1ZUUA

Crystal structure of the yeast bzz1 first sh3 domain at 0.97-a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
ENKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BZZ1 protein
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zuuA00
3VRYA 1AVZC 3RBBB 2JM8A 2YDLA 3M0RA 1B3QA 4D8DA 2K2MA 2C0OA 2LJ0A 2DBMA 3VS2A 1GL5A 2RN8A 2K79A 1GCQA 1RLQC 1SHGA 1UFFA 1W1FA 2DL3A 2EKHA 2O31A 2LJ1A 1SSHA 2LNHB 2AKKA 2RPNA 1X2QA 2KR3A 1W70A 3PVQA 4M4ZA 3KFVA 1MUZA 2O9VA 3REAB 4HVUA 1GRIA 1FMKA 2LMJA 1ZUKA 2OAWA 1M3AA 2DNUA 2J7IA 1V1CA 5FWCA 4HVVA 2BZXA 2VVKA 1PKSA 3I35A 1ZUYA 2K6DA 1QWFA 1ARKA 4F17A 1UHCA 2DX1A 1X27A 3REBB 2GBQA 4RTWA 3IQLA 2P4RA 4ZNXA 1TG0A 2EQIA 5FW9A 1SRMA 1YCSB 2A28A 3VS6A 1HD3A 4OMLA 1I1JA 1YP5A 2EYWA 3EG0A 4ORZA 4AG1C 1XOVA 1PHTA 5I22A 1N5ZA 2SEMA 4IIOA 2YT6A 2OI3A 1E6HA 1NYFA 1HJDA 2GGRA 2DL8A 2ROLA 1UJYA 2A37A 2EYXA 2K3BA 2A08A 1WXTA 2D8HA 1GFCA 3R6NA 1SHFA 1SRLA 1UE9A 2SRCA 1Z9QA 2LJ3A 3LH5A 2GTOA 4JJBA 3EG2A 3EG3A 1UTIA 2V1QA 3H41A 3NMZC 2ABLA 2L0AA 3I9QA 1WFWA 1OV3A 2A36A 4CC2A 3NGPA 1VYTA 5IXBA 2FRYA 5HCKA 2KT8A 2J05A 1U06A 2RQRA 3QWYA 2DVJA 2ESWA 2AZSA 2HSPA 2DYBA 2F2VA 1I0CA 4E6RA 2OJ2A 1E7OA 3VS1A 2DBKA 2KE9A 4OMQA 1SEMA 1GCQC 2CSIA 1JXOA 2EVRA 1AWJA 1M3BA 3EGUA 2ED0A 4J9CA 3M0PA 1JXMA 2X3WD 4OMNA 2HBWA 1H3HA 1K9AA 4HVWA 2O2OA 1W6XA 3UA6A 2DL5A 5IXFA 2EPDA 2VWFA 2CH4A 1U3OA 1T3LA 1OEBA 1QLYA 4OMPA 2FEIA 2LQNA 1UECA 1Y57A 2X3XD 4CC4B 1RUWA 4F16A 4LN2A 4LUDA 2KBTA 2YUPA 3H0IA 2EW3A 2JM9A 5L23A 2KNBB 2IIMA 2JW4A 1J3TA 4J9IA 2BZ8A 2PZ1A 3JV3A 1WXBA 2L3QA 1HSQA 4LE9A 3VS7A 4JZ3A 2AKLA 1CKBA 2EYZA 1GBQA 1KJWA 2AZVA 1MV3A 2L3SA 3VS4A 1H92A 4AFZC 1GFDA 1WA7A 2I0NA 4RTYA 1UGVA 2MIOA 1VYUA 1OPLA 1H8KA 2B86A 2PTKA 2DA9A 4AFSC 2DL4A 1ZSGA 1NG2A 3VS5A 1M8MA 4J9EA 2E5KA 2RQWA 2QDLA 2LCSA 1BB9A 4LUEA 3PVLA 3UF4A 1ZBJA 5ECAA 2RMOA 1M27C 1T0HA 3NHNA 2CT3A 4Z88A 2M0YA 1AD5A 2KRMA 1JO8A 1X6GA 2KXCA 4F14A 2O9SA 2J06A 1VA7A 1CSKA 2JMCA 3ULRB 2DLPA 1U5SA 2KGTA 1WDXA 3EHRA 2M51A 4IIMA 2JTEA 2DJQA 3UATA 1EFNA 5GJVB 2K7AA 2GNCA 1ABQA 1NEBA 3I5SA 1X2KA 1AZEA 1BK2A 1JU5C 4Z89A 3O5ZA 4Z8AA 1WXUA 1PWTA 2LQWA 3TSWA 1TUDA 1NM7A 1M30A 2W0ZA 2FPEA 1RLPC 2EGAA 5IHNA 1S1NA 1YWPA 2O88A 1NLPC 2GQIA 2ED1A 4CC7A 4CC3A 4RTTA 2JS0A 1AWWA 1A0NB 1Z9ZA 1BBZA 3H0HA 3THKA 2JXBA 2D0NA 3EG1A 3VRZA 3M0QA 1K4US 2LX7A 2KYMA 1JEGA 3A98A 3FJ5A 3ZL7C 2YUOA 2J6OA 1AEYA 3TSZA 1AWOA 4DEXA 1KFZA 2CT4A 4RUGA 2CUDA 2HCKA 4FSSA 1RI9A 1CKAA 4J9GA 4RTUA 4EIKA 1BU1A 4GLMA 4J9BA 2C0IA 2YUQA 1NLOC 1WYXA 1G2BA 5GJWB 2KXDA 2YUNA 2AK5A 1YWOA 5IHIA 3U23A 2V1RA 1ZX6A 2H8HA 3NPFA 2DL7A 1I07A 4QT7A 4RTXA 1WLPB 1WIEA 1UUEA 1NYGA 2DILA 3RNJA 4AG2C 1ZUUA 2KT1A 1K76A 3CQTA 2RQTA 1QKWA 4Y92A 2FO0A 1LCKA 4AFQC 4KRTA 1IO6A 1NEGA 1M3CA 1UHFA 2EGEA 1YN8A 4DEYA 2MOXA 4J9FA 1K1ZA 4K11A 2RQVA 4LNPA 4OMMA 3TVTA 1T0JA 2VKNA 2CH4W 2CUBA 4JZ4A 3M0TA 4HXJA 3VS3A 2D1XA 2G6FX 2J6KA 2C0TA 3EHQA 1YNZA 4X1VA 2FPDA 1AWXA 1G83A 2KRNA 4RTVA 1UG1A 1AZGB 2DRKA 3QWXX 2DE0X 4HCKA 1KSWA 2NUZA 1Y0MA 2XMFA 1UJ0A 1E6GA 2F2WA 5IH2A 1PNJA 2MCNA 2CDTA 1PRLC 4D8KA 2NWMA 4RTZA 5FWBA 3VS0A 4OMOA 3SHWA 2L3PA 2KROA 2RF0A 2LP5A 1FYNA 2BTTA 4ESRA 2L2PA 2JT4A 1ABOA 1PRMC 2RNAA 2PNIA 1T3SA 2DMOA 2J6FA 2KRSA 4JJDA 1PKTA 3C0CA 3M0SA 3UA7A 1MV0B 1AOJA 1WI7A 2DM1A 2LZ6B 1UDLA 2RQUA 1X43A 2KYBA 1B07A 2D8JA 4JPBW 2ROTA 2DRMA 1K0XA 1KIKA 2KEAA 1QWEA 2CSQA 1SPKA 3I5RA 1QCFA 2FG0A 5EC7A 2EYYA 2JMAA 1WX6A 4AFUC 4WCIA 1VYVA 2GTJA 4R0KA 1OOTA 4J9HA 2K9GA 1GCPA 3PE0A 3SEMA 1X69A 1QKXA 5IHKA 2ECZA 3H0FA 2CREA 3M0UA 4JJCA 2EGCA 2EBPA 1OPKA 2BZYA 2F2XA 2YSQA 1GBRA 2HDAA 2ENMA 1ZLMA 2DF6A 1X6BA 2HEQA 1TUCA 4J9DA 2FPFA 4GBQA 4A63B 5I11A 1K0SA 2W10A 2FRWA 2JS2A 3GBQA 1JQQA
chains in the Genus database with same CATH superfamily
3MKDA 3RBBB 3BE3A 1KC8U 2P84A 3L2QA 4AMCA 4DBRA 2LJ0A 1YBYA 4X9DA 4BACA 2DBMA 1ZSZA 4L6V5 3CC7T 1GCQA 2EKHA 1UFFA 1W70A 1AT1B 3VU3C 3BY7A 2FZGB 4HVUA 2DTIA 3OYDA 4IUQA 1GRIA 1ZUKA 4PFPA 5GAOp 4C5GA 1V1CA 4PJOC 4HVVA 5GMKe 1WQWA 2OX7A 2XG8D 1BI3A 1ZHIA 3KBGA 3REBB 2GBQA 4RTWA 3IQLA 4PJOF 1Q7YR 1VQOT 1K9MC 3OYBA 1YCSB 4E7IA 3VS6A 2CKKA 4OMLA 3HFNA 4ORZA 3LGLA 3CCQA 3CC2T 2G3RA 2QTVA 4J6XA 2YT6A 1D09B 4KH0B 4E7ZA 2OI3A 2GGRA 2D6FA 2A37A 3UPUA 3CMAT 4C8QC 2RHIA 3R6NA 2YRCA 1VQLQ 2SRCA 2HL5C 4O6JA 3HL8A 2GTOA 1LVKA 3EG3A 2V1QA 5HK0A 1RAHB 4C92E 4C8QF 1WFWA 3G71A 4RCBA 1KQSP 5M9OA 2A36A 3NGPA 4B6MA 3A8HB 2DXCA 3RDVA 3T9NA 5IXBA 2KT8A 1MGQA 1BIBA 2VXEA 1U06A 3MEWA 3QWYA 1VQ9T 5CKBA 3AT1B 2AZSA 3GPLA 2DFUA 2HSPA 3CC7A 3GNGA 2QEXT 1I0CA 1Q82U 4J7IA 3SWNB 4EMGA 1E7OA 4M77G 5LJ3d 3OYAA 3V8LA 1SEMA 2DK3A 4BY6B 2CSIA 4WTOB 3QDRB 1JJ2A 3CD6Q 3QJ6A 2ED0A 2LCLA 4J9CA 2EAYA 2RA2A 1JXMA 1H3ZA 4Z02A 4OMNA 3G6ET 2QASA 5GMKh 4FSXA 4DOVA 1G3TA 1VQOA 1RAEB 2EPDA 1T3LA 2MI6A 1OEBA 2XKOC 3CC2A 4OGCA 4OMPA 3EFOB 1Y57A 4F16A 1UEBA 1SSFA 2QQAA 2KBTA 1N8RR 2EW3A 1MHNA 5L23A 3CC4A 5FRMA 2PZ1A 2KMTA 4C0DB 2L3QA 2KQWA 1HSQA 4II1A 1DJ7B 3M55A 5FU7B 3VS7A 5C6SA 3CCVQ 4XU3A 4L5GA 3EG9A 3VS4A 1F1BB 2LT1A 4F7UA 3CCSQ 2PVOB 2EQKA 2K3XA 2B86A 2CP7A 2KK4A 1KD1C 4PJOG 5GAMd 3HRSA 3MCAB 2E5KA 2ZCFB 4M75A 3GP8A 1VQ6T 4J8OA 2BIVA 2LQ8A 2LCSA 3UF4A 2JTFA 2EYQA 4IUPA 5KYUA 3P8HA 1M27C 1T0HA 2K2VA 2A3LA 2CT3A 2QEXA 1RL2A 3OMGA 1PD0A 1AD5A 1JO8A 3E1SA 3EH1A 1VA7A 2VYTA 1U5SA 5FLXE 4IIMA 1HK9A 3I55T 2DVEA 4IUTA 2DJQA 4FYYB 2LRQA 2HMAA 5EG2A 2CP6A 3UATA 2OAUA 4M7DB 2M02A 3QYHB 3G6EA 5GJVB 5AT1B 4C8QG 1ABQA 1NEBA 3OYLA 3EGDB 1AZEA 4HCBA 3QZ9B 1RAFB 2XD0A 4XTZA 1RADB 4Z89A 5A0GA 3M53A 1SG5A 3CMEA 3CXCP 3QSUA 3O8VA 3TSWA 3M54A 4Q5WA 2W0ZA 2Y4YA 5IHNA 4FCYA 3OSVA 1YWPA 1JRIA 2GQIA 2CZ1B 2ED1A 2VUBA 2QA4T 1QVFA 2IG0A 1D1AA 3H0HA 2XDBA 1RAIB 4PJMA 5CQXA 3GF5A 1K4US 2V8KA 4KUDK 1QCNA 3JB9F 1JEGA 2ZPHB 3ZBDA 3A98A 3FJ5A 3G4SQ 3E9FA 3J81E 3TSZA 2YHTA 2CT4A 1OULA 2LC4A 1RI9A 1VQ6A 1JB0E 4J9GA 1YITT 4GLMA 2C0IA 3X26B 1VQ5A 3G1JA 1G2BA 1VQ4Q 4PL6A 3CCLT 5IHIA 3U23A 2V1RA 3VUZA 3M57A 5GAOq 3SWNC 3SFMA 4M7AA 4XTYA 1R77A 1TS9A 4JJNK 1KHCA 4C0ZA 5CVIA 4BY6C 3RKWA 2X9HA 4FYXB 1OX9A 1Q7YU 2EKOA 1M8VA 2RQTA 2HQXA 3JCMX 