 2A08A 5CKHA 3QO3A 2L89A 3NFCA 3OYLA 3CCST 4KGVB 2QA4T 2RK1A 4J7FA 2DL8A 2F2WA 3HHTB 2YSQA 3ME9A 4N4HA 2KAFA 1PD0A 5ECAA 2GBQA 3N5BB 1WGSA 3E19A 1IGUA 1KQSP 2V8IA 2D6FA 4M7DD 2IIMA 3CC2Q 2AKLA 3LYIA 3GOXA 1AWJA 4WCIA 1SPKA 2RI2A 3NGPA 4LN2A 4E7ZA 3NTHA 2HL5C 3PIPA 1X6BA 1VQPT 3CCQQ 1HYOA 5J26A 5CIUA 2LX7A 1U1TA 1NJIR 1LCKA 4XTXA 4EPCA 4M7AA 3OA6A 1C6VX 3RDVA 1M3AA 1VQMA 1X2QA 3EGDA 3CD6T 3HKSA 3CCSQ 2QA4Q 4RKUE 3MP1A 1VQ6A 1CKBA 3E2UA 3RBBB 2VXFA 1D3BB 1F1BB 2PU9B 3EGXB 4E47A 4BY6C 1NBEB 2X3WD 1QWFA 3MCAB 5CVIA 2WSFE 3PNWC 3BY7A 1TH7A 1CSKA 4GBQA 1SSHA 1GL5A 3JCMV 1N5ZA 2KMTA 3A1PA 2WSEE 3R6NA 1VQ8T 1OI1A 4PJOD 4OMOA 3S3MA 3VUBA 1C1AA 2IVWA 2D8JA 1VQPQ 2K3XA 1S72A 4XAXB 1VOMA 2KT1A 2RMOA 3GIBA 4M7DA 2DD4A 3RNJA 4Y28E 2LQKA 3DLMA 3JB9J 4P5NA 1Q7YC 4XTYA 4EMKA 3EG0A 2O4XA 1W70A 3CD6Q 2RPNA 4LD9K 2QQAA 4M78B 5CCAA 3JCMf 2RN8A 3OYNA 4MMLA 1WPYA 3OBYA 4C92C 3TSZA 4WF2A 3VS3A 3L2WA 1NLPC 1P92A 1UB4A 1WDXA 3M0QA 4M75F 1YCSB 2HCKA 3C0CA 4C8QB 1SHFA 4JJCA 1M5Q1 3OBWA 1M1FA 2RB6A 3CEYA 3I56A 2C0IA 1VQ8Q 2DPPB 2QK0A 1WA7A 2RO0A 3ER0A 2CZ0B 1ZSGA 4JS5A 4JRKA 3UPUA 1M8MA 2YT6A 2JUFA 1NLOC 2V8JA 2DE0X 4E7JA 1BB9A 2MWPA 1HJDA 1VA7A 4M78C 1K0XA 2KXDA 2LQNA 4ELYC 3FEOA 5I22A 5LJ5d 2J6OA 2RQVA 1ZUKA 3OSSC 4E2FB 2O31A 1K9MC 3MHXA 2CS7A 5FRNA 4HVUA 4BE1A 2QEXA 1UGSB 1M27C 3EG1A 4C8QC 2F69A 3PTAA 2HQXA 1I5OB 1HXDA 5DLQE 1KQSA 1WJQA 2GFUA 2E3HA 3L2QA 4Y92A 3RKYA 3OYEA 2DEUA 2PVGB 1IRXA 4ZTJA 2OTLA 1AD5A 3OS5A 5GAOl 4QQDA 3KBGA 4ANJA 3TU4K 2RHIA 1MGQA 3OB9A 4FCYA 2A7YA 3V7CA 3RIRA 4M7DF 1Q86R 1NPRA 1QW1A 2C06A 4J8OA 2D0QB 3CPWS 3PVLA 1PKTA 3GLXA 4M77B 3OW2P 4JJDA 5GAOm 2EQKA 2DYIA 1QVGS 3FJPA 5GAN3 2AIRB 4JRIA 1LOJA 2HBPA 4VUBA 2FEIA 5A0DA 2DIGA 2VGMA 2YRCA 1HD3A 1BI3A 1V76A 4LUDA 4J6YA 3UF4A 2DRKA 1ZUUA 3LGLA 1Q81C 1M1KR 2BKDN 2Z0WA 2HD0A 2ZGWA 3JB9D 4PJOF 5FWBA 2J7IA 4JLIA 1K8AC 2E64A 3HFOA 4FT4A 2JTFA 4Z02A 3JB9H 1I8FA 2FHDA 2YDLA 3JCMd 5LJ5h 3I9QA 1NJIC 2VC8A 1M90R 1R0BG 4J5YA 3EGDB 1W1FA 3M4YA 2R58A 3C4SA 1VQ5A 4FYWB 2E6ZA 1WYXA 2CSIA 1B34A 1WI7A 4MZMA 5GAMe 2F5TX 3M59A 2FO0A 2DXCA 1B3QA 3A98A 3M9QA 3A8OB 1M1GA 4OMLA 2CKKA 3QUIA 4F14A 4WTOB 2DTOA 1YI2A 2K9GA 4JZ3A 2Y4YA 4KGZB 2VV5A 1YN8A 3JCMc 3FJ5A 1S1NA 1NEBA 4EIKA 4RMOA 1MUZA 4EMKB 4M7AC 4C0FA 2B86A 2BE7D 3X25B 1N8RC 1WQ7A 4XU1A 3L2ZA 4OVAA 3GP8A 2LDMA 4JPBW 1N9RA 1ZBJA 2LJ0A 4FM4B 5LJ3j 3CCVT 4PFPA 1VQNQ 1SRLA 2RI5A 4M75G 3EGUA 3CCRA 2YLCA 5L23A 2VVKA 1OX9A 3CC7A 1IXDA 4ZGEB 3CCLA 2JM9A 1UGRB 3H0IA 3PT9A 1TUCA 5KYUB 1OPKA 3JCMJ 1U5SA 2X4WA 1QP3A 2COZA 4FW1A 2ATCB 3CCET 1PG5B 3OW2A 2NLUA 2PZ1A 4EMKC 2XD0A 1X2KA 2JVVA 1I07A 5CO7A 1K73R 3CCRT 3UA6A 2BIVA 3CCLT 2KYBA 3JCMh 4J9DA 5GMKj 1BCOA 2XIDA 4M75E 3CCVQ 4J9GA 5M9OA 4XU2A 2EWNA 3VYHB 1M30A 1M3CA 2HKQB 1RUWA 2NUPA 1YNZA 4FSXA 1C0MA 2QTVA 2FRYA 1YBYA 2LX9A 1QVFS 3I55A 2QQRA 3OYYA 3CCEQ 1RLPC 1ZSZB 2O2OA 2EGAA 1KC8U 4ZTFA 2JM8A 3TREA 2JW4A 4A63B 4HCZA 2VXEA 3CCRQ 3JB9F 2HL3A 3G6EA 2LCCA 1Q7YR 4AFSC 4AFUC 4M7DG 1OULA 2XKOC 4ZGDB 5GAMg 3BDLA 1MNDA 3EHRA 4NS5A 2JOYA 3EG2A 1YCYA 1RLQC 3V8LA 1RADB 2JT4A 1X75C 2K4YA 5KCHA 3ULRB 4MZPA 3GPLA 4C0ZA 2JS0A 4KULA 4PJLA 3CCMT 2XDPA 4M4ZA 3NTIA 1VQ9T 1WIEA 3OS2A 3P8HA 1PCXA 1OPLA 3HPWA 2L3SA 1LPLA 1G8XA 2P0QA 4OGEA 2DZCA 5LL6S 2DYBA 4A4GA 2KGTA 3ZEHA 3QSUA 4OMQA 2KNBB 1UDLA 5KYXA 1FMVA 4ZNXA 4AMCA 4LDUA 1R0CB 1WJSA 5HK0A 4C5EA 3REBB 4DBFA 1FYNA 1TUGB 1I81A 1ZQ1A 4AFQC 4PJOG 2M0OA 4NOYA 4BB7A 1Y96B 2EGCA 3KFVA 5LJ3g 1RACB 3JCMX 1RAHB 3X20B 1J3TA 3L2VA 1MV0B 3CCMQ 1K9MR 4PLIA 3QZ5B 3QDRB 1VQ9Q 2DVEA 3GNGA 1LVKA 3M58A 4J7IA 5CAIA 2C0TA 1VYTA 1UGVA 2LT4A 2K3BA 1B34B 2OX7A 1EZZB 1KD1U 2WSCE 4II1A 2RF0A 4M77D 3CC2A 4BDYA 1YIJT 3E9FA 1WHMA 2AZSA 2VYTA 2HQEA 3CCQA 1AOJA 2JMAA 2VKNA 3I35A 3F70A 4RTWA 2DL3A 1VQ7T 4CC3A 3OY9A 3JSCA 3META 3M0SA 4PJNA 3QWXX 3CCSA 1BU1A 3CMET 1OX8A 2QA4A 1VQLT 1FWZA 3CC2T 1V29B 1OV3A 2BUDA 1JBMA 2MK5A 3DB3A 3MO8A 3INZA 2KT8A 2K5IA 2RJDA 3QG1A 5J39A 3HL8A 4DQ2A 2RD1A 4Z89A 2FPDA 2GQIA 2XU8A 2GGRA 2AZVA 5GAOr 1M2VA 2KQWA 1YIJQ 3RUXA 4Q5WA 3MP8A 2D8HA 2J6KA 1VQPA 4M75A 2AHJB 1OZ3A 2K7AA 4QKUA 4DEXA 4R56A 1MNEA 4BY6B 1Q81R 1AWOA 2PUOB 4RG2A 1VQ7Q 4C0DC 1M8VA 1RAAB 2QAZA 5GMKi 4F7UF 3CD6A 4A54A 3CMEQ 4QW2A 1VQLQ 5D6WA 1K8AR 1NZ9A 1U3OA 2V8KA 3BE3A 3A8LB 3EFSA 2MPXC 4BE2A 4O6JA 3CCUT 4J6XA 3H0FA 3MEAA 2ESWA 2JTEA 3TEEA 1K73C 3C12A 1VQ8A 1BYMA 2E12A 4X1VA 5A2QE 1GCQA 1B7TA 3LWHA 4LDXA 1Q82R 1K0SA 1YWPA 2E65A 4RTTA 4V2SA 4C92B 3JV3A 2ZPEB 1QVPA 2L0AA 2RQTA 3J81E 2X4YA 3H6ZA 2ROTA 4KBMB 2O01E 2JZ2A 3LX7A 1KHCA 1X6OA 3VKIA 2H3JA 1OZ2A 3CCUQ 4MDWA 4GY5A 2MI6A 1B07A 1EX4A 1ACMB 4A53A 3JB9G 2LNHB 5GANg 5LJ5j 3JCMQ 1N8RR 1IO6A 1X69A 2CZ7B 5I2MA 2FL7A 2NUZA 1HSQA 4ME7A 3UDCA 2EBPA 1M9SA 3M57A 4E7KA 5GAN4 3CXCP 2EJGA 2XI9A 3I5SA 5D6XA 4F16A 1T3SA 5GAOp 2QXFA 4QVZA 3LH5A 4X9CA 3OYJA 2WACA 2JS2A 2EGEA 2E70A 1ZX6A 2LCSA 1OU8A 1YHQT 4FIBA 3M4GA 3ASKA 2X4JA 3VS7A 2PQWA 4PJOA 3E1SA 3S3OA 3THKA 1MMGA 2HAXA 2DK3A 4PFOA 2LJ1A 1YJ9T 3MPUB 2DTIA 1YP5A 6AT1B 3JB9I 3MKDA 2FG0A 3EHQA 3C95A 2LJ3A 3NPFA 2FPEA 1RI0A 4AG1C 1QWEA 1YHQQ 3OYCA 4JZ4A 4N0AA 4ZN3A 4J9CA 2CUDA 4PJJA 3TCJA 3L2UA 1BIAA 1MMDA 2QGGA 2IPOB 2ZCFB 2EYXA 1ZLMA 4MMKA 3CMAT 5IHKA 2EJ9A 1AHJB 8AT1B 2DTHA 4J9BA 3VU3C 3OYHA 1UHCA 