1ZUYA

High-resolution structure of yeast myo5 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-5 isoform
publication title High-resolution structure of yeast Myo5 SH3 domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zuyA00
1PWTA 2LJ0A 1S1NA 2DL7A 1T0JA 1EFNA 2KT1A 1GCPA 3JV3A 3I9QA 1AZGB 1XOVA 1NM7A 3EG2A 4RTWA 2RPNA 1ZLMA 2KYMA 3VS4A 1SHFA 5GJWB 3M0SA 1ZUYA 1HSQA 2CT4A 2KT8A 2DL3A 1BBZA 2FPDA 1FYNA 5I11A 2A28A 4RTVA 1T3LA 2YSQA 3UATA 1Z9ZA 4RTUA 4Y92A 1X43A 2LMJA 4HXJA 1JXMA 2JMAA 1CKBA 2CUDA 2OAWA 2F2VA 4J9IA 3CQTA 1E7OA 3H0FA 2B86A 1YCSB 2G6FX 1UGVA 2C0IA 4AFZC 2EVRA 3H41A 4J9HA 4LUEA 1AVZC 1AWWA 3RNJA 1ABOA 2DL4A 2LZ6B 1LCKA 4FSSA 1K4US 1U3OA 1GFDA 4OMOA 3EG3A 3IQLA 3EHRA 2JS0A 1AWJA 1QLYA 2DA9A 2K9GA 2ENMA 4IIMA 4JPBW 3PE0A 2DL5A 4ZNXA 2ED1A 1TG0A 3O5ZA 1BK2A 3ULRB 1W70A 1V1CA 2MOXA 1SEMA 1SRLA 2DX1A 2RQVA 1VYUA 1SSHA 4J9GA 3EG0A 3LH5A 1QWFA 2LCSA 2HEQA 4RTTA 1IO6A 1I1JA 1U06A 1T0HA 2K2MA 4J9FA 4Z8AA 4J9DA 2CSQA 1UG1A 1PRLC 2FPFA 2I0NA 2O88A 1X6GA 2LNHB 1M8MA 2JTEA 2PNIA 2W10A 1OOTA 2AKKA 2GQIA 1GBQA 4RTXA 1UDLA 2KXDA 2CH4A 3M0QA 1NLOC 2X3WD 3I35A 1PKTA 2YUQA 2EYXA 4LUDA 2CDTA 1X2QA 1YWOA 4J9EA 2EPDA 4ESRA 1QWEA 3A98A 2D8HA 3M0UA 2W0ZA 4LN2A 2RQWA 2AZVA 2O9SA 1X6BA 1H3HA 2KE9A 1UHFA 2JM9A 2L3PA 1G83A 2RN8A 3TVTA 2BZXA 1SRMA 2LQWA 2M0YA 5IXFA 2HCKA 2FO0A 2K7AA 1JQQA 4HVVA 2DF6A 2RNAA 2EGCA 3SHWA 3REBB 2DE0X 3ZL7C 1YN8A 1A0NB 2EYZA 4CC3A 1WYXA 1WI7A 4E6RA 4JJDA 1X69A 1MUZA 1UUEA 1B07A 4GBQA 4DEYA 1M3BA 2JMCA 2ROTA 4GLMA 2YDLA 3VS7A 1CSKA 3R6NA 4OMLA 1AWOA 1KJWA 1W1FA 4KRTA 4JJCA 3KFVA 4LNPA 3VRYA 2IIMA 2L2PA 1ABQA 2EBPA 2K79A 4R0KA 1K0XA 2FRWA 2EYYA 3UF4A 5HCKA 1GBRA 4D8KA 1AWXA 2J6OA 1QCFA 2AKLA 2KEAA 4LE9A 5EC7A 1E6GA 3RBBB 1MV3A 4D8DA 1K9AA 2E5KA 5IXBA 2GGRA 3PVQA 3PVLA 4F17A 2J6FA 1VYTA 1NG2A 2DVJA 2ED0A 3QWYA 1ZUUA 3M0TA 4HVUA 1CKAA 2DBMA 2ECZA 2K6DA 1VYVA 2M51A 2EGAA 1ZBJA 2SRCA 3SEMA 3M0RA 1RI9A 1N5ZA 1M3AA 3EGUA 2DL8A 2LP5A 1UJ0A 2OJ2A 1RLPC 2LJ3A 1GCQC 1I0CA 1PRMC 3THKA 2K3BA 1W6XA 4A63B 2GBQA 1HD3A 1AD5A 1GRIA 1UHCA 1OPLA 1K76A 2H8HA 3GBQA 3EHQA 2DM1A 4AFSC 3VS3A 2VWFA 1GL5A 2F2XA 2DNUA 3VS5A 4Z88A 4DEXA 1NYFA 2HDAA 4EIKA 4AFUC 1G2BA 2L3QA 1B3QA 2DILA 3EG1A 4AG1C 2A08A 1WA7A 1OEBA 1M30A 2KRMA 4RTZA 2RF0A 4IIOA 2MCNA 1RLQC 2BZ8A 2KGTA 2D1XA 3NPFA 2NWMA 3C0CA 3M0PA 1WXUA 5FW9A 1FMKA 1Y0MA 2HSPA 2A37A 2GTJA 2AZSA 1BU1A 1RUWA 1ZSGA 2GTOA 1JEGA 2BTTA 1K0SA 3UA6A 2KXCA 4CC4B 2KR3A 2QDLA 2JW4A 2F2WA 2DYBA 2YUNA 4OMNA 4X1VA 2NUZA 1ZUKA 4RTYA 4HCKA 4JZ4A 2FRYA 2FEIA 4M4ZA 3VS2A 1YNZA 2SEMA 1TUCA 2O2OA 1WLPB 2LJ1A 2D0NA 2JS2A 1ARKA 2LX7A 1TUDA 2OI3A 4AG2C 1WDXA 5ECAA 2DBKA 1KIKA 2ESWA 1E6HA 2JM8A 2FPEA 4QT7A 2EW3A 2VVKA 2L0AA 1SPKA 3U23A 1WX6A 1AEYA 4RUGA 4J9BA 4F16A 2J05A 2RQTA 1QKXA 2J7IA 1NLPC 1JO8A 2V1QA 3TSZA 1NYGA 2DMOA 1PKSA 5IHIA 2CH4W 1H8KA 3NHNA 3I5SA 2KBTA 1X27A 2DJQA 1KFZA 2C0TA 3NMZC 1PHTA 2CSIA 2LQNA 4JZ3A 2JT4A 2J6KA 5IHNA 5IH2A 1NEBA 2MIOA 4J9CA 2VKNA 2L3SA 1ZX6A 1WFWA 1AZEA 2CREA 2ABLA 1UFFA 4K11A 5IHKA 2P4RA 2YUPA 2GNCA 4HVWA 2CT3A 2PZ1A 2C0OA 2A36A 4CC7A 1UECA 5FWBA 4Z89A 2KYBA 1U5SA 2KRNA 2AK5A 4OMMA 1VA7A 5GJVB 4OMQA 5I22A 5FWCA 3VS1A 2KROA 3NGPA 2YUOA 3VS6A 3FJ5A 1NEGA 3H0HA 1QKWA 3QWXX 2KNBB 4JJBA 2O9VA 1PNJA 2KRSA 4ORZA 2EKHA 1K1ZA 1GCQA 1WXTA 1Y57A 2HBWA 2BZYA 3VS0A 1I07A 4CC2A 2J06A 3VRZA 2RMOA 4OMPA 2EQIA 5L23A 1J3TA 1HJDA 3H0IA 1WIEA 2RQUA 1H92A 2O31A 2FG0A 2XMFA 2D8JA 3UA7A 1KSWA 1UJYA 2EGEA 1UE9A 1X2KA 1M3CA 1MV0B 2YT6A 2CUBA 1BB9A 1SHGA 1UTIA 1AOJA 1GFCA 2ROLA 1JU5C 2DRMA 1T3SA 2RQRA 1OPKA 2JXBA 2PTKA 4F14A 1JXOA 1OV3A 1M27C 3REAB 2DRKA 2DLPA 4AFQC 1YWPA 1WXBA 4WCIA 3I5RA 2X3XD 1YP5A 3TSWA 2EYWA 2V1RA 1Z9QA
