1ZUYA

High-resolution structure of yeast myo5 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-5 isoform
publication title High-resolution structure of yeast Myo5 SH3 domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zuyA00
2DBMA 4JZ3A 4ZNXA 2GTJA 1WI7A 3H41A 2AZVA 2YT6A 4Y92A 1ZLMA 2CSIA 4JZ4A 2GNCA 2EPDA 2JTEA 2CH4W 4KRTA 1T0HA 4CC3A 3EG2A 1MUZA 1Z9ZA 4LE9A 3QWYA 1U3OA 2ABLA 2LQNA 2HBWA 1ABQA 3LH5A 1GCPA 1UG1A 1E6GA 4D8DA 2DBKA 2KNBB 1I1JA 2EGEA 4RTVA 1B3QA 4QT7A 2RQRA 4RTUA 2HSPA 2F2VA 1WA7A 2ROLA 2ENMA 3THKA 4J9IA 2AKLA 1H8KA 1NYFA 1W70A 2V1RA 3PVQA 1HD3A 2EYXA 1UECA 2KROA 2KT8A 1VA7A 1J3TA 3C0CA 3JV3A 4OMPA 2KRSA 2J6KA 1ZBJA 2C0IA 1UHFA 2DL5A 1T3SA 1AWWA 2KE9A 1PKSA 2OAWA 3M0RA 2J6OA 1JU5C 2DRMA 3UA7A 4RTWA 2EGAA 1NM7A 2YUOA 2LMJA 2KT1A 2V1QA 2YUQA 1AD5A 1JXOA 2X3XD 3EG3A 1HSQA 4AFUC 3EG1A 2F2XA 2FRWA 4GBQA 2W0ZA 1JO8A 2DL4A 2EVRA 1TUDA 4LUEA 2DILA 3H0IA 1PHTA 1QCFA 2OI3A 1KIKA 4X1VA 1Z9QA 4IIMA 3EGUA 2DL8A 2FG0A 2LJ0A 2JMCA 4WCIA 1VYTA 2DM1A 1FYNA 3QWXX 4J9FA 2ECZA 1K9AA 4RUGA 2CUBA 2YSQA 5IHIA 1PWTA 2XMFA 5IHNA 1HJDA 1WXUA 2KBTA 2K7AA 4LN2A 1ZX6A 2FRYA 2K6DA 1OPLA 2K79A 3PE0A 4HCKA 4DEYA 2RNAA 1GBRA 1NLPC 4F17A 2YUNA 1AEYA 3CQTA 4DEXA 2G6FX 1BBZA 1VYVA 2PZ1A 1PNJA 4CC2A 2KRMA 4AFSC 1X69A 2RQWA 3I5SA 1QKXA 2K3BA 2F2WA 2M51A 2GTOA 4J9BA 2SEMA 5I11A 2D8HA 2QDLA 2O9SA 3IQLA 3PVLA 3VS0A 1M3BA 5FWBA 2O88A 1WLPB 2CH4A 2FO0A 4RTYA 4GLMA 2LX7A 3KFVA 4RTTA 3M0SA 2CSQA 1AZGB 1U5SA 2EBPA 2DX1A 3I35A 2DL3A 5FWCA 1IO6A 1WIEA 4Z89A 3U23A 1GCQA 3RNJA 1SRMA 4AG1C 1M27C 2FEIA 1OEBA 1QWFA 4Z8AA 4EIKA 1NG2A 2PNIA 1UGVA 2A36A 4J9EA 4AFQC 5ECAA 1JQQA 2BZXA 3GBQA 1RLQC 2L2PA 1LCKA 1KSWA 3FJ5A 1XOVA 4Z88A 1K4US 1KJWA 2JW4A 2KR3A 2O9VA 2DLPA 1W1FA 4OMNA 1W6XA 1WYXA 1X2KA 1ZUUA 4F14A 4E6RA 2O2OA 2EW3A 4HXJA 5IHKA 1AOJA 2I0NA 1K76A 3ULRB 1BB9A 2RQUA 2LJ3A 3UA6A 4JJDA 2L3QA 2RN8A 2MIOA 2NWMA 1NEGA 3NHNA 2AKKA 2DNUA 1E7OA 3EHQA 2FPFA 1H3HA 5IXFA 2L3PA 2RMOA 1AWJA 3I9QA 1GRIA 1PKTA 4OMOA 1WDXA 4IIOA 2GGRA 1GL5A 2MCNA 1CSKA 1X2QA 1UUEA 2KYMA 1S1NA 1SHFA 4JJBA 2DRKA 2CT4A 4RTZA 3A98A 5IXBA 1ARKA 2FPDA 2H8HA 2PTKA 1UE9A 1YWOA 2M0YA 4ORZA 3VS3A 1FMKA 1GCQC 1NLOC 1PRLC 1QWEA 2DJQA 2JS2A 2B86A 2LQWA 2LCSA 1SEMA 2KRNA 4OMQA 1K0SA 2RQVA 3NPFA 4HVWA 4AG2C 4AFZC 1UJYA 2O31A 4HVUA 2JM8A 5HCKA 1YN8A 3NGPA 4A63B 2HCKA 2BZ8A 2EQIA 5IH2A 1X6BA 2C0TA 1T3LA 3VRYA 4JJCA 2EGCA 2E5KA 3M0TA 2RF0A 2J06A 1GFCA 4R0KA 1RI9A 2LP5A 1BU1A 2EYZA 2JMAA 1PRMC 2MOXA 5L23A 2BTTA 2YUPA 2CT3A 3M0PA 3VS1A 1NYGA 1X43A 1KFZA 4ESRA 2J7IA 4JPBW 2LZ6B 3SEMA 1WXBA 3VS5A 1OOTA 1T0JA 4OMMA 1G83A 1YCSB 2K9GA 3TVTA 3TSWA 1I0CA 1WFWA 2JT4A 3R6NA 3NMZC 3VS4A 1K0XA 4M4ZA 1WXTA 1AVZC 1Y0MA 2C0OA 2ED1A 1UDLA 3TSZA 2D1XA 2EYWA 2RQTA 2DL7A 1SRLA 1SPKA 2CDTA 2NUZA 1N5ZA 3VS7A 3EHRA 4D8KA 2KYBA 3UATA 1YWPA 2KXDA 1ZUKA 4J9HA 1E6HA 1U06A 3SHWA 1A0NB 2CUDA 2FPEA 2DYBA 1H92A 1QLYA 2DA9A 1YNZA 2ESWA 2LJ1A 2HDAA 1B07A 2CREA 1ABOA 2JXBA 1UFFA 2A08A 2VWFA 1AWOA 3EG0A 1K1ZA 2EYYA 2LNHB 4J9GA 3ZL7C 1RLPC 1JEGA 2AK5A 2VVKA 1X27A 3REAB 3UF4A 1CKAA 2DMOA 1G2BA 5GJVB 2IIMA 2X3WD 3VS2A 1MV3A 3H0HA 5FW9A 1UJ0A 1VYUA 2D0NA 2KXCA 1GFDA 1EFNA 1GBQA 1V1CA 1OV3A 4HVVA 2VKNA 4RTXA 3I5RA 4OMLA 4CC7A 3O5ZA 2L0AA 4CC4B 1TUCA 2AZSA 2GQIA 4LUDA 1TG0A 2JS0A 1WX6A 2RPNA 2ED0A 1M8MA 2JM9A 3M0QA 5I22A 1SHGA 2DF6A 4LNPA 5EC7A 2HEQA 1NEBA 1I07A 3M0UA 1CKBA 4J9DA 4K11A 3REBB 1MV0B 2KGTA 2L3SA 1X6GA 1ZSGA 2J6FA 2EKHA 4F16A 2BZYA 3H0FA 1M30A 2DE0X 1AZEA 4FSSA 2P4RA 1BK2A 2A37A 2ROTA 5GJWB 3RBBB 1JXMA 1AWXA 3VRZA 1YP5A 2SRCA 1SSHA 4J9CA 3VS6A 1RUWA 1QKWA 2W10A 2OJ2A 2KEAA 2GBQA 1M3AA 2DVJA 2J05A 1Y57A 2A28A 1ZUYA 1M3CA 1UTIA 2K2MA 2D8JA 2YDLA 1UHCA 1OPKA
chains in the Genus database with same CATH superfamily
2QI2A 2AZVA 1KD1C 3CCRT 4M7DG 2GNCA 4LDUA 2JTEA 5AYFA 2CH4W 3JCMX 1Z9ZA 1N8RU 3LW5E 2ABLA 2HBWA 2L89A 5CK9A 2R5AA 2PVOB 2ZPIB 4R55A 3S3MA 1GCPA 4ZN3A 3BE3A 3FRNA 3A8MB 2JN0A 1C0MA 2RO0A 4QQ6A 1BIAA 2RQRA 2VGNA 2R5MA 4LDWA 3THKA 1W70A 1U8RA 2DD5A 3QYGB 2EYXA 4XU1A 2JUFA 4IURA 3MKDA 1QVFP 3N5BB 2E65A 1WPYA 3TREA 1YBYA 2DL5A 1T3SA 1AWWA 2KE9A 3CEYA 5CQXA 3S3NA 5CO7A 2WSCE 2P84A 3CCQA 3CPWP 3C4SA 1PSFA 1Q95G 3EFRA 2YUOA 1Q7YC 2X3XD 1JXOA 3QUIA 4OMFB 3EG1A 1Q86C 4RG8A 1LPLA 4QVDA 2DILA 5GAN3 5GAMe 1EZZB 3G4SQ 3JB9H 3JB9G 4FYVB 1KIKA 1Z9QA 2DL8A 1M1KU 3BY7A 3JCMV 3G6ET 4JS4A 2JMCA 1VYTA 1IXDA 4HT9A 2WSEE 1BKBA 1VOMA 4J9FA 5GAN8 3QSUA 2ECZA 2K3YA 1Q81U 2V8IA 4A4KA 2XDDA 5D6XA 4DBRA 2FRYA 2K6DA 3J81E 2GQVA 1I81A 1YJ9A 1YJNA 5GAMg 2QA4Q 4F17A 1C1AA 4M7AB 1AEYA 4E2FB 4N4HA 4XTWA 2KRMA 3I55T 1X69A 1VQ8T 4QKUA 4MMKA 3GLXA 1S72T 4XQ3A 3CCMT 3R6OA 4C8QG 3ME9A 2OTLA 5FWBA 4LDYA 4FCYA 1W2BS 2O88A 3RERA 3LGLA 2DVEA 1O9SA 1SSFA 2QAZA 4E47A 3CCJQ 3M0SA 1VQ9A 4PKCC 3P8DA 3V7CA 2M0OA 4DQ2A 2YLCA 5FWCA 2DETA 3L2RA 3JRZA 4FU6A 1WIEA 1M27C 2WACA 3EH1A 3UDCA 4EIKA 7AT1B 5GMKj 1UGVA 3CMET 3BDUA 4UC4A 1H641 3RDVA 3X24B 4C5EA 2X9HA 4E7SA 2AT1B 1LCKA 1KSWA 2ZAEA 3PT9A 1D0XA 3WVEB 3A8OB 1K4US 2JW4A 1O75A 2CKKA 2O9VA 2DLPA 3V8KA 1W1FA 2RHUA 1WHJA 1WYXA 5LL6S 2O2OA 3NFCA 1IZ6A 2F1LA 2QQAA 2RQUA 4FYYB 1M1KR 1LOJA 1VQLQ 1IHVA 4JJDA 2ZPGB 4PJOB 3NHNA 1Y7XA 2NYSA 2QQ9A 1VQ4T 5LJ5h 1Q81R 2FPFA 1H3HA 3ZEHA 2L3PA 2QQSA 3BFMA 5GAOn 2YRCA 2CS7A 4M78B 2MCNA 2A0FB 4E7KA 4MZMA 1X2QA 3JCMP 2HMAA 2D9TA 3ZFJA 2DRKA 4B9XA 2CYZB 4RTZA 4PFZA 1VQPQ 1Y96B 2LC4A 3JB9D 2PTKA 1UE9A 4XK8E 1KQ1A 4ORZA 4OB3B 2FYKA 1G3YA 5GAOl 1FMKA 1GCQC 1NLOC 1QWEA 2DXCA 4JLGA 2LCSA 1TSFA 5GANh 2KRNA 2ZPFB 5FRMA 4FYWB 2RQVA 2E12A 3PIPA 1ZQ1A 2O31A 3E9FA 1VQKT 4M75E 1YIJQ 4A63B 1TOVA 2K5FA 2EQIA 1LNXA 5IH2A 4BE2A 1X6BA 2C0TA 4GLKA 4PJOA 2EGCA 3M0TA 1GFCA 4R0KA 4JS5A 1RI9A 2LP5A 2DXBA 4F7UB 2MF2A 4M78A 3P8HA 2MOXA 4ATOA 5J39A 2CP5A 2KAFA 4IUPA 4M75F 1KC8C 2GFUA 1X43A 4C8QD 2OX7A 1UB4A 1QP2A 1Y96A 1WXBA 4EMKB 4M77B 4OMMA 3CC2Q 4EMKC 3TVTA 4M77C 4ZTFA 1I0CA 1WFWA 2JT4A 3L2QA 1Q82U 1W4SA 1X6OA 4C92G 2LX9A 4XU0A 3OBWA 1K0XA 4TVRA 4M4ZA 3OYIA 2WSFE 2CZ6B 1AVZC 1YHQA 2YWWA 2EQUA 1W2BP 1D09B 4N4GA 4ZTJA 5KYXB 2DL7A 5LJ3d 1BCMA 2VV5A 1M90C 5KH6A 2YHTA 