1ZUYA

High-resolution structure of yeast myo5 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of yeast Myo5 SH3 domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin-5 isoform
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zuyA00
1SSHA 4Z89A 2X3XD 4J9IA 4J9BA 1RI9A 2KRNA 1TG0A 3PE0A 2J7IA 1LCKA 1OEBA 3NHNA 4JZ3A 1M8MA 4LUEA 1WXBA 2D8JA 2FPFA 4LNPA 3NMZC 2G6FX 1TUCA 4AFSC 2ABLA 4OMOA 4M4ZA 3M0RA 2L0AA 2YSQA 1ABOA 1NLOC 2VWFA 2RQWA 1QKXA 2EYXA 1V1CA 2FRYA 2B86A 1X43A 4IIOA 4RTWA 4AFUC 2OJ2A 1ZUUA 3EHRA 2VVKA 3M0UA 1CKBA 1WLPB 4K11A 3THKA 2O88A 2LZ6B 1M27C 3H0FA 4GLMA 2O2OA 4CC7A 1WYXA 2ROLA 1J3TA 3RBBB 1Y57A 3KFVA 2ROTA 1SHGA 3H0HA 2QDLA 1AVZC 1K0SA 1T3SA 2KXCA 1G83A 2NUZA 1WXUA 4EIKA 1M30A 2SEMA 4RTZA 4A63B 2BZXA 4JJDA 1NG2A 4DEYA 4J9EA 3TVTA 2KRMA 3SHWA 1WA7A 1JXMA 4E6RA 2ED1A 4Z8AA 2HEQA 2K7AA 1QWEA 1WFWA 2P4RA 1UUEA 2C0OA 1I07A 2J6FA 2DE0X 2A28A 1AOJA 4FSSA 4HVWA 3VS6A 3M0SA 2LJ1A 2XMFA 2EYWA 3REBB 1ZBJA 2K2MA 2KNBB 4Z88A 1SRLA 4OMLA 1IO6A 2AZVA 2BZ8A 1RUWA 2X3WD 2EVRA 2I0NA 3C0CA 2L2PA 2DYBA 1OPLA 3PVQA 2A36A 1UE9A 2O9VA 2EBPA 2ECZA 3EHQA 1WX6A 1YNZA 2PZ1A 1OV3A 1UTIA 2DL4A 4J9CA 2E5KA 3UA6A 4RUGA 4AG2C 2RQVA 3TSZA 1K4US 2V1RA 2HCKA 3VS7A 2CDTA 1GCPA 2KYMA 1MUZA 1UGVA 2EQIA 1TUDA 4HXJA 2AKLA 5GJWB 2VKNA 2CH4W 2DJQA 3UA7A 1VA7A 1SHFA 4CC4B 3VRZA 3UF4A 2FO0A 4AFQC 4CC2A 3VRYA 1ZSGA 2DNUA 2KRSA 3CQTA 1SPKA 4KRTA 1NEBA 2EW3A 2DVJA 4J9FA 1H3HA 1GBRA 1MV0B 2FPEA 2CH4A 2EGEA 1PRMC 2DBKA 4RTXA 2CREA 2EPDA 2D1XA 2LMJA 2K3BA 5I22A 5IXBA 2KROA 2EYZA 4ESRA 4ZNXA 3EG0A 4WCIA 2KR3A 2GGRA 2MOXA 2FPDA 1GRIA 1E7OA 1X2KA 3GBQA 3EG2A 1U5SA 2F2VA 2YUNA 3VS2A 4AFZC 2YDLA 2BZYA 3I9QA 2OAWA 1NYFA 1WDXA 1BU1A 3PVLA 1UFFA 1K1ZA 3VS1A 3H41A 4RTTA 4JPBW 4OMPA 1VYUA 1UHCA 1OOTA 1CSKA 2JM9A 1GBQA 2EGCA 3O5ZA 4OMQA 2RQTA 2BTTA 2CT4A 1AWXA 1AWJA 4X1VA 1QLYA 2CUBA 1SEMA 5IHIA 2RQRA 2YT6A 3TSWA 2KXDA 1HJDA 1CKAA 1UJYA 4J9DA 3I5SA 1T3LA 4JJCA 1FYNA 1JQQA 2JS0A 2EYYA 2D0NA 1GFDA 4F16A 2LQWA 4RTUA 2J6OA 2OI3A 1PKSA 1KIKA 1VYVA 2RN8A 1FMKA 4D8KA 5FWCA 1UDLA 2JMCA 2DA9A 2DLPA 2M0YA 2RMOA 2J6KA 2LNHB 1E6HA 3SEMA 1BB9A 1H92A 2A37A 1AD5A 5FW9A 2C0TA 1K0XA 1EFNA 1T0HA 2FRWA 2ENMA 1WI7A 2KGTA 1NEGA 2JMAA 2DL5A 2PNIA 1JEGA 2JM8A 1RLQC 1JU5C 3M0QA 1X27A 1Z9ZA 1OPKA 2DM1A 2NWMA 2JXBA 2L3PA 2LX7A 3FJ5A 5HCKA 2RNAA 2K79A 3QWXX 2GTOA 4DEXA 1JXOA 5EC7A 2W0ZA 1GL5A 2GNCA 2O9SA 1PKTA 4RTVA 4JJBA 2PTKA 2AZSA 1ARKA 4CC3A 5IHKA 4HCKA 2LCSA 3IQLA 2MCNA 1GCQC 1AZEA 4Y92A 4QT7A 2YUPA 2KBTA 3NPFA 3H0IA 1QWFA 2EKHA 1ZUYA 1T0JA 1U3OA 2YUOA 1QKWA 3EGUA 2AKKA 2RPNA 5L23A 2DF6A 2DRMA 2KYBA 1W1FA 1PRLC 1Y0MA 1BK2A 2W10A 1PHTA 2H8HA 1X69A 2SRCA 3A98A 4RTYA 2MIOA 1HD3A 2HDAA 1G2BA 2C0IA 4OMMA 1ZLMA 4LUDA 3EG1A 1W6XA 2HBWA 1A0NB 1B07A 2EGAA 1K76A 1NM7A 4AG1C 3R6NA 1GFCA 4GBQA 1K9AA 2RQUA 2LJ3A 1UECA 4OMNA 2D8HA 2ED0A 4ORZA 1KSWA 1PWTA 3UATA 1I0CA 2CUDA 1SRMA 2M51A 4F17A 3M0PA 1BBZA 1WIEA 1WXTA 2GTJA 1Z9QA 5I11A 1PNJA 2DL3A 1U06A 3I35A 3VS3A 4HVUA 2LP5A 3RNJA 2LQNA 2JTEA 2DBMA 2KT8A 1GCQA 1M3CA 3VS4A 5FWBA 1AEYA 3ZL7C 2JW4A 1NLPC 4F14A 2J06A 1JO8A 1B3QA 2CT3A 2HSPA 1UJ0A 5ECAA 2GBQA 1X2QA 2DRKA 4LE9A 2FEIA 1UG1A 2CSQA 1ABQA 2DL8A 2YUQA 1VYTA 2FG0A 2KT1A 2L3QA 1H8KA 2JS2A 2JT4A 2O31A 1E6GA 2RF0A 4IIMA 2K6DA 1AWWA 4R0KA 4JZ4A 2ESWA 2KEAA 4LN2A 1ZX6A 4D8DA 5IXFA 1W70A 1UHFA 1MV3A 2V1QA 1YN8A 2LJ0A 1X6BA 1X6GA 1XOVA 2AK5A 2DMOA 4J9HA 2DX1A 2K9GA 1KFZA 4HVVA 4J9GA 3REAB 5IH2A 2A08A 3EG3A 3VS0A 1N5ZA 2GQIA 1S1NA 1M3BA 1YP5A 1QCFA 3VS5A 3U23A 1RLPC 1M3AA 2KE9A 1YWOA 1NYGA 2DILA 2J05A 2CSIA 2DL7A 1AWOA 1I1JA 1KJWA 2L3SA 2F2XA 3JV3A 3NGPA 3QWYA 2F2WA 2IIMA 1HSQA 1YWPA 5IHNA 5GJVB 3M0TA 3I5RA 3ULRB 1AZGB 1YCSB 3LH5A 1ZUKA
chains in the Genus database with same CATH superfamily
2QASA 2ZPHB 1QMCA 3OYFA 1IZ6A 3M58A 3G6ET 2LDMA 2FPFA 2DAQA 2LQ8A 4OB2B 3CCLT 4KGVB 4KH0B 4OMOA 4E2FB 1PC0A 1MMGA 3TEEA 2L0AA 1QKXA 2EYXA 3P8DA 3PT9A 1EX4A 3DB3A 3G71Q 4IIOA 3TU4K 4AFUC 2OJ2A 1FMVA 1WHKA 2VVKA 1B7TA 3H0FA 4GLMA 2O2OA 4CC7A 3QJ6A 3OYNA 3NTKA 4OB0B 3NTHA 2MWOA 1OI1A 1BKBA 3CXCP 4M75D 1H641 1YJNQ 2JOYA 3L42A 4D6WA 5HK3A 3C4SA 1AVZC 2QI2A 2G3RA 3V8LA 2GCXA 2NUZA 2DIQA 4EIKA 1U1SA 5KYXB 5FRMA 1OZ3A 4RTZA 4DBFA 3BFMA 4HT9A 4M78F 4J9EA 5CQYA 3TVTA 3C12A 4E6RA 2ED1A 2HEQA 2RM4A 2MAMA 2P4RA 5GMKl 1B34A 5IT9E 2FVUA 3RMQA 4HVWA 3VS6A 1XTDA 1N8RU 1M90C 2MMPA 3MKDA 3DLLA 1QVGP 3REBB 2LTOA 2FB7A 2EYQA 1VQ9Q 1PD0A 1Y7XA 2AZVA 2XDDA 2IVWA 2X3WD 2QQBA 2EVRA 2L2PA 1NZ9A 3Q1JA 3NFCA 4BY6B 2F1LA 2VXEA 2O9VA 1JJ2S 1WX6A 5GAN3 2DL4A 3UA6A 1MNDA 1YCYA 2PVGB 3FC3A 2HCKA 3JCMe 1WHLA 3VUZA 3QKJA 4M78D 2CH4W 4N4GA 3MP8A 3ZBDA 5J39A 1M90R 4PJOF 4E7SA 3FEOA 3CC2A 4N4HA 2KVQG 4FSXA 2DNUA 1M9SA 4M78A 4PFPA 2QA4Q 2RJCA 1NEBA 2XU8A 4C8QG 1H3HA 4BI3A 2K3XA 3H9NA 2FPEA 4J83A 1BI3A 2EGEA 2F5KA 3CCLA 1PRMC 2CREA 3HFNA 2ZZDA 2CZ6B 2K3BA 4ESRA 5A0DA 5GANh 1BYMA 3CMEA 3ME9A 1IXDA 1GRIA 1X2KA 5GAOq 2E6NA 1U5SA 3VS2A 1KD1C 2D0QB 1YITA 3G4SQ 3I9QA 2OAWA 1K73R 4O5VA 3CMEQ 3G6EA 4XQ3A 1K1ZA 2CKKA 4KUDK 2XDBA 3G4SA 4JPBW 3OW2A 4OMPA 4LDYA 1UHCA 5GANd 2YXYA 1N8RC 4XTYA 2RI5A 3RIRA 2HQXA 2QQ9A 3UT1A 1S72A 1QLYA 2CUBA 1WNLA 1OX9A 3E2UA 5HKCA 1IGUA 1MGQA 3CC7A 2HZYA 3LX7A 1UJYA 1SSFA 3X24B 1FYNA 3QUIA 2EYYA 1S72Q 3HFOA 4ZGJB 2RA2A 1GFDA 1RAGB 2OTLT 1TU0B 2LQWA 4PJJA 4RTUA 4LDVA 3SB2A 2RN8A 4D8KA 1I4K1 5FWCA 1G3YA 4MZPA 2QTXA 2DA9A 3MP6A 2AHJB 2HSEB 3QSUA 2RMOA 2VGMA 5M9OA 1ZA1B 2XK0A 4C5GA 3JCMg 2DERA 5FW9A 1XQHA 2DXUA 2ENMA 2XKOC 3PIPA 1WI7A 5CCAA 3V8JA 1FXXA 4MZTA 1K9MC 2RHUA 2JTFA 2JXBA 2Z0WA 5LJ5f 4BY6C 4XTWA 1BI0A 1O75A 1JXOA 3QYGB 5EC7A 3UWNA 3CCQA 2V8KA 2GNCA 4PLLA 3S3NA 4RTVA 2ZPEB 1WJQA 1G3WA 2R58A 4PJOG 2MCNA 1GCQC 5GAOl 2EJGA 4QT7A 5GAOr 4ZN1A 1ZA2B 2I2LA 3OBYA 4PJOC 3I55Q 1PRLC 1PHTA 2EWNA 1X69A 4XU3A 3A98A 4RTYA 2NYSA 4X34A 4F7UG 4RCBA 4IUUA 2PVOB 1C6VX 2EQUA 1BI2A 3A8MB 1A0NB 3OW2P 1KQ2A 2EGAA 3CCVQ 4PJMA 2QK0A 1K76A 3O8VA 4GBQA 3VUBA 3CCRQ 5CKFA 2XI9A 2ED0A 3CMAQ 5CVIA 4BD3A 4Z02A 5KYWA 3M5AA 4QQGA 2JTMA 4M75C 1SRMA 2M51A 4J8OA 4MMLA 2O4XA 4QVDA 2VXFA 3OYGA 1D1AA 5LJ3e 5I11A 