1ZUUA

Crystal structure of the yeast bzz1 first sh3 domain at 0.97-a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
b'ENKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BZZ1 protein
molecule tags Unknown function
source organism Saccharomyces cerevisiae
publication title Structural genomics of yeast SH3 domains
rcsb
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zuuA00
2J7IA 4Y92A 2D8JA 1H92A 3VRZA 1H3HA 1RLQC 2CREA 1MV3A 2O9VA 2LNHB 4DEXA 1YWPA 2EYZA 3ULRB 4CC2A 1YCSB 1WFWA 1VYTA 2DYBA 4F16A 1OOTA 3M0UA 2KBTA 1OPLA 4DEYA 4AG2C 2RQWA 3EG0A 4CC3A 4F17A 3IQLA 1YP5A 2SEMA 1FYNA 1UHCA 4F14A 1FMKA 1WXTA 2OJ2A 1K9AA 3PE0A 1PRMC 2DE0X 1B3QA 3I35A 4A63B 4KRTA 1UTIA 2DJQA 3QWYA 2KEAA 1BU1A 2K7AA 2KYBA 2FEIA 2J6FA 4CC4B 2EGAA 1JEGA 3ZL7C 3R6NA 1AWOA 1RUWA 3PVQA 4LE9A 2X3WD 2DRKA 3GBQA 5I11A 3NHNA 1T0HA 1OPKA 1JXMA 2V1QA 2L3QA 4OMLA 2O9SA 1GL5A 2RN8A 2GTJA 1W6XA 2EYWA 2NUZA 2FRWA 3H41A 1AEYA 4D8KA 1HSQA 2EGEA 2I0NA 2PNIA 2EBPA 4HVVA 1K4US 2E5KA 1GRIA 2HEQA 4HCKA 1NLOC 2JM9A 2ESWA 1JXOA 3NGPA 1SHFA 4HVWA 5ECAA 5IHNA 1Z9ZA 3EG3A 2EYXA 2JTEA 3RNJA 2QDLA 2O31A 1AWWA 1AZEA 3VS3A 1NEGA 3TSWA 2MOXA 4AG1C 1EFNA 1M8MA 1QWEA 1H8KA 4OMPA 4OMOA 1MUZA 2DX1A 1BB9A 1UE9A 4X1VA 4CC7A 1ZUKA 1JU5C 1S1NA 2IIMA 2KR3A 2CDTA 2LP5A 1UJYA 2HBWA 1QKXA 2P4RA 1GFCA 3VS1A 1NYFA 5HCKA 4AFUC 5IH2A 5IHIA 2GBQA 4LNPA 1QLYA 3M0TA 2EYYA 2FPFA 3VS6A 1ZUUA 1E6GA 4IIMA 3VS5A 2DLPA 1ZX6A 3JV3A 1WDXA 2O2OA 3SEMA 2KRNA 1CKBA 1T0JA 2D8HA 2ROTA 1WI7A 4GLMA 4JJDA 1UJ0A 1KIKA 1K76A 3M0SA 1M3BA 2SRCA 2W0ZA 3VS4A 3THKA 2JW4A 2YUPA 1PKSA 2EQIA 1ARKA 4J9DA 2CH4A 2GTOA 1E7OA 2AZVA 1GFDA 3EHRA 2JMAA 3REBB 1X43A 2KT8A 2ED0A 2ENMA 2DBMA 1ABOA 4EIKA 3LH5A 2KXDA 1AVZC 3M0QA 3EGUA 3H0IA 2L2PA 1AOJA 2JS2A 3CQTA 2OI3A 2J6OA 4Z89A 1ZSGA 2CT4A 2C0TA 3I5SA 1RI9A 2KXCA 2HCKA 1GCQA 2VKNA 5GJVB 1X6BA 1NEBA 1JQQA 1WIEA 1T3SA 4J9BA 2DM1A 2J06A 2JM8A 3EG1A 1WXBA 1N5ZA 3C0CA 5FWBA 4JZ3A 2MIOA 2K9GA 3EHQA 1CSKA 2EPDA 4K11A 2CUDA 5FWCA 4J9EA 1ZBJA 2YUNA 1M3AA 2DRMA 4J9GA 2A36A 3UF4A 1J3TA 2DNUA 2KGTA 2YUQA 3TVTA 2DVJA 2RMOA 1TUCA 2F2XA 1NG2A 4RTTA 4D8DA 3VS0A 1IO6A 1NLPC 1SPKA 2BZYA 5GJWB 1G2BA 1WYXA 2LJ0A 4J9FA 2D1XA 1AWJA 5L23A 2RNAA 1UDLA 3SHWA 2LCSA 1PRLC 2L3PA 1B07A 1KSWA 2L0AA 2KRMA 1UG1A 2AKKA 2LQNA 2MCNA 1KJWA 2D0NA 4AFSC 1Y0MA 4OMQA 1YNZA 1PHTA 1W1FA 2K6DA 2DL7A 1U5SA 2M51A 1WA7A 3H0FA 1K0XA 2LQWA 1I07A 4LN2A 3REAB 4QT7A 3PVLA 2JMCA 4ESRA 3UA6A 1M27C 4AFZC 2LJ3A 2RQVA 1JO8A 4E6RA 1UGVA 1WXUA 4R0KA 5IHKA 1I0CA 4OMNA 2LZ6B 2X3XD 2FO0A 2ABLA 2K3BA 1PWTA 1SHGA 1VA7A 1PKTA 1M30A 4IIOA 4RTVA 1RLPC 1YWOA 4JJCA 2J6KA 2J05A 5IXFA 2LX7A 2HSPA 3U23A 1HD3A 1SEMA 1WLPB 2DBKA 2M0YA 2JT4A 1OEBA 1QWFA 3EG2A 3I9QA 4M4ZA 4Z88A 1AZGB 1X6GA 2EKHA 2RQRA 2DA9A 4AFQC 2BTTA 3O5ZA 2KRSA 1GBRA 4J9HA 1ZLMA 4WCIA 3VRYA 2DMOA 4JZ4A 4J9IA 2DL3A 1QKWA 2FG0A 1M3CA 2KNBB 2G6FX 2BZ8A 1U3OA 3VS7A 2RQUA 3RBBB 1GCQC 2V1RA 1NYGA 2NWMA 1Y57A 1VYVA 3KFVA 4HXJA 1UHFA 1G83A 1UUEA 2YT6A 2K2MA 2YDLA 2W10A 4LUDA 5IXBA 2DL4A 1TG0A 2GQIA 4Z8AA 4RTYA 2ED1A 1OV3A 3A98A 1I1JA 2KROA 1E6HA 1UFFA 3TSZA 2AK5A 2F2WA 3FJ5A 2DL5A 2FPDA 1AWXA 2KE9A 4JJBA 4J9CA 2AZSA 2JS0A 1AD5A 2C0OA 2PTKA 2LJ1A 2FRYA 4ZNXA 2LMJA 2JXBA 2B86A 5EC7A 4JPBW 5FW9A 2RQTA 2A08A 1HJDA 2GGRA 2EGCA 4GBQA 3VS2A 1GBQA 1ABQA 1X69A 1MV0B 1A0NB 2EVRA 2PZ1A 1NM7A 1VYUA 1XOVA 1YN8A 2ECZA 2OAWA 2EW3A 4RTZA 1X2QA 4RTXA 2CSIA 5I22A 2RPNA 1SSHA 4OMMA 2O88A 2DF6A 3UATA 1BBZA 1U06A 2KT1A 3NMZC 2DILA 1K1ZA 2F2VA 2KYMA 1Z9QA 2FPEA 3M0PA 1WX6A 2CSQA 2YUOA 1TUDA 2L3SA 3NPFA 1UECA 2GNCA 4RTUA 1CKAA 1SRLA 1QCFA 1KFZA 2RF0A 4RUGA 2C0IA 1SRMA 1ZUYA 1K0SA 2A37A 2CH4W 4LUEA 1X2KA 2ROLA 2VVKA 3UA7A 2CT3A 4RTWA 1BK2A 3QWXX 2H8HA 3H0HA 4HVUA 2A28A 2AKLA 1LCKA 1PNJA 2VWFA 1W70A 4FSSA 2DL8A 2K79A 1X27A 3M0RA 3I5RA 2YSQA 1GCPA 1T3LA 1V1CA 2HDAA 2XMFA 2BZXA 2CUBA 4ORZA
chains in the Genus database with same CATH superfamily
2J7IA 5GMKe 2LTOA 2X51A 1Y07A 2CREA 1ZSZB 1VQOT 2LNHB 4DEXA 4NL2A 4C0DB 4IUTA 1B34A 4JDSA 2DAQA 1WFWA 3RESA 1YJWQ 2YRDA 3E1SA 3ME9A 1OOTA 2KK4A 2V26A 3OYGA 2KBTA 4M7AE 5KE3A 2RQWA 4CC3A 1Y7XA 2K3YA 5J39A 2SEMA 4F7UA 2QEXQ 1N8RC 1UHCA 1VQ6A 3NFCA 1ZQ1A 3CBOA 3I35A 3RMQA 4A63B 1BU1A 4XU0A 3G71T 2EGAA 3ZL7C 2E3HA 5A0GA 1BI3A 2MI6A 2DRKA 4PFZA 4EMKA 2XDPA 3JCMe 5I11A 3CC4T 2OTLT 3JB9H 2V1QA 3HRSA 4DBHA 2L3QA 3GIBA 1KC8U 1WHJA 3L1AA 3VYGA 2CZ0B 4C8QE 3A1PA 3CCVT 2HZYA 1WHLA 1WJQA 1QVFS 2RO0A 2PNIA 4F7UE 4MZPA 3V8KA 2GQVA 3CC2Q 2XU8A 2CP2A 1D1AA 1N9SA 5FU7B 2JM9A 3HSBA 2ESWA 4HVWA 1SHFA 2XICA 2RB6A 1Z9ZA 1ZA2B 3PNWC 2QDLA 4PL6A 1VQ4A 1G3WA 2ZZDA 1M1KR 1QWEA 4OMPA 1M1FA 2DX1A 1BB9A 4X1VA 1ZUKA 1JU5C 2IIMA 1G5VA 3MEUA 1OU8A 1UJYA 2LP5A 2HBWA 1QKXA 2RI5A 1GFCA 4M78B 1NYFA 5HCKA 4AFUC 5CVIA 5IH2A 4QW2A 3UPUA 2JN0A 4RCBA 5IAYA 2ATCB 4PLIA 2FPFA 2RHUA 5CK9A 4E7SA 1VQPA 2O4XA 1ZX6A 2LCCA 4N0AC 2AT1B 2RK2A 5GAOq 2HSEB 2ROTA 1WI7A 3M53A 3MHXA 2JUFA 4E47A 3M58A 2XK0A 2SRCA 1M2OA 3VS4A 2YUPA 2EFIA 3CCLT 2EQIA 2QQBA 4M78E 3CXCP 1PSFA 2DIQA 2F5TX 2GTOA 4J9DA 1E7OA 5IN1A 4ZN3A 1IHWA 1QP2A 5EG2A 3EHRA 2VYTA 3KBGA 4C8QF 4KBMB 4A4GA 4QQDA 2PVGB 2RHYA 4FYXB 3M0QA 4C8QA 3EGUA 2DK3A 1RAAB 2JS2A 1MMGA 2OI3A 4Z89A 4M7DG 3CCUQ 3I5SA 3SDZA 1N8RR 2LC4A 3QDFA 5GJVB 1X6BA 2R58A 4QQGA 4M77E 3HTRA 4RG2A 3FRNA 4KULA 2M16A 2CP5A 2X35A 1YJWA 4J9BA 2J06A 3QIIA 3CC7Q 1K73U 2M9UA 3C94A 3I55Q 4ZGEB 1N5ZA 3L2QA 3EHQA 1VQKQ 1WHHA 3CCMA 4BI3A 3G4ST 4RG8A 4E2FB 4L6V5 1VQ4T 1VQ7T 4PJLA 2YUNA 2DRMA 3RKYA 1J3TA 4O6JA 2KGTA 1VQ8Q 2DVJA 4IKFA 1NPPA 3EG9B 4RTTA 5GJWB 1BCOA 4J6XA 1UDLA 2YHTA 2V8IA 2LCSA 1PRLC 2KRMA 1KJWA 2QG9B 2E65A 4AFSC 2CP7A 4ME7A 1Q82C 1W1FA 1U5SA 1VIEA 4Z02A 1WA7A 4M77D 4LN2A 3JB9I 2HQXA 3EGXB 3PVLA 2JMCA 3C4SA 3DLMA 4AFZC 1G3TA 5LJ5j 4ZTJA 1D0YA 4R0KA 4CI0C 3CMET 1Q81R 5CO7A 2FO0A 4XTUA 1WJSA 1SHGA 3EH2A 2QQSA 1YI2Q 1HK9A 2VUBA 4N4IA 3MP6A 1X75C 4KGVB 3CCVA 2DIGA 1XQHA 1FXXA 3JCMJ 3U23A 4B9XA 1SEMA 2LVMA 2HL5C 2DBKA 2QA4T 4A53A 3I56A 1UB4A 5DLQE 3A8LB 1QWFA 4M4ZA 3LWIA 4BUGA 2JTFA 5I2MA 5DM7R 4AFQC 1VQ9T 2VXFA 4TVRA 1ZLMA 3C12A 4ELZC 1KD1U 1VQ7A 1FMWA 1RADB 3J80E 