chains in the Genus database with same CATH superfamily
3M5AA 4JLIA 1EZZB 1PWTA 3CC2A 2DL7A 1K9MC 1I81A 2LRQA 2CZ0B 8AT1B 4JLGA 4A4HA 2OTLQ 4C8QF 5GAN3 4MZMA 3EG2A 4BUGA 1BIBA 2LVMA 1ZLMA 1NPRA 1Q7YC 3G4SQ 5GJWB 5I2SA 1M1KR 4C8QA 3I56Q 3O8VA 3LWIA 1R8OB 3LGLA 4KGXB 1VIFA 5KYXB 4PLIA 3M4YA 3M53A 3A5ZB 4EMKB 4XK8E 2XICA 2C0IA 1IZ6A 3EGDA 3HKSA 1FX7A 2CGHA 4LUEA 1LCKA 1K4US 4RCBA 4IUVA 3JB9F 4OMOA 2RI3A 2PUKB 3UDCA 5LJ3h 3IQLA 5AT1B 5GANd 3BDUA 1QLYA 2K9GA 5J3BA 1D3BA 2OTLT 3GLXA 4PJLA 2K5LA 4KH1B 3PGGA 4PJOG 1O9SA 2ZPGB 2DTOA 2RQVA 1VYUA 3OYIA 4J9GA 2XDDA 3VUZA 4A4FA 5LL6S 2E65A 3FLGA 1W4SA 2B8AA 3L2QA 1I1JA 1VQ4T 3GP8A 1K73C 1PRLC 2I0NA 2VGNA 2EJGA 4OB2B 4QKUA 4QQGA 2O88A 1QCOA 1VIEA 4PJJA 4Q5WA 1M8MA 2PNIA 1KHIA 3CXCP 1GXIE 3OYAA 3CMEA 3GPLA 1NLOC 1VQPQ 2YUQA 3MCAB 2MWPA 3A8GB 1ZSZC 4BDZA 2CDTA 4J9EA 2W0ZA 4KT0E 2RQWA 4J5YA 1X6BA 2IG0A 2KE9A 2P4TA 3TVTA 1YJWQ 4M7AB 2R5AA 2LQWA 1JBMA 3NTIA 2HZYA 5KYWA 1QVFP 4B9WA 2DJZA 4OGCA 4O5VA 3QXEB 2DF6A 2RNAA 2EGCA 2YXYA 3SHWA 1KC8R 1YIJQ 4F7UG 3JCMX 3ZL7C 1I4K1 4CC3A 1WI7A 3HP9A 2I2LA 3J7AF 2DFUA 2QA4Q 2F5KA 1ZSZA 4X9DA 2ROTA 2YDLA 4AMCA 4C92B 4FSXA 1AWOA 3VRYA 2IIMA 1VQPT 1ABQA 2K79A 5A2QE 1QVGS 3UF4A 3CC2Q 1GBRA 4QVCA 4NL3A 4FIBA 3CCSQ 1VQ7A 2LTOA 4MZTA 2QAZA 3X26B 4IUPA 3L2RA 1QCFA 2AKLA 3RBBB 1E6GA 4D8DA 3VKIA 1K9AA 5IXBA 3PVLA 4F17A 2QEXT 3EAEA 1VYTA 3CCJT 4EMKC 3G6EA 4E7IA 5CKBA 4F04B 2K6DA 1VYVA 1TUGB 1M9SA 3M54A 2SRCA 5HK0A 1NJIC 1BCOA 2GQVA 1M3AA 1AHJB 2IPOB 1WPYA 2OJ2A 1RLPC 3CCLT 1I0CA 3THKA 2ZPHB 3L1AA 3I55T 5KYUB 2OX7A 1W6XA 2QA4T 3V7CA 2GCXA 8ATCB 2L5QA 5HKCA 4ATOA 5KYXA 2DKGA 2LQ8A 1GL5A 3CC2T 5I2MA 1RABB 3CCST 2DNUA 4Y28E 4ME7A 3Q1JA 1G2BA 4MDWA 1B3QA 3RUXA 2H3JA 2KRMA 4IIOA 3QKJA 2COYA 2BZ8A 3MEAA 4WF2A 1IGQA 2NWMA 4JRKA 1ACMB 3M0PA 5FU7B 2Y90A 2CP6A 3H6ZA 5D7UA 2FYKA 3RR6A 2A7YA 2GTJA 1BU1A 2VXEA 3JCMe 2WSCE 1WHKA 1X01A 2FZGB 3CC7Q 2CZ7B 4M7AC 4MMLA 2DYBA 1G3WA 4XTXA 4X1VA 1ZUKA 3MHXA 4HCKA 5C6SA 4RG2A 3VS2A 2R58A 1WLPB 5CQYA 3MPUB 1ARKA 2LX7A 2OI3A 4M7DB 3HRUA 4AG2C 5J39A 2JTFA 1E6HA 5KYNA 1YI2A 2JTMA 2ZCFB 3CPFA 3QZ5B 4M7AF 2VVKA 4C92C 3PIPA 1SPKA 4E2FB 3U23A 1WX6A 2BKDN 3S3OA 4RUGA 5GAMe 3L2VA 1YHQA 2CP5A 3PMTA 3RKYA 4QQ6A 1WQ7A 2RK2A 2QTVA 4Y91A 4XQ3A 4XTWA 2RQTA 4M7AA 1NLPC 1JO8A 2V1QA 3BY7A 1PSFA 3TREA 3CMET 3CEYA 1FXXA 3GNFB 5C0MA 1H8KA 1R0BG 4E47A 1TU0B 2MI6A 2MK5A 2KBTA 5KYYA 1P92A 3PNWC 2C0TA 2COWA 3NMZC 2HMAA 1VQ7Q 2LT1A 2J6KA 1NEBA 3OS0A 4J9CA 3C4SA 4C92A 4DOWA 4GY5A 5LJ5d 2YRVA 5CIUA 2YUPA 4GLKA 2CT3A 1YCYA 1W2BP 3VYHB 2DXTA 1UECA 1K8AR 3OYCA 2KYBA 1TXQA 1NBEB 1K9MR 2VASA 3A1PA 3CXCS 1VQ5Q 3PTAA 2E3HA 2KRNA 3G7ZA 1IHWA 1HK9A 4OMMA 5FWCA 1UEBA 3VS6A 1VQ9A 3FJ5A 3QWXX 3HHTB 4JJBA 2O9VA 1PNJA 2HBWA 3VS0A 4CC2A 2RHZA 3VRZA 2CZ6B 2RMOA 4OMPA 5L23A 3N5BB 4O6JA 4DA4A 3JB9H 1WIEA 