2NUZA 1VQMA 2KYBA 3UATA 1YWPA 1YITQ 4J9HA 3CMAQ 5IN1A 3OYAA 1U06A 4L59A 1QLYA 4F7UA 1YNZA 2LVMA 4BI4A 1RL2A 2CREA 2OAUA 1G3TA 2JXBA 1D1BA 2FB7A 5GANf 1AWOA 3RKYA 2EYYA 1JEGA 1QVGS 1X27A 3VYHB 4A4EA 1TXQA 4LD6A 4EMKA 4M77A 3CCRA 1X01A 3VS2A 4M7AE 1YJWQ 3G4ST 1ZHIA 1BIBA 2D0NA 3NTKA 4FT2A 4ZGDB 3V7SA 2OTLT 2RB6A 2EQMA 4HVVA 1RI0A 3A5ZB 5CKBA 1QVFA 4RTXA 5KYXA 1NE8A 3O5ZA 4OF1A 3MEUA 3CPFA 4OGEA 1VQ9T 4C0DB 4E7IA 1HK9A 3CPWA 3E19A 4M7AF 3O8VA 2IPOB 3CXCS 4ELYC 1N27A 3MHXA 5I22A 1NBEB 3QHSA 4FSXA 3GIBA 1SHGA 2GF7A 2HZYA 3M0UA 5HY6A 5LJ5g 1MV0B 3MP6A 3NTIA 1RAFB 3LWHA 2RA2A 2J6FA 3OY9A 5C0MA 5FU7B 5FU7C 1K9MC 3ER0A 3CCSA 2P4RA 1BK2A 2A37A 2ROTA 3VUBA 3VS6A 4J9CA 5GMKh 3CC4A 1KD1U 1M3AA 1VQ7A 4OB0B 2EJGA 2JVVA 1VQOQ 1IHWA 1RACB 2RJEA 1ZBXA 4JZ3A 2GTJA 1KHCA 1WI7A 3CD6T 3H41A 2YT6A 5J3BA 4PJOE 3L2VA 3JCMJ 2CP3A 1T0HA 4ZN1A 1MUZA 3CBPA 4J7IA 2E3HA 4LE9A 4C92D 3OA6A 1ZSZB 4M78E 2X4YA 2DXTA 4ANJA 4QW2A 3CCEQ 2YLBA 2KK4A 2DZCA 2HAXA 2MI6A 1K8AC 5GAMd 2V26A 2XHCA 4PJOF 3RKWA 1B7TA 2EIFA 4Q5WA 4RTUA 3X28B 1WA7A 3LLRA 2ENMA 5FU6B 3FLGA 4J9IA 1NPPA 1NYFA 2V1RA 1UECA 1VQ8A 2RHXA 1VQNQ 1S72A 3I56A 2K5IA 1Q7YU 3G71Q 3CCMA 2OAWA 3FDRA 1VQ6Q 1JU5C 5EG2A 5KE3A 5KYWA 1Q86U 3OYKA 4C0ZA 3GNFB 1OU9A 2RJCA 2RHIA 3MCAB 2KT1A 2YUQA 1BI0A 3LYIA 2COYA 3DLMA 1VQPT 4RKUE 3E9GA 3QDRB 3JCMe 4RMOA 1VIEA 2CP6A 2JTMA 4PJJA 1QVGP 1VQ5Q 2W0ZA 3UT1A 4F7UE 1TH7A 2EFIA 1TUDA 4LUEA 1SG5A 3H0IA 4X9CA 2QASA 2EQJA 3CMEA 2B8AA 3ASKA 4X1VA 4ZGEB 4J6YA 1QQJA 4M77E 2LJ0A 1AT1B 3M54A 1KD1R 1LVKA 3CBMA 4FW1A 1FMVA 2LQKA 4RUGA 5KYYA 1PWTA 2K5LA 2K7AA 5GMKi 1VQMT 4BACA 4BDYA 2Z0WA 3CXCP 3TEEA 2K79A 1SKUB 3PE0A 1I5LA 4II1A 2DIQA 3EAEA 2YUNA 3CQTA 4XTXA 3EH2A 3JCMc 1NPRA 2DD4A 1I5OB 4DBFA 2K4YA 2RQWA 1QKXA 2HQEA 2L3RA 4NOYA 2RD1A 2CP0A 2KVQG 4AT1B 2QDLA 1M2OA 1KQSA 2FO0A 4XU3A 4RTYA 4EMGA 4GLMA 5GAOq 1M9SA 3KFVA 3MO8A 2FZKB 2E5QA 1U5SA 2DL3A 1IO6A 3DB4A 2DTOA 4M75B 2P0KA 3EFSA 4XTUA 1SRMA 4M75C 2EYQA 1Q86R 2PNIA 2A36A 5GAOp 1VQKA 4J9EA 4AFQC 1RLQC 2LTOA 2VXEA 5IT9E 3MP8A 2JTFA 3FJ5A 1IB8A 2K2VA 1WJQA 1R0BG 1WHMA 4IUUA 3PFSA 1IRXA 4YTLA 1W6XA 2E1HA 1X2KA 4A4HA 4E6RA 1W2BA 1YJWT 1AOJA 4A54A 3M5AA 2VB6A 1ZA2B 2EWNA 5A0DA 5CKFA 3CCST 4OP0A 1UGPB 4P5NA 3UA6A 4JJNK 3L1AA 2MIOA 2JNGA 4CRIA 3CC4T 2DNUA 1E7OA 1KK7A 1VQ7T 2HQXA 3OMCA 4C0FA 3HRTA 5FRNA 4NL3A 1WDXA 1GL5A 1MMNA 5C6SA 2FVUA 1TS9A 3GF5A 4M75A 1CSKA 2LCLA 3T9NA 4HCZA 4M77G 3CCVQ 4JJBA 4KGVB 3L2WA 5GMKl 2E41A 2DPPB 4MMLA 1WQWA 4JRIA 3HP9A 2P0QA 3ZBDA 3QZ5B 3M59A 1BI1A 1U1SA 1NJIC 2B86A 3INZA 4QQDA 1SEMA 4OMQA 3CC7Q 3RMSA 1RABB 4WF2A 3NPFA 2EQKA 5LJ3j 2JM8A 1F1BB 2BKDN 4J7FA 1XNIA 3NGPA 1ACMB 1NZ9A 2X4XA 4M7AC 1R77A 1N8RR 1T3LA 3VRYA 1KC8U 3G4SA 3I56T 3OSSC 4FYXB 4PL6A 1FMWA 1RAAB 2JJ9A 2EYZA 1BI2A 2JMAA 4PLIA 3QJYA 1JBMA 1PRMC 5L23A 5J26A 2YUPA 3M0PA 3VS1A 1KFZA 2DO3A 2I2LA 4PJOD 4ESRA 2COZA 4QQGA 3VS5A 1M90U 2VUBA 3NMZC 4M78D 3CCET 2AIRB 1XTDA 1MMDA 2LT4A 4EPCA 4FM4B 5I21A 4RCBA 3HTRA 1BYMA 2FZCB 1SPKA 2CDTA 5A0GA 1XJWB 4M7AA 4F04B 2BIVA 1VQNT 3EHRA 3M55A 2RJDA 1YI2Q 1ZUKA 4Z02A 2EJFA 4KBMB 3SHWA 1A0NB 2CUDA 3QG1A 4AMCA 5CAIA 3PIOA 9ATCB 2PVDB 3EG0A 3FC3A 2MAMA 3RMQA 2V8KA 4KH1B 1RLPC 2AK5A 1G5VA 3OW2S 4PJOC 2DMOA 1QMCA 3A8GB 1VQ5T 3CD6A 5GJVB 4C5IA 2L5QA 2R57A 2QEXQ 1FWZA 4HA8A 3H6ZA 1VYUA 2G3RA 4M78C 2PVGB 1EFNA 4MDXA 1V1CA 1IREB 2FHDA 2VKNA 3VV0A 1M1FA 4R56A 4CC4B 4M77D 2AZSA 4LUDA 4M7DB 2VC8A 2CZ0B 3P8BB 1TTHB 2QXFA 1M8MA 4KUIA 3A1PA 2BUDA 1D3BB 3RESA 1K9MU 5EC7A 1NEBA 1I07A 3REBB 1ZSGA 4C0GA 4BI3A 3SDZA 3V8LA 4IUTA 2DTIA 1M90R 1M30A 5GAMj 4FSSA 2M9UA 1DJ7B 3RBBB 1AWXA 1SSHA 2MWPA 1VQPA 1LJOA 3DKMA 3MJXA 2GBQA 2QQRA 2DVJA 2A28A 1I8FA 5HKCA 4LXCA 1M3CA 1TUGB 4BY6B 1UTIA 2K2MA 5CKEA 1OPKA 4BY6C 5DY9A 3CXCA 2HBPA 2YXYA 2E10A 4FL6A 2KDSA 2PU9B 4JRQA 4JZ4A 3META 3KBGA 3EG9B 4CC3A 1QP3A 1PD0A 3LX7A 1D3BA 1YIJA 1K8AU 1U3OA 2LQNA 5D6WA 3RR6A 1ABQA 3JCMd 3G7ZA 4LDVA 3OS5A 2DBKA 2KNBB 1X75C 1I1JA 2EGEA 3HFNA 4RTVA 2XICA 1B3QA 4QT7A 2LNVA 2A3LA 2F2VA 2ROLA 2XKOC 1U1TA 4OGCA 3MEAA 2KT8A 1J3TA 3C0CA 4OMPA 2HNIA 2KRSA 4BE1A 3CC2A 1ZBJA 2C0IA 1PKSA 3M0RA 3PMIA 1OX8A 1RADB 2DRMA 2MK5A 3S6WA 3MEVA 3UA7A 4RTWA 1NM7A 5LJ5e 2LMJA 3EGDB 3RIRA 1OZ3A 4ME7A 1K9MR 8ATCB 1FX7A 5LJ3h 2FRWA 1M8VA 4GBQA 3OW2P 1JO8A 2DL4A 4B9WA 2EVRA 3AT1B 4MDWA 1YITA 2HL5C 3CMAA 4C0DC 2F69A 2K57A 2OI3A 2E6NA 3PGGA 1PC0A 3CC7T 3EGUA 1R8OB 3WXMB 1MGQA 4M75G 4IKFA 4WCIA 2L8DA 2QA4T 2DM1A 1FYNA 3QWXX 5GANe 2CUBA 3H8ZA 5CQYA 1PM3A 5IHNA 1HJDA 2CGHA 1WXUA 4PJNA 1YJWA 3X26B 3QBYA 4MZPA 1Q82R 2XD0A 1GBRA 3G6EQ 3SWNB 1K73C 3SWNC 1KHIA 4DEXA 3CCUQ 1BBZA 2COWA 1VYVA 2PZ1A 3EGDA 1K8AR 3CCJT 3I5SA 4GY5A 1RAIB 2HSEB 2K3BA 2RI2A 5GANg 2M51A 2SEMA 2DTHA 1Y07A 2D8HA 3GPLA 3PVLA 2CH4A 3VU3C 5AT1B 3OS1A 4PFOA 3FEOA 3I55Q 4RTTA 1OULA 3VUZA 2CSQA 2EBPA 3I35A 1ZSZC 3CCMQ 1PG5B 1YI2T 3J80E 3U23A 1TWBA 3F70A 2DZ9A 4AG1C 2FEIA 5LJ3f 3OS2A 1JJ2S 4Z8AA 1QWFA 4N4IA 3OB9A 4DBHA 1NG2A 4M7DE 5ECAA 1JQQA 3JCMf 2OTJQ 3TCJA 2PUKB 3SWNA 3PTAA 5FU6C 4NS5A 1VQLT 1OYXA 1XOVA 3CCLQ 4Z88A 1VQOA 3QKJA 4OMNA 4M7AG 3J7AF 3MEWA 2PQWA 4KT0E 5DLQE 4F14A 3UWNA 2RJFA 4DOVA 4EDUA 5KCHA 2RI3A 1UGSB 3FB9A 3ULRB 4M7DF 4HCCA 2LDMA 5GAN5 2LJ3A 4XTYA 4VUBA 1YCYA 2X35A 4XAXB 3EHQA 3MPUB 1ZSZA 4E7HA 5IXFA 2RMOA 3I9QA 3CCEA 5HK3A 1GRIA 4OMOA 4PJLA 2GGRA 3OYCA 3QO3A 2V8JA 1UUEA 2KYMA 1NJIU 5GAMh 4KULA 3A98A 4C92B 5IXBA 3V8JA 3M57A 1ARKA 3CBOA 1VQ4Q 2H8HA 5M9OA 1YIJT 1VQNA 2LRQA 1YWOA 4M75D 3G71A 2DEQA 1VQ6A 4PK4A 3VS3A 4C5HA 2LQWA 3MP1A 2DJQA 2LCCA 4BUGA 1IGUA 1K0SA 4A4GA 4AG2C 1SF9A 3OYLA 1UJYA 2CP7A 4OVAA 5LJ5j 3SFMA 2BZ8A 3A8LB 1VQ5A 2QYZA 4JJCA 5GAOm 1M4ZA 4L6V5 4X9DA 2J06A 3CC2T 5A0LA 3KUFA 3DLLA 3HSBA 4JRPA 4FIBA 4PJOG 1BU1A 3GOXA 3JB9F 2DKGA 2MMPA 1NYGA 4ZGJB 1M5Q1 4M78G 4HKEA 2KMTA 4JPBW 3SEMA 3GNGA 1G83A 2LQ8A 1YCSB 3TSWA 5GAOr 1XQHA 1Q7YR 4FW2A 1RAGB 1YITT 3VS4A 3CCQQ 4PJMA 5A2QE 3CMAT 2QQBA 4C8QE 1Y0MA 5FLXE 2C0OA 2ED1A 5IAYA 5GAN2 3DB3A 1UDLA 1OZ2A 2D1XA 3TSZA 2EYWA 4A53A 2FZGB 2YRDA 5KE2A 4KGZB 2HKNA 2JZ2A 2AHJB 5GAMf 1N5ZA 2GFAA 2XDPA 1E6HA 3C12A 1JJ2P 2K3XA 