2R57A 3PIOA 4PJOD 5LJ3f 1TWBA 4JLIA 1NEGA 1M1KR 2E64A 2EGEA 3META 3QZ5B 3OYCA 1I4K1 2MOXA 4FU6A 1K1ZA 4K11A 4OMMA 1VQPT 3H6ZA 3ME9A 8AT1B 2HNIA 3CCRQ 2F69A 3HKSA 4LDYA 3CPWA 4BE2A 1TTHB 3VS3A 3JB9I 3HSBA 4MMKA 4C0DC 2C0TA 3EHQA 1YNZA 3OS2A 1M4ZA 5FU7C 3HRUA 2FPDA 1WHMA 1G3WA 4A4HA 4RTVA 3QWXX 1ZA2B 4C8QD 4L59A 2NUZA 4DBQA 2XMFA 3JAME 2F2WA 4ZGJB 2EIFA 3SD4A 1PNJA 4M77B 2CDTA 1WZOA 3DLLA 4V2SA 2DD5A 1YITA 2XU8A 4ESRA 5CKHA 1VQNQ 1O75A 1PRMC 1R0BG 2E65A 3CCLA 5GAMf 4BE0A 1T3SA 2DMOA 1PKTA 2E5QA 2VGMA 3M0SA 4FYWB 1M9SA 1WI7A 5KE2A 2LZ6B 2QQ9A 4F7UE 2RQUA 2KYBA 1B07A 1Q95G 2D8JA 1TXQA 3MEUA 2DRMA 3HFOA 2OTLQ 2EJ9A 4M7DC 5AYFA 1D1BA 4EDUA 4E7SA 1VQ7Q 2M1HA 3JRZA 8ATCB 2P0KA 4LDXA 2DZ9A 5LJ3h 4C92G 2F1LA 1N8RU 2JMAA 1VQ8T 1Q81C 4M7DF 7AT1B 4ATOA 1VQPA 4NOYA 1PSEA 1BKBA 1VYVA 1VQMT 4J9HA 2KAFA 1QKXA 5IHKA 3H0FA 2CREA 1R8OB 5GANg 2BZYA 2K5IA 3CCMT 1WQ7A 2F2XA 3MJXA 1NJIR 1X6BA 2HEQA 3HHTB 1MMNA 3HP9A 2W10A 3QJYA 1K0SA 3GBQA 2ZGWA 3LW5E 3MHXA 2JM8A 2YDLA 4KGZB 2X4WA 2EQMA 1K8AC 1Y7XA 4BE1A 4LXCA 3JB9J 3I56T 5GAOn 2RN8A 2DERA 1LOJA 2DL3A 2RPNA 2LNHB 2AKKA 3PVQA 3M4GA 3M56A 3REAB 2JOYA 4DBFA 2BZXA 1PKSA 3FIFA 3OY9A 2DX1A 3J80E 5GANe 1VQLA 2DTOA 2CZ6B 1TG0A 5FW9A 1SRMA 1VIFA 2CS7A 3OS1A 1I1JA 3EG0A 3MP1A 5A0LA 4PJJA 1N5ZA 4IIOA 1JJ2P 5HK3A 1E6HA 3RKXA 4M78B 2NUPB 2ROLA 1YIJQ 2EYXA 2K3BA 3FJPA 3S3MA 1ZA1B 5LJ5j 3CCMA 2R5AA 2KDSA 4M7AE 1YJWQ 3NMZC 2AHJB 3MEVA 1I5OB 5HCKA 1OX8A 4C5HA 3QKJA 1S72Q 3NTIA 3X28B 4IURA 3I56A 3CCQT 5CAIA 4NL2A 1M1GA 1U1SA 2Y4XA 4M7DG 2WACA 4NL3A 1PM3A 4OMQA 4M77F 2IVWA 1JXOA 5FU6C 2EVRA 1AWJA 2COYA 4DQ2A 4BI3A 1NBEB 4XAXB 1W2BS 4FIBA 4KGVB 4FL6A 2HBWA 1K9AA 3G71T 3CCSA 1W4SA 1M1KU 5GANh 2NUTB 2CH4A 2CP3A 2LQKA 1QLYA 1QW1A 2X3XD 4M75C 3H0IA 5LJ5e 3GNFB 2NYSA 2JW4A 2ZAEA 1RAAB 4DOWA 4N0AA 3JV3A 3NFCA 2RM4A 4LE9A 4PLLA 5KYYB 5DLQE 5KE3A 2FYKA 1YJ9Q 3EH2A 1KG1A 2L3SA 3QHSA 2RK2A 3BW1A 1H92A 4AFZC 1UB4A 1QP3A 1WA7A 1UGVA 2R58A 5IAYA 2MIOA 1OPLA 1H8KA 1M5Q1 1M90C 4A54A 2DXUA 2DL4A 1ZSGA 1NG2A 1I8FA 3NTKA 3VYHB 2MK5A 5KCOA 1V29B 2NLUA 3A5ZB 5GAN6 3JB9H 4ME7A 3L42A 1ZBJA 5ECAA 1XJWB 1QVFP 2F5TX 3OYFA 3NHNA 2M0YA 2VASA 3CC4T 2DPPB 2O9SA 2J06A 1WHHA 1CSKA 1R0CB 1YI2Q 3LX7A 2KGTA 3FRNA 5KCHA 2CZ0B 5FROA 3C4SA 2L3RA 1TH7A 4C92B 1YHQQ 2DIQA 3BDUA 4OB2B 1D0XA 1BK2A 1FMVA 3L2VA 1JBMA 4JRPA 3G4SA 2P0QA 4Z8AA 1PWTA 1D0YA 1MMDA 2LQWA 3CBMA 3CEYA 2QQSA 3HPWA 2RJFA 2RI5A 4J5YA 5D7UA 3DLMA 3C95A 4M7DD 1EZZB 3L2ZA 1S1NA 2QK0A 5KYWA 1NLPC 4JUVA 1NJIU 4M78C 2LDMA 1VQ4A 4E7HA 2CP0A 4M7AC 1JJ2S 4PJNA 3VRZA 4M78F 2LX7A 1WGSA 2QDYB 2J6OA 4F04B 4FT4A 1AWOA 2L5QA 3EGXA 2CUDA 4B9WA 4FSSA 4F7UG 3S6WA 3CPWP 3OW2S 4FW2A 4J9BA 3CMET 1Q86R 1KC8C 2E6NA 1YJNT 1B7TA 5GAOr 2KXDA 2HAXA 2YUNA 2X4JA 4LDWA 1ZX6A 4M75G 2K57A 1I07A 1TU0B 5KYXA 3LLRA 4JS4A 3PNWC 3INZA 3CCRA 4P5NA 1UGSB 3PT9A 1K76A 2JZ2A 2EJGA 1M3CA 2M9UA 4DEYA 4OB3B 4C5IA 5IN1A 3TVTA 1B34B 4FT2A 1OZ3A 2VKNA 2RH2A 1VQ5T 3M0TA 2HKNA 2RK1A 2ATCB 2G6FX 1BIAA 1LJOA 3KUFA 4ZGEB 1WHKA 3RMSA 1Y71A 1AWXA 3TREA 4MDWA 1G83A 3FB9A 1AZGB 1FMWA 1UJ0A 1IHVA 1E6GA 3QUIA 2MCNA 1LPLA 4JLGA 3CCET 1QCOA 2WSFE 5FWBA 3VS0A 2OTLA 3SHWA 2KROA 1ZSZB 2BTTA 1VQ7A 1YJNA 4PJOA 1IREB 2RNAA 2PNIA 2J6FA 2EFIA 3QXEB 4JJDA 2VGNA 3S3OA 2DO3A 4M77D 3OBWA 3C0CA 1K9MR 3WVDB 2DTHA 1Q82C 2PVDB 4MDXA 4RG2A 2DM1A 1D3BA 1WNLA 4M78G 1YJWT 5CQYA 5LJ3j 1QMCA 5GMKl 4C92C 2FZKB 4M7AG 1QWEA 2K5LA 2LTOA 1QVGA 1QCFA 6AT1B 4C92F 2ZPBB 4C8QA 1WX6A 4PLIA 2D9TA 3UDCA 4WCIA 2GFUA 3P8BB 2K9GA 5CKFA 1GCPA 1P92A 1X69A 5GANd 4JJCA 2EGCA 1KQSS 1MNEA 2EBPA 3C94A 1M2VB 1OQKA 3V7RA 1GBRA 2HDAA 1ZLMA 1TUCA 2FPFA 2MMPA 3BFMA 5I11A 2YRDA 4GLKA 1PSFA 1AVZC 5GMKi 3M0RA 4D8DA 4OMFB 2P4TA 2K2MA 2C0OA 2M16A 4MZPA 4A4EA 3VS2A 4MMLA 1GL5A 2NUPA 2QQBA 2EWNA 3CCEA 4UC4A 1SHGA 2O31A 3JSCA 1SSHA 1X2QA 4EMKA 2RI2A 2PUOB 2FHDA 1C6VX 1BI2A 2O9VA 5GAMj 4LDVA 3LWIA 2E4HA 1VQOQ 1VUBA 1N6AA 2MF2A 2OAWA 1M3AA 2HL3A 5FWCA 4E7JA 3JCMP 5J39A 4QQGA 2VVKA 1YIJA 1ZUYA 1GXIE 1YJ9T 3CC2Q 1ARKA 4F17A 1X27A 3SDZA 2P4RA 4ZNXA 2EQIA 3DB3A 4R56A 4KULA 2MPXC 3L1AA 1YJWA 3RR6A 1YP5A 2YXYA 1XOVA 1PHTA 4BDYA 1IGQA 3CMAQ 3QIIA 2FVUA 1Y96A 1IB8A 1S72A 2H3EB 1NYFA 2RJDA 4KH1B 2JN0A 1EIFA 5FU6B 2V8JA 4JS5A 1MNDA 1GFCA 2XDPA 1SRLA 1QQJA 1UE9A 1KD1R 2LJ3A 3L2UA 3EG2A 3EG9B 1UTIA 2EJFA 3LH0A 1I81A 2HZYA 4F7UB 1VQ9Q 1OV3A 3Q1JA 2HKQB 2BUDA 4M77E 5LJ5d 3MEAA 4M78D 1BI1A 1VYTA 1VQLT 3A8OB 1RABB 3UWNA 4M75B 3MO8A 1Q86U 1TSFA 1D1CA 5KYUB 2F2VA 3WVEB 4MZTA 3OYEA 4E6RA 2OJ2A 4CI0C 4RG8A 2COWA 3VS1A 2DBKA 2KE9A 1ZSZC 3OSSC 3OS0A 1GCQC 3OYNA 3L2WA 2RD1A 1IRXA 3FDRA 1M3BA 3EGUA 1NPPA 3PMIA 1WJSA 1KK7A 3CXCS 1VQKQ 1YJ9A 2OTJQ 3PIPA 4HA8A 4HVWA 1W6XA 1ZBXA 3CD6T 1N9RA 5I21A 2VWFA 2O4XB 3GOXA 3M5AA 1U3OA 4KUIA 4N4IA 1Q7YC 2LQNA 1G8XA 1RUWA 2KVQG 2YUPA 3EFSA 2JM9A 2KNBB 2IIMA 4JRIA 3TEEA 2BZ8A 2WSEE 4A4KA 4PJOE 3E19A 4JZ3A 1CKBA 3OQ5A 2EYZA 1KJWA 3D7SB 4PK4A 1GFDA 3J7AF 1EX4A 4RTYA 2DAQA 1WJRA 1VYUA 2K5FA 3VJPA 2PTKA 5GMKm 5A0DA 4ZN3A 3CCVT 4J6WA 2VC8A 1X01A 1SF9A 5GANf 1TOVA 3CCST 5CKEA 3MP6A 1BB9A 4LUEA 2RMOA 4BDZA 3RUXA 3SWNA 4ZN1A 3I55Q 2L89A 4C8QE 2KRMA 4HT9A 2L8DA 2I2LA 3V8JA 4CRIA 2Y90A 1LNXA 3ULRB 2DLPA 1K9MU 2M51A 4M7AB 3CBOA 1XTDA 3PGGA 3BDLA 2JTEA 3JCMg 1EFNA 4D6WA 3PTAA 2M0OA 3I5SA 2D0QB 1X2KA 4GY5A 4BUGA 1UGPB 2CYZB 3CD6A 1JU5C 2MWOA 3EFOA 5LJ5g 4RMOA 1WXUA 3QBYA 1N27A 1NM7A 2QA4Q 4XTUA 5GAOl 5KYNA 3V7CA 3PFSA 2HBPA 4C92D 2FPEA 1RLPC 1K73R 4ELZC 3AHUA 4XTVA 2O88A 1ZQ1A 2VB6A 4XU0A 3QDFA 3CCUQ 1N8RC 4CC7A 4RTTA 1A0NB 2RHUA 2DYIA 4MZMA 2HSEB 2DETA 4PFOA 2RHZA 2D0NA 3EG1A 4J6YA 5GMKj 1YITQ 3CCJQ 2KYMA 3ZL7C 4QVZA 3CCVA 3RKYA 1AEYA 5I2MA 1KFZA 4RUGA 4B9XA 2HCKA 3MP8A 3CCLQ 1CKAA 3JCMe 3ASKA 4RTUA 4EIKA 1NE8A 1BU1A 4QVDA 3G4ST 4F7UF 3GLXA 3JCMW 2YUQA 1W2BA 3CPFA 2E3HA 5GJWB 3P8DA 3A8GB 3TQ7P 4LDUA 1V76A 1G3SA 2AK5A 1YWOA 3KXTA 3S3NA 9ATCB 2CZ7B 3NPFA 4M75F 1WLPB 1BCOA 2XK0A 1VQ4T 4M7DA 3RIRA 5HKCA 4AG2C 1ZUUA 3EGDA 5GAN4 5D6YA 1QKWA 4QQ6A 1VQPQ 2LVMA 1Q81R 2FO0A 1WPYA 4BI8B 4AFQC 4KRTA 3JCMb 4R55A 2PQWA 5J26A 4J9FA 3NTHA 4N4HA 2RQVA 4LNPA 4YTLA 4JRQA 2DZCA 