2QTVA 2DL3A 1U06A 3EGDB 1UGQB 3M4YA 2KT8A 2EAYA 1M3CA 3VS4A 2AIRB 2R57A 3ZEHA 1AEYA 3ZL7C 4J6YA 2JW4A 2O4XB 1Y96A 1JO8A 3CPWS 1YITQ 2K2VA 1LJOA 3WXMB 4PL6A 1BI1A 2QG9B 1D3BA 1NJIC 3GNFB 3GNGA 4E7HA 4LDWA 1M2OA 5CKEA 1UG1A 1QCOA 2CSQA 4M77A 1ABQA 1N27A 1VYTA 2L3QA 2JS2A 3I56A 2XIDA 2JT4A 4ATOA 2RF0A 3V8KA 2K6DA 3VYHB 4DOVA 1VQ5A 1U1TA 2ESWA 2GF7A 3LH0A 3OS0A 1M1FA 1W70A 3MCAB 1ZSZB 2AK5A 4J9HA 3PTAA 1I8FA 1OZ2A 1ACMB 4HVVA 4J9GA 3EGDA 4ZGDB 5GAN6 3JCMh 2WSFE 1M3BA 2DK3A 4FIBA 2X4YA 4TVRA 3DLMA 5GAN8 2JJ9A 1NYGA 2RI3A 1I1JA 2F2XA 3QWYA 4B9WA 4LDUA 4M7DA 1NPPA 3DKMA 4RCCA 1YIJT 5GJVB 3V7SA 3I5RA 3BDUA 2XDPA 2DXBA 4PFOA 4J9IA 5FU7C 2HL3A 1VQ7A 2QQAA 4C5HA 1OEBA 4XK8E 3FLGA 1WXBA 3BE3A 2G6FX 1XJWB 4NL2A 4JRPA 4PJOB 1RL2A 5CKBA 3QHSA 4M4ZA 4BE1A 3CCJA 1VQNA 4MMKA 2M1HA 2R5AA 2L8DA 2B86A 1UGSB 1ZUUA 2XICA 3CCVT 2Y4XA 3M0UA 4PNOA 3HRTA 1CKBA 3OS2A 2DKGA 3I55A 4M7AC 2DD5A 2ZPBB 3RBBB 1WHHA 1Y57A 2IG0A 2M9UA 3M4GA 3KFVA 1O9SA 2ROTA 2QDLA 1TOVA 1QVPA 5LJ3f 2NUPA 2KXCA 1BIAA 4OGEA 2YLBA 2SEMA 5GMKj 3RDVA 4M75F 2QEXA 4C8QB 2VYTA 1NG2A 4DEYA 4KT0E 1WA7A 2KAFA 4C92D 1WZOA 1QWEA 1FX7A 4E7KA 5GMKi 1V76A 3CXCS 1JRIA 1I07A 3AHUA 4M78C 1AT1B 1Q81R 2QQRA 1AOJA 4BACA 1YI2T 4ZN3A 4FSSA 2WSCE 2ZAEA 5GAMf 1W2BS 2XMFA 2EYWA 1K9MR 2GQVA 3G71A 3JB9H 8ATCB 2KNBB 3MEWA 4KH1B 4Z88A 1SRLA 1KQSS 3JCMb 3SD4A 1IO6A 4OP0A 2RHYA 1KK7A 4HA8A 2I0NA 3JCMQ 4QVCA 1OPLA 7AT1B 1UE9A 2EBPA 2ECZA 2X9HA 4C8QA 3CCEA 1YNZA 1OV3A 1UTIA 1C1AA 3I56Q 4FYXB 3TSZA 1WJRA 2K5LA 1GCPA 1KD1R 5LJ5g 2DFUA 4KBMB 1MUZA 1UGVA 1TUDA 2VB6A 3WVDB 5GJWB 1NE8A 3LWHA 1Y71A 1XNIA 4EMHA 2ZPIB 5GMKh 1BCMA 3SWNC 3UA7A 3LWIA 1I5OB 2E4HA 3JCMJ 2CS7A 2PU9B 3UF4A 2FO0A 2OTLQ 3RKXA 3VRYA 1QP2A 3CD6T 3CQTA 5GAN7 4KRTA 4A53A 3GIBA 2BUDA 4FCYA 2ATCB 5GAMj 4JUVA 4KGXB 1GBRA 1MV0B 4X9CA 3OBWA 1KG1A 2CH4A 4Y28E 4RTXA 3CD6Q 2EPDA 5C6SA 2EYZA 3OMCA 1HK9A 3A8GB 3J81E 3CCUQ 1WHJA 4WCIA 1N9RA 1MMDA 4M7DG 3C95A 2E70A 3GBQA 3EG2A 2FZCB 2YUNA 2HNIA 2KI7A 4M7DF 1VQ9T 2BZYA 4M78B 3KUFA 2H3EB 2EQKA 3HSBA 1OQKA 3PVLA 4C0ZA 1UFFA 2CYZB 3HPWA 4Y91A 4A4HA 1Y96B 3VS1A 1QVFP 2E64A 3OYMA 4M7AB 3RERA 1D0ZA 1VYUA 2R5MA 1D3BB 3O5ZA 2M0OA 4BB7A 1NJIR 3CCSQ 1G3SA 4E7JA 1AWXA 1AWJA 4X1VA 5IHIA 1NJIU 1VQ5T 1IHWA 2FHDA 3I5SA 1T3LA 4FM4B 2VUBA 3C94A 2FYKA 4HCCA 4F7UA 1Q86R 5J26A 2D0NA 4F16A 2K3YA 3OSSC 4A4FA 1UGRB 1KQ1A 3PFSA 3M57A 4O6JA 1KIKA 1IHVA 3G4ST 3GOXA 3E9FA 1FMKA 3LGFA 2QEXQ 4C5IA 4FYVB 1IRXA 2J6KA 2LNHB 2KQWA 4GY5A 1K73U 1JJ2A 1BB9A 1M2VA 5GMKe 2C0TA 4OB3B 1NEGA 1JEGA 1JU5C 2OTJA 1X27A 1Z9ZA 1OPKA 2DM1A 1WHMA 2LX7A 5CO7A 1YHQA 1EIFA 3L2QA 1D1BA 2K79A 2RHZA 2VC8A 3CCMQ 2GTOA 4HCZA 1QP3A 1HYOA 4A4KA 2EFIA 2CP2A 2O9SA 1PKTA 2OTJQ 2GFAA 2PTKA 5HK0A 1ARKA 5IHKA 3OYEA 4HCKA 1MMAA 1VQ4A 2DPPB 1Y07A 2D6FA 2KBTA 3URGA 3H0IA 1QWFA 3N5BB 2EKHA 3OYCA 1T0JA 3EGUA 1QKWA 2RPNA 4XTXA 2DF6A 1W1FA 1BK2A 2W10A 1Q95G 2OX7A 1KD1U 4L59A 3H6ZA 2L5QA 3A8OB 2C0IA 1TUGB 1W6XA 2PVDB 1GFCA 3HRSA 2CP0A 2RQUA 4N0AA 4PK4A 4OMNA 2D8HA 3M53A 2BIVA 3MEVA 1KSWA 2DJZA 4F17A 1VQMT 3OY9A 1WXTA 4ZGEB 1I81A 1M1GA 5GAMe 5KH6A 1VQOQ 3UDCA 4HVUA 2LP5A 1PCXA 2LQNA 5KYWB 4RMOA 2RK1A 1NLPC 3CCJQ 1P92A 2JNGA 1B3QA 2MPXC 1VQOT 3E1SA 5ECAA 4C5EA 3CC7T 4BE2A 1X2QA 2CP5A 1VQ4T 2FEIA 2VGNA 3T9NA 2DL8A 2P84A 2YUQA 4P5NA 2ZPFB 2NUTA 1M90U 1UGPB 1QVGA 4IIMA 1AWWA 4XU0A 3KXTA 4R0KA 1ZHIA 2XG8D 4JZ4A 3SFMA 4LN2A 4D8DA 2DD4A 3UPUA 4PKCC 3LYIA 1MV3A 3JCMc 1YN8A 2DMOA 2COYA 1VQ5Q 2DX1A 2K9GA 4XU2A 5IH2A 2DZ9A 3EG9B 4EPCA 1N5ZA 1S1NA 4C8QE 1X75C 1YP5A 4R56A 3CEYA 5I21A 1QCFA 3EH1A 5IAYA 1ZSZC 3DB4A 5LJ3d 2KE9A 4EMKA 3M55A 3J80E 2DILA 4V2SA 2DL7A 3EG9A 1KJWA 3JV3A 4M7DE 2QGFB 2NUPB 1YJ9T 1KC8U 4Z89A 4M77E 2X35A 2KRNA 1TG0A 1WQWA 2J7IA 3PE0A 4EMGA 2AT1B 3NHNA 4OGCA 4JZ3A 4LUEA 4BI4A 5GAOn 4LDXA 2FZGB 2CZ0B 4FW2A 4PJOA 3BY7A 2ABLA 4AFSC 1QQJA 4C92E 3CCQQ 5FRNA 3M0RA 3JB9F 3VV0A 1NLOC 4M77G 3CCET 4E7IA 3OYDA 1OULA 1SG5A 2FRYA 5GANg 5LJ3g 1X43A 3EGXA 4Q5WA 1F1BB 1VUBA 3MEAA 3EHRA 1YI2A 2DETA 3I56T 3THKA 3ASKA 2EQMA 4IUQA 4K11A 2LZ6B 1M27C 1OU9A 1VQLQ 2X4XA 3VYGA 2A3LA 4CRIA 1J3TA 2EQJA 3CC2Q 4JJNK 2DYIA 4DBHA 1SHGA 3H0HA 1X6OA 4ELZC 2YRCA 3OYLA 1B34B 1G83A 2M16A 3SDZA 5KYXA 2HBPA 2Y4YA 3JB9I 3EFOA 1R77A 4JJDA 3EFSA 4A54A 4N4IA 1WJSA 1KQSP 2KRMA 3OW2S 5GAMg 1JXMA 2E3IA 3CCRA 4Z8AA 3RESA 2K7AA 4ZTFA 4LD6A 1WFWA 1UUEA 1QVFA 4JRKA 3MPUB 3I55T 4F7UE 2LCCA 3JSCA 5FU6B 2DZCA 2LJ1A 2DTIA 5IN1A 3QDFA 2NLUA 1RAFB 2QA4T 4M78G 3JCMd 1ZBJA 3KBGA 2V8JA 1Q82C 4OMLA 4M75B 3S3MA 1ZQ1A 4RKUE 1ZSZA 4BI8B 1D1CA 1M1KR 1MNEA 1RUWA 3MO8A 4VUBA 3L2WA 1VQ8A 3MP1A 3HL8A 1FWZA 3PVQA 4C8QD 1M1KC 3VU3C 1YJNA 2K57A 2K5IA 3CC7Q 4J9CA 2E5KA 2YHTA 4RUGA 1VQKQ 3OS5A 1VQ7T 5LJ3h 1K4US 2EKOA 2O01E 2LNVA 2V1RA 3VS7A 1W2BP 2CDTA 1PSEA 2KYMA 2WACA 2EQIA 3G7ZA 2BE9B 2CP7A 2AKLA 3OMGA 3P8HA 5GAOp 1C0MA 3MJXA 1VA7A 2DTOA 4C92F 1SHFA 4ME7A 2EJFA 4IUVA 3EFRA 4CC4B 1ZSGA 3JRZA 1VQPA 2KRSA 1YBYA 2LT4A 2PUOB 2EW3A 4J9FA 3L1AA 4IUPA 1K8AU 3OYJA 1UB4A 5KCOA 4J5YA 2F5TX 2JUFA 3CC4Q 4QVZA 2RO0A 3QZ5B 1QVGS 4MDXA 1M1KU 1Q7YU 4DQ2A 3GPLA 3M54A 4C0GA 2D1XA 2LMJA 5IXBA 5I22A 3CPWA 3TCJA 3CC4A 2KR3A 2GGRA 1YHQQ 2MOXA 3V7RA 2FPDA 3CCMA 4QKUA 5KCHA 3PMIA 1SF9A 4AFZC 3RMSA 4CI0C 5A0GA 1NYFA 1OU8A 4M78E 2NUTB 1BU1A 2HQHA 4JDSA 3GP8A 3MHXA 1VQNQ 3H41A 2K5FA 2E1HA 5DY9A 4M77C 2JM9A 3D7SB 3A1PA 3M59A 4OMQA 2RQTA 2BTTA 2CT4A 1YIJQ 3WVEB 2QGGA 3SWNA 1Q82U 2YT6A 3TSWA 2KXDA 1CKAA 3QDRB 4J9DA 1G5VA 4JLGA 3EAEA 2CP6A 2E12A 2EIFA 5KYUA 4PJOE 1TSFA 1JBMA 4BE0A 3CCLQ 3JB9D 4B9XA 2OI3A 1PKSA 2HKQB 1VYVA 4BUGA 2M0YA 1H3ZA 3RR6A 5D7UA 2QA4A 2WSEE 1E6HA 4XAXB 4M7AD 4FT4A 1D0XA 1AD5A 1WGSA 2VV5A 5D6WA 2QDYB 1T0HA 1K73C 2FRWA 3G6EQ 1VQMQ 3X28B 5KE2A 2XD0A 3OYAA 3HHTB 3CMAA 2NWMA 1YJNT 2L3PA 4C8QF 3FJ5A 4M75G 5HCKA 3V7CA 3J7AF 1M4ZA 2FZKB 2MF2A 2P4TA 1GL5A 2HAXA 3RKWA 4HCBA 3OYBA 4CC3A 1YJWA 4DBRA 1PD1A 2P0QA 4Y92A 2YUPA 1RAHB 3QG1A 1YHQT 1PG5B 3LW5E 1LNXA 4J6XA 5A0LA 1ZUYA 2OTJT 2YUOA 3M9QA 1NPRA 4FYYB 8AT1B 2DRMA 4DA4A 1Y0MA 5GANf 2H8HA 3HRUA 2A0FB 3RUXA 4XTZA 4OB1B 2H3JA 4N0AC 1VQPT 1Q7YR 5AYFA 1HD3A 2PQWA 2E5QA 