4J6WA 4C8QF 2FPEA 1H92A 8AT1B 2DA9A 4KH0B 2ESWA 2LJ1A 2VASA 3TQ7P 1NJIR 4M7AD 2QDYB 1OQKA 2VWFA 4B6MA 3E2UA 2JOYA 4JUVA 2LNHB 1G8XA 4J9GA 3OQ5A 4F7UG 2P4TA 3REAB 4KGXB 1CKAA 3L2ZA 1G2BA 2DFUA 3OYEA 3OYJA 2IIMA 2MWOA 4E7JA 1YJ9Q 3L42A 5I2MA 1YJNQ 2KXCA 5GAN4 2DXUA 2VXFA 1RAEB 2E4HA 3VJPA 3LGFA 1OV3A 2H3EB 3OMGA 4KUDK 3JB9I 4OMLA 5KYNA 4XTZA 1TUCA 3VYGA 1WX6A 5DM7R 2RPNA 4HT8A 2OTLQ 2QG9B 2JM9A 4J6XA 1WJSA 2RI5A 1KQSS 2DF6A 4LNPA 1CKBA 4J9DA 4K11A 2L3SA 1PCXA 3CCUT 3OW2A 1X6GA 2DIGA 1VQ9Q 1G3SA 4RG2A 1RAHB 2EKHA 4E7ZA 2E3IA 4F16A 1OU8A 2D6FA 3JSCA 3M56A 3G1JA 3HRUA 1VQOT 4LDXA 3JCMb 3H0FA 2DE0X 3JCMW 1AZEA 1OX9A 2NLUA 2XG8D 3CCVA 3EGXB 3SB2A 1M1GA 1YP5A 2SRCA 3JAME 2EKOA 1QKWA 2OJ2A 2J05A 1Y57A 2M1HA 1WNLA 2O9SA 1B34B 2QK0A 2DBMA 4ZNXA 3BW1A 3CC7A 2F5KA 1M2VB 4Y92A 1ZLMA 2CSIA 5KYUB 2EPDA 4KRTA 1VIFA 2QA4A 3URGA 3EG2A 1VUBA 2OTJT 3QWYA 5LJ5d 3EFOB 4M7DD 2ZZDA 2DYIA 3CCLT 1MNEA 4HCBA 3CD6Q 2ZGWA 3OSVA 3LH5A 5L8RE 1UG1A 4D8DA 1E6GA 4QVCA 3G71T 4BB7A 1N8RC 2P0PA 4JLIA 4C92E 1VQ6T 1MMGA 2FL7A 5CKDA 2HSPA 1EX4A 3EGXA 1D0YA 2AKLA 1H8KA 2C06A 3PVQA 1HD3A 2KROA 2HD0A 3CCJA 1VA7A 3JV3A 3GP8A 2J6KA 4BDZA 1JRIA 2KI7A 1UHFA 5GANd 4EMHA 1PSEA 2J6OA 1KQ2A 4C92F 1B34A 2XK0A 2E70A 4PFPA 1R0CB 1M2VA 2EGAA 2BE9B 4IUVA 1WHHA 2BE7D 2V1QA 5KYUA 3HHTB 1AD5A 3EG3A 4BD3A 1HSQA 4AFUC 3HRSA 2F2XA 4PNOA 3EFOA 1YI2A 4M7DC 3PNWC 1KC8R 1V76A 1PHTA 1QCFA 1BI3A 1EIFA 2DJZA 1WJRA 2CP2A 4IIMA 5CR2A 2FG0A 3HFOA 1VQLA 2VGMA 2D0QB 3NTHA 1QVGA 1K9AA 2YSQA 5IHIA 1K73U 5CKHA 2XMFA 2KBTA 1M1KC 2GCXA 2QEXA 2QTVA 4IUQA 4LN2A 4A4FA 3LWIA 1ZX6A 1OPLA 3JB9J 2LT1A 4HCKA 2VYTA 4DEYA 3WVDB 3L2UA 1YHQQ 2RNAA 1Q81C 4J8OA 1KQSP 1NLPC 2G6FX 3QJ6A 4ELZC 4JRKA 1PNJA 1KG1A 4CC2A 1MHNA 4AFSC 5KCOA 2KSSA 1VQMQ 2F2WA 4E7LA 4M7DA 4RCCA 2GTOA 4J9BA 5I11A 3QYHB 3M53A 3IQLA 3VS0A 1M3BA 5I2SA 3CCQT 1WLPB 5CVIA 2O4XB 2LX7A 2CZ1B 3D7SB 1I4K1 3H9NA 5D7UA 1AZGB 2DX1A 2X51A 3QXEB 4Z89A 1BCOA 1GCQA 3RNJA 3CCRQ 3HKSA 1OEBA 5LJ5f 2A7YA 2E64A 3A8HB 2BZXA 3GBQA 2E6ZA 2L2PA 4OB1B 4NL2A 2IG0A 1KJWA 2KR3A 4PLLA 5DLOA 3QIIA 4FT4A 2ZPBB 5HK0A 2H3JA 1UGQB 1ZUUA 5D6YA 2QGFB 2DAQA 2EW3A 4HXJA 5IHKA 2RK2A 2I0NA 1D0ZA 3OYMA 1YJ9T 1K76A 1YJNT 4CI0C 2X4WA 1BB9A 3CCVT 3OYGA 2L3QA 2RN8A 3EG9A 1AHJB 1QCOA 2O4XA 4C8QB 2NWMA 1NEGA 2AKKA 4C8QC 1K73R 1AWJA 1JJ2A 3C95A 3V7RA 1PKTA 2Y90A 4IIOA 3JCMh 5CIUA 2CZ7B 4JDSA 3CCSQ 1S1NA 1Y71A 1WZOA 3FIFA 1SHFA 2CT4A 2IVWA 2HL3A 3CC4Q 4C5GA 2FPDA 1VQ7Q 4DBQA 4XTVA 1QVPA 2NUPB 2M0YA 3M58A 1WQ7A 4OB2B 3AHUA 1WHLA 2JS2A 3R6NA 1PRLC 4DOWA 2DERA 4HVWA 1D1AA 5GMKm 1WHKA 4AFZC 1HXDA 3S3OA 4HVUA 5HCKA 2RM4A 1YN8A 6AT1B 2HCKA 1MNDA 3QPHA 3M9QA 2Y4XA 2ZCFB 4C8QA 2X4JA 2E5KA 1UGRB 2RF0A 3OYHA 2M02A 4O6JA 4MZTA 3HL8A 1D1CA 1JB0E 3UPUA 2EJ9A 3OYFA 2BTTA 2CT3A 1P92A 2DEUA 4Y91A 2MPXC 2J7IA 3OYNA 1VQ8Q 2LZ6B 5GAN6 1OOTA 1S72Q 1T0JA 2KY9A 3I56Q 5KYWB 1MMAA 2K9GA 2NUPA 4XU2A 1GXIE 2QGGA 4V2SA 1WXTA 1H3ZA 3G6EA 2R58A 2RQTA 3CCUA 1SRLA 1OI1A 4N0AC 1QW1A 1Q82C 1QVFS 4LD9K 3RKXA 3C94A 2RK1A 3VS7A 3HPWA 4X34A 4D8KA 3E1SA 3OYYA 2KXDA 2XDBA 5GAN7 1TU0B 3X25B 2QEXT 3CMEQ 3CPWS 1FXXA 2DYBA 4J5YA 3M4GA 2HDAA 2F5TX 4QVZA 1B07A 1ABOA 1UFFA 2A08A 3I55A 1K1ZA 5KYYB 4M78F 1QCNA 3ZL7C 1C6VX 2VVKA 2ATCB 3OS0A 3UF4A 2MYSA 3KXTA 2DK3A 2X3WD 1MV3A 2QTXA 2NUTB 3H0HA 5FW9A 2M16A 3JCMQ 1UJ0A 3OYBA 1GFDA 5LJ3e 4DA4A 2RH2A 1GBQA 1ZA1B 4L5GA 2OTJA 3FJPA 3LH0A 3I5RA 2XIDA 2HQHA 5FROA 4Y28E 4CC7A 4N0AA 1G3WA 3CCLA 4J83A 2L0AA 4C92C 1V29B 4BI8B 2GQIA 1TG0A 1UEBA 2JS0A 3BDLA 2ED0A 2O01E 3TU4K 4O5VA 1IGQA 3M0QA 4D6WA 4BE0A 1YHQT 1YFNA 2HEQA 5LJ3g 1N9SA 2KQWA 2KGTA 3M4YA 4WTOB 1N9RA 4F7UF 2XI9A 2ZPHB 3SD4A 2Y4YA 3JCMg 2YRVA 2XU8A 3PMTA 2PUOB 2BZYA 2ZPEB 5GMKe 2HKQB 3OBYA 3X20B 2EAYA 3QDFA 3Q1JA 5GJWB 2NUTA 1JXMA 4M77F 1VQKQ 3VRZA 1HYOA 3RUXA 1RUWA 1N6AA 2RHYA 2W10A 5CCAA 2RHZA 1VQ4A 2KEAA 1WGSA 1PD1A 1ZUYA 4C92A 1WHGA 3VKIA 5GANj 3OYDA 2D8JA 2YDLA 1UHCA 3QZ9B
chains in the Genus database with same CATH topology
2DBMA 4JZ3A 4ZNXA 2GTJA 1WI7A 3H41A 2AZVA 2YT6A 4Y92A 1ZLMA 2CSIA 4JZ4A 2GNCA 2EPDA 2JTEA 2CH4W 4KRTA 1T0HA 4CC3A 3EG2A 1MUZA 1Z9ZA 4LE9A 3QWYA 1U3OA 2ABLA 2LQNA 2HBWA 1ABQA 3LH5A 1GCPA 1UG1A 1E6GA 4D8DA 2DBKA 2KNBB 1I1JA 2EGEA 4RTVA 1B3QA 4QT7A 2RQRA 4RTUA 2HSPA 2F2VA 1WA7A 2ROLA 2ENMA 3THKA 4J9IA 2AKLA 1H8KA 1NYFA 1W70A 2V1RA 3PVQA 1HD3A 2EYXA 1UECA 2KROA 2KT8A 1VA7A 1J3TA 3C0CA 3JV3A 4OMPA 2KRSA 2J6KA 1ZBJA 2C0IA 1UHFA 2DL5A 1T3SA 1AWWA 2KE9A 1PKSA 2OAWA 3M0RA 2J6OA 1JU5C 2DRMA 3UA7A 4RTWA 2EGAA 1NM7A 2YUOA 2LMJA 2KT1A 2V1QA 2YUQA 1AD5A 1JXOA 2X3XD 3EG3A 1HSQA 4AFUC 3EG1A 2F2XA 2FRWA 4GBQA 2W0ZA 1JO8A 2DL4A 2EVRA 1TUDA 4LUEA 2DILA 3H0IA 1PHTA 1QCFA 2OI3A 1KIKA 4X1VA 1Z9QA 4IIMA 3EGUA 2DL8A 2FG0A 2LJ0A 2JMCA 4WCIA 1VYTA 2DM1A 1FYNA 3QWXX 4J9FA 2ECZA 1K9AA 4RUGA 2CUBA 2YSQA 5IHIA 1PWTA 2XMFA 5IHNA 1HJDA 1WXUA 2KBTA 2K7AA 4LN2A 1ZX6A 2FRYA 2K6DA 1OPLA 2K79A 3PE0A 4HCKA 4DEYA 2RNAA 1GBRA 1NLPC 4F17A 2YUNA 1AEYA 3CQTA 4DEXA 2G6FX 1BBZA 1VYVA 2PZ1A 1PNJA 4CC2A 2KRMA 4AFSC 1X69A 2RQWA 3I5SA 1QKXA 2K3BA 2F2WA 2M51A 2GTOA 4J9BA 2SEMA 5I11A 2D8HA 2QDLA 2O9SA 3IQLA 3PVLA 3VS0A 1M3BA 5FWBA 2O88A 1WLPB 2CH4A 2FO0A 4RTYA 4GLMA 2LX7A 3KFVA 4RTTA 3M0SA 2CSQA 1AZGB 1U5SA 2EBPA 2DX1A 3I35A 2DL3A 5FWCA 1IO6A 1WIEA 4Z89A 3U23A 1GCQA 3RNJA 1SRMA 4AG1C 1M27C 2FEIA 1OEBA 1QWFA 4Z8AA 4EIKA 1NG2A 2PNIA 1UGVA 2A36A 4J9EA 4AFQC 5ECAA 1JQQA 2BZXA 3GBQA 1RLQC 2L2PA 1LCKA 1KSWA 3FJ5A 1XOVA 4Z88A 1K4US 1KJWA 2JW4A 2KR3A 2O9VA 2DLPA 1W1FA 4OMNA 1W6XA 1WYXA 1X2KA 1ZUUA 4F14A 4E6RA 2O2OA 2EW3A 4HXJA 5IHKA 1AOJA 2I0NA 1K76A 3ULRB 1BB9A 2RQUA 2LJ3A 3UA6A 4JJDA 2L3QA 2RN8A 2MIOA 2NWMA 1NEGA 3NHNA 2AKKA 2DNUA 1E7OA 3EHQA 2FPFA 1H3HA 5IXFA 2L3PA 2RMOA 1AWJA 3I9QA 1GRIA 1PKTA 4OMOA 1WDXA 4IIOA 2GGRA 1GL5A 2MCNA 1CSKA 1X2QA 1UUEA 2KYMA 1S1NA 1SHFA 4JJBA 2DRKA 2CT4A 4RTZA 3A98A 5IXBA 1ARKA 2FPDA 2H8HA 2PTKA 1UE9A 1YWOA 2M0YA 4ORZA 3VS3A 1FMKA 1GCQC 1NLOC 1PRLC 1QWEA 2DJQA 2JS2A 2B86A 2LQWA 2LCSA 1SEMA 2KRNA 4OMQA 1K0SA 2RQVA 3NPFA 4HVWA 4AG2C 4AFZC 1UJYA 2O31A 4HVUA 2JM8A 5HCKA 1YN8A 3NGPA 4A63B 2HCKA 2BZ8A 