1ZUUA

Crystal structure of the yeast bzz1 first sh3 domain at 0.97-a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
ENKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords BZZ1 protein
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zuuA00
1UTIA 1VYVA 4HVWA 3VRZA 1SHFA 2NUZA 1K76A 1RLPC 4J9CA 1SSHA 5GJVB 3EG0A 4RTXA 4F17A 2C0OA 2F2XA 5FWBA 1UHCA 1SEMA 2DVJA 1K9AA 2CT3A 2CUDA 2DA9A 5FWCA 3RBBB 2AKKA 1KIKA 2ED0A 1PRMC 4RTUA 5I22A 2KT8A 2LJ0A 3KFVA 2DNUA 4DEYA 2EGAA 2HEQA 2K9GA 2EKHA 1U06A 3NHNA 1T3SA 1H92A 1AWOA 1NYFA 2LMJA 2SRCA 3ULRB 1UECA 1WXUA 4D8KA 2RN8A 2CSQA 2JS0A 2FG0A 5GJWB 2RQRA 3PVLA 4OMQA 1VYTA 2PTKA 2RQVA 4JZ4A 2EGCA 2J05A 1AOJA 2J7IA 2A08A 4JJBA 5FW9A 3VS4A 1I1JA 1VA7A 4J9BA 1GFCA 1UUEA 1Z9ZA 2LX7A 4AG2C 3TVTA 4OMPA 3VS0A 1GRIA 1PRLC 4CC7A 1AZGB 2LCSA 4FSSA 1MUZA 3NMZC 1AEYA 1QCFA 1S1NA 5IXBA 2O9SA 1W70A 4RTTA 1AVZC 1OEBA 4CC3A 3REBB 1ZSGA 2FPEA 3TSWA 2EW3A 2FRWA 2H8HA 1RI9A 1X6GA 2BZYA 1AWWA 2GQIA 1WX6A 3I5SA 1G2BA 2D8JA 2G6FX 1AWXA 2HCKA 2QDLA 4LE9A 4HVUA 1H3HA 2A28A 2CSIA 3SEMA 2O88A 2RPNA 1M30A 1TUCA 2KGTA 2X3WD 1E6HA 4R0KA 1JXMA 2D8HA 1ABOA 1IO6A 1K4US 2L0AA 1QKWA 2YUOA 2EYYA 1WYXA 2A37A 2W10A 1UG1A 2RQTA 2OAWA 1W6XA 2DLPA 2OI3A 1X43A 2LQWA 2JXBA 1HD3A 1OV3A 5L23A 2EYWA 2E5KA 1YP5A 1SRMA 2M0YA 3M0RA 4J9GA 4RTZA 2HBWA 4AFSC 1WXBA 4JPBW 1JU5C 4F14A 2AZVA 2DRKA 3QWXX 2ED1A 1M8MA 1GCQC 2KYMA 2OJ2A 2KRNA 4LN2A 4LUEA 1KFZA 4F16A 2PNIA 4EIKA 1CSKA 1X2QA 2C0TA 2DMOA 3EHQA 1JXOA 2GBQA 1PWTA 2FPFA 2K79A 2J6FA 3SHWA 1TUDA 1K0XA 3M0TA 3GBQA 4Z89A 3I35A 1NM7A 1QWEA 1XOVA 2KE9A 2PZ1A 2DBMA 4RUGA 2YSQA 4Y92A 3RNJA 1UFFA 1Y57A 2JS2A 3PE0A 1YCSB 2JM8A 2RF0A 3H41A 1TG0A 3UATA 2LZ6B 3M0SA 2K2MA 1I0CA 2DL8A 2DYBA 2DE0X 1UJ0A 2JT4A 2BTTA 2BZ8A 2A36A 2CH4W 3REAB 2L2PA 2LQNA 2C0IA 3VS6A 4J9HA 4IIMA 5EC7A 2K6DA 2CDTA 1HSQA 4HXJA 1SRLA 2AK5A 2DL5A 3VRYA 1OPKA 1UGVA 2YDLA 4JJDA 1W1FA 1ZUUA 2J06A 1GBQA 2MOXA 4CC4B 1PKSA 1NYGA 4AFUC 1LCKA 3THKA 2RQUA 3M0UA 3EG3A 4Z88A 1CKAA 5IHIA 5IXFA 1SPKA 1MV3A 4DEXA 5ECAA 2DL7A 1GL5A 2LNHB 3VS3A 2KNBB 3ZL7C 4JJCA 5IHNA 4J9IA 3VS1A 5IHKA 2DL4A 2D0NA 2DF6A 2KR3A 1YWOA 1NEBA 2HDAA 4RTWA 4OMOA 2MCNA 1QLYA 3NPFA 4AFQC 2F2WA 1ZLMA 2EBPA 2W0ZA 4ESRA 2EYZA 1AWJA 1SHGA 2DRMA 2LJ1A 1K0SA 1N5ZA 1CKBA 4IIOA 1NLPC 1RLQC 2LJ3A 1UJYA 2O31A 2DL3A 2FPDA 1GBRA 2EQIA 1V1CA 1JO8A 2RQWA 2VWFA 4KRTA 4HCKA 1WDXA 1YNZA 2MIOA 3TSZA 5IH2A 2EYXA 3NGPA 4OMNA 2EGEA 4A63B 1NLOC 2FO0A 3U23A 2DJQA 3I9QA 3VS7A 1U3OA 2KXCA 3A98A 2KRSA 1EFNA 4E6RA 2EPDA 1WI7A 3UA7A 4X1VA 2ROLA 4OMLA 2O9VA 4HVVA 3M0PA 2JM9A 2KBTA 2ROTA 1Z9QA 2GGRA 1GFDA 4QT7A 1KJWA 1E7OA 2YT6A 3EHRA 2YUQA 2GNCA 2SEMA 2VVKA 5I11A 2KROA 1RUWA 2KEAA 3VS2A 1YN8A 3VS5A 1T3LA 2IIMA 2CUBA 1X2KA 1BK2A 2KYBA 2ESWA 4CC2A 3H0IA 1M3BA 1BB9A 4ZNXA 1WA7A 1ZX6A 2K3BA 1K1ZA 2JMCA 2NWMA 1JEGA 1GCQA 1GCPA 1NG2A 2DILA 2V1RA 1X6BA 3IQLA 2KXDA 4GBQA 1A0NB 1BBZA 1NEGA 1WLPB 1HJDA 4LNPA 1BU1A 4K11A 1WIEA 3PVQA 2D1XA 2L3PA 4AFZC 2BZXA 2YUPA 4D8DA 1AD5A 4JZ3A 1UE9A 2L3SA 1FYNA 2HSPA 1G83A 1X27A 2AKLA 3R6NA 1J3TA 3QWYA 2LP5A 2ABLA 1FMKA 3EGUA 2K7AA 3EG2A 4AG1C 2AZSA 1KSWA 1QWFA 4J9FA 1PHTA 1X69A 2B86A 1ZUKA 1T0JA 2EVRA 3M0QA 3C0CA 2CH4A 3H0HA 3H0FA 2GTOA 1M3AA 2ENMA 1E6GA 3UF4A 1ABQA 1YWPA 3CQTA 1B07A 2I0NA 2VKNA 2DM1A 1VYUA 2L3QA 2CT4A 2KT1A 1WXTA 2RMOA 2ECZA 4GLMA 2M51A 4WCIA 3UA6A 4Z8AA 2XMFA 4ORZA 2P4RA 2V1QA 3LH5A 1MV0B 2O2OA 1AZEA 1WFWA 2CREA 4LUDA 4M4ZA 4J9DA 1T0HA 4OMMA 2FRYA 2JMAA 2DX1A 1UHFA 1PKTA 1PNJA 1M3CA 2X3XD 1H8KA 1M27C 2JTEA 1I07A 1QKXA 1JQQA 1Y0MA 2DBKA 4RTYA 1ZUYA 3FJ5A 4RTVA 2GTJA 1UDLA 4J9EA 2J6KA 2RNAA 5HCKA 2J6OA 3JV3A 1ZBJA 1OOTA 3EG1A 2KRMA 2FEIA 3O5ZA 2YUNA 3I5RA 2F2VA 2JW4A 1U5SA 1ARKA 1B3QA 1OPLA
chains in the Genus database with same CATH superfamily
2RJFA 5GMKe 1VYVA 4M78C 1SHFA 2NUZA 4LDUA 1KHCA 2EFIA 4J9CA 2ZPGB 4M7DG 2EJGA 2MWPA 1WHHA 4F7UA 2C0OA 4FSXA 4VUBA 3GNFB 5FWBA 1UHCA 2DXCA 5LJ3f 3D7SB 1PD1A 2DIGA 1BYMA 3QG1A 2OTLA 4MMKA 1KIKA 1VQ4A 1X75C 1YHQQ 5I22A 2KT8A 1ZA2B 2DNUA 2EGAA 2LDMA 2IPOB 4C0GA 2EKHA 3CBOA 1H92A 7AT1B 2O01E 3ULRB 1VQ7A 1UECA 1WXUA 3S3MA 1QVFA 4M7AC 2JS0A 4KGZB 1R0CB 5CO7A 4OMQA 3VUBA 1VQLT 1IZ6A 1ZBXA 1EIFA 1Q86C 1LPLA 1AOJA 2A08A 3RR6A 4C5EA 1VQMQ 1VA7A 1V29B 1OULA 4KULA 5AYFA 2YWWA 4CC7A 3T9NA 2LCSA 2HQXA 3MEWA 1UB4A 4DOVA 2RHXA 2O9SA 3PFSA 3CMAT 5DLQE 1KC8C 3BW1A 1R0BG 1SG5A 2O4XB 2K3YA 3REBB 4E7LA 3TSWA 3OYFA 3G7ZA 1ZA1B 4C0DC 2CYZB 2P0QA 5GAN6 1JJ2S 2FRWA 4R55A 3LWHA 4M77D 5I21A 2FZKB 3MEAA 3JB9G 2JUFA 2BZYA 4Z02A 2JZ2A 1QVGA 1WHKA 2GQIA 1WX6A 4KUIA 5LJ3g 3UT1A 3M59A 2QDLA 4LE9A 5IN1A 3CCVT 1YIJT 2A28A 2CSIA 2M16A 5J26A 3SEMA 5FU6C 1N8RR 3M54A 3QKJA 2HAXA 1KQ1A 1OQKA 1TUCA 4PJOC 1RABB 1JJ2A 1QVGP 1JXMA 1JBMA 2G3RA 2GQVA 2EYYA 2NUTB 2A37A 3OSVA 4FU6A 2RQTA 2OAWA 1X43A 2JXBA 1YFNA 2QTXA 1OV3A 5L23A 1SRMA 3QDRB 2M0YA 2K4YA 2RB6A 2E65A 1NZ9A 1WXBA 2X9HA 2AZVA 1XQHA 3OMCA 2KYMA 1WPYA 5GMKj 4MDWA 4ME7A 1IB8A 5GAOl 3OYIA 2LQKA 3NTIA 4EIKA 2NUPA 3V8JA 1TUDA 3M0TA 1Y07A 2KVQG 3CC2A 2QG9B 1Q81R 1PSEA 1XOVA 4FW1A 2E1HA 1TU0B 2YSQA 2RI2A 1P92A 1Y57A 1LJOA 1VQ8Q 2D0QB 3QYGB 1R77A 2LZ6B 1I0CA 2DL8A 2DYBA 4QQDA 2CP2A 3CC2Q 2CH4W 3REAB 5GAN8 4J83A 3VS6A 2EJFA 4XQ3A 1FMVA 1YCYA 2ZPHB 4M7DD 5CCAA 2X4XA 1UGVA 4M75B 4A4FA 3VUZA 3WXMB 2MOXA 4CC4B 4RCBA 1VQNQ 1R8OB 1Q86R 1LCKA 1JB0E 1VQPT 3M0UA 1VQ5A 3H6ZA 5IAYA 1RAIB 4PNOA 1SPKA 3OA6A 5ECAA 2VXFA 4QQ6A 1MNDA 2HL5C 2LNHB 1GL5A 3ZL7C 1BI1A 2XK0A 1QVPA 3KXTA 2D0NA 2DF6A 2KR3A 2P4TA 1NEBA 4RG2A 3JCMg 4OMOA 1B34B 4FM4B 1VQOT 3M57A 1OU9A 5GAOp 4OP0A 4OVAA 4IUQA 3LX7A 2QQBA 2ZGWA 3QDFA 2QYZA 1CKBA 5GAOn 4IIOA 1BI0A 1NLPC 2EYQA 2RK1A 1UJYA 2PQWA 2OAUA 2RQWA 3JCMV 4KRTA 1OZ2A 3G71T 2MIOA 3TSZA 1UGPB 5IH2A 4PJJA 3OYNA 2YLBA 3VKIA 4PFZA 2EGEA 5FU7C 3VS7A 1SSFA 1U3OA 3A98A 5CVIA 4JRKA 4X1VA 3NTKA 3MP8A 4L6V5 4A53A 4C8QB 5HKCA 3CCMT 3BFMA 3GNGA 3M5AA 1Z9QA 3A8MB 3PIOA 2QXFA 2QQ9A 3V7CA 4QT7A 1KJWA 3EHRA 2GNCA 4OF1A 1N6AA 5I11A 4C8QA 4R56A 3VS2A 1YN8A 1BCOA 3OS0A 4A4HA 1M8VA 2CUBA 3SWNC 1X2KA 1BK2A 2KYBA 3I55Q 1M3BA 1PG5B 4ZNXA 1IREB 2PVOB 1K1ZA 1EZZB 