5GAMf 1JJ2P 3UA7A 2CSQA 2D1XA 1YJ9Q 3G71T 3PGGA 4PNOA 5DY9A 2RI3A 4IIMA 5KH6A 1WQWA 2KEAA 2DILA 3PIOA 3EG9A 1RL2A 1WHHA 3UWNA 3FB9A 3VYGA 2EVRA 1EIFA 1ABQA 5CK9A 3WXMB 2CYZB 1M2VB 4FYXB 2HBWA 1KG1A 2NYSA 5KYWA 1NJIU 4BI3A 1PRLC 3AHUA 1YJNT 1UECA 4CRIA 1X01A 3VS1A 2KDSA 4CC2A 3CC4T 3QBYA 2RQUA 4C5GA 3CMAQ 1KQSS 5GMKl 2DXBA 1ZA1B 4L6V5 1VUBA 3RERA 2EQMA 2J6FA 2DMOA 1YFNA 4A4FA 5EC7A 2YLBA 4F7UG 3OYGA 2CDTA 4LDWA 3G71Q 2K3YA 4B9WA 1KFZA 2CREA 5KYYA 3CXCA 1RAFB 4AT1B 2L2PA 4PFZA 3P8DA 2XG8D 4ELZC 1VQNA 3QIIA 4M7AB 1JRIA 5GMKm 3QXEB 1UEBA 3WVDB 3VS5A 1QKXA 1RI9A 1LNXA 1Y71A 4M75C 1YJNQ 5KYNA 1QCNA 4BUGA 1I1JA 5A0GA 4NL3A 4DBHA 3CC4Q 1O9SA 5D6YA 1Y7XA 3M0RA 1Q82C 5GAN2 2EIFA 3O8VA 3PMIA 2MOXA 2KYMA 4F7UE 4J6WA 1VQNT 2B8AA 1ARKA 1NYFA 1D0YA 2LQWA 3PFSA 1KHIA 2CZ1B 2EYZA 1SHGA 3V8JA 2CUBA 2K5FA 5CR2A 1QQJA 2JJ9A 3CCVA 2EJFA 3EFOA 1XOVA 2RQWA 1G2BA 4M7DB 2VWFA 3RKWA 4GLMA 4C5HA 4KUIA 4X34A 4IUVA 1SRMA 2AK5A 2O4XB 1I4K1 4LDVA 4OMMA 3L42A 3CBPA 4HA8A 1H92A 2YUOA 4OB0B 2F1LA 3CCEA 3QDFA 2L3QA 4E7SA 1VQKT 5LJ3e 3URGA 1W2BP 3JCMb 1NEGA 5HK3A 4C0GA 3OYDA 2V26A 2ZPIB 1D0XA 3H0HA 1OOTA 1JJ2A 1R8OB 1KSWA 4M77G 2JMCA 5IXBA 3L1AA 3QWYA 2K2MA 1FX7A 2P4RA 4C92D 4O5VA 3TQ7P 2A28A 1CKAA 5HKCA 3X26B 5GAMd 4M7DC 2CGHA 2O88A 4PJOB 4ATOA 3HTRA 2FZKB 3VRZA 4JS4A 1W4SA 2HSEB 1N27A 3CBOA 5AT1B 2P4TA 2DZ9A 3PVQA 2RHZA 5GMKe 1Q86U 5IAYA 1VQKQ 2G6FX 3P8BB 1ABOA 2X9HA 4QQGA 2H8HA 3PE0A 4M77E 2COYA 3NHNA 2CZ6B 2DBMA 4M78D 3RMSA 2GFAA 5FU7C 4GLKA 2X4XA 4EMHA 3RMQA 1PD1A 1SG5A 3CCMA 1QCFA 4C8QD 4D8DA 1UE9A 3ZL7C 4PJOC 1VQ9A 1D3BA 4KH1B 2M51A 2GTOA 2K79A 4J9EA 4RTVA 3EGXA 3QPHA 4HVWA 1JU5C 3VRYA 2KI7A 5GANf 2KBTA 3G7ZA 4CC7A 3JCMP 1BK2A 1ZUYA 2VASA 3DKMA 1M1KU 3OW2S 2M1HA 2EQJA 1YJWT 2DA9A 2ZPGB 4XK8E 2EPDA 3EG9B 2E6NA 4RTUA 2O9VA 2YRDA 1TWBA 1GRIA 2J05A 1H8KA 4MZTA 4FL6A 2ZPBB 2E10A 2DVJA 2A37A 5KE2A 3QJYA 2A3LA 2DIQA 3A8MB 1N6AA 2P0PA 2CP0A 2EAYA 2HZYA 2V1QA 4N0AC 9ATCB 4HCBA 1M90U 1XJWB 3HSBA 1BI0A 5HY6A 1WXBA 5CKDA 1WHKA 3HP9A 5IXFA 2ROLA 3RR6A 1N9SA 1PWTA 3FC3A 4EDUA 2JN0A 2X35A 1PKSA 2XMFA 4D8KA 2OAWA 2YUPA 2MWOA 4XTUA 4F7UA 1UGPB 1E6HA 5GAMh 2LRQA 2EYQA 2E41A 4J83A 5KYYB 1KC8C 1YJWQ 5IHIA 3X28B 2M0YA 1YIJA 4Z88A 3GNFB 2RA2A 4JJBA 1FMKA 1YITT 1W2BA 4XTVA 5D7UA 3M5AA 1W6XA 1XNIA 4KUDK 1VQ4T 2CT3A 2MF2A 3VV0A 1VQ7A 3A8GB 1NE8A 3OSVA 2HSPA 2K2VA 2QQBA 2W10A 3J80E 3CMEA 3CCJT 1VQLA 5GANe 4RUGA 2GQVA 1WXUA 2X3XD 3V7RA 5I21A 2OTJT 3TVTA 2FPFA 5FLXE 2XK0A 4LD6A 2DBKA 2DL7A 3EAEA 4HXJA 2QG9B 2OAUA 1GFCA 3LW5E 3JCMW 1MHNA 4C0DB 2KROA 4C92F 1LJOA 1K4US 1M3BA 1QMCA 2K57A 2JXBA 1TSFA 3A8HB 1YITQ 3HRSA 1K76A 1KK7A 4QVDA 2LVMA 2OI3A 2D0NA 4N4IA 1K9AA 2FVUA 4ZN1A 1VQ4Q 3SEMA 1XTDA 3OS0A 3OYMA 1OEBA 1AWWA 1AZEA 1UG1A 3QYGB 1MV3A 3T9NA 1NYGA 3CCJQ 5GAOq 2LMJA 1SKUB 5FROA 1JO8A 1K73U 1I5LA 3NMZC 1TOVA 4M7AD 2OTJQ 2DKGA 2VB6A 5CKFA 1NM7A 3CCUA 2FZGB 4IUTA 3PMTA 4M78F 5I2SA 2X51A 1YWOA 5C6SA 2ZAEA 1KD1C 4M77A 2QYZA 2E4HA 4YTLA 4E7LA 3CPWP 2YWWA 4HVVA 4L59A 2EKHA 2DJZA 1RAGB 4PLLA 3SDZA 3EFRA 4C8QF 2MMPA 4IUPA 5GANd 3M0PA 1QVGP 1VIFA 2EYWA 2CP3A 5KE3A 3SD4A 1G3SA 2XDBA 2CP2A 3MEUA 2RHYA 2LC4A 3G4ST 1VQOT 2NWMA 3LGFA 3CPFA 2XICA 1I0CA 1Q7YU 3FIFA 2I2LA 2QGFB 2GNCA 2DETA 4RCCA 2NUPB 2BTTA 1SF9A 2DNUA 2HQHA 2DERA 2FRWA 3OQ5A 1Y07A 2RNAA 2YHTA 2ED0A 2K5LA 7AT1B 4OB3B 2VUBA 2CH4W 1T3LA 4KGXB 4HCCA 8ATCB 2V1RA 2DXTA 3SHWA 5GAN8 2P84A 2ED1A 4DBQA 1G3TA 4B6MA 3G4SQ 1VQOQ 4FW2A 3OYBA 2HDAA 2F2VA 4J9IA 4JJNK 5LJ5e 4CC4B 1NG2A 1VQMT 4OP0A 3M0TA 1YHQA 4LDYA 2LP5A 1VQ6T 4JRQA 2DM1A 2KRNA 2YXYA 5L8RE 2DFUA 2XDDA 1JEGA 3CBMA 1K9MU 1BBZA 4X9DA 2HNIA 2MAMA 3BFMA 2EKOA 2GF7A 4M77F 2LZ6B 3FLGA 3OYKA 1HK9A 2DXUA 2QI2A 2QQSA 4XU0A 1YJ9A 2CH4A 1PHTA 1Z9ZA 1BKBA 1JXMA 5KYXB 2ABLA 4F7UB 1UJYA 1S72T 3QZ9B 4PL6A 2EQIA 5GANh 1MMAA 4A4EA 5AYFA 1ZA2B 2SEMA 4BI8B 1QCOA 1VQMQ 4Y91A 1D09B 2HKNA 5KYUA 2AT1B 1XQHA 2KRMA 3VS0A 1VQ6Q 3H9NA 4QT7A 4PK4A 1WFWA 2L8DA 3CMAA 2VGNA 4OB1B 1DJ7B 3CPWA 1H641 2J06A 3I56T 1PSEA 3G71A 4M7AF 1IGQA 3SWNA 1K1ZA 1QVGA 2M16A 4KRTA 3OYFA 1U8RA 4R55A 3HRUA 1S72Q 1U06A 2D9TA 2F2XA 2HEQA 5FU6B 5I11A 1D1AA 3M56A 2FZCB 1ZHIA 5CQXA 3TSWA 4C92G 4HT8A 2Y90A 5A0LA 3J7AF 4F17A 1Q81U 3BDUA 4IURA
chains in the Genus database with same CATH topology
4ZNXA 3VS2A 1E6GA 1M3AA 2PNIA 1X2QA 3REBB 1FYNA 1NEGA 4AFQC 2YUQA 4LNPA 3H0HA 1OOTA 2L3PA 4LE9A 1CKBA 2EGCA 3RBBB 1KSWA 3KFVA 2JMCA 1J3TA 1MV0B 5IXBA 2X3WD 1QWFA 4OMQA 3QWYA 2K2MA 2P4RA 4GBQA 1CSKA 1SSHA 1AWXA 2A28A 1GL5A 1CKAA 1UUEA 5GJWB 1N5ZA 1QKWA 2O88A 2C0TA 1VYTA 1UGVA 2DL5A 3R6NA 2K3BA 4OMOA 3VRZA 2D8JA 2RF0A 2ENMA 2RMOA 2KT1A 3REAB 2AZSA 1AEYA 4AFZC 3RNJA 3PVQA 2DLPA 1AOJA 2JMAA 2G6FX 4J9HA 2VKNA 3EG0A 5IH2A 1ABOA 5HCKA 3I35A 1W70A 2W0ZA 2RPNA 4RTWA 2DL3A 2H8HA 3PE0A 2KE9A 3NHNA 4CC3A 2RN8A 2DBMA 3M0SA 4RTXA 1UJ0A 3QWXX 1BU1A 3TSZA 2O9SA 3VS3A 1NLPC 1WDXA 2MIOA 3M0QA 1OV3A 1PRMC 1Y0MA 1YCSB 2HCKA 3C0CA 1SHFA 4JJCA 2KT8A 4J9FA 1QCFA 4D8DA 1UE9A 3ZL7C 2C0IA 2DF6A 2BZYA 1WA7A 2GTOA 2K79A 2M51A 4J9EA 4RTVA 4Z89A 1ZSGA 4HVWA 2FPDA 1JU5C 2GQIA 3VRYA 2GGRA 1G83A 2AZVA 2KBTA 1GBQA 4CC7A 2EYYA 1BK2A 1M8MA 1ZUYA 2D8HA 2YT6A 2J6KA 1NLOC 2DE0X 2DA9A 2K7AA 2EPDA 4RTUA 2O9VA 4DEXA 1AWOA 1Y57A 1GRIA 1BB9A 2SRCA 2J05A 1H8KA 1HJDA 4DEYA 