3CCRT 3OYIA 3MEUA 3PMTA 4OMMA 4R55A 3EG1A 4MZMA 1WPYA 2ZGWA 2MI6A 2COWA 1LOJA 3X20B 1NM7A 1Q86C 1AHJB 3R6NA 2X4WA 1K9AA 1MHNA 4ORZA 2DTHA 1PWTA 3SWNB 2PUKB 3UATA 1I0CA 5CK9A 1VQ7Q 1WIEA 2M02A 4J6WA 1KHIA 2RB6A 3LLRA 2DEUA 1VQ6Q 3RNJA 2JTEA 2DBMA 4HT8A 4KULA 2RH2A 2LCLA 2VASA 3QZ9B 3VKIA 4NL3A 2K4YA 2CZ1B 4QQDA 3PGGA 1TWBA 2CT3A 2XHCA 1UJ0A 2DO3A 2MK5A 5DLOA 2GBQA 2E3HA 4OF1A 1D0YA 4LE9A 1N8RR 2LRQA 1S72T 3QYHB 2B8AA 5GMKm 4FT2A 1LPLA 1WHGA 1M5Q1 4F7UF 2HQEA 2LC4A 4NS5A 2FG0A 2KT1A 3JB9J 2V26A 4XTVA 1TTHB 3META 3CXCA 4C0DC 1FMWA 1ZX6A 3OSVA 5IXFA 4IKFA 5LL6S 1W2BA 3QIIA 1UHFA 4JLIA 1R8OB 3E19A 5KYYB 1X6GA 1XOVA 1UEBA 1QW1A 4PLIA 4M75E 3REAB 1OYXA 3NTIA 3CMET 1RAIB 2A08A 3VS0A 3INZA 1D09B 4XTUA 6AT1B 4M7AE 1PM3A 1VQOA 2IPOB 2RI2A 4ELYC 3VS5A 1M3AA 1YFNA 3QXEB 4BDYA 3NGPA 1VQLT 5GANe 2F2WA 2IIMA 3F70A 1TH7A 1YWPA 3HKSA 2X4JA 1AZGB 1YCSB 2L3RA 1ZUKA 1VQMA 1SSHA 3ZFJA 2DIGA 2X3XD 4J9BA 3X26B 1RI9A 1Q86U 3OQ5A 3EFOB 4M77B 1LCKA 3JCMV 1M8MA 2D8JA 5GAN2 4LNPA 3NMZC 1TUCA 2C06A 4FYWB 2RHIA 5CKDA 4C92B 1IGQA 2COZA 2YSQA 2LT1A 1ABOA 2P0PA 2VWFA 2RQWA 1Q81C 1V1CA 1RACB 1MMNA 2CP3A 4RTWA 3OYKA 3JB9G 3X25B 4M7AA 3L2VA 4A4GA 1VOMA 1WLPB 2O88A 1I5LA 1KC8R 4B6MA 4MDWA 1WYXA 5C0MA 4PJLA 2ROLA 5HY6A 3QO3A 2KDSA 5CR2A 1K0SA 1T3SA 4L6V5 5FLXE 4C0DB 3OB9A 3JCMX 5DM7R 1NBEB 1WXUA 3GF5A 4C92A 1M30A 4X9DA 1RAEB 4EMKC 3RKYA 4A63B 1M2VB 2BZXA 5I2SA 4BDZA 5KE3A 3OS1A 4PJOD 3SHWA 5KYYA 3GLXA 1U8RA 3CD6A 2LQKA 4L5GA 4M7DD 2KMTA 1Q81U 4KGZB 3CCUA 1X01A 4C0FA 4AMCA 2C0OA 4M7DC 2J6FA 4QQ6A 4C8QC 2DE0X 2A28A 4KUIA 3FJPA 2D9TA 4F7UB 4FW1A 3M0SA 2OAUA 3JAME 2YRDA 5LJ5e 5GAOm 2RK2A 2K2MA 1R0BG 2DXTA 4F04B 2BZ8A 5KYUB 3CCJT 2ZPGB 2RJDA 4C92G 3C0CA 2DYBA 3CBMA 1JB0E 2A36A 1V29B 1BIBA 3EHQA 2PZ1A 4AG2C 2V8IA 2RQVA 2YLCA 4C92C 2P0KA 1M8VA 5AT1B 5EG2A 4HXJA 3CPFA 4XU1A 3CBPA 2VKNA 5D6XA 2DJQA 3AT1B 3VRZA 4AFQC 4DOWA 4OVAA 4CC2A 3QJYA 2DXCA 1RAAB 1SPKA 4WF2A 3CMAT 2DVJA 1BCOA 5CIUA 2QEXT 5FROA 2JN0A 5GAN5 9ATCB 1K8AC 2DBKA 4E7LA 3LGLA 2KROA 4ZNXA 4DBQA 3EG0A 2X51A 1HXDA 2BE7D 4NOYA 4JS4A 1E7OA 1VQNT 1G3TA 2F2VA 1EZZB 2YDLA 4M75A 1G8XA 2RJFA 1KC8C 1WDXA 1YJWQ 1VQKA 4J7IA 4M77D 4JRIA 4E47A 1QCNA 3CBOA 2YWWA 3A8HB 5CKHA 1N9SA 4RTTA 1VQ9A 1LVKA 1YJ9A 1OOTA 1CSKA 1GBQA 2QQSA 2EGCA 3L2RA 3L2ZA 5LJ5h 2QXFA 4A4EA 2E65A 4LXCA 3FB9A 2ZCFB 1SEMA 1YITT 2RQRA 4EMKB 3EH2A 1HJDA 3ER0A 3E9GA 4JJCA 2JS0A 1JQQA 2QAZA 2CZ7B 1YIJA 4M77F 4FU6A 4RG2A 5I2MA 5GAMh 2J6OA 4LD9K 2A7YA 5DLQE 2E6ZA 1UDLA 2JMCA 2DLPA 3CC4T 4HKEA 3G71T 3HP9A 2CGHA 1GXIE 3SEMA 4IURA 1H92A 4AT1B 2A37A 1VQ6A 2KY9A 1K0XA 1EFNA 1K9MU 3CCST 4FL6A 2KGTA 3CCMT 1SKUB 2E10A 2JMAA 2DL5A 2PNIA 5L8RE 2JM8A 3CC2T 1RLQC 1RADB 2DEQA 3M0QA 2LX9A 4II1A 1JJ2P 3QBYA 2F69A 2RNAA 3QWXX 4DEXA 2MWPA 4PJNA 2W0ZA 1DJ7B 1K8AR 4JJBA 4ANJA 2AZSA 2E41A 5LJ5j 2LCSA 3IQLA 1VIFA 5D6YA 5FU6C 1AZEA 1VQ8Q 1Q7YC 4JRQA 3NPFA 1N6AA 4EDUA 3HTRA 1U3OA 3FDRA 2AKKA 5L23A 3JCMP 2KYBA 1ZBXA 4M7AG 5LJ5d 4IUTA 3CCSA 5GAN4 2JVVA 3PIOA 2RD1A 1VQ8T 3OYYA 2SRCA 3CCVA 2HMAA 3JCMW 3JCMf 2MYSA 2QYZA 4E7ZA 1TXQA 2MIOA 2HDAA 2KSSA 3FIFA 1G2BA 1ZLMA 4LUDA 2HBWA 1B07A 2L89A 4M7DB 3OYHA 3TQ7P 5CQXA 1PSFA 2RHXA 1VQPQ 4AG1C 1QVFS 2KK4A 1KHCA 2LJ3A 3VJPA 1UECA 2EJ9A 3P8BB 1YJWT 1RABB 3CCQT 2LVMA 2CUDA 3M0PA 1BBZA 2GFUA 2GTJA 3H8ZA 1Z9QA 1PNJA 1WQ7A 3I35A 3VS3A 2FL7A 2HL5C 1GCQA 3G1JA 1VQ4Q 5FWBA 2JZ2A 5GAMd 4J7FA 3A8LB 4F14A 2J06A 4QW2A 3CCUT 2HSPA 1IB8A 1R0CB 2DRKA 3EGXB 3QPHA 1OX8A 1Q82R 1VQKT 3CPWP 4WTOB 5J3BA 2YRVA 5FU7B 1VIEA 1YI2Q 3CCEQ 1RI0A 2HD0A 1H8KA 3A5ZB 1YJ9Q 2O31A 1E6GA 3S6WA 5GANj 2Y90A 5A2QE 4M7AF 3M56A 2KEAA 3FRNA 1IREB 3TREA 2V1QA 3BW1A 2LJ0A 1TS9A 1X6BA 2HKNA 4PFZA 1VQ6T 4YTLA 2RJEA 1KFZA 5KYNA 4JS5A 2OTLA 5CAIA 4UC4A 1KQSA 3EG3A 1VQLA 3R6OA 2BKDN 4ZTJA 2GQIA 4OMFB 4GLKA 5LJ3j 3PNWC 3U23A 1RLPC 1YWOA 3S3OA 2J05A 2CSIA 1AWOA 2L3SA 3OA6A 4RG8A 3BDLA 2DVEA 3L2UA 1HSQA 5IHNA 3M0TA 1W4SA 3ULRB 3LH5A
chains in the Genus database with same CATH topology
1SSHA 4Z89A 2X3XD 4J9IA 4J9BA 1RI9A 2KRNA 1TG0A 3PE0A 2J7IA 1LCKA 1OEBA 3NHNA 4JZ3A 1M8MA 4LUEA 1WXBA 2D8JA 2FPFA 4LNPA 3NMZC 2G6FX 1TUCA 4AFSC 2ABLA 4OMOA 4M4ZA 3M0RA 2L0AA 2YSQA 1ABOA 1NLOC 2VWFA 2RQWA 1QKXA 2EYXA 1V1CA 2FRYA 2B86A 1X43A 4IIOA 4RTWA 4AFUC 2OJ2A 1ZUUA 3EHRA 2VVKA 3M0UA 1CKBA 1WLPB 4K11A 3THKA 2O88A 2LZ6B 1M27C 3H0FA 4GLMA 2O2OA 4CC7A 1WYXA 2ROLA 1J3TA 3RBBB 1Y57A 3KFVA 2ROTA 1SHGA 3H0HA 2QDLA 1AVZC 1K0SA 1T3SA 2KXCA 1G83A 2NUZA 1WXUA 4EIKA 1M30A 2SEMA 4RTZA 4A63B 2BZXA 4JJDA 1NG2A 4DEYA 4J9EA 3TVTA 2KRMA 3SHWA 1WA7A 1JXMA 4E6RA 2ED1A 4Z8AA 2HEQA 2K7AA 1QWEA 1WFWA 2P4RA 1UUEA 2C0OA 1I07A 2J6FA 2DE0X 2A28A 1AOJA 4FSSA 4HVWA 3VS6A 3M0SA 2LJ1A 2XMFA 2EYWA 3REBB 1ZBJA 2K2MA 2KNBB 4Z88A 1SRLA 4OMLA 1IO6A 2AZVA 2BZ8A 1RUWA 2X3WD 2EVRA 2I0NA 3C0CA 2L2PA 2DYBA 1OPLA 3PVQA 2A36A 1UE9A 2O9VA 2EBPA 2ECZA 3EHQA 1WX6A 1YNZA 2PZ1A 1OV3A 1UTIA 2DL4A 4J9CA 2E5KA 3UA6A 4RUGA 4AG2C 2RQVA 3TSZA 1K4US 2V1RA 2HCKA 3VS7A 2CDTA 1GCPA 2KYMA 1MUZA 1UGVA 2EQIA 1TUDA 4HXJA 2AKLA 5GJWB 2VKNA 2CH4W 2DJQA 3UA7A 1VA7A 1SHFA 4CC4B 3VRZA 3UF4A 2FO0A 4AFQC 4CC2A 3VRYA 1ZSGA 2DNUA 2KRSA 3CQTA 1SPKA 4KRTA 1NEBA 2EW3A 2DVJA 4J9FA 1H3HA 1GBRA 1MV0B 2FPEA 2CH4A 2EGEA 1PRMC 2DBKA 4RTXA 2CREA 2EPDA 2D1XA 2LMJA 2K3BA 5I22A 5IXBA 2KROA 2EYZA 4ESRA 4ZNXA 3EG0A 4WCIA 2KR3A 2GGRA 2MOXA 2FPDA 1GRIA 1E7OA 1X2KA 3GBQA 3EG2A 1U5SA 2F2VA 2YUNA 3VS2A 4AFZC 2YDLA 2BZYA 3I9QA 2OAWA 1NYFA 1WDXA 1BU1A 3PVLA 1UFFA 1K1ZA 3VS1A 3H41A 4RTTA 4JPBW 4OMPA 1VYUA 1UHCA 1OOTA 1CSKA 2JM9A 1GBQA 2EGCA 3O5ZA 4OMQA 2RQTA 2BTTA 2CT4A 1AWXA 1AWJA 4X1VA 1QLYA 2CUBA 1SEMA 5IHIA 2RQRA 2YT6A 3TSWA 2KXDA 1HJDA 1CKAA 1UJYA 4J9DA 3I5SA 1T3LA 4JJCA 1FYNA 1JQQA 2JS0A 2EYYA 2D0NA 1GFDA 4F16A 2LQWA 4RTUA 2J6OA 2OI3A 1PKSA 1KIKA 1VYVA 2RN8A 1FMKA 4D8KA 5FWCA 1UDLA 2JMCA 2DA9A 2DLPA 2M0YA 2RMOA 2J6KA 2LNHB 1E6HA 3SEMA 1BB9A 1H92A 2A37A 1AD5A 5FW9A 2C0TA 1K0XA 1EFNA 1T0HA 2FRWA 2ENMA 1WI7A 2KGTA 1NEGA 2JMAA 2DL5A 2PNIA 1JEGA 2JM8A 1RLQC 1JU5C 3M0QA 1X27A 1Z9ZA 1OPKA 2DM1A 2NWMA 2JXBA 2L3PA 2LX7A 3FJ5A 5HCKA 2RNAA 2K79A 3QWXX 2GTOA 