1GCPA 4X34A 4HKEA 1JRIA 3J80E 4PJLA 2QQSA 2V1RA 1X6BA 1BI2A 1HYOA 1A0NB 2FYKA 2JNGA 2BKDN 3HRSA 1Q86U 1MGQA 3MP1A 4E7KA 4B9WA 4N0AC 4C5GA 3CXCP 4JZ3A 2JN0A 1W2BS 2GF7A 3Q1JA 1WGSA 2L3RA 2DAQA 1MMGA 1FMKA 4LD6A 3I55A 2K7AA 3EG2A 3E9GA 2JTMA 3JCMJ 1KSWA 3CCSQ 3CCEA 2DVEA 3DLLA 2B86A 4QVZA 3LYIA 2RJDA 1SKUB 3JCMh 3X25B 3CCQQ 2GTOA 2LCLA 2HQEA 3CPWA 2NYSA 3JCMe 2RO0A 1ABQA 3CQTA 2DTIA 4IUVA 5L8RE 4WTOB 1Q7YU 2KT1A 2QEXT 4WCIA 4Z8AA 2BUDA 2O2OA 1VUBA 1LNXA 1YJWA 2VASA 1YJNQ 4ZN3A 4M7DE 3CBMA 3SB2A 5CKDA 2HNIA 2DX1A 1BKBA 2IVWA 2O4XA 3JCMc 3OBWA 1VQ8A 1M4ZA 2DBKA 3DB3A 3PT9A 5GANd 4NOYA 3OYHA 1Y96B 2GTJA 1PCXA 1UDLA 5LJ5d 1B34A 2DEUA 2RA2A 2J6OA 3JV3A 3RUXA 1NJIU 2KRMA 2P0KA 2QK0A 2YUNA 3HP9A 3LWIA 2JW4A 3G6ET 4M7DB 1ARKA 3QXEB 5CQXA 3A8LB 1W4SA 4HVWA 3GLXA 1K8AU 5DM7R 2BE7D 2B8AA 5GAN4 4EMKB 3EG0A 3SWNB 3KUFA 3QYHB 2JVVA 1YHQT 4PK4A 4C5HA 1SEMA 2DK3A 2A3LA 1M90C 3RBBB 2KDSA 5KYYA 1U1TA 4EMHA 4J5YA 2DFUA 2YXYA 4B6MA 3JCMf 2NUTA 3INZA 2LRQA 1NYFA 4MZPA 2WSEE 3L42A 5GMKi 1D0YA 1RADB 5LJ3e 4A4KA 6AT1B 3PVLA 5LJ3d 3G4SQ 2PTKA 4JDSA 2IG0A 4C8QD 3CXCS 4M7DA 3BE3A 3MEUA 3CCLA 3HTRA 2YHTA 5D6XA 3VS0A 1RL2A 4GY5A 1PRLC 4WF2A 3CCJQ 4FSSA 4M77F 4DA4A 1AEYA 1QCFA 2GFUA 5HY6A 1AHJB 4CC3A 3I56T 1RAGB 4EDUA 1RI9A 3VU3C 3I5SA 3CMET 2G6FX 5GANg 3CPWS 2HCKA 3VJPA 4DBFA 1OZ3A 3V8LA 3TCJA 4OMFB 3CCRA 2O88A 1VQ7Q 2RPNA 2M9UA 2E3IA 4R0KA 2D8HA 1ABOA 3JRZA 4C92C 1IO6A 2YUOA 2FVUA 2EJ9A 1MNEA 3CC4T 1UG1A 5A0DA 1HD3A 4C92A 4D6WA 3HL8A 4OB2B 1IXDA 4RTZA 1YI2T 4EPCA 4AFSC 4BE1A 1RAEB 3PMIA 4JPBW 4M75D 2DRKA 1H3ZA 1C6VX 1M8MA 2OTLT 4RMOA 1OYXA 2PUOB 4LN2A 1D0XA 3FLGA 5A0GA 3CD6A 2OX7A 3CXCA 5KCOA 4J7FA 3HRUA 1YITT 3E1SA 2DMOA 3EHQA 1UGRB 2CGHA 4J6YA 5LL6S 1QP2A 2FPFA 2DJZA 4YTLA 4A4EA 4B9XA 1OU8A 4E7ZA 2ZCFB 3GBQA 3CCRT 3RMSA 1QWEA 2KE9A 3URGA 2DBMA 4RUGA 5KYWB 4BUGA 4Y92A 4PFOA 4C92F 1YJ9Q 1TG0A 3M0SA 3CCVA 2K2MA 1UJ0A 4M78A 2JT4A 2BTTA 4IUPA 4F7UF 1YJWQ 5I2SA 1OI1A 1ACMB 4J6WA 3WVDB 4HXJA 1SRLA 1VQ5T 1W1FA 5KYUB 1W2BP 5GAMj 4Q5WA 3QPHA 2J06A 2XD0A 1VQ4T 2HBPA 3A8OB 1NYGA 3CD6T 1YHQA 3HHTB 2R58A 5KE3A 5KYXA 2RQUA 2XU8A 3EG3A 5IXFA 2MI6A 5IHIA 4KGVB 2DERA 4BD3A 1M2VA 2YRCA 1FXXA 1HK9A 5D7UA 5HK3A 4BACA 3CCUA 4M77C 3VS3A 2ATCB 2QA4A 5IHNA 2NLUA 4J9IA 1DJ7B 2DL4A 4JS4A 1YWOA 2HDAA 2QA4Q 4RTWA 1K8AR 1SF9A 4KT0E 4E2FB 4FL6A 2FL7A 1SHGA 1K0SA 1MMAA 1N9SA 4PJOG 2V8KA 5CKFA 2KY9A 4E7IA 1RLQC 2LJ3A 3PIPA 1WJRA 1D1AA 3CC7Q 2DYIA 2O31A 4PFPA 1D1CA 2DL3A 5FROA 3VV0A 1S72Q 2EQIA 4M77E 3OYJA 5LJ5h 2VWFA 1VQKQ 2E70A 5GMKl 4KH0B 2K2VA 3MKDA 5GANj 2XI9A 1LVKA 1UGSB 4A63B 2FO0A 3U23A 5LJ3j 2EKOA 4M75E 4BY6C 2X4JA 1EFNA 2EPDA 3UDCA 3UA7A 2ROLA 2X51A 2JM9A 3RIRA 3OYCA 1BI3A 1PM3A 5GAN3 3ZBDA 3FDRA 2X4WA 1W2BA 3OS5A 2YT6A 1F1BB 2YUQA 9ATCB 3RKYA 2VVKA 2KROA 3H8ZA 3RESA 2FZCB 2KEAA 1ZQ1A 4P5NA 5GANe 3L2WA 1ZSZB 5LJ5j 1WQ7A 1U1SA 1UEBA 2CP0A 1BB9A 3JCMP 2JMCA 2M1HA 2VUBA 1GCQA 2YRVA 1NG2A 3M58A 3LGFA 4Y91A 3CCRQ 1I4K1 1WHGA 2CZ0B 4NS5A 4GBQA 5GAMe 4MMLA 1NEGA 4LNPA 2HSEB 1WIEA 4OGEA 5GAMh 5D6WA 2YUPA 4D8DA 3GP8A 4JRIA 2KK4A 2L3SA 1QCNA 1G83A 4IKFA 1KQSA 2AKLA 3R6NA 4PLIA 4M78B 2X35A 3QWYA 2AT1B 3EGUA 4JRQA 5GMKh 4XTXA 2DKGA 1PHTA 1X69A 1ZUKA 1T0JA 3M0QA 1UGQB 2A7YA 3M4GA 1Y71A 3META 3CCET 1B07A 2I0NA 2DM1A 3PNWC 1KQ2A 1TS9A 3JCMb 3CCUT 2L3QA 5J39A 2CT4A 2R5AA 2ZAEA 2KI7A 3OW2A 2RMOA 3GOXA 2ECZA 3OYMA 4M7AB 2FZGB 3UA6A 2XMFA 4BE2A 1AZEA 3FB9A 1IRXA 2QI2A 3OSSC 4FT2A 1VQ9A 3C4SA 4FYXB 4OMMA 1VQ9Q 3EFOB 3PTAA 1VQ6T 1UHFA 1PKTA 2X3XD 5CKBA 2JTEA 1I07A 1YBYA 1Y0MA 1GXIE 5DLOA 3FJ5A 5C6SA 4A4GA 3QZ5B 3JSCA 5HCKA 2EAYA 4ELZC 1I5OB 1VQKT 3R6OA 1OOTA 1K8AC 4O6JA 4XTUA 2F2VA 4M7AD 1G3SA 2R5MA 2LT4A 2HZYA 1UTIA 1QMCA 1K73R 2E6NA 3ASKA 1NJIC 3VYHB 3A8HB 1K76A 4FW2A 1VIFA 1RLPC 5GJVB 1KK7A 1NPRA 2HD0A 4LXCA 4F17A 3CCMA 2PVGB 2CKKA 2CT3A 5GAMg 5FU6B 2ED0A 1PRMC 3KFVA 4DEYA 1IGQA 2DIQA 2GFAA 4FT4A 4RKUE 2Y4XA 2K9GA 1VIEA 1Q82U 1WQWA 4QVCA 2LMJA 4PKCC 4M78D 3S3OA 3M56A 3G71Q 3EFRA 2FG0A 3ER0A 2RQRA 2LX9A 1VYTA 3HFOA 1N9RA 2RQVA 2ZZDA 2EGCA 2J05A 2QEXA 2PVDB 4JJBA 1YJ9T 4IUUA 3L2QA 3VS4A 1I1JA 1UUEA 2LX7A 4AG2C 1PC0A 3TVTA 1VQOA 2MPXC 4PJOE 1GRIA 4KBMB 1AZGB 8ATCB 2E12A 4XU2A 4F04B 4PJOA 3L2ZA 8AT1B 2DZ9A 5IXBA 1G5VA 2RHUA 1Q95G 3FJPA 1W70A 2QQAA 1AVZC 4M77B 4ELYC 1ZSGA 4BB7A 2FPEA 1WHLA 2EW3A 1VQNT 3EG9B 4Y28E 3CMEQ 3EAEA 1X6GA 2MF2A 1U8RA 4PJOD 2QDYB 1EX4A 4JUVA 3HKSA 2E3HA 1WNLA 3HRTA 4ZN1A 4JLIA 3SDZA 1QVGS 3MJXA 3AT1B 1XTDA 2KGTA 3OYAA 2XDDA 1E6HA 5LJ3h 1WYXA 3BDLA 3DKMA 2W10A 1Q81C 4C5IA 2C06A 1W6XA 5GAMf 1V76A 4AMCA 3QZ9B 2EYWA 1BCMA 2E5KA 1YP5A 2K5FA 3TEEA 1JJ2P 3L2UA 2HBWA 5GAN7 4E7HA 3OYYA 4F14A 2VB6A 2RM4A 2WSFE 1FMWA 2YRDA 1GCQC 3G6EQ 2OJ2A 2KRNA 1TH7A 2E5QA 3KBGA 1K73U 2WSCE 1KFZA 2WACA 4F16A 4RG8A 1Y7XA 1CSKA 1X2QA 2C0TA 3X24B 1VQMA 1JXOA 4AT1B 1PWTA 5I2MA 1QVFS 4N0AA 3MCAB 2Z0WA 3RKXA 4C0FA 4C92G 1UFFA 3PE0A 1YCSB 4C0DB 3CC7A 2JM8A 2RF0A 4DBRA 1TUGB 5KE2A 2DTHA 2XICA 4PJOF 2DE0X 4NL3A 3OYKA 1ZHIA 2L2PA 2LQNA 4IUTA 3I56A 2HQHA 4IIMA 1KD1R 1VQ4Q 3I55T 2K6DA 2CDTA 2OTLQ 1HSQA 2AK5A 2DL5A 3VRYA 1MMNA 1YJ9A 3CD6Q 1OPKA 1RAHB 2GCXA 2RHZA 3OMGA 4JJDA 2EQJA 2F69A 1ZUUA 1KQSP 3OYEA 1GBQA 4RCCA 2M0OA 1K9MU 2P0PA 4M7AA 3GF5A 4AFUC 2JJ9A 4C0ZA 1WHJA 1CKAA 1TXQA 1VQ8T 3CCLT 2LVMA 4LDXA 4DEXA 3LLRA 2DL7A 2KNBB 4M78G 1K9MR 3EGXB 1O9SA 4N4HA 2YLCA 3NFCA 2V8JA 3MP6A 3JCMd 3LW5E 2HL3A 1PSFA 1QLYA 1M9SA 1YJWT 2QGGA 4FIBA 4PJMA 3NPFA 4DOWA 1KC8R 4ZGDB 4AFQC 2F2WA 1ZLMA 2EBPA 1KD1U 2W0ZA 4ESRA 2EYZA 2LJ1A 3QO3A 4BY6B 1Q7YC 4M77A 4J6XA 4EMGA 4M7AF 4E7SA 1N5ZA 2OTJQ 3OYDA 4JRPA 1S72T 5FRMA 4PJNA 1C1AA 3S3NA 3OYBA 1WJQA 3HSBA 3TQ7P 1XNIA 2VYTA 1XJWB 1AT1B 3TREA 4C8QG 2KSSA 2FPDA 1GBRA 1V1CA 1JO8A 4TVRA 4HCKA 1YNZA 2BIVA 2EYXA 3NGPA 5C0MA 5LJ5e 1BIAA 2K3XA 3BY7A 3ME9A 4FYWB 3JAME 5A0LA 1NLOC 2DJQA 3EH2A 2KXCA 2KRSA 4E6RA 4XU3A 4DBHA 4M75G 2Y4YA 4OMLA 2O9VA 3M0PA 2KBTA 4M78F 2GGRA 1GFDA 3ZEHA 2HKNA 2HKQB 1VOMA 2SEMA 3TU4K 1M1GA 3CC2T 2DEQA 2RJCA 1MMDA 3VS5A 1T3LA 1KC8U 1YITA 2JTFA 2RHYA 2DXTA 2ESWA 4CC2A 4J7IA 4ANJA 3H0IA 2A0FB 1WA7A 4IURA 3FRNA 3G1JA 