5GMKm 2QAZA 3A8HB 2EKOA 4M77B 1VIFA 2KNBB 3EFOB 4OP0A 3RBBB 2NWMA 4MDWA 2XKOC 4UC4A 4PK4A 3CC2A 5GAMg 2IVWA 4DQ2A 3PGGA 3M59A 1UUEA 1KQSA 5IXBA 2KQWA 5A2QE 3OYKA 2DTIA 1OX9A 2KROA 1OZ2A 1SKUB 3TSZA 3FJ5A 2YXYA 2KI7A 1R77A 4M7DF 4JJBA 4J9CA 3FEOA 2X9HA 5GMKl 2E64A 2LJ1A 2FRYA 1YJ9A 3S3MA 2JXBA 2B86A 2PQWA 2DO3A 5EC7A 5FRNA 2P0KA 5FW9A 3CCMT 1GBQA 1ACMB 4N4HA 1ABQA 3JCMX 1G3SA 1X69A 1A0NB 3OQ5A 2EVRA 3FJPA 4QQ6A 1YN8A 2OAWA 5GAN3 3WVEB 3VJPA 5HK0A 4OMMA 2DF6A 1BBZA 2KT1A 1YJ9Q 3PFSA 1X6OA 3D7SB 2JNGA 1KD1R 2F2VA 2YLCA 1Z9QA 3QPHA 1VQPQ 2HNIA 1MMDA 4BY6C 2CSQA 1VQ6T 1PD0A 4BY6B 1VQ5A 4WF2A 1TUDA 3R6OA 5GAN8 1D1BA 4EMGA 3PT9A 4KUIA 4D6WA 4ELYC 4M7AD 5KYYA 1OX8A 4HT9A 3G4SQ 4C92F 1TUGB 1K0SA 5A0DA 2CH4W 1X2KA 2ROLA 2V8KA 1S72Q 3L2ZA 4PJMA 1KHIA 1M8VA 1I4K1 4X9DA 3H0HA 3OYFA 2A28A 4LD9K 3I55T 4C8QB 1OYXA 3GNGA 4FSSA 2DETA 5AYFA 2P84A 5LJ3e 2K79A 4F7UF 5CKFA 3M0RA 3LWHA 1M5Q1 5KE2A 1QVFP 3QZ9B 2NUPA 1V1CA 4ORZA 1BKBA 2DXBA 1N9RA 5GAN5 2QA4A 3GLXA 1VQNT 1MV3A 2O9VA 5CAIA 4XTWA 2DYIA 3M4GA 1YWPA 2EYZA 1NJIC 1YCSB 1TSFA 3M0UA 5GAMe 2LQKA 3TEEA 4M7AB 3IQLA 1YP5A 1WXTA 4X9CA 2OJ2A 1K9AA 2K5IA 1QVGP 2QTVA 4FT2A 5CR2A 3CCET 2KEAA 2BUDA 2K7AA 2KYBA 2FEIA 2J6FA 3R6NA 1N8RU 1AWOA 2JOYA 3PVQA 4LE9A 2CYZB 3CXCA 3WXMB 1MGQA 1RAGB 2PU9B 2QK0A 3J81E 3I56T 5LJ3f 2O9SA 1W6XA 1YCYA 4EDUA 2NUZA 3KUFA 3BFMA 3LX7A 3H41A 5GMKi 4M7AC 4C0ZA 1HSQA 4JUVA 5GAN4 4MDXA 1KC8C 4HVVA 1YI2T 2OTLQ 2P0PA 2PUOB 2JVVA 5KYUA 5CKHA 4JRIA 2RK1A 3GNFB 2ZGWA 4PKCC 2HEQA 3JB9F 5LJ3d 5FU6C 5IT9E 2EWNA 3RNJA 1K8AU 1M1KC 2O31A 4ZN1A 1NEGA 2FVUA 5LJ5d 3MP1A 3CXCS 3OSVA 1M8MA 5GANh 1H8KA 4OMOA 1OU9A 1D3BB 1UE9A 1U1SA 3DB4A 1BI1A 1S1NA 4OVAA 1JB0E 4QKUA 2ZAEA 5IHIA 3CPWP 3P8HA 3CC7A 4Y91A 1YJWT 4XTZA 2EYYA 4C92C 1M90R 4JRPA 3VS6A 1E6GA 3VS5A 3JCMf 1YITQ 4LXCA 3H8ZA 3JV3A 5LJ5g 1VOMA 2QGFB 3NTKA 3DB3A 4BD3A 2CZ7B 2E1HA 1C6VX 1YJ9T 2QQ9A 1OI1A 4GLMA 4HCBA 1Q81C 4Y28E 1UJ0A 1I81A 1KIKA 3X24B 2CP6A 3M0SA 4FIBA 4NL3A 1G8XA 1QVFA 4OMFB 3THKA 1PKSA 4FYVB 4J5YA 1W2BS 4HCCA 2CH4A 3HPWA 4M75C 4E7ZA 1GFDA 2JMAA 1K9MR 2CGHA 2YRVA 2ED0A 2DBMA 4F7UG 1KHCA 4EIKA 3PMIA 2L3RA 3OYJA 3BE3A 3H0IA 2RM4A 2CT4A 2C0TA 2L89A 1RI9A 5FU6B 3SD4A 1VQ8T 1KG1A 4FU6A 3OS1A 4ZTFA 5J3BA 4LDUA 1JQQA 1TU0B 3H6ZA 2LT4A 4CRIA 2E12A 2G3RA 5GAMf 4JJNK 2D9TA 5FWBA 4JZ3A 4L5GA 1VQMT 3CC7T 3V7SA 2EPDA 3CPWS 4EMHA 2CUDA 5FWCA 3EG9A 7AT1B 4JRKA 1ZBJA 1NBEB 4PJOB 2R57A 3CCJA 3QHSA 3UF4A 2YUQA 3TVTA 4E7LA 3M5AA 2DFUA 2VC8A 1WQ7A 3QO3A 1YHQQ 4M77C 5CIUA 4J9FA 1Q82R 4C92B 2XG8D 2OTJT 2RA2A 1Q82U 1MMNA 2H3JA 2L3PA 3VUZA 1UG1A 1TOVA 2HD0A 2JJ9A 2ZPHB 1VQKA 1Y0MA 1YNZA 2RI2A 1PHTA 3INZA 2DL7A 2M51A 1AHJB 1ZSZC 1I07A 4QT7A 3L2RA 2XDBA 1AT1B 4ESRA 1M27C 2JTMA 4A4FA 2OTJQ 4BDYA 1UGVA 3KXTA 2F1LA 2X3XD 3CCUA 3V7RA 1O75A 1D0XA 2ABLA 1OZ3A 2GCXA 5GANe 4IIOA 4RTVA 4J7IA 5GAOr 1I8FA 1VQ5Q 2J05A 1R0BG 5IXFA 2LX7A 2HSPA 2NUTA 2HBPA 1LNXA 4B9WA 2E6NA 2JT4A 4BE1A 3CCSQ 3EG2A 3I9QA 2NUTB 5GANg 2E6ZA 1KQSP 1Q7YC 2RQRA 2RHIA 3CMEQ 2HQHA 4XU1A 2DA9A 4BE2A 1N6AA 2MYSA 3AHUA 3RKXA 4J9HA 2DXCA 1IB8A 4LDYA 4WCIA 1WPYA 1I5OB 3VRYA 4ANJA 2DERA 5CKEA 5CQYA 4J9IA 1BIAA 1QKWA 2FG0A 3CMAQ 1YHQT 2G6FX 3VS7A 3QKJA 2RQUA 3CBMA 1Q86U 1PD1A 1NYGA 1ZHIA 3X25B 3KFVA 2LRQA 3JAME 4PJOC 2YT6A 4C0DC 3VUBA 4LUDA 3PIOA 3OBYA 3RIRA 2A0FB 2GQIA 2QQRA 4Z8AA 1VQMQ 3VYHB 2ED1A 3GF5A 2DZCA 1RAFB 1PC0A 2QQAA 3FDRA 2CKKA 4J6WA 3L2WA 2LX9A 4EMKB 5GAN6 3EGDA 1YJNT 3S3OA 2CP3A 3MJXA 1AWXA 1JRIA 2JS0A 1AD5A 1VQKT 3L2UA 2RHXA 4JPBW 4M75F 1K9MU 1RAIB 2KSSA 1Q81U 2EGCA 1QCNA 2FZCB 5DLOA 5GANj 1FWZA 2K57A 4FYWB 3M56A 2EW3A 4RTZA 2AIRB 4RTXA 2RPNA 1SSHA 3HKSA 4OB1B 2O88A 5L8RE 3CCUT 2MWPA 3NMZC 3J7AF 1K1ZA 5KYXB 1YITA 2KYMA 2FPEA 1RAHB 4KGXB 3L2VA 1FMVA 4LDXA 1LVKA 5DY9A 2ZPGB 1K73C 2GNCA 4RTUA 4A4HA 1SRLA 3T9NA 1KFZA 4RUGA 3S6WA 3N5BB 9ATCB 6AT1B 3NTIA 1RL2A 3TQ7P 3OYBA 4DBRA 1NPRA 4M78G 3QWXX 2H8HA 2AKLA 3CCQT 4NOYA 1IZ6A 1LCKA 3JB9D 2GF7A 2Y4YA 1W70A 2KY9A 2RJCA 2KVQG 2DZ9A 2MAMA 8AT1B 2CZ6B 2FYKA 3LGLA 2O4XB 2GFUA 2YSQA 4X34A 3OBWA 2CUBA 2M0OA 5HK3A 3CCMQ 4Y92A 2DVEA 3JCMb 1RLQC 2QDYB 3LYIA 1MHNA 1M1GA 3ULRB 4LD6A 1VYTA 1QVPA 2YRCA 1OPLA 3M9QA 4J7FA 4PJOF 2LNVA 1FYNA 1FMKA 1YJNQ 3FLGA 5KYWA 1VQ5T 4KRTA 1UTIA 2DJQA 1LJOA 1M2VB 1OULA 3CPWA 2RI3A 2DEQA 1BYMA 4BDZA 2DKGA 1YFNA 1YIJT 2R5MA 4M7DC 1FX7A 4XTYA 3NHNA 1T0HA 1OPKA 1JXMA 2M02A 1ZA1B 4OMLA 2WSCE 1GL5A 2GTJA 1RI0A 2JZ2A 1N27A 3CCLA 4D8KA 1TH7A 4MMKA 2EGEA 1WJRA 5KCOA 5LJ5f 3SWNB 2GFAA 3G71Q 1YHQA 4HCKA 1NLOC 4BI4A 4P5NA 1Q7YU 4EMKC 2ZCFB 2QEXT 3TSWA 2MOXA 4JLIA 1MUZA 4N0AA 4EPCA 3Q1JA 4GY5A 2KR3A 3MEAA 4HCZA 4II1A 3OB9A 3VS1A 2EIFA 2GBQA 4LNPA 4M75B 4M78D 1QLYA 4FW2A 2COWA 4E7JA 3UWNA 4M75D 1V29B 4M75A 3OYAA 4M77F 2O2OA 4KH1B 2KRNA 2BIVA 1Q95G 5AT1B 3VU3C 2D8HA 2CS7A 3A8MB 1JJ2P 4GLKA 2QASA 1IHVA 2RHZA 1XJWB 2HAXA 2JW4A 3E9FA 2D6FA 1ARKA 4JS4A 3QXEB 4PNOA 2O01E 4DOVA 1X01A 2AZVA 5C0MA 1VQLA 2X4JA 3CCRT 2C06A 3CC2T 3REBB 2DXUA 2KT8A 3ZFJA 1ZBXA 1ABOA 3A8GB 1AVZC 2L2PA 2J6OA 5GAN7 3CC4A 2DTOA 2E70A 1YJNA 2F69A 1TTHB 4FCYA 4F7UB 2HCKA 1NEBA 3CCJT 4XK8E 4C5GA 2EQMA 4J83A 8ATCB 1VQLQ 2Y4XA 5LJ3h 1Y71A 4JS5A 2DM1A 2JM8A 3G4SA 1TWBA 3EG1A 4LDVA 1EX4A 2BKDN 2DXTA 2MIOA 4PLLA 4E7HA 2QTXA 2Z0WA 1CSKA 2RJEA 4C5IA 4R56A 5KYXA 3NTHA 1WHMA 3JRZA 3LLRA 4C92A 1Q86R 4LDWA 1U1TA 4HA8A 1TUCA 2F2XA 4IUVA 1VQ9A 3VS0A 1IO6A 1NLPC 3HFOA 2BZYA 2M1HA 1V76A 1F1BB 1W2BP 1WQWA 1WYXA 2LJ0A 1B7TA 2D1XA 4IUUA 3SHWA 3QSUA 4JLGA 5A0LA 5KH6A 3CMAT 1KSWA 2LDMA 2L0AA 2VGMA 2AKKA 2LQNA 2MCNA 4HT8A 1YI2A 3LH0A 4N4GA 2NYSA 4FW1A 1KQSS 5C6SA 2MWOA 4OMQA 2FL7A 3OY9A 3DLLA 2D0QB 2K6DA 3JSCA 3H0FA 1K0XA 2FZKB 5M9OA 1HXDA 3URGA 1VQNQ 2KDSA 2EQKA 1H641 3UA6A 2ZPIB 2RQVA 4KT0E 4DOWA 5IHKA 1I0CA 2LZ6B 3META 3ZBDA 3CBPA 1XNIA 2EQJA 1RLPC 1YWOA 1OQKA 4JJCA 5LJ5h 3CCLQ 3LGFA 2IPOB 4IUPA 2DJZA 1WLPB 4C8QD 3RERA 2RD1A 2A3LA 2M0YA 3C95A 3BY7A 3QYHB 2I2LA 5KCHA 5KYWB 4OGEA 1AZGB 1U8RA 1X6GA 2EKHA 2QGGA 2HKNA 2K5FA 3TCJA 4M77G 2DTHA 1GBRA 2ZPEB 2DMOA 1H3ZA 4JZ4A 1YITT 2DL3A 5J26A 2WSFE 1M3CA 1Y96B 2X4WA 1GCQC 3V8JA 2ZPFB 3HHTB 1Y57A 1VYVA 3TU4K 4HXJA 