2EQIA 5IH2A 1X6BA 2C0TA 1T3LA 3VRYA 4JJCA 2EGCA 2E5KA 3M0TA 2RF0A 2J06A 1GFCA 4R0KA 1RI9A 2LP5A 1BU1A 2EYZA 2JMAA 1PRMC 2MOXA 5L23A 2BTTA 2YUPA 2CT3A 3M0PA 3VS1A 1NYGA 1X43A 1KFZA 4ESRA 2J7IA 4JPBW 2LZ6B 3SEMA 1WXBA 3VS5A 1OOTA 1T0JA 4OMMA 1G83A 1YCSB 2K9GA 3TVTA 3TSWA 1I0CA 1WFWA 2JT4A 3R6NA 3NMZC 3VS4A 1K0XA 4M4ZA 1WXTA 1AVZC 1Y0MA 2C0OA 2ED1A 1UDLA 3TSZA 2D1XA 2EYWA 2RQTA 2DL7A 1SRLA 1SPKA 2CDTA 2NUZA 1N5ZA 3VS7A 3EHRA 4D8KA 2KYBA 3UATA 1YWPA 2KXDA 1ZUKA 4J9HA 1E6HA 1U06A 3SHWA 1A0NB 2CUDA 2FPEA 2DYBA 1H92A 1QLYA 2DA9A 1YNZA 2ESWA 2LJ1A 2HDAA 1B07A 2CREA 1ABOA 2JXBA 1UFFA 2A08A 2VWFA 1AWOA 3EG0A 1K1ZA 2EYYA 2LNHB 4J9GA 3ZL7C 1RLPC 1JEGA 2AK5A 2VVKA 1X27A 3REAB 3UF4A 1CKAA 2DMOA 1G2BA 5GJVB 2IIMA 2X3WD 3VS2A 1MV3A 3H0HA 5FW9A 1UJ0A 1VYUA 2D0NA 2KXCA 1GFDA 1EFNA 1GBQA 1V1CA 1OV3A 4HVVA 2VKNA 4RTXA 3I5RA 4OMLA 4CC7A 3O5ZA 2L0AA 4CC4B 1TUCA 2AZSA 2GQIA 4LUDA 1TG0A 2JS0A 1WX6A 2RPNA 2ED0A 1M8MA 2JM9A 3M0QA 5I22A 1SHGA 2DF6A 4LNPA 5EC7A 2HEQA 1NEBA 1I07A 3M0UA 1CKBA 4J9DA 4K11A 3REBB 1MV0B 2KGTA 2L3SA 1X6GA 1ZSGA 2J6FA 2EKHA 4F16A 2BZYA 3H0FA 1M30A 2DE0X 1AZEA 4FSSA 2P4RA 1BK2A 2A37A 2ROTA 5GJWB 3RBBB 1JXMA 1AWXA 3VRZA 1YP5A 2SRCA 1SSHA 4J9CA 3VS6A 1RUWA 1QKWA 2W10A 2OJ2A 2KEAA 2GBQA 1M3AA 2DVJA 2J05A 1Y57A 2A28A 1ZUYA 1M3CA 1UTIA 2K2MA 2D8JA 2YDLA 1UHCA 1OPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBM A;  4JZ3 A;  4ZNX A;  2GTJ A;  1WI7 A;  3H41 A;  2AZV A;  2YT6 A;  4Y92 A;  1ZLM A;  2CSI A;  4JZ4 A;  2GNC A;  2EPD A;  2JTE A;  2CH4 W;  4KRT A;  1T0H A;  4CC3 A;  3EG2 A;  1MUZ A;  1Z9Z A;  4LE9 A;  3QWY A;  1U3O A;  2ABL A;  2LQN A;  2HBW A;  1ABQ A;  3LH5 A;  1GCP A;  1UG1 A;  1E6G A;  4D8D A;  2DBK A;  2KNB B;  1I1J A;  2EGE A;  4RTV A;  1B3Q A;  4QT7 A;  2RQR A;  4RTU A;  2HSP A;  2F2V A;  1WA7 A;  2ROL A;  2ENM A;  3THK A;  4J9I A;  2AKL A;  1H8K A;  1NYF A;  1W70 A;  2V1R A;  3PVQ A;  1HD3 A;  2EYX A;  1UEC A;  2KRO A;  2KT8 A;  1VA7 A;  1J3T A;  3C0C A;  3JV3 A;  4OMP A;  2KRS A;  2J6K A;  1ZBJ A;  2C0I A;  1UHF A;  2DL5 A;  1T3S A;  1AWW A;  2KE9 A;  1PKS A;  2OAW A;  3M0R A;  2J6O A;  1JU5 C;  2DRM A;  3UA7 A;  4RTW A;  2EGA A;  1NM7 A;  2YUO A;  2LMJ A;  2KT1 A;  2V1Q A;  2YUQ A;  1AD5 A;  1JXO A;  2X3X D;  3EG3 A;  1HSQ A;  4AFU C;  3EG1 A;  2F2X A;  2FRW A;  4GBQ A;  2W0Z A;  1JO8 A;  2DL4 A;  2EVR A;  1TUD A;  4LUE A;  2DIL A;  3H0I A;  1PHT A;  1QCF A;  2OI3 A;  1KIK A;  4X1V A;  1Z9Q A;  4IIM A;  3EGU A;  2DL8 A;  2FG0 A;  2LJ0 A;  2JMC A;  4WCI A;  1VYT A;  2DM1 A;  1FYN A;  3QWX X;  4J9F A;  2ECZ A;  1K9A A;  4RUG A;  2CUB A;  2YSQ A;  5IHI A;  1PWT A;  2XMF A;  5IHN A;  1HJD A;  1WXU A;  2KBT A;  2K7A A;  4LN2 A;  1ZX6 A;  2FRY A;  2K6D A;  1OPL A;  2K79 A;  3PE0 A;  4HCK A;  4DEY A;  2RNA A;  1GBR A;  1NLP C;  4F17 A;  2YUN A;  1AEY A;  3CQT A;  4DEX A;  2G6F X;  1BBZ A;  1VYV A;  2PZ1 A;  1PNJ A;  4CC2 A;  2KRM A;  4AFS C;  1X69 A;  2RQW A;  3I5S A;  1QKX A;  2K3B A;  2F2W A;  2M51 A;  2GTO A;  4J9B A;  2SEM A;  5I11 A;  2D8H A;  2QDL A;  2O9S A;  3IQL A;  3PVL A;  3VS0 A;  1M3B A;  5FWB A;  2O88 A;  1WLP B;  2CH4 A;  2FO0 A;  4RTY A;  4GLM A;  2LX7 A;  3KFV A;  4RTT A;  3M0S A;  2CSQ A;  1AZG B;  1U5S A;  2EBP A;  2DX1 A;  3I35 A;  2DL3 A;  5FWC A;  1IO6 A;  1WIE A;  4Z89 A;  3U23 A;  1GCQ A;  3RNJ A;  1SRM A;  4AG1 C;  1M27 C;  2FEI A;  1OEB A;  1QWF A;  4Z8A A;  4EIK A;  1NG2 A;  2PNI A;  1UGV A;  2A36 A;  4J9E A;  4AFQ C;  5ECA A;  1JQQ A;  2BZX A;  3GBQ A;  1RLQ C;  2L2P A;  1LCK A;  1KSW A;  3FJ5 A;  1XOV A;  4Z88 A;  1K4U S;  1KJW A;  2JW4 A;  2KR3 A;  2O9V A;  2DLP A;  1W1F A;  4OMN A;  1W6X A;  1WYX A;  1X2K A;  1ZUU A;  4F14 A;  4E6R A;  2O2O A;  2EW3 A;  4HXJ A;  5IHK A;  1AOJ A;  2I0N A;  1K76 A;  3ULR B;  1BB9 A;  2RQU A;  2LJ3 A;  3UA6 A;  4JJD A;  2L3Q A;  2RN8 A;  2MIO A;  2NWM A;  1NEG A;  3NHN A;  2AKK A;  2DNU A;  1E7O A;  3EHQ A;  2FPF A;  1H3H A;  5IXF A;  2L3P A;  2RMO A;  1AWJ A;  3I9Q A;  1GRI A;  1PKT A;  4OMO A;  1WDX A;  4IIO A;  2GGR A;  1GL5 A;  2MCN A;  1CSK A;  1X2Q A;  1UUE A;  2KYM A;  1S1N A;  1SHF A;  4JJB A;  2DRK A;  2CT4 A;  4RTZ A;  3A98 A;  5IXB A;  1ARK A;  2FPD A;  2H8H A;  2PTK A;  1UE9 A;  1YWO A;  2M0Y A;  4ORZ A;  3VS3 A;  1FMK A;  1GCQ C;  1NLO C;  1PRL C;  1QWE A;  2DJQ A;  2JS2 A;  2B86 A;  2LQW A;  2LCS A;  1SEM A;  2KRN A;  4OMQ A;  1K0S A;  2RQV A;  3NPF A;  4HVW A;  4AG2 C;  4AFZ C;  1UJY A;  2O31 A;  4HVU A;  2JM8 A;  5HCK A;  1YN8 A;  3NGP A;  4A63 B;  2HCK A;  2BZ8 A;  2EQI A;  5IH2 A;  1X6B A;  2C0T A;  1T3L A;  3VRY A;  4JJC A;  2EGC A;  2E5K A;  3M0T A;  2RF0 A;  2J06 A;  1GFC A;  4R0K A;  1RI9 A;  2LP5 A;  1BU1 A;  2EYZ A;  2JMA A;  1PRM C;  2MOX A;  5L23 A;  2BTT A;  2YUP A;  2CT3 A;  3M0P A;  3VS1 A;  1NYG A;  1X43 A;  1KFZ A;  4ESR A;  2J7I A;  4JPB W;  2LZ6 B;  3SEM A;  1WXB A;  3VS5 A;  1OOT A;  1T0J A;  4OMM A;  1G83 A;  1YCS B;  2K9G A;  3TVT A;  3TSW A;  1I0C A;  1WFW A;  2JT4 A;  3R6N A;  3NMZ C;  3VS4 A;  1K0X A;  4M4Z A;  1WXT A;  1AVZ C;  1Y0M A;  2C0O A;  2ED1 A;  1UDL A;  3TSZ A;  2D1X A;  2EYW A;  2RQT A;  2DL7 A;  1SRL A;  1SPK A;  2CDT A;  2NUZ A;  1N5Z A;  3VS7 A;  3EHR A;  4D8K A;  2KYB A;  3UAT A;  1YWP A;  2KXD A;  1ZUK A;  4J9H A;  1E6H A;  1U06 A;  3SHW A;  1A0N B;  2CUD A;  2FPE A;  2DYB A;  1H92 A;  1QLY A;  2DA9 A;  1YNZ A;  2ESW A;  2LJ1 A;  2HDA A;  1B07 A;  2CRE A;  1ABO A;  2JXB A;  1UFF A;  2A08 A;  2VWF A;  1AWO A;  3EG0 A;  1K1Z A;  2EYY A;  2LNH B;  4J9G A;  3ZL7 C;  1RLP C;  1JEG A;  2AK5 A;  2VVK A;  1X27 A;  3REA B;  3UF4 A;  1CKA A;  2DMO A;  1G2B A;  5GJV B;  2IIM A;  2X3W D;  3VS2 A;  1MV3 A;  3H0H A;  5FW9 A;  1UJ0 A;  1VYU A;  2D0N A;  2KXC A;  1GFD A;  1EFN A;  1GBQ A;  1V1C A;  1OV3 A;  4HVV A;  2VKN A;  4RTX A;  3I5R A;  4OML A;  4CC7 A;  3O5Z A;  2L0A A;  4CC4 B;  1TUC A;  2AZS A;  2GQI A;  4LUD A;  1TG0 A;  2JS0 A;  1WX6 A;  2RPN A;  2ED0 A;  1M8M A;  2JM9 A;  3M0Q A;  5I22 A;  1SHG A;  2DF6 A;  4LNP A;  5EC7 A;  2HEQ A;  1NEB A;  1I07 A;  3M0U A;  1CKB A;  4J9D A;  4K11 A;  3REB B;  1MV0 B;  2KGT A;  2L3S A;  1X6G A;  1ZSG A;  2J6F A;  2EKH A;  4F16 A;  2BZY A;  3H0F A;  1M30 A;  2DE0 X;  1AZE A;  4FSS A;  2P4R A;  1BK2 A;  2A37 A;  2ROT A;  5GJW B;  3RBB B;  1JXM A;  1AWX A;  3VRZ A;  1YP5 A;  2SRC A;  1SSH A;  4J9C A;  3VS6 A;  1RUW A;  1QKW A;  2W10 A;  2OJ2 A;  2KEA A;  2GBQ A;  1M3A A;  2DVJ A;  2J05 A;  1Y57 A;  2A28 A;  1ZUY A;  1M3C A;  1UTI A;  2K2M A;  2D8J A;  2YDL A;  1UHC A;  1OPK A; 