2EWNA 1VQ7T 5GAOq 2NWMA 1JEGA 2MYSA 1M90R 3OY9A 2CZ7B 2MWOA 3S6WA 3A1PA 3IQLA 2KXDA 2XIDA 3EG9A 1BBZA 1WLPB 2F5TX 4QW2A 5FRNA 4KH1B 2LC4A 4K11A 5J3BA 3X28B 3FC3A 2OTJA 1MHNA 2D1XA 2L3PA 4AFZC 3RKWA 1AD5A 1M1FA 1UE9A 1FYNA 4DBQA 4M7DC 3X20B 3RERA 1J3TA 1N27A 4QQGA 2LP5A 4XTZA 4HT9A 1WZOA 4AG1C 4C92D 4FYVB 3M53A 1YJNT 2XKOC 3V7RA 2PUKB 1VQ6A 3P8BB 2H3EB 3O8VA 3VYGA 2VGMA 3RDVA 2CH4A 3CCLQ 3H0FA 3OS2A 2M02A 2ENMA 1M1KR 1D3BA 1E6GA 3UF4A 1YWPA 3H9NA 1M2VB 4M7AG 2VKNA 3P8HA 1YJNA 3G4SA 2LTOA 3EGDA 2BE9B 1G3WA 2K5IA 3CPFA 4GLMA 2M51A 4ORZA 2P4RA 2V1QA 1Q82R 2CREA 5GMKm 4M4ZA 4J8OA 2AHJB 1RACB 4XK8E 1G3YA 3JB9J 1PNJA 1RAFB 1QKXA 1QP3A 2CP7A 1M1KC 4EMKA 4RTVA 5KYWA 3JB9F 5GAOr 5GAOm 3JCMQ 2J6KA 2RNAA 3C95A 2FB7A 3OW2S 3JCMX 4V2SA 1ZBJA 3EG1A 1NBEB 2FEIA 3O5ZA 3RMQA 3I5RA 2JOYA 3ZFJA 2RD1A 3NHNA 1B3QA 4HCZA 3VRZA 5AT1B 2DO3A 3L2RA 2ZPFB 1SSHA 4RTXA 2F2XA 4KGXB 1M1KU 1YI2Q 1QW1A 2DVJA 1K9AA 2DA9A 2CUDA 5FWCA 2AIRB 4OB0B 2AKKA 5GAN2 1X6OA 1M2OA 5FU7B 2L5QA 4OB3B 4MZMA 4RTUA 3CCJT 2LJ0A 2HEQA 1KQSS 2D6FA 1RAAB 2COWA 1U06A 4XTWA 3JB9I 1T3SA 1NE8A 2E64A 1AWOA 5HK0A 2SRCA 3PGGA 4D8KA 3CMEA 2RN8A 2CSQA 4L5GA 3OS1A 4ZTFA 1NJIR 5GJWB 1TSFA 2KAFA 3DLMA 2COYA 3I56Q 4BDZA 3JB9H 1M5Q1 4JZ4A 4CRIA 4GLKA 5CK9A 2J7IA 2P84A 2F5KA 5FW9A 3CCVQ 2QGFB 4J9BA 3SFMA 3MPUB 1GFCA 5IT9E 4JJNK 1Z9ZA 4X9DA 5CKEA 1O75A 3EFSA 3UPUA 4OMPA 3L1AA 2DD5A 1MUZA 4M77G 3JB9D 2H3JA 3NMZC 4FYYB 3CCSA 4M75C 1S1NA 4ZTJA 2RK2A 1C0MA 2QAZA 5GANf 2DETA 3E2UA 5EG2A 4RTTA 3V7SA 2V26A 1OEBA 5LJ5f 1N8RU 2VGNA 1VQOQ 1Q7YR 3G71A 2K5LA 2L8DA 2H8HA 3JCMW 2KQWA 4LDWA 1AWWA 2QQRA 2ZPIB 4N4IA 1G2BA 3LH0A 2D8JA 1AWXA 2RI3A 3EGDB 3CEYA 4HVUA 3L2VA 1H3HA 4BDYA 3QBYA 5KH6A 2QA4T 4C8QE 1D3BB 1M30A 2E41A 3OB9A 4O5VA 1HXDA 2X3WD 3MHXA 4XAXB 1K4US 2L0AA 1QKWA 2EQKA 1VQLA 4C8QF 2DLPA 2OI3A 5GAMd 2LQWA 2DXUA 4A54A 4NL2A 2KMTA 3M0RA 4J9GA 2FHDA 1KHIA 3OQ5A 3CCMQ 3GPLA 1JU5C 3QWXX 2ED1A 4OB1B 1RI0A 1YIJA 2VV5A 4HT8A 3GIBA 2RH2A 4LUEA 3A5ZB 5CR2A 1OX8A 3SWNA 1VQ5Q 2PNIA 2GBQA 3CCQT 1VQNA 2K79A 2J6FA 3SHWA 1K0XA 4C8QC 4Z89A 2EQMA 3I35A 1NM7A 1QVFP 2PZ1A 3G4ST 1Y96A 3RNJA 2JS2A 3CPWP 2E4HA 3CMAA 1B7TA 5CAIA 3H41A 3UATA 3J7AF 2E10A 1FWZA 3QJYA 1VQ9T 4LD9K 4OGCA 2CP6A 3HPWA 2QEXQ 2BZ8A 2A36A 1IHWA 2LT1A 4M78E 4F7UG 4MZTA 4LDYA 2C0IA 4J9HA 4KUDK 3QHSA 3M9QA 5EC7A 3CMAQ 1IHVA 3EH1A 3BDUA 4FCYA 2YDLA 3MO8A 3PMTA 5DY9A 1PKSA 3CC4A 2E6ZA 3THKA 3CCST 3AHUA 1K73C 4Z88A 1D0ZA 3CC7T 1MV3A 5CIUA 4M75F 2XDBA 2RHIA 5GANh 4HA8A 3C94A 1YIJQ 4JJCA 1KG1A 1VQPQ 1ZSZC 3VS1A 4ZGJB 5IHKA 1VQPA 2VXEA 2CP3A 3X26B 2LQ8A 2CS7A 2D9TA 2MCNA 3V8KA 4MDXA 4C92E 1NPPA 3LGLA 1AWJA 2DRMA 4L59A 3FEOA 3CC4Q 2DZCA 3M4YA 1QQJA 2MAMA 4XTYA 1H641 2QASA 5A2QE 4II1A 2X4YA 3F70A 2RI5A 2DTOA 2I2LA 5KCHA 3EGXA 4F7UE 1OX9A 4PL6A 4ZGEB 4CI0C 4E7JA 5FLXE 1WDXA 4QKUA 2MMPA 3OYLA 4OMNA 1YITQ 4X9CA 1I8FA 3I9QA 3CCJA 4HCCA 1ZSZA 1WI7A 1VQ6Q 1FX7A 4HVVA 3M55A 2ROTA 5KYUA 4UC4A 2OTJT 1E7OA 2CP5A 2XDPA 2XHCA 2ZPBB 4C92B 4HCBA 1Q81U 1X01A 1N8RC 1RUWA 5GAN5 4BI8B 1TWBA 2IIMA 2Y90A 4DQ2A 1ZX6A 2K3BA 1I81A 3QIIA 2QTVA 1LOJA 5LJ5g 4XTVA 5CKHA 2LNVA 2DILA 1D09B 4M75A 1VQLQ 3A8GB 4PLLA 2PU9B 1HJDA 1BU1A 1VQMT 3PVQA 2BZXA 2LCCA 1M90U 2L89A 2XG8D 2HSPA 1PD0A 1X27A 1TOVA 5KYNA 3EFOA 4EMKC 2EQUA 4JLGA 2ABLA 1Q82C 3E19A 2AZSA 2DPPB 3OBYA 4M7AE 2RJEA 1QWFA 3QUIA 4BI4A 4J9FA 3C12A 2NUPB 4XU1A 2EVRA 3SD4A 2K57A 5D6YA 3J81E 5CQYA 2DXBA 3C0CA 3H0HA 1M3AA 2ZPEB 3CBPA 3DB4A 3FIFA 2DD4A 4M7DF 2CZ6B 1K9MC 5KYXB 1IGUA 1VYUA 2R57A 3P8DA 1WJSA 1WXTA 2VC8A 1G8XA 5KYYB 3LH5A 1G3TA 1MV0B 3MEVA 4E47A 4BE0A 4XU0A 1WFWA 3N5BB 4LUDA 3QJ6A 4J9DA 2V8IA 1I5LA 1T0HA 1VQKA 2CZ1B 3QSUA 2F1LA 1D1BA 5M9OA 2FRYA 4BI3A 2JMAA 1S72A 1M3CA 2MK5A 1H8KA 1M27C 4LDVA 3E9FA 1JQQA 3UWNA 4F7UB 3HFNA 3CCQA 4RTYA 4PJOB 3OYGA 3NTHA 1ZUYA 1KD1C 1YI2A 2HMAA 3G6EA 1WHMA 4J9EA 4ATOA 1BIBA 3OW2P 3CCEQ 1QCOA 3WVEB 2COZA 4JS5A 3CCUQ 4N4GA 1U5SA 1TTHB 2EIFA 1OPLA 4QVDA
chains in the Genus database with same CATH topology
1UTIA 1VYVA 4HVWA 3VRZA 1SHFA 2NUZA 1K76A 1RLPC 4J9CA 1SSHA 5GJVB 3EG0A 4RTXA 4F17A 2C0OA 2F2XA 5FWBA 1UHCA 1SEMA 2DVJA 1K9AA 2CT3A 2CUDA 2DA9A 5FWCA 3RBBB 2AKKA 1KIKA 2ED0A 1PRMC 4RTUA 5I22A 2KT8A 2LJ0A 3KFVA 2DNUA 4DEYA 2EGAA 2HEQA 2K9GA 2EKHA 1U06A 3NHNA 1T3SA 1H92A 1AWOA 1NYFA 2LMJA 2SRCA 3ULRB 1UECA 1WXUA 4D8KA 2RN8A 2CSQA 2JS0A 2FG0A 5GJWB 2RQRA 3PVLA 4OMQA 1VYTA 2PTKA 2RQVA 4JZ4A 2EGCA 2J05A 1AOJA 2J7IA 2A08A 4JJBA 5FW9A 3VS4A 1I1JA 1VA7A 4J9BA 1GFCA 1UUEA 1Z9ZA 2LX7A 4AG2C 3TVTA 4OMPA 3VS0A 1GRIA 1PRLC 4CC7A 1AZGB 2LCSA 4FSSA 1MUZA 3NMZC 1AEYA 1QCFA 1S1NA 5IXBA 2O9SA 1W70A 4RTTA 1AVZC 1OEBA 4CC3A 3REBB 1ZSGA 2FPEA 3TSWA 2EW3A 2FRWA 2H8HA 1RI9A 1X6GA 2BZYA 1AWWA 2GQIA 1WX6A 3I5SA 1G2BA 2D8JA 2G6FX 1AWXA 2HCKA 2QDLA 4LE9A 4HVUA 1H3HA 2A28A 2CSIA 3SEMA 2O88A 2RPNA 1M30A 1TUCA 2KGTA 2X3WD 1E6HA 4R0KA 1JXMA 2D8HA 1ABOA 1IO6A 1K4US 2L0AA 1QKWA 2YUOA 2EYYA 1WYXA 2A37A 2W10A 1UG1A 2RQTA 2OAWA 1W6XA 2DLPA 2OI3A 1X43A 2LQWA 2JXBA 1HD3A 1OV3A 5L23A 2EYWA 2E5KA 1YP5A 1SRMA 2M0YA 3M0RA 4J9GA 4RTZA 2HBWA 4AFSC 1WXBA 4JPBW 1JU5C 4F14A 2AZVA 2DRKA 3QWXX 2ED1A 1M8MA 1GCQC 2KYMA 2OJ2A 2KRNA 4LN2A 4LUEA 1KFZA 4F16A 2PNIA 4EIKA 1CSKA 1X2QA 2C0TA 2DMOA 3EHQA 1JXOA 2GBQA 1PWTA 2FPFA 2K79A 2J6FA 3SHWA 1TUDA 1K0XA 3M0TA 3GBQA 4Z89A 3I35A 1NM7A 1QWEA 1XOVA 2KE9A 2PZ1A 2DBMA 4RUGA 2YSQA 4Y92A 3RNJA 1UFFA 1Y57A 2JS2A 3PE0A 1YCSB 2JM8A 2RF0A 3H41A 1TG0A 3UATA 2LZ6B 3M0SA 2K2MA 1I0CA 2DL8A 2DYBA 2DE0X 1UJ0A 2JT4A 2BTTA 2BZ8A 2A36A 2CH4W 3REAB 2L2PA 2LQNA 2C0IA 3VS6A 4J9HA 4IIMA 5EC7A 2K6DA 2CDTA 1HSQA 4HXJA 1SRLA 2AK5A 2DL5A 3VRYA 1OPKA 1UGVA 2YDLA 4JJDA 1W1FA 1ZUUA 2J06A 1GBQA 2MOXA 4CC4B 1PKSA 1NYGA 4AFUC 1LCKA 3THKA 2RQUA 3M0UA 3EG3A 4Z88A 1CKAA 5IHIA 5IXFA 1SPKA 1MV3A 4DEXA 5ECAA 2DL7A 1GL5A 2LNHB 3VS3A 2KNBB 3ZL7C 4JJCA 5IHNA 4J9IA 3VS1A 5IHKA 2DL4A 2D0NA 2DF6A 2KR3A 1YWOA 1NEBA 2HDAA 4RTWA 4OMOA 2MCNA 1QLYA 3NPFA 4AFQC 2F2WA 1ZLMA 2EBPA 2W0ZA 4ESRA 2EYZA 1AWJA 1SHGA 2DRMA 2LJ1A 1K0SA 1N5ZA 1CKBA 4IIOA 1NLPC 1RLQC 2LJ3A 1UJYA 2O31A 2DL3A 2FPDA 1GBRA 2EQIA 1V1CA 1JO8A 