4DEXA 1JXOA 5EC7A 2W0ZA 1GL5A 2GNCA 2O9SA 1PKTA 4RTVA 4JJBA 2PTKA 2AZSA 1ARKA 4CC3A 5IHKA 4HCKA 2LCSA 3IQLA 2MCNA 1GCQC 1AZEA 4Y92A 4QT7A 2YUPA 2KBTA 3NPFA 3H0IA 1QWFA 2EKHA 1ZUYA 1T0JA 1U3OA 2YUOA 1QKWA 3EGUA 2AKKA 2RPNA 5L23A 2DF6A 2DRMA 2KYBA 1W1FA 1PRLC 1Y0MA 1BK2A 2W10A 1PHTA 2H8HA 1X69A 2SRCA 3A98A 4RTYA 2MIOA 1HD3A 2HDAA 1G2BA 2C0IA 4OMMA 1ZLMA 4LUDA 3EG1A 1W6XA 2HBWA 1A0NB 1B07A 2EGAA 1K76A 1NM7A 4AG1C 3R6NA 1GFCA 4GBQA 1K9AA 2RQUA 2LJ3A 1UECA 4OMNA 2D8HA 2ED0A 4ORZA 1KSWA 1PWTA 3UATA 1I0CA 2CUDA 1SRMA 2M51A 4F17A 3M0PA 1BBZA 1WIEA 1WXTA 2GTJA 1Z9QA 5I11A 1PNJA 2DL3A 1U06A 3I35A 3VS3A 4HVUA 2LP5A 3RNJA 2LQNA 2JTEA 2DBMA 2KT8A 1GCQA 1M3CA 3VS4A 5FWBA 1AEYA 3ZL7C 2JW4A 1NLPC 4F14A 2J06A 1JO8A 1B3QA 2CT3A 2HSPA 1UJ0A 5ECAA 2GBQA 1X2QA 2DRKA 4LE9A 2FEIA 1UG1A 2CSQA 1ABQA 2DL8A 2YUQA 1VYTA 2FG0A 2KT1A 2L3QA 1H8KA 2JS2A 2JT4A 2O31A 1E6GA 2RF0A 4IIMA 2K6DA 1AWWA 4R0KA 4JZ4A 2ESWA 2KEAA 4LN2A 1ZX6A 4D8DA 5IXFA 1W70A 1UHFA 1MV3A 2V1QA 1YN8A 2LJ0A 1X6BA 1X6GA 1XOVA 2AK5A 2DMOA 4J9HA 2DX1A 2K9GA 1KFZA 4HVVA 4J9GA 3REAB 5IH2A 2A08A 3EG3A 3VS0A 1N5ZA 2GQIA 1S1NA 1M3BA 1YP5A 1QCFA 3VS5A 3U23A 1RLPC 1M3AA 2KE9A 1YWOA 1NYGA 2DILA 2J05A 2CSIA 2DL7A 1AWOA 1I1JA 1KJWA 2L3SA 2F2XA 3JV3A 3NGPA 3QWYA 2F2WA 2IIMA 1HSQA 1YWPA 5IHNA 5GJVB 3M0TA 3I5RA 3ULRB 1AZGB 1YCSB 3LH5A 1ZUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSH A;  4Z89 A;  2X3X D;  4J9I A;  4J9B A;  1RI9 A;  2KRN A;  1TG0 A;  3PE0 A;  2J7I A;  1LCK A;  1OEB A;  3NHN A;  4JZ3 A;  1M8M A;  4LUE A;  1WXB A;  2D8J A;  2FPF A;  4LNP A;  3NMZ C;  2G6F X;  1TUC A;  4AFS C;  2ABL A;  4OMO A;  4M4Z A;  3M0R A;  2L0A A;  2YSQ A;  1ABO A;  1NLO C;  2VWF A;  2RQW A;  1QKX A;  2EYX A;  1V1C A;  2FRY A;  2B86 A;  1X43 A;  4IIO A;  4RTW A;  4AFU C;  2OJ2 A;  1ZUU A;  3EHR A;  2VVK A;  3M0U A;  1CKB A;  1WLP B;  4K11 A;  3THK A;  2O88 A;  2LZ6 B;  1M27 C;  3H0F A;  4GLM A;  2O2O A;  4CC7 A;  1WYX A;  2ROL A;  1J3T A;  3RBB B;  1Y57 A;  3KFV A;  2ROT A;  1SHG A;  3H0H A;  2QDL A;  1AVZ C;  1K0S A;  1T3S A;  2KXC A;  1G83 A;  2NUZ A;  1WXU A;  4EIK A;  1M30 A;  2SEM A;  4RTZ A;  4A63 B;  2BZX A;  4JJD A;  1NG2 A;  4DEY A;  4J9E A;  3TVT A;  2KRM A;  3SHW A;  1WA7 A;  1JXM A;  4E6R A;  2ED1 A;  4Z8A A;  2HEQ A;  2K7A A;  1QWE A;  1WFW A;  2P4R A;  1UUE A;  2C0O A;  1I07 A;  2J6F A;  2DE0 X;  2A28 A;  1AOJ A;  4FSS A;  4HVW A;  3VS6 A;  3M0S A;  2LJ1 A;  2XMF A;  2EYW A;  3REB B;  1ZBJ A;  2K2M A;  2KNB B;  4Z88 A;  1SRL A;  4OML A;  1IO6 A;  2AZV A;  2BZ8 A;  1RUW A;  2X3W D;  2EVR A;  2I0N A;  3C0C A;  2L2P A;  2DYB A;  1OPL A;  3PVQ A;  2A36 A;  1UE9 A;  2O9V A;  2EBP A;  2ECZ A;  3EHQ A;  1WX6 A;  1YNZ A;  2PZ1 A;  1OV3 A;  1UTI A;  2DL4 A;  4J9C A;  2E5K A;  3UA6 A;  4RUG A;  4AG2 C;  2RQV A;  3TSZ A;  1K4U S;  2V1R A;  2HCK A;  3VS7 A;  2CDT A;  1GCP A;  2KYM A;  1MUZ A;  1UGV A;  2EQI A;  1TUD A;  4HXJ A;  2AKL A;  5GJW B;  2VKN A;  2CH4 W;  2DJQ A;  3UA7 A;  1VA7 A;  1SHF A;  4CC4 B;  3VRZ A;  3UF4 A;  2FO0 A;  4AFQ C;  4CC2 A;  3VRY A;  1ZSG A;  2DNU A;  2KRS A;  3CQT A;  1SPK A;  4KRT A;  1NEB A;  2EW3 A;  2DVJ A;  4J9F A;  1H3H A;  1GBR A;  1MV0 B;  2FPE A;  2CH4 A;  2EGE A;  1PRM C;  2DBK A;  4RTX A;  2CRE A;  2EPD A;  2D1X A;  2LMJ A;  2K3B A;  5I22 A;  5IXB A;  2KRO A;  2EYZ A;  4ESR A;  4ZNX A;  3EG0 A;  4WCI A;  2KR3 A;  2GGR A;  2MOX A;  2FPD A;  1GRI A;  1E7O A;  1X2K A;  3GBQ A;  3EG2 A;  1U5S A;  2F2V A;  2YUN A;  3VS2 A;  4AFZ C;  2YDL A;  2BZY A;  3I9Q A;  2OAW A;  1NYF A;  1WDX A;  1BU1 A;  3PVL A;  1UFF A;  1K1Z A;  3VS1 A;  3H41 A;  4RTT A;  4JPB W;  4OMP A;  1VYU A;  1UHC A;  1OOT A;  1CSK A;  2JM9 A;  1GBQ A;  2EGC A;  3O5Z A;  4OMQ A;  2RQT A;  2BTT A;  2CT4 A;  1AWX A;  1AWJ A;  4X1V A;  1QLY A;  2CUB A;  1SEM A;  5IHI A;  2RQR A;  2YT6 A;  3TSW A;  2KXD A;  1HJD A;  1CKA A;  1UJY A;  4J9D A;  3I5S A;  1T3L A;  4JJC A;  1FYN A;  1JQQ A;  2JS0 A;  2EYY A;  2D0N A;  1GFD A;  4F16 A;  2LQW A;  4RTU A;  2J6O A;  2OI3 A;  1PKS A;  1KIK A;  1VYV A;  2RN8 A;  1FMK A;  4D8K A;  5FWC A;  1UDL A;  2JMC A;  2DA9 A;  2DLP A;  2M0Y A;  2RMO A;  2J6K A;  2LNH B;  1E6H A;  3SEM A;  1BB9 A;  1H92 A;  2A37 A;  1AD5 A;  5FW9 A;  2C0T A;  1K0X A;  1EFN A;  1T0H A;  2FRW A;  2ENM A;  1WI7 A;  2KGT A;  1NEG A;  2JMA A;  2DL5 A;  2PNI A;  1JEG A;  2JM8 A;  1RLQ C;  1JU5 C;  3M0Q A;  1X27 A;  1Z9Z A;  1OPK A;  2DM1 A;  2NWM A;  2JXB A;  2L3P A;  2LX7 A;  3FJ5 A;  5HCK A;  2RNA A;  2K79 A;  3QWX X;  2GTO A;  4DEX A;  1JXO A;  5EC7 A;  2W0Z A;  1GL5 A;  2GNC A;  2O9S A;  1PKT A;  4RTV A;  4JJB A;  2PTK A;  2AZS A;  1ARK A;  4CC3 A;  5IHK A;  4HCK A;  2LCS A;  3IQL A;  2MCN A;  1GCQ C;  1AZE A;  4Y92 A;  4QT7 A;  2YUP A;  2KBT A;  3NPF A;  3H0I A;  1QWF A;  2EKH A;  1ZUY A;  1T0J A;  1U3O A;  2YUO A;  1QKW A;  3EGU A;  2AKK A;  2RPN A;  5L23 A;  2DF6 A;  2DRM A;  2KYB A;  1W1F A;  1PRL C;  1Y0M A;  1BK2 A;  2W10 A;  1PHT A;  2H8H A;  1X69 A;  2SRC A;  3A98 A;  4RTY A;  2MIO A;  1HD3 A;  2HDA A;  1G2B A;  2C0I A;  4OMM A;  1ZLM A;  4LUD A;  3EG1 A;  1W6X A;  2HBW A;  1A0N B;  1B07 A;  2EGA A;  1K76 A;  1NM7 A;  4AG1 C;  3R6N A;  1GFC A;  4GBQ A;  1K9A A;  2RQU A;  2LJ3 A;  1UEC A;  4OMN A;  2D8H A;  2ED0 A;  4ORZ A;  1KSW A;  1PWT A;  3UAT A;  1I0C A;  2CUD A;  1SRM A;  2M51 A;  4F17 A;  3M0P A;  1BBZ A;  1WIE A;  1WXT A;  2GTJ A;  1Z9Q A;  5I11 A;  1PNJ A;  2DL3 A;  1U06 A;  3I35 A;  3VS3 A;  4HVU A;  2LP5 A;  3RNJ A;  2LQN A;  2JTE A;  2DBM A;  2KT8 A;  1GCQ A;  1M3C A;  3VS4 A;  5FWB A;  1AEY A;  3ZL7 C;  2JW4 A;  1NLP C;  4F14 A;  2J06 A;  1JO8 A;  1B3Q A;  2CT3 A;  2HSP A;  1UJ0 A;  5ECA A;  2GBQ A;  1X2Q A;  2DRK A;  4LE9 A;  2FEI A;  1UG1 A;  2CSQ A;  1ABQ A;  2DL8 A;  2YUQ A;  1VYT A;  2FG0 A;  2KT1 A;  2L3Q A;  1H8K A;  2JS2 A;  2JT4 A;  2O31 A;  1E6G A;  2RF0 A;  4IIM A;  2K6D A;  1AWW A;  4R0K A;  4JZ4 A;  2ESW A;  2KEA A;  4LN2 A;  1ZX6 A;  4D8D A;  5IXF A;  1W70 A;  1UHF A;  1MV3 A;  2V1Q A;  1YN8 A;  2LJ0 A;  1X6B A;  1X6G A;  1XOV A;  2AK5 A;  2DMO A;  4J9H A;  2DX1 A;  2K9G A;  1KFZ A;  4HVV A;  4J9G A;  3REA B;  5IH2 A;  2A08 A;  3EG3 A;  3VS0 A;  1N5Z A;  2GQI A;  1S1N A;  1M3B A;  1YP5 A;  1QCF A;  3VS5 A;  3U23 A;  1RLP C;  1M3A A;  2KE9 A;  1YWO A;  1NYG A;  2DIL A;  2J05 A;  2CSI A;  2DL7 A;  1AWO A;  1I1J A;  1KJW A;  2L3S A;  2F2X A;  3JV3 A;  3NGP A;  3QWY A;  2F2W A;  2IIM A;  1HSQ A;  1YWP A;  5IHN A;  5GJV B;  3M0T A;  3I5R A;  3ULR B;  1AZG B;  1YCS B;  3LH5 A;  1ZUK A; 