1SF9A 4LD9K 4FL6A 2ZPFB 1BCMA 1VQ7T 1OX9A 3G4SA 5KYUA 1M3CA 1M90U 1UB4A 5FU7C 1JU5C 2RQRA 3JCMJ 2PTKA 3OMGA 3I56A 3EGXB 3H9NA 1N27A 4AFQC 1WXBA 5GANh 3G6ET 1D0XA 4PJOE 1Z9QA 4IKFA 4E7LA 2KMTA 1KD1U 1T0JA 1EFNA 2KT1A 1GCPA 4FW1A 1M4ZA 1XOVA 4XTZA 1NM7A 1I5LA 3GF5A 2DD5A 3JCMb 3CXCA 4KULA 2CP2A 1VOMA 4M7DC 4BD3A 1OYXA 4II1A 2CT4A 4XAXB 3CBPA 1NE8A 1BBZA 2FPDA 3QJ6A 1FYNA 5I11A 1QCNA 3OY9A 3ZEHA 4RTVA 2YSQA 5DY9A 3TCJA 1QVGP 1OI1A 3PMIA 4RTUA 5CKDA 1X43A 3C12A 2LMJA 4XU0A 1JXMA 1CKBA 4FYXB 3BDLA 4PFPA 3JCMd 3X24B 5GAN2 3CQTA 4HT9A 1YCSB 2G6FX 4M7DF 1UGVA 4AFZC 5IT9E 3OYDA 2EVRA 3H41A 3CD6A 2DEQA 1AVZC 3RNJA 1ABOA 2LZ6B 1QVFA 4FSSA 4FM4B 5L8RE 1GFDA 2L89A 1JRIA 1PSEA 3EG3A 5IN1A 2JS0A 2QI2A 4M7DA 4IIMA 2ENMA 2EQUA 1ZA2B 2RO0A 4ZN3A 2DL5A 4ZNXA 4M78A 3CPWP 3OBYA 4KBMB 1WHMA 1BK2A 2BE9B 5D6YA 1S72A 4JS4A 2MOXA 3MEWA 1SEMA 4F7UE 1VQPA 2DX1A 3EG0A 5CK9A 1EX4A 4M77B 1Q81U 3GIBA 4BY6C 3FB9A 2OTJQ 1U06A 3MEVA 1PG5B 4J9FA 3CMAQ 4Z8AA 4J9DA 4HT8A 2CYZB 2XDBA 2CSQA 1N8RR 4E7JA 2FPFA 5LJ5g 2RM4A 2D0QB 2M02A 1YJWA 1MMNA 2LC4A 4X34A 2MAMA 2W10A 1VQOQ 2XD0A 2XDPA 3PFSA 2PVGB 3M0QA 2JJ9A 1YI2T 1YIJA 5GMKe 3JCMP 1WHGA 3LX7A 2DZ9A 2EYXA 4LUDA 1JB0E 1RL2A 1BIAA 2EPDA 4ESRA 4QQDA 1YHQT 1C0MA 2AIRB 3M0UA 4LN2A 2DEUA 5GAN6 2JM9A 1VQ9Q 1VUBA 1WJRA 4PJNA 4XU1A 3LLRA 3DB3A 1Q82U 1G3YA 5IAYA 2PU9B 2P84A 3CCSA 2RH2A 1VQMQ 1V29B 1NJIR 2DE0X 1A0NB 1TWBA 2EKOA 2EWNA 2PQWA 4E6RA 3MJXA 1X69A 1MUZA 4GBQA 1D1CA 2RHIA 4OP0A 1EIFA 2GFAA 3V8JA 2NUTB 3EFOA 1VQOT 2JMCA 4GLMA 1OZ2A 2EQMA 3VS7A 3SWNB 2XHCA 3R6NA 3INZA 4KRTA 3S3MA 4M7AD 4LNPA 2RHYA 3QG1A 1BKBA 1M2VA 2EBPA 1H641 3UPUA 2EYYA 4D8KA 1AWXA 1UGSB 5LJ5f 1XJWB 2WSEE 2X4JA 2PVDB 3CCEQ 1I8FA 4YTLA 4E7SA 2KEAA 4N4IA 1VQ9T 3HFOA 2J6FA 2E6ZA 4FT2A 2LQKA 1NG2A 2ED0A 3JCMV 3QWYA 3EH1A 1CKAA 3EG9B 2DBMA 4C92D 5GAOr 1XQHA 1WZOA 1X75C 2QTXA 4ZGEB 3SEMA 3NTHA 1TSFA 1RI9A 4QVZA 2OAUA 3G4ST 2DL8A 2QQBA 3MP8A 4FW2A 1W2BS 5KCOA 5LJ5j 1YFNA 2V8JA 2K3BA 1QQJA 4PJOB 3SDZA 4A63B 4XU2A 3CD6Q 2GBQA 5LJ3e 1AD5A 3I56T 4CRIA 1K76A 2RK1A 3EHQA 3VS3A 2ZPEB 4M77C 4MDXA 1ZQ1A 4OB0B 2Y4XA 2HKNA 2Z0WA 4JRIA 1MNEA 3CCET 2K5FA 1NYFA 2HDAA 4M78E 4AFUC 1QP2A 2X35A 4LDYA 1S72Q 3CC7A 2E4HA 3EG1A 1Q81C 4J6XA 4N4GA 1WA7A 1M30A 2MCNA 1BI2A 4M77F 2PUOB 3OS2A 3OYMA 2VV5A 3NPFA 3C0CA 2XI9A 1OU9A 1U1SA 2EIFA 1XNIA 3HRTA 1FMKA 2HSPA 4M75B 2AZSA 4M77A 3QDFA 1JEGA 3CD6T 2RJFA 4M7AG 5CR2A 1W2BA 2JW4A 2DK3A 2F2WA 3R6OA 2EFIA 2HQEA 3FRNA 1YNZA 2SEMA 1TUCA 4F7UB 5J26A 5LJ5h 2QGGA 1WDXA 1Q82C 1S72T 4HCZA 3CCUQ 2JM8A 2FPEA 2KSSA 7AT1B 2RHXA 4QT7A 3G71Q 1H3ZA 2EW3A 1MNDA 3JCMc 4C92G 3SWNC 3NFCA 5FROA 1D0YA 3META 5I21A 2AT1B 3G1JA 2DD4A 2F5TX 2C06A 3C94A 5GAOn 2VGMA 1YJWT 1KC8U 3EH2A 3QUIA 4M7DD 4RG8A 5IHIA 4C8QE 2CH4W 4M78D 1VQKQ 1VQ5A 1YIJT 4A53A 3X25B 5DLQE 3CPWS 1B7TA 2X51A 3DLLA 2CSIA 4B6MA 5IHNA 2D6FA 2DYIA 1WGSA 2NUTA 2L3SA 1WFWA 2CP7A 4HKEA 2CREA 3SWNA 4PK4A 4R55A 2ABLA 5GANg 3F70A 5IHKA 3V7RA 3E19A 2EQJA 3QO3A 5CQXA 4CC7A 1V76A 1VQLQ 2ZPIB 2RB6A 4EMKA 5FU6B 3ZBDA 1QVGA 4DQ2A 4A4GA 5GJVB 2HBPA 1UGPB 3MKDA 4OMQA 4J7IA 2QYZA 1QW1A 1BI0A 3H0HA 1TTHB 2KNBB 3EG9A 2EKHA 1K1ZA 4PJOF 1WXTA 2EJ9A 2BZYA 1I07A 2J06A 2EQIA 3H0IA 2O31A 3LW5E 3LYIA 3JCMh 4KGVB 3HPWA 4JDSA 1M1FA 1TOVA 2YT6A 