1UHFA 3PIPA 3EFSA 1Y96A 2E3IA 2LCLA 1UGSB 4M78C 2W10A 5GMKj 2MK5A 3OYCA 4OGCA 3EGDB 1IREB 2WSEE 4WTOB 1R8OB 4RTYA 1OV3A 3CCQQ 1SG5A 1VUBA 3FC3A 2CZ1B 5GAOp 2DPPB 2AK5A 2F2WA 2FHDA 2FPDA 2KE9A 3VKIA 3ER0A 3WVDB 1LPLA 3FB9A 5D6WA 2C0OA 3OMCA 3V8LA 2PTKA 2A7YA 2EJGA 4ZNXA 1NJIU 2LMJA 3OMGA 2RQTA 2A08A 1HJDA 4FL6A 2CP0A 3GOXA 1D1CA 3QJYA 2EAYA 1XOVA 3OYNA 1X2QA 3OYMA 3CD6A 2CSIA 3JB9J 3UATA 4DBQA 3GPLA 5GAOm 3JCMc 4BACA 2OTJA 4PJOD 3OW2S 3M0PA 1WX6A 3M55A 5KYUB 1QQJA 2YUOA 4RMOA 1KC8R 1MNDA 2BE7D 3NPFA 1UECA 3EGXA 4FYYB 4C5HA 1KD1C 2E10A 1CKAA 2B8AA 2MMPA 1QCFA 2RF0A 1K8AR 2C0IA 1P92A 1SRMA 3HL8A 5FROA 3JCMV 2KAFA 4LUEA 2E41A 3UA7A 1C0MA 2CT3A 4RTWA 2PVDB 1BK2A 1KK7A 2XD0A 2XI9A 4XTXA 4M75G 2VWFA 4PJJA 2OX7A 2DL8A 3RMSA 1KQ2A 1K8AC 1M1KU 4FSXA 3CC4Q 4BE0A 3QJ6A 3OS5A 3F70A 2HDAA 2XMFA 1VQ7Q 5GAN2 2D8JA 4C0GA 3VRZA 4C5EA 1H92A 1H3HA 2L8DA 4Q5WA 2BE9B 2IG0A 2E5QA 4FM4B 1C1AA 4AMCA 4CC2A 4M7AG 3OS0A 3AT1B 2DYBA 4XTVA 1JJ2S 1QP3A 4F16A 3MP8A 2OTLA 4DEYA 1W2BA 1M9SA 4AG2C 1WGSA 3EG0A 4MMLA 3P8DA 1IRXA 1G3YA 4F17A 3OYHA 3EFRA 3CCVQ 4E7KA 4F14A 3X26B 3PE0A 1PRMC 2DE0X 1B3QA 1VQ6Q 3JB9G 4DA4A 1M90U 3QWYA 2K3XA 5CKDA 4PJOE 1VQPT 2PUKB 4CC4B 1JEGA 3BDUA 1BCMA 1RUWA 4DBFA 3I56Q 2X3WD 4RKUE 3VV0A 3GBQA 3L42A 1VQ4Q 1D0ZA 3ZEHA 3UDCA 1WHKA 1QVGS 2RN8A 4B6MA 1BI0A 4PFPA 3CMAA 2EYWA 2EYQA 4FT4A 1QVGA 2FRWA 5GAMh 1AEYA 1JBMA 1W4SA 2I0NA 5GAMd 2EBPA 1K4US 3OW2A 2E5KA 1GXIE 3JCMP 1GRIA 1Q86C 1JXOA 3NGPA 5ECAA 2EQUA 2LQ8A 1VQ8A 5IHNA 3EG3A 3CD6Q 2EYXA 2JTEA 4KH0B 3UT1A 2RJFA 4PJOG 3G6EQ 1AWWA 1AZEA 3VS3A 4AG1C 4O5VA 1EFNA 2MF2A 1TXQA 4CC7A 2EJFA 2CDTA 2F5KA 2P4RA 3A8OB 3MEWA 3CPFA 1UEBA 3CCQA 3I55A 3OW2P 2MPXC 1YBYA 3QG1A 3M0TA 1MMAA 4M78A 1UGPB 3CCEQ 3TREA 1RACB 1ZUUA 3OYYA 4IIMA 2DLPA 3RKWA 3G6EA 3PTAA 1BIBA 2K4YA 2WACA 2XDDA 5HY6A 4XQ3A 1WDXA 1EIFA 3SEMA 4BI8B 1YIJA 4ZGDB 1CKBA 1T0JA 4C92E 1XTDA 2HQEA 5LJ3g 4JJDA 1RAEB 1K76A 1NE8A 4M78F 1R0CB 1M3BA 2W0ZA 4M75E 5LJ5e 4XU2A 4A4KA 4NS5A 3CD6T 2VASA 3EAEA 3QYGB 5LL6S 3QZ5B 3E2UA 2H3EB 4IURA 4V2SA 2DD4A 4IUQA 1X43A 3CCJQ 1PM3A 4M77A 2KMTA 3OS2A 2ENMA 3EFOA 3LH5A 4AT1B 5GANf 3MPUB 3OA6A 2KXDA 1AOJA 3CQTA 3E19A 1ZSGA 5LJ3j 4OF1A 2KXCA 1S72T 1GCQA 5GAMj 2VKNA 3PMTA 4E7IA 4OB0B 4BB7A 5FU7C 2LT1A 3LW5E 3RUXA 3SFMA 3CCRQ 1WIEA 3CCRA 1T3SA 4C8QC 3JCMg 4PFOA 4M7DE 5D7UA 3X28B 1WXBA 3HRTA 5D6XA 3C0CA 3BW1A 1B34B 1DJ7B 3M4YA 4XAXB 2K9GA 3JCMd 5FRMA 4K11A 1MNEA 1VQLT 4J9EA 1I5LA 4A4EA 1M3AA 1SF9A 2E4HA 2VB6A 3CMEA 4J9GA 2A36A 2DNUA 1VQOA 2RMOA 4C92D 3CCSA 1NG2A 4D8DA 4F04B 5CQXA 1SPKA 3SB2A 1G2BA 3CCEA 1AWJA 1EZZB 5L23A 2RH2A 2RNAA 2VXEA 1TS9A 2PVOB 1B07A 1Q7YR 2D0NA 4A54A 5HKCA 1QW1A 1YIJQ 3O8VA 2LQWA 3REAB 2COZA 2K5LA 4C0FA 5KYNA 3EH1A 1PCXA 2NLUA 2QA4Q 2LJ3A 1S72A 1JO8A 4E6RA 4J6YA 1WXUA 4PJNA 3G1JA 2YLBA 4OMNA 1HYOA 3FIFA 2XHCA 1K9MC 1PG5B 2K3BA 3H9NA 1PWTA 4KGZB 1VA7A 1PKTA 1M30A 4HKEA 2FZGB 2P0QA 4KUDK 2J6KA 1QCOA 2RJDA 1D3BA 2DEUA 2R5AA 1HD3A 1IGQA 3X20B 5GAOn 1VQNA 3HFNA 1OEBA 4Z88A 2NUPB 1NJIR 3CEYA 2QI2A 1M2VA 4ZGJB 4M7DB 2BTTA 3O5ZA 2KRSA 2L5QA 2XIDA 4C8QG 1WZOA 3OYDA 2FB7A 4MZMA 4QVCA 2K2VA 1UGQB 4M7DA 3BDLA 2QXFA 2BZ8A 4OB3B 1U3OA 2EJ9A 3V7CA 2V1RA 2HL3A 1SSFA 5GANd 4M7AA 4J8OA 2HKQB 2VV5A 2ZPBB 4JRQA 1G83A 1PSEA 2X4YA 2K2MA 2YDLA 2DL4A 1TG0A 3OSSC 5I21A 5CKBA 1LOJA 3QBYA 3M57A 3SWNA 1BI2A 1WNLA 3A98A 3MCAB 1I1JA 1UGRB 4XU3A 4QVZA 1K73R 2DD5A 1E6HA 3MO8A 5CCAA 1UFFA 1D09B 5D6YA 2P4TA 2DL5A 4C92G 2AZSA 1M90C 2YWWA 3GP8A 3HRUA 3QUIA 3OYLA 2VGNA 3M54A 1NZ9A 3ASKA 1M4ZA 1VQOQ 2GGRA 2Y90A 4GBQA 3VS2A 2X4XA 4VUBA 3RDVA 1MV0B 2PZ1A 1NM7A 1VYUA 2ECZA 3G7ZA 4OB2B 1JJ2A 4L59A 3OYEA 5I22A 3CCST 4YTLA 3OYIA 4M7AF 1U06A 2V8JA 2DILA 3G71A 1QMCA 1KQ1A 3MEVA 1RABB 1IGUA 3DKMA 5FLXE 3QDRB 4PJOA 1IXDA 4ATOA 5I2SA 2L3SA 3G6ET 3JCMh 3RR6A 2COYA 2AHJB 1VQMA 1ZUYA 2A37A 2VVKA 3JCMW 5GAOl 2HMAA 5KYYB 1O9SA 3JCMQ 4HVUA 4M7DD 5GMKh 1PNJA 1VQ9Q 4QVDA 1WHGA 3A5ZB 3E9GA 1X27A 3P8BB 3SWNC 3I5RA 3MKDA 4MZTA 2QEXA 2OAUA 1GCPA 1ZSZA 4RCCA 1T3LA 2BZXA 4R55A 3S3NA 3HP9A 2QYZA
chains in the Genus database with same CATH topology
2J7IA 4Y92A 2D8JA 1H92A 3VRZA 1H3HA 1RLQC 2CREA 1MV3A 2O9VA 2LNHB 4DEXA 1YWPA 2EYZA 3ULRB 4CC2A 1YCSB 1WFWA 1VYTA 2DYBA 4F16A 1OOTA 3M0UA 2KBTA 1OPLA 4DEYA 4AG2C 2RQWA 3EG0A 4CC3A 4F17A 3IQLA 1YP5A 2SEMA 1FYNA 1UHCA 4F14A 1FMKA 1WXTA 2OJ2A 1K9AA 3PE0A 1PRMC 2DE0X 1B3QA 3I35A 4A63B 4KRTA 1UTIA 2DJQA 3QWYA 2KEAA 1BU1A 2K7AA 2KYBA 2FEIA 2J6FA 4CC4B 2EGAA 1JEGA 3ZL7C 3R6NA 1AWOA 1RUWA 3PVQA 4LE9A 2X3WD 2DRKA 3GBQA 5I11A 3NHNA 1T0HA 1OPKA 1JXMA 2V1QA 2L3QA 4OMLA 2O9SA 1GL5A 2RN8A 2GTJA 1W6XA 2EYWA 2NUZA 2FRWA 3H41A 1AEYA 4D8KA 1HSQA 2EGEA 2I0NA 2PNIA 2EBPA 4HVVA 1K4US 2E5KA 1GRIA 2HEQA 4HCKA 1NLOC 2JM9A 2ESWA 1JXOA 3NGPA 1SHFA 4HVWA 5ECAA 5IHNA 1Z9ZA 3EG3A 2EYXA 2JTEA 3RNJA 2QDLA 2O31A 1AWWA 1AZEA 3VS3A 1NEGA 3TSWA 2MOXA 4AG1C 1EFNA 1M8MA 1QWEA 1H8KA 4OMPA 4OMOA 1MUZA 2DX1A 1BB9A 1UE9A 4X1VA 4CC7A 1ZUKA 1JU5C 1S1NA 2IIMA 2KR3A 2CDTA 2LP5A 1UJYA 2HBWA 1QKXA 2P4RA 1GFCA 3VS1A 1NYFA 5HCKA 4AFUC 5IH2A 5IHIA 2GBQA 4LNPA 1QLYA 3M0TA 2EYYA 2FPFA 3VS6A 1ZUUA 1E6GA 4IIMA 3VS5A 2DLPA 1ZX6A 3JV3A 1WDXA 2O2OA 3SEMA 2KRNA 1CKBA 1T0JA 2D8HA 2ROTA 1WI7A 4GLMA 4JJDA 1UJ0A 1KIKA 1K76A 3M0SA 1M3BA 2SRCA 2W0ZA 3VS4A 3THKA 2JW4A 2YUPA 1PKSA 2EQIA 1ARKA 4J9DA 2CH4A 2GTOA 1E7OA 2AZVA 1GFDA 3EHRA 2JMAA 3REBB 1X43A 2KT8A 2ED0A 2ENMA 2DBMA 1ABOA 4EIKA 3LH5A 2KXDA 1AVZC 3M0QA 3EGUA 3H0IA 2L2PA 1AOJA 2JS2A 3CQTA 2OI3A 2J6OA 4Z89A 1ZSGA 2CT4A 2C0TA 3I5SA 1RI9A 2KXCA 2HCKA 1GCQA 2VKNA 5GJVB 1X6BA 1NEBA 1JQQA 1WIEA 1T3SA 4J9BA 2DM1A 2J06A 2JM8A 3EG1A 1WXBA 1N5ZA 3C0CA 5FWBA 4JZ3A 2MIOA 2K9GA 3EHQA 1CSKA 2EPDA 4K11A 2CUDA 5FWCA 4J9EA 1ZBJA 2YUNA 1M3AA 2DRMA 4J9GA 2A36A 3UF4A 1J3TA 2DNUA 2KGTA 2YUQA 3TVTA 2DVJA 2RMOA 1TUCA 2F2XA 1NG2A 4RTTA 4D8DA 3VS0A 1IO6A 1NLPC 1SPKA 2BZYA 5GJWB 1G2BA 1WYXA 2LJ0A 4J9FA 2D1XA 1AWJA 5L23A 2RNAA 1UDLA 3SHWA 2LCSA 1PRLC 2L3PA 1B07A 1KSWA 2L0AA 2KRMA 1UG1A 2AKKA 2LQNA 2MCNA 1KJWA 2D0NA 4AFSC 1Y0MA 4OMQA 1YNZA 1PHTA 1W1FA 2K6DA 2DL7A 1U5SA 2M51A 1WA7A 3H0FA 1K0XA 2LQWA 1I07A 4LN2A 