1VA7A 1K0XA 2KXDA 2LQNA 4E6RA 5I22A 3U23A 2J6OA 2C0OA 2A37A 1ZUKA 2DVJA 2RQVA 2O31A 1E7OA 1VYUA 4HVUA 1U3OA 3EG3A 1AVZC 2V1QA 4RTZA 1M27C 3EG1A 1GCQC 1WXBA 2K6DA 3H0FA 2ESWA 3H41A 5IXFA 2ROLA 1PWTA 2JTEA 2YUNA 4D8KA 1PKSA 2XMFA 2OAWA 4Y92A 2YUPA 1E6HA 4X1VA 1GCQA 1AD5A 1X43A 5IHIA 2M0YA 1K0SA 1YWPA 4RTTA 4Z88A 3JV3A 4JJBA 3CQTA 1FMKA 1JXOA 1JQQA 1W6XA 2L0AA 2RQTA 4R0KA 1TG0A 2I0NA 2CT3A 4Z8AA 2ROTA 4OMNA 3PVLA 2HSPA 1PKTA 2W10A 4JJDA 4RUGA 4IIOA 1WXUA 2X3XD 1B07A 3TVTA 2FPFA 1T0HA 2LNHB 2DBKA 2DL7A 4HXJA 1X27A 2FEIA 1IO6A 1X69A 1GFCA 1HD3A 1AZGB 2NUZA 1HSQA 2KROA 2L3QA 4LUDA 3M0UA 3UF4A 2DRKA 2E5KA 1UHFA 1ZUUA 2EBPA 1K4US 1M3BA 2BZXA 2JXBA 3I5SA 4F16A 1T3SA 1K76A 2OI3A 2D0NA 3GBQA 1Z9QA 1K9AA 1KJWA 4LUEA 3LH5A 5FWBA 2J7IA 3SEMA 1OEBA 1AWWA 2DJQA 1AZEA 1UG1A 2JS2A 2EGEA 1MV3A 1NYGA 2OJ2A 3I5RA 2YDLA 2LMJA 1ZX6A 2GTJA 2LCSA 1JO8A 1EFNA 3I9QA 2BZ8A 3NMZC 1W1FA 1NM7A 3VS7A 2PTKA 2DX1A 1WYXA 2CSIA 1YWOA 2A36A 1WI7A 3THKA 1A0NB 2FO0A 4HVVA 2EKHA 1B3QA 3A98A 2LJ1A 1YP5A 1SEMA 1V1CA 4OMLA 3UATA 2FG0A 3EHQA 3M0PA 4F14A 2EYWA 2LJ3A 1TUDA 2K9GA 4JZ3A 3NPFA 2FPEA 1KIKA 1YN8A 4AG1C 2NWMA 3FJ5A 1S1NA 1NEBA 1QWEA 4EIKA 1I0CA 2RQRA 4JZ4A 1MUZA 4J9CA 2CUDA 2B86A 2EYXA 2GNCA 1ZLMA 2AKKA 5IHKA 2BTTA 4J9BA 1UTIA 1UHCA 2DNUA 2FRWA 4JPBW 2KRSA 2RNAA 2LJ0A 1ZBJA 3UA7A 2CSQA 2D1XA 2ED0A 4IIMA 1SRLA 1H3HA 2CH4W 1T3LA 2KEAA 3EGUA 5L23A 2VVKA 2DILA 2V1RA 3VS6A 4OMPA 2JM9A 3H0IA 3SHWA 1WXTA 1TUCA 2EVRA 3O5ZA 2ED1A 1ABQA 1OPKA 1U5SA 2HBWA 2KXCA 2HDAA 2F2VA 3IQLA 4J9IA 1GBRA 1QLYA 1PRLC 2PZ1A 4AG2C 1UECA 4CC4B 2DL4A 5FWCA 1X2KA 1NG2A 3VS1A 4CC2A 1I07A 3M0TA 5FW9A 2RQUA 2KR3A 5IHNA 1WLPB 2LP5A 1GFDA 3UA6A 1X6GA 2DM1A 5GJVB 2KYBA 2KRNA 2J6FA 2DMOA 4J9DA 1WX6A 1JEGA 5EC7A 2QDLA 2CDTA 4J9GA 1KFZA 1BBZA 2CREA 2LZ6B 1VYVA 2ECZA 2L2PA 1M30A 1M3CA 1UFFA 1RUWA 3VS4A 2CH4A 1PHTA 1Z9ZA 4HCKA 1T0JA 1YNZA 2FRYA 2MCNA 1JXMA 2EW3A 2ABLA 4RTYA 4K11A 4FSSA 1UJYA 2EQIA 1GCPA 3VS5A 1QKXA 1RI9A 1RLPC 2DRMA 4ORZA 2CT4A 2O2OA 2SEMA 2EGAA 1PNJA 4ESRA 1I1JA 2JM8A 2JW4A 4A63B 3M0RA 2KRMA 3VS0A 2A08A 2MOXA 2KYMA 4AFUC 4AFSC 4QT7A 1WFWA 3EHRA 1ARKA 1NYFA 2DL8A 2F2WA 2LQWA 3EG2A 1RLQC 2EYZA 2YSQA 1SHGA 2JT4A 2CUBA 3ULRB 2JS0A 2J06A 5ECAA 2GBQA 4M4ZA 1K1ZA 1XOVA 2RQWA 1G2BA 1WIEA 2VWFA 4GLMA 4KRTA 2IIMA 2AKLA 1SRMA 2AK5A 1AWJA 1U06A 4WCIA 2F2XA 1SPKA 2HEQA 3NGPA 4LN2A 5I11A 4OMMA 1OPLA 1X6BA 2L3SA 2LX7A 3TSWA 1H92A 2YUOA 1LCKA 2DYBA 2KGTA 4F17A 2KNBB 1UDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNX A;  3VS2 A;  1E6G A;  1M3A A;  2PNI A;  1X2Q A;  3REB B;  1FYN A;  1NEG A;  4AFQ C;  2YUQ A;  4LNP A;  3H0H A;  1OOT A;  2L3P A;  4LE9 A;  1CKB A;  2EGC A;  3RBB B;  1KSW A;  3KFV A;  2JMC A;  1J3T A;  1MV0 B;  5IXB A;  2X3W D;  1QWF A;  4OMQ A;  3QWY A;  2K2M A;  2P4R A;  4GBQ A;  1CSK A;  1SSH A;  1AWX A;  2A28 A;  1GL5 A;  1CKA A;  1UUE A;  5GJW B;  1N5Z A;  1QKW A;  2O88 A;  2C0T A;  1VYT A;  1UGV A;  2DL5 A;  3R6N A;  2K3B A;  4OMO A;  3VRZ A;  2D8J A;  2RF0 A;  2ENM A;  2RMO A;  2KT1 A;  3REA B;  2AZS A;  1AEY A;  4AFZ C;  3RNJ A;  3PVQ A;  2DLP A;  1AOJ A;  2JMA A;  2G6F X;  4J9H A;  2VKN A;  3EG0 A;  5IH2 A;  1ABO A;  5HCK A;  3I35 A;  1W70 A;  2W0Z A;  2RPN A;  4RTW A;  2DL3 A;  2H8H A;  3PE0 A;  2KE9 A;  3NHN A;  4CC3 A;  2RN8 A;  2DBM A;  3M0S A;  4RTX A;  1UJ0 A;  3QWX X;  1BU1 A;  3TSZ A;  2O9S A;  3VS3 A;  1NLP C;  1WDX A;  2MIO A;  3M0Q A;  1OV3 A;  1PRM C;  1Y0M A;  1YCS B;  2HCK A;  3C0C A;  1SHF A;  4JJC A;  2KT8 A;  4J9F A;  1QCF A;  4D8D A;  1UE9 A;  3ZL7 C;  2C0I A;  2DF6 A;  2BZY A;  1WA7 A;  2GTO A;  2K79 A;  2M51 A;  4J9E A;  4RTV A;  4Z89 A;  1ZSG A;  4HVW A;  2FPD A;  1JU5 C;  2GQI A;  3VRY A;  2GGR A;  1G83 A;  2AZV A;  2KBT A;  1GBQ A;  4CC7 A;  2EYY A;  1BK2 A;  1M8M A;  1ZUY A;  2D8H A;  2YT6 A;  2J6K A;  1NLO C;  2DE0 X;  2DA9 A;  2K7A A;  2EPD A;  4RTU A;  2O9V A;  4DEX A;  1AWO A;  1Y57 A;  1GRI A;  1BB9 A;  2SRC A;  2J05 A;  1H8K A;  1HJD A;  4DEY A;  1VA7 A;  1K0X A;  2KXD A;  2LQN A;  4E6R A;  5I22 A;  3U23 A;  2J6O A;  2C0O A;  2A37 A;  1ZUK A;  2DVJ A;  2RQV A;  2O31 A;  1E7O A;  1VYU A;  4HVU A;  1U3O A;  3EG3 A;  1AVZ C;  2V1Q A;  4RTZ A;  1M27 C;  3EG1 A;  1GCQ C;  1WXB A;  2K6D A;  3H0F A;  2ESW A;  3H41 A;  5IXF A;  2ROL A;  1PWT A;  2JTE A;  2YUN A;  4D8K A;  1PKS A;  2XMF A;  2OAW A;  4Y92 A;  2YUP A;  1E6H A;  4X1V A;  1GCQ A;  1AD5 A;  1X43 A;  5IHI A;  2M0Y A;  1K0S A;  1YWP A;  4RTT A;  4Z88 A;  3JV3 A;  4JJB A;  3CQT A;  1FMK A;  1JXO A;  1JQQ A;  1W6X A;  2L0A A;  2RQT A;  4R0K A;  1TG0 A;  2I0N A;  2CT3 A;  4Z8A A;  2ROT A;  4OMN A;  3PVL A;  2HSP A;  1PKT A;  2W10 A;  4JJD A;  4RUG A;  4IIO A;  1WXU A;  2X3X D;  1B07 A;  3TVT A;  2FPF A;  1T0H A;  2LNH B;  2DBK A;  2DL7 A;  4HXJ A;  1X27 A;  2FEI A;  1IO6 A;  1X69 A;  1GFC A;  1HD3 A;  1AZG B;  2NUZ A;  1HSQ A;  2KRO A;  2L3Q A;  4LUD A;  3M0U A;  3UF4 A;  2DRK A;  2E5K A;  1UHF A;  1ZUU A;  2EBP A;  1K4U S;  1M3B A;  2BZX A;  2JXB A;  3I5S A;  4F16 A;  1T3S A;  1K76 A;  2OI3 A;  2D0N A;  3GBQ A;  1Z9Q A;  1K9A A;  1KJW A;  4LUE A;  3LH5 A;  5FWB A;  2J7I A;  3SEM A;  1OEB A;  1AWW A;  2DJQ A;  1AZE A;  1UG1 A;  2JS2 A;  2EGE A;  1MV3 A;  1NYG A;  2OJ2 