2RQWA 2VWFA 4KRTA 4HCKA 1WDXA 1YNZA 2MIOA 3TSZA 5IH2A 2EYXA 3NGPA 4OMNA 2EGEA 4A63B 1NLOC 2FO0A 3U23A 2DJQA 3I9QA 3VS7A 1U3OA 2KXCA 3A98A 2KRSA 1EFNA 4E6RA 2EPDA 1WI7A 3UA7A 4X1VA 2ROLA 4OMLA 2O9VA 4HVVA 3M0PA 2JM9A 2KBTA 2ROTA 1Z9QA 2GGRA 1GFDA 4QT7A 1KJWA 1E7OA 2YT6A 3EHRA 2YUQA 2GNCA 2SEMA 2VVKA 5I11A 2KROA 1RUWA 2KEAA 3VS2A 1YN8A 3VS5A 1T3LA 2IIMA 2CUBA 1X2KA 1BK2A 2KYBA 2ESWA 4CC2A 3H0IA 1M3BA 1BB9A 4ZNXA 1WA7A 1ZX6A 2K3BA 1K1ZA 2JMCA 2NWMA 1JEGA 1GCQA 1GCPA 1NG2A 2DILA 2V1RA 1X6BA 3IQLA 2KXDA 4GBQA 1A0NB 1BBZA 1NEGA 1WLPB 1HJDA 4LNPA 1BU1A 4K11A 1WIEA 3PVQA 2D1XA 2L3PA 4AFZC 2BZXA 2YUPA 4D8DA 1AD5A 4JZ3A 1UE9A 2L3SA 1FYNA 2HSPA 1G83A 1X27A 2AKLA 3R6NA 1J3TA 3QWYA 2LP5A 2ABLA 1FMKA 3EGUA 2K7AA 3EG2A 4AG1C 2AZSA 1KSWA 1QWFA 4J9FA 1PHTA 1X69A 2B86A 1ZUKA 1T0JA 2EVRA 3M0QA 3C0CA 2CH4A 3H0HA 3H0FA 2GTOA 1M3AA 2ENMA 1E6GA 3UF4A 1ABQA 1YWPA 3CQTA 1B07A 2I0NA 2VKNA 2DM1A 1VYUA 2L3QA 2CT4A 2KT1A 1WXTA 2RMOA 2ECZA 4GLMA 2M51A 4WCIA 3UA6A 4Z8AA 2XMFA 4ORZA 2P4RA 2V1QA 3LH5A 1MV0B 2O2OA 1AZEA 1WFWA 2CREA 4LUDA 4M4ZA 4J9DA 1T0HA 4OMMA 2FRYA 2JMAA 2DX1A 1UHFA 1PKTA 1PNJA 1M3CA 2X3XD 1H8KA 1M27C 2JTEA 1I07A 1QKXA 1JQQA 1Y0MA 2DBKA 4RTYA 1ZUYA 3FJ5A 4RTVA 2GTJA 1UDLA 4J9EA 2J6KA 2RNAA 5HCKA 2J6OA 3JV3A 1ZBJA 1OOTA 3EG1A 2KRMA 2FEIA 3O5ZA 2YUNA 3I5RA 2F2VA 2JW4A 1U5SA 1ARKA 1B3QA 1OPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTI A;  1VYV A;  4HVW A;  3VRZ A;  1SHF A;  2NUZ A;  1K76 A;  1RLP C;  4J9C A;  1SSH A;  5GJV B;  3EG0 A;  4RTX A;  4F17 A;  2C0O A;  2F2X A;  5FWB A;  1UHC A;  1SEM A;  2DVJ A;  1K9A A;  2CT3 A;  2CUD A;  2DA9 A;  5FWC A;  3RBB B;  2AKK A;  1KIK A;  2ED0 A;  1PRM C;  4RTU A;  5I22 A;  2KT8 A;  2LJ0 A;  3KFV A;  2DNU A;  4DEY A;  2EGA A;  2HEQ A;  2K9G A;  2EKH A;  1U06 A;  3NHN A;  1T3S A;  1H92 A;  1AWO A;  1NYF A;  2LMJ A;  2SRC A;  3ULR B;  1UEC A;  1WXU A;  4D8K A;  2RN8 A;  2CSQ A;  2JS0 A;  2FG0 A;  5GJW B;  2RQR A;  3PVL A;  4OMQ A;  1VYT A;  2PTK A;  2RQV A;  4JZ4 A;  2EGC A;  2J05 A;  1AOJ A;  2J7I A;  2A08 A;  4JJB A;  5FW9 A;  3VS4 A;  1I1J A;  1VA7 A;  4J9B A;  1GFC A;  1UUE A;  1Z9Z A;  2LX7 A;  4AG2 C;  3TVT A;  4OMP A;  3VS0 A;  1GRI A;  1PRL C;  4CC7 A;  1AZG B;  2LCS A;  4FSS A;  1MUZ A;  3NMZ C;  1AEY A;  1QCF A;  1S1N A;  5IXB A;  2O9S A;  1W70 A;  4RTT A;  1AVZ C;  1OEB A;  4CC3 A;  3REB B;  1ZSG A;  2FPE A;  3TSW A;  2EW3 A;  2FRW A;  2H8H A;  1RI9 A;  1X6G A;  2BZY A;  1AWW A;  2GQI A;  1WX6 A;  3I5S A;  1G2B A;  2D8J A;  2G6F X;  1AWX A;  2HCK A;  2QDL A;  4LE9 A;  4HVU A;  1H3H A;  2A28 A;  2CSI A;  3SEM A;  2O88 A;  2RPN A;  1M30 A;  1TUC A;  2KGT A;  2X3W D;  1E6H A;  4R0K A;  1JXM A;  2D8H A;  1ABO A;  1IO6 A;  1K4U S;  2L0A A;  1QKW A;  2YUO A;  2EYY A;  1WYX A;  2A37 A;  2W10 A;  1UG1 A;  2RQT A;  2OAW A;  1W6X A;  2DLP A;  2OI3 A;  1X43 A;  2LQW A;  2JXB A;  1HD3 A;  1OV3 A;  5L23 A;  2EYW A;  2E5K A;  1YP5 A;  1SRM A;  2M0Y A;  3M0R A;  4J9G A;  4RTZ A;  2HBW A;  4AFS C;  1WXB A;  4JPB W;  1JU5 C;  4F14 A;  2AZV A;  2DRK A;  3QWX X;  2ED1 A;  1M8M A;  1GCQ C;  2KYM A;  2OJ2 A;  2KRN A;  4LN2 A;  4LUE A;  1KFZ A;  4F16 A;  2PNI A;  4EIK A;  1CSK A;  1X2Q A;  2C0T A;  2DMO A;  3EHQ A;  1JXO A;  2GBQ A;  1PWT A;  2FPF A;  2K79 A;  2J6F A;  3SHW A;  1TUD A;  1K0X A;  3M0T A;  3GBQ A;  4Z89 A;  3I35 A;  1NM7 A;  1QWE A;  1XOV A;  2KE9 A;  2PZ1 A;  2DBM A;  4RUG A;  2YSQ A;  4Y92 A;  3RNJ A;  1UFF A;  1Y57 A;  2JS2 A;  3PE0 A;  1YCS B;  2JM8 A;  2RF0 A;  3H41 A;  1TG0 A;  3UAT A;  2LZ6 B;  3M0S A;  2K2M A;  1I0C A;  2DL8 A;  2DYB A;  2DE0 X;  1UJ0 A;  2JT4 A;  2BTT A;  2BZ8 A;  2A36 A;  2CH4 W;  3REA B;  2L2P A;  2LQN A;  2C0I A;  3VS6 A;  4J9H A;  4IIM A;  5EC7 A;  2K6D A;  2CDT A;  1HSQ A;  4HXJ A;  1SRL A;  2AK5 A;  2DL5 A;  3VRY A;  1OPK A;  1UGV A;  2YDL A;  4JJD A;  1W1F A;  1ZUU A;  2J06 A;  1GBQ A;  2MOX A;  4CC4 B;  1PKS A;  1NYG A;  4AFU C;  1LCK A;  3THK A;  2RQU A;  3M0U A;  3EG3 A;  4Z88 A;  1CKA A;  5IHI A;  5IXF A;  1SPK A;  1MV3 A;  4DEX A;  5ECA A;  2DL7 A;  1GL5 A;  2LNH B;  3VS3 A;  2KNB B;  3ZL7 C;  4JJC A;  5IHN A;  4J9I A;  3VS1 A;  5IHK A;  2DL4 A;  2D0N A;  2DF6 A;  2KR3 A;  1YWO A;  1NEB A;  2HDA A;  4RTW A;  4OMO A;  2MCN A;  1QLY A;  3NPF A;  4AFQ C;  2F2W A;  1ZLM A;  2EBP A;  2W0Z A;  4ESR A;  2EYZ A;  1AWJ A;  1SHG A;  2DRM A;  2LJ1 A;  1K0S A;  1N5Z A;  1CKB A;  4IIO A;  1NLP C;  1RLQ C;  2LJ3 A;  1UJY A;  2O31 A;  2DL3 A;  2FPD A;  1GBR A;  2EQI A;  1V1C A;  1JO8 A;  2RQW A;  2VWF A;  4KRT A;  4HCK A;  1WDX A;  1YNZ A;  2MIO A;  3TSZ A;  5IH2 A;  2EYX A;  3NGP A;  4OMN A;  2EGE A;  4A63 B;  1NLO C;  2FO0 A;  3U23 A;  2DJQ A;  3I9Q A;  3VS7 A;  1U3O A;  2KXC A;  3A98 A;  2KRS A;  1EFN A;  4E6R A;  2EPD A;  1WI7 A;  3UA7 A;  4X1V A;  2ROL A;  4OML A;  2O9V A;  4HVV A;  3M0P A;  2JM9 A;  2KBT A;  2ROT A;  1Z9Q A;  2GGR A;  1GFD A;  4QT7 A;  1KJW A;  1E7O A;  2YT6 A;  3EHR A;  2YUQ A;  2GNC A;  2SEM A;  2VVK A;  5I11 A;  2KRO A;  1RUW A;  2KEA A;  3VS2 A;  1YN8 A;  3VS5 A;  1T3L A;  2IIM A;  2CUB A;  1X2K A;  1BK2 A;  2KYB A;  2ESW A;  4CC2 A;  3H0I A;  1M3B A;  1BB9 A;  4ZNX A;  1WA7 A;  1ZX6 A;  2K3B A;  1K1Z A;  2JMC A;  2NWM A;  1JEG A;  1GCQ A;  1GCP A;  1NG2 A;  2DIL A;  2V1R A;  1X6B A;  3IQL A;  2KXD A;  4GBQ A;  1A0N B;  1BBZ A;  1NEG A;  1WLP B;  1HJD A;  4LNP A;  1BU1 A;  4K11 A;  1WIE A;  3PVQ A;  2D1X A;  2L3P A;  4AFZ C;  2BZX A;  2YUP A;  4D8D A;  1AD5 A;  4JZ3 A;  1UE9 A;  2L3S A;  1FYN A;  2HSP A;  1G83 A;  1X27 A;  2AKL A;  3R6N A;  1J3T A;  3QWY A;  2LP5 A;  2ABL A;  1FMK A;  3EGU A;  2K7A A;  3EG2 A;  4AG1 C;  2AZS A;  1KSW A;  1QWF A;  4J9F A;  1PHT A;  1X69 A;  2B86 A;  1ZUK A;  1T0J A;  2EVR A;  3M0Q A;  3C0C A;  2CH4 A;  3H0H A;  3H0F A;  2GTO A;  1M3A A;  2ENM A;  1E6G A;  3UF4 A;  1ABQ A;  1YWP A;  3CQT A;  1B07 A;  2I0N A;  2VKN A;  2DM1 A;  1VYU A;  2L3Q A;  2CT4 A;  2KT1 A;  1WXT A;  2RMO A;  2ECZ A;  4GLM A;  2M51 A;  4WCI A;  3UA6 A;  4Z8A A;  2XMF A;  4ORZ A;  2P4R A;  2V1Q A;  3LH5 A;  1MV0 B;  2O2O A;  1AZE A;  1WFW A;  2CRE A;  4LUD A;  4M4Z A;  4J9D A;  1T0H A;  4OMM A;  2FRY A;  2JMA A;  2DX1 A;  1UHF A;  1PKT A;  1PNJ A;  1M3C A;  2X3X D;  1H8K A;  1M27 C;  2JTE A;  1I07 A;  1QKX A;  1JQQ A;  1Y0M A;  2DBK A;  4RTY A;  1ZUY A;  3FJ5 A;  4RTV A;  2GTJ A;  1UDL A;  4J9E A;  2J6K A;  2RNA A;  5HCK A;  2J6O A;  3JV3 A;  1ZBJ A;  1OOT A;  3EG1 A;  2KRM A;  2FEI A;  3O5Z A;  2YUN A;  3I5R A;  2F2V A;  2JW4 A;  1U5S A;  1ARK A;  1B3Q A;  1OPL A; 