3REAB 4QT7A 3PVLA 2JMCA 4ESRA 3UA6A 1M27C 4AFZC 2LJ3A 2RQVA 1JO8A 4E6RA 1UGVA 1WXUA 4R0KA 5IHKA 1I0CA 4OMNA 2LZ6B 2X3XD 2FO0A 2ABLA 2K3BA 1PWTA 1SHGA 1VA7A 1PKTA 1M30A 4IIOA 4RTVA 1RLPC 1YWOA 4JJCA 2J6KA 2J05A 5IXFA 2LX7A 2HSPA 3U23A 1HD3A 1SEMA 1WLPB 2DBKA 2M0YA 2JT4A 1OEBA 1QWFA 3EG2A 3I9QA 4M4ZA 4Z88A 1AZGB 1X6GA 2EKHA 2RQRA 2DA9A 4AFQC 2BTTA 3O5ZA 2KRSA 1GBRA 4J9HA 1ZLMA 4WCIA 3VRYA 2DMOA 4JZ4A 4J9IA 2DL3A 1QKWA 2FG0A 1M3CA 2KNBB 2G6FX 2BZ8A 1U3OA 3VS7A 2RQUA 3RBBB 1GCQC 2V1RA 1NYGA 2NWMA 1Y57A 1VYVA 3KFVA 4HXJA 1UHFA 1G83A 1UUEA 2YT6A 2K2MA 2YDLA 2W10A 4LUDA 5IXBA 2DL4A 1TG0A 2GQIA 4Z8AA 4RTYA 2ED1A 1OV3A 3A98A 1I1JA 2KROA 1E6HA 1UFFA 3TSZA 2AK5A 2F2WA 3FJ5A 2DL5A 2FPDA 1AWXA 2KE9A 4JJBA 4J9CA 2AZSA 2JS0A 1AD5A 2C0OA 2PTKA 2LJ1A 2FRYA 4ZNXA 2LMJA 2JXBA 2B86A 5EC7A 4JPBW 5FW9A 2RQTA 2A08A 1HJDA 2GGRA 2EGCA 4GBQA 3VS2A 1GBQA 1ABQA 1X69A 1MV0B 1A0NB 2EVRA 2PZ1A 1NM7A 1VYUA 1XOVA 1YN8A 2ECZA 2OAWA 2EW3A 4RTZA 1X2QA 4RTXA 2CSIA 5I22A 2RPNA 1SSHA 4OMMA 2O88A 2DF6A 3UATA 1BBZA 1U06A 2KT1A 3NMZC 2DILA 1K1ZA 2F2VA 2KYMA 1Z9QA 2FPEA 3M0PA 1WX6A 2CSQA 2YUOA 1TUDA 2L3SA 3NPFA 1UECA 2GNCA 4RTUA 1CKAA 1SRLA 1QCFA 1KFZA 2RF0A 4RUGA 2C0IA 1SRMA 1ZUYA 1K0SA 2A37A 2CH4W 4LUEA 1X2KA 2ROLA 2VVKA 3UA7A 2CT3A 4RTWA 1BK2A 3QWXX 2H8HA 3H0HA 4HVUA 2A28A 2AKLA 1LCKA 1PNJA 2VWFA 1W70A 4FSSA 2DL8A 2K79A 1X27A 3M0RA 3I5RA 2YSQA 1GCPA 1T3LA 1V1CA 2HDAA 2XMFA 2BZXA 2CUBA 4ORZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7I A;  4Y92 A;  2D8J A;  1H92 A;  3VRZ A;  1H3H A;  1RLQ C;  2CRE A;  1MV3 A;  2O9V A;  2LNH B;  4DEX A;  1YWP A;  2EYZ A;  3ULR B;  4CC2 A;  1YCS B;  1WFW A;  1VYT A;  2DYB A;  4F16 A;  1OOT A;  3M0U A;  2KBT A;  1OPL A;  4DEY A;  4AG2 C;  2RQW A;  3EG0 A;  4CC3 A;  4F17 A;  3IQL A;  1YP5 A;  2SEM A;  1FYN A;  1UHC A;  4F14 A;  1FMK A;  1WXT A;  2OJ2 A;  1K9A A;  3PE0 A;  1PRM C;  2DE0 X;  1B3Q A;  3I35 A;  4A63 B;  4KRT A;  1UTI A;  2DJQ A;  3QWY A;  2KEA A;  1BU1 A;  2K7A A;  2KYB A;  2FEI A;  2J6F A;  4CC4 B;  2EGA A;  1JEG A;  3ZL7 C;  3R6N A;  1AWO A;  1RUW A;  3PVQ A;  4LE9 A;  2X3W D;  2DRK A;  3GBQ A;  5I11 A;  3NHN A;  1T0H A;  1OPK A;  1JXM A;  2V1Q A;  2L3Q A;  4OML A;  2O9S A;  1GL5 A;  2RN8 A;  2GTJ A;  1W6X A;  2EYW A;  2NUZ A;  2FRW A;  3H41 A;  1AEY A;  4D8K A;  1HSQ A;  2EGE A;  2I0N A;  2PNI A;  2EBP A;  4HVV A;  1K4U S;  2E5K A;  1GRI A;  2HEQ A;  4HCK A;  1NLO C;  2JM9 A;  2ESW A;  1JXO A;  3NGP A;  1SHF A;  4HVW A;  5ECA A;  5IHN A;  1Z9Z A;  3EG3 A;  2EYX A;  2JTE A;  3RNJ A;  2QDL A;  2O31 A;  1AWW A;  1AZE A;  3VS3 A;  1NEG A;  3TSW A;  2MOX A;  4AG1 C;  1EFN A;  1M8M A;  1QWE A;  1H8K A;  4OMP A;  4OMO A;  1MUZ A;  2DX1 A;  1BB9 A;  1UE9 A;  4X1V A;  4CC7 A;  1ZUK A;  1JU5 C;  1S1N A;  2IIM A;  2KR3 A;  2CDT A;  2LP5 A;  1UJY A;  2HBW A;  1QKX A;  2P4R A;  1GFC A;  3VS1 A;  1NYF A;  5HCK A;  4AFU C;  5IH2 A;  5IHI A;  2GBQ A;  4LNP A;  1QLY A;  3M0T A;  2EYY A;  2FPF A;  3VS6 A;  1ZUU A;  1E6G A;  4IIM A;  3VS5 A;  2DLP A;  1ZX6 A;  3JV3 A;  1WDX A;  2O2O A;  3SEM A;  2KRN A;  1CKB A;  1T0J A;  2D8H A;  2ROT A;  1WI7 A;  4GLM A;  4JJD A;  1UJ0 A;  1KIK A;  1K76 A;  3M0S A;  1M3B A;  2SRC A;  2W0Z A;  3VS4 A;  3THK A;  2JW4 A;  2YUP A;  1PKS A;  2EQI A;  1ARK A;  4J9D A;  2CH4 A;  2GTO A;  1E7O A;  2AZV A;  1GFD A;  3EHR A;  2JMA A;  3REB B;  1X43 A;  2KT8 A;  2ED0 A;  2ENM A;  2DBM A;  1ABO A;  4EIK A;  3LH5 A;  2KXD A;  1AVZ C;  3M0Q A;  3EGU A;  3H0I A;  2L2P A;  1AOJ A;  2JS2 A;  3CQT A;  2OI3 A;  2J6O A;  4Z89 A;  1ZSG A;  2CT4 A;  2C0T A;  3I5S A;  1RI9 A;  2KXC A;  2HCK A;  1GCQ A;  2VKN A;  5GJV B;  1X6B A;  1NEB A;  1JQQ A;  1WIE A;  1T3S A;  4J9B A;  2DM1 A;  2J06 A;  2JM8 A;  3EG1 A;  1WXB A;  1N5Z A;  3C0C A;  5FWB A;  4JZ3 A;  2MIO A;  2K9G A;  3EHQ A;  1CSK A;  2EPD A;  4K11 A;  2CUD A;  5FWC A;  4J9E A;  1ZBJ A;  2YUN A;  1M3A A;  2DRM A;  4J9G A;  2A36 A;  3UF4 A;  1J3T A;  2DNU A;  2KGT A;  2YUQ A;  3TVT A;  2DVJ A;  2RMO A;  1TUC A;  2F2X A;  1NG2 A;  4RTT A;  4D8D A;  3VS0 A;  1IO6 A;  1NLP C;  1SPK A;  2BZY A;  5GJW B;  1G2B A;  1WYX A;  2LJ0 A;  4J9F A;  2D1X A;  1AWJ A;  5L23 A;  2RNA A;  1UDL A;  3SHW A;  2LCS A;  1PRL C;  2L3P A;  1B07 A;  1KSW A;  2L0A A;  2KRM A;  1UG1 A;  2AKK A;  2LQN A;  2MCN A;  1KJW A;  2D0N A;  4AFS C;  1Y0M A;  4OMQ A;  1YNZ A;  1PHT A;  1W1F A;  2K6D A;  2DL7 A;  1U5S A;  2M51 A;  1WA7 A;  3H0F A;  1K0X A;  2LQW A;  1I07 A;  4LN2 A;  3REA B;  4QT7 A;  3PVL A;  2JMC A;  4ESR A;  3UA6 A;  1M27 C;  4AFZ C;  2LJ3 A;  2RQV A;  1JO8 A;  4E6R A;  1UGV A;  1WXU A;  4R0K A;  5IHK A;  1I0C A;  4OMN A;  2LZ6 B;  2X3X D;  2FO0 A;  2ABL A;  2K3B A;  1PWT A;  1SHG A;  1VA7 A;  1PKT A;  1M30 A;  4IIO A;  4RTV A;  1RLP C;  1YWO A;  4JJC A;  2J6K A;  2J05 A;  5IXF A;  2LX7 A;  2HSP A;  3U23 A;  1HD3 A;  1SEM A;  1WLP B;  2DBK A;  2M0Y A;  2JT4 A;  1OEB A;  1QWF A;  3EG2 A;  3I9Q A;  4M4Z A;  4Z88 A;  1AZG B;  1X6G A;  2EKH A;  2RQR A;  2DA9 A;  4AFQ C;  2BTT A;  3O5Z A;  2KRS A;  1GBR A;  4J9H A;  1ZLM A;  4WCI A;  3VRY A;  2DMO A;  4JZ4 A;  4J9I A;  2DL3 A;  1QKW A;  2FG0 A;  1M3C A;  2KNB B;  2G6F X;  2BZ8 A;  1U3O A;  3VS7 A;  2RQU A;  3RBB B;  1GCQ C;  2V1R A;  1NYG A;  2NWM A;  1Y57 A;  1VYV A;  3KFV A;  4HXJ A;  1UHF A;  1G83 A;  1UUE A;  2YT6 A;  2K2M A;  2YDL A;  2W10 A;  4LUD A;  5IXB A;  2DL4 A;  1TG0 A;  2GQI A;  4Z8A A;  4RTY A;  2ED1 A;  1OV3 A;  3A98 A;  1I1J A;  2KRO A;  1E6H A;  1UFF A;  3TSZ A;  2AK5 A;  2F2W A;  3FJ5 A;  2DL5 A;  2FPD A;  1AWX A;  2KE9 A;  4JJB A;  4J9C A;  2AZS A;  2JS0 A;  1AD5 A;  2C0O A;  2PTK A;  2LJ1 A;  2FRY A;  4ZNX A;  2LMJ A;  2JXB A;  2B86 A;  5EC7 A;  4JPB W;  5FW9 A;  2RQT A;  2A08 A;  1HJD A;  2GGR A;  2EGC A;  4GBQ A;  3VS2 A;  1GBQ A;  1ABQ A;  1X69 A;  1MV0 B;  1A0N B;  2EVR A;  2PZ1 A;  1NM7 A;  1VYU A;  1XOV A;  1YN8 A;  2ECZ A;  2OAW A;  2EW3 A;  4RTZ A;  1X2Q A;  4RTX A;  2CSI A;  5I22 A;  2RPN A;  1SSH A;  4OMM A;  2O88 A;  2DF6 A;  3UAT A;  1BBZ A;  1U06 A;  2KT1 A;  3NMZ C;  2DIL A;  1K1Z A;  2F2V A;  2KYM A;  1Z9Q A;  2FPE A;  3M0P A;  1WX6 A;  2CSQ A;  2YUO A;  1TUD A;  2L3S A;  3NPF A;  1UEC A;  2GNC A;  4RTU A;  1CKA A;  1SRL A;  1QCF A;  1KFZ A;  2RF0 A;  4RUG A;  2C0I A;  1SRM A;  1ZUY A;  1K0S A;  2A37 A;  2CH4 W;  4LUE A;  1X2K A;  2ROL A;  2VVK A;  3UA7 A;  2CT3 A;  4RTW A;  1BK2 A;  3QWX X;  2H8H A;  3H0H A;  4HVU A;  2A28 A;  2AKL A;  1LCK A;  1PNJ A;  2VWF A;  1W70 A;  4FSS A;  2DL8 A;  2K79 A;  1X27 A;  3M0R A;  3I5R A;  2YSQ A;  1GCP A;  1T3L A;  1V1C A;  2HDA A;  2XMF A;  2BZX A;  2CUB A;  4ORZ A; 