4A53A 5HY6A 2CH4W 5DM7R 4ZTJA 4JZ4A 4EPCA 2D1XA 1KD1U 3VV0A 3OS5A 1K8AR 4X1VA 1C1AA 3CCRT 3QYGB 1QVGP 1UG1A 2A7YA 1NPRA 3QPHA 2DE0X 4HCKA 1Y0MA 4BI4A 2X4YA 2CP2A 4NS5A 2LX9A 1PRLC 4D8KA 1AHJB 2NWMA 4C0GA 3TU4K 2PU9B 4OP0A 3H8ZA 3X24B 3V7SA 2L3PA 2RF0A 2LP5A 1FYNA 4LD9K 3EFRA 3FLGA 2CP5A 3JCMh 1M2VA 4BB7A 2L2PA 2PUKB 1ABOA 3OYYA 4TVRA 3RESA 1X75C 2A0FB 2YLCA 5GAN7 1YFNA 5LJ5h 5CK9A 1YCYA 2HD0A 1VQNT 2PVGB 1FXXA 3UA7A 1QP2A 1UDLA 1X43A 5D6WA 1VQ8Q 1WJQA 3CBPA 4X34A 4IUVA 1K0XA 1VQMQ 2VV5A 2CSQA 4M7AF 2BE9B 3A8LB 5EC7A 2EYYA 3CCMQ 4ZTFA 4HCCA 4AFUC 2OTLT 4E7KA 2JTMA 2GTJA 1M1KC 4R0KA 1OOTA 2LT4A 4AT1B 1VQ7T 2AIRB 4EMKC 3M0UA 2QTXA 1OPKA 4KBMB 4ZGDB 3JCMQ 4FYVB 5DY9A 2QGFB 3OYIA 2EQJA 4J9DA 3DKMA 4GBQA 4JRKA 4A63B 2FRWA 1VIEA 2RJEA 3I56Q 1JQQA 5IT9E 3VRYA 3PMTA 2F5KA 5CKDA 3OW2A 1B3QA 4QVCA 4M77A 1VQKT 1U8RA 2OTJT 3GIBA 2DXBA 4LD6A 5GAOm 2K79A 3QG1A 2MYSA 1RLQC 1W1FA 3CQTA 2LJ1A 2RI3A 2B8AA 4M4ZA 3FC3A 2KR3A 2R5MA 3KFVA 1MUZA 3CMAA 3A8MB 4QKUA 1FMKA 5J3BA 2KSSA 2LMJA 4DA4A 3H9NA 2DNUA 2J7IA 1OYXA 2ZPIB 3I35A 1VQNA 2K6DA 1QWFA 4OF1A 1UHCA 2QYZA 1XNIA 2AT1B 2A28A 2KY9A 1VQ9A 1HD3A 2EYWA 4X9CA 3M9QA 4AG1C 5I22A 2SEMA 1UGRB 3HTRA 1K73U 2ZPFB 2LCCA 2XHCA 4FM4B 1HJDA 2DL8A 1UJYA 1RI0A 2QI2A 2A08A 1WHLA 2CGHA 3WXMB 1WXTA 2E41A 1M90R 2D8HA 2YLBA 2XICA 1SHFA 4IKFA 1Z9QA 3LH5A 4JJBA 2COZA 3H41A 1YIJT 2ABLA 2L0AA 3I9QA 4M7DE 2O4XA 3CCQQ 3SB2A 4CC2A 1QVFS 2RO0A 1NJIC 2IPOB 2FRYA 2XI9A 2V8IA 1VQKA 2OTJA 4OVAA 1MMAA 2J05A 2RQRA 4A4FA 2DVJA 2ESWA 3VUBA 2E10A 4IUUA 2DYBA 4XQ3A 1QVGS 1RAGB 1S72T 5LJ3g 3R6OA 2JJ9A 1I5LA 5CO7A 3G71Q 4M75D 3RMQA 2QG9B 3M0PA 3CCUT 1IXDA 2X3WD 1H3HA 4ANJA 1Q81U 2XDDA 2O2OA 1WHJA 5CIUA 1O9SA 2DL5A 3UA6A 4HKEA 5IXFA 4PNOA 3CCJT 3CC7Q 2RHYA 3ZEHA 4J7FA 1UGQB 3OYGA 2X35A 1NZ9A 4PJLA 1TUGB 2LNVA 2FEIA 1KQSA 1UECA 4CC4B 4LN2A 4LUDA 4M78A 1J3TA 4J9IA 2X51A 4XU1A 1WXBA 4RCCA 2AKLA 1GBQA 4OGEA 2AZVA 1MV3A 5KYWB 3I55A 1K8AU 4Y28E 3ZFJA 2I0NA 5I2SA 1IGUA 2RJCA 3EAEA 5LJ3e 3CPWS 2DA9A 4A4GA 4AFSC 3M59A 3VS5A 1KC8R 4XU2A 3VYGA 2KI7A 1M8MA 4J9EA 5GAMg 2RQWA 1ACMB 3CC4Q 3EGXB 2QDLA 5CR2A 3MPUB 3C12A 3PVLA 4RKUE 3OYKA 1M2OA 2DJZA 4Z88A 4XTWA 3TCJA 1X6GA 2KXCA 4F14A 2QA4A 2FB7A 3LYIA 1K73C 2H3JA 4KT0E 2JMCA 4VUBA 4J83A 2Z0WA 3OYHA 1WDXA 3EHRA 5D6XA 2QAZA 2QGGA 5KYXB 2EQUA 5CCAA 3JCMd 4OB0B 1HXDA 1QVPA 2K4YA 3CCUA 2RB6A 4C0FA 2K7AA 1YI2T 2GNCA 3QO3A 2NUTA 1W2BP 1SKUB 4FW1A 2FZCB 3CCJA 3UT1A 2QEXQ 3O5ZA 2MAMA 3JCMc 1YHQT 1G3YA 4M7AD 1TUDA 2GF7A 1M30A 1C0MA 5GAMe 1VOMA 3A1PA 2EGAA 2FL7A 5KYYA 4XK8E 2ZPEB 2GQVA 1WHGA 2YWWA 2QXFA 1OU9A 1IHWA 4CC3A 2JS0A 1AWWA 3M4YA 4PFZA 2JNGA 1Z9ZA 3G6EQ 1OZ2A 4N0AC 1BBZA 4Y91A 3THKA 2GFAA 3JB9G 2JXBA 2BE7D 3M0QA 4E2FB 1BCMA 3CMEQ 2YUOA 1YJNQ 4QQDA 5GANj 4M75E 4DEXA 2DD4A 4EMHA 3HRTA 2DIGA 1U1TA 1IZ6A 3OBYA 1NLOC 4O5VA 1XQHA 1WYXA 1N9SA 1Q82R 1MMGA 5KH6A 5LL6S 2E12A 4PJOB 4ELYC 1FWZA 3CXCA 5FRNA 2H8HA 2DL7A 1HYOA 4QT7A 4RTXA 1WIEA 1UUEA 1D0ZA 4C92A 1NYGA 2DILA 3RNJA 2VXFA 3URGA 2KT1A 1D3BB 4Y92A 1VQ6Q 1YI2A 3ER0A 5GAN5 1LCKA 3OA6A 1IO6A 2ZZDA 1VQ5Q 1UHFA 1YN8A 1Y07A 4DBHA 1PCXA 1YHQA 1KHIA 3LWHA 1T0JA 4BD3A 2YRVA 2DXTA 4C8QB 2CUBA 3N5BB 2WSCE 4HXJA 1M90U 5GAMh 5GAN8 3V8KA 2HQEA 1KQ1A 3OYJA 2J6KA 4WF2A 1X6OA 4HT8A 4C5EA 4JDSA 5L8RE 2E70A 2P0PA 3M58A 3CCEQ 2KRNA 4PKCC 2DRKA 4E47A 2JUFA 1KSWA 2K3YA 2QQRA 2MWPA 5IH2A 1BYMA 5GAN2 4XTXA 4QW2A 1PC0A 4E7LA 2C06A 2X4XA 4RTZA 1VQ8A 1KQ2A 4N4GA 2DEUA 2V26A 3OMCA 4OMOA 1VQMA 1OU8A 3G7ZA 5DLOA 5GAN3 1M1FA 4M78E 2JT4A 4EMKB 2E6ZA 2DEQA 3F70A 4HCZA 2XIDA 3OW2P 2KRSA 1Q86C 3VKIA 2E3IA 3JCMJ 1MV0B 1AOJA 4OB1B 1BI0A 2BKDN 3JB9D 2E1HA 5C0MA 4JPBW 2ROTA 1KIKA 2KEAA 2GCXA 4M77C 3L2RA 2DKGA 1SPKA 3I5RA 2ZPGB 3E9GA 2FG0A 1B34A 3RERA 1FX7A 1PD1A 3JCMf 1Y96B 3X25B 3X20B 1H641 3PE0A 3SEMA 3E2UA 3OYMA 4KGXB 1RACB 2ECZA 3DB4A 3FEOA 2RHXA 1PG5B 2YSQA 5LJ5f 3JCMV 2O01E 1OI1A 3LGFA 2ENMA 2DF6A 2JVVA 5A2QE 2HQHA 1G5VA 2JS2A 3OB9A
chains in the Genus database with same CATH topology
3VRYA 1AVZC 3RBBB 2JM8A 2YDLA 3M0RA 1B3QA 4D8DA 2K2MA 2C0OA 2LJ0A 2DBMA 3VS2A 1GL5A 2RN8A 2K79A 1GCQA 1RLQC 1SHGA 1UFFA 1W1FA 2DL3A 2EKHA 2O31A 2LJ1A 1SSHA 2LNHB 2AKKA 2RPNA 1X2QA 2KR3A 1W70A 3PVQA 4M4ZA 3KFVA 1MUZA 2O9VA 3REAB 4HVUA 1GRIA 1FMKA 2LMJA 1ZUKA 2OAWA 1M3AA 2DNUA 2J7IA 1V1CA 5FWCA 4HVVA 2BZXA 2VVKA 1PKSA 3I35A 1ZUYA 2K6DA 1QWFA 1ARKA 4F17A 1UHCA 2DX1A 1X27A 3REBB 2GBQA 4RTWA 3IQLA 2P4RA 4ZNXA 1TG0A 2EQIA 5FW9A 1SRMA 1YCSB 2A28A 3VS6A 1HD3A 4OMLA 1I1JA 1YP5A 2EYWA 3EG0A 4ORZA 4AG1C 1XOVA 1PHTA 5I22A 1N5ZA 2SEMA 4IIOA 2YT6A 2OI3A 1E6HA 1NYFA 1HJDA 2GGRA 2DL8A 2ROLA 1UJYA 2A37A 2EYXA 2K3BA 2A08A 1WXTA 2D8HA 1GFCA 3R6NA 1SHFA 1SRLA 1UE9A 2SRCA 1Z9QA 2LJ3A 3LH5A 2GTOA 4JJBA 3EG2A 3EG3A 1UTIA 2V1QA 3H41A 3NMZC 2ABLA 2L0AA 3I9QA 1WFWA 1OV3A 2A36A 4CC2A 3NGPA 1VYTA 5IXBA 2FRYA 5HCKA 2KT8A 2J05A 1U06A 2RQRA 3QWYA 2DVJA 2ESWA 2AZSA 2HSPA 2DYBA 2F2VA 1I0CA 4E6RA 2OJ2A 1E7OA 3VS1A 2DBKA 2KE9A 4OMQA 1SEMA 1GCQC 2CSIA 1JXOA 2EVRA 1AWJA 1M3BA 3EGUA 2ED0A 4J9CA 3M0PA 1JXMA 2X3WD 4OMNA 2HBWA 1H3HA 1K9AA 4HVWA 2O2OA 1W6XA 3UA6A 2DL5A 5IXFA 2EPDA 2VWFA 2CH4A 1U3OA 1T3LA 1OEBA 1QLYA 4OMPA 2FEIA 2LQNA 1UECA 1Y57A 2X3XD 4CC4B 1RUWA 4F16A 4LN2A 4LUDA 2KBTA 2YUPA 3H0IA 2EW3A 2JM9A 5L23A 2KNBB 2IIMA 2JW4A 1J3TA 4J9IA 2BZ8A 2PZ1A 3JV3A 1WXBA 2L3QA 1HSQA 4LE9A 3VS7A 4JZ3A 2AKLA 1CKBA 2EYZA 1GBQA 1KJWA 2AZVA 1MV3A 2L3SA 3VS4A 1H92A 4AFZC 1GFDA 1WA7A 2I0NA 4RTYA 1UGVA 2MIOA 1VYUA 1OPLA 1H8KA 2B86A 2PTKA 2DA9A 4AFSC 2DL4A 1ZSGA 1NG2A 3VS5A 1M8MA 4J9EA 2E5KA 2RQWA 2QDLA 2LCSA 1BB9A 4LUEA 3PVLA 3UF4A 1ZBJA 5ECAA 2RMOA 1M27C 1T0HA 3NHNA 2CT3A 4Z88A 2M0YA 1AD5A 2KRMA 1JO8A 1X6GA 2KXCA 4F14A 2O9SA 2J06A 1VA7A 1CSKA 2JMCA 3ULRB 2DLPA 1U5SA 2KGTA 1WDXA 3EHRA 2M51A 4IIMA 2JTEA 2DJQA 3UATA 1EFNA 5GJVB 2K7AA 2GNCA 1ABQA 1NEBA 3I5SA 1X2KA 1AZEA 1BK2A 1JU5C 4Z89A 3O5ZA 4Z8AA 1WXUA 1PWTA 2LQWA 3TSWA 1TUDA 1NM7A 1M30A 2W0ZA 2FPEA 1RLPC 2EGAA 5IHNA 1S1NA 1YWPA 2O88A 1NLPC 2GQIA 2ED1A 4CC7A 4CC3A 4RTTA 2JS0A 1AWWA 1A0NB 1Z9ZA 1BBZA 3H0HA 3THKA 2JXBA 2D0NA 3EG1A 3VRZA 3M0QA 1K4US 2LX7A 2KYMA 