A;  3I5R A;  2YDL A;  2LMJ A;  1ZX6 A;  2GTJ A;  2LCS A;  1JO8 A;  1EFN A;  3I9Q A;  2BZ8 A;  3NMZ C;  1W1F A;  1NM7 A;  3VS7 A;  2PTK A;  2DX1 A;  1WYX A;  2CSI A;  1YWO A;  2A36 A;  1WI7 A;  3THK A;  1A0N B;  2FO0 A;  4HVV A;  2EKH A;  1B3Q A;  3A98 A;  2LJ1 A;  1YP5 A;  1SEM A;  1V1C A;  4OML A;  3UAT A;  2FG0 A;  3EHQ A;  3M0P A;  4F14 A;  2EYW A;  2LJ3 A;  1TUD A;  2K9G A;  4JZ3 A;  3NPF A;  2FPE A;  1KIK A;  1YN8 A;  4AG1 C;  2NWM A;  3FJ5 A;  1S1N A;  1NEB A;  1QWE A;  4EIK A;  1I0C A;  2RQR A;  4JZ4 A;  1MUZ A;  4J9C A;  2CUD A;  2B86 A;  2EYX A;  2GNC A;  1ZLM A;  2AKK A;  5IHK A;  2BTT A;  4J9B A;  1UTI A;  1UHC A;  2DNU A;  2FRW A;  4JPB W;  2KRS A;  2RNA A;  2LJ0 A;  1ZBJ A;  3UA7 A;  2CSQ A;  2D1X A;  2ED0 A;  4IIM A;  1SRL A;  1H3H A;  2CH4 W;  1T3L A;  2KEA A;  3EGU A;  5L23 A;  2VVK A;  2DIL A;  2V1R A;  3VS6 A;  4OMP A;  2JM9 A;  3H0I A;  3SHW A;  1WXT A;  1TUC A;  2EVR A;  3O5Z A;  2ED1 A;  1ABQ A;  1OPK A;  1U5S A;  2HBW A;  2KXC A;  2HDA A;  2F2V A;  3IQL A;  4J9I A;  1GBR A;  1QLY A;  1PRL C;  2PZ1 A;  4AG2 C;  1UEC A;  4CC4 B;  2DL4 A;  5FWC A;  1X2K A;  1NG2 A;  3VS1 A;  4CC2 A;  1I07 A;  3M0T A;  5FW9 A;  2RQU A;  2KR3 A;  5IHN A;  1WLP B;  2LP5 A;  1GFD A;  3UA6 A;  1X6G A;  2DM1 A;  5GJV B;  2KYB A;  2KRN A;  2J6F A;  2DMO A;  4J9D A;  1WX6 A;  1JEG A;  5EC7 A;  2QDL A;  2CDT A;  4J9G A;  1KFZ A;  1BBZ A;  2CRE A;  2LZ6 B;  1VYV A;  2ECZ A;  2L2P A;  1M30 A;  1M3C A;  1UFF A;  1RUW A;  3VS4 A;  2CH4 A;  1PHT A;  1Z9Z A;  4HCK A;  1T0J A;  1YNZ A;  2FRY A;  2MCN A;  1JXM A;  2EW3 A;  2ABL A;  4RTY A;  4K11 A;  4FSS A;  1UJY A;  2EQI A;  1GCP A;  3VS5 A;  1QKX A;  1RI9 A;  1RLP C;  2DRM A;  4ORZ A;  2CT4 A;  2O2O A;  2SEM A;  2EGA A;  1PNJ A;  4ESR A;  1I1J A;  2JM8 A;  2JW4 A;  4A63 B;  3M0R A;  2KRM A;  3VS0 A;  2A08 A;  2MOX A;  2KYM A;  4AFU C;  4AFS C;  4QT7 A;  1WFW A;  3EHR A;  1ARK A;  1NYF A;  2DL8 A;  2F2W A;  2LQW A;  3EG2 A;  1RLQ C;  2EYZ A;  2YSQ A;  1SHG A;  2JT4 A;  2CUB A;  3ULR B;  2JS0 A;  2J06 A;  5ECA A;  2GBQ A;  4M4Z A;  1K1Z A;  1XOV A;  2RQW A;  1G2B A;  1WIE A;  2VWF A;  4GLM A;  4KRT A;  2IIM A;  2AKL A;  1SRM A;  2AK5 A;  1AWJ A;  1U06 A;  4WCI A;  2F2X A;  1SPK A;  2HEQ A;  3NGP A;  4LN2 A;  5I11 A;  4OMM A;  1OPL A;  1X6B A;  2L3S A;  2LX7 A;  3TSW A;  1H92 A;  2YUO A;  1LCK A;  2DYB A;  2KGT A;  4F17 A;  2KNB B;  1UDL A; 
#chains in the Genus database with same CATH topology
 1YJN A;  3OS1 A;  3M55 A;  4IUQ A;  3VS2 A;  1E6G A;  2PNI A;  4HT9 A;  3CC4 A;  1KQ2 A;  4DBR A;  3JCM e;  3KXT A;  2YUQ A;  2EQU A;  1ZSZ A;  5IT9 E;  4LNP A;  3VJP A;  1K8A U;  2L3P A;  2P0K A;  4LE9 A;  1QVF P;  2RJC A;  4BD3 A;  2QEX T;  5EG2 A;  4HKE A;  3I56 Q;  2DD5 A;  1AWX A;  1UUE A;  5GJW B;  1QKW A;  4A4K A;  4M75 B;  1G3W A;  3VUZ A;  2DL5 A;  1M2O A;  4NL2 A;  4IUU A;  3JAM E;  1UGQ B;  4C92 E;  4M78 G;  2OTL T;  5FU6 C;  1TU0 B;  2R5A A;  3RKX A;  5LJ5 g;  3LWI A;  2ENM A;  3OMG A;  3REA B;  1Q82 U;  1AEY A;  4AFZ C;  1KC8 R;  2DLP A;  1RAB B;  4J9H A;  5IH2 A;  4C8Q G;  2KVQ G;  5HCK A;  2NUT A;  2W0Z A;  2JNG A;  5LJ3 f;  1TTH B;  2KE9 A;  2KK4 A;  5CQY A;  5DM7 R;  4RTX A;  1UJ0 A;  2QEX Q;  4DOW A;  2O9S A;  3MEW A;  2MIO A;  1BI2 A;  2BE9 B;  1PRM C;  1Y0M A;  5KCO A;  4KT0 E;  1D0Z A;  2PUK B;  2YRV A;  4J9F A;  2QDY B;  3Q1J A;  4M78 E;  2DF6 A;  2BZY A;  1N8R U;  1Y96 A;  4PJM A;  3SFM A;  5DLO A;  3S3N A;  2CP6 A;  5CKB A;  2OTL Q;  4M77 C;  4OB2 B;  1O75 A;  1G83 A;  3S6W A;  1OQK A;  1GBQ A;  3NTK A;  2EYY A;  1G3Y A;  3R6O A;  4C8Q E;  2COW A;  4DA4 A;  1D1C A;  2HMA A;  5GAM j;  1Y57 A;  2H3E B;  2SRC A;  2RH2 A;  2LTO A;  4DEY A;  4F04 B;  3M53 A;  1WHL A;  1VQK A;  4E6R A;  3OYA A;  3U23 A;  4IKF A;  2C0O A;  2E1H A;  1E7O A;  1VYU A;  1AT1 B;  3HRT A;  4A4H A;  3EG3 A;  1AVZ C;  2ZPH B;  4RTZ A;  4EMG A;  4JRP A;  3CXC S;  4RCB A;  3EH1 A;  1GCQ C;  4OGC A;  2FB7 A;  2CP7 A;  1SSF A;  1WHG A;  2K6D A;  1VQ5 T;  2RK2 A;  3H41 A;  3X24 B;  2YUN A;  5J3B A;  2F5K A;  4FYY B;  2QTX A;  2RJE A;  1FMW A;  1R77 A;  3FDR A;  1KD1 R;  1X43 A;  3AT1 B;  2RHU A;  1Q95 G;  3CQT A;  1JXO A;  5FU7 B;  3JCM g;  3D7S B;  3EH2 A;  1YI2 T;  1JQQ A;  2ZZD A;  1RAE B;  4R0K A;  2IG0 A;  2M02 A;  1TG0 A;  5CKE A;  3GF5 A;  1QVF A;  2I0N A;  4Z8A A;  2KSS A;  4OMN A;  4MDX A;  3FRN A;  3KUF A;  5GAN 6;  1WZO A;  4IIO A;  1VQ5 Q;  1BCM A;  4XQ3 A;  4BDZ A;  2DEQ A;  2QQ9 A;  4DOV A;  1IRE B;  1T0H A;  4FU6 A;  1X27 A;  1TS9 A;  2DAQ A;  1AZG B;  3M0U A;  2GCX A;  2E5K A;  1UHF A;  2JTM A;  3UT1 A;  3CC7 T;  2BZX A;  3SWN B;  1BIB A;  1YI2 Q;  1YJW A;  4M7A G;  3A5Z B;  2RM4 A;  3GBQ A;  1Z9Q A;  1KJW A;  4LUE A;  3RES A;  2PVD B;  1BI1 A;  2DJQ A;  1JB0 E;  4RG8 A;  4FYV B;  3OYI A;  1JJ2 S;  4JDS A;  2LT1 A;  2QAS A;  2OJ2 A;  4C92 A;  3I5R A;  5LJ3 d;  4XU3 A;  4OMF B;  2GTJ A;  4D6W A;  1EFN A;  2BZ8 A;  2M9U A;  2LNV A;  5GAO n;  1IZ6 A;  2PTK A;  2DX1 A;  2R57 A;  1IHV A;  3L2R A;  2A36 A;  3MEV A;  3ZFJ A;  1A0N B;  3QJ6 A;  4C5I A;  1G5V A;  1ZBX A;  2LQ8 A;  3LH0 A;  5GAN 5;  3CC7 Q;  4M7A E;  4ZGJ B;  3OMC A;  5GAN 7;  3SWN C;  2A0F B;  1WNL A;  5KYW B;  