#chains in the Genus database with same CATH topology
 2J7I A;  5GMK e;  2LTO A;  2X51 A;  1Y07 A;  2CRE A;  1ZSZ B;  1VQO T;  2LNH B;  4DEX A;  4NL2 A;  4C0D B;  4IUT A;  1B34 A;  4JDS A;  2DAQ A;  1WFW A;  3RES A;  1YJW Q;  2YRD A;  3E1S A;  3ME9 A;  1OOT A;  2KK4 A;  2V26 A;  3OYG A;  2KBT A;  4M7A E;  5KE3 A;  2RQW A;  4CC3 A;  1Y7X A;  2K3Y A;  5J39 A;  2SEM A;  4F7U A;  2QEX Q;  1N8R C;  1UHC A;  1VQ6 A;  3NFC A;  1ZQ1 A;  3CBO A;  3I35 A;  3RMQ A;  4A63 B;  1BU1 A;  4XU0 A;  3G71 T;  2EGA A;  3ZL7 C;  2E3H A;  5A0G A;  1BI3 A;  2MI6 A;  2DRK A;  4PFZ A;  4EMK A;  2XDP A;  3JCM e;  5I11 A;  3CC4 T;  2OTL T;  3JB9 H;  2V1Q A;  3HRS A;  4DBH A;  2L3Q A;  3GIB A;  1KC8 U;  1WHJ A;  3L1A A;  3VYG A;  2CZ0 B;  4C8Q E;  3A1P A;  3CCV T;  2HZY A;  1WHL A;  1WJQ A;  1QVF S;  2RO0 A;  2PNI A;  4F7U E;  4MZP A;  3V8K A;  2GQV A;  3CC2 Q;  2XU8 A;  2CP2 A;  1D1A A;  1N9S A;  5FU7 B;  2JM9 A;  3HSB A;  2ESW A;  4HVW A;  1SHF A;  2XIC A;  2RB6 A;  1Z9Z A;  1ZA2 B;  3PNW C;  2QDL A;  4PL6 A;  1VQ4 A;  1G3W A;  2ZZD A;  1M1K R;  1QWE A;  4OMP A;  1M1F A;  2DX1 A;  1BB9 A;  4X1V A;  1ZUK A;  1JU5 C;  2IIM A;  1G5V A;  3MEU A;  1OU8 A;  1UJY A;  2LP5 A;  2HBW A;  1QKX A;  2RI5 A;  1GFC A;  4M78 B;  1NYF A;  5HCK A;  4AFU C;  5CVI A;  5IH2 A;  4QW2 A;  3UPU A;  2JN0 A;  4RCB A;  5IAY A;  2ATC B;  4PLI A;  2FPF A;  2RHU A;  5CK9 A;  4E7S A;  1VQP A;  2O4X A;  1ZX6 A;  2LCC A;  4N0A C;  2AT1 B;  2RK2 A;  5GAO q;  2HSE B;  2ROT A;  1WI7 A;  3M53 A;  3MHX A;  2JUF A;  4E47 A;  3M58 A;  2XK0 A;  2SRC A;  1M2O A;  3VS4 A;  2YUP A;  2EFI A;  3CCL T;  2EQI A;  2QQB A;  4M78 E;  3CXC P;  1PSF A;  2DIQ A;  2F5T X;  2GTO A;  4J9D A;  1E7O A;  5IN1 A;  4ZN3 A;  1IHW A;  1QP2 A;  5EG2 A;  3EHR A;  2VYT A;  3KBG A;  4C8Q F;  4KBM B;  4A4G A;  4QQD A;  2PVG B;  2RHY A;  4FYX B;  3M0Q A;  4C8Q A;  3EGU A;  2DK3 A;  1RAA B;  2JS2 A;  1MMG A;  2OI3 A;  4Z89 A;  4M7D G;  3CCU Q;  3I5S A;  3SDZ A;  1N8R R;  2LC4 A;  3QDF A;  5GJV B;  1X6B A;  2R58 A;  4QQG A;  4M77 E;  3HTR A;  4RG2 A;  3FRN A;  4KUL A;  2M16 A;  2CP5 A;  2X35 A;  1YJW A;  4J9B A;  2J06 A;  3QII A;  3CC7 Q;  1K73 U;  2M9U A;  3C94 A;  3I55 Q;  4ZGE B;  1N5Z A;  3L2Q A;  3EHQ A;  1VQK Q;  1WHH A;  3CCM A;  4BI3 A;  3G4S T;  4RG8 A;  4E2F B;  4L6V 5;  1VQ4 T;  1VQ7 T;  4PJL A;  2YUN A;  2DRM A;  3RKY A;  1J3T A;  4O6J A;  2KGT A;  1VQ8 Q;  2DVJ A;  4IKF A;  1NPP A;  3EG9 B;  4RTT A;  5GJW B;  1BCO A;  4J6X A;  1UDL A;  2YHT A;  2V8I A;  2LCS A;  1PRL C;  2KRM A;  1KJW A;  2QG9 B;  2E65 A;  4AFS C;  2CP7 A;  4ME7 A;  1Q82 C;  1W1F A;  1U5S A;  1VIE A;  4Z02 A;  1WA7 A;  4M77 D;  4LN2 A;  3JB9 I;  2HQX A;  3EGX B;  3PVL A;  2JMC A;  3C4S A;  3DLM A;  4AFZ C;  1G3T A;  5LJ5 j;  4ZTJ A;  1D0Y A;  4R0K A;  4CI0 C;  3CME T;  1Q81 R;  5CO7 A;  2FO0 A;  4XTU A;  1WJS A;  1SHG A;  3EH2 A;  2QQS A;  1YI2 Q;  1HK9 A;  2VUB A;  4N4I A;  3MP6 A;  1X75 C;  4KGV B;  3CCV A;  2DIG A;  1XQH A;  1FXX A;  3JCM J;  3U23 A;  4B9X A;  1SEM A;  2LVM A;  2HL5 C;  2DBK A;  2QA4 T;  4A53 A;  3I56 A;  1UB4 A;  5DLQ E;  3A8L B;  1QWF A;  4M4Z A;  3LWI A;  4BUG A;  2JTF A;  5I2M A;  5DM7 R;  4AFQ C;  1VQ9 T;  2VXF A;  4TVR A;  1ZLM A;  3C12 A;  4ELZ C;  1KD1 U;  1VQ7 A;  1FMW A;  1RAD B;  3J80 E;  5GMK m;  2QAZ A;  3A8H B;  2EKO A;  4M77 B;  1VIF A;  2KNB B;  3EFO B;  4OP0 A;  3RBB B;  2NWM A;  4MDW A;  2XKO C;  4UC4 A;  4PK4 A;  3CC2 A;  5GAM g;  2IVW A;  4DQ2 A;  3PGG A;  3M59 A;  1UUE A;  1KQS A;  5IXB A;  2KQW A;  5A2Q E;  3OYK A;  2DTI A;  1OX9 A;  2KRO A;  1OZ2 A;  1SKU B;  3TSZ A;  3FJ5 A;  2YXY A;  2KI7 A;  1R77 A;  4M7D F;  4JJB A;  4J9C A;  3FEO A;  2X9H A;  5GMK l;  2E64 A;  2LJ1 A;  2FRY A;  1YJ9 A;  3S3M A;  2JXB A;  2B86 A;  2PQW A;  2DO3 A;  5EC7 A;  5FRN A;  2P0K A;  5FW9 A;  3CCM T;  1GBQ A;  1ACM B;  4N4H A;  1ABQ A;  3JCM X;  1G3S A;  1X69 A;  1A0N B;  3OQ5 A;  2EVR A;  3FJP A;  4QQ6 A;  1YN8 A;  2OAW A;  5GAN 3;  3WVE B;  3VJP A;  5HK0 A;  4OMM A;  2DF6 A;  1BBZ A;  2KT1 A;  1YJ9 Q;  3PFS A;  1X6O A;  3D7S B;  2JNG A;  1KD1 R;  2F2V A;  2YLC A;  1Z9Q A;  3QPH A;  1VQP Q;  2HNI A;  1MMD A;  4BY6 C;  2CSQ A;  1VQ6 T;  1PD0 A;  4BY6 B;  1VQ5 A;  4WF2 A;  1TUD A;  3R6O A;  5GAN 8;  1D1B A;  4EMG A;  3PT9 A;  4KUI A;  4D6W A;  4ELY C;  4M7A D;  5KYY A;  1OX8 A;  4HT9 A;  3G4S Q;  4C92 F;  1TUG B;  1K0S A;  5A0D A;  2CH4 W;  1X2K A;  2ROL A;  2V8K A;  1S72 Q;  3L2Z A;  4PJM A;  1KHI A;  1M8V A;  1I4K 1;  4X9D A;  3H0H A;  3OYF A;  2A28 A;  4LD9 K;  3I55 T;  4C8Q B;  1OYX A;  3GNG A;  4FSS A;  2DET A;  5AYF A;  2P84 A;  5LJ3 e;  2K79 A;  4F7U F;  5CKF A;  3M0R A;  3LWH A;  1M5Q 1;  5KE2 A;  1QVF P;  3QZ9 B;  2NUP A;  1V1C A;  4ORZ A;  1BKB A;  2DXB A;  1N9R A;  5GAN 5;  2QA4 A;  3GLX A;  1VQN T;  1MV3 A;  2O9V A;  5CAI A;  4XTW A;  2DYI A;  3M4G A;  1YWP A;  2EYZ A;  1NJI C;  1YCS B;  1TSF A;  3M0U A;  5GAM e;  2LQK A;  3TEE A;  4M7A B;  3IQL A;  1YP5 A;  1WXT A;  4X9C A;  2OJ2 A;  1K9A A;  2K5I A;  1QVG P;  2QTV A;  4FT2 A;  5CR2 A;  3CCE T;  2KEA A;  2BUD A;  2K7A A;  2KYB A;  2FEI A;  2J6F A;  3R6N A;  1N8R U;  1AWO A;  2JOY A;  3PVQ A;  4LE9 A;  2CYZ B;  3CXC A;  3WXM B;  1MGQ A;  1RAG B;  2PU9 B;  2QK0 A;  3J81 E;  3I56 T;  5LJ3 f;  2O9S A;  1W6X A;  1YCY A;  4EDU A;  2NUZ A;  3KUF A;  3BFM A;  3LX7 A;  3H41 A;  5GMK i;  4M7A C;  4C0Z A;  1HSQ A;  4JUV A;  5GAN 4;  4MDX A;  1KC8 C;  4HVV A;  1YI2 T;  2OTL Q;  2P0P A;  2PUO B;  2JVV