1JEGA 3A98A 3FJ5A 3ZL7C 2YUOA 2J6OA 1AEYA 3TSZA 1AWOA 4DEXA 1KFZA 2CT4A 4RUGA 2CUDA 2HCKA 4FSSA 1RI9A 1CKAA 4J9GA 4RTUA 4EIKA 1BU1A 4GLMA 4J9BA 2C0IA 2YUQA 1NLOC 1WYXA 1G2BA 5GJWB 2KXDA 2YUNA 2AK5A 1YWOA 5IHIA 3U23A 2V1RA 1ZX6A 2H8HA 3NPFA 2DL7A 1I07A 4QT7A 4RTXA 1WLPB 1WIEA 1UUEA 1NYGA 2DILA 3RNJA 4AG2C 1ZUUA 2KT1A 1K76A 3CQTA 2RQTA 1QKWA 4Y92A 2FO0A 1LCKA 4AFQC 4KRTA 1IO6A 1NEGA 1M3CA 1UHFA 2EGEA 1YN8A 4DEYA 2MOXA 4J9FA 1K1ZA 4K11A 2RQVA 4LNPA 4OMMA 3TVTA 1T0JA 2VKNA 2CH4W 2CUBA 4JZ4A 3M0TA 4HXJA 3VS3A 2D1XA 2G6FX 2J6KA 2C0TA 3EHQA 1YNZA 4X1VA 2FPDA 1AWXA 1G83A 2KRNA 4RTVA 1UG1A 1AZGB 2DRKA 3QWXX 2DE0X 4HCKA 1KSWA 2NUZA 1Y0MA 2XMFA 1UJ0A 1E6GA 2F2WA 5IH2A 1PNJA 2MCNA 2CDTA 1PRLC 4D8KA 2NWMA 4RTZA 5FWBA 3VS0A 4OMOA 3SHWA 2L3PA 2KROA 2RF0A 2LP5A 1FYNA 2BTTA 4ESRA 2L2PA 2JT4A 1ABOA 1PRMC 2RNAA 2PNIA 1T3SA 2DMOA 2J6FA 2KRSA 4JJDA 1PKTA 3C0CA 3M0SA 3UA7A 1MV0B 1AOJA 1WI7A 2DM1A 2LZ6B 1UDLA 2RQUA 1X43A 2KYBA 1B07A 2D8JA 4JPBW 2ROTA 2DRMA 1K0XA 1KIKA 2KEAA 1QWEA 2CSQA 1SPKA 3I5RA 1QCFA 2FG0A 5EC7A 2EYYA 2JMAA 1WX6A 4AFUC 4WCIA 1VYVA 2GTJA 4R0KA 1OOTA 4J9HA 2K9GA 1GCPA 3PE0A 3SEMA 1X69A 1QKXA 5IHKA 2ECZA 3H0FA 2CREA 3M0UA 4JJCA 2EGCA 2EBPA 1OPKA 2BZYA 2F2XA 2YSQA 1GBRA 2HDAA 2ENMA 1ZLMA 2DF6A 1X6BA 2HEQA 1TUCA 4J9DA 2FPFA 4GBQA 4A63B 5I11A 1K0SA 2W10A 2FRWA 2JS2A 3GBQA 1JQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRY A;  1AVZ C;  3RBB B;  2JM8 A;  2YDL A;  3M0R A;  1B3Q A;  4D8D A;  2K2M A;  2C0O A;  2LJ0 A;  2DBM A;  3VS2 A;  1GL5 A;  2RN8 A;  2K79 A;  1GCQ A;  1RLQ C;  1SHG A;  1UFF A;  1W1F A;  2DL3 A;  2EKH A;  2O31 A;  2LJ1 A;  1SSH A;  2LNH B;  2AKK A;  2RPN A;  1X2Q A;  2KR3 A;  1W70 A;  3PVQ A;  4M4Z A;  3KFV A;  1MUZ A;  2O9V A;  3REA B;  4HVU A;  1GRI A;  1FMK A;  2LMJ A;  1ZUK A;  2OAW A;  1M3A A;  2DNU A;  2J7I A;  1V1C A;  5FWC A;  4HVV A;  2BZX A;  2VVK A;  1PKS A;  3I35 A;  1ZUY A;  2K6D A;  1QWF A;  1ARK A;  4F17 A;  1UHC A;  2DX1 A;  1X27 A;  3REB B;  2GBQ A;  4RTW A;  3IQL A;  2P4R A;  4ZNX A;  1TG0 A;  2EQI A;  5FW9 A;  1SRM A;  1YCS B;  2A28 A;  3VS6 A;  1HD3 A;  4OML A;  1I1J A;  1YP5 A;  2EYW A;  3EG0 A;  4ORZ A;  4AG1 C;  1XOV A;  1PHT A;  5I22 A;  1N5Z A;  2SEM A;  4IIO A;  2YT6 A;  2OI3 A;  1E6H A;  1NYF A;  1HJD A;  2GGR A;  2DL8 A;  2ROL A;  1UJY A;  2A37 A;  2EYX A;  2K3B A;  2A08 A;  1WXT A;  2D8H A;  1GFC A;  3R6N A;  1SHF A;  1SRL A;  1UE9 A;  2SRC A;  1Z9Q A;  2LJ3 A;  3LH5 A;  2GTO A;  4JJB A;  3EG2 A;  3EG3 A;  1UTI A;  2V1Q A;  3H41 A;  3NMZ C;  2ABL A;  2L0A A;  3I9Q A;  1WFW A;  1OV3 A;  2A36 A;  4CC2 A;  3NGP A;  1VYT A;  5IXB A;  2FRY A;  5HCK A;  2KT8 A;  2J05 A;  1U06 A;  2RQR A;  3QWY A;  2DVJ A;  2ESW A;  2AZS A;  2HSP A;  2DYB A;  2F2V A;  1I0C A;  4E6R A;  2OJ2 A;  1E7O A;  3VS1 A;  2DBK A;  2KE9 A;  4OMQ A;  1SEM A;  1GCQ C;  2CSI A;  1JXO A;  2EVR A;  1AWJ A;  1M3B A;  3EGU A;  2ED0 A;  4J9C A;  3M0P A;  1JXM A;  2X3W D;  4OMN A;  2HBW A;  1H3H A;  1K9A A;  4HVW A;  2O2O A;  1W6X A;  3UA6 A;  2DL5 A;  5IXF A;  2EPD A;  2VWF A;  2CH4 A;  1U3O A;  1T3L A;  1OEB A;  1QLY A;  4OMP A;  2FEI A;  2LQN A;  1UEC A;  1Y57 A;  2X3X D;  4CC4 B;  1RUW A;  4F16 A;  4LN2 A;  4LUD A;  2KBT A;  2YUP A;  3H0I A;  2EW3 A;  2JM9 A;  5L23 A;  2KNB B;  2IIM A;  2JW4 A;  1J3T A;  4J9I A;  2BZ8 A;  2PZ1 A;  3JV3 A;  1WXB A;  2L3Q A;  1HSQ A;  4LE9 A;  3VS7 A;  4JZ3 A;  2AKL A;  1CKB A;  2EYZ A;  1GBQ A;  1KJW A;  2AZV A;  1MV3 A;  2L3S A;  3VS4 A;  1H92 A;  4AFZ C;  1GFD A;  1WA7 A;  2I0N A;  4RTY A;  1UGV A;  2MIO A;  1VYU A;  1OPL A;  1H8K A;  2B86 A;  2PTK A;  2DA9 A;  4AFS C;  2DL4 A;  1ZSG A;  1NG2 A;  3VS5 A;  1M8M A;  4J9E A;  2E5K A;  2RQW A;  2QDL A;  2LCS A;  1BB9 A;  4LUE A;  3PVL A;  3UF4 A;  1ZBJ A;  5ECA A;  2RMO A;  1M27 C;  1T0H A;  3NHN A;  2CT3 A;  4Z88 A;  2M0Y A;  1AD5 A;  2KRM A;  1JO8 A;  1X6G A;  2KXC A;  4F14 A;  2O9S A;  2J06 A;  1VA7 A;  1CSK A;  2JMC A;  3ULR B;  2DLP A;  1U5S A;  2KGT A;  1WDX A;  3EHR A;  2M51 A;  4IIM A;  2JTE A;  2DJQ A;  3UAT A;  1EFN A;  5GJV B;  2K7A A;  2GNC A;  1ABQ A;  1NEB A;  3I5S A;  1X2K A;  1AZE A;  1BK2 A;  1JU5 C;  4Z89 A;  3O5Z A;  4Z8A A;  1WXU A;  1PWT A;  2LQW A;  3TSW A;  1TUD A;  1NM7 A;  1M30 A;  2W0Z A;  2FPE A;  1RLP C;  2EGA A;  5IHN A;  1S1N A;  1YWP A;  2O88 A;  1NLP C;  2GQI A;  2ED1 A;  4CC7 A;  4CC3 A;  4RTT A;  2JS0 A;  1AWW A;  1A0N B;  1Z9Z A;  1BBZ A;  3H0H A;  3THK A;  2JXB A;  2D0N A;  3EG1 A;  3VRZ A;  3M0Q A;  1K4U S;  2LX7 A;  2KYM A;  1JEG A;  3A98 A;  3FJ5 A;  3ZL7 C;  2YUO A;  2J6O A;  1AEY A;  3TSZ A;  1AWO A;  4DEX A;  1KFZ A;  2CT4 A;  4RUG A;  2CUD A;  2HCK A;  4FSS A;  1RI9 A;  1CKA A;  4J9G A;  4RTU A;  4EIK A;  1BU1 A;  4GLM A;  4J9B A;  2C0I A;  2YUQ A;  1NLO C;  1WYX A;  1G2B A;  5GJW B;  2KXD A;  2YUN A;  2AK5 A;  1YWO A;  5IHI A;  3U23 A;  2V1R A;  1ZX6 A;  2H8H A;  3NPF A;  2DL7 A;  1I07 A;  4QT7 A;  4RTX A;  1WLP B;  1WIE A;  1UUE A;  1NYG A;  2DIL A;  3RNJ A;  4AG2 C;  1ZUU A;  2KT1 A;  1K76 A;  3CQT A;  2RQT A;  1QKW A;  4Y92 A;  2FO0 A;  1LCK A;  4AFQ C;  4KRT A;  1IO6 A;  1NEG A;  1M3C A;  1UHF A;  2EGE A;  1YN8 A;  4DEY A;  2MOX A;  4J9F A;  1K1Z A;  4K11 A;  2RQV A;  4LNP A;  4OMM A;  3TVT A;  1T0J A;  2VKN A;  2CH4 W;  2CUB A;  4JZ4 A;  3M0T A;  4HXJ A;  3VS3 A;  2D1X A;  2G6F X;  2J6K A;  2C0T A;  3EHQ A;  1YNZ A;  4X1V A;  2FPD A;  1AWX A;  1G83 A;  2KRN A;  4RTV A;  1UG1 A;  1AZG B;  2DRK A;  3QWX X;  2DE0 X;  4HCK A;  1KSW A;  2NUZ A;  1Y0M A;  2XMF A;  1UJ0 A;  1E6G A;  2F2W A;  5IH2 A;  1PNJ A;  2MCN A;  2CDT A;  1PRL C;  4D8K A;  2NWM A;  4RTZ A;  5FWB A;  3VS0 A;  4OMO A;  3SHW A;  2L3P A;  2KRO A;  2RF0 A;  2LP5 A;  1FYN A;  2BTT A;  4ESR A;  2L2P A;  2JT4 A;  1ABO A;  1PRM C;  2RNA A;  2PNI A;  1T3S A;  2DMO A;  2J6F A;  2KRS A;  4JJD A;  1PKT A;  3C0C A;  3M0S A;  3UA7 A;  1MV0 B;  1AOJ A;  1WI7 A;  2DM1 A;  2LZ6 B;  1UDL A;  2RQU A;  1X43 A;  2KYB A;  1B07 A;  2D8J A;  4JPB W;  2ROT A;  2DRM A;  1K0X A;  1KIK A;  2KEA A;  1QWE A;  2CSQ A;  1SPK A;  3I5R A;  1QCF A;  2FG0 A;  5EC7 A;  2EYY A;  2JMA A;  1WX6 A;  4AFU C;  4WCI A;  1VYV A;  2GTJ A;  4R0K A;  1OOT A;  4J9H A;  2K9G A;  1GCP A;  3PE0 A;  3SEM A;  1X69 A;  1QKX A;  5IHK A;  2ECZ A;  3H0F A;  2CRE A;  3M0U A;  4JJC A;  2EGC A;  2EBP A;  1OPK A;  2BZY A;  2F2X A;  2YSQ A;  1GBR A;  2HDA A;  2ENM A;  1ZLM A;  2DF6 A;  1X6B A;  2HEQ A;  1TUC A;  4J9D A;  2FPF A;  4GBQ A;  4A63 B;  5I11 A;  1K0S A;  2W10 A;  2FRW A;  2JS2 A;  3GBQ A;  1JQQ A; 