#chains in the Genus database with same CATH topology
 2QI2 A;  2AZV A;  1KD1 C;  3CCR T;  4M7D G;  2GNC A;  4LDU A;  2JTE A;  5AYF A;  2CH4 W;  3JCM X;  1Z9Z A;  1N8R U;  3LW5 E;  2ABL A;  2HBW A;  2L89 A;  5CK9 A;  2R5A A;  2PVO B;  2ZPI B;  4R55 A;  3S3M A;  1GCP A;  4ZN3 A;  3BE3 A;  3FRN A;  3A8M B;  2JN0 A;  1C0M A;  2RO0 A;  4QQ6 A;  1BIA A;  2RQR A;  2VGN A;  2R5M A;  4LDW A;  3THK A;  1W70 A;  1U8R A;  2DD5 A;  3QYG B;  2EYX A;  4XU1 A;  2JUF A;  4IUR A;  3MKD A;  1QVF P;  3N5B B;  2E65 A;  1WPY A;  3TRE A;  1YBY A;  2DL5 A;  1T3S A;  1AWW A;  2KE9 A;  3CEY A;  5CQX A;  3S3N A;  5CO7 A;  2WSC E;  2P84 A;  3CCQ A;  3CPW P;  3C4S A;  1PSF A;  1Q95 G;  3EFR A;  2YUO A;  1Q7Y C;  2X3X D;  1JXO A;  3QUI A;  4OMF B;  3EG1 A;  1Q86 C;  4RG8 A;  1LPL A;  4QVD A;  2DIL A;  5GAN 3;  5GAM e;  1EZZ B;  3G4S Q;  3JB9 H;  3JB9 G;  4FYV B;  1KIK A;  1Z9Q A;  2DL8 A;  1M1K U;  3BY7 A;  3JCM V;  3G6E T;  4JS4 A;  2JMC A;  1VYT A;  1IXD A;  4HT9 A;  2WSE E;  1BKB A;  1VOM A;  4J9F A;  5GAN 8;  3QSU A;  2ECZ A;  2K3Y A;  1Q81 U;  2V8I A;  4A4K A;  2XDD A;  5D6X A;  4DBR A;  2FRY A;  2K6D A;  3J81 E;  2GQV A;  1I81 A;  1YJ9 A;  1YJN A;  5GAM g;  2QA4 Q;  4F17 A;  1C1A A;  4M7A B;  1AEY A;  4E2F B;  4N4H A;  4XTW A;  2KRM A;  3I55 T;  1X69 A;  1VQ8 T;  4QKU A;  4MMK A;  3GLX A;  1S72 T;  4XQ3 A;  3CCM T;  3R6O A;  4C8Q G;  3ME9 A;  2OTL A;  5FWB A;  4LDY A;  4FCY A;  1W2B S;  2O88 A;  3RER A;  3LGL A;  2DVE A;  1O9S A;  1SSF A;  2QAZ A;  4E47 A;  3CCJ Q;  3M0S A;  1VQ9 A;  4PKC C;  3P8D A;  3V7C A;  2M0O A;  4DQ2 A;  2YLC A;  5FWC A;  2DET A;  3L2R A;  3JRZ A;  4FU6 A;  1WIE A;  1M27 C;  2WAC A;  3EH1 A;  3UDC A;  4EIK A;  7AT1 B;  5GMK j;  1UGV A;  3CME T;  3BDU A;  4UC4 A;  1H64 1;  3RDV A;  3X24 B;  4C5E A;  2X9H A;  4E7S A;  2AT1 B;  1LCK A;  1KSW A;  2ZAE A;  3PT9 A;  1D0X A;  3WVE B;  3A8O B;  1K4U S;  2JW4 A;  1O75 A;  2CKK A;  2O9V A;  2DLP A;  3V8K A;  1W1F A;  2RHU A;  1WHJ A;  1WYX A;  5LL6 S;  2O2O A;  3NFC A;  1IZ6 A;  2F1L A;  2QQA A;  2RQU A;  4FYY B;  1M1K R;  1LOJ A;  1VQL Q;  1IHV A;  4JJD A;  2ZPG B;  4PJO B;  3NHN A;  1Y7X A;  2NYS A;  2QQ9 A;  1VQ4 T;  5LJ5 h;  1Q81 R;  2FPF A;  1H3H A;  3ZEH A;  2L3P A;  2QQS A;  3BFM A;  5GAO n;  2YRC A;  2CS7 A;  4M78 B;  2MCN A;  2A0F B;  4E7K A;  4MZM A;  1X2Q A;  3JCM P;  2HMA A;  2D9T A;  3ZFJ A;  2DRK A;  4B9X A;  2CYZ B;  4RTZ A;  4PFZ A;  1VQP Q;  1Y96 B;  2LC4 A;  3JB9 D;  2PTK A;  1UE9 A;  4XK8 E;  1KQ1 A;  4ORZ A;  4OB3 B;  2FYK A;  1G3Y A;  5GAO l;  1FMK A;  1GCQ C;  1NLO C;  1QWE A;  2DXC A;  4JLG A;  2LCS A;  1TSF A;  5GAN h;  2KRN A;  2ZPF B;  5FRM A;  4FYW B;  2RQV A;  2E12 A;  3PIP A;  1ZQ1 A;  2O31 A;  3E9F A;  1VQK T;  4M75 E;  1YIJ Q;  4A63 B;  1TOV A;  2K5F A;  2EQI A;  1LNX A;  5IH2 A;  4BE2 A;  1X6B A;  2C0T A;  4GLK A;  4PJO A;  2EGC A;  3M0T A;  1GFC A;  4R0K A;  4JS5 A;  1RI9 A;  2LP5 A;  2DXB A;  4F7U B;  2MF2 A;  4M78 A;  3P8H A;  2MOX A;  4ATO A;  5J39 A;  2CP5 A;  2KAF A;  4IUP A;  4M75 F;  1KC8 C;  2GFU A;  1X43 A;  4C8Q D;  2OX7 A;  1UB4 A;  1QP2 A;  1Y96 A;  1WXB A;  4EMK B;  4M77 B;  4OMM A;  3CC2 Q;  4EMK C;  3TVT A;  4M77 C;  4ZTF A;  1I0C A;  1WFW A;  2JT4 A;  3L2Q A;  1Q82 U;  1W4S A;  1X6O A;  4C92 G;  2LX9 A;  4XU0 A;  3OBW A;  1K0X A;  4TVR A;  4M4Z A;  3OYI A;  2WSF E;  2CZ6 B;  1AVZ C;  1YHQ A;  2YWW A;  2EQU A;  1W2B P;  1D09 B;  4N4G A;  4ZTJ A;  5KYX B;  2DL7 A;  5LJ3 d;  1BCM A;  2VV5 A;  1M90 C;  5KH6 A;  2YHT A;  2NUZ A;  1VQM A;  2KYB A;  3UAT A;  1YWP A;  1YIT Q;  4J9H A;  3CMA Q;  5IN1 A;  3OYA A;  1U06 A;  4L59 A;  1QLY A;  4F7U A;  1YNZ A;  2LVM A;  4BI4 A;  1RL2 A;  2CRE A;  2OAU A;  1G3T A;  2JXB A;  1D1B A;  2FB7 A;  5GAN f;  1AWO A;  3RKY A;  2EYY A;  1JEG A;  1QVG S;  1X27 A;  3VYH B;  4A4E A;  1TXQ A;  4LD6 A;  4EMK A;  4M77 A;  3CCR A;  1X01 A;  3VS2 A;  4M7A E;  1YJW Q;  3G4S T;  1ZHI A;  1BIB A;  2D0N A;  3NTK A;  4FT2 A;  4ZGD B;  3V7S A;  2OTL T;  2RB6 A;  2EQM A;  4HVV A;  1RI0 A;  3A5Z B;  5CKB A;  1QVF A;  4RTX A;  5KYX A;  1NE8 A;  3O5Z A;  4OF1 A;  3MEU A;  3CPF A;  4OGE A;  1VQ9 T;  4C0D B;  4E7I A;  1HK9 A;  3CPW A;  3E19 A;  4M7A F;  3O8V A;  2IPO B;  3CXC S;  4ELY C;  1N27 A;  3MHX A;  5I22 A;  1NBE B;  3QHS A;  4FSX A;  3GIB A;  1SHG A;  2GF7 A;  2HZY A;  3M0U A;  5HY6 A;  5LJ5 g;  1MV0 B;  3MP6 A;  3NTI A;  1RAF B;  3LWH A;  2RA2 A;  2J6F A;  3OY9 A;  5C0M A;  5FU7 B;  5FU7 C;  1K9M C;  3ER0 A;  3CCS A;  2P4R A;  1BK2 A;  2A37 A;  2ROT A;  3VUB A;  3VS6 A;  4J9C A;  5GMK h;  3CC4 A;  1KD1 U;  1M3A A;  1VQ7 A;  4OB0 B;  2EJG A;  2JVV A;  1VQO Q;  1IHW A;  1RAC B;  2RJE A;  1ZBX A;  4JZ3 A;  2GTJ A;  1KHC A;  1WI7 A;  3CD6 T;  3H41 A;  2YT6 A;  5J3B A;  4PJO E;  3L2V A;  3JCM J;  2CP3 A;  1T0H A;  4ZN1 A;  1MUZ A;  3CBP A;  4J7I A;  2E3H A;  4LE9 A;  4C92 D;  3OA6 A;  1ZSZ B;  4M78 E;  2X4Y A;  2DXT A;  4ANJ A;  4QW2 A;  3CCE Q;  2YLB A;  2KK4 A;  2DZC A;  2HAX A;  2MI6 A;  1K8A C;  5GAM d;  2V26 A;  2XHC A;  4PJO F;  3RKW A;  1B7T A;  2EIF A;  4Q5W A;  4RTU A;  3X28 B;  1WA7 A;  3LLR A;  2ENM A;  5FU6 B;  3FLG A;  4J9I A;  1NPP A;  1NYF A;  2V1R A;  1UEC A;  1VQ8 A;  2RHX A;  1VQN Q;  1S72 A;  3I56 A;  2K5I A;  1Q7Y U;  3G71 Q;  3CCM A;  2OAW A;  3FDR A;  1VQ6 Q;  1JU5 C;  5EG2 A;  5KE3 A;  5KYW A;  1Q86 U;  3OYK A;  4C0Z A;  3GNF B;  1OU9 A;  2RJC A;  2RHI A;  3MCA B;  2KT1 A;  2YUQ A;  1BI0 A;  3LYI A;  2COY A;  3DLM A;  1VQP T;  4RKU E;  3E9G A;  3QDR B;  3JCM e;  4RMO A;  1VIE A;  2CP6 A;  