#chains in the Genus database with same CATH topology
 2RJF A;  5GMK e;  1VYV A;  4M78 C;  1SHF A;  2NUZ A;  4LDU A;  1KHC A;  2EFI A;  4J9C A;  2ZPG B;  4M7D G;  2EJG A;  2MWP A;  1WHH A;  4F7U A;  2C0O A;  4FSX A;  4VUB A;  3GNF B;  5FWB A;  1UHC A;  2DXC A;  5LJ3 f;  3D7S B;  1PD1 A;  2DIG A;  1BYM A;  3QG1 A;  2OTL A;  4MMK A;  1KIK A;  1VQ4 A;  1X75 C;  1YHQ Q;  5I22 A;  2KT8 A;  1ZA2 B;  2DNU A;  2EGA A;  2LDM A;  2IPO B;  4C0G A;  2EKH A;  3CBO A;  1H92 A;  7AT1 B;  2O01 E;  3ULR B;  1VQ7 A;  1UEC A;  1WXU A;  3S3M A;  1QVF A;  4M7A C;  2JS0 A;  4KGZ B;  1R0C B;  5CO7 A;  4OMQ A;  3VUB A;  1VQL T;  1IZ6 A;  1ZBX A;  1EIF A;  1Q86 C;  1LPL A;  1AOJ A;  2A08 A;  3RR6 A;  4C5E A;  1VQM Q;  1VA7 A;  1V29 B;  1OUL A;  4KUL A;  5AYF A;  2YWW A;  4CC7 A;  3T9N A;  2LCS A;  2HQX A;  3MEW A;  1UB4 A;  4DOV A;  2RHX A;  2O9S A;  3PFS A;  3CMA T;  5DLQ E;  1KC8 C;  3BW1 A;  1R0B G;  1SG5 A;  2O4X B;  2K3Y A;  3REB B;  4E7L A;  3TSW A;  3OYF A;  3G7Z A;  1ZA1 B;  4C0D C;  2CYZ B;  2P0Q A;  5GAN 6;  1JJ2 S;  2FRW A;  4R55 A;  3LWH A;  4M77 D;  5I21 A;  2FZK B;  3MEA A;  3JB9 G;  2JUF A;  2BZY A;  4Z02 A;  2JZ2 A;  1QVG A;  1WHK A;  2GQI A;  1WX6 A;  4KUI A;  5LJ3 g;  3UT1 A;  3M59 A;  2QDL A;  4LE9 A;  5IN1 A;  3CCV T;  1YIJ T;  2A28 A;  2CSI A;  2M16 A;  5J26 A;  3SEM A;  5FU6 C;  1N8R R;  3M54 A;  3QKJ A;  2HAX A;  1KQ1 A;  1OQK A;  1TUC A;  4PJO C;  1RAB B;  1JJ2 A;  1QVG P;  1JXM A;  1JBM A;  2G3R A;  2GQV A;  2EYY A;  2NUT B;  2A37 A;  3OSV A;  4FU6 A;  2RQT A;  2OAW A;  1X43 A;  2JXB A;  1YFN A;  2QTX A;  1OV3 A;  5L23 A;  1SRM A;  3QDR B;  2M0Y A;  2K4Y A;  2RB6 A;  2E65 A;  1NZ9 A;  1WXB A;  2X9H A;  2AZV A;  1XQH A;  3OMC A;  2KYM A;  1WPY A;  5GMK j;  4MDW A;  4ME7 A;  1IB8 A;  5GAO l;  3OYI A;  2LQK A;  3NTI A;  4EIK A;  2NUP A;  3V8J A;  1TUD A;  3M0T A;  1Y07 A;  2KVQ G;  3CC2 A;  2QG9 B;  1Q81 R;  1PSE A;  1XOV A;  4FW1 A;  2E1H A;  1TU0 B;  2YSQ A;  2RI2 A;  1P92 A;  1Y57 A;  1LJO A;  1VQ8 Q;  2D0Q B;  3QYG B;  1R77 A;  2LZ6 B;  1I0C A;  2DL8 A;  2DYB A;  4QQD A;  2CP2 A;  3CC2 Q;  2CH4 W;  3REA B;  5GAN 8;  4J83 A;  3VS6 A;  2EJF A;  4XQ3 A;  1FMV A;  1YCY A;  2ZPH B;  4M7D D;  5CCA A;  2X4X A;  1UGV A;  4M75 B;  4A4F A;  3VUZ A;  3WXM B;  2MOX A;  4CC4 B;  4RCB A;  1VQN Q;  1R8O B;  1Q86 R;  1LCK A;  1JB0 E;  1VQP T;  3M0U A;  1VQ5 A;  3H6Z A;  5IAY A;  1RAI B;  4PNO A;  1SPK A;  3OA6 A;  5ECA A;  2VXF A;  4QQ6 A;  1MND A;  2HL5 C;  2LNH B;  1GL5 A;  3ZL7 C;  1BI1 A;  2XK0 A;  1QVP A;  3KXT A;  2D0N A;  2DF6 A;  2KR3 A;  2P4T A;  1NEB A;  4RG2 A;  3JCM g;  4OMO A;  1B34 B;  4FM4 B;  1VQO T;  3M57 A;  1OU9 A;  5GAO p;  4OP0 A;  4OVA A;  4IUQ A;  3LX7 A;  2QQB A;  2ZGW A;  3QDF A;  2QYZ A;  1CKB A;  5GAO n;  4IIO A;  1BI0 A;  1NLP C;  2EYQ A;  2RK1 A;  1UJY A;  2PQW A;  2OAU A;  2RQW A;  3JCM V;  4KRT A;  1OZ2 A;  3G71 T;  2MIO A;  3TSZ A;  1UGP B;  5IH2 A;  4PJJ A;  3OYN A;  2YLB A;  3VKI A;  4PFZ A;  2EGE A;  5FU7 C;  3VS7 A;  1SSF A;  1U3O A;  3A98 A;  5CVI A;  4JRK A;  4X1V A;  3NTK A;  3MP8 A;  4L6V 5;  4A53 A;  4C8Q B;  5HKC A;  3CCM T;  3BFM A;  3GNG A;  3M5A A;  1Z9Q A;  3A8M B;  3PIO A;  2QXF A;  2QQ9 A;  3V7C A;  4QT7 A;  1KJW A;  3EHR A;  2GNC A;  4OF1 A;  1N6A A;  5I11 A;  4C8Q A;  4R56 A;  3VS2 A;  1YN8 A;  1BCO A;  3OS0 A;  4A4H A;  1M8V A;  2CUB A;  3SWN C;  1X2K A;  1BK2 A;  2KYB A;  3I55 Q;  1M3B A;  1PG5 B;  4ZNX A;  1IRE B;  2PVO B;  1K1Z A;  1EZZ B;  1GCP A;  4X34 A;  4HKE A;  1JRI A;  3J80 E;  4PJL A;  2QQS A;  2V1R A;  1X6B A;  1BI2 A;  1HYO A;  1A0N B;  2FYK A;  2JNG A;  2BKD N;  3HRS A;  1Q86 U;  1MGQ A;  3MP1 A;  4E7K A;  4B9W A;  4N0A C;  4C5G A;  3CXC P;  4JZ3 A;  2JN0 A;  1W2B S;  2GF7 A;  3Q1J A;  1WGS A;  2L3R A;  2DAQ A;  1MMG A;  1FMK A;  4LD6 A;  3I55 A;  2K7A A;  3EG2 A;  3E9G A;  2JTM A;  3JCM J;  1KSW A;  3CCS Q;  3CCE A;  2DVE A;  3DLL A;  2B86 A;  4QVZ A;  3LYI A;  2RJD A;  1SKU B;  3JCM h;  3X25 B;  3CCQ Q;  2GTO A;  2LCL A;  2HQE A;  3CPW A;  2NYS A;  3JCM e;  2RO0 A;  1ABQ A;  3CQT A;  2DTI A;  4IUV A;  5L8R E;  4WTO B;  1Q7Y U;  2KT1 A;  2QEX T;  4WCI A;  4Z8A A;  2BUD A;  2O2O A;  1VUB A;  1LNX A;  1YJW A;  2VAS A;  1YJN Q;  4ZN3 A;  4M7D E;  3CBM A;  3SB2 A;  5CKD A;  2HNI A;  2DX1 A;  1BKB A;  2IVW A;  2O4X A;  3JCM c;  3OBW A;  1VQ8 A;  1M4Z A;  2DBK A;  3DB3 A;  3PT9 A;  5GAN d;  4NOY A;  3OYH A;  1Y96 B;  2GTJ A;  1PCX A;  1UDL A;  5LJ5 d;  1B34 A;  2DEU A;  2RA2 A;  2J6O A;  3JV3 A;  3RUX A;  1NJI U;  2KRM A;  2P0K A;  2QK0 A;  2YUN A;  3HP9 A;  3LWI A;  2JW4 A;  3G6E T;  4M7D B;  1ARK A;  3QXE B;  5CQX A;  3A8L B;  1W4S A;  4HVW A;  3GLX A;  1K8A U;  5DM7 R;  2BE7 D;  2B8A A;  5GAN 4;  4EMK B;  3EG0 A;  3SWN B;  3KUF A;  3QYH B;  2JVV A;  1YHQ T;  4PK4 A;  4C5H A;  1SEM A;  2DK3 A;  2A3L A;  1M90 C;  3RBB B;  2KDS A;  5KYY A;  1U1T A;  4EMH A;  4J5Y A;  2DFU A;  2YXY A;  4B6M A;  3JCM f;  2NUT A;  3INZ A;  2LRQ A;  1NYF A;  4MZP A;  2WSE E;  3L42 A;  5GMK i;  1D0Y A;  1RAD B;  5LJ3 e;  4A4K A;  6AT1 B;  3PVL A;  5LJ3 d;  3G4S Q;  2PTK A;  4JDS A;  2IG0 A;  4C8Q D;  3CXC S;  4M7D A;  3BE3 A;  3MEU A;  3CCL A;  3HTR A;  2YHT A;  5D6X A;  3VS0 A;  1RL2 A;  4GY5 A;  1PRL C;  4WF2 A;  3CCJ Q;  4FSS A;  4M77 F;  4DA4 A;  1AEY A;  1QCF A;  2GFU A;  5HY6 A;  1AHJ B;  4CC3 A;  3I56 T;  1RAG B;  4EDU A;  1RI9 A;  3VU3 C;  3I5S A;  3CME T;  2G6F X;  5GAN g;  3CPW S;  2HCK A;  3VJP A;  4DBF A;  1OZ3 A;  3V8L A;  3TCJ A;  4OMF B;  3CCR A;  2O88 A;  1VQ7 Q;  