A;  5KYU A;  5CKH A;  4JRI A;  2RK1 A;  3GNF B;  2ZGW A;  4PKC C;  2HEQ A;  3JB9 F;  5LJ3 d;  5FU6 C;  5IT9 E;  2EWN A;  3RNJ A;  1K8A U;  1M1K C;  2O31 A;  4ZN1 A;  1NEG A;  2FVU A;  5LJ5 d;  3MP1 A;  3CXC S;  3OSV A;  1M8M A;  5GAN h;  1H8K A;  4OMO A;  1OU9 A;  1D3B B;  1UE9 A;  1U1S A;  3DB4 A;  1BI1 A;  1S1N A;  4OVA A;  1JB0 E;  4QKU A;  2ZAE A;  5IHI A;  3CPW P;  3P8H A;  3CC7 A;  4Y91 A;  1YJW T;  4XTZ A;  2EYY A;  4C92 C;  1M90 R;  4JRP A;  3VS6 A;  1E6G A;  3VS5 A;  3JCM f;  1YIT Q;  4LXC A;  3H8Z A;  3JV3 A;  5LJ5 g;  1VOM A;  2QGF B;  3NTK A;  3DB3 A;  4BD3 A;  2CZ7 B;  2E1H A;  1C6V X;  1YJ9 T;  2QQ9 A;  1OI1 A;  4GLM A;  4HCB A;  1Q81 C;  4Y28 E;  1UJ0 A;  1I81 A;  1KIK A;  3X24 B;  2CP6 A;  3M0S A;  4FIB A;  4NL3 A;  1G8X A;  1QVF A;  4OMF B;  3THK A;  1PKS A;  4FYV B;  4J5Y A;  1W2B S;  4HCC A;  2CH4 A;  3HPW A;  4M75 C;  4E7Z A;  1GFD A;  2JMA A;  1K9M R;  2CGH A;  2YRV A;  2ED0 A;  2DBM A;  4F7U G;  1KHC A;  4EIK A;  3PMI A;  2L3R A;  3OYJ A;  3BE3 A;  3H0I A;  2RM4 A;  2CT4 A;  2C0T A;  2L89 A;  1RI9 A;  5FU6 B;  3SD4 A;  1VQ8 T;  1KG1 A;  4FU6 A;  3OS1 A;  4ZTF A;  5J3B A;  4LDU A;  1JQQ A;  1TU0 B;  3H6Z A;  2LT4 A;  4CRI A;  2E12 A;  2G3R A;  5GAM f;  4JJN K;  2D9T A;  5FWB A;  4JZ3 A;  4L5G A;  1VQM T;  3CC7 T;  3V7S A;  2EPD A;  3CPW S;  4EMH A;  2CUD A;  5FWC A;  3EG9 A;  7AT1 B;  4JRK A;  1ZBJ A;  1NBE B;  4PJO B;  2R57 A;  3CCJ A;  3QHS A;  3UF4 A;  2YUQ A;  3TVT A;  4E7L A;  3M5A A;  2DFU A;  2VC8 A;  1WQ7 A;  3QO3 A;  1YHQ Q;  4M77 C;  5CIU A;  4J9F A;  1Q82 R;  4C92 B;  2XG8 D;  2OTJ T;  2RA2 A;  1Q82 U;  1MMN A;  2H3J A;  2L3P A;  3VUZ A;  1UG1 A;  1TOV A;  2HD0 A;  2JJ9 A;  2ZPH B;  1VQK A;  1Y0M A;  1YNZ A;  2RI2 A;  1PHT A;  3INZ A;  2DL7 A;  2M51 A;  1AHJ B;  1ZSZ C;  1I07 A;  4QT7 A;  3L2R A;  2XDB A;  1AT1 B;  4ESR A;  1M27 C;  2JTM A;  4A4F A;  2OTJ Q;  4BDY A;  1UGV A;  3KXT A;  2F1L A;  2X3X D;  3CCU A;  3V7R A;  1O75 A;  1D0X A;  2ABL A;  1OZ3 A;  2GCX A;  5GAN e;  4IIO A;  4RTV A;  4J7I A;  5GAO r;  1I8F A;  1VQ5 Q;  2J05 A;  1R0B G;  5IXF A;  2LX7 A;  2HSP A;  2NUT A;  2HBP A;  1LNX A;  4B9W A;  2E6N A;  2JT4 A;  4BE1 A;  3CCS Q;  3EG2 A;  3I9Q A;  2NUT B;  5GAN g;  2E6Z A;  1KQS P;  1Q7Y C;  2RQR A;  2RHI A;  3CME Q;  2HQH A;  4XU1 A;  2DA9 A;  4BE2 A;  1N6A A;  2MYS A;  3AHU A;  3RKX A;  4J9H A;  2DXC A;  1IB8 A;  4LDY A;  4WCI A;  1WPY A;  1I5O B;  3VRY A;  4ANJ A;  2DER A;  5CKE A;  5CQY A;  4J9I A;  1BIA A;  1QKW A;  2FG0 A;  3CMA Q;  1YHQ T;  2G6F X;  3VS7 A;  3QKJ A;  2RQU A;  3CBM A;  1Q86 U;  1PD1 A;  1NYG A;  1ZHI A;  3X25 B;  3KFV A;  2LRQ A;  3JAM E;  4PJO C;  2YT6 A;  4C0D C;  3VUB A;  4LUD A;  3PIO A;  3OBY A;  3RIR A;  2A0F B;  2GQI A;  2QQR A;  4Z8A A;  1VQM Q;  3VYH B;  2ED1 A;  3GF5 A;  2DZC A;  1RAF B;  1PC0 A;  2QQA A;  3FDR A;  2CKK A;  4J6W A;  3L2W A;  2LX9 A;  4EMK B;  5GAN 6;  3EGD A;  1YJN T;  3S3O A;  2CP3 A;  3MJX A;  1AWX A;  1JRI A;  2JS0 A;  1AD5 A;  1VQK T;  3L2U A;  2RHX A;  4JPB W;  4M75 F;  1K9M U;  1RAI B;  2KSS A;  1Q81 U;  2EGC A;  1QCN A;  2FZC B;  5DLO A;  5GAN j;  1FWZ A;  2K57 A;  4FYW B;  3M56 A;  2EW3 A;  4RTZ A;  2AIR B;  4RTX A;  2RPN A;  1SSH A;  3HKS A;  4OB1 B;  2O88 A;  5L8R E;  3CCU T;  2MWP A;  3NMZ C;  3J7A F;  1K1Z A;  5KYX B;  1YIT A;  2KYM A;  2FPE A;  1RAH B;  4KGX B;  3L2V A;  1FMV A;  4LDX A;  1LVK A;  5DY9 A;  2ZPG B;  1K73 C;  2GNC A;  4RTU A;  4A4H A;  1SRL A;  3T9N A;  1KFZ A;  4RUG A;  3S6W A;  3N5B B;  9ATC B;  6AT1 B;  3NTI A;  1RL2 A;  3TQ7 P;  3OYB A;  4DBR A;  1NPR A;  4M78 G;  3QWX X;  2H8H A;  2AKL A;  3CCQ T;  4NOY A;  1IZ6 A;  1LCK A;  3JB9 D;  2GF7 A;  2Y4Y A;  1W70 A;  2KY9 A;  2RJC A;  2KVQ G;  2DZ9 A;  2MAM A;  8AT1 B;  2CZ6 B;  2FYK A;  3LGL A;  2O4X B;  2GFU A;  2YSQ A;  4X34 A;  3OBW A;  2CUB A;  2M0O A;  5HK3 A;  3CCM Q;  4Y92 A;  2DVE A;  3JCM b;  1RLQ C;  2QDY B;  3LYI A;  1MHN A;  1M1G A;  3ULR B;  4LD6 A;  1VYT A;  1QVP A;  2YRC A;  1OPL A;  3M9Q A;  4J7F A;  4PJO F;  2LNV A;  1FYN A;  1FMK A;  1YJN Q;  3FLG A;  5KYW A;  1VQ5 T;  4KRT A;  1UTI A;  2DJQ A;  1LJO A;  1M2V B;  1OUL A;  3CPW A;  2RI3 A;  2DEQ A;  1BYM A;  4BDZ A;  2DKG A;  1YFN A;  1YIJ T;  2R5M A;  4M7D C;  1FX7 A;  4XTY A;  3NHN A;  1T0H A;  1OPK A;  1JXM A;  2M02 A;  1ZA1 B;  4OML A;  2WSC E;  1GL5 A;  2GTJ A;  1RI0 A;  2JZ2 A;  1N27 A;  3CCL A;  4D8K A;  1TH7 A;  4MMK A;  2EGE A;  1WJR A;  5KCO A;  5LJ5 f;  3SWN B;  2GFA A;  3G71 Q;  1YHQ A;  4HCK A;  1NLO C;  4BI4 A;  4P5N A;  1Q7Y U;  4EMK C;  2ZCF B;  2QEX T;  3TSW A;  2MOX A;  4JLI A;  1MUZ A;  4N0A A;  4EPC A;  3Q1J A;  4GY5 A;  2KR3 A;  3MEA A;  4HCZ A;  4II1 A;  3OB9 A;  3VS1 A;  2EIF A;  2GBQ A;  4LNP A;  4M75 B;  4M78 D;  1QLY A;  4FW2 A;  2COW A;  4E7J A;  3UWN A;  4M75 D;  1V29 B;  4M75 A;  3OYA A;  4M77 F;  2O2O A;  4KH1 B;  2KRN A;  2BIV A;  1Q95 G;  5AT1 B;  3VU3 C;  2D8H A;  2CS7 A;  3A8M B;  1JJ2 P;  4GLK A;  2QAS A;  1IHV A;  2RHZ A;  1XJW B;  2HAX A;  2JW4 A;  3E9F A;  2D6F A;  1ARK A;  4JS4 A;  3QXE B;  4PNO A;  2O01 E;  4DOV A;  1X01 A;  2AZV A;  5C0M A;  1VQL A;  2X4J A;  3CCR T;  2C06 A;  3CC2 T;  3REB B;  2DXU A;  2KT8 A;  3ZFJ A;  1ZBX A;  1ABO A;  3A8G B;  1AVZ C;  2L2P A;  2J6O A;  5GAN 7;  3CC4 A;  2DTO A;  2E70 A;  1YJN A;  2F69 A;  1TTH B;  4FCY A;  4F7U B;  2HCK A;  1NEB A;  3CCJ T;  4XK8 E;  4C5G A;  2EQM A;  4J83 A;  8ATC B;  1VQL Q;  2Y4X A;  5LJ3 h;  1Y71 A;  4JS5 A;  2DM1 A;  2JM8 A;  3G4S A;  1TWB A;  3EG1 A;  4LDV A;  1EX4 A;  2BKD N;  2DXT A;  2MIO A;  4PLL A;  4E7H A;  2QTX A;  2Z0W A;  1CSK A;  2RJE A;  4C5I A;  4R56 A;  5KYX A;  3NTH A;  1WHM A;  3JRZ A;  3LLR A;  4C92 A;  1Q86 R;  4LDW A;  1U1T A;  4HA8 A;  1TUC A;  2F2X A;  4IUV A;  1VQ9 A;  3VS0 A;  1IO6 A;  1NLP C;  3HFO A;  2BZY A;  2M1H A;  1V76 A;  1F1B B;  1W2B P;  1WQW A;  1WYX A;  2LJ0 A;  1B7T A;  2D1X A;  4IUU A;  3SHW A;  3QSU A;  4JLG A;  5A0L A;  5KH6 A;  3CMA T;  1KSW A;  2LDM A;  2L0A A;  2VGM A;  2AKK A;  2LQN A;  2MCN A;  4HT8 A;  1YI2 A;  