#chains in the Genus database with same CATH topology
 2QAS A;  2ZPH B;  1QMC A;  3OYF A;  1IZ6 A;  3M58 A;  3G6E T;  2LDM A;  2FPF A;  2DAQ A;  2LQ8 A;  4OB2 B;  3CCL T;  4KGV B;  4KH0 B;  4OMO A;  4E2F B;  1PC0 A;  1MMG A;  3TEE A;  2L0A A;  1QKX A;  2EYX A;  3P8D A;  3PT9 A;  1EX4 A;  3DB3 A;  3G71 Q;  4IIO A;  3TU4 K;  4AFU C;  2OJ2 A;  1FMV A;  1WHK A;  2VVK A;  1B7T A;  3H0F A;  4GLM A;  2O2O A;  4CC7 A;  3QJ6 A;  3OYN A;  3NTK A;  4OB0 B;  3NTH A;  2MWO A;  1OI1 A;  1BKB A;  3CXC P;  4M75 D;  1H64 1;  1YJN Q;  2JOY A;  3L42 A;  4D6W A;  5HK3 A;  3C4S A;  1AVZ C;  2QI2 A;  2G3R A;  3V8L A;  2GCX A;  2NUZ A;  2DIQ A;  4EIK A;  1U1S A;  5KYX B;  5FRM A;  1OZ3 A;  4RTZ A;  4DBF A;  3BFM A;  4HT9 A;  4M78 F;  4J9E A;  5CQY A;  3TVT A;  3C12 A;  4E6R A;  2ED1 A;  2HEQ A;  2RM4 A;  2MAM A;  2P4R A;  5GMK l;  1B34 A;  5IT9 E;  2FVU A;  3RMQ A;  4HVW A;  3VS6 A;  1XTD A;  1N8R U;  1M90 C;  2MMP A;  3MKD A;  3DLL A;  1QVG P;  3REB B;  2LTO A;  2FB7 A;  2EYQ A;  1VQ9 Q;  1PD0 A;  1Y7X A;  2AZV A;  2XDD A;  2IVW A;  2X3W D;  2QQB A;  2EVR A;  2L2P A;  1NZ9 A;  3Q1J A;  3NFC A;  4BY6 B;  2F1L A;  2VXE A;  2O9V A;  1JJ2 S;  1WX6 A;  5GAN 3;  2DL4 A;  3UA6 A;  1MND A;  1YCY A;  2PVG B;  3FC3 A;  2HCK A;  3JCM e;  1WHL A;  3VUZ A;  3QKJ A;  4M78 D;  2CH4 W;  4N4G A;  3MP8 A;  3ZBD A;  5J39 A;  1M90 R;  4PJO F;  4E7S A;  3FEO A;  3CC2 A;  4N4H A;  2KVQ G;  4FSX A;  2DNU A;  1M9S A;  4M78 A;  4PFP A;  2QA4 Q;  2RJC A;  1NEB A;  2XU8 A;  4C8Q G;  1H3H A;  4BI3 A;  2K3X A;  3H9N A;  2FPE A;  4J83 A;  1BI3 A;  2EGE A;  2F5K A;  3CCL A;  1PRM C;  2CRE A;  3HFN A;  2ZZD A;  2CZ6 B;  2K3B A;  4ESR A;  5A0D A;  5GAN h;  1BYM A;  3CME A;  3ME9 A;  1IXD A;  1GRI A;  1X2K A;  5GAO q;  2E6N A;  1U5S A;  3VS2 A;  1KD1 C;  2D0Q B;  1YIT A;  3G4S Q;  3I9Q A;  2OAW A;  1K73 R;  4O5V A;  3CME Q;  3G6E A;  4XQ3 A;  1K1Z A;  2CKK A;  4KUD K;  2XDB A;  3G4S A;  4JPB W;  3OW2 A;  4OMP A;  4LDY A;  1UHC A;  5GAN d;  2YXY A;  1N8R C;  4XTY A;  2RI5 A;  3RIR A;  2HQX A;  2QQ9 A;  3UT1 A;  1S72 A;  1QLY A;  2CUB A;  1WNL A;  1OX9 A;  3E2U A;  5HKC A;  1IGU A;  1MGQ A;  3CC7 A;  2HZY A;  3LX7 A;  1UJY A;  1SSF A;  3X24 B;  1FYN A;  3QUI A;  2EYY A;  1S72 Q;  3HFO A;  4ZGJ B;  2RA2 A;  1GFD A;  1RAG B;  2OTL T;  1TU0 B;  2LQW A;  4PJJ A;  4RTU A;  4LDV A;  3SB2 A;  2RN8 A;  4D8K A;  1I4K 1;  5FWC A;  1G3Y A;  4MZP A;  2QTX A;  2DA9 A;  3MP6 A;  2AHJ B;  2HSE B;  3QSU A;  2RMO A;  2VGM A;  5M9O A;  1ZA1 B;  2XK0 A;  4C5G A;  3JCM g;  2DER A;  5FW9 A;  1XQH A;  2DXU A;  2ENM A;  2XKO C;  3PIP A;  1WI7 A;  5CCA A;  3V8J A;  1FXX A;  4MZT A;  1K9M C;  2RHU A;  2JTF A;  2JXB A;  2Z0W A;  5LJ5 f;  4BY6 C;  4XTW A;  1BI0 A;  1O75 A;  1JXO A;  3QYG B;  5EC7 A;  3UWN A;  3CCQ A;  2V8K A;  2GNC A;  4PLL A;  3S3N A;  4RTV A;  2ZPE B;  1WJQ A;  1G3W A;  2R58 A;  4PJO G;  2MCN A;  1GCQ C;  5GAO l;  2EJG A;  4QT7 A;  5GAO r;  4ZN1 A;  1ZA2 B;  2I2L A;  3OBY A;  4PJO C;  3I55 Q;  1PRL C;  1PHT A;  2EWN A;  1X69 A;  4XU3 A;  3A98 A;  4RTY A;  2NYS A;  4X34 A;  4F7U G;  4RCB A;  4IUU A;  2PVO B;  1C6V X;  2EQU A;  1BI2 A;  3A8M B;  1A0N B;  3OW2 P;  1KQ2 A;  2EGA A;  3CCV Q;  4PJM A;  2QK0 A;  1K76 A;  3O8V A;  4GBQ A;  3VUB A;  3CCR Q;  5CKF A;  2XI9 A;  2ED0 A;  3CMA Q;  5CVI A;  4BD3 A;  4Z02 A;  5KYW A;  3M5A A;  4QQG A;  2JTM A;  4M75 C;  1SRM A;  2M51 A;  4J8O A;  4MML A;  2O4X A;  4QVD A;  2VXF A;  3OYG A;  1D1A A;  5LJ3 e;  5I11 A;  2QTV A;  2DL3 A;  1U06 A;  3EGD B;  1UGQ B;  3M4Y A;  2KT8 A;  2EAY A;  1M3C A;  3VS4 A;  2AIR B;  2R57 A;  3ZEH A;  1AEY A;  3ZL7 C;  4J6Y A;  2JW4 A;  2O4X B;  1Y96 A;  1JO8 A;  3CPW S;  1YIT Q;  2K2V A;  1LJO A;  3WXM B;  4PL6 A;  1BI1 A;  2QG9 B;  1D3B A;  1NJI C;  3GNF B;  3GNG A;  4E7H A;  4LDW A;  1M2O A;  5CKE A;  1UG1 A;  1QCO A;  2CSQ A;  4M77 A;  1ABQ A;  1N27 A;  1VYT A;  2L3Q A;  2JS2 A;  3I56 A;  2XID A;  2JT4 A;  4ATO A;  2RF0 A;  3V8K A;  2K6D A;  3VYH B;  4DOV A;  1VQ5 A;  1U1T A;  2ESW A;  2GF7 A;  3LH0 A;  3OS0 A;  1M1F A;  1W70 A;  3MCA B;  1ZSZ B;  2AK5 A;  4J9H A;  3PTA A;  1I8F A;  1OZ2 A;  1ACM B;  4HVV A;  4J9G A;  3EGD A;  4ZGD B;  5GAN 6;  3JCM h;  2WSF E;  1M3B A;  2DK3 A;  4FIB A;  2X4Y A;  4TVR A;  3DLM A;  5GAN 8;  2JJ9 A;  1NYG A;  2RI3 A;  1I1J A;  2F2X A;  3QWY A;  4B9W A;  4LDU A;  4M7D A;  1NPP A;  3DKM A;  4RCC A;  1YIJ T;  5GJV B;  3V7S A;  3I5R A;  3BDU A;  2XDP A;  2DXB A;  4PFO A;  4J9I A;  5FU7 C;  2HL3 A;  1VQ7 A;  2QQA A;  4C5H A;  1OEB A;  4XK8 E;  3FLG A;  1WXB A;  3BE3 A;  2G6F X;  1XJW B;  4NL2 A;  4JRP A;  4PJO B;  1RL2 A;  5CKB A;  3QHS A;  4M4Z A;  4BE1 A;  3CCJ A;  1VQN A;  4MMK A;  2M1H A;  2R5A A;  2L8D A;  2B86 A;  1UGS B;  1ZUU A;  2XIC A;  3CCV T;  2Y4X A;  3M0U A;  4PNO A;  3HRT A;  1CKB A;  3OS2 A;  2DKG A;  3I55 A;  4M7A C;  2DD5 A;  2ZPB B;  3RBB B;  1WHH A;  1Y57 A;  2IG0 A;  2M9U A;  3M4G A;  3KFV A;  1O9S A;  2ROT A;  2QDL A;  1TOV A;  1QVP A;  5LJ3 f;  2NUP A;  2KXC A;  1BIA A;  4OGE A;  2YLB A;  2SEM A;  5GMK j;  3RDV A;  4M75 F;  2QEX A;  4C8Q B;  2VYT A;  1NG2 A;  4DEY A;  4KT0 E;  1WA7 A;  2KAF A;  4C92 D;  1WZO A;  1QWE A;  1FX7 A;  4E7K A;  5GMK i;  1V76 A;  3CXC S;  1JRI A;  1I07 A;  3AHU A;  4M78 C;  1AT1 B;  1Q81 R;  2QQR A;  1AOJ A;  4BAC A;  1YI2 T;  4ZN3 A;  4FSS A;  2WSC E;  2ZAE A;  5GAM f;  1W2B S;  2XMF A;  2EYW A;  1K9M R;  2GQV A;  3G71 A;  3JB9 H;  8ATC B;  2KNB B;  3MEW A;  4KH1 B;  4Z88 A;  1SRL A;  1KQS S;  3JCM b;  3SD4 A;  1IO6 A;  4OP0 