1BB9A 1SHGA 2VUBA 1T3SA 1OPKA 4RKUE 1PM3A 4N0AC 2PVOB 1QVPA 2JXBA 2X4XA 2HD0A 4M75C 4ZGJB 2YWWA 3REAB 4LDVA 2DLPA 4XTUA 3RERA 4WCIA 2V1RA 4C8QD 2LJ0A 2X4WA 2K4YA 4J83A 4WTOB 2HKQB 3I9QA 3JV3A 1AZGB 3P8BB 5GANf 4RTWA 2RPNA 3QSUA 3HTRA 3A8MB 1UGQB 4J6WA 1MMDA 4JRQA 4M75F 4M7DG 1ZUYA 3WVEB 4M78G 4P5NA 4QW2A 2P0QA 4J8OA 5GAN4 3CCVQ 1KQSP 2JOYA 1T3LA 1M8VA 3UATA 4ELZC 4EPCA 4M75A 4Z02A 4Y92A 1IGUA 4HXJA 2JMAA 1VQ6Q 2CUDA 4F7UF 1E7OA 3H0FA 5GMKl 2B86A 1D0ZA 2O01E 4C5GA 3S3NA 3CC7T 2DTHA 3JB9D 4J9HA 2OTJA 4KGZB 2H3EB 5GANj 1YJ9Q 1AWWA 1KQ2A 2CKKA 3CMAA 1VQNQ 2DETA 1Q86R 2DAQA 2ZZDA 2FL7A 2HL5C 2F1LA 3QDRB 4JPBW 1VQOA 3VJPA 5FRNA 3PE0A 1KC8C 4IUUA 1M2OA 1TG0A 3OS1A 3ZFJA 1SRLA 1SSHA 1FMWA 2E3IA 1M1GA 1YJNQ 1QWFA 2CP0A 2LCSA 2HEQA 3GOXA 3VV0A 2FZCB 2E64A 4A4KA 2KAFA 5FU6C 1Q7YR 4N4HA 1X6GA 1RI0A 4EMGA 2EJFA 2DZCA 1UGRB 2AKKA 2GQIA 1GBQA 4RTXA 4DBFA 1UDLA 2NYSA 3HFNA 2CH4A 1VQMA 1YJ9T 2X3WD 2AHJB 2V8IA 2E10A 1VQNT 1Q95G 4M77D 5CVIA 4C8QG 2HNIA 3V8KA 1X2QA 1Y96B 1QWEA 4PFOA 1YITQ 2D8HA 3OSSC 3ASKA 2AZVA 2O9SA 1K8AU 1C6VX 4IUQA 5CKEA 3TQ7P 1G83A 1K9MU 2QXFA 2BZXA 2QQAA 3J81E 4E7ZA 2E1HA 2O4XB 1SRMA 2M0YA 5IXFA 2VC8A 1YJNT 3LH0A 3M4GA 1VQ5T 3CCEA 2D9TA 2KVQG 3REBB 1YN8A 2KK4A 2EYZA 2MYSA 4FT4A 1G8XA 1Y71A 4JJDA 1VQ8Q 3X28B 5GANe 3VUBA 5GAOq 3MO8A 3JB9G 2DERA 1D3BB 1N6AA 4OMLA 1KJWA 3P8HA 1JJ2S 1Y7XA 2P0PA 3KFVA 1ZA1B 2IVWA 4JJCA 2L2PA 1SG5A 2DVEA 1K73R 1MHNA 1K0XA 3OYBA 1B34B 2DO3A 2QDYB 5CCAA 1LOJA 2J6OA 5EC7A 1MV3A 2GGRA 3PVQA 5GMKm 1LJOA 4LDUA 3A8OB 4BACA 1ZUUA 2FB7A 1MMAA 2ECZA 5A0LA 1SSFA 5A0DA 4TVRA 2YHTA 3JCMQ 3JAME 2CS7A 4JS5A 1ZBJA 4JRPA 4FYYB 1WHLA 2K3YA 4M7AE 3NTKA 1N5ZA 3CC4A 1RAAB 1LPLA 2LP5A 1UJ0A 2RA2A 1GCQC 1PRMC 1LNXA 5GAMd 4BE1A 4AT1B 3OYJA 1IRXA 4J7FA 4M77G 5CKFA 3JRZA 3CBOA 1D1AA 3VS5A 4C92E 3DB4A 5KYWB 1DJ7B 1PC0A 2DPPB 4JJNK 2L3QA 3HSBA 2RHUA 2DILA 4AG1C 2A08A 2HQXA 3OA6A 4RTZA 5KH6A 4LD6A 3A8LB 4C5IA 1IB8A 2KGTA 1F1BB 3E9GA 3TEEA 5KE2A 2V26A 5FW9A 2FHDA 4LDXA 9ATCB 3OYFA 1Y0MA 3CCUA 3CCMQ 2A37A 3G71A 4OB3B 1RUWA 3OS5A 5GMKi 1ZSGA 1N8RU 3E1SA 3LGFA 2BTTA 4ZGDB 3TU4K 2OTJT 1K0SA 3OB9A 2L8DA 3M57A 2RJCA 5D6XA 2KR3A 3CMAT 5GAN7 4BE0A 1M90C 3E2UA 2KI7A 3V7SA 1TS9A 2NUZA 2VXFA 2FEIA 4M4ZA 2LJ1A 2D0NA 1RADB 1G3TA 1TUDA 4HCCA 2EAYA 3FEOA 1BI1A 5ECAA 4M75D 1KD1C 1KQSS 2ESWA 3S6WA 1VQKA 3SD4A 3E9FA 1Y96A 4XTVA 3T9NA 4OMFB 1VQ4Q 3EGXA 4F16A 1OU8A 3H8ZA 3LWHA 4C0DB 3L2WA 4D6WA 1QKXA 2O4XA 2J7IA 2EQKA 3CCMT 3M59A 2NLUA 1NJIU 3FJPA 1IHVA 5D6WA 4PNOA 2DMOA 2YRDA 1VQLA 3NHNA 3JCMg 1VQMT 1FWZA 4L6V5 1M1KU 1ZHIA 1PHTA 2LQNA 3CCRA 2MIOA 1OQKA 2VKNA 1AZEA 5GAOm 2E12A 2E41A 1UFFA 3C95A 1D1BA 4HVWA 2C0OA 1B34A 2A36A 3MP1A 4RMOA 4M7DE 1KQSA 2XK0A 2MWOA 1I5OB 2AK5A 2MPXC 3CC4Q 1VA7A 3MEUA 5GAMg 3X20B 4BI4A 3VS1A 2KROA 2QG9B 2QQSA 2YUOA 1NEGA 3OYGA 1QKWA 3BW1A 4ORZA 3KBGA 1RAIB 3P8DA 3JCMW 1KHCA 3J80E 1HJDA 2RQUA 3QYHB 2FG0A 3OBWA 2XMFA 3QYGB 1KSWA 1UJYA 2EGEA 4PJMA 1UE9A 2LCLA 4ZTJA 3OW2P 1X2KA 2NUPB 1MV0B 1UTIA 2CUBA 1AOJA 1FMVA 1GFCA 2DRMA 2XIDA 3JCMf 4M75G 4F14A 1WNLA 1JXOA 1M27C 3CCVA 3BE3A 5GAN8 2HQHA 2QEXQ 2X3XD 1YP5A 5M9OA 4BI3A 3CCJQ 3RESA 2MMPA 1S1NA 3PT9A 1VQ6A 4HA8A 2P0KA 2DXUA 3WVDB 3CC4T 1BI3A 5KYYB 2MF2A 3OYYA 3OYHA 1N8RC 3OQ5A 4C0FA 2KYMA 1YJ9A 