2JTM A;  4PJJ A;  1QVG P;  1VQ5 Q;  2W0Z A;  3UT1 A;  4F7U E;  1TH7 A;  2EFI A;  1TUD A;  4LUE A;  1SG5 A;  3H0I A;  4X9C A;  2QAS A;  2EQJ A;  3CME A;  2B8A A;  3ASK A;  4X1V A;  4ZGE B;  4J6Y A;  1QQJ A;  4M77 E;  2LJ0 A;  1AT1 B;  3M54 A;  1KD1 R;  1LVK A;  3CBM A;  4FW1 A;  1FMV A;  2LQK A;  4RUG A;  5KYY A;  1PWT A;  2K5L A;  2K7A A;  5GMK i;  1VQM T;  4BAC A;  4BDY A;  2Z0W A;  3CXC P;  3TEE A;  2K79 A;  1SKU B;  3PE0 A;  1I5L A;  4II1 A;  2DIQ A;  3EAE A;  2YUN A;  3CQT A;  4XTX A;  3EH2 A;  3JCM c;  1NPR A;  2DD4 A;  1I5O B;  4DBF A;  2K4Y A;  2RQW A;  1QKX A;  2HQE A;  2L3R A;  4NOY A;  2RD1 A;  2CP0 A;  2KVQ G;  4AT1 B;  2QDL A;  1M2O A;  1KQS A;  2FO0 A;  4XU3 A;  4RTY A;  4EMG A;  4GLM A;  5GAO q;  1M9S A;  3KFV A;  3MO8 A;  2FZK B;  2E5Q A;  1U5S A;  2DL3 A;  1IO6 A;  3DB4 A;  2DTO A;  4M75 B;  2P0K A;  3EFS A;  4XTU A;  1SRM A;  4M75 C;  2EYQ A;  1Q86 R;  2PNI A;  2A36 A;  5GAO p;  1VQK A;  4J9E A;  4AFQ C;  1RLQ C;  2LTO A;  2VXE A;  5IT9 E;  3MP8 A;  2JTF A;  3FJ5 A;  1IB8 A;  2K2V A;  1WJQ A;  1R0B G;  1WHM A;  4IUU A;  3PFS A;  1IRX A;  4YTL A;  1W6X A;  2E1H A;  1X2K A;  4A4H A;  4E6R A;  1W2B A;  1YJW T;  1AOJ A;  4A54 A;  3M5A A;  2VB6 A;  1ZA2 B;  2EWN A;  5A0D A;  5CKF A;  3CCS T;  4OP0 A;  1UGP B;  4P5N A;  3UA6 A;  4JJN K;  3L1A A;  2MIO A;  2JNG A;  4CRI A;  3CC4 T;  2DNU A;  1E7O A;  1KK7 A;  1VQ7 T;  2HQX A;  3OMC A;  4C0F A;  3HRT A;  5FRN A;  4NL3 A;  1WDX A;  1GL5 A;  1MMN A;  5C6S A;  2FVU A;  1TS9 A;  3GF5 A;  4M75 A;  1CSK A;  2LCL A;  3T9N A;  4HCZ A;  4M77 G;  3CCV Q;  4JJB A;  4KGV B;  3L2W A;  5GMK l;  2E41 A;  2DPP B;  4MML A;  1WQW A;  4JRI A;  3HP9 A;  2P0Q A;  3ZBD A;  3QZ5 B;  3M59 A;  1BI1 A;  1U1S A;  1NJI C;  2B86 A;  3INZ A;  4QQD A;  1SEM A;  4OMQ A;  3CC7 Q;  3RMS A;  1RAB B;  4WF2 A;  3NPF A;  2EQK A;  5LJ3 j;  2JM8 A;  1F1B B;  2BKD N;  4J7F A;  1XNI A;  3NGP A;  1ACM B;  1NZ9 A;  2X4X A;  4M7A C;  1R77 A;  1N8R R;  1T3L A;  3VRY A;  1KC8 U;  3G4S A;  3I56 T;  3OSS C;  4FYX B;  4PL6 A;  1FMW A;  1RAA B;  2JJ9 A;  2EYZ A;  1BI2 A;  2JMA A;  4PLI A;  3QJY A;  1JBM A;  1PRM C;  5L23 A;  5J26 A;  2YUP A;  3M0P A;  3VS1 A;  1KFZ A;  2DO3 A;  2I2L A;  4PJO D;  4ESR A;  2COZ A;  4QQG A;  3VS5 A;  1M90 U;  2VUB A;  3NMZ C;  4M78 D;  3CCE T;  2AIR B;  1XTD A;  1MMD A;  2LT4 A;  4EPC A;  4FM4 B;  5I21 A;  4RCB A;  3HTR A;  1BYM A;  2FZC B;  1SPK A;  2CDT A;  5A0G A;  1XJW B;  4M7A A;  4F04 B;  2BIV A;  1VQN T;  3EHR A;  3M55 A;  2RJD A;  1YI2 Q;  1ZUK A;  4Z02 A;  2EJF A;  4KBM B;  3SHW A;  1A0N B;  2CUD A;  3QG1 A;  4AMC A;  5CAI A;  3PIO A;  9ATC B;  2PVD B;  3EG0 A;  3FC3 A;  2MAM A;  3RMQ A;  2V8K A;  4KH1 B;  1RLP C;  2AK5 A;  1G5V A;  3OW2 S;  4PJO C;  2DMO A;  1QMC A;  3A8G B;  1VQ5 T;  3CD6 A;  5GJV B;  4C5I A;  2L5Q A;  2R57 A;  2QEX Q;  1FWZ A;  4HA8 A;  3H6Z A;  1VYU A;  2G3R A;  4M78 C;  2PVG B;  1EFN A;  4MDX A;  1V1C A;  1IRE B;  2FHD A;  2VKN A;  3VV0 A;  1M1F A;  4R56 A;  4CC4 B;  4M77 D;  2AZS A;  4LUD A;  4M7D B;  2VC8 A;  2CZ0 B;  3P8B B;  1TTH B;  2QXF A;  1M8M A;  4KUI A;  3A1P A;  2BUD A;  1D3B B;  3RES A;  1K9M U;  5EC7 A;  1NEB A;  1I07 A;  3REB B;  1ZSG A;  4C0G A;  4BI3 A;  3SDZ A;  3V8L A;  4IUT A;  2DTI A;  1M90 R;  1M30 A;  5GAM j;  4FSS A;  2M9U A;  1DJ7 B;  3RBB B;  1AWX A;  1SSH A;  2MWP A;  1VQP A;  1LJO A;  3DKM A;  3MJX A;  2GBQ A;  2QQR A;  2DVJ A;  2A28 A;  1I8F A;  5HKC A;  4LXC A;  1M3C A;  1TUG B;  4BY6 B;  1UTI A;  2K2M A;  5CKE A;  1OPK A;  4BY6 C;  5DY9 A;  3CXC A;  2HBP A;  2YXY A;  2E10 A;  4FL6 A;  2KDS A;  2PU9 B;  4JRQ A;  4JZ4 A;  3MET A;  3KBG A;  3EG9 B;  4CC3 A;  1QP3 A;  1PD0 A;  3LX7 A;  1D3B A;  1YIJ A;  1K8A U;  1U3O A;  2LQN A;  5D6W A;  3RR6 A;  1ABQ A;  3JCM d;  3G7Z A;  4LDV A;  3OS5 A;  2DBK A;  2KNB B;  1X75 C;  1I1J A;  2EGE A;  3HFN A;  4RTV A;  2XIC A;  1B3Q A;  4QT7 A;  2LNV A;  2A3L A;  2F2V A;  2ROL A;  2XKO C;  1U1T A;  4OGC A;  3MEA A;  2KT8 A;  1J3T A;  3C0C A;  4OMP A;  2HNI A;  2KRS A;  4BE1 A;  3CC2 A;  1ZBJ A;  2C0I A;  1PKS A;  3M0R A;  3PMI A;  1OX8 A;  1RAD B;  2DRM A;  2MK5 A;  3S6W A;  3MEV A;  3UA7 A;  4RTW A;  1NM7 A;  5LJ5 e;  2LMJ A;  3EGD B;  3RIR A;  1OZ3 A;  4ME7 A;  1K9M R;  8ATC B;  1FX7 A;  5LJ3 h;  2FRW A;  1M8V A;  4GBQ A;  3OW2 P;  1JO8 A;  2DL4 A;  4B9W A;  2EVR A;  3AT1 B;  4MDW A;  1YIT A;  2HL5 C;  3CMA A;  4C0D C;  2F69 A;  2K57 A;  2OI3 A;  2E6N A;  3PGG A;  1PC0 A;  3CC7 T;  3EGU A;  1R8O B;  3WXM B;  1MGQ A;  4M75 G;  4IKF A;  4WCI A;  2L8D A;  2QA4 T;  2DM1 A;  1FYN A;  3QWX X;  5GAN e;  2CUB A;  3H8Z A;  5CQY A;  1PM3 A;  5IHN A;  1HJD A;  2CGH A;  1WXU A;  4PJN A;  1YJW A;  3X26 B;  3QBY A;  4MZP A;  1Q82 R;  2XD0 A;  1GBR A;  3G6E Q;  3SWN B;  1K73 C;  3SWN C;  1KHI A;  4DEX A;  3CCU Q;  1BBZ A;  2COW A;  1VYV A;  2PZ1 A;  3EGD A;  1K8A R;  3CCJ T;  3I5S A;  4GY5 A;  1RAI B;  2HSE B;  2K3B A;  2RI2 A;  5GAN g;  2M51 A;  2SEM A;  2DTH A;  1Y07 A;  2D8H A;  3GPL A;  3PVL A;  2CH4 A;  3VU3 C;  5AT1 B;  3OS1 A;  4PFO A;  3FEO A;  3I55 Q;  4RTT A;  1OUL A;  3VUZ A;  2CSQ A;  2EBP A;  3I35 A;  1ZSZ C;  3CCM Q;  1PG5 B;  1YI2 T;  3J80 E;  3U23 A;  1TWB A;  3F70 A;  2DZ9 A;  4AG1 C;  2FEI A;  5LJ3 f;  3OS2 A;  1JJ2 S;  4Z8A A;  1QWF A;  4N4I A;  3OB9 A;  4DBH A;  1NG2 A;  4M7D E;  5ECA A;  1JQQ A;  3JCM f;  2OTJ Q;  3TCJ A;  2PUK B;  3SWN A;  3PTA A;  5FU6 C;  4NS5 A;  1VQL T;  1OYX A;  1XOV A;  3CCL Q;  4Z88 A;  1VQO A;  3QKJ A;  4OMN A;  4M7A G;  3J7A F;  3MEW A;  2PQW A;  4KT0 E;  5DLQ E;  4F14 A;  3UWN A;  2RJF A;  4DOV A;  4EDU A;  5KCH A;  2RI3 A;  1UGS B;  3FB9 A;  3ULR B;  4M7D F;  4HCC A;  2LDM A;  5GAN 5;  2LJ3 A;  4XTY A;  4VUB A;  1YCY A;  2X35 A;  4XAX B;  3EHQ A;  3MPU B;  1ZSZ A;  4E7H A;  5IXF A;  2RMO A;  3I9Q A;  3CCE A;  5HK3 A;  1GRI A;  4OMO A;  4PJL A;  2GGR A;  3OYC A;  3QO3 A;  2V8J A;  1UUE A;  2KYM A;  1NJI U;  5GAM h;  4KUL A;  3A98 A;  4C92 B;  5IXB A;  3V8J A;  3M57 A;  1ARK A;  3CBO A;  1VQ4 Q;  2H8H A;  