A;  2RHY A;  1KK7 A;  4HA8 A;  2I0N A;  3JCM Q;  4QVC A;  1OPL A;  7AT1 B;  1UE9 A;  2EBP A;  2ECZ A;  2X9H A;  4C8Q A;  3CCE A;  1YNZ A;  1OV3 A;  1UTI A;  1C1A A;  3I56 Q;  4FYX B;  3TSZ A;  1WJR A;  2K5L A;  1GCP A;  1KD1 R;  5LJ5 g;  2DFU A;  4KBM B;  1MUZ A;  1UGV A;  1TUD A;  2VB6 A;  3WVD B;  5GJW B;  1NE8 A;  3LWH A;  1Y71 A;  1XNI A;  4EMH A;  2ZPI B;  5GMK h;  1BCM A;  3SWN C;  3UA7 A;  3LWI A;  1I5O B;  2E4H A;  3JCM J;  2CS7 A;  2PU9 B;  3UF4 A;  2FO0 A;  2OTL Q;  3RKX A;  3VRY A;  1QP2 A;  3CD6 T;  3CQT A;  5GAN 7;  4KRT A;  4A53 A;  3GIB A;  2BUD A;  4FCY A;  2ATC B;  5GAM j;  4JUV A;  4KGX B;  1GBR A;  1MV0 B;  4X9C A;  3OBW A;  1KG1 A;  2CH4 A;  4Y28 E;  4RTX A;  3CD6 Q;  2EPD A;  5C6S A;  2EYZ A;  3OMC A;  1HK9 A;  3A8G B;  3J81 E;  3CCU Q;  1WHJ A;  4WCI A;  1N9R A;  1MMD A;  4M7D G;  3C95 A;  2E70 A;  3GBQ A;  3EG2 A;  2FZC B;  2YUN A;  2HNI A;  2KI7 A;  4M7D F;  1VQ9 T;  2BZY A;  4M78 B;  3KUF A;  2H3E B;  2EQK A;  3HSB A;  1OQK A;  3PVL A;  4C0Z A;  1UFF A;  2CYZ B;  3HPW A;  4Y91 A;  4A4H A;  1Y96 B;  3VS1 A;  1QVF P;  2E64 A;  3OYM A;  4M7A B;  3RER A;  1D0Z A;  1VYU A;  2R5M A;  1D3B B;  3O5Z A;  2M0O A;  4BB7 A;  1NJI R;  3CCS Q;  1G3S A;  4E7J A;  1AWX A;  1AWJ A;  4X1V A;  5IHI A;  1NJI U;  1VQ5 T;  1IHW A;  2FHD A;  3I5S A;  1T3L A;  4FM4 B;  2VUB A;  3C94 A;  2FYK A;  4HCC A;  4F7U A;  1Q86 R;  5J26 A;  2D0N A;  4F16 A;  2K3Y A;  3OSS C;  4A4F A;  1UGR B;  1KQ1 A;  3PFS A;  3M57 A;  4O6J A;  1KIK A;  1IHV A;  3G4S T;  3GOX A;  3E9F A;  1FMK A;  3LGF A;  2QEX Q;  4C5I A;  4FYV B;  1IRX A;  2J6K A;  2LNH B;  2KQW A;  4GY5 A;  1K73 U;  1JJ2 A;  1BB9 A;  1M2V A;  5GMK e;  2C0T A;  4OB3 B;  1NEG A;  1JEG A;  1JU5 C;  2OTJ A;  1X27 A;  1Z9Z A;  1OPK A;  2DM1 A;  1WHM A;  2LX7 A;  5CO7 A;  1YHQ A;  1EIF A;  3L2Q A;  1D1B A;  2K79 A;  2RHZ A;  2VC8 A;  3CCM Q;  2GTO A;  4HCZ A;  1QP3 A;  1HYO A;  4A4K A;  2EFI A;  2CP2 A;  2O9S A;  1PKT A;  2OTJ Q;  2GFA A;  2PTK A;  5HK0 A;  1ARK A;  5IHK A;  3OYE A;  4HCK A;  1MMA A;  1VQ4 A;  2DPP B;  1Y07 A;  2D6F A;  2KBT A;  3URG A;  3H0I A;  1QWF A;  3N5B B;  2EKH A;  3OYC A;  1T0J A;  3EGU A;  1QKW A;  2RPN A;  4XTX A;  2DF6 A;  1W1F A;  1BK2 A;  2W10 A;  1Q95 G;  2OX7 A;  1KD1 U;  4L59 A;  3H6Z A;  2L5Q A;  3A8O B;  2C0I A;  1TUG B;  1W6X A;  2PVD B;  1GFC A;  3HRS A;  2CP0 A;  2RQU A;  4N0A A;  4PK4 A;  4OMN A;  2D8H A;  3M53 A;  2BIV A;  3MEV A;  1KSW A;  2DJZ A;  4F17 A;  1VQM T;  3OY9 A;  1WXT A;  4ZGE B;  1I81 A;  1M1G A;  5GAM e;  5KH6 A;  1VQO Q;  3UDC A;  4HVU A;  2LP5 A;  1PCX A;  2LQN A;  5KYW B;  4RMO A;  2RK1 A;  1NLP C;  3CCJ Q;  1P92 A;  2JNG A;  1B3Q A;  2MPX C;  1VQO T;  3E1S A;  5ECA A;  4C5E A;  3CC7 T;  4BE2 A;  1X2Q A;  2CP5 A;  1VQ4 T;  2FEI A;  2VGN A;  3T9N A;  2DL8 A;  2P84 A;  2YUQ A;  4P5N A;  2ZPF B;  2NUT A;  1M90 U;  1UGP B;  1QVG A;  4IIM A;  1AWW A;  4XU0 A;  3KXT A;  4R0K A;  1ZHI A;  2XG8 D;  4JZ4 A;  3SFM A;  4LN2 A;  4D8D A;  2DD4 A;  3UPU A;  4PKC C;  3LYI A;  1MV3 A;  3JCM c;  1YN8 A;  2DMO A;  2COY A;  1VQ5 Q;  2DX1 A;  2K9G A;  4XU2 A;  5IH2 A;  2DZ9 A;  3EG9 B;  4EPC A;  1N5Z A;  1S1N A;  4C8Q E;  1X75 C;  1YP5 A;  4R56 A;  3CEY A;  5I21 A;  1QCF A;  3EH1 A;  5IAY A;  1ZSZ C;  3DB4 A;  5LJ3 d;  2KE9 A;  4EMK A;  3M55 A;  3J80 E;  2DIL A;  4V2S A;  2DL7 A;  3EG9 A;  1KJW A;  3JV3 A;  4M7D E;  2QGF B;  2NUP B;  1YJ9 T;  1KC8 U;  4Z89 A;  4M77 E;  2X35 A;  2KRN A;  1TG0 A;  1WQW A;  2J7I A;  3PE0 A;  4EMG A;  2AT1 B;  3NHN A;  4OGC A;  4JZ3 A;  4LUE A;  4BI4 A;  5GAO n;  4LDX A;  2FZG B;  2CZ0 B;  4FW2 A;  4PJO A;  3BY7 A;  2ABL A;  4AFS C;  1QQJ A;  4C92 E;  3CCQ Q;  5FRN A;  3M0R A;  3JB9 F;  3VV0 A;  1NLO C;  4M77 G;  3CCE T;  4E7I A;  3OYD A;  1OUL A;  1SG5 A;  2FRY A;  5GAN g;  5LJ3 g;  1X43 A;  3EGX A;  4Q5W A;  1F1B B;  1VUB A;  3MEA A;  3EHR A;  1YI2 A;  2DET A;  3I56 T;  3THK A;  3ASK A;  2EQM A;  4IUQ A;  4K11 A;  2LZ6 B;  1M27 C;  1OU9 A;  1VQL Q;  2X4X A;  3VYG A;  2A3L A;  4CRI A;  1J3T A;  2EQJ A;  3CC2 Q;  4JJN K;  2DYI A;  4DBH A;  1SHG A;  3H0H A;  1X6O A;  4ELZ C;  2YRC A;  3OYL A;  1B34 B;  1G83 A;  2M16 A;  3SDZ A;  5KYX A;  2HBP A;  2Y4Y A;  3JB9 I;  3EFO A;  1R77 A;  4JJD A;  3EFS A;  4A54 A;  4N4I A;  1WJS A;  1KQS P;  2KRM A;  3OW2 S;  5GAM g;  1JXM A;  2E3I A;  3CCR A;  4Z8A A;  3RES A;  2K7A A;  4ZTF A;  4LD6 A;  1WFW A;  1UUE A;  1QVF A;  4JRK A;  3MPU B;  3I55 T;  4F7U E;  2LCC A;  3JSC A;  5FU6 B;  2DZC A;  2LJ1 A;  2DTI A;  5IN1 A;  3QDF A;  2NLU A;  1RAF B;  2QA4 T;  4M78 G;  3JCM d;  1ZBJ A;  3KBG A;  2V8J A;  1Q82 C;  4OML A;  4M75 B;  3S3M A;  1ZQ1 A;  4RKU E;  1ZSZ A;  4BI8 B;  1D1C A;  1M1K R;  1MNE A;  1RUW A;  3MO8 A;  4VUB A;  3L2W A;  1VQ8 A;  3MP1 A;  3HL8 A;  1FWZ A;  3PVQ A;  4C8Q D;  1M1K C;  3VU3 C;  1YJN A;  2K57 A;  2K5I A;  3CC7 Q;  4J9C A;  2E5K A;  2YHT A;  4RUG A;  1VQK Q;  3OS5 A;  1VQ7 T;  5LJ3 h;  1K4U S;  2EKO A;  2O01 E;  2LNV A;  2V1R A;  3VS7 A;  1W2B P;  2CDT A;  1PSE A;  2KYM A;  2WAC A;  2EQI A;  3G7Z A;  2BE9 B;  2CP7 A;  2AKL A;  3OMG A;  3P8H A;  5GAO p;  1C0M A;  3MJX A;  1VA7 A;  2DTO A;  4C92 F;  1SHF A;  4ME7 A;  2EJF A;  4IUV A;  3EFR A;  4CC4 B;  1ZSG A;  3JRZ A;  1VQP A;  2KRS A;  1YBY A;  2LT4 A;  2PUO B;  2EW3 A;  4J9F A;  3L1A A;  4IUP A;  1K8A U;  3OYJ A;  1UB4 A;  5KCO A;  4J5Y A;  2F5T X;  2JUF A;  3CC4 Q;  4QVZ A;  2RO0 A;  3QZ5 B;  1QVG S;  4MDX A;  1M1K U;  1Q7Y U;  4DQ2 A;  3GPL A;  3M54 A;  4C0G A;  2D1X A;  2LMJ A;  5IXB A;  5I22 A;  3CPW A;  3TCJ A;  3CC4 A;  2KR3 A;  2GGR A;  1YHQ Q;  2MOX A;  3V7R A;  2FPD A;  3CCM A;  4QKU A;  5KCH A;  3PMI A;  1SF9 A;  4AFZ C;  3RMS A;  4CI0 C;  5A0G A;  1NYF A;  1OU8 A;  4M78 E;  2NUT B;  1BU1 A;  2HQH A;  4JDS A;  3GP8 A;  3MHX A;  1VQN Q;  3H41 A;  2K5F A;  2E1H A;  5DY9 A;  4M77 C;  2JM9 A;  3D7S B;  3A1P A;  3M59 A;  4OMQ A;  2RQT A;  2BTT A;  2CT4 A;  1YIJ Q;  3WVE B;  2QGG A;  3SWN A;  1Q82 U;  2YT6 A;  3TSW A;  2KXD A;  1CKA A;  3QDR B;  4J9D A;  