3DLL A;  3CCL Q;  1Q86 C;  1SEM A;  1V1C A;  3UAT A;  1U1S A;  1IB8 A;  1YIT A;  3I55 T;  1TUD A;  4M78 A;  2R5M A;  1KIK A;  2PVO B;  1M4Z A;  3E9G A;  1WJR A;  4TVR A;  1VQ4 A;  4BI4 A;  1D1B A;  4JLG A;  2RQR A;  4JUV A;  1KQ1 A;  1H3Z A;  1VIE A;  4PKC C;  3G6E T;  4FT2 A;  3V8K A;  4C8Q A;  3CCJ A;  2NUT B;  1PM3 A;  2MYS A;  2AKK A;  1ZSZ C;  4N4G A;  3LLR A;  2OTJ A;  1FXX A;  1UTI A;  1MMN A;  2E5Q A;  2KRS A;  4M7D E;  3H8Z A;  5FRM A;  4CI0 C;  3MJX A;  1M1K C;  4KH0 B;  3DB4 A;  4XTW A;  1H3H A;  3WVE B;  2DO3 A;  4QVC A;  5C0M A;  3QYH B;  3VS6 A;  2CP5 A;  4OMP A;  3I55 Q;  2EFI A;  4BAC A;  1WXT A;  3O5Z A;  4LXC A;  1WHJ A;  3ZBD A;  2KY9 A;  5IN1 A;  2G3R A;  2KXC A;  3G1J A;  3IQL A;  1GBR A;  1QP2 A;  1QLY A;  2RHX A;  3BW1 A;  1M90 C;  1RAI B;  4AG2 C;  3G6E Q;  2DL4 A;  5FWC A;  4M75 D;  4QQ6 A;  5GAN j;  3QHS A;  2LCL A;  5FW9 A;  1PC0 A;  2KR3 A;  5IHN A;  2E3I A;  1WLP B;  1GFD A;  3EFO B;  3M54 A;  5LJ3 h;  1GXI E;  1X6G A;  3HFN A;  5GJV B;  1WX6 A;  3C94 A;  4E7I A;  2QDL A;  4E7H A;  4PJO E;  1TXQ A;  4UC4 A;  1VYV A;  2XHC A;  4BE0 A;  2FYK A;  2ECZ A;  2L3R A;  1UFF A;  3VS4 A;  4HCK A;  3JRZ A;  1T0J A;  3V7S A;  1OU9 A;  1W2B S;  2MCN A;  1NPP A;  2EW3 A;  4RTY A;  4K11 A;  4B9X A;  4FSS A;  1OYX A;  4XTZ A;  3QKJ A;  1GCP A;  2DRM A;  4L5G A;  4ORZ A;  3MP6 A;  2CT4 A;  3CCQ T;  1PNJ A;  2Y4X A;  2ZPF B;  3G4S A;  2L5Q A;  3SB2 A;  4ESR A;  2RJF A;  5LJ5 f;  1VQO A;  4OF1 A;  1IHW A;  5GMK h;  1PSF A;  2A08 A;  5CKH A;  3QO3 A;  2L89 A;  3NFC A;  3OYL A;  3CCS T;  4KGV B;  2QA4 T;  2RK1 A;  4J7F A;  2DL8 A;  2F2W A;  3HHT B;  2YSQ A;  3ME9 A;  4N4H A;  2KAF A;  1PD0 A;  5ECA A;  2GBQ A;  3N5B B;  1WGS A;  3E19 A;  1IGU A;  1KQS P;  2V8I A;  2D6F A;  4M7D D;  2IIM A;  3CC2 Q;  2AKL A;  3LYI A;  3GOX A;  1AWJ A;  4WCI A;  1SPK A;  2RI2 A;  3NGP A;  4LN2 A;  4E7Z A;  3NTH A;  2HL5 C;  3PIP A;  1X6B A;  1VQP T;  3CCQ Q;  1HYO A;  5J26 A;  5CIU A;  2LX7 A;  1U1T A;  1NJI R;  1LCK A;  4XTX A;  4EPC A;  4M7A A;  3OA6 A;  1C6V X;  3RDV A;  1M3A A;  1VQM A;  1X2Q A;  3EGD A;  3CD6 T;  3HKS A;  3CCS Q;  2QA4 Q;  4RKU E;  3MP1 A;  1VQ6 A;  1CKB A;  3E2U A;  3RBB B;  2VXF A;  1D3B B;  1F1B B;  2PU9 B;  3EGX B;  4E47 A;  4BY6 C;  1NBE B;  2X3W D;  1QWF A;  3MCA B;  5CVI A;  2WSF E;  3PNW C;  3BY7 A;  1TH7 A;  1CSK A;  4GBQ A;  1SSH A;  1GL5 A;  3JCM V;  1N5Z A;  2KMT A;  3A1P A;  2WSE E;  3R6N A;  1VQ8 T;  1OI1 A;  4PJO D;  4OMO A;  3S3M A;  3VUB A;  1C1A A;  2IVW A;  2D8J A;  1VQP Q;  2K3X A;  1S72 A;  4XAX B;  1VOM A;  2KT1 A;  2RMO A;  3GIB A;  4M7D A;  2DD4 A;  3RNJ A;  4Y28 E;  2LQK A;  3DLM A;  3JB9 J;  4P5N A;  1Q7Y C;  4XTY A;  4EMK A;  3EG0 A;  2O4X A;  1W70 A;  3CD6 Q;  2RPN A;  4LD9 K;  2QQA A;  4M78 B;  5CCA A;  3JCM f;  2RN8 A;  3OYN A;  4MML A;  1WPY A;  3OBY A;  4C92 C;  3TSZ A;  4WF2 A;  3VS3 A;  3L2W A;  1NLP C;  1P92 A;  1UB4 A;  1WDX A;  3M0Q A;  4M75 F;  1YCS B;  2HCK A;  3C0C A;  4C8Q B;  1SHF A;  4JJC A;  1M5Q 1;  3OBW A;  1M1F A;  2RB6 A;  3CEY A;  3I56 A;  2C0I A;  1VQ8 Q;  2DPP B;  2QK0 A;  1WA7 A;  2RO0 A;  3ER0 A;  2CZ0 B;  1ZSG A;  4JS5 A;  4JRK A;  3UPU A;  1M8M A;  2YT6 A;  2JUF A;  1NLO C;  2V8J A;  2DE0 X;  4E7J A;  1BB9 A;  2MWP A;  1HJD A;  1VA7 A;  4M78 C;  1K0X A;  2KXD A;  2LQN A;  4ELY C;  3FEO A;  5I22 A;  5LJ5 d;  2J6O A;  2RQV A;  1ZUK A;  3OSS C;  4E2F B;  2O31 A;  1K9M C;  3MHX A;  2CS7 A;  5FRN A;  4HVU A;  4BE1 A;  2QEX A;  1UGS B;  1M27 C;  3EG1 A;  4C8Q C;  2F69 A;  3PTA A;  2HQX A;  1I5O B;  1HXD A;  5DLQ E;  1KQS A;  1WJQ A;  2GFU A;  2E3H A;  3L2Q A;  4Y92 A;  3RKY A;  3OYE A;  2DEU A;  2PVG B;  1IRX A;  4ZTJ A;  2OTL A;  1AD5 A;  3OS5 A;  5GAO l;  4QQD A;  3KBG A;  4ANJ A;  3TU4 K;  2RHI A;  1MGQ A;  3OB9 A;  4FCY A;  2A7Y A;  3V7C A;  3RIR A;  4M7D F;  1Q86 R;  1NPR A;  1QW1 A;  2C06 A;  4J8O A;  2D0Q B;  3CPW S;  3PVL A;  1PKT A;  3GLX A;  4M77 B;  3OW2 P;  4JJD A;  5GAO m;  2EQK A;  2DYI A;  1QVG S;  3FJP A;  5GAN 3;  2AIR B;  4JRI A;  1LOJ A;  2HBP A;  4VUB A;  2FEI A;  5A0D A;  2DIG A;  2VGM A;  2YRC A;  1HD3 A;  1BI3 A;  1V76 A;  4LUD A;  4J6Y A;  3UF4 A;  2DRK A;  1ZUU A;  3LGL A;  1Q81 C;  1M1K R;  2BKD N;  2Z0W A;  2HD0 A;  2ZGW A;  3JB9 D;  4PJO F;  5FWB A;  2J7I A;  4JLI A;  1K8A C;  2E64 A;  3HFO A;  4FT4 A;  2JTF A;  4Z02 A;  3JB9 H;  1I8F A;  2FHD A;  2YDL A;  3JCM d;  5LJ5 h;  3I9Q A;  1NJI C;  2VC8 A;  1M90 R;  1R0B G;  4J5Y A;  3EGD B;  1W1F A;  3M4Y A;  2R58 A;  3C4S A;  1VQ5 A;  4FYW B;  2E6Z A;  1WYX A;  2CSI A;  1B34 A;  1WI7 A;  4MZM A;  5GAM e;  2F5T X;  3M59 A;  2FO0 A;  2DXC A;  1B3Q A;  3A98 A;  3M9Q A;  3A8O B;  1M1G A;  4OML A;  2CKK A;  3QUI A;  4F14 A;  4WTO B;  2DTO A;  1YI2 A;  2K9G A;  4JZ3 A;  2Y4Y A;  4KGZ B;  2VV5 A;  1YN8 A;  3JCM c;  3FJ5 A;  1S1N A;  1NEB A;  4EIK A;  4RMO A;  1MUZ A;  4EMK B;  4M7A C;  4C0F A;  2B86 A;  2BE7 D;  3X25 B;  1N8R C;  1WQ7 A;  4XU1 A;  3L2Z A;  4OVA A;  3GP8 A;  2LDM A;  4JPB W;  1N9R A;  1ZBJ A;  2LJ0 A;  4FM4 B;  5LJ3 j;  3CCV T;  4PFP A;  1VQN Q;  1SRL A;  2RI5 A;  4M75 G;  3EGU A;  3CCR A;  2YLC A;  5L23 A;  2VVK A;  1OX9 A;  3CC7 A;  1IXD A;  4ZGE B;  3CCL A;  