3LH0 A;  4N4G A;  2NYS A;  4FW1 A;  1KQS S;  5C6S A;  2MWO A;  4OMQ A;  2FL7 A;  3OY9 A;  3DLL A;  2D0Q B;  2K6D A;  3JSC A;  3H0F A;  1K0X A;  2FZK B;  5M9O A;  1HXD A;  3URG A;  1VQN Q;  2KDS A;  2EQK A;  1H64 1;  3UA6 A;  2ZPI B;  2RQV A;  4KT0 E;  4DOW A;  5IHK A;  1I0C A;  2LZ6 B;  3MET A;  3ZBD A;  3CBP A;  1XNI A;  2EQJ A;  1RLP C;  1YWO A;  1OQK A;  4JJC A;  5LJ5 h;  3CCL Q;  3LGF A;  2IPO B;  4IUP A;  2DJZ A;  1WLP B;  4C8Q D;  3RER A;  2RD1 A;  2A3L A;  2M0Y A;  3C95 A;  3BY7 A;  3QYH B;  2I2L A;  5KCH A;  5KYW B;  4OGE A;  1AZG B;  1U8R A;  1X6G A;  2EKH A;  2QGG A;  2HKN A;  2K5F A;  3TCJ A;  4M77 G;  2DTH A;  1GBR A;  2ZPE B;  2DMO A;  1H3Z A;  4JZ4 A;  1YIT T;  2DL3 A;  5J26 A;  2WSF E;  1M3C A;  1Y96 B;  2X4W A;  1GCQ C;  3V8J A;  2ZPF B;  3HHT B;  1Y57 A;  1VYV A;  3TU4 K;  4HXJ A;  1UHF A;  3PIP A;  3EFS A;  1Y96 A;  2E3I A;  2LCL A;  1UGS B;  4M78 C;  2W10 A;  5GMK j;  2MK5 A;  3OYC A;  4OGC A;  3EGD B;  1IRE B;  2WSE E;  4WTO B;  1R8O B;  4RTY A;  1OV3 A;  3CCQ Q;  1SG5 A;  1VUB A;  3FC3 A;  2CZ1 B;  5GAO p;  2DPP B;  2AK5 A;  2F2W A;  2FHD A;  2FPD A;  2KE9 A;  3VKI A;  3ER0 A;  3WVD B;  1LPL A;  3FB9 A;  5D6W A;  2C0O A;  3OMC A;  3V8L A;  2PTK A;  2A7Y A;  2EJG A;  4ZNX A;  1NJI U;  2LMJ A;  3OMG A;  2RQT A;  2A08 A;  1HJD A;  4FL6 A;  2CP0 A;  3GOX A;  1D1C A;  3QJY A;  2EAY A;  1XOV A;  3OYN A;  1X2Q A;  3OYM A;  3CD6 A;  2CSI A;  3JB9 J;  3UAT A;  4DBQ A;  3GPL A;  5GAO m;  3JCM c;  4BAC A;  2OTJ A;  4PJO D;  3OW2 S;  3M0P A;  1WX6 A;  3M55 A;  5KYU B;  1QQJ A;  2YUO A;  4RMO A;  1KC8 R;  1MND A;  2BE7 D;  3NPF A;  1UEC A;  3EGX A;  4FYY B;  4C5H A;  1KD1 C;  2E10 A;  1CKA A;  2B8A A;  2MMP A;  1QCF A;  2RF0 A;  1K8A R;  2C0I A;  1P92 A;  1SRM A;  3HL8 A;  5FRO A;  3JCM V;  2KAF A;  4LUE A;  2E41 A;  3UA7 A;  1C0M A;  2CT3 A;  4RTW A;  2PVD B;  1BK2 A;  1KK7 A;  2XD0 A;  2XI9 A;  4XTX A;  4M75 G;  2VWF A;  4PJJ A;  2OX7 A;  2DL8 A;  3RMS A;  1KQ2 A;  1K8A C;  1M1K U;  4FSX A;  3CC4 Q;  4BE0 A;  3QJ6 A;  3OS5 A;  3F70 A;  2HDA A;  2XMF A;  1VQ7 Q;  5GAN 2;  2D8J A;  4C0G A;  3VRZ A;  4C5E A;  1H92 A;  1H3H A;  2L8D A;  4Q5W A;  2BE9 B;  2IG0 A;  2E5Q A;  4FM4 B;  1C1A A;  4AMC A;  4CC2 A;  4M7A G;  3OS0 A;  3AT1 B;  2DYB A;  4XTV A;  1JJ2 S;  1QP3 A;  4F16 A;  3MP8 A;  2OTL A;  4DEY A;  1W2B A;  1M9S A;  4AG2 C;  1WGS A;  3EG0 A;  4MML A;  3P8D A;  1IRX A;  1G3Y A;  4F17 A;  3OYH A;  3EFR A;  3CCV Q;  4E7K A;  4F14 A;  3X26 B;  3PE0 A;  1PRM C;  2DE0 X;  1B3Q A;  1VQ6 Q;  3JB9 G;  4DA4 A;  1M90 U;  3QWY A;  2K3X A;  5CKD A;  4PJO E;  1VQP T;  2PUK B;  4CC4 B;  1JEG A;  3BDU A;  1BCM A;  1RUW A;  4DBF A;  3I56 Q;  2X3W D;  4RKU E;  3VV0 A;  3GBQ A;  3L42 A;  1VQ4 Q;  1D0Z A;  3ZEH A;  3UDC A;  1WHK A;  1QVG S;  2RN8 A;  4B6M A;  1BI0 A;  4PFP A;  3CMA A;  2EYW A;  2EYQ A;  4FT4 A;  1QVG A;  2FRW A;  5GAM h;  1AEY A;  1JBM A;  1W4S A;  2I0N A;  5GAM d;  2EBP A;  1K4U S;  3OW2 A;  2E5K A;  1GXI E;  3JCM P;  1GRI A;  1Q86 C;  1JXO A;  3NGP A;  5ECA A;  2EQU A;  2LQ8 A;  1VQ8 A;  5IHN A;  3EG3 A;  3CD6 Q;  2EYX A;  2JTE A;  4KH0 B;  3UT1 A;  2RJF A;  4PJO G;  3G6E Q;  1AWW A;  1AZE A;  3VS3 A;  4AG1 C;  4O5V A;  1EFN A;  2MF2 A;  1TXQ A;  4CC7 A;  2EJF A;  2CDT A;  2F5K A;  2P4R A;  3A8O B;  3MEW A;  3CPF A;  1UEB A;  3CCQ A;  3I55 A;  3OW2 P;  2MPX C;  1YBY A;  3QG1 A;  3M0T A;  1MMA A;  4M78 A;  1UGP B;  3CCE Q;  3TRE A;  1RAC B;  1ZUU A;  3OYY A;  4IIM A;  2DLP A;  3RKW A;  3G6E A;  3PTA A;  1BIB A;  2K4Y A;  2WAC A;  2XDD A;  5HY6 A;  4XQ3 A;  1WDX A;  1EIF A;  3SEM A;  4BI8 B;  1YIJ A;  4ZGD B;  1CKB A;  1T0J A;  4C92 E;  1XTD A;  2HQE A;  5LJ3 g;  4JJD A;  1RAE B;  1K76 A;  1NE8 A;  4M78 F;  1R0C B;  1M3B A;  2W0Z A;  4M75 E;  5LJ5 e;  4XU2 A;  4A4K A;  4NS5 A;  3CD6 T;  2VAS A;  3EAE A;  3QYG B;  5LL6 S;  3QZ5 B;  3E2U A;  2H3E B;  4IUR A;  4V2S A;  2DD4 A;  4IUQ A;  1X43 A;  3CCJ Q;  1PM3 A;  4M77 A;  2KMT A;  3OS2 A;  2ENM A;  3EFO A;  3LH5 A;  4AT1 B;  5GAN f;  3MPU B;  3OA6 A;  2KXD A;  1AOJ A;  3CQT A;  3E19 A;  1ZSG A;  5LJ3 j;  4OF1 A;  2KXC A;  1S72 T;  1GCQ A;  5GAM j;  2VKN A;  3PMT A;  4E7I A;  4OB0 B;  4BB7 A;  5FU7 C;  2LT1 A;  3LW5 E;  3RUX A;  3SFM A;  3CCR Q;  1WIE A;  3CCR A;  1T3S A;  4C8Q C;  3JCM g;  4PFO A;  4M7D E;  5D7U A;  3X28 B;  1WXB A;  3HRT A;  5D6X A;  3C0C A;  3BW1 A;  1B34 B;  1DJ7 B;  3M4Y A;  4XAX B;  2K9G A;  3JCM d;  5FRM A;  4K11 A;  1MNE A;  1VQL T;  4J9E A;  1I5L A;  4A4E A;  1M3A A;  1SF9 A;  2E4H A;  2VB6 A;  3CME A;  4J9G A;  2A36 A;  2DNU A;  1VQO A;  2RMO A;  4C92 D;  3CCS A;  1NG2 A;  4D8D A;  4F04 B;  5CQX A;  1SPK A;  3SB2 A;  1G2B A;  3CCE A;  1AWJ A;  1EZZ B;  5L23 A;  2RH2 A;  2RNA A;  2VXE A;  1TS9 A;  2PVO B;  1B07 A;  1Q7Y R;  2D0N A;  4A54 A;  5HKC A;  1QW1 A;  1YIJ Q;  3O8V A;  2LQW A;  3REA B;  2COZ A;  2K5L A;  4C0F A;  5KYN A;  3EH1 A;  1PCX A;  2NLU A;  2QA4 Q;  2LJ3 A;  1S72 A;  1JO8 A;  4E6R A;  4J6Y A;  1WXU A;  4PJN A;  3G1J A;  2YLB A;  4OMN A;  1HYO A;  3FIF A;  2XHC A;  1K9M C;  1PG5 B;  2K3B A;  3H9N A;  1PWT A;  4KGZ B;  1VA7 A;  1PKT A;  1M30 A;  4HKE A;  2FZG B;  2P0Q A;  4KUD K;  2J6K A;  1QCO A;  2RJD A;  1D3B A;  2DEU A;  2R5A A;  1HD3 A;  1IGQ A;  3X20 B;  5GAO n;  1VQN A;  3HFN A;  1OEB A;  4Z88 A;  2NUP B;  1NJI R;  3CEY A;  2QI2 A;  1M2V A;  4ZGJ B;  4M7D B;  2BTT A;  3O5Z A;  2KRS A;  2L5Q A;  2XID A;  4C8Q G;  1WZO A;  3OYD A;  2FB7 A;  4MZM A;  4QVC A;  2K2V A;  1UGQ B;  4M7D A;  3BDL A;  2QXF A;  2BZ8 A;  4OB3 B;  1U3O A;  2EJ9 A;  3V7C A;  2V1R A;  2HL3 A;  1SSF A;  5GAN d;  4M7A A;  4J8O A;  2HKQ B;  2VV5 A;  2ZPB B;  4JRQ A;  1G83 A;  1PSE A;  2X4Y A;  2K2M A;  2YDL A;  2DL4 A;  1TG0 A;  3OSS C;  5I21 A;  5CKB A;  1LOJ A;  3QBY A;  3M57 A;  3SWN A;  1BI2 A;  1WNL A;  3A98 A;  3MCA B;  1I1J A;  1UGR B;  4XU3 A;  4QVZ A;  1K73 R;  2DD5 A;  1E6H A;  3MO8 A;  5CCA A;  1UFF A;  1D09 B;  5D6Y A;  2P4T A;  2DL5 A;  4C92 G;  2AZS A;  1M90 C;  2YWW A;  3GP8 A;  3HRU A;  3QUI A;  3OYL A;  2VGN A;  3M54 A;  1NZ9 A;  3ASK A;  1M4Z A;  1VQO Q;  2GGR A;  2Y90 A;  4GBQ A;  3VS2 A;  2X4X A;  4VUB A;  3RDV A;  1MV0 B;  2PZ1 A;  1NM7 A;  1VYU A;  2ECZ A;  3G7Z A;  4OB2 B;  1JJ2 A;  4L59 A;  3OYE A;  5I22 A;  3CCS T;  4YTL A;  3OYI A;  4M7A F;  1U06 A;  2V8J A;  2DIL A;  3G71 A;  1QMC A;  1KQ1 A;  3MEV A;  1RAB B;  1IGU A;  3DKM A;  5FLX E;  3QDR B;  4PJO A;  1IXD A;  4ATO A;  5I2S A;  2L3S A;  3G6E T;  3JCM h;  3RR6 A;  2COY A;  2AHJ B;  1VQM A;  1ZUY A;  2A37 A;  2VVK A;  3JCM W;  5GAO l;  2HMA A;  5KYY B;  1O9S A;  3JCM Q;  4HVU A;  4M7D D;  5GMK h;  1PNJ A;  1VQ9 Q;  4QVD A;  1WHG A;  3A5Z B;  3E9G A;  1X27 A;  3P8B B;  3SWN C;  3I5R A;  3MKD A;  4MZT A;  2QEX A;  2OAU A;  1GCP A;  1ZSZ A;  4RCC A;  1T3L A;  2BZX A;  4R55 A;  3S3N A;  3HP9 A;  2QYZ A; 