3DLMA 3VS4A 4QVDA 1SHFA 3CCLQ 1VQNA 2JZ2A 3M0SA 3I55Q 1HSQA 2COZA 2KT8A 2V8KA 2DL3A 3QPHA 3JSCA 1JJ2P 2WSFE 3PIOA 2KDSA 3JB9J 2A28A 5LJ5e 2CP3A 1Z9ZA 5GAMf 4EMHA 2K3XA 2GF7A 2OAWA 3M9QA 2F2VA 4J9IA 3QJYA 2M0OA 4C0DC 2R57A 2HSEB 1YJNA 1RAEB 2CZ1B 2DL4A 2KY9A 2LNVA 4PLLA 1U3OA 2X9HA 1ZBXA 3RKWA 3EHRA 1AWJA 2DA9A 2KQWA 3FDRA 5AYFA 2ED1A 1R77A 5CKHA 3O5ZA 3CCUT 4ZTFA 2M16A 3ULRB 1W70A 5GAMj 1V1CA 3G71T 4PJOC 4CI0C 1RAHB 3RDVA 3AT1B 5CAIA 3LH5A 1R0CB 1RAFB 1U1TA 4DBQA 1M1KC 3OYEA 4E7KA 1NPPA 3OMCA 4OB1B 4RTTA 1YITA 1IO6A 2FZKB 1T0HA 2K2MA 2VYTA 1NZ9A 3OYLA 1UG1A 3CCRQ 1RACB 4NL2A 3M58A 2LNHB 4LXCA 2JTEA 2E5QA 1OOTA 1PCXA 2KXDA 2RI5A 1VQKT 1WJSA 1MMGA 3I35A 1PKTA 2YLCA 5KE3A 2JN0A 2QASA 1YWOA 4PJOA 1YBYA 3A98A 3CPWA 2M1HA 1VQ8A 5LJ3d 2K57A 1H3HA 1UHFA 4C0GA 4X9CA 2L3PA 2RN8A 4JUVA 3QIIA 2QK0A 3CCQA 4ELYC 2HCKA 1KK7A 2FO0A 2K7AA 3A8HB 3EFRA 1JQQA 1VQLT 3CMEQ 4HVVA 4OVAA 2JNGA 2E70A 2LCCA 4J6YA 4LDWA 2QQRA 2K5IA 4NOYA 3CCRT 1WYXA 4DBHA 4M77E 5GAMh 1UUEA 5A0GA 1B07A 4DEYA 1M3BA 1Y07A 1CSKA 4PKCC 4N0AA 1W1FA 2EYQA 4M78B 2DTIA 3KUFA 4R0KA 2FRWA 5HCKA 1OULA 2NUPA 5EG2A 4BI8B 3HL8A 1AT1B 2YRCA 4LE9A 3HRSA 3URGA 4KUIA 3SB2A 2E5KA 4MZPA 2ATCB 1WQWA 1U8RA 3MP6A 1IREB 2XKOC 2DVJA 4F7UA 3M0TA 1PD0A 4HVUA 3L2ZA 2M51A 2A3LA 4OGEA 2L3RA 2EGAA 4C92F 2LT4A 4FCYA 2RJEA 3M0RA 3QZ9B 3BFMA 4BDYA 3VU3C 3EGUA 4DBRA 2LDMA 2LJ3A 4XTYA 4RCCA 2BIVA 5GAN5 2HAXA 1HD3A 1GRIA 1UHCA 3CCVT 1OPLA 4UC4A 5DM7R 2H8HA 3GBQA 4AFSC 2DM1A 5HK3A 4BY6B 2VWFA 2RD1A 1M90R 5CO7A 2BUDA 3VYGA 1OX8A 3G6EQ 2F2XA 5FLXE 1C1AA 1VQ6T 1G5VA 4L5GA 3CCMA 3CBMA 4Z88A 4DEXA 4KUDK 4HCBA 3SFMA 4EIKA 1Q86U 3RIRA 4E7HA 2RJDA 4BB7A 1KD1R 4ZN1A 1OEBA 2DIQA 3UWNA 2RF0A 3D7SB 1KQ1A 3OW2S 1RLQC 2D1XA 3EFOB 4C8QB 1WXUA 2RI2A 3KXTA 2QQ9A 2OTLA 2A0FB 4A4EA 2X4YA 4XU3A 4C0ZA 1M2VB 1WHHA 1PD1A 2GTOA 1QVFS 1Q7YU 1XTDA 3QBYA 3UA6A 3V8LA 2KXCA 4CC4B 3EGDB 3RMQA 2QDLA 1VQ4A 4KH0B 4C5EA 2G3RA 5LJ3g 2YUNA 4OMNA 4RTYA 5HY6A 2Y4YA 4JZ4A 2FRYA 4PL6A 2O2OA 2JS2A 4A54A 1LVKA 2JUFA 5GMKj 2DBKA 1KIKA 2DXCA 2ZAEA 3CCQQ 2HL3A 4V2SA 2BE7D 3OSVA 2L0AA 1N9RA 1AEYA 1KG1A 1YITT 2WACA 2FVUA 4M78C 1M5Q1 4J9BA 1QMCA 3M55A 2J05A 3FC3A 3ME9A 3OW2A 4DOVA 1Q81R 4MMKA 3RMSA 1RAGB 3TSZA 1NYGA 1PKSA 1QP3A 2XU8A 4PFZA 3I5SA 3WXMB 1X27A 2DJQA 1YI2Q 1KFZA 4M78F 4M75E 2DIGA 1TH7A 5GAOl 4ANJA 5KCHA 2E6NA 3EFSA 2JT4A 4JZ3A 5GAOp 3L2UA 1VQ8T 5IH2A 4OF1A 2XG8D 3FIFA 1YHQQ 1K73U 5FRMA 1ZX6A 3QHSA 1O75A 2YLBA 4K11A 4BE2A 3CCQT 5LJ3f 2P4RA 2GNCA 2ZPBB 2PZ1A 1SKUB 3DKMA 5FWBA 4C5HA 4Z89A 1JJ2A 4FYWB 4FU6A 1U5SA 3GNGA 1HYOA 5GMKh 1Q82R 1WJQA 5I22A 4FYVB 3L42A 4IURA 1HXDA 3NGPA 4NS5A 1OZ3A 1D09B 3UT1A 4PJOD 2QEXA 3JB9I 3ER0A 2KRSA 3CCJA 3AHUA 1GCQA 2DXBA 2GFUA 1Y57A 1ZSZB 3OYNA 1J3TA 1H92A 2K2VA 3RKXA 1BYMA 2JVVA 1X6OA 2D8JA 5LJ3j 3UA7A 2F69A 2LX9A 6AT1B 1Q86C 2M9UA 2ZGWA 4R56A 4C8QC 4EDUA 4B9XA 4L59A 3CCLA 2R5MA 3I55A 1G3SA 2ROLA 1IXDA 2QA4A 4IUTA 3OYKA 2VB6A 1OV3A 5DLOA 2DRKA 2QGFB 1YWPA 4VUBA 1WHJA 1N9SA 3I5RA 3TSWA 1MGQA 2EYWA 1K8AC 3M56A
chains in the Genus database with same CATH topology