2JM9 A;  1UGR B;  3H0I A;  3PT9 A;  1TUC A;  5KYU B;  1OPK A;  3JCM J;  1U5S A;  2X4W A;  1QP3 A;  2COZ A;  4FW1 A;  2ATC B;  3CCE T;  1PG5 B;  3OW2 A;  2NLU A;  2PZ1 A;  4EMK C;  2XD0 A;  1X2K A;  2JVV A;  1I07 A;  5CO7 A;  1K73 R;  3CCR T;  3UA6 A;  2BIV A;  3CCL T;  2KYB A;  3JCM h;  4J9D A;  5GMK j;  1BCO A;  2XID A;  4M75 E;  3CCV Q;  4J9G A;  5M9O A;  4XU2 A;  2EWN A;  3VYH B;  1M30 A;  1M3C A;  2HKQ B;  1RUW A;  2NUP A;  1YNZ A;  4FSX A;  1C0M A;  2QTV A;  2FRY A;  1YBY A;  2LX9 A;  1QVF S;  3I55 A;  2QQR A;  3OYY A;  3CCE Q;  1RLP C;  1ZSZ B;  2O2O A;  2EGA A;  1KC8 U;  4ZTF A;  2JM8 A;  3TRE A;  2JW4 A;  4A63 B;  4HCZ A;  2VXE A;  3CCR Q;  3JB9 F;  2HL3 A;  3G6E A;  2LCC A;  1Q7Y R;  4AFS C;  4AFU C;  4M7D G;  1OUL A;  2XKO C;  4ZGD B;  5GAM g;  3BDL A;  1MND A;  3EHR A;  4NS5 A;  2JOY A;  3EG2 A;  1YCY A;  1RLQ C;  3V8L A;  1RAD B;  2JT4 A;  1X75 C;  2K4Y A;  5KCH A;  3ULR B;  4MZP A;  3GPL A;  4C0Z A;  2JS0 A;  4KUL A;  4PJL A;  3CCM T;  2XDP A;  4M4Z A;  3NTI A;  1VQ9 T;  1WIE A;  3OS2 A;  3P8H A;  1PCX A;  1OPL A;  3HPW A;  2L3S A;  1LPL A;  1G8X A;  2P0Q A;  4OGE A;  2DZC A;  5LL6 S;  2DYB A;  4A4G A;  2KGT A;  3ZEH A;  3QSU A;  4OMQ A;  2KNB B;  1UDL A;  5KYX A;  1FMV A;  4ZNX A;  4AMC A;  4LDU A;  1R0C B;  1WJS A;  5HK0 A;  4C5E A;  3REB B;  4DBF A;  1FYN A;  1TUG B;  1I81 A;  1ZQ1 A;  4AFQ C;  4PJO G;  2M0O A;  4NOY A;  4BB7 A;  1Y96 B;  2EGC A;  3KFV A;  5LJ3 g;  1RAC B;  3JCM X;  1RAH B;  3X20 B;  1J3T A;  3L2V A;  1MV0 B;  3CCM Q;  1K9M R;  4PLI A;  3QZ5 B;  3QDR B;  1VQ9 Q;  2DVE A;  3GNG A;  1LVK A;  3M58 A;  4J7I A;  5CAI A;  2C0T A;  1VYT A;  1UGV A;  2LT4 A;  2K3B A;  1B34 B;  2OX7 A;  1EZZ B;  1KD1 U;  2WSC E;  4II1 A;  2RF0 A;  4M77 D;  3CC2 A;  4BDY A;  1YIJ T;  3E9F A;  1WHM A;  2AZS A;  2VYT A;  2HQE A;  3CCQ A;  1AOJ A;  2JMA A;  2VKN A;  3I35 A;  3F70 A;  4RTW A;  2DL3 A;  1VQ7 T;  4CC3 A;  3OY9 A;  3JSC A;  3MET A;  3M0S A;  4PJN A;  3QWX X;  3CCS A;  1BU1 A;  3CME T;  1OX8 A;  2QA4 A;  1VQL T;  1FWZ A;  3CC2 T;  1V29 B;  1OV3 A;  2BUD A;  1JBM A;  2MK5 A;  3DB3 A;  3MO8 A;  3INZ A;  2KT8 A;  2K5I A;  2RJD A;  3QG1 A;  5J39 A;  3HL8 A;  4DQ2 A;  2RD1 A;  4Z89 A;  2FPD A;  2GQI A;  2XU8 A;  2GGR A;  2AZV A;  5GAO r;  1M2V A;  2KQW A;  1YIJ Q;  3RUX A;  4Q5W A;  3MP8 A;  2D8H A;  2J6K A;  1VQP A;  4M75 A;  2AHJ B;  1OZ3 A;  2K7A A;  4QKU A;  4DEX A;  4R56 A;  1MNE A;  4BY6 B;  1Q81 R;  1AWO A;  2PUO B;  4RG2 A;  1VQ7 Q;  4C0D C;  1M8V A;  1RAA B;  2QAZ A;  5GMK i;  4F7U F;  3CD6 A;  4A54 A;  3CME Q;  4QW2 A;  1VQL Q;  5D6W A;  1K8A R;  1NZ9 A;  1U3O A;  2V8K A;  3BE3 A;  3A8L B;  3EFS A;  2MPX C;  4BE2 A;  4O6J A;  3CCU T;  4J6X A;  3H0F A;  3MEA A;  2ESW A;  2JTE A;  3TEE A;  1K73 C;  3C12 A;  1VQ8 A;  1BYM A;  2E12 A;  4X1V A;  5A2Q E;  1GCQ A;  1B7T A;  3LWH A;  4LDX A;  1Q82 R;  1K0S A;  1YWP A;  2E65 A;  4RTT A;  4V2S A;  4C92 B;  3JV3 A;  2ZPE B;  1QVP A;  2L0A A;  2RQT A;  3J81 E;  2X4Y A;  3H6Z A;  2ROT A;  4KBM B;  2O01 E;  2JZ2 A;  3LX7 A;  1KHC A;  1X6O A;  3VKI A;  2H3J A;  1OZ2 A;  3CCU Q;  4MDW A;  4GY5 A;  2MI6 A;  1B07 A;  1EX4 A;  1ACM B;  4A53 A;  3JB9 G;  2LNH B;  5GAN g;  5LJ5 j;  3JCM Q;  1N8R R;  1IO6 A;  1X69 A;  2CZ7 B;  5I2M A;  2FL7 A;  2NUZ A;  1HSQ A;  4ME7 A;  3UDC A;  2EBP A;  1M9S A;  3M57 A;  4E7K A;  5GAN 4;  3CXC P;  2EJG A;  2XI9 A;  3I5S A;  5D6X A;  4F16 A;  1T3S A;  5GAO p;  2QXF A;  4QVZ A;  3LH5 A;  4X9C A;  3OYJ A;  2WAC A;  2JS2 A;  2EGE A;  2E70 A;  1ZX6 A;  2LCS A;  1OU8 A;  1YHQ T;  4FIB A;  3M4G A;  3ASK A;  2X4J A;  3VS7 A;  2PQW A;  4PJO A;  3E1S A;  3S3O A;  3THK A;  1MMG A;  2HAX A;  2DK3 A;  4PFO A;  2LJ1 A;  1YJ9 T;  3MPU B;  2DTI A;  1YP5 A;  6AT1 B;  3JB9 I;  3MKD A;  2FG0 A;  3EHQ A;  3C95 A;  2LJ3 A;  3NPF A;  2FPE A;  1RI0 A;  4AG1 C;  1QWE A;  1YHQ Q;  3OYC A;  4JZ4 A;  4N0A A;  4ZN3 A;  4J9C A;  2CUD A;  4PJJ A;  3TCJ A;  3L2U A;  1BIA A;  1MMD A;  2QGG A;  2IPO B;  2ZCF B;  2EYX A;  1ZLM A;  4MMK A;  3CMA T;  5IHK A;  2EJ9 A;  1AHJ B;  8AT1 B;  2DTH A;  4J9B A;  3VU3 C;  3OYH A;  1UHC A;  5GAM f;  1JJ2 P;  3UA7 A;  2CSQ A;  2D1X A;  1YJ9 Q;  3G71 T;  3PGG A;  4PNO A;  5DY9 A;  2RI3 A;  4IIM A;  5KH6 A;  1WQW A;  2KEA A;  2DIL A;  3PIO A;  3EG9 A;  1RL2 A;  1WHH A;  3UWN A;  3FB9 A;  3VYG A;  2EVR A;  1EIF A;  1ABQ A;  5CK9 A;  3WXM B;  2CYZ B;  1M2V B;  4FYX B;  2HBW A;  1KG1 A;  2NYS A;  5KYW A;  1NJI U;  4BI3 A;  1PRL C;  3AHU A;  1YJN T;  1UEC A;  4CRI A;  1X01 A;  3VS1 A;  2KDS A;  4CC2 A;  3CC4 T;  3QBY A;  2RQU A;  4C5G A;  3CMA Q;  1KQS S;  5GMK l;  2DXB A;  1ZA1 B;  4L6V 5;  1VUB A;  3RER A;  2EQM A;  2J6F A;  2DMO A;  1YFN A;  4A4F A;  5EC7 A;  2YLB A;  4F7U G;  3OYG A;  2CDT A;  4LDW A;  3G71 Q;  2K3Y A;  4B9W A;  1KFZ A;  2CRE A;  5KYY A;  3CXC A;  1RAF B;  4AT1 B;  2L2P A;  4PFZ A;  3P8D A;  2XG8 D;  4ELZ C;  1VQN A;  3QII A;  4M7A B;  1JRI A;  5GMK m;  3QXE B;  1UEB A;  3WVD B;  3VS5 A;  1QKX A;  1RI9 A;  1LNX A;  1Y71 A;  4M75 C;  1YJN Q;  5KYN A;  1QCN A;  4BUG A;  1I1J A;  5A0G A;  4NL3 A;  4DBH A;  3CC4 Q;  1O9S A;  5D6Y A;  1Y7X A;  3M0R A;  1Q82 C;  5GAN 2;  2EIF A;  3O8V A;  3PMI A;  2MOX A;  