2RPN A;  2M9U A;  2E3I A;  4R0K A;  2D8H A;  1ABO A;  3JRZ A;  4C92 C;  1IO6 A;  2YUO A;  2FVU A;  2EJ9 A;  1MNE A;  3CC4 T;  1UG1 A;  5A0D A;  1HD3 A;  4C92 A;  4D6W A;  3HL8 A;  4OB2 B;  1IXD A;  4RTZ A;  1YI2 T;  4EPC A;  4AFS C;  4BE1 A;  1RAE B;  3PMI A;  4JPB W;  4M75 D;  2DRK A;  1H3Z A;  1C6V X;  1M8M A;  2OTL T;  4RMO A;  1OYX A;  2PUO B;  4LN2 A;  1D0X A;  3FLG A;  5A0G A;  3CD6 A;  2OX7 A;  3CXC A;  5KCO A;  4J7F A;  3HRU A;  1YIT T;  3E1S A;  2DMO A;  3EHQ A;  1UGR B;  2CGH A;  4J6Y A;  5LL6 S;  1QP2 A;  2FPF A;  2DJZ A;  4YTL A;  4A4E A;  4B9X A;  1OU8 A;  4E7Z A;  2ZCF B;  3GBQ A;  3CCR T;  3RMS A;  1QWE A;  2KE9 A;  3URG A;  2DBM A;  4RUG A;  5KYW B;  4BUG A;  4Y92 A;  4PFO A;  4C92 F;  1YJ9 Q;  1TG0 A;  3M0S A;  3CCV A;  2K2M A;  1UJ0 A;  4M78 A;  2JT4 A;  2BTT A;  4IUP A;  4F7U F;  1YJW Q;  5I2S A;  1OI1 A;  1ACM B;  4J6W A;  3WVD B;  4HXJ A;  1SRL A;  1VQ5 T;  1W1F A;  5KYU B;  1W2B P;  5GAM j;  4Q5W A;  3QPH A;  2J06 A;  2XD0 A;  1VQ4 T;  2HBP A;  3A8O B;  1NYG A;  3CD6 T;  1YHQ A;  3HHT B;  2R58 A;  5KE3 A;  5KYX A;  2RQU A;  2XU8 A;  3EG3 A;  5IXF A;  2MI6 A;  5IHI A;  4KGV B;  2DER A;  4BD3 A;  1M2V A;  2YRC A;  1FXX A;  1HK9 A;  5D7U A;  5HK3 A;  4BAC A;  3CCU A;  4M77 C;  3VS3 A;  2ATC B;  2QA4 A;  5IHN A;  2NLU A;  4J9I A;  1DJ7 B;  2DL4 A;  4JS4 A;  1YWO A;  2HDA A;  2QA4 Q;  4RTW A;  1K8A R;  1SF9 A;  4KT0 E;  4E2F B;  4FL6 A;  2FL7 A;  1SHG A;  1K0S A;  1MMA A;  1N9S A;  4PJO G;  2V8K A;  5CKF A;  2KY9 A;  4E7I A;  1RLQ C;  2LJ3 A;  3PIP A;  1WJR A;  1D1A A;  3CC7 Q;  2DYI A;  2O31 A;  4PFP A;  1D1C A;  2DL3 A;  5FRO A;  3VV0 A;  1S72 Q;  2EQI A;  4M77 E;  3OYJ A;  5LJ5 h;  2VWF A;  1VQK Q;  2E70 A;  5GMK l;  4KH0 B;  2K2V A;  3MKD A;  5GAN j;  2XI9 A;  1LVK A;  1UGS B;  4A63 B;  2FO0 A;  3U23 A;  5LJ3 j;  2EKO A;  4M75 E;  4BY6 C;  2X4J A;  1EFN A;  2EPD A;  3UDC A;  3UA7 A;  2ROL A;  2X51 A;  2JM9 A;  3RIR A;  3OYC A;  1BI3 A;  1PM3 A;  5GAN 3;  3ZBD A;  3FDR A;  2X4W A;  1W2B A;  3OS5 A;  2YT6 A;  1F1B B;  2YUQ A;  9ATC B;  3RKY A;  2VVK A;  2KRO A;  3H8Z A;  3RES A;  2FZC B;  2KEA A;  1ZQ1 A;  4P5N A;  5GAN e;  3L2W A;  1ZSZ B;  5LJ5 j;  1WQ7 A;  1U1S A;  1UEB A;  2CP0 A;  1BB9 A;  3JCM P;  2JMC A;  2M1H A;  2VUB A;  1GCQ A;  2YRV A;  1NG2 A;  3M58 A;  3LGF A;  4Y91 A;  3CCR Q;  1I4K 1;  1WHG A;  2CZ0 B;  4NS5 A;  4GBQ A;  5GAM e;  4MML A;  1NEG A;  4LNP A;  2HSE B;  1WIE A;  4OGE A;  5GAM h;  5D6W A;  2YUP A;  4D8D A;  3GP8 A;  4JRI A;  2KK4 A;  2L3S A;  1QCN A;  1G83 A;  4IKF A;  1KQS A;  2AKL A;  3R6N A;  4PLI A;  4M78 B;  2X35 A;  3QWY A;  2AT1 B;  3EGU A;  4JRQ A;  5GMK h;  4XTX A;  2DKG A;  1PHT A;  1X69 A;  1ZUK A;  1T0J A;  3M0Q A;  1UGQ B;  2A7Y A;  3M4G A;  1Y71 A;  3MET A;  3CCE T;  1B07 A;  2I0N A;  2DM1 A;  3PNW C;  1KQ2 A;  1TS9 A;  3JCM b;  3CCU T;  2L3Q A;  5J39 A;  2CT4 A;  2R5A A;  2ZAE A;  2KI7 A;  3OW2 A;  2RMO A;  3GOX A;  2ECZ A;  3OYM A;  4M7A B;  2FZG B;  3UA6 A;  2XMF A;  4BE2 A;  1AZE A;  3FB9 A;  1IRX A;  2QI2 A;  3OSS C;  4FT2 A;  1VQ9 A;  3C4S A;  4FYX B;  4OMM A;  1VQ9 Q;  3EFO B;  3PTA A;  1VQ6 T;  1UHF A;  1PKT A;  2X3X D;  5CKB A;  2JTE A;  1I07 A;  1YBY A;  1Y0M A;  1GXI E;  5DLO A;  3FJ5 A;  5C6S A;  4A4G A;  3QZ5 B;  3JSC A;  5HCK A;  2EAY A;  4ELZ C;  1I5O B;  1VQK T;  3R6O A;  1OOT A;  1K8A C;  4O6J A;  4XTU A;  2F2V A;  4M7A D;  1G3S A;  2R5M A;  2LT4 A;  2HZY A;  1UTI A;  1QMC A;  1K73 R;  2E6N A;  3ASK A;  1NJI C;  3VYH B;  3A8H B;  1K76 A;  4FW2 A;  1VIF A;  1RLP C;  5GJV B;  1KK7 A;  1NPR A;  2HD0 A;  4LXC A;  4F17 A;  3CCM A;  2PVG B;  2CKK A;  2CT3 A;  5GAM g;  5FU6 B;  2ED0 A;  1PRM C;  3KFV A;  4DEY A;  1IGQ A;  2DIQ A;  2GFA A;  4FT4 A;  4RKU E;  2Y4X A;  2K9G A;  1VIE A;  1Q82 U;  1WQW A;  4QVC A;  2LMJ A;  4PKC C;  4M78 D;  3S3O A;  3M56 A;  3G71 Q;  3EFR A;  2FG0 A;  3ER0 A;  2RQR A;  2LX9 A;  1VYT A;  3HFO A;  1N9R A;  2RQV A;  2ZZD A;  2EGC A;  2J05 A;  2QEX A;  2PVD B;  4JJB A;  1YJ9 T;  4IUU A;  3L2Q A;  3VS4 A;  1I1J A;  1UUE A;  2LX7 A;  4AG2 C;  1PC0 A;  3TVT A;  1VQO A;  2MPX C;  4PJO E;  1GRI A;  4KBM B;  1AZG B;  8ATC B;  2E12 A;  4XU2 A;  4F04 B;  4PJO A;  3L2Z A;  8AT1 B;  2DZ9 A;  5IXB A;  1G5V A;  2RHU A;  1Q95 G;  3FJP A;  1W70 A;  2QQA A;  1AVZ C;  4M77 B;  4ELY C;  1ZSG A;  4BB7 A;  2FPE A;  1WHL A;  2EW3 A;  1VQN T;  3EG9 B;  4Y28 E;  3CME Q;  3EAE A;  1X6G A;  2MF2 A;  1U8R A;  4PJO D;  2QDY B;  1EX4 A;  4JUV A;  3HKS A;  2E3H A;  1WNL A;  3HRT A;  4ZN1 A;  4JLI A;  3SDZ A;  1QVG S;  3MJX A;  3AT1 B;  1XTD A;  2KGT A;  3OYA A;  2XDD A;  1E6H A;  5LJ3 h;  1WYX A;  3BDL A;  3DKM A;  2W10 A;  1Q81 C;  4C5I A;  2C06 A;  1W6X A;  5GAM f;  1V76 A;  4AMC A;  3QZ9 B;  2EYW A;  1BCM A;  2E5K A;  1YP5 A;  2K5F A;  3TEE A;  1JJ2 P;  3L2U A;  2HBW A;  5GAN 7;  4E7H A;  3OYY A;  4F14 A;  2VB6 A;  2RM4 A;  2WSF E;  1FMW A;  2YRD A;  1GCQ C;  3G6E Q;  2OJ2 A;  2KRN A;  1TH7 A;  2E5Q A;  3KBG A;  1K73 U;  2WSC E;  1KFZ A;  2WAC A;  4F16 A;  4RG8 A;  1Y7X A;  1CSK A;  1X2Q A;  2C0T A;  3X24 B;  1VQM A;  1JXO A;  4AT1 B;  1PWT A;  5I2M A;  1QVF S;  4N0A A;  3MCA B;  2Z0W A;  3RKX A;  4C0F A;  4C92 G;  1UFF A;  3PE0 A;  1YCS B;  4C0D B;  3CC7 A;  2JM8 A;  2RF0 A;  4DBR A;  1TUG B;  5KE2 A;  2DTH A;  2XIC A;  4PJO F;  2DE0 X;  4NL3 A;  3OYK A;  1ZHI A;  2L2P A;  2LQN A;  4IUT A;  3I56 A;  2HQH A;  4IIM A;  1KD1 R;  1VQ4 Q;  3I55 T;  2K6D A;  2CDT A;  2OTL Q;  1HSQ A;  2AK5 A;  2DL5 A;  3VRY A;  1MMN A;  1YJ9 A;  3CD6 Q;  1OPK A;  1RAH B;  2GCX A;  2RHZ A;  3OMG A;  4JJD A;  2EQJ A;  2F69 A;  1ZUU A;  1KQS P;  3OYE A;  1GBQ A;  4RCC A;  2M0O A;  1K9M U;  2P0P A;  4M7A A;  3GF5 A;  4AFU C;  2JJ9 A;  4C0Z A;  1WHJ A;  1CKA A;  1TXQ A;  1VQ8 T;  3CCL T;  2LVM A;  4LDX A;  4DEX A;  3LLR A;  2DL7 A;  2KNB B;  4M78 G;  1K9M R;  3EGX B;  1O9S A;  4N4H A;  2YLC A;  3NFC A;  2V8J A;  3MP6 A;  3JCM d;  3LW5 E;  2HL3 A;  1PSF A;  1QLY A;  1M9S A;  1YJW T;  2QGG A;  4FIB A;  4PJM A;  3NPF A;  4DOW A;  1KC8 