1PWTA 2LJ0A 1S1NA 2DL7A 1T0JA 1EFNA 2KT1A 1GCPA 3JV3A 3I9QA 1AZGB 1XOVA 1NM7A 3EG2A 4RTWA 2RPNA 1ZLMA 2KYMA 3VS4A 1SHFA 5GJWB 3M0SA 1ZUYA 1HSQA 2CT4A 2KT8A 2DL3A 1BBZA 2FPDA 1FYNA 5I11A 2A28A 4RTVA 1T3LA 2YSQA 3UATA 1Z9ZA 4RTUA 4Y92A 1X43A 2LMJA 4HXJA 1JXMA 2JMAA 1CKBA 2CUDA 2OAWA 2F2VA 4J9IA 3CQTA 1E7OA 3H0FA 2B86A 1YCSB 2G6FX 1UGVA 2C0IA 4AFZC 2EVRA 3H41A 4J9HA 4LUEA 1AVZC 1AWWA 3RNJA 1ABOA 2DL4A 2LZ6B 1LCKA 4FSSA 1K4US 1U3OA 1GFDA 4OMOA 3EG3A 3IQLA 3EHRA 2JS0A 1AWJA 1QLYA 2DA9A 2K9GA 2ENMA 4IIMA 4JPBW 3PE0A 2DL5A 4ZNXA 2ED1A 1TG0A 3O5ZA 1BK2A 3ULRB 1W70A 1V1CA 2MOXA 1SEMA 1SRLA 2DX1A 2RQVA 1VYUA 1SSHA 4J9GA 3EG0A 3LH5A 1QWFA 2LCSA 2HEQA 4RTTA 1IO6A 1I1JA 1U06A 1T0HA 2K2MA 4J9FA 4Z8AA 4J9DA 2CSQA 1UG1A 1PRLC 2FPFA 2I0NA 2O88A 1X6GA 2LNHB 1M8MA 2JTEA 2PNIA 2W10A 1OOTA 2AKKA 2GQIA 1GBQA 4RTXA 1UDLA 2KXDA 2CH4A 3M0QA 1NLOC 2X3WD 3I35A 1PKTA 2YUQA 2EYXA 4LUDA 2CDTA 1X2QA 1YWOA 4J9EA 2EPDA 4ESRA 1QWEA 3A98A 2D8HA 3M0UA 2W0ZA 4LN2A 2RQWA 2AZVA 2O9SA 1X6BA 1H3HA 2KE9A 1UHFA 2JM9A 2L3PA 1G83A 2RN8A 3TVTA 2BZXA 1SRMA 2LQWA 2M0YA 5IXFA 2HCKA 2FO0A 2K7AA 1JQQA 4HVVA 2DF6A 2RNAA 2EGCA 3SHWA 3REBB 2DE0X 3ZL7C 1YN8A 1A0NB 2EYZA 4CC3A 1WYXA 1WI7A 4E6RA 4JJDA 1X69A 1MUZA 1UUEA 1B07A 4GBQA 4DEYA 1M3BA 2JMCA 2ROTA 4GLMA 2YDLA 3VS7A 1CSKA 3R6NA 4OMLA 1AWOA 1KJWA 1W1FA 4KRTA 4JJCA 3KFVA 4LNPA 3VRYA 2IIMA 2L2PA 1ABQA 2EBPA 2K79A 4R0KA 1K0XA 2FRWA 2EYYA 3UF4A 5HCKA 1GBRA 4D8KA 1AWXA 2J6OA 1QCFA 2AKLA 2KEAA 4LE9A 5EC7A 1E6GA 3RBBB 1MV3A 4D8DA 1K9AA 2E5KA 5IXBA 2GGRA 3PVQA 3PVLA 4F17A 2J6FA 1VYTA 1NG2A 2DVJA 2ED0A 3QWYA 1ZUUA 3M0TA 4HVUA 1CKAA 2DBMA 2ECZA 2K6DA 1VYVA 2M51A 2EGAA 1ZBJA 2SRCA 3SEMA 3M0RA 1RI9A 1N5ZA 1M3AA 3EGUA 2DL8A 2LP5A 1UJ0A 2OJ2A 1RLPC 2LJ3A 1GCQC 1I0CA 1PRMC 3THKA 2K3BA 1W6XA 4A63B 2GBQA 1HD3A 1AD5A 1GRIA 1UHCA 1OPLA 1K76A 2H8HA 3GBQA 3EHQA 2DM1A 4AFSC 3VS3A 2VWFA 1GL5A 2F2XA 2DNUA 3VS5A 4Z88A 4DEXA 1NYFA 2HDAA 4EIKA 4AFUC 1G2BA 2L3QA 1B3QA 2DILA 3EG1A 4AG1C 2A08A 1WA7A 1OEBA 1M30A 2KRMA 4RTZA 2RF0A 4IIOA 2MCNA 1RLQC 2BZ8A 2KGTA 2D1XA 3NPFA 2NWMA 3C0CA 3M0PA 1WXUA 5FW9A 1FMKA 1Y0MA 2HSPA 2A37A 2GTJA 2AZSA 1BU1A 1RUWA 1ZSGA 2GTOA 1JEGA 2BTTA 1K0SA 3UA6A 2KXCA 4CC4B 2KR3A 2QDLA 2JW4A 2F2WA 2DYBA 2YUNA 4OMNA 4X1VA 2NUZA 1ZUKA 4RTYA 4HCKA 4JZ4A 2FRYA 2FEIA 4M4ZA 3VS2A 1YNZA 2SEMA 1TUCA 2O2OA 1WLPB 2LJ1A 2D0NA 2JS2A 1ARKA 2LX7A 1TUDA 2OI3A 4AG2C 1WDXA 5ECAA 2DBKA 1KIKA 2ESWA 1E6HA 2JM8A 2FPEA 4QT7A 2EW3A 2VVKA 2L0AA 1SPKA 3U23A 1WX6A 1AEYA 4RUGA 4J9BA 4F16A 2J05A 2RQTA 1QKXA 2J7IA 1NLPC 1JO8A 2V1QA 3TSZA 1NYGA 2DMOA 1PKSA 5IHIA 2CH4W 1H8KA 3NHNA 3I5SA 2KBTA 1X27A 2DJQA 1KFZA 2C0TA 3NMZC 1PHTA 2CSIA 2LQNA 4JZ3A 2JT4A 2J6KA 5IHNA 5IH2A 1NEBA 2MIOA 4J9CA 2VKNA 2L3SA 1ZX6A 1WFWA 1AZEA 2CREA 2ABLA 1UFFA 4K11A 5IHKA 2P4RA 2YUPA 2GNCA 4HVWA 2CT3A 2PZ1A 2C0OA 2A36A 4CC7A 1UECA 5FWBA 4Z89A 2KYBA 1U5SA 2KRNA 2AK5A 4OMMA 1VA7A 5GJVB 4OMQA 5I22A 5FWCA 3VS1A 2KROA 3NGPA 2YUOA 3VS6A 3FJ5A 1NEGA 3H0HA 1QKWA 3QWXX 2KNBB 4JJBA 2O9VA 1PNJA 2KRSA 4ORZA 2EKHA 1K1ZA 1GCQA 1WXTA 1Y57A 2HBWA 2BZYA 3VS0A 1I07A 4CC2A 2J06A 3VRZA 2RMOA 4OMPA 2EQIA 5L23A 1J3TA 1HJDA 3H0IA 1WIEA 2RQUA 1H92A 2O31A 2FG0A 2XMFA 2D8JA 3UA7A 1KSWA 1UJYA 2EGEA 1UE9A 1X2KA 1M3CA 1MV0B 2YT6A 2CUBA 1BB9A 1SHGA 1UTIA 1AOJA 1GFCA 2ROLA 1JU5C 2DRMA 1T3SA 2RQRA 1OPKA 2JXBA 2PTKA 4F14A 1JXOA 1OV3A 1M27C 3REAB 2DRKA 2DLPA 4AFQC 1YWPA 1WXBA 4WCIA 3I5RA 2X3XD 1YP5A 3TSWA 2EYWA 2V1RA 