1G5V A;  4JLG A;  3EAE A;  2CP6 A;  2E12 A;  2EIF A;  5KYU A;  4PJO E;  1TSF A;  1JBM A;  4BE0 A;  3CCL Q;  3JB9 D;  4B9X A;  2OI3 A;  1PKS A;  2HKQ B;  1VYV A;  4BUG A;  2M0Y A;  1H3Z A;  3RR6 A;  5D7U A;  2QA4 A;  2WSE E;  1E6H A;  4XAX B;  4M7A D;  4FT4 A;  1D0X A;  1AD5 A;  1WGS A;  2VV5 A;  5D6W A;  2QDY B;  1T0H A;  1K73 C;  2FRW A;  3G6E Q;  1VQM Q;  3X28 B;  5KE2 A;  2XD0 A;  3OYA A;  3HHT B;  3CMA A;  2NWM A;  1YJN T;  2L3P A;  4C8Q F;  3FJ5 A;  4M75 G;  5HCK A;  3V7C A;  3J7A F;  1M4Z A;  2FZK B;  2MF2 A;  2P4T A;  1GL5 A;  2HAX A;  3RKW A;  4HCB A;  3OYB A;  4CC3 A;  1YJW A;  4DBR A;  1PD1 A;  2P0Q A;  4Y92 A;  2YUP A;  1RAH B;  3QG1 A;  1YHQ T;  1PG5 B;  3LW5 E;  1LNX A;  4J6X A;  5A0L A;  1ZUY A;  2OTJ T;  2YUO A;  3M9Q A;  1NPR A;  4FYY B;  8AT1 B;  2DRM A;  4DA4 A;  1Y0M A;  5GAN f;  2H8H A;  3HRU A;  2A0F B;  3RUX A;  4XTZ A;  4OB1 B;  2H3J A;  4N0A C;  1VQP T;  1Q7Y R;  5AYF A;  1HD3 A;  2PQW A;  2E5Q A;  3CCR T;  3OYI A;  3MEU A;  3PMT A;  4OMM A;  4R55 A;  3EG1 A;  4MZM A;  1WPY A;  2ZGW A;  2MI6 A;  2COW A;  1LOJ A;  3X20 B;  1NM7 A;  1Q86 C;  1AHJ B;  3R6N A;  2X4W A;  1K9A A;  1MHN A;  4ORZ A;  2DTH A;  1PWT A;  3SWN B;  2PUK B;  3UAT A;  1I0C A;  5CK9 A;  1VQ7 Q;  1WIE A;  2M02 A;  4J6W A;  1KHI A;  2RB6 A;  3LLR A;  2DEU A;  1VQ6 Q;  3RNJ A;  2JTE A;  2DBM A;  4HT8 A;  4KUL A;  2RH2 A;  2LCL A;  2VAS A;  3QZ9 B;  3VKI A;  4NL3 A;  2K4Y A;  2CZ1 B;  4QQD A;  3PGG A;  1TWB A;  2CT3 A;  2XHC A;  1UJ0 A;  2DO3 A;  2MK5 A;  5DLO A;  2GBQ A;  2E3H A;  4OF1 A;  1D0Y A;  4LE9 A;  1N8R R;  2LRQ A;  1S72 T;  3QYH B;  2B8A A;  5GMK m;  4FT2 A;  1LPL A;  1WHG A;  1M5Q 1;  4F7U F;  2HQE A;  2LC4 A;  4NS5 A;  2FG0 A;  2KT1 A;  3JB9 J;  2V26 A;  4XTV A;  1TTH B;  3MET A;  3CXC A;  4C0D C;  1FMW A;  1ZX6 A;  3OSV A;  5IXF A;  4IKF A;  5LL6 S;  1W2B A;  3QII A;  1UHF A;  4JLI A;  1R8O B;  3E19 A;  5KYY B;  1X6G A;  1XOV A;  1UEB A;  1QW1 A;  4PLI A;  4M75 E;  3REA B;  1OYX A;  3NTI A;  3CME T;  1RAI B;  2A08 A;  3VS0 A;  3INZ A;  1D09 B;  4XTU A;  6AT1 B;  4M7A E;  1PM3 A;  1VQO A;  2IPO B;  2RI2 A;  4ELY C;  3VS5 A;  1M3A A;  1YFN A;  3QXE B;  4BDY A;  3NGP A;  1VQL T;  5GAN e;  2F2W A;  2IIM A;  3F70 A;  1TH7 A;  1YWP A;  3HKS A;  2X4J A;  1AZG B;  1YCS B;  2L3R A;  1ZUK A;  1VQM A;  1SSH A;  3ZFJ A;  2DIG A;  2X3X D;  4J9B A;  3X26 B;  1RI9 A;  1Q86 U;  3OQ5 A;  3EFO B;  4M77 B;  1LCK A;  3JCM V;  1M8M A;  2D8J A;  5GAN 2;  4LNP A;  3NMZ C;  1TUC A;  2C06 A;  4FYW B;  2RHI A;  5CKD A;  4C92 B;  1IGQ A;  2COZ A;  2YSQ A;  2LT1 A;  1ABO A;  2P0P A;  2VWF A;  2RQW A;  1Q81 C;  1V1C A;  1RAC B;  1MMN A;  2CP3 A;  4RTW A;  3OYK A;  3JB9 G;  3X25 B;  4M7A A;  3L2V A;  4A4G A;  1VOM A;  1WLP B;  2O88 A;  1I5L A;  1KC8 R;  4B6M A;  4MDW A;  1WYX A;  5C0M A;  4PJL A;  2ROL A;  5HY6 A;  3QO3 A;  2KDS A;  5CR2 A;  1K0S A;  1T3S A;  4L6V 5;  5FLX E;  4C0D B;  3OB9 A;  3JCM X;  5DM7 R;  1NBE B;  1WXU A;  3GF5 A;  4C92 A;  1M30 A;  4X9D A;  1RAE B;  4EMK C;  3RKY A;  4A63 B;  1M2V B;  2BZX A;  5I2S A;  4BDZ A;  5KE3 A;  3OS1 A;  4PJO D;  3SHW A;  5KYY A;  3GLX A;  1U8R A;  3CD6 A;  2LQK A;  4L5G A;  4M7D D;  2KMT A;  1Q81 U;  4KGZ B;  3CCU A;  1X01 A;  4C0F A;  4AMC A;  2C0O A;  4M7D C;  2J6F A;  4QQ6 A;  4C8Q C;  2DE0 X;  2A28 A;  4KUI A;  3FJP A;  2D9T A;  4F7U B;  4FW1 A;  3M0S A;  2OAU A;  3JAM E;  2YRD A;  5LJ5 e;  5GAO m;  2RK2 A;  2K2M A;  1R0B G;  2DXT A;  4F04 B;  2BZ8 A;  5KYU B;  3CCJ T;  2ZPG B;  2RJD A;  4C92 G;  3C0C A;  2DYB A;  3CBM A;  1JB0 E;  2A36 A;  1V29 B;  1BIB A;  3EHQ A;  2PZ1 A;  4AG2 C;  2V8I A;  2RQV A;  2YLC A;  4C92 C;  2P0K A;  1M8V A;  5AT1 B;  5EG2 A;  4HXJ A;  3CPF A;  4XU1 A;  3CBP A;  2VKN A;  5D6X A;  2DJQ A;  3AT1 B;  3VRZ A;  4AFQ C;  4DOW A;  4OVA A;  4CC2 A;  3QJY A;  2DXC A;  1RAA B;  1SPK A;  4WF2 A;  3CMA T;  2DVJ A;  1BCO A;  5CIU A;  2QEX T;  5FRO A;  2JN0 A;  5GAN 5;  9ATC B;  1K8A C;  2DBK A;  4E7L A;  3LGL A;  2KRO A;  4ZNX A;  4DBQ A;  3EG0 A;  2X51 A;  1HXD A;  2BE7 D;  4NOY A;  4JS4 A;  1E7O A;  1VQN T;  1G3T A;  2F2V A;  1EZZ B;  2YDL A;  4M75 A;  1G8X A;  2RJF A;  1KC8 C;  1WDX A;  1YJW Q;  1VQK A;  4J7I A;  4M77 D;  4JRI A;  4E47 A;  1QCN A;  3CBO A;  2YWW A;  3A8H B;  5CKH A;  1N9S A;  4RTT A;  1VQ9 A;  1LVK A;  1YJ9 A;  1OOT A;  1CSK A;  1GBQ A;  2QQS A;  2EGC A;  3L2R A;  3L2Z A;  5LJ5 h;  2QXF A;  4A4E A;  2E65 A;  4LXC A;  3FB9 A;  2ZCF B;  1SEM A;  1YIT T;  2RQR A;  4EMK B;  3EH2 A;  1HJD A;  3ER0 A;  3E9G A;  4JJC A;  2JS0 A;  1JQQ A;  2QAZ A;  2CZ7 B;  1YIJ A;  4M77 F;  4FU6 A;  4RG2 A;  5I2M A;  5GAM h;  2J6O A;  4LD9 K;  2A7Y A;  5DLQ E;  2E6Z A;  1UDL A;  2JMC A;  2DLP A;  3CC4 T;  4HKE A;  3G71 T;  3HP9 A;  2CGH A;  1GXI E;  3SEM A;  4IUR A;  1H92 A;  4AT1 B;  2A37 A;  1VQ6 A;  2KY9 A;  1K0X A;  1EFN A;  1K9M U;  3CCS T;  4FL6 A;  2KGT A;  3CCM T;  1SKU B;  2E10 A;  2JMA A;  2DL5 A;  2PNI A;  5L8R E;  2JM8 A;  3CC2 T;  1RLQ C;  1RAD B;  2DEQ A;  3M0Q A;  2LX9 A;  4II1 A;  1JJ2 P;  3QBY A;  2F69 A;  2RNA A;  3QWX X;  4DEX A;  2MWP A;  4PJN A;  2W0Z A;  1DJ7 B;  1K8A R;  4JJB A;  4ANJ A;  2AZS A;  2E41 A;  5LJ5 j;  2LCS A;  3IQL A;  1VIF A;  5D6Y A;  5FU6 C;  1AZE A;  1VQ8 Q;  1Q7Y C;  4JRQ A;  3NPF A;  1N6A A;  4EDU A;  3HTR A;  1U3O A;  3FDR A;  2AKK A;  5L23 A;  3JCM P;  2KYB A;  1ZBX A;  4M7A G;  5LJ5 d;  4IUT A;  3CCS A;  5GAN 4;  2JVV A;  3PIO A;  2RD1 A;  1VQ8 T;  3OYY A;  2SRC A;  3CCV A;  2HMA A;  3JCM W;  3JCM f;  2MYS A;  2QYZ A;  4E7Z A;  1TXQ A;  2MIO A;  2HDA A;  2KSS A;  3FIF A;  1G2B A;  1ZLM A;  4LUD A;  2HBW A;  1B07 A;  2L89 A;  4M7D B;  3OYH A;  3TQ7 P;  5CQX A;  1PSF A;  2RHX A;  1VQP Q;  4AG1 C;  1QVF S;  2KK4 A;  1KHC A;  2LJ3 A;  3VJP A;  1UEC A;  2EJ9 A;  3P8B B;  1YJW T;  1RAB B;  3CCQ T;  2LVM A;  2CUD A;  3M0P A;  1BBZ A;  2GFU A;  2GTJ A;  3H8Z A;  1Z9Q A;  1PNJ A;  1WQ7 A;  3I35 A;  3VS3 A;  2FL7 A;  2HL5 C;  1GCQ A;  3G1J A;  1VQ4 Q;  5FWB A;  2JZ2 A;  5GAM d;  4J7F A;  3A8L B;  4F14 A;  2J06 A;  4QW2 A;  3CCU T;  2HSP A;  1IB8 A;  1R0C B;  2DRK A;  3EGX B;  3QPH A;  1OX8 A;  1Q82 R;  1VQK T;  3CPW P;  4WTO B;  5J3B A;  2YRV A;  5FU7 B;  1VIE A;  1YI2 Q;  3CCE Q;  1RI0 A;  2HD0 A;  1H8K A;  3A5Z B;  1YJ9 Q;  2O31 A;  1E6G A;  3S6W A;  5GAN j;  2Y90 A;  5A2Q E;  4M7A F;  3M56 A;  2KEA A;  3FRN A;  1IRE B;  3TRE A;  2V1Q A;  3BW1 A;  2LJ0 A;  1TS9 A;  1X6B A;  2HKN A;  4PFZ A;  1VQ6 T;  4YTL A;  2RJE A;  1KFZ A;  5KYN A;  4JS5 A;  2OTL A;  5CAI A;  4UC4 A;  1KQS A;  3EG3 A;  1VQL A;  3R6O A;  2BKD N;  4ZTJ A;  2GQI A;  4OMF B;  4GLK A;  5LJ3 j;  3PNW C;  3U23 A;  1RLP C;  1YWO A;  3S3O A;  2J05 A;  2CSI A;  1AWO A;  2L3S A;  3OA6 A;  4RG8 A;  3BDL A;  2DVE A;  3L2U A;  1HSQ A;  5IHN A;  3M0T A;  1W4S A;  3ULR B;  3LH5 A; 