R;  4ZGD B;  4AFQ C;  2F2W A;  1ZLM A;  2EBP A;  1KD1 U;  2W0Z A;  4ESR A;  2EYZ A;  2LJ1 A;  3QO3 A;  4BY6 B;  1Q7Y C;  4M77 A;  4J6X A;  4EMG A;  4M7A F;  4E7S A;  1N5Z A;  2OTJ Q;  3OYD A;  4JRP A;  1S72 T;  5FRM A;  4PJN A;  1C1A A;  3S3N A;  3OYB A;  1WJQ A;  3HSB A;  3TQ7 P;  1XNI A;  2VYT A;  1XJW B;  1AT1 B;  3TRE A;  4C8Q G;  2KSS A;  2FPD A;  1GBR A;  1V1C A;  1JO8 A;  4TVR A;  4HCK A;  1YNZ A;  2BIV A;  2EYX A;  3NGP A;  5C0M A;  5LJ5 e;  1BIA A;  2K3X A;  3BY7 A;  3ME9 A;  4FYW B;  3JAM E;  5A0L A;  1NLO C;  2DJQ A;  3EH2 A;  2KXC A;  2KRS A;  4E6R A;  4XU3 A;  4DBH A;  4M75 G;  2Y4Y A;  4OML A;  2O9V A;  3M0P A;  2KBT A;  4M78 F;  2GGR A;  1GFD A;  3ZEH A;  2HKN A;  2HKQ B;  1VOM A;  2SEM A;  3TU4 K;  1M1G A;  3CC2 T;  2DEQ A;  2RJC A;  1MMD A;  3VS5 A;  1T3L A;  1KC8 U;  1YIT A;  2JTF A;  2RHY A;  2DXT A;  2ESW A;  4CC2 A;  4J7I A;  4ANJ A;  3H0I A;  2A0F B;  1WA7 A;  4IUR A;  3FRN A;  3G1J A;  2EWN A;  1VQ7 T;  5GAO q;  2NWM A;  1JEG A;  2MYS A;  1M90 R;  3OY9 A;  2CZ7 B;  2MWO A;  3S6W A;  3A1P A;  3IQL A;  2KXD A;  2XID A;  3EG9 A;  1BBZ A;  1WLP B;  2F5T X;  4QW2 A;  5FRN A;  4KH1 B;  2LC4 A;  4K11 A;  5J3B A;  3X28 B;  3FC3 A;  2OTJ A;  1MHN A;  2D1X A;  2L3P A;  4AFZ C;  3RKW A;  1AD5 A;  1M1F A;  1UE9 A;  1FYN A;  4DBQ A;  4M7D C;  3X20 B;  3RER A;  1J3T A;  1N27 A;  4QQG A;  2LP5 A;  4XTZ A;  4HT9 A;  1WZO A;  4AG1 C;  4C92 D;  4FYV B;  3M53 A;  1YJN T;  2XKO C;  3V7R A;  2PUK B;  1VQ6 A;  3P8B B;  2H3E B;  3O8V A;  3VYG A;  2VGM A;  3RDV A;  2CH4 A;  3CCL Q;  3H0F A;  3OS2 A;  2M02 A;  2ENM A;  1M1K R;  1D3B A;  1E6G A;  3UF4 A;  1YWP A;  3H9N A;  1M2V B;  4M7A G;  2VKN A;  3P8H A;  1YJN A;  3G4S A;  2LTO A;  3EGD A;  2BE9 B;  1G3W A;  2K5I A;  3CPF A;  4GLM A;  2M51 A;  4ORZ A;  2P4R A;  2V1Q A;  1Q82 R;  2CRE A;  5GMK m;  4M4Z A;  4J8O A;  2AHJ B;  1RAC B;  4XK8 E;  1G3Y A;  3JB9 J;  1PNJ A;  1RAF B;  1QKX A;  1QP3 A;  2CP7 A;  1M1K C;  4EMK A;  4RTV A;  5KYW A;  3JB9 F;  5GAO r;  5GAO m;  3JCM Q;  2J6K A;  2RNA A;  3C95 A;  2FB7 A;  3OW2 S;  3JCM X;  4V2S A;  1ZBJ A;  3EG1 A;  1NBE B;  2FEI A;  3O5Z A;  3RMQ A;  3I5R A;  2JOY A;  3ZFJ A;  2RD1 A;  3NHN A;  1B3Q A;  4HCZ A;  3VRZ A;  5AT1 B;  2DO3 A;  3L2R A;  2ZPF B;  1SSH A;  4RTX A;  2F2X A;  4KGX B;  1M1K U;  1YI2 Q;  1QW1 A;  2DVJ A;  1K9A A;  2DA9 A;  2CUD A;  5FWC A;  2AIR B;  4OB0 B;  2AKK A;  5GAN 2;  1X6O A;  1M2O A;  5FU7 B;  2L5Q A;  4OB3 B;  4MZM A;  4RTU A;  3CCJ T;  2LJ0 A;  2HEQ A;  1KQS S;  2D6F A;  1RAA B;  2COW A;  1U06 A;  4XTW A;  3JB9 I;  1T3S A;  1NE8 A;  2E64 A;  1AWO A;  5HK0 A;  2SRC A;  3PGG A;  4D8K A;  3CME A;  2RN8 A;  2CSQ A;  4L5G A;  3OS1 A;  4ZTF A;  1NJI R;  5GJW B;  1TSF A;  2KAF A;  3DLM A;  2COY A;  3I56 Q;  4BDZ A;  3JB9 H;  1M5Q 1;  4JZ4 A;  4CRI A;  4GLK A;  5CK9 A;  2J7I A;  2P84 A;  2F5K A;  5FW9 A;  3CCV Q;  2QGF B;  4J9B A;  3SFM A;  3MPU B;  1GFC A;  5IT9 E;  4JJN K;  1Z9Z A;  4X9D A;  5CKE A;  1O75 A;  3EFS A;  3UPU A;  4OMP A;  3L1A A;  2DD5 A;  1MUZ A;  4M77 G;  3JB9 D;  2H3J A;  3NMZ C;  4FYY B;  3CCS A;  4M75 C;  1S1N A;  4ZTJ A;  2RK2 A;  1C0M A;  2QAZ A;  5GAN f;  2DET A;  3E2U A;  5EG2 A;  4RTT A;  3V7S A;  2V26 A;  1OEB A;  5LJ5 f;  1N8R U;  2VGN A;  1VQO Q;  1Q7Y R;  3G71 A;  2K5L A;  2L8D A;  2H8H A;  3JCM W;  2KQW A;  4LDW A;  1AWW A;  2QQR A;  2ZPI B;  4N4I A;  1G2B A;  3LH0 A;  2D8J A;  1AWX A;  2RI3 A;  3EGD B;  3CEY A;  4HVU A;  3L2V A;  1H3H A;  4BDY A;  3QBY A;  5KH6 A;  2QA4 T;  4C8Q E;  1D3B B;  1M30 A;  2E41 A;  3OB9 A;  4O5V A;  1HXD A;  2X3W D;  3MHX A;  4XAX B;  1K4U S;  2L0A A;  1QKW A;  2EQK A;  1VQL A;  4C8Q F;  2DLP A;  2OI3 A;  5GAM d;  2LQW A;  2DXU A;  4A54 A;  4NL2 A;  2KMT A;  3M0R A;  4J9G A;  2FHD A;  1KHI A;  3OQ5 A;  3CCM Q;  3GPL A;  1JU5 C;  3QWX X;  2ED1 A;  4OB1 B;  1RI0 A;  1YIJ A;  2VV5 A;  4HT8 A;  3GIB A;  2RH2 A;  4LUE A;  3A5Z B;  5CR2 A;  1OX8 A;  3SWN A;  1VQ5 Q;  2PNI A;  2GBQ A;  3CCQ T;  1VQN A;  2K79 A;  2J6F A;  3SHW A;  1K0X A;  4C8Q C;  4Z89 A;  2EQM A;  3I35 A;  1NM7 A;  1QVF P;  2PZ1 A;  3G4S T;  1Y96 A;  3RNJ A;  2JS2 A;  3CPW P;  2E4H A;  3CMA A;  1B7T A;  5CAI A;  3H41 A;  3UAT A;  3J7A F;  2E10 A;  1FWZ A;  3QJY A;  1VQ9 T;  4LD9 K;  4OGC A;  2CP6 A;  3HPW A;  2QEX Q;  2BZ8 A;  2A36 A;  1IHW A;  2LT1 A;  4M78 E;  4F7U G;  4MZT A;  4LDY A;  2C0I A;  4J9H A;  4KUD K;  3QHS A;  3M9Q A;  5EC7 A;  3CMA Q;  1IHV A;  3EH1 A;  3BDU A;  4FCY A;  2YDL A;  3MO8 A;  3PMT A;  5DY9 A;  1PKS A;  3CC4 A;  2E6Z A;  3THK A;  3CCS T;  3AHU A;  1K73 C;  4Z88 A;  1D0Z A;  3CC7 T;  1MV3 A;  5CIU A;  4M75 F;  2XDB A;  2RHI A;  5GAN h;  4HA8 A;  3C94 A;  1YIJ Q;  4JJC A;  1KG1 A;  1VQP Q;  1ZSZ C;  3VS1 A;  4ZGJ B;  5IHK A;  1VQP A;  2VXE A;  2CP3 A;  3X26 B;  2LQ8 A;  2CS7 A;  2D9T A;  2MCN A;  3V8K A;  4MDX A;  4C92 E;  1NPP A;  3LGL A;  1AWJ A;  2DRM A;  4L59 A;  3FEO A;  3CC4 Q;  2DZC A;  3M4Y A;  1QQJ A;  2MAM A;  4XTY A;  1H64 1;  2QAS A;  5A2Q E;  4II1 A;  2X4Y A;  3F70 A;  2RI5 A;  2DTO A;  2I2L A;  5KCH A;  3EGX A;  4F7U E;  1OX9 A;  4PL6 A;  4ZGE B;  4CI0 C;  4E7J A;  5FLX E;  1WDX A;  4QKU A;  2MMP A;  3OYL A;  4OMN A;  1YIT Q;  4X9C A;  1I8F A;  3I9Q A;  3CCJ A;  4HCC A;  1ZSZ A;  1WI7 A;  1VQ6 Q;  1FX7 A;  4HVV A;  3M55 A;  2ROT A;  5KYU A;  4UC4 A;  2OTJ T;  1E7O A;  2CP5 A;  2XDP A;  2XHC A;  2ZPB B;  4C92 B;  4HCB A;  1Q81 U;  1X01 A;  1N8R C;  1RUW A;  5GAN 5;  4BI8 B;  1TWB A;  2IIM A;  2Y90 A;  4DQ2 A;  1ZX6 A;  2K3B A;  1I81 A;  3QII A;  2QTV A;  1LOJ A;  5LJ5 g;  4XTV A;  5CKH A;  2LNV A;  2DIL A;  1D09 B;  4M75 A;  1VQL Q;  3A8G B;  4PLL A;  2PU9 B;  1HJD A;  1BU1 A;  1VQM T;  3PVQ A;  2BZX A;  2LCC A;  1M90 U;  2L89 A;  2XG8 D;  2HSP A;  1PD0 A;  1X27 A;  1TOV A;  5KYN A;  3EFO A;  4EMK C;  2EQU A;  4JLG A;  2ABL A;  1Q82 C;  3E19 A;  2AZS A;  2DPP B;  3OBY A;  4M7A E;  2RJE A;  1QWF A;  3QUI A;  4BI4 A;  4J9F A;  3C12 A;  2NUP B;  4XU1 A;  2EVR A;  3SD4 A;  2K57 A;  5D6Y A;  3J81 E;  5CQY A;  2DXB A;  3C0C A;  3H0H A;  1M3A A;  2ZPE B;  3CBP A;  3DB4 A;  3FIF A;  2DD4 A;  4M7D F;  2CZ6 B;  1K9M C;  5KYX B;  1IGU A;  1VYU A;  2R57 A;  3P8D A;  1WJS A;  1WXT A;  2VC8 A;  1G8X A;  5KYY B;  3LH5 A;  1G3T A;  1MV0 B;  3MEV A;  4E47 A;  4BE0 A;  4XU0 A;  1WFW A;  3N5B B;  4LUD A;  3QJ6 A;  4J9D A;  2V8I A;  1I5L A;  1T0H A;  1VQK A;  2CZ1 B;  3QSU A;  2F1L A;  1D1B A;  5M9O A;  2FRY A;  4BI3 A;  2JMA A;  1S72 A;  1M3C A;  2MK5 A;  1H8K A;  1M27 C;  4LDV A;  3E9F A;  1JQQ A;  3UWN A;  4F7U B;  3HFN A;  3CCQ A;  4RTY A;  4PJO B;  3OYG A;  3NTH A;  1ZUY A;  1KD1 C;  1YI2 A;  2HMA A;  3G6E A;  1WHM A;  4J9E A;  4ATO A;  1BIB A;  3OW2 P;  3CCE Q;  1QCO A;  3WVE B;  2COZ A;  4JS5 A;  3CCU Q;  4N4G A;  1U5S A;  1TTH B;  2EIF A;  1OPL A;  4QVD A; 