#chains in the Genus database with same CATH topology
 3MKD A;  3RBB B;  3BE3 A;  1KC8 U;  2P84 A;  3L2Q A;  4AMC A;  4DBR A;  2LJ0 A;  1YBY A;  4X9D A;  4BAC A;  2DBM A;  1ZSZ A;  4L6V 5;  3CC7 T;  1GCQ A;  2EKH A;  1UFF A;  1W70 A;  1AT1 B;  3VU3 C;  3BY7 A;  2FZG B;  4HVU A;  2DTI A;  3OYD A;  4IUQ A;  1GRI A;  1ZUK A;  4PFP A;  5GAO p;  4C5G A;  1V1C A;  4PJO C;  4HVV A;  5GMK e;  1WQW A;  2OX7 A;  2XG8 D;  1BI3 A;  1ZHI A;  3KBG A;  3REB B;  2GBQ A;  4RTW A;  3IQL A;  4PJO F;  1Q7Y R;  1VQO T;  1K9M C;  3OYB A;  1YCS B;  4E7I A;  3VS6 A;  2CKK A;  4OML A;  3HFN A;  4ORZ A;  3LGL A;  3CCQ A;  3CC2 T;  2G3R A;  2QTV A;  4J6X A;  2YT6 A;  1D09 B;  4KH0 B;  4E7Z A;  2OI3 A;  2GGR A;  2D6F A;  2A37 A;  3UPU A;  3CMA T;  4C8Q C;  2RHI A;  3R6N A;  2YRC A;  1VQL Q;  2SRC A;  2HL5 C;  4O6J A;  3HL8 A;  2GTO A;  1LVK A;  3EG3 A;  2V1Q A;  5HK0 A;  1RAH B;  4C92 E;  4C8Q F;  1WFW A;  3G71 A;  4RCB A;  1KQS P;  5M9O A;  2A36 A;  3NGP A;  4B6M A;  3A8H B;  2DXC A;  3RDV A;  3T9N A;  5IXB A;  2KT8 A;  1MGQ A;  1BIB A;  2VXE A;  1U06 A;  3MEW A;  3QWY A;  1VQ9 T;  5CKB A;  3AT1 B;  2AZS A;  3GPL A;  2DFU A;  2HSP A;  3CC7 A;  3GNG A;  2QEX T;  1I0C A;  1Q82 U;  4J7I A;  3SWN B;  4EMG A;  1E7O A;  4M77 G;  5LJ3 d;  3OYA A;  3V8L A;  1SEM A;  2DK3 A;  4BY6 B;  2CSI A;  4WTO B;  3QDR B;  1JJ2 A;  3CD6 Q;  3QJ6 A;  2ED0 A;  2LCL A;  4J9C A;  2EAY A;  2RA2 A;  1JXM A;  1H3Z A;  4Z02 A;  4OMN A;  3G6E T;  2QAS A;  5GMK h;  4FSX A;  4DOV A;  1G3T A;  1VQO A;  1RAE B;  2EPD A;  1T3L A;  2MI6 A;  1OEB A;  2XKO C;  3CC2 A;  4OGC A;  4OMP A;  3EFO B;  1Y57 A;  4F16 A;  1UEB A;  1SSF A;  2QQA A;  2KBT A;  1N8R R;  2EW3 A;  1MHN A;  5L23 A;  3CC4 A;  5FRM A;  2PZ1 A;  2KMT A;  4C0D B;  2L3Q A;  2KQW A;  1HSQ A;  4II1 A;  1DJ7 B;  3M55 A;  5FU7 B;  3VS7 A;  5C6S A;  3CCV Q;  4XU3 A;  4L5G A;  3EG9 A;  3VS4 A;  1F1B B;  2LT1 A;  4F7U A;  3CCS Q;  2PVO B;  2EQK A;  2K3X A;  2B86 A;  2CP7 A;  2KK4 A;  1KD1 C;  4PJO G;  5GAM d;  3HRS A;  3MCA B;  2E5K A;  2ZCF B;  4M75 A;  3GP8 A;  1VQ6 T;  4J8O A;  2BIV A;  2LQ8 A;  2LCS A;  3UF4 A;  2JTF A;  2EYQ A;  4IUP A;  5KYU A;  3P8H A;  1M27 C;  1T0H A;  2K2V A;  2A3L A;  2CT3 A;  2QEX A;  1RL2 A;  3OMG A;  1PD0 A;  1AD5 A;  1JO8 A;  3E1S A;  3EH1 A;  1VA7 A;  2VYT A;  1U5S A;  5FLX E;  4IIM A;  1HK9 A;  3I55 T;  2DVE A;  4IUT A;  2DJQ A;  4FYY B;  2LRQ A;  2HMA A;  5EG2 A;  2CP6 A;  3UAT A;  2OAU A;  4M7D B;  2M02 A;  3QYH B;  3G6E A;  5GJV B;  5AT1 B;  4C8Q G;  1ABQ A;  1NEB A;  3OYL A;  3EGD B;  1AZE A;  4HCB A;  3QZ9 B;  1RAF B;  2XD0 A;  4XTZ A;  1RAD B;  4Z89 A;  5A0G A;  3M53 A;  1SG5 A;  3CME A;  3CXC P;  3QSU A;  3O8V A;  3TSW A;  3M54 A;  4Q5W A;  2W0Z A;  2Y4Y A;  5IHN A;  4FCY A;  3OSV A;  1YWP A;  1JRI A;  2GQI A;  2CZ1 B;  2ED1 A;  2VUB A;  2QA4 T;  1QVF A;  2IG0 A;  1D1A A;  3H0H A;  2XDB A;  1RAI B;  4PJM A;  5CQX A;  3GF5 A;  1K4U S;  2V8K A;  4KUD K;  1QCN A;  3JB9 F;  1JEG A;  2ZPH B;  3ZBD A;  3A98 A;  3FJ5 A;  3G4S Q;  3E9F A;  3J81 E;  3TSZ A;  2YHT A;  2CT4 A;  1OUL A;  2LC4 A;  1RI9 A;  1VQ6 A;  1JB0 E;  4J9G A;  1YIT T;  4GLM A;  2C0I A;  3X26 B;  1VQ5 A;  3G1J A;  1G2B A;  1VQ4 Q;  4PL6 A;  3CCL T;  5IHI A;  3U23 A;  2V1R A;  3VUZ A;  3M57 A;  5GAO q;  3SWN C;  3SFM A;  4M7A A;  4XTY A;  1R77 A;  1TS9 A;  4JJN K;  1KHC A;  4C0Z A;  5CVI A;  4BY6 C;  3RKW A;  2X9H A;  4FYX B;  1OX9 A;  1Q7Y U;  2EKO A;  1M8V A;  2RQT A;  2HQX A;  3JCM X;  2R57 A;  3PIO A;  4PJO D;  5LJ3 f;  1TWB A;  4JLI A;  1NEG A;  1M1K R;  2E64 A;  2EGE A;  3MET A;  3QZ5 B;  3OYC A;  1I4K 1;  2MOX A;  4FU6 A;  1K1Z A;  4K11 A;  4OMM A;  1VQP T;  3H6Z A;  3ME9 A;  8AT1 B;  2HNI A;  3CCR Q;  2F69 A;  3HKS A;  4LDY A;  3CPW A;  4BE2 A;  1TTH B;  3VS3 A;  3JB9 I;  3HSB A;  4MMK A;  4C0D C;  2C0T A;  3EHQ A;  1YNZ A;  3OS2 A;  1M4Z A;  5FU7 C;  3HRU A;  2FPD A;  1WHM A;  1G3W A;  4A4H A;  4RTV A;  3QWX X;  1ZA2 B;  4C8Q D;  4L59 A;  2NUZ A;  4DBQ A;  2XMF A;  3JAM E;  2F2W A;  4ZGJ B;  2EIF A;  3SD4 A;  1PNJ A;  4M77 B;  2CDT A;  1WZO A;  3DLL A;  4V2S A;  2DD5 A;  1YIT A;  2XU8 A;  4ESR A;  5CKH A;  1VQN Q;  1O75 A;  1PRM C;  1R0B G;  2E65 A;  3CCL A;  5GAM f;  4BE0 A;  1T3S A;  2DMO A;  1PKT A;  2E5Q A;  2VGM A;  3M0S A;  4FYW B;  1M9S A;  1WI7 A;  5KE2 A;  2LZ6 B;  2QQ9 A;  4F7U E;  2RQU A;  2KYB A;  1B07 A;  1Q95 G;  2D8J A;  1TXQ A;  3MEU A;  2DRM A;  3HFO A;  2OTL Q;  2EJ9 A;  4M7D C;  5AYF A;  1D1B A;  4EDU A;  4E7S A;  1VQ7 Q;  2M1H A;  3JRZ A;  8ATC B;  2P0K A;  4LDX A;  2DZ9 A;  5LJ3 h;  4C92 G;  2F1L A;  1N8R U;  2JMA A;  1VQ8 T;  1Q81 C;  4M7D F;  7AT1 B;  4ATO A;  1VQP A;  4NOY A;  1PSE A;  1BKB A;  1VYV A;  1VQM T;  4J9H A;  2KAF A;  1QKX A;  5IHK A;  3H0F A;  2CRE A;  1R8O B;  5GAN g;  2BZY A;  2K5I A;  3CCM T;  1WQ7 A;  2F2X A;  3MJX A;  1NJI R;  1X6B A;  2HEQ A;  3HHT B;  1MMN A;  3HP9 A;  2W10 A;  3QJY A;  1K0S A;  3GBQ A;  2ZGW A;  3LW5 E;  3MHX A;  2JM8 A;  2YDL A;  4KGZ B;  2X4W A;  2EQM A;  1K8A C;  1Y7X A;  4BE1 A;  4LXC A;  3JB9 J;  3I56 T;  5GAO n;  2RN8 A;  2DER A;  1LOJ A;  2DL3 A;  2RPN A;  2LNH B;  2AKK A;  3PVQ A;  3M4G A;  3M56 A;  3REA B;  2JOY A;  4DBF A;  2BZX A;  1PKS A;  3FIF A;  3OY9 A;  2DX1 A;  3J80 E;  5GAN e;  1VQL A;  2DTO A;  2CZ6 B;  1TG0 A;  5FW9 A;  1SRM A;  1VIF A;  2CS7 A;  3OS1 A;  1I1J A;  3EG0 A;  3MP1 A;  5A0L A;  4PJJ A;  1N5Z A;  4IIO A;  1JJ2 P;  5HK3 A;  1E6H A;  3RKX A;  4M78 B;  2NUP B;  2ROL A;  1YIJ Q;  2EYX A;  2K3B A;  3FJP A;  3S3M A;  