#chains in the Genus database with same CATH homology
 1SSH A;  4Z89 A;  2X3X D;  4J9I A;  4J9B A;  1RI9 A;  2KRN A;  1TG0 A;  3PE0 A;  2J7I A;  1LCK A;  1OEB A;  3NHN A;  4JZ3 A;  1M8M A;  4LUE A;  1WXB A;  2D8J A;  2FPF A;  4LNP A;  3NMZ C;  2G6F X;  1TUC A;  4AFS C;  2ABL A;  4OMO A;  4M4Z A;  3M0R A;  2L0A A;  2YSQ A;  1ABO A;  1NLO C;  2VWF A;  2RQW A;  1QKX A;  2EYX A;  1V1C A;  2FRY A;  2B86 A;  1X43 A;  4IIO A;  4RTW A;  4AFU C;  2OJ2 A;  1ZUU A;  3EHR A;  2VVK A;  3M0U A;  1CKB A;  1WLP B;  4K11 A;  3THK A;  2O88 A;  2LZ6 B;  1M27 C;  3H0F A;  4GLM A;  2O2O A;  4CC7 A;  1WYX A;  2ROL A;  1J3T A;  3RBB B;  1Y57 A;  3KFV A;  2ROT A;  1SHG A;  3H0H A;  2QDL A;  1AVZ C;  1K0S A;  1T3S A;  2KXC A;  1G83 A;  2NUZ A;  1WXU A;  4EIK A;  1M30 A;  2SEM A;  4RTZ A;  4A63 B;  2BZX A;  4JJD A;  1NG2 A;  4DEY A;  4J9E A;  3TVT A;  2KRM A;  3SHW A;  1WA7 A;  1JXM A;  4E6R A;  2ED1 A;  4Z8A A;  2HEQ A;  2K7A A;  1QWE A;  1WFW A;  2P4R A;  1UUE A;  2C0O A;  1I07 A;  2J6F A;  2DE0 X;  2A28 A;  1AOJ A;  4FSS A;  4HVW A;  3VS6 A;  3M0S A;  2LJ1 A;  2XMF A;  2EYW A;  3REB B;  1ZBJ A;  2K2M A;  2KNB B;  4Z88 A;  1SRL A;  4OML A;  1IO6 A;  2AZV A;  2BZ8 A;  1RUW A;  2X3W D;  2EVR A;  2I0N A;  3C0C A;  2L2P A;  2DYB A;  1OPL A;  3PVQ A;  2A36 A;  1UE9 A;  2O9V A;  2EBP A;  2ECZ A;  3EHQ A;  1WX6 A;  1YNZ A;  2PZ1 A;  1OV3 A;  1UTI A;  2DL4 A;  4J9C A;  2E5K A;  3UA6 A;  4RUG A;  4AG2 C;  2RQV A;  3TSZ A;  1K4U S;  2V1R A;  2HCK A;  3VS7 A;  2CDT A;  1GCP A;  2KYM A;  1MUZ A;  1UGV A;  2EQI A;  1TUD A;  4HXJ A;  2AKL A;  5GJW B;  2VKN A;  2CH4 W;  2DJQ A;  3UA7 A;  1VA7 A;  1SHF A;  4CC4 B;  3VRZ A;  3UF4 A;  2FO0 A;  4AFQ C;  4CC2 A;  3VRY A;  1ZSG A;  2DNU A;  2KRS A;  3CQT A;  1SPK A;  4KRT A;  1NEB A;  2EW3 A;  2DVJ A;  4J9F A;  1H3H A;  1GBR A;  1MV0 B;  2FPE A;  2CH4 A;  2EGE A;  1PRM C;  2DBK A;  4RTX A;  2CRE A;  2EPD A;  2D1X A;  2LMJ A;  2K3B A;  5I22 A;  5IXB A;  2KRO A;  2EYZ A;  4ESR A;  4ZNX A;  3EG0 A;  4WCI A;  2KR3 A;  2GGR A;  2MOX A;  2FPD A;  1GRI A;  1E7O A;  1X2K A;  3GBQ A;  3EG2 A;  1U5S A;  2F2V A;  2YUN A;  3VS2 A;  4AFZ C;  2YDL A;  2BZY A;  3I9Q A;  2OAW A;  1NYF A;  1WDX A;  1BU1 A;  3PVL A;  1UFF A;  1K1Z A;  3VS1 A;  3H41 A;  4RTT A;  4JPB W;  4OMP A;  1VYU A;  1UHC A;  1OOT A;  1CSK A;  2JM9 A;  1GBQ A;  2EGC A;  3O5Z A;  4OMQ A;  2RQT A;  2BTT A;  2CT4 A;  1AWX A;  1AWJ A;  4X1V A;  1QLY A;  2CUB A;  1SEM A;  5IHI A;  2RQR A;  2YT6 A;  3TSW A;  2KXD A;  1HJD A;  1CKA A;  1UJY A;  4J9D A;  3I5S A;  1T3L A;  4JJC A;  1FYN A;  1JQQ A;  2JS0 A;  2EYY A;  2D0N A;  1GFD A;  4F16 A;  2LQW A;  4RTU A;  2J6O A;  2OI3 A;  1PKS A;  1KIK A;  1VYV A;  2RN8 A;  1FMK A;  4D8K A;  5FWC A;  1UDL A;  2JMC A;  2DA9 A;  2DLP A;  2M0Y A;  2RMO A;  2J6K A;  2LNH B;  1E6H A;  3SEM A;  1BB9 A;  1H92 A;  2A37 A;  1AD5 A;  5FW9 A;  2C0T A;  1K0X A;  1EFN A;  1T0H A;  2FRW A;  2ENM A;  1WI7 A;  2KGT A;  1NEG A;  2JMA A;  2DL5 A;  2PNI A;  1JEG A;  2JM8 A;  1RLQ C;  1JU5 C;  3M0Q A;  1X27 A;  1Z9Z A;  1OPK A;  2DM1 A;  2NWM A;  2JXB A;  2L3P A;  2LX7 A;  3FJ5 A;  5HCK A;  2RNA A;  2K79 A;  3QWX X;  2GTO A;  4DEX A;  1JXO A;  5EC7 A;  2W0Z A;  1GL5 A;  2GNC A;  2O9S A;  1PKT A;  4RTV A;  4JJB A;  2PTK A;  2AZS A;  1ARK A;  4CC3 A;  5IHK A;  4HCK A;  2LCS A;  3IQL A;  2MCN A;  1GCQ C;  1AZE A;  4Y92 A;  4QT7 A;  2YUP A;  2KBT A;  3NPF A;  3H0I A;  1QWF A;  2EKH A;  1ZUY A;  1T0J A;  1U3O A;  2YUO A;  1QKW A;  3EGU A;  2AKK A;  2RPN A;  5L23 A;  2DF6 A;  2DRM A;  2KYB A;  1W1F A;  1PRL C;  1Y0M A;  1BK2 A;  2W10 A;  1PHT A;  2H8H A;  1X69 A;  2SRC A;  3A98 A;  4RTY A;  2MIO A;  1HD3 A;  2HDA A;  1G2B A;  2C0I A;  4OMM A;  1ZLM A;  4LUD A;  3EG1 A;  1W6X A;  2HBW A;  1A0N B;  1B07 A;  2EGA A;  1K76 A;  1NM7 A;  4AG1 C;  3R6N A;  1GFC A;  4GBQ A;  1K9A A;  2RQU A;  2LJ3 A;  1UEC A;  4OMN A;  2D8H A;  2ED0 A;  4ORZ A;  1KSW A;  1PWT A;  3UAT A;  1I0C A;  2CUD A;  1SRM A;  2M51 A;  4F17 A;  3M0P A;  1BBZ A;  1WIE A;  1WXT A;  2GTJ A;  1Z9Q A;  5I11 A;  1PNJ A;  2DL3 A;  1U06 A;  3I35 A;  3VS3 A;  4HVU A;  2LP5 A;  3RNJ A;  2LQN A;  2JTE A;  2DBM A;  2KT8 A;  1GCQ A;  1M3C A;  3VS4 A;  5FWB A;  1AEY A;  3ZL7 C;  2JW4 A;  1NLP C;  4F14 A;  2J06 A;  1JO8 A;  1B3Q A;  2CT3 A;  2HSP A;  1UJ0 A;  5ECA A;  2GBQ A;  1X2Q A;  2DRK A;  4LE9 A;  2FEI A;  1UG1 A;  2CSQ A;  1ABQ A;  2DL8 A;  2YUQ A;  1VYT A;  2FG0 A;  2KT1 A;  2L3Q A;  1H8K A;  2JS2 A;  2JT4 A;  2O31 A;  1E6G A;  2RF0 A;  4IIM A;  2K6D A;  1AWW A;  4R0K A;  4JZ4 A;  2ESW A;  2KEA A;  4LN2 A;  1ZX6 A;  4D8D A;  5IXF A;  1W70 A;  1UHF A;  1MV3 A;  2V1Q A;  1YN8 A;  2LJ0 A;  1X6B A;  1X6G A;  1XOV A;  2AK5 A;  2DMO A;  4J9H A;  2DX1 A;  2K9G A;  1KFZ A;  4HVV A;  4J9G A;  3REA B;  5IH2 A;  2A08 A;  3EG3 A;  3VS0 A;  1N5Z A;  2GQI A;  1S1N A;  1M3B A;  1YP5 A;  1QCF A;  3VS5 A;  3U23 A;  1RLP C;  1M3A A;  2KE9 A;  1YWO A;  1NYG A;  2DIL A;  2J05 A;  2CSI A;  2DL7 A;  1AWO A;  1I1J A;  1KJW A;  2L3S A;  2F2X A;  3JV3 A;  3NGP A;  3QWY A;  2F2W A;  2IIM A;  1HSQ A;  1YWP A;  5IHN A;  5GJV B;  3M0T A;  3I5R A;  3ULR B;  1AZG B;  1YCS B;  3LH5 A;  1ZUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...