1Z9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWT A;  2LJ0 A;  1S1N A;  2DL7 A;  1T0J A;  1EFN A;  2KT1 A;  1GCP A;  3JV3 A;  3I9Q A;  1AZG B;  1XOV A;  1NM7 A;  3EG2 A;  4RTW A;  2RPN A;  1ZLM A;  2KYM A;  3VS4 A;  1SHF A;  5GJW B;  3M0S A;  1ZUY A;  1HSQ A;  2CT4 A;  2KT8 A;  2DL3 A;  1BBZ A;  2FPD A;  1FYN A;  5I11 A;  2A28 A;  4RTV A;  1T3L A;  2YSQ A;  3UAT A;  1Z9Z A;  4RTU A;  4Y92 A;  1X43 A;  2LMJ A;  4HXJ A;  1JXM A;  2JMA A;  1CKB A;  2CUD A;  2OAW A;  2F2V A;  4J9I A;  3CQT A;  1E7O A;  3H0F A;  2B86 A;  1YCS B;  2G6F X;  1UGV A;  2C0I A;  4AFZ C;  2EVR A;  3H41 A;  4J9H A;  4LUE A;  1AVZ C;  1AWW A;  3RNJ A;  1ABO A;  2DL4 A;  2LZ6 B;  1LCK A;  4FSS A;  1K4U S;  1U3O A;  1GFD A;  4OMO A;  3EG3 A;  3IQL A;  3EHR A;  2JS0 A;  1AWJ A;  1QLY A;  2DA9 A;  2K9G A;  2ENM A;  4IIM A;  4JPB W;  3PE0 A;  2DL5 A;  4ZNX A;  2ED1 A;  1TG0 A;  3O5Z A;  1BK2 A;  3ULR B;  1W70 A;  1V1C A;  2MOX A;  1SEM A;  1SRL A;  2DX1 A;  2RQV A;  1VYU A;  1SSH A;  4J9G A;  3EG0 A;  3LH5 A;  1QWF A;  2LCS A;  2HEQ A;  4RTT A;  1IO6 A;  1I1J A;  1U06 A;  1T0H A;  2K2M A;  4J9F A;  4Z8A A;  4J9D A;  2CSQ A;  1UG1 A;  1PRL C;  2FPF A;  2I0N A;  2O88 A;  1X6G A;  2LNH B;  1M8M A;  2JTE A;  2PNI A;  2W10 A;  1OOT A;  2AKK A;  2GQI A;  1GBQ A;  4RTX A;  1UDL A;  2KXD A;  2CH4 A;  3M0Q A;  1NLO C;  2X3W D;  3I35 A;  1PKT A;  2YUQ A;  2EYX A;  4LUD A;  2CDT A;  1X2Q A;  1YWO A;  4J9E A;  2EPD A;  4ESR A;  1QWE A;  3A98 A;  2D8H A;  3M0U A;  2W0Z A;  4LN2 A;  2RQW A;  2AZV A;  2O9S A;  1X6B A;  1H3H A;  2KE9 A;  1UHF A;  2JM9 A;  2L3P A;  1G83 A;  2RN8 A;  3TVT A;  2BZX A;  1SRM A;  2LQW A;  2M0Y A;  5IXF A;  2HCK A;  2FO0 A;  2K7A A;  1JQQ A;  4HVV A;  2DF6 A;  2RNA A;  2EGC A;  3SHW A;  3REB B;  2DE0 X;  3ZL7 C;  1YN8 A;  1A0N B;  2EYZ A;  4CC3 A;  1WYX A;  1WI7 A;  4E6R A;  4JJD A;  1X69 A;  1MUZ A;  1UUE A;  1B07 A;  4GBQ A;  4DEY A;  1M3B A;  2JMC A;  2ROT A;  4GLM A;  2YDL A;  3VS7 A;  1CSK A;  3R6N A;  4OML A;  1AWO A;  1KJW A;  1W1F A;  4KRT A;  4JJC A;  3KFV A;  4LNP A;  3VRY A;  2IIM A;  2L2P A;  1ABQ A;  2EBP A;  2K79 A;  4R0K A;  1K0X A;  2FRW A;  2EYY A;  3UF4 A;  5HCK A;  1GBR A;  4D8K A;  1AWX A;  2J6O A;  1QCF A;  2AKL A;  2KEA A;  4LE9 A;  5EC7 A;  1E6G A;  3RBB B;  1MV3 A;  4D8D A;  1K9A A;  2E5K A;  5IXB A;  2GGR A;  3PVQ A;  3PVL A;  4F17 A;  2J6F A;  1VYT A;  1NG2 A;  2DVJ A;  2ED0 A;  3QWY A;  1ZUU A;  3M0T A;  4HVU A;  1CKA A;  2DBM A;  2ECZ A;  2K6D A;  1VYV A;  2M51 A;  2EGA A;  1ZBJ A;  2SRC A;  3SEM A;  3M0R A;  1RI9 A;  1N5Z A;  1M3A A;  3EGU A;  2DL8 A;  2LP5 A;  1UJ0 A;  2OJ2 A;  1RLP C;  2LJ3 A;  1GCQ C;  1I0C A;  1PRM C;  3THK A;  2K3B A;  1W6X A;  4A63 B;  2GBQ A;  1HD3 A;  1AD5 A;  1GRI A;  1UHC A;  1OPL A;  1K76 A;  2H8H A;  3GBQ A;  3EHQ A;  2DM1 A;  4AFS C;  3VS3 A;  2VWF A;  1GL5 A;  2F2X A;  2DNU A;  3VS5 A;  4Z88 A;  4DEX A;  1NYF A;  2HDA A;  4EIK A;  4AFU C;  1G2B A;  2L3Q A;  1B3Q A;  2DIL A;  3EG1 A;  4AG1 C;  2A08 A;  1WA7 A;  1OEB A;  1M30 A;  2KRM A;  4RTZ A;  2RF0 A;  4IIO A;  2MCN A;  1RLQ C;  2BZ8 A;  2KGT A;  2D1X A;  3NPF A;  2NWM A;  3C0C A;  3M0P A;  1WXU A;  5FW9 A;  1FMK A;  1Y0M A;  2HSP A;  2A37 A;  2GTJ A;  