5M9O A;  1YIJ T;  1VQN A;  2LRQ A;  1YWO A;  4M75 D;  3G71 A;  2DEQ A;  1VQ6 A;  4PK4 A;  3VS3 A;  4C5H A;  2LQW A;  3MP1 A;  2DJQ A;  2LCC A;  4BUG A;  1IGU A;  1K0S A;  4A4G A;  4AG2 C;  1SF9 A;  3OYL A;  1UJY A;  2CP7 A;  4OVA A;  5LJ5 j;  3SFM A;  2BZ8 A;  3A8L B;  1VQ5 A;  2QYZ A;  4JJC A;  5GAO m;  1M4Z A;  4L6V 5;  4X9D A;  2J06 A;  3CC2 T;  5A0L A;  3KUF A;  3DLL A;  3HSB A;  4JRP A;  4FIB A;  4PJO G;  1BU1 A;  3GOX A;  3JB9 F;  2DKG A;  2MMP A;  1NYG A;  4ZGJ B;  1M5Q 1;  4M78 G;  4HKE A;  2KMT A;  4JPB W;  3SEM A;  3GNG A;  1G83 A;  2LQ8 A;  1YCS B;  3TSW A;  5GAO r;  1XQH A;  1Q7Y R;  4FW2 A;  1RAG B;  1YIT T;  3VS4 A;  3CCQ Q;  4PJM A;  5A2Q E;  3CMA T;  2QQB A;  4C8Q E;  1Y0M A;  5FLX E;  2C0O A;  2ED1 A;  5IAY A;  5GAN 2;  3DB3 A;  1UDL A;  1OZ2 A;  2D1X A;  3TSZ A;  2EYW A;  4A53 A;  2FZG B;  2YRD A;  5KE2 A;  4KGZ B;  2HKN A;  2JZ2 A;  2AHJ B;  5GAM f;  1N5Z A;  2GFA A;  2XDP A;  1E6H A;  3C12 A;  1JJ2 P;  2K3X A;  4J6W A;  4C8Q F;  2FPE A;  1H92 A;  8AT1 B;  2DA9 A;  4KH0 B;  2ESW A;  2LJ1 A;  2VAS A;  3TQ7 P;  1NJI R;  4M7A D;  2QDY B;  1OQK A;  2VWF A;  4B6M A;  3E2U A;  2JOY A;  4JUV A;  2LNH B;  1G8X A;  4J9G A;  3OQ5 A;  4F7U G;  2P4T A;  3REA B;  4KGX B;  1CKA A;  3L2Z A;  1G2B A;  2DFU A;  3OYE A;  3OYJ A;  2IIM A;  2MWO A;  4E7J A;  1YJ9 Q;  3L42 A;  5I2M A;  1YJN Q;  2KXC A;  5GAN 4;  2DXU A;  2VXF A;  1RAE B;  2E4H A;  3VJP A;  3LGF A;  1OV3 A;  2H3E B;  3OMG A;  4KUD K;  3JB9 I;  4OML A;  5KYN A;  4XTZ A;  1TUC A;  3VYG A;  1WX6 A;  5DM7 R;  2RPN A;  4HT8 A;  2OTL Q;  2QG9 B;  2JM9 A;  4J6X A;  1WJS A;  2RI5 A;  1KQS S;  2DF6 A;  4LNP A;  1CKB A;  4J9D A;  4K11 A;  2L3S A;  1PCX A;  3CCU T;  3OW2 A;  1X6G A;  2DIG A;  1VQ9 Q;  1G3S A;  4RG2 A;  1RAH B;  2EKH A;  4E7Z A;  2E3I A;  4F16 A;  1OU8 A;  2D6F A;  3JSC A;  3M56 A;  3G1J A;  3HRU A;  1VQO T;  4LDX A;  3JCM b;  3H0F A;  2DE0 X;  3JCM W;  1AZE A;  1OX9 A;  2NLU A;  2XG8 D;  3CCV A;  3EGX B;  3SB2 A;  1M1G A;  1YP5 A;  2SRC A;  3JAM E;  2EKO A;  1QKW A;  2OJ2 A;  2J05 A;  1Y57 A;  2M1H A;  1WNL A;  2O9S A;  1B34 B;  2QK0 A;  2DBM A;  4ZNX A;  3BW1 A;  3CC7 A;  2F5K A;  1M2V B;  4Y92 A;  1ZLM A;  2CSI A;  5KYU B;  2EPD A;  4KRT A;  1VIF A;  2QA4 A;  3URG A;  3EG2 A;  1VUB A;  2OTJ T;  3QWY A;  5LJ5 d;  3EFO B;  4M7D D;  2ZZD A;  2DYI A;  3CCL T;  1MNE A;  4HCB A;  3CD6 Q;  2ZGW A;  3OSV A;  3LH5 A;  5L8R E;  1UG1 A;  4D8D A;  1E6G A;  4QVC A;  3G71 T;  4BB7 A;  1N8R C;  2P0P A;  4JLI A;  4C92 E;  1VQ6 T;  1MMG A;  2FL7 A;  5CKD A;  2HSP A;  1EX4 A;  3EGX A;  1D0Y A;  2AKL A;  1H8K A;  2C06 A;  3PVQ A;  1HD3 A;  2KRO A;  2HD0 A;  3CCJ A;  1VA7 A;  3JV3 A;  3GP8 A;  2J6K A;  4BDZ A;  1JRI A;  2KI7 A;  1UHF A;  5GAN d;  4EMH A;  1PSE A;  2J6O A;  1KQ2 A;  4C92 F;  1B34 A;  2XK0 A;  2E70 A;  4PFP A;  1R0C B;  1M2V A;  2EGA A;  2BE9 B;  4IUV A;  1WHH A;  2BE7 D;  2V1Q A;  5KYU A;  3HHT B;  1AD5 A;  3EG3 A;  4BD3 A;  1HSQ A;  4AFU C;  3HRS A;  2F2X A;  4PNO A;  3EFO A;  1YI2 A;  4M7D C;  3PNW C;  1KC8 R;  1V76 A;  1PHT A;  1QCF A;  1BI3 A;  1EIF A;  2DJZ A;  1WJR A;  2CP2 A;  4IIM A;  5CR2 A;  2FG0 A;  3HFO A;  1VQL A;  2VGM A;  2D0Q B;  3NTH A;  1QVG A;  1K9A A;  2YSQ A;  5IHI A;  1K73 U;  5CKH A;  2XMF A;  2KBT A;  1M1K C;  2GCX A;  2QEX A;  2QTV A;  4IUQ A;  4LN2 A;  4A4F A;  3LWI A;  1ZX6 A;  1OPL A;  3JB9 J;  2LT1 A;  4HCK A;  2VYT A;  4DEY A;  3WVD B;  3L2U A;  1YHQ Q;  2RNA A;  1Q81 C;  4J8O A;  1KQS P;  1NLP C;  2G6F X;  3QJ6 A;  4ELZ C;  4JRK A;  1PNJ A;  1KG1 A;  4CC2 A;  1MHN A;  4AFS C;  5KCO A;  2KSS A;  1VQM Q;  2F2W A;  4E7L A;  4M7D A;  4RCC A;  2GTO A;  4J9B A;  5I11 A;  3QYH B;  3M53 A;  3IQL A;  3VS0 A;  1M3B A;  5I2S A;  3CCQ T;  1WLP B;  5CVI A;  2O4X B;  2LX7 A;  2CZ1 B;  3D7S B;  1I4K 1;  3H9N A;  5D7U A;  1AZG B;  2DX1 A;  2X51 A;  3QXE B;  4Z89 A;  1BCO A;  1GCQ A;  3RNJ A;  3CCR Q;  3HKS A;  1OEB A;  5LJ5 f;  2A7Y A;  2E64 A;  3A8H B;  2BZX A;  3GBQ A;  2E6Z A;  2L2P A;  4OB1 B;  4NL2 A;  2IG0 A;  1KJW A;  2KR3 A;  4PLL A;  5DLO A;  3QII A;  4FT4 A;  2ZPB B;  5HK0 A;  2H3J A;  1UGQ B;  1ZUU A;  5D6Y A;  2QGF B;  2DAQ A;  2EW3 A;  4HXJ A;  5IHK A;  2RK2 A;  2I0N A;  1D0Z A;  3OYM A;  1YJ9 T;  1K76 A;  1YJN T;  4CI0 C;  2X4W A;  1BB9 A;  3CCV T;  3OYG A;  2L3Q A;  2RN8 A;  3EG9 A;  1AHJ B;  1QCO A;  2O4X A;  4C8Q B;  2NWM A;  1NEG A;  2AKK A;  4C8Q C;  1K73 R;  1AWJ A;  1JJ2 A;  3C95 A;  3V7R A;  1PKT A;  2Y90 A;  4IIO A;  3JCM h;  5CIU A;  2CZ7 B;  4JDS A;  3CCS Q;  1S1N A;  1Y71 A;  1WZO A;  3FIF A;  1SHF A;  2CT4 A;  2IVW A;  2HL3 A;  3CC4 Q;  4C5G A;  2FPD A;  1VQ7 Q;  4DBQ A;  4XTV A;  1QVP A;  2NUP B;  2M0Y A;  3M58 A;  1WQ7 A;  4OB2 B;  3AHU A;  1WHL A;  2JS2 A;  3R6N A;  1PRL C;  4DOW A;  2DER A;  4HVW A;  1D1A A;  5GMK m;  1WHK A;  4AFZ C;  1HXD A;  3S3O A;  4HVU A;  5HCK A;  2RM4 A;  1YN8 A;  6AT1 B;  2HCK A;  1MND A;  3QPH A;  3M9Q A;  2Y4X A;  2ZCF B;  4C8Q A;  2X4J A;  2E5K A;  1UGR B;  2RF0 A;  3OYH A;  2M02 A;  4O6J A;  4MZT A;  3HL8 A;  1D1C A;  1JB0 E;  3UPU A;  2EJ9 A;  3OYF A;  2BTT A;  2CT3 A;  1P92 A;  2DEU A;  4Y91 A;  2MPX C;  2J7I A;  3OYN A;  1VQ8 Q;  2LZ6 B;  5GAN 6;  1OOT A;  1S72 Q;  1T0J A;  2KY9 A;  3I56 Q;  5KYW B;  1MMA A;  2K9G A;  2NUP A;  4XU2 A;  1GXI E;  2QGG A;  4V2S A;  1WXT A;  1H3Z A;  3G6E A;  2R58 A;  2RQT A;  3CCU A;  1SRL A;  1OI1 A;  4N0A C;  1QW1 A;  1Q82 C;  1QVF S;  4LD9 K;  3RKX A;  3C94 A;  2RK1 A;  3VS7 A;  3HPW A;  4X34 A;  4D8K A;  3E1S A;  3OYY A;  2KXD A;  2XDB A;  5GAN 7;  1TU0 B;  3X25 B;  2QEX T;  3CME Q;  3CPW S;  1FXX A;  2DYB A;  4J5Y A;  3M4G A;  2HDA A;  2F5T X;  4QVZ A;  1B07 A;  1ABO A;  1UFF A;  2A08 A;  3I55 A;  1K1Z A;  5KYY B;  4M78 F;  1QCN A;  3ZL7 C;  1C6V X;  2VVK A;  2ATC B;  3OS0 A;  3UF4 A;  2MYS A;  3KXT A;  2DK3 A;  2X3W D;  1MV3 A;  2QTX A;  2NUT B;  3H0H A;  5FW9 A;  2M16 A;  3JCM Q;  1UJ0 A;  3OYB A;  1GFD A;  5LJ3 e;  4DA4 A;  2RH2 A;  1GBQ A;  1ZA1 B;  4L5G A;  2OTJ A;  3FJP A;  3LH0 A;  3I5R A;  2XID A;  2HQH A;  5FRO A;  4Y28 E;  4CC7 A;  4N0A A;  1G3W A;  3CCL A;  4J83 A;  2L0A A;  4C92 C;  1V29 B;  4BI8 B;  2GQI A;  1TG0 A;  1UEB A;  2JS0 A;  3BDL A;  2ED0 A;  2O01 E;  3TU4 K;  4O5V A;  1IGQ A;  3M0Q A;  4D6W A;  4BE0 A;  1YHQ T;  1YFN A;  2HEQ A;  5LJ3 g;  1N9S A;  2KQW A;  2KGT A;  3M4Y A;  4WTO B;  1N9R A;  4F7U F;  2XI9 A;  2ZPH B;  3SD4 A;  2Y4Y A;  3JCM g;  2YRV A;  2XU8 A;  3PMT A;  2PUO B;  2BZY A;  2ZPE B;  5GMK e;  2HKQ B;  3OBY A;  3X20 B;  2EAY A;  3QDF A;  3Q1J A;  5GJW B;  2NUT A;  1JXM A;  4M77 F;  1VQK Q;  3VRZ A;  1HYO A;  3RUX A;  1RUW A;  1N6A A;  2RHY A;  2W10 A;  5CCA A;  2RHZ A;  1VQ4 A;  2KEA A;  1WGS A;  1PD1 A;  1ZUY A;  4C92 A;  1WHG A;  3VKI A;  5GAN j;  3OYD A;  2D8J A;  2YDL A;  1UHC A;  3QZ9 B; 
#chains in the Genus database with same CATH homology
 2DBM A;  4JZ3 A;  4ZNX A;  2GTJ A;  1WI7 A;  3H41 A;  2AZV A;  2YT6 A;  4Y92 A;  1ZLM A;  2CSI A;  4JZ4 A;  2GNC A;  2EPD A;  2JTE A;  2CH4 W;  4KRT A;  1T0H A;  4CC3 A;  3EG2 A;  1MUZ A;  1Z9Z A;  4LE9 A;  3QWY A;  1U3O A;  2ABL A;  2LQN A;  2HBW A;  1ABQ A;  3LH5 A;  1GCP A;  1UG1 A;  1E6G A;  4D8D A;  2DBK A;  2KNB B;  1I1J A;  2EGE A;  4RTV A;  1B3Q A;  4QT7 A;  2RQR A;  4RTU A;  2HSP A;  2F2V A;  1WA7 A;  2ROL A;  2ENM A;  3THK A;  4J9I A;  2AKL A;  1H8K A;  1NYF A;  1W70 A;  2V1R A;  3PVQ A;  1HD3 A;  2EYX A;  1UEC A;  2KRO A;  2KT8 A;  1VA7 A;  1J3T A;  3C0C A;  3JV3 A;  4OMP A;  2KRS A;  2J6K A;  1ZBJ A;  2C0I A;  1UHF A;  2DL5 A;  1T3S A;  1AWW A;  2KE9 A;  1PKS A;  2OAW A;  3M0R A;  2J6O A;  1JU5 C;  2DRM A;  3UA7 A;  4RTW A;  2EGA A;  1NM7 A;  2YUO A;  2LMJ A;  2KT1 A;  2V1Q A;  2YUQ A;  1AD5 A;  1JXO A;  2X3X D;  3EG3 A;  1HSQ A;  4AFU C;  3EG1 A;  2F2X A;  2FRW A;  4GBQ A;  2W0Z A;  1JO8 A;  2DL4 A;  2EVR A;  1TUD A;  4LUE A;  2DIL A;  3H0I A;  1PHT A;  1QCF A;  2OI3 A;  1KIK A;  4X1V A;  1Z9Q A;  4IIM A;  3EGU A;  2DL8 A;  2FG0 A;  2LJ0 A;  2JMC A;  4WCI A;  1VYT A;  2DM1 A;  1FYN A;  3QWX X;  4J9F A;  2ECZ A;  1K9A A;  4RUG A;  2CUB A;  2YSQ A;  5IHI A;  1PWT A;  2XMF A;  5IHN A;  1HJD A;  1WXU A;  2KBT A;  2K7A A;  4LN2 A;  1ZX6 A;  2FRY A;  2K6D A;  1OPL A;  2K79 A;  3PE0 A;  4HCK A;  4DEY A;  2RNA A;  1GBR A;  1NLP C;  4F17 A;  2YUN A;  1AEY A;  3CQT A;  4DEX A;  2G6F X;  1BBZ A;  1VYV A;  2PZ1 A;  1PNJ A;  4CC2 A;  2KRM A;  4AFS C;  1X69 A;  2RQW A;  3I5S A;  1QKX A;  2K3B A;  2F2W A;  2M51 A;  2GTO A;  4J9B A;  2SEM A;  5I11 A;  2D8H A;  2QDL A;  2O9S A;  3IQL A;  3PVL A;  3VS0 A;  1M3B A;  5FWB A;  2O88 A;  1WLP B;  2CH4 A;  2FO0 A;  4RTY A;  4GLM A;  2LX7 A;  3KFV A;  4RTT A;  3M0S A;  2CSQ A;  1AZG B;  1U5S A;  2EBP A;  2DX1 A;  3I35 A;  2DL3 A;  5FWC A;  1IO6 A;  1WIE A;  4Z89 A;  3U23 A;  1GCQ A;  3RNJ A;  1SRM A;  4AG1 C;  1M27 C;  2FEI A;  1OEB A;  1QWF A;  4Z8A A;  4EIK A;  1NG2 A;  2PNI A;  1UGV A;  2A36 A;  4J9E A;  4AFQ C;  5ECA A;  1JQQ A;  2BZX A;  3GBQ A;  1RLQ C;  2L2P A;  1LCK A;  1KSW A;  3FJ5 A;  1XOV A;  4Z88 A;  1K4U S;  1KJW A;  2JW4 A;  2KR3 A;  2O9V A;  2DLP A;  1W1F A;  4OMN A;  1W6X A;  1WYX A;  1X2K A;  1ZUU A;  4F14 A;  4E6R A;  2O2O A;  2EW3 A;  4HXJ A;  5IHK A;  1AOJ A;  2I0N A;  1K76 A;  3ULR B;  1BB9 A;  2RQU A;  2LJ3 A;  3UA6 A;  4JJD A;  2L3Q A;  2RN8 A;  2MIO A;  2NWM A;  1NEG A;  3NHN A;  2AKK A;  2DNU A;  1E7O A;  3EHQ A;  2FPF A;  1H3H A;  5IXF A;  2L3P A;  2RMO A;  1AWJ A;  3I9Q A;  1GRI A;  1PKT A;  4OMO A;  1WDX A;  4IIO A;  2GGR A;  1GL5 A;  2MCN A;  1CSK A;  1X2Q A;  1UUE A;  2KYM A;  1S1N A;  1SHF A;  4JJB A;  2DRK A;  2CT4 A;  4RTZ A;  3A98 A;  5IXB A;  1ARK A;  2FPD A;  2H8H A;  2PTK A;  1UE9 A;  1YWO A;  2M0Y A;  4ORZ A;  3VS3 A;  1FMK A;  1GCQ C;  1NLO C;  1PRL C;  1QWE A;  2DJQ A;  2JS2 A;  2B86 A;  2LQW A;  2LCS A;  1SEM A;  2KRN A;  4OMQ A;  1K0S A;  2RQV A;  3NPF A;  4HVW A;  4AG2 C;  4AFZ C;  1UJY A;  2O31 A;  4HVU A;  2JM8 A;  5HCK A;  1YN8 A;  3NGP A;  4A63 B;  2HCK A;  2BZ8 A;  2EQI A;  5IH2 A;  1X6B A;  2C0T A;  1T3L A;  3VRY A;  4JJC A;  2EGC A;  2E5K A;  3M0T A;  2RF0 A;  2J06 A;  1GFC A;  4R0K A;  1RI9 A;  2LP5 A;  1BU1 A;  2EYZ A;  2JMA A;  1PRM C;  2MOX A;  5L23 A;  2BTT A;  2YUP A;  2CT3 A;  3M0P A;  3VS1 A;  1NYG A;  1X43 A;  1KFZ A;  4ESR A;  2J7I A;  4JPB W;  2LZ6 B;  3SEM A;  1WXB A;  3VS5 A;  1OOT A;  1T0J A;  4OMM A;  1G83 A;  1YCS B;  2K9G A;  3TVT A;  3TSW A;  1I0C A;  1WFW A;  2JT4 A;  3R6N A;  3NMZ C;  3VS4 A;  1K0X A;  4M4Z A;  1WXT A;  1AVZ C;  1Y0M A;  2C0O A;  2ED1 A;  1UDL A;  3TSZ A;  2D1X A;  2EYW A;  2RQT A;  2DL7 A;  1SRL A;  1SPK A;  2CDT A;  2NUZ A;  1N5Z A;  3VS7 A;  3EHR A;  4D8K A;  2KYB A;  3UAT A;  1YWP A;  2KXD A;  1ZUK A;  4J9H A;  1E6H A;  1U06 A;  3SHW A;  1A0N B;  2CUD A;  2FPE A;  2DYB A;  1H92 A;  1QLY A;  2DA9 A;  1YNZ A;  2ESW A;  2LJ1 A;  2HDA A;  1B07 A;  2CRE A;  1ABO A;  2JXB A;  1UFF A;  2A08 A;  2VWF A;  1AWO A;  3EG0 A;  1K1Z A;  2EYY A;  2LNH B;  4J9G A;  3ZL7 C;  1RLP C;  1JEG A;  2AK5 A;  2VVK A;  1X27 A;  3REA B;  3UF4 A;  1CKA A;  2DMO A;  1G2B A;  5GJV B;  2IIM A;  2X3W D;  3VS2 A;  1MV3 A;  3H0H A;  5FW9 A;  1UJ0 A;  1VYU A;  2D0N A;  2KXC A;  1GFD A;  1EFN A;  1GBQ A;  1V1C A;  1OV3 A;  4HVV A;  2VKN A;  4RTX A;  3I5R A;  4OML A;  4CC7 A;  3O5Z A;  2L0A A;  4CC4 B;  1TUC A;  2AZS A;  2GQI A;  4LUD A;  1TG0 A;  2JS0 A;  1WX6 A;  2RPN A;  2ED0 A;  1M8M A;  2JM9 A;  3M0Q A;  5I22 A;  1SHG A;  2DF6 A;  4LNP A;  5EC7 A;  2HEQ A;  1NEB A;  1I07 A;  3M0U A;  1CKB A;  4J9D A;  4K11 A;  3REB B;  1MV0 B;  2KGT A;  2L3S A;  1X6G A;  1ZSG A;  2J6F A;  2EKH A;  4F16 A;  2BZY A;  3H0F A;  1M30 A;  2DE0 X;  1AZE A;  4FSS A;  2P4R A;  1BK2 A;  2A37 A;  2ROT A;  5GJW B;  3RBB B;  1JXM A;  1AWX A;  3VRZ A;  1YP5 A;  2SRC A;  1SSH A;  4J9C A;  3VS6 A;  1RUW A;  1QKW A;  2W10 A;  2OJ2 A;  2KEA A;  2GBQ A;  1M3A A;  2DVJ A;  2J05 A;  1Y57 A;  2A28 A;  1ZUY A;  1M3C A;  1UTI A;  2K2M A;  2D8J A;  2YDL A;  1UHC A;  1OPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...