2KYM A;  4F7U E;  4J6W A;  1VQN T;  2B8A A;  1ARK A;  1NYF A;  1D0Y A;  2LQW A;  3PFS A;  1KHI A;  2CZ1 B;  2EYZ A;  1SHG A;  3V8J A;  2CUB A;  2K5F A;  5CR2 A;  1QQJ A;  2JJ9 A;  3CCV A;  2EJF A;  3EFO A;  1XOV A;  2RQW A;  1G2B A;  4M7D B;  2VWF A;  3RKW A;  4GLM A;  4C5H A;  4KUI A;  4X34 A;  4IUV A;  1SRM A;  2AK5 A;  2O4X B;  1I4K 1;  4LDV A;  4OMM A;  3L42 A;  3CBP A;  4HA8 A;  1H92 A;  2YUO A;  4OB0 B;  2F1L A;  3CCE A;  3QDF A;  2L3Q A;  4E7S A;  1VQK T;  5LJ3 e;  3URG A;  1W2B P;  3JCM b;  1NEG A;  5HK3 A;  4C0G A;  3OYD A;  2V26 A;  2ZPI B;  1D0X A;  3H0H A;  1OOT A;  1JJ2 A;  1R8O B;  1KSW A;  4M77 G;  2JMC A;  5IXB A;  3L1A A;  3QWY A;  2K2M A;  1FX7 A;  2P4R A;  4C92 D;  4O5V A;  3TQ7 P;  2A28 A;  1CKA A;  5HKC A;  3X26 B;  5GAM d;  4M7D C;  2CGH A;  2O88 A;  4PJO B;  4ATO A;  3HTR A;  2FZK B;  3VRZ A;  4JS4 A;  1W4S A;  2HSE B;  1N27 A;  3CBO A;  5AT1 B;  2P4T A;  2DZ9 A;  3PVQ A;  2RHZ A;  5GMK e;  1Q86 U;  5IAY A;  1VQK Q;  2G6F X;  3P8B B;  1ABO A;  2X9H A;  4QQG A;  2H8H A;  3PE0 A;  4M77 E;  2COY A;  3NHN A;  2CZ6 B;  2DBM A;  4M78 D;  3RMS A;  2GFA A;  5FU7 C;  4GLK A;  2X4X A;  4EMH A;  3RMQ A;  1PD1 A;  1SG5 A;  3CCM A;  1QCF A;  4C8Q D;  4D8D A;  1UE9 A;  3ZL7 C;  4PJO C;  1VQ9 A;  1D3B A;  4KH1 B;  2M51 A;  2GTO A;  2K79 A;  4J9E A;  4RTV A;  3EGX A;  3QPH A;  4HVW A;  1JU5 C;  3VRY A;  2KI7 A;  5GAN f;  2KBT A;  3G7Z A;  4CC7 A;  3JCM P;  1BK2 A;  1ZUY A;  2VAS A;  3DKM A;  1M1K U;  3OW2 S;  2M1H A;  2EQJ A;  1YJW T;  2DA9 A;  2ZPG B;  4XK8 E;  2EPD A;  3EG9 B;  2E6N A;  4RTU A;  2O9V A;  2YRD A;  1TWB A;  1GRI A;  2J05 A;  1H8K A;  4MZT A;  4FL6 A;  2ZPB B;  2E10 A;  2DVJ A;  2A37 A;  5KE2 A;  3QJY A;  2A3L A;  2DIQ A;  3A8M B;  1N6A A;  2P0P A;  2CP0 A;  2EAY A;  2HZY A;  2V1Q A;  4N0A C;  9ATC B;  4HCB A;  1M90 U;  1XJW B;  3HSB A;  1BI0 A;  5HY6 A;  1WXB A;  5CKD A;  1WHK A;  3HP9 A;  5IXF A;  2ROL A;  3RR6 A;  1N9S A;  1PWT A;  3FC3 A;  4EDU A;  2JN0 A;  2X35 A;  1PKS A;  2XMF A;  4D8K A;  2OAW A;  2YUP A;  2MWO A;  4XTU A;  4F7U A;  1UGP B;  1E6H A;  5GAM h;  2LRQ A;  2EYQ A;  2E41 A;  4J83 A;  5KYY B;  1KC8 C;  1YJW Q;  5IHI A;  3X28 B;  2M0Y A;  1YIJ A;  4Z88 A;  3GNF B;  2RA2 A;  4JJB A;  1FMK A;  1YIT T;  1W2B A;  4XTV A;  5D7U A;  3M5A A;  1W6X A;  1XNI A;  4KUD K;  1VQ4 T;  2CT3 A;  2MF2 A;  3VV0 A;  1VQ7 A;  3A8G B;  1NE8 A;  3OSV A;  2HSP A;  2K2V A;  2QQB A;  2W10 A;  3J80 E;  3CME A;  3CCJ T;  1VQL A;  5GAN e;  4RUG A;  2GQV A;  1WXU A;  2X3X D;  3V7R A;  5I21 A;  2OTJ T;  3TVT A;  2FPF A;  5FLX E;  2XK0 A;  4LD6 A;  2DBK A;  2DL7 A;  3EAE A;  4HXJ A;  2QG9 B;  2OAU A;  1GFC A;  3LW5 E;  3JCM W;  1MHN A;  4C0D B;  2KRO A;  4C92 F;  1LJO A;  1K4U S;  1M3B A;  1QMC A;  2K57 A;  2JXB A;  1TSF A;  3A8H B;  1YIT Q;  3HRS A;  1K76 A;  1KK7 A;  4QVD A;  2LVM A;  2OI3 A;  2D0N A;  4N4I A;  1K9A A;  2FVU A;  4ZN1 A;  1VQ4 Q;  3SEM A;  1XTD A;  3OS0 A;  3OYM A;  1OEB A;  1AWW A;  1AZE A;  1UG1 A;  3QYG B;  1MV3 A;  3T9N A;  1NYG A;  3CCJ Q;  5GAO q;  2LMJ A;  1SKU B;  5FRO A;  1JO8 A;  1K73 U;  1I5L A;  3NMZ C;  1TOV A;  4M7A D;  2OTJ Q;  2DKG A;  2VB6 A;  5CKF A;  1NM7 A;  3CCU A;  2FZG B;  4IUT A;  3PMT A;  4M78 F;  5I2S A;  2X51 A;  1YWO A;  5C6S A;  2ZAE A;  1KD1 C;  4M77 A;  2QYZ A;  2E4H A;  4YTL A;  4E7L A;  3CPW P;  2YWW A;  4HVV A;  4L59 A;  2EKH A;  2DJZ A;  1RAG B;  4PLL A;  3SDZ A;  3EFR A;  4C8Q F;  2MMP A;  4IUP A;  5GAN d;  3M0P A;  1QVG P;  1VIF A;  2EYW A;  2CP3 A;  5KE3 A;  3SD4 A;  1G3S A;  2XDB A;  2CP2 A;  3MEU A;  2RHY A;  2LC4 A;  3G4S T;  1VQO T;  2NWM A;  3LGF A;  3CPF A;  2XIC A;  1I0C A;  1Q7Y U;  3FIF A;  2I2L A;  2QGF B;  2GNC A;  2DET A;  4RCC A;  2NUP B;  2BTT A;  1SF9 A;  2DNU A;  2HQH A;  2DER A;  2FRW A;  3OQ5 A;  1Y07 A;  2RNA A;  2YHT A;  2ED0 A;  2K5L A;  7AT1 B;  4OB3 B;  2VUB A;  2CH4 W;  1T3L A;  4KGX B;  4HCC A;  8ATC B;  2V1R A;  2DXT A;  3SHW A;  5GAN 8;  2P84 A;  2ED1 A;  4DBQ A;  1G3T A;  4B6M A;  3G4S Q;  1VQO Q;  4FW2 A;  3OYB A;  2HDA A;  2F2V A;  4J9I A;  4JJN K;  5LJ5 e;  4CC4 B;  1NG2 A;  1VQM T;  4OP0 A;  3M0T A;  1YHQ A;  4LDY A;  2LP5 A;  1VQ6 T;  4JRQ A;  2DM1 A;  2KRN A;  2YXY A;  5L8R E;  2DFU A;  2XDD A;  1JEG A;  3CBM A;  1K9M U;  1BBZ A;  4X9D A;  2HNI A;  2MAM A;  3BFM A;  2EKO A;  2GF7 A;  4M77 F;  2LZ6 B;  3FLG A;  3OYK A;  1HK9 A;  2DXU A;  2QI2 A;  2QQS A;  4XU0 A;  1YJ9 A;  2CH4 A;  1PHT A;  1Z9Z A;  1BKB A;  1JXM A;  5KYX B;  2ABL A;  4F7U B;  1UJY A;  1S72 T;  3QZ9 B;  4PL6 A;  2EQI A;  5GAN h;  1MMA A;  4A4E A;  5AYF A;  1ZA2 B;  2SEM A;  4BI8 B;  1QCO A;  1VQM Q;  4Y91 A;  1D09 B;  2HKN A;  5KYU A;  2AT1 B;  1XQH A;  2KRM A;  3VS0 A;  1VQ6 Q;  3H9N A;  4QT7 A;  4PK4 A;  1WFW A;  2L8D A;  3CMA A;  2VGN A;  4OB1 B;  1DJ7 B;  3CPW A;  1H64 1;  2J06 A;  3I56 T;  1PSE A;  3G71 A;  4M7A F;  1IGQ A;  3SWN A;  1K1Z A;  1QVG A;  2M16 A;  4KRT A;  3OYF A;  1U8R A;  4R55 A;  3HRU A;  1S72 Q;  1U06 A;  2D9T A;  2F2X A;  2HEQ A;  5FU6 B;  5I11 A;  1D1A A;  3M56 A;  2FZC B;  1ZHI A;  5CQX A;  3TSW A;  4C92 G;  4HT8 A;  2Y90 A;  5A0L A;  3J7A F;  4F17 A;  1Q81 U;  3BDU A;  4IUR A; 
#chains in the Genus database with same CATH homology