1ZA1 B;  5LJ5 j;  3CCM A;  2R5A A;  2KDS A;  4M7A E;  1YJW Q;  3NMZ C;  2AHJ B;  3MEV A;  1I5O B;  5HCK A;  1OX8 A;  4C5H A;  3QKJ A;  1S72 Q;  3NTI A;  3X28 B;  4IUR A;  3I56 A;  3CCQ T;  5CAI A;  4NL2 A;  1M1G A;  1U1S A;  2Y4X A;  4M7D G;  2WAC A;  4NL3 A;  1PM3 A;  4OMQ A;  4M77 F;  2IVW A;  1JXO A;  5FU6 C;  2EVR A;  1AWJ A;  2COY A;  4DQ2 A;  4BI3 A;  1NBE B;  4XAX B;  1W2B S;  4FIB A;  4KGV B;  4FL6 A;  2HBW A;  1K9A A;  3G71 T;  3CCS A;  1W4S A;  1M1K U;  5GAN h;  2NUT B;  2CH4 A;  2CP3 A;  2LQK A;  1QLY A;  1QW1 A;  2X3X D;  4M75 C;  3H0I A;  5LJ5 e;  3GNF B;  2NYS A;  2JW4 A;  2ZAE A;  1RAA B;  4DOW A;  4N0A A;  3JV3 A;  3NFC A;  2RM4 A;  4LE9 A;  4PLL A;  5KYY B;  5DLQ E;  5KE3 A;  2FYK A;  1YJ9 Q;  3EH2 A;  1KG1 A;  2L3S A;  3QHS A;  2RK2 A;  3BW1 A;  1H92 A;  4AFZ C;  1UB4 A;  1QP3 A;  1WA7 A;  1UGV A;  2R58 A;  5IAY A;  2MIO A;  1OPL A;  1H8K A;  1M5Q 1;  1M90 C;  4A54 A;  2DXU A;  2DL4 A;  1ZSG A;  1NG2 A;  1I8F A;  3NTK A;  3VYH B;  2MK5 A;  5KCO A;  1V29 B;  2NLU A;  3A5Z B;  5GAN 6;  3JB9 H;  4ME7 A;  3L42 A;  1ZBJ A;  5ECA A;  1XJW B;  1QVF P;  2F5T X;  3OYF A;  3NHN A;  2M0Y A;  2VAS A;  3CC4 T;  2DPP B;  2O9S A;  2J06 A;  1WHH A;  1CSK A;  1R0C B;  1YI2 Q;  3LX7 A;  2KGT A;  3FRN A;  5KCH A;  2CZ0 B;  5FRO A;  3C4S A;  2L3R A;  1TH7 A;  4C92 B;  1YHQ Q;  2DIQ A;  3BDU A;  4OB2 B;  1D0X A;  1BK2 A;  1FMV A;  3L2V A;  1JBM A;  4JRP A;  3G4S A;  2P0Q A;  4Z8A A;  1PWT A;  1D0Y A;  1MMD A;  2LQW A;  3CBM A;  3CEY A;  2QQS A;  3HPW A;  2RJF A;  2RI5 A;  4J5Y A;  5D7U A;  3DLM A;  3C95 A;  4M7D D;  1EZZ B;  3L2Z A;  1S1N A;  2QK0 A;  5KYW A;  1NLP C;  4JUV A;  1NJI U;  4M78 C;  2LDM A;  1VQ4 A;  4E7H A;  2CP0 A;  4M7A C;  1JJ2 S;  4PJN A;  3VRZ A;  4M78 F;  2LX7 A;  1WGS A;  2QDY B;  2J6O A;  4F04 B;  4FT4 A;  1AWO A;  2L5Q A;  3EGX A;  2CUD A;  4B9W A;  4FSS A;  4F7U G;  3S6W A;  3CPW P;  3OW2 S;  4FW2 A;  4J9B A;  3CME T;  1Q86 R;  1KC8 C;  2E6N A;  1YJN T;  1B7T A;  5GAO r;  2KXD A;  2HAX A;  2YUN A;  2X4J A;  4LDW A;  1ZX6 A;  4M75 G;  2K57 A;  1I07 A;  1TU0 B;  5KYX A;  3LLR A;  4JS4 A;  3PNW C;  3INZ A;  3CCR A;  4P5N A;  1UGS B;  3PT9 A;  1K76 A;  2JZ2 A;  2EJG A;  1M3C A;  2M9U A;  4DEY A;  4OB3 B;  4C5I A;  5IN1 A;  3TVT A;  1B34 B;  4FT2 A;  1OZ3 A;  2VKN A;  2RH2 A;  1VQ5 T;  3M0T A;  2HKN A;  2RK1 A;  2ATC B;  2G6F X;  1BIA A;  1LJO A;  3KUF A;  4ZGE B;  1WHK A;  3RMS A;  1Y71 A;  1AWX A;  3TRE A;  4MDW A;  1G83 A;  3FB9 A;  1AZG B;  1FMW A;  1UJ0 A;  1IHV A;  1E6G A;  3QUI A;  2MCN A;  1LPL A;  4JLG A;  3CCE T;  1QCO A;  2WSF E;  5FWB A;  3VS0 A;  2OTL A;  3SHW A;  2KRO A;  1ZSZ B;  2BTT A;  1VQ7 A;  1YJN A;  4PJO A;  1IRE B;  2RNA A;  2PNI A;  2J6F A;  2EFI A;  3QXE B;  4JJD A;  2VGN A;  3S3O A;  2DO3 A;  4M77 D;  3OBW A;  3C0C A;  1K9M R;  3WVD B;  2DTH A;  1Q82 C;  2PVD B;  4MDX A;  4RG2 A;  2DM1 A;  1D3B A;  1WNL A;  4M78 G;  1YJW T;  5CQY A;  5LJ3 j;  1QMC A;  5GMK l;  4C92 C;  2FZK B;  4M7A G;  1QWE A;  2K5L A;  2LTO A;  1QVG A;  1QCF A;  6AT1 B;  4C92 F;  2ZPB B;  4C8Q A;  1WX6 A;  4PLI A;  2D9T A;  3UDC A;  4WCI A;  2GFU A;  3P8B B;  2K9G A;  5CKF A;  1GCP A;  1P92 A;  1X69 A;  5GAN d;  4JJC A;  2EGC A;  1KQS S;  1MNE A;  2EBP A;  3C94 A;  1M2V B;  1OQK A;  3V7R A;  1GBR A;  2HDA A;  1ZLM A;  1TUC A;  2FPF A;  2MMP A;  3BFM A;  5I11 A;  2YRD A;  4GLK A;  1PSF A;  1AVZ C;  5GMK i;  3M0R A;  4D8D A;  4OMF B;  2P4T A;  2K2M A;  2C0O A;  2M16 A;  4MZP A;  4A4E A;  3VS2 A;  4MML A;  1GL5 A;  2NUP A;  2QQB A;  2EWN A;  3CCE A;  4UC4 A;  1SHG A;  2O31 A;  3JSC A;  1SSH A;  1X2Q A;  4EMK A;  2RI2 A;  2PUO B;  2FHD A;  1C6V X;  1BI2 A;  2O9V A;  5GAM j;  4LDV A;  3LWI A;  2E4H A;  1VQO Q;  1VUB A;  1N6A A;  2MF2 A;  2OAW A;  1M3A A;  2HL3 A;  5FWC A;  4E7J A;  3JCM P;  5J39 A;  4QQG A;  2VVK A;  1YIJ A;  1ZUY A;  1GXI E;  1YJ9 T;  3CC2 Q;  1ARK A;  4F17 A;  1X27 A;  3SDZ A;  2P4R A;  4ZNX A;  2EQI A;  3DB3 A;  4R56 A;  4KUL A;  2MPX C;  3L1A A;  1YJW A;  3RR6 A;  1YP5 A;  2YXY A;  1XOV A;  1PHT A;  4BDY A;  1IGQ A;  3CMA Q;  3QII A;  2FVU A;  1Y96 A;  1IB8 A;  1S72 A;  2H3E B;  1NYF A;  2RJD A;  4KH1 B;  2JN0 A;  1EIF A;  5FU6 B;  2V8J A;  4JS5 A;  1MND A;  1GFC A;  2XDP A;  1SRL A;  1QQJ A;  1UE9 A;  1KD1 R;  2LJ3 A;  3L2U A;  3EG2 A;  3EG9 B;  1UTI A;  2EJF A;  3LH0 A;  1I81 A;  2HZY A;  4F7U B;  1VQ9 Q;  1OV3 A;  3Q1J A;  2HKQ B;  2BUD A;  4M77 E;  5LJ5 d;  3MEA A;  4M78 D;  1BI1 A;  1VYT A;  1VQL T;  3A8O B;  1RAB B;  3UWN A;  4M75 B;  3MO8 A;  1Q86 U;  1TSF A;  1D1C A;  5KYU B;  2F2V A;  3WVE B;  4MZT A;  3OYE A;  4E6R A;  2OJ2 A;  4CI0 C;  4RG8 A;  2COW A;  3VS1 A;  2DBK A;  2KE9 A;  1ZSZ C;  3OSS C;  3OS0 A;  1GCQ C;  3OYN A;  3L2W A;  2RD1 A;  1IRX A;  3FDR A;  1M3B A;  3EGU A;  1NPP A;  3PMI A;  1WJS A;  1KK7 A;  3CXC S;  1VQK Q;  1YJ9 A;  2OTJ Q;  3PIP A;  4HA8 A;  4HVW A;  1W6X A;  1ZBX A;  3CD6 T;  1N9R A;  5I21 A;  2VWF A;  2O4X B;  3GOX A;  3M5A A;  1U3O A;  4KUI A;  4N4I A;  1Q7Y C;  2LQN A;  1G8X A;  1RUW A;  2KVQ G;  2YUP A;  3EFS A;  2JM9 A;  2KNB B;  2IIM A;  4JRI A;  3TEE A;  2BZ8 A;  2WSE E;  4A4K A;  4PJO E;  3E19 A;  4JZ3 A;  1CKB A;  3OQ5 A;  2EYZ A;  1KJW A;  3D7S B;  4PK4 A;  1GFD A;  3J7A F;  1EX4 A;  4RTY A;  2DAQ A;  1WJR A;  1VYU A;  2K5F A;  3VJP A;  2PTK A;  5GMK m;  5A0D A;  4ZN3 A;  3CCV T;  4J6W A;  2VC8 A;  1X01 A;  1SF9 A;  5GAN f;  1TOV A;  3CCS T;  5CKE A;  3MP6 A;  1BB9 A;  4LUE A;  2RMO A;  4BDZ A;  3RUX A;  3SWN A;  4ZN1 A;  3I55 Q;  2L89 A;  4C8Q E;  2KRM A;  4HT9 A;  2L8D A;  2I2L A;  3V8J A;  4CRI A;  2Y90 A;  1LNX A;  3ULR B;  2DLP A;  1K9M U;  2M51 A;  4M7A B;  3CBO A;  1XTD A;  3PGG A;  3BDL A;  2JTE A;  3JCM g;  1EFN A;  4D6W A;  3PTA A;  2M0O A;  3I5S A;  2D0Q B;  1X2K A;  4GY5 A;  4BUG A;  1UGP B;  2CYZ B;  3CD6 A;  1JU5 C;  2MWO A;  3EFO A;  5LJ5 g;  4RMO A;  1WXU A;  3QBY A;  1N27 A;  1NM7 A;  2QA4 Q;  4XTU A;  5GAO l;  5KYN A;  3V7C A;  3PFS A;  2HBP A;  4C92 D;  2FPE A;  1RLP C;  1K73 R;  4ELZ C;  3AHU A;  4XTV A;  2O88 A;  1ZQ1 A;  2VB6 A;  4XU0 A;  3QDF A;  3CCU Q;  1N8R C;  4CC7 A;  4RTT A;  1A0N B;  2RHU A;  2DYI A;  4MZM A;  2HSE B;  2DET A;  4PFO A;  2RHZ A;  2D0N A;  3EG1 A;  4J6Y A;  5GMK j;  1YIT Q;  3CCJ Q;  2KYM A;  3ZL7 C;  4QVZ A;  3CCV A;  3RKY A;  1AEY A;  5I2M A;  1KFZ A;  4RUG A;  4B9X A;  2HCK A;  3MP8 A;  3CCL Q;  1CKA A;  3JCM e;  3ASK A;  4RTU A;  4EIK A;  1NE8 A;  1BU1 A;  4QVD A;  3G4S T;  4F7U F;  3GLX A;  3JCM W;  2YUQ A;  1W2B A;  3CPF A;  2E3H A;  5GJW B;  3P8D A;  3A8G B;  3TQ7 P;  4LDU A;  1V76 A;  1G3S A;  2AK5 A;  1YWO A;  3KXT A;  3S3N A;  9ATC B;  2CZ7 B;  3NPF A;  4M75 F;  1WLP B;  1BCO A;  2XK0 A;  1VQ4 T;  4M7D A;  3RIR A;  5HKC A;  4AG2 C;  1ZUU A;  3EGD A;  5GAN 4;  5D6Y A;  1QKW A;  4QQ6 A;  1VQP Q;  2LVM A;  1Q81 R;  2FO0 A;  1WPY A;  4BI8 B;  4AFQ C;  4KRT A;  3JCM b;  4R55 A;  2PQW A;  5J26 A;  4J9F A;  3NTH A;  4N4H A;  2RQV A;  4LNP A;  4YTL A;  4JRQ A;  2DZC A;  4A53 A;  5HY6 A;  2CH4 W;  5DM7 R;  4ZTJ A;  4JZ4 A;  4EPC A;  2D1X A;  1KD1 U;  3VV0 A;  3OS5 A;  1K8A R;  4X1V A;  1C1A A;  3CCR T;  3QYG B;  1QVG P;  1UG1 A;  2A7Y A;  1NPR A;  3QPH A;  2DE0 X;  4HCK A;  1Y0M A;  4BI4 A;  2X4Y A;  2CP2 A;  4NS5 A;  2LX9 A;  1PRL C;  4D8K A;  1AHJ B;  2NWM A;  4C0G A;  3TU4 K;  2PU9 B;  4OP0 A;  3H8Z A;  3X24 B;  3V7S A;  2L3P A;  2RF0 A;  2LP5 A;  1FYN A;  4LD9 K;  3EFR A;  3FLG A;  2CP5 A;  3JCM h;  1M2V A;  4BB7 A;  2L2P A;  2PUK B;  1ABO A;  3OYY A;  4TVR A;  3RES A;  1X75 C;  2A0F B;  2YLC A;  5GAN 7;  1YFN A;  5LJ5 h;  5CK9 A;  1YCY A;  2HD0 A;  1VQN T;  2PVG B;  1FXX A;  3UA7 A;  1QP2 A;  1UDL A;  1X43 A;  5D6W A;  1VQ8 Q;  1WJQ A;  3CBP A;  4X34 A;  4IUV A;  1K0X A;  1VQM Q;  2VV5 A;  2CSQ A;  4M7A F;  2BE9 B;  3A8L B;  5EC7 A;  2EYY A;  3CCM Q;  4ZTF A;  4HCC A;  4AFU C;  2OTL T;  4E7K A;  2JTM A;  2GTJ A;  1M1K C;  4R0K A;  1OOT A;  2LT4 A;  4AT1 B;  1VQ7 T;  2AIR B;  4EMK C;  3M0U A;  2QTX A;  1OPK A;  4KBM B;  4ZGD B;  3JCM Q;  4FYV B;  5DY9 A;  2QGF B;  3OYI A;  2EQJ A;  4J9D A;  3DKM A;  4GBQ A;  4JRK A;  4A63 B;  2FRW A;  1VIE A;  2RJE A;  3I56 Q;  1JQQ A;  5IT9 E;  3VRY A;  3PMT A;  2F5K A;  5CKD A;  3OW2 A;  1B3Q A;  4QVC A;  4M77 A;  1VQK T;  1U8R A;  2OTJ T;  3GIB A;  2DXB A;  4LD6 A;  5GAO m;  2K79 A;  3QG1 A;  2MYS A;  1RLQ C;  1W1F A;  3CQT A;  2LJ1 A;  2RI3 A;  2B8A A;  4M4Z A;  3FC3 A;  2KR3 A;  2R5M A;  3KFV A;  1MUZ A;  3CMA A;  3A8M B;  4QKU A;  1FMK A;  5J3B A;  2KSS A;  2LMJ A;  4DA4 A;  3H9N A;  2DNU A;  2J7I A;  1OYX A;  2ZPI B;  3I35 A;  1VQN A;  2K6D A;  1QWF A;  4OF1 A;  1UHC A;  2QYZ A;  1XNI A;  2AT1 B;  2A28 A;  2KY9 A;  1VQ9 A;  1HD3 A;  2EYW A;  4X9C A;  3M9Q A;  4AG1 C;  5I22 A;  2SEM A;  1UGR B;  3HTR A;  1K73 U;  2ZPF B;  2LCC A;  2XHC A;  4FM4 B;  1HJD A;  2DL8 A;  1UJY A;  1RI0 A;  2QI2 A;  2A08 A;  1WHL A;  2CGH A;  3WXM B;  1WXT A;  2E41 A;  1M90 R;  2D8H A;  2YLB A;  2XIC A;  1SHF A;  4IKF A;  1Z9Q A;  3LH5 A;  4JJB A;  2COZ A;  3H41 A;  1YIJ T;  2ABL A;  2L0A A;  3I9Q A;  4M7D E;  2O4X A;  3CCQ Q;  3SB2 A;  4CC2 A;  1QVF S;  2RO0 A;  1NJI C;  2IPO B;  2FRY A;  2XI9 A;  2V8I A;  1VQK A;  2OTJ A;  4OVA A;  1MMA A;  2J05 A;  2RQR A;  4A4F A;  2DVJ A;  2ESW A;  3VUB A;  2E10 A;  4IUU A;  2DYB A;  4XQ3 A;  1QVG S;  1RAG B;  1S72 T;  5LJ3 g;  3R6O A;  2JJ9 A;  1I5L A;  5CO7 A;  3G71 Q;  4M75 D;  3RMQ A;  2QG9 B;  3M0P A;  3CCU T;  1IXD A;  2X3W D;  1H3H A;  4ANJ A;  1Q81 U;  2XDD A;  2O2O A;  1WHJ A;  5CIU A;  1O9S A;  2DL5 A;  3UA6 A;  4HKE A;  5IXF A;  4PNO A;  3CCJ T;  3CC7 Q;  2RHY A;  3ZEH A;  4J7F A;  1UGQ B;  3OYG A;  2X35 A;  1NZ9 A;  4PJL A;  1TUG B;  2LNV A;  2FEI A;  1KQS A;  1UEC A;  4CC4 B;  4LN2 A;  4LUD A;  4M78 A;  1J3T A;  4J9I A;  2X51 A;  4XU1 A;  1WXB A;  4RCC A;  2AKL A;  1GBQ A;  4OGE A;  2AZV A;  1MV3 A;  5KYW B;  3I55 A;  1K8A U;  4Y28 E;  3ZFJ A;  2I0N A;  5I2S A;  1IGU A;  2RJC A;  3EAE A;  5LJ3 e;  3CPW S;  2DA9 A;  4A4G A;  4AFS C;  3M59 A;  3VS5 A;  1KC8 R;  4XU2 A;  3VYG A;  2KI7 A;  1M8M A;  4J9E A;  5GAM g;  2RQW A;  1ACM B;  3CC4 Q;  3EGX B;  2QDL A;  5CR2 A;  3MPU B;  3C12 A;  3PVL A;  4RKU E;  3OYK A;  1M2O A;  2DJZ A;  4Z88 A;  4XTW A;  3TCJ A;  1X6G A;  2KXC A;  4F14 A;  2QA4 A;  2FB7 A;  3LYI A;  1K73 C;  2H3J A;  4KT0 E;  2JMC A;  4VUB A;  4J83 A;  2Z0W A;  3OYH A;  1WDX A;  3EHR A;  5D6X A;  2QAZ A;  2QGG A;  5KYX B;  2EQU A;  5CCA A;  3JCM d;  4OB0 B;  1HXD A;  1QVP A;  2K4Y A;  3CCU A;  2RB6 A;  4C0F A;  2K7A A;  1YI2 T;  2GNC A;  3QO3 A;  2NUT A;  1W2B P;  1SKU B;  4FW1 A;  2FZC B;  3CCJ A;  3UT1 A;  2QEX Q;  3O5Z A;  2MAM A;  3JCM c;  1YHQ T;  1G3Y A;  4M7A D;  1TUD A;  2GF7 A;  1M30 A;  1C0M A;  5GAM e;  1VOM A;  3A1P A;  2EGA A;  2FL7 A;  5KYY A;  4XK8 E;  2ZPE B;  2GQV A;  1WHG A;  2YWW A;  2QXF A;  1OU9 A;  1IHW A;  4CC3 A;  2JS0 A;  1AWW A;  3M4Y A;  4PFZ A;  2JNG A;  1Z9Z A;  3G6E Q;  1OZ2 A;  4N0A C;  1BBZ A;  4Y91 A;  3THK A;  2GFA A;  3JB9 G;  2JXB A;  2BE7 D;  3M0Q A;  4E2F B;  1BCM A;  3CME Q;  2YUO A;  1YJN Q;  4QQD A;  5GAN j;  4M75 E;  4DEX A;  2DD4 A;  4EMH A;  3HRT A;  2DIG A;  1U1T A;  1IZ6 A;  3OBY A;  1NLO C;  4O5V A;  1XQH A;  1WYX A;  1N9S A;  1Q82 R;  1MMG A;  5KH6 A;  5LL6 S;  2E12 A;  4PJO B;  4ELY C;  1FWZ A;  3CXC A;  5FRN A;  2H8H A;  2DL7 A;  1HYO A;  4QT7 A;  4RTX A;  1WIE A;  1UUE A;  1D0Z A;  4C92 A;  1NYG A;  2DIL A;  3RNJ A;  2VXF A;  3URG A;  2KT1 A;  1D3B B;  4Y92 A;  1VQ6 Q;  1YI2 A;  3ER0 A;  5GAN 5;  1LCK A;  3OA6 A;  1IO6 A;  2ZZD A;  1VQ5 Q;  1UHF A;  1YN8 A;  1Y07 A;  4DBH A;  1PCX A;  1YHQ A;  1KHI A;  3LWH A;  1T0J A;  4BD3 A;  2YRV A;  2DXT A;  4C8Q B;  2CUB A;  3N5B B;  2WSC E;  4HXJ A;  1M90 U;  5GAM h;  5GAN 8;  3V8K A;  2HQE A;  1KQ1 A;  3OYJ A;  2J6K A;  4WF2 A;  1X6O A;  4HT8 A;  4C5E A;  4JDS A;  5L8R E;  2E70 A;  2P0P A;  3M58 A;  3CCE Q;  2KRN A;  4PKC C;  2DRK A;  4E47 A;  2JUF A;  1KSW A;  2K3Y A;  2QQR A;  2MWP A;  5IH2 A;  1BYM A;  5GAN 2;  4XTX A;  4QW2 A;  1PC0 A;  4E7L A;  2C06 A;  2X4X A;  4RTZ A;  1VQ8 A;  1KQ2 A;  4N4G A;  2DEU A;  2V26 A;  3OMC A;  4OMO A;  1VQM A;  1OU8 A;  3G7Z A;  5DLO A;  5GAN 3;  1M1F A;  4M78 E;  2JT4 A;  4EMK B;  2E6Z A;  2DEQ A;  3F70 A;  4HCZ A;  2XID A;  3OW2 P;  2KRS A;  1Q86 C;  3VKI A;  2E3I A;  3JCM J;  1MV0 B;  1AOJ A;  4OB1 B;  1BI0 A;  2BKD N;  3JB9 D;  2E1H A;  5C0M A;  4JPB W;  2ROT A;  1KIK A;  2KEA A;  2GCX A;  4M77 C;  3L2R A;  2DKG A;  1SPK A;  3I5R A;  2ZPG B;  3E9G A;  2FG0 A;  1B34 A;  3RER A;  1FX7 A;  1PD1 A;  3JCM f;  1Y96 B;  3X25 B;  3X20 B;  1H64 1;  3PE0 A;  3SEM A;  3E2U A;  3OYM A;  4KGX B;  1RAC B;  2ECZ A;  3DB4 A;  3FEO A;  2RHX A;  1PG5 B;  2YSQ A;  5LJ5 f;  3JCM V;  2O01 E;  1OI1 A;  3LGF A;  2ENM A;  2DF6 A;  2JVV A;  5A2Q E;  2HQH A;  1G5V A;  2JS2 A;  3OB9 A; 