#chains in the Genus database with same CATH homology
 2J7I A;  4Y92 A;  2D8J A;  1H92 A;  3VRZ A;  1H3H A;  1RLQ C;  2CRE A;  1MV3 A;  2O9V A;  2LNH B;  4DEX A;  1YWP A;  2EYZ A;  3ULR B;  4CC2 A;  1YCS B;  1WFW A;  1VYT A;  2DYB A;  4F16 A;  1OOT A;  3M0U A;  2KBT A;  1OPL A;  4DEY A;  4AG2 C;  2RQW A;  3EG0 A;  4CC3 A;  4F17 A;  3IQL A;  1YP5 A;  2SEM A;  1FYN A;  1UHC A;  4F14 A;  1FMK A;  1WXT A;  2OJ2 A;  1K9A A;  3PE0 A;  1PRM C;  2DE0 X;  1B3Q A;  3I35 A;  4A63 B;  4KRT A;  1UTI A;  2DJQ A;  3QWY A;  2KEA A;  1BU1 A;  2K7A A;  2KYB A;  2FEI A;  2J6F A;  4CC4 B;  2EGA A;  1JEG A;  3ZL7 C;  3R6N A;  1AWO A;  1RUW A;  3PVQ A;  4LE9 A;  2X3W D;  2DRK A;  3GBQ A;  5I11 A;  3NHN A;  1T0H A;  1OPK A;  1JXM A;  2V1Q A;  2L3Q A;  4OML A;  2O9S A;  1GL5 A;  2RN8 A;  2GTJ A;  1W6X A;  2EYW A;  2NUZ A;  2FRW A;  3H41 A;  1AEY A;  4D8K A;  1HSQ A;  2EGE A;  2I0N A;  2PNI A;  2EBP A;  4HVV A;  1K4U S;  2E5K A;  1GRI A;  2HEQ A;  4HCK A;  1NLO C;  2JM9 A;  2ESW A;  1JXO A;  3NGP A;  1SHF A;  4HVW A;  5ECA A;  5IHN A;  1Z9Z A;  3EG3 A;  2EYX A;  2JTE A;  3RNJ A;  2QDL A;  2O31 A;  1AWW A;  1AZE A;  3VS3 A;  1NEG A;  3TSW A;  2MOX A;  4AG1 C;  1EFN A;  1M8M A;  1QWE A;  1H8K A;  4OMP A;  4OMO A;  1MUZ A;  2DX1 A;  1BB9 A;  1UE9 A;  4X1V A;  4CC7 A;  1ZUK A;  1JU5 C;  1S1N A;  2IIM A;  2KR3 A;  2CDT A;  2LP5 A;  1UJY A;  2HBW A;  1QKX A;  2P4R A;  1GFC A;  3VS1 A;  1NYF A;  5HCK A;  4AFU C;  5IH2 A;  5IHI A;  2GBQ A;  4LNP A;  1QLY A;  3M0T A;  2EYY A;  2FPF A;  3VS6 A;  1ZUU A;  1E6G A;  4IIM A;  3VS5 A;  2DLP A;  1ZX6 A;  3JV3 A;  1WDX A;  2O2O A;  3SEM A;  2KRN A;  1CKB A;  1T0J A;  2D8H A;  2ROT A;  1WI7 A;  4GLM A;  4JJD A;  1UJ0 A;  1KIK A;  1K76 A;  3M0S A;  1M3B A;  2SRC A;  2W0Z A;  3VS4 A;  3THK A;  2JW4 A;  2YUP A;  1PKS A;  2EQI A;  1ARK A;  4J9D A;  2CH4 A;  2GTO A;  1E7O A;  2AZV A;  1GFD A;  3EHR A;  2JMA A;  3REB B;  1X43 A;  2KT8 A;  2ED0 A;  2ENM A;  2DBM A;  1ABO A;  4EIK A;  3LH5 A;  2KXD A;  1AVZ C;  3M0Q A;  3EGU A;  3H0I A;  2L2P A;  1AOJ A;  2JS2 A;  3CQT A;  2OI3 A;  2J6O A;  4Z89 A;  1ZSG A;  2CT4 A;  2C0T A;  3I5S A;  1RI9 A;  2KXC A;  2HCK A;  1GCQ A;  2VKN A;  5GJV B;  1X6B A;  1NEB A;  1JQQ A;  1WIE A;  1T3S A;  4J9B A;  2DM1 A;  2J06 A;  2JM8 A;  3EG1 A;  1WXB A;  1N5Z A;  3C0C A;  5FWB A;  4JZ3 A;  2MIO A;  2K9G A;  3EHQ A;  1CSK A;  2EPD A;  4K11 A;  2CUD A;  5FWC A;  4J9E A;  1ZBJ A;  2YUN A;  1M3A A;  2DRM A;  4J9G A;  2A36 A;  3UF4 A;  1J3T A;  2DNU A;  2KGT A;  2YUQ A;  3TVT A;  2DVJ A;  2RMO A;  1TUC A;  2F2X A;  1NG2 A;  4RTT A;  4D8D A;  3VS0 A;  1IO6 A;  1NLP C;  1SPK A;  2BZY A;  5GJW B;  1G2B A;  1WYX A;  2LJ0 A;  4J9F A;  2D1X A;  1AWJ A;  5L23 A;  2RNA A;  1UDL A;  3SHW A;  2LCS A;  1PRL C;  2L3P A;  1B07 A;  1KSW A;  2L0A A;  2KRM A;  1UG1 A;  2AKK A;  2LQN A;  2MCN A;  1KJW A;  2D0N A;  4AFS C;  1Y0M A;  4OMQ A;  1YNZ A;  1PHT A;  1W1F A;  2K6D A;  2DL7 A;  1U5S A;  2M51 A;  1WA7 A;  3H0F A;  1K0X A;  2LQW A;  1I07 A;  4LN2 A;  3REA B;  4QT7 A;  3PVL A;  2JMC A;  4ESR A;  3UA6 A;  1M27 C;  4AFZ C;  2LJ3 A;  2RQV A;  1JO8 A;  4E6R A;  1UGV A;  1WXU A;  4R0K A;  5IHK A;  1I0C A;  4OMN A;  2LZ6 B;  2X3X D;  2FO0 A;  2ABL A;  2K3B A;  1PWT A;  1SHG A;  1VA7 A;  1PKT A;  1M30 A;  4IIO A;  4RTV A;  1RLP C;  1YWO A;  4JJC A;  2J6K A;  2J05 A;  5IXF A;  2LX7 A;  2HSP A;  3U23 A;  1HD3 A;  1SEM A;  1WLP B;  2DBK A;  2M0Y A;  2JT4 A;  1OEB A;  1QWF A;  3EG2 A;  3I9Q A;  4M4Z A;  4Z88 A;  1AZG B;  1X6G A;  2EKH A;  2RQR A;  2DA9 A;  4AFQ C;  2BTT A;  3O5Z A;  2KRS A;  1GBR A;  4J9H A;  1ZLM A;  4WCI A;  3VRY A;  2DMO A;  4JZ4 A;  4J9I A;  2DL3 A;  1QKW A;  2FG0 A;  1M3C A;  2KNB B;  2G6F X;  2BZ8 A;  1U3O A;  3VS7 A;  2RQU A;  3RBB B;  1GCQ C;  2V1R A;  1NYG A;  2NWM A;  1Y57 A;  1VYV A;  3KFV A;  4HXJ A;  1UHF A;  1G83 A;  1UUE A;  2YT6 A;  2K2M A;  2YDL A;  2W10 A;  4LUD A;  5IXB A;  2DL4 A;  1TG0 A;  2GQI A;  4Z8A A;  4RTY A;  2ED1 A;  1OV3 A;  3A98 A;  1I1J A;  2KRO A;  1E6H A;  1UFF A;  3TSZ A;  2AK5 A;  2F2W A;  3FJ5 A;  2DL5 A;  2FPD A;  1AWX A;  2KE9 A;  4JJB A;  4J9C A;  2AZS A;  2JS0 A;  1AD5 A;  2C0O A;  2PTK A;  2LJ1 A;  2FRY A;  4ZNX A;  2LMJ A;  2JXB A;  2B86 A;  5EC7 A;  4JPB W;  5FW9 A;  2RQT A;  2A08 A;  1HJD A;  2GGR A;  2EGC A;  4GBQ A;  3VS2 A;  1GBQ A;  1ABQ A;  1X69 A;  1MV0 B;  1A0N B;  2EVR A;  2PZ1 A;  1NM7 A;  1VYU A;  1XOV A;  1YN8 A;  2ECZ A;  2OAW A;  2EW3 A;  4RTZ A;  1X2Q A;  4RTX A;  2CSI A;  5I22 A;  2RPN A;  1SSH A;  4OMM A;  2O88 A;  2DF6 A;  3UAT A;  1BBZ A;  1U06 A;  2KT1 A;  3NMZ C;  2DIL A;  1K1Z A;  2F2V A;  2KYM A;  1Z9Q A;  2FPE A;  3M0P A;  1WX6 A;  2CSQ A;  2YUO A;  1TUD A;  2L3S A;  3NPF A;  1UEC A;  2GNC A;  4RTU A;  1CKA A;  1SRL A;  1QCF A;  1KFZ A;  2RF0 A;  4RUG A;  2C0I A;  1SRM A;  1ZUY A;  1K0S A;  2A37 A;  2CH4 W;  4LUE A;  1X2K A;  2ROL A;  2VVK A;  3UA7 A;  2CT3 A;  4RTW A;  1BK2 A;  3QWX X;  2H8H A;  3H0H A;  4HVU A;  2A28 A;  2AKL A;  1LCK A;  1PNJ A;  2VWF A;  1W70 A;  4FSS A;  2DL8 A;  2K79 A;  1X27 A;  3M0R A;  3I5R A;  2YSQ A;  1GCP A;  1T3L A;  1V1C A;  2HDA A;  2XMF A;  2BZX A;  2CUB A;  4ORZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...