 4ZNX A;  3VS2 A;  1E6G A;  1M3A A;  2PNI A;  1X2Q A;  3REB B;  1FYN A;  1NEG A;  4AFQ C;  2YUQ A;  4LNP A;  3H0H A;  1OOT A;  2L3P A;  4LE9 A;  1CKB A;  2EGC A;  3RBB B;  1KSW A;  3KFV A;  2JMC A;  1J3T A;  1MV0 B;  5IXB A;  2X3W D;  1QWF A;  4OMQ A;  3QWY A;  2K2M A;  2P4R A;  4GBQ A;  1CSK A;  1SSH A;  1AWX A;  2A28 A;  1GL5 A;  1CKA A;  1UUE A;  5GJW B;  1N5Z A;  1QKW A;  2O88 A;  2C0T A;  1VYT A;  1UGV A;  2DL5 A;  3R6N A;  2K3B A;  4OMO A;  3VRZ A;  2D8J A;  2RF0 A;  2ENM A;  2RMO A;  2KT1 A;  3REA B;  2AZS A;  1AEY A;  4AFZ C;  3RNJ A;  3PVQ A;  2DLP A;  1AOJ A;  2JMA A;  2G6F X;  4J9H A;  2VKN A;  3EG0 A;  5IH2 A;  1ABO A;  5HCK A;  3I35 A;  1W70 A;  2W0Z A;  2RPN A;  4RTW A;  2DL3 A;  2H8H A;  3PE0 A;  2KE9 A;  3NHN A;  4CC3 A;  2RN8 A;  2DBM A;  3M0S A;  4RTX A;  1UJ0 A;  3QWX X;  1BU1 A;  3TSZ A;  2O9S A;  3VS3 A;  1NLP C;  1WDX A;  2MIO A;  3M0Q A;  1OV3 A;  1PRM C;  1Y0M A;  1YCS B;  2HCK A;  3C0C A;  1SHF A;  4JJC A;  2KT8 A;  4J9F A;  1QCF A;  4D8D A;  1UE9 A;  3ZL7 C;  2C0I A;  2DF6 A;  2BZY A;  1WA7 A;  2GTO A;  2K79 A;  2M51 A;  4J9E A;  4RTV A;  4Z89 A;  1ZSG A;  4HVW A;  2FPD A;  1JU5 C;  2GQI A;  3VRY A;  2GGR A;  1G83 A;  2AZV A;  2KBT A;  1GBQ A;  4CC7 A;  2EYY A;  1BK2 A;  1M8M A;  1ZUY A;  2D8H A;  2YT6 A;  2J6K A;  1NLO C;  2DE0 X;  2DA9 A;  2K7A A;  2EPD A;  4RTU A;  2O9V A;  4DEX A;  1AWO A;  1Y57 A;  1GRI A;  1BB9 A;  2SRC A;  2J05 A;  1H8K A;  1HJD A;  4DEY A;  1VA7 A;  1K0X A;  2KXD A;  2LQN A;  4E6R A;  5I22 A;  3U23 A;  2J6O A;  2C0O A;  2A37 A;  1ZUK A;  2DVJ A;  2RQV A;  2O31 A;  1E7O A;  1VYU A;  4HVU A;  1U3O A;  3EG3 A;  1AVZ C;  2V1Q A;  4RTZ A;  1M27 C;  3EG1 A;  1GCQ C;  1WXB A;  2K6D A;  3H0F A;  2ESW A;  3H41 A;  5IXF A;  2ROL A;  1PWT A;  2JTE A;  2YUN A;  4D8K A;  1PKS A;  2XMF A;  2OAW A;  4Y92 A;  2YUP A;  1E6H A;  4X1V A;  1GCQ A;  1AD5 A;  1X43 A;  5IHI A;  2M0Y A;  1K0S A;  1YWP A;  4RTT A;  4Z88 A;  3JV3 A;  4JJB A;  3CQT A;  1FMK A;  1JXO A;  1JQQ A;  1W6X A;  2L0A A;  2RQT A;  4R0K A;  1TG0 A;  2I0N A;  2CT3 A;  4Z8A A;  2ROT A;  4OMN A;  3PVL A;  2HSP A;  1PKT A;  2W10 A;  4JJD A;  4RUG A;  4IIO A;  1WXU A;  2X3X D;  1B07 A;  3TVT A;  2FPF A;  1T0H A;  2LNH B;  2DBK A;  2DL7 A;  4HXJ A;  1X27 A;  2FEI A;  1IO6 A;  1X69 A;  1GFC A;  1HD3 A;  1AZG B;  2NUZ A;  1HSQ A;  2KRO A;  2L3Q A;  4LUD A;  3M0U A;  3UF4 A;  2DRK A;  2E5K A;  1UHF A;  1ZUU A;  2EBP A;  1K4U S;  1M3B A;  2BZX A;  2JXB A;  3I5S A;  4F16 A;  1T3S A;  1K76 A;  2OI3 A;  2D0N A;  3GBQ A;  1Z9Q A;  1K9A A;  1KJW A;  4LUE A;  3LH5 A;  5FWB A;  2J7I A;  3SEM A;  1OEB A;  1AWW A;  2DJQ A;  1AZE A;  1UG1 A;  2JS2 A;  2EGE A;  1MV3 A;  1NYG A;  2OJ2 A;  3I5R A;  2YDL A;  2LMJ A;  1ZX6 A;  2GTJ A;  2LCS A;  1JO8 A;  1EFN A;  3I9Q A;  2BZ8 A;  3NMZ C;  1W1F A;  1NM7 A;  3VS7 A;  2PTK A;  2DX1 A;  1WYX A;  2CSI A;  1YWO A;  2A36 A;  1WI7 A;  3THK A;  1A0N B;  2FO0 A;  4HVV A;  2EKH A;  1B3Q A;  3A98 A;  2LJ1 A;  1YP5 A;  1SEM A;  1V1C A;  4OML A;  3UAT A;  2FG0 A;  3EHQ A;  3M0P A;  4F14 A;  2EYW A;  2LJ3 A;  1TUD A;  2K9G A;  4JZ3 A;  3NPF A;  2FPE A;  1KIK A;  1YN8 A;  4AG1 C;  2NWM A;  3FJ5 A;  1S1N A;  1NEB A;  1QWE A;  4EIK A;  1I0C A;  2RQR A;  4JZ4 A;  1MUZ A;  4J9C A;  2CUD A;  2B86 A;  2EYX A;  2GNC A;  1ZLM A;  2AKK A;  5IHK A;  2BTT A;  4J9B A;  1UTI A;  1UHC A;  2DNU A;  2FRW A;  4JPB W;  2KRS A;  2RNA A;  2LJ0 A;  1ZBJ A;  3UA7 A;  2CSQ A;  2D1X A;  2ED0 A;  4IIM A;  1SRL A;  1H3H A;  2CH4 W;  1T3L A;  2KEA A;  3EGU A;  5L23 A;  2VVK A;  2DIL A;  2V1R A;  3VS6 A;  4OMP A;  2JM9 A;  3H0I A;  3SHW A;  1WXT A;  1TUC A;  2EVR A;  3O5Z A;  2ED1 A;  1ABQ A;  1OPK A;  1U5S A;  2HBW A;  2KXC A;  2HDA A;  2F2V A;  3IQL A;  4J9I A;  1GBR A;  1QLY A;  1PRL C;  2PZ1 A;  4AG2 C;  1UEC A;  4CC4 B;  2DL4 A;  5FWC A;  1X2K A;  1NG2 A;  3VS1 A;  4CC2 A;  1I07 A;  3M0T A;  5FW9 A;  2RQU A;  2KR3 A;  5IHN A;  1WLP B;  2LP5 A;  1GFD A;  3UA6 A;  1X6G A;  2DM1 A;  5GJV B;  2KYB A;  2KRN A;  2J6F A;  2DMO A;  4J9D A;  1WX6 A;  1JEG A;  5EC7 A;  2QDL A;  2CDT A;  4J9G A;  1KFZ A;  1BBZ A;  2CRE A;  2LZ6 B;  1VYV A;  2ECZ A;  2L2P A;  1M30 A;  1M3C A;  1UFF A;  1RUW A;  3VS4 A;  2CH4 A;  1PHT A;  1Z9Z A;  4HCK A;  1T0J A;  1YNZ A;  2FRY A;  2MCN A;  1JXM A;  2EW3 A;  2ABL A;  4RTY A;  4K11 A;  4FSS A;  1UJY A;  2EQI A;  1GCP A;  3VS5 A;  1QKX A;  1RI9 A;  1RLP C;  2DRM A;  4ORZ A;  2CT4 A;  2O2O A;  2SEM A;  2EGA A;  1PNJ A;  4ESR A;  1I1J A;  2JM8 A;  2JW4 A;  4A63 B;  3M0R A;  2KRM A;  3VS0 A;  2A08 A;  2MOX A;  2KYM A;  4AFU C;  4AFS C;  4QT7 A;  1WFW A;  3EHR A;  1ARK A;  1NYF A;  2DL8 A;  2F2W A;  2LQW A;  3EG2 A;  1RLQ C;  2EYZ A;  2YSQ A;  1SHG A;  2JT4 A;  2CUB A;  3ULR B;  2JS0 A;  2J06 A;  5ECA A;  2GBQ A;  4M4Z A;  1K1Z A;  1XOV A;  2RQW A;  1G2B A;  1WIE A;  2VWF A;  4GLM A;  4KRT A;  2IIM A;  2AKL A;  1SRM A;  2AK5 A;  1AWJ A;  1U06 A;  4WCI A;  2F2X A;  1SPK A;  2HEQ A;  3NGP A;  4LN2 A;  5I11 A;  4OMM A;  1OPL A;  1X6B A;  2L3S A;  2LX7 A;  3TSW A;  1H92 A;  2YUO A;  1LCK A;  2DYB A;  2KGT A;  4F17 A;  2KNB B;  1UDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...