#chains in the Genus database with same CATH homology
 3VRY A;  1AVZ C;  3RBB B;  2JM8 A;  2YDL A;  3M0R A;  1B3Q A;  4D8D A;  2K2M A;  2C0O A;  2LJ0 A;  2DBM A;  3VS2 A;  1GL5 A;  2RN8 A;  2K79 A;  1GCQ A;  1RLQ C;  1SHG A;  1UFF A;  1W1F A;  2DL3 A;  2EKH A;  2O31 A;  2LJ1 A;  1SSH A;  2LNH B;  2AKK A;  2RPN A;  1X2Q A;  2KR3 A;  1W70 A;  3PVQ A;  4M4Z A;  3KFV A;  1MUZ A;  2O9V A;  3REA B;  4HVU A;  1GRI A;  1FMK A;  2LMJ A;  1ZUK A;  2OAW A;  1M3A A;  2DNU A;  2J7I A;  1V1C A;  5FWC A;  4HVV A;  2BZX A;  2VVK A;  1PKS A;  3I35 A;  1ZUY A;  2K6D A;  1QWF A;  1ARK A;  4F17 A;  1UHC A;  2DX1 A;  1X27 A;  3REB B;  2GBQ A;  4RTW A;  3IQL A;  2P4R A;  4ZNX A;  1TG0 A;  2EQI A;  5FW9 A;  1SRM A;  1YCS B;  2A28 A;  3VS6 A;  1HD3 A;  4OML A;  1I1J A;  1YP5 A;  2EYW A;  3EG0 A;  4ORZ A;  4AG1 C;  1XOV A;  1PHT A;  5I22 A;  1N5Z A;  2SEM A;  4IIO A;  2YT6 A;  2OI3 A;  1E6H A;  1NYF A;  1HJD A;  2GGR A;  2DL8 A;  2ROL A;  1UJY A;  2A37 A;  2EYX A;  2K3B A;  2A08 A;  1WXT A;  2D8H A;  1GFC A;  3R6N A;  1SHF A;  1SRL A;  1UE9 A;  2SRC A;  1Z9Q A;  2LJ3 A;  3LH5 A;  2GTO A;  4JJB A;  3EG2 A;  3EG3 A;  1UTI A;  2V1Q A;  3H41 A;  3NMZ C;  2ABL A;  2L0A A;  3I9Q A;  1WFW A;  1OV3 A;  2A36 A;  4CC2 A;  3NGP A;  1VYT A;  5IXB A;  2FRY A;  5HCK A;  2KT8 A;  2J05 A;  1U06 A;  2RQR A;  3QWY A;  2DVJ A;  2ESW A;  2AZS A;  2HSP A;  2DYB A;  2F2V A;  1I0C A;  4E6R A;  2OJ2 A;  1E7O A;  3VS1 A;  2DBK A;  2KE9 A;  4OMQ A;  1SEM A;  1GCQ C;  2CSI A;  1JXO A;  2EVR A;  1AWJ A;  1M3B A;  3EGU A;  2ED0 A;  4J9C A;  3M0P A;  1JXM A;  2X3W D;  4OMN A;  2HBW A;  1H3H A;  1K9A A;  4HVW A;  2O2O A;  1W6X A;  3UA6 A;  2DL5 A;  5IXF A;  2EPD A;  2VWF A;  2CH4 A;  1U3O A;  1T3L A;  1OEB A;  1QLY A;  4OMP A;  2FEI A;  2LQN A;  1UEC A;  1Y57 A;  2X3X D;  4CC4 B;  1RUW A;  4F16 A;  4LN2 A;  4LUD A;  2KBT A;  2YUP A;  3H0I A;  2EW3 A;  2JM9 A;  5L23 A;  2KNB B;  2IIM A;  2JW4 A;  1J3T A;  4J9I A;  2BZ8 A;  2PZ1 A;  3JV3 A;  1WXB A;  2L3Q A;  1HSQ A;  4LE9 A;  3VS7 A;  4JZ3 A;  2AKL A;  1CKB A;  2EYZ A;  1GBQ A;  1KJW A;  2AZV A;  1MV3 A;  2L3S A;  3VS4 A;  1H92 A;  4AFZ C;  1GFD A;  1WA7 A;  2I0N A;  4RTY A;  1UGV A;  2MIO A;  1VYU A;  1OPL A;  1H8K A;  2B86 A;  2PTK A;  2DA9 A;  4AFS C;  2DL4 A;  1ZSG A;  1NG2 A;  3VS5 A;  1M8M A;  4J9E A;  2E5K A;  2RQW A;  2QDL A;  2LCS A;  1BB9 A;  4LUE A;  3PVL A;  3UF4 A;  1ZBJ A;  5ECA A;  2RMO A;  1M27 C;  1T0H A;  3NHN A;  2CT3 A;  4Z88 A;  2M0Y A;  1AD5 A;  2KRM A;  1JO8 A;  1X6G A;  2KXC A;  4F14 A;  2O9S A;  2J06 A;  1VA7 A;  1CSK A;  2JMC A;  3ULR B;  2DLP A;  1U5S A;  2KGT A;  1WDX A;  3EHR A;  2M51 A;  4IIM A;  2JTE A;  2DJQ A;  3UAT A;  1EFN A;  5GJV B;  2K7A A;  2GNC A;  1ABQ A;  1NEB A;  3I5S A;  1X2K A;  1AZE A;  1BK2 A;  1JU5 C;  4Z89 A;  3O5Z A;  4Z8A A;  1WXU A;  1PWT A;  2LQW A;  3TSW A;  1TUD A;  1NM7 A;  1M30 A;  2W0Z A;  2FPE A;  1RLP C;  2EGA A;  5IHN A;  1S1N A;  1YWP A;  2O88 A;  1NLP C;  2GQI A;  2ED1 A;  4CC7 A;  4CC3 A;  4RTT A;  2JS0 A;  1AWW A;  1A0N B;  1Z9Z A;  1BBZ A;  3H0H A;  3THK A;  2JXB A;  2D0N A;  3EG1 A;  3VRZ A;  3M0Q A;  1K4U S;  2LX7 A;  2KYM A;  1JEG A;  3A98 A;  3FJ5 A;  3ZL7 C;  2YUO A;  2J6O A;  1AEY A;  3TSZ A;  1AWO A;  4DEX A;  1KFZ A;  2CT4 A;  4RUG A;  2CUD A;  2HCK A;  4FSS A;  1RI9 A;  1CKA A;  4J9G A;  4RTU A;  4EIK A;  1BU1 A;  4GLM A;  4J9B A;  2C0I A;  2YUQ A;  1NLO C;  1WYX A;  1G2B A;  5GJW B;  2KXD A;  2YUN A;  2AK5 A;  1YWO A;  5IHI A;  3U23 A;  2V1R A;  1ZX6 A;  2H8H A;  3NPF A;  2DL7 A;  1I07 A;  4QT7 A;  4RTX A;  1WLP B;  1WIE A;  1UUE A;  1NYG A;  2DIL A;  3RNJ A;  4AG2 C;  1ZUU A;  2KT1 A;  1K76 A;  3CQT A;  2RQT A;  1QKW A;  4Y92 A;  2FO0 A;  1LCK A;  4AFQ C;  4KRT A;  1IO6 A;  1NEG A;  1M3C A;  1UHF A;  2EGE A;  1YN8 A;  4DEY A;  2MOX A;  4J9F A;  1K1Z A;  4K11 A;  2RQV A;  4LNP A;  4OMM A;  3TVT A;  1T0J A;  2VKN A;  2CH4 W;  2CUB A;  4JZ4 A;  3M0T A;  4HXJ A;  3VS3 A;  2D1X A;  2G6F X;  2J6K A;  2C0T A;  3EHQ A;  1YNZ A;  4X1V A;  2FPD A;  1AWX A;  1G83 A;  2KRN A;  4RTV A;  1UG1 A;  1AZG B;  2DRK A;  3QWX X;  2DE0 X;  4HCK A;  1KSW A;  2NUZ A;  1Y0M A;  2XMF A;  1UJ0 A;  1E6G A;  2F2W A;  5IH2 A;  1PNJ A;  2MCN A;  2CDT A;  1PRL C;  4D8K A;  2NWM A;  4RTZ A;  5FWB A;  3VS0 A;  4OMO A;  3SHW A;  2L3P A;  2KRO A;  2RF0 A;  2LP5 A;  1FYN A;  2BTT A;  4ESR A;  2L2P A;  2JT4 A;  1ABO A;  1PRM C;  2RNA A;  2PNI A;  1T3S A;  2DMO A;  2J6F A;  2KRS A;  4JJD A;  1PKT A;  3C0C A;  3M0S A;  3UA7 A;  1MV0 B;  1AOJ A;  1WI7 A;  2DM1 A;  2LZ6 B;  1UDL A;  2RQU A;  1X43 A;  2KYB A;  1B07 A;  2D8J A;  4JPB W;  2ROT A;  2DRM A;  1K0X A;  1KIK A;  2KEA A;  1QWE A;  2CSQ A;  1SPK A;  3I5R A;  1QCF A;  2FG0 A;  5EC7 A;  2EYY A;  2JMA A;  1WX6 A;  4AFU C;  4WCI A;  1VYV A;  2GTJ A;  4R0K A;  1OOT A;  4J9H A;  2K9G A;  1GCP A;  3PE0 A;  3SEM A;  1X69 A;  1QKX A;  5IHK A;  2ECZ A;  3H0F A;  2CRE A;  3M0U A;  4JJC A;  2EGC A;  2EBP A;  1OPK A;  2BZY A;  2F2X A;  2YSQ A;  1GBR A;  2HDA A;  2ENM A;  1ZLM A;  2DF6 A;  1X6B A;  2HEQ A;  1TUC A;  4J9D A;  2FPF A;  4GBQ A;  4A63 B;  5I11 A;  1K0S A;  2W10 A;  2FRW A;  2JS2 A;  3GBQ A;  1JQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...