#chains in the Genus database with same CATH homology
 1UTI A;  1VYV A;  4HVW A;  3VRZ A;  1SHF A;  2NUZ A;  1K76 A;  1RLP C;  4J9C A;  1SSH A;  5GJV B;  3EG0 A;  4RTX A;  4F17 A;  2C0O A;  2F2X A;  5FWB A;  1UHC A;  1SEM A;  2DVJ A;  1K9A A;  2CT3 A;  2CUD A;  2DA9 A;  5FWC A;  3RBB B;  2AKK A;  1KIK A;  2ED0 A;  1PRM C;  4RTU A;  5I22 A;  2KT8 A;  2LJ0 A;  3KFV A;  2DNU A;  4DEY A;  2EGA A;  2HEQ A;  2K9G A;  2EKH A;  1U06 A;  3NHN A;  1T3S A;  1H92 A;  1AWO A;  1NYF A;  2LMJ A;  2SRC A;  3ULR B;  1UEC A;  1WXU A;  4D8K A;  2RN8 A;  2CSQ A;  2JS0 A;  2FG0 A;  5GJW B;  2RQR A;  3PVL A;  4OMQ A;  1VYT A;  2PTK A;  2RQV A;  4JZ4 A;  2EGC A;  2J05 A;  1AOJ A;  2J7I A;  2A08 A;  4JJB A;  5FW9 A;  3VS4 A;  1I1J A;  1VA7 A;  4J9B A;  1GFC A;  1UUE A;  1Z9Z A;  2LX7 A;  4AG2 C;  3TVT A;  4OMP A;  3VS0 A;  1GRI A;  1PRL C;  4CC7 A;  1AZG B;  2LCS A;  4FSS A;  1MUZ A;  3NMZ C;  1AEY A;  1QCF A;  1S1N A;  5IXB A;  2O9S A;  1W70 A;  4RTT A;  1AVZ C;  1OEB A;  4CC3 A;  3REB B;  1ZSG A;  2FPE A;  3TSW A;  2EW3 A;  2FRW A;  2H8H A;  1RI9 A;  1X6G A;  2BZY A;  1AWW A;  2GQI A;  1WX6 A;  3I5S A;  1G2B A;  2D8J A;  2G6F X;  1AWX A;  2HCK A;  2QDL A;  4LE9 A;  4HVU A;  1H3H A;  2A28 A;  2CSI A;  3SEM A;  2O88 A;  2RPN A;  1M30 A;  1TUC A;  2KGT A;  2X3W D;  1E6H A;  4R0K A;  1JXM A;  2D8H A;  1ABO A;  1IO6 A;  1K4U S;  2L0A A;  1QKW A;  2YUO A;  2EYY A;  1WYX A;  2A37 A;  2W10 A;  1UG1 A;  2RQT A;  2OAW A;  1W6X A;  2DLP A;  2OI3 A;  1X43 A;  2LQW A;  2JXB A;  1HD3 A;  1OV3 A;  5L23 A;  2EYW A;  2E5K A;  1YP5 A;  1SRM A;  2M0Y A;  3M0R A;  4J9G A;  4RTZ A;  2HBW A;  4AFS C;  1WXB A;  4JPB W;  1JU5 C;  4F14 A;  2AZV A;  2DRK A;  3QWX X;  2ED1 A;  1M8M A;  1GCQ C;  2KYM A;  2OJ2 A;  2KRN A;  4LN2 A;  4LUE A;  1KFZ A;  4F16 A;  2PNI A;  4EIK A;  1CSK A;  1X2Q A;  2C0T A;  2DMO A;  3EHQ A;  1JXO A;  2GBQ A;  1PWT A;  2FPF A;  2K79 A;  2J6F A;  3SHW A;  1TUD A;  1K0X A;  3M0T A;  3GBQ A;  4Z89 A;  3I35 A;  1NM7 A;  1QWE A;  1XOV A;  2KE9 A;  2PZ1 A;  2DBM A;  4RUG A;  2YSQ A;  4Y92 A;  3RNJ A;  1UFF A;  1Y57 A;  2JS2 A;  3PE0 A;  1YCS B;  2JM8 A;  2RF0 A;  3H41 A;  1TG0 A;  3UAT A;  2LZ6 B;  3M0S A;  2K2M A;  1I0C A;  2DL8 A;  2DYB A;  2DE0 X;  1UJ0 A;  2JT4 A;  2BTT A;  2BZ8 A;  2A36 A;  2CH4 W;  3REA B;  2L2P A;  2LQN A;  2C0I A;  3VS6 A;  4J9H A;  4IIM A;  5EC7 A;  2K6D A;  2CDT A;  1HSQ A;  4HXJ A;  1SRL A;  2AK5 A;  2DL5 A;  3VRY A;  1OPK A;  1UGV A;  2YDL A;  4JJD A;  1W1F A;  1ZUU A;  2J06 A;  1GBQ A;  2MOX A;  4CC4 B;  1PKS A;  1NYG A;  4AFU C;  1LCK A;  3THK A;  2RQU A;  3M0U A;  3EG3 A;  4Z88 A;  1CKA A;  5IHI A;  5IXF A;  1SPK A;  1MV3 A;  4DEX A;  5ECA A;  2DL7 A;  1GL5 A;  2LNH B;  3VS3 A;  2KNB B;  3ZL7 C;  4JJC A;  5IHN A;  4J9I A;  3VS1 A;  5IHK A;  2DL4 A;  2D0N A;  2DF6 A;  2KR3 A;  1YWO A;  1NEB A;  2HDA A;  4RTW A;  4OMO A;  2MCN A;  1QLY A;  3NPF A;  4AFQ C;  2F2W A;  1ZLM A;  2EBP A;  2W0Z A;  4ESR A;  2EYZ A;  1AWJ A;  1SHG A;  2DRM A;  2LJ1 A;  1K0S A;  1N5Z A;  1CKB A;  4IIO A;  1NLP C;  1RLQ C;  2LJ3 A;  1UJY A;  2O31 A;  2DL3 A;  2FPD A;  1GBR A;  2EQI A;  1V1C A;  1JO8 A;  2RQW A;  2VWF A;  4KRT A;  4HCK A;  1WDX A;  1YNZ A;  2MIO A;  3TSZ A;  5IH2 A;  2EYX A;  3NGP A;  4OMN A;  2EGE A;  4A63 B;  1NLO C;  2FO0 A;  3U23 A;  2DJQ A;  3I9Q A;  3VS7 A;  1U3O A;  2KXC A;  3A98 A;  2KRS A;  1EFN A;  4E6R A;  2EPD A;  1WI7 A;  3UA7 A;  4X1V A;  2ROL A;  4OML A;  2O9V A;  4HVV A;  3M0P A;  2JM9 A;  2KBT A;  2ROT A;  1Z9Q A;  2GGR A;  1GFD A;  4QT7 A;  1KJW A;  1E7O A;  2YT6 A;  3EHR A;  2YUQ A;  2GNC A;  2SEM A;  2VVK A;  5I11 A;  2KRO A;  1RUW A;  2KEA A;  3VS2 A;  1YN8 A;  3VS5 A;  1T3L A;  2IIM A;  2CUB A;  1X2K A;  1BK2 A;  2KYB A;  2ESW A;  4CC2 A;  3H0I A;  1M3B A;  1BB9 A;  4ZNX A;  1WA7 A;  1ZX6 A;  2K3B A;  1K1Z A;  2JMC A;  2NWM A;  1JEG A;  1GCQ A;  1GCP A;  1NG2 A;  2DIL A;  2V1R A;  1X6B A;  3IQL A;  2KXD A;  4GBQ A;  1A0N B;  1BBZ A;  1NEG A;  1WLP B;  1HJD A;  4LNP A;  1BU1 A;  4K11 A;  1WIE A;  3PVQ A;  2D1X A;  2L3P A;  4AFZ C;  2BZX A;  2YUP A;  4D8D A;  1AD5 A;  4JZ3 A;  1UE9 A;  2L3S A;  1FYN A;  2HSP A;  1G83 A;  1X27 A;  2AKL A;  3R6N A;  1J3T A;  3QWY A;  2LP5 A;  2ABL A;  1FMK A;  3EGU A;  2K7A A;  3EG2 A;  4AG1 C;  2AZS A;  1KSW A;  1QWF A;  4J9F A;  1PHT A;  1X69 A;  2B86 A;  1ZUK A;  1T0J A;  2EVR A;  3M0Q A;  3C0C A;  2CH4 A;  3H0H A;  3H0F A;  2GTO A;  1M3A A;  2ENM A;  1E6G A;  3UF4 A;  1ABQ A;  1YWP A;  3CQT A;  1B07 A;  2I0N A;  2VKN A;  2DM1 A;  1VYU A;  2L3Q A;  2CT4 A;  2KT1 A;  1WXT A;  2RMO A;  2ECZ A;  4GLM A;  2M51 A;  4WCI A;  3UA6 A;  4Z8A A;  2XMF A;  4ORZ A;  2P4R A;  2V1Q A;  3LH5 A;  1MV0 B;  2O2O A;  1AZE A;  1WFW A;  2CRE A;  4LUD A;  4M4Z A;  4J9D A;  1T0H A;  4OMM A;  2FRY A;  2JMA A;  2DX1 A;  1UHF A;  1PKT A;  1PNJ A;  1M3C A;  2X3X D;  1H8K A;  1M27 C;  2JTE A;  1I07 A;  1QKX A;  1JQQ A;  1Y0M A;  2DBK A;  4RTY A;  1ZUY A;  3FJ5 A;  4RTV A;  2GTJ A;  1UDL A;  4J9E A;  2J6K A;  2RNA A;  5HCK A;  2J6O A;  3JV3 A;  1ZBJ A;  1OOT A;  3EG1 A;  2KRM A;  2FEI A;  3O5Z A;  2YUN A;  3I5R A;  2F2V A;  2JW4 A;  1U5S A;  1ARK A;  1B3Q A;  1OPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...