2AZS A;  1BU1 A;  1RUW A;  1ZSG A;  2GTO A;  1JEG A;  2BTT A;  1K0S A;  3UA6 A;  2KXC A;  4CC4 B;  2KR3 A;  2QDL A;  2JW4 A;  2F2W A;  2DYB A;  2YUN A;  4OMN A;  4X1V A;  2NUZ A;  1ZUK A;  4RTY A;  4HCK A;  4JZ4 A;  2FRY A;  2FEI A;  4M4Z A;  3VS2 A;  1YNZ A;  2SEM A;  1TUC A;  2O2O A;  1WLP B;  2LJ1 A;  2D0N A;  2JS2 A;  1ARK A;  2LX7 A;  1TUD A;  2OI3 A;  4AG2 C;  1WDX A;  5ECA A;  2DBK A;  1KIK A;  2ESW A;  1E6H A;  2JM8 A;  2FPE A;  4QT7 A;  2EW3 A;  2VVK A;  2L0A A;  1SPK A;  3U23 A;  1WX6 A;  1AEY A;  4RUG A;  4J9B A;  4F16 A;  2J05 A;  2RQT A;  1QKX A;  2J7I A;  1NLP C;  1JO8 A;  2V1Q A;  3TSZ A;  1NYG A;  2DMO A;  1PKS A;  5IHI A;  2CH4 W;  1H8K A;  3NHN A;  3I5S A;  2KBT A;  1X27 A;  2DJQ A;  1KFZ A;  2C0T A;  3NMZ C;  1PHT A;  2CSI A;  2LQN A;  4JZ3 A;  2JT4 A;  2J6K A;  5IHN A;  5IH2 A;  1NEB A;  2MIO A;  4J9C A;  2VKN A;  2L3S A;  1ZX6 A;  1WFW A;  1AZE A;  2CRE A;  2ABL A;  1UFF A;  4K11 A;  5IHK A;  2P4R A;  2YUP A;  2GNC A;  4HVW A;  2CT3 A;  2PZ1 A;  2C0O A;  2A36 A;  4CC7 A;  1UEC A;  5FWB A;  4Z89 A;  2KYB A;  1U5S A;  2KRN A;  2AK5 A;  4OMM A;  1VA7 A;  5GJV B;  4OMQ A;  5I22 A;  5FWC A;  3VS1 A;  2KRO A;  3NGP A;  2YUO A;  3VS6 A;  3FJ5 A;  1NEG A;  3H0H A;  1QKW A;  3QWX X;  2KNB B;  4JJB A;  2O9V A;  1PNJ A;  2KRS A;  4ORZ A;  2EKH A;  1K1Z A;  1GCQ A;  1WXT A;  1Y57 A;  2HBW A;  2BZY A;  3VS0 A;  1I07 A;  4CC2 A;  2J06 A;  3VRZ A;  2RMO A;  4OMP A;  2EQI A;  5L23 A;  1J3T A;  1HJD A;  3H0I A;  1WIE A;  2RQU A;  1H92 A;  2O31 A;  2FG0 A;  2XMF A;  2D8J A;  3UA7 A;  1KSW A;  1UJY A;  2EGE A;  1UE9 A;  1X2K A;  1M3C A;  1MV0 B;  2YT6 A;  2CUB A;  1BB9 A;  1SHG A;  1UTI A;  1AOJ A;  1GFC A;  2ROL A;  1JU5 C;  2DRM A;  1T3S A;  2RQR A;  1OPK A;  2JXB A;  2PTK A;  4F14 A;  1JXO A;  1OV3 A;  1M27 C;  3REA B;  2DRK A;  2DLP A;  4AFQ C;  1YWP A;  1WXB A;  4WCI A;  3I5R A;  2X3X D;  1YP5 A;  3TSW A;  2EYW A;  2V1R A;  1Z9Q A; 
#chains in the Genus database with same CATH topology
 3M5A A;  4JLI A;  1EZZ B;  1PWT A;  3CC2 A;  2DL7 A;  1K9M C;  1I81 A;  2LRQ A;  2CZ0 B;  8AT1 B;  4JLG A;  4A4H A;  2OTL Q;  4C8Q F;  5GAN 3;  4MZM A;  3EG2 A;  4BUG A;  1BIB A;  2LVM A;  1ZLM A;  1NPR A;  1Q7Y C;  3G4S Q;  5GJW B;  5I2S A;  1M1K R;  4C8Q A;  3I56 Q;  3O8V A;  3LWI A;  1R8O B;  3LGL A;  4KGX B;  1VIF A;  5KYX B;  4PLI A;  3M4Y A;  3M53 A;  3A5Z B;  4EMK B;  4XK8 E;  2XIC A;  2C0I A;  1IZ6 A;  3EGD A;  3HKS A;  1FX7 A;  2CGH A;  4LUE A;  1LCK A;  1K4U S;  4RCB A;  4IUV A;  3JB9 F;  4OMO A;  2RI3 A;  2PUK B;  3UDC A;  5LJ3 h;  3IQL A;  5AT1 B;  5GAN d;  3BDU A;  1QLY A;  2K9G A;  5J3B A;  1D3B A;  2OTL T;  3GLX A;  4PJL A;  2K5L A;  4KH1 B;  3PGG A;  4PJO G;  1O9S A;  2ZPG B;  2DTO A;  2RQV A;  1VYU A;  3OYI A;  4J9G A;  2XDD A;  3VUZ A;  4A4F A;  5LL6 S;  2E65 A;  3FLG A;  1W4S A;  2B8A A;  3L2Q A;  1I1J A;  1VQ4 T;  3GP8 A;  1K73 C;  1PRL C;  2I0N A;  2VGN A;  2EJG A;  4OB2 B;  4QKU A;  4QQG A;  2O88 A;  1QCO A;  1VIE A;  4PJJ A;  4Q5W A;  1M8M A;  2PNI A;  1KHI A;  3CXC P;  1GXI E;  3OYA A;  3CME A;  3GPL A;  1NLO C;  1VQP Q;  2YUQ A;  3MCA B;  2MWP A;  3A8G B;  1ZSZ C;  4BDZ A;  2CDT A;  4J9E A;  2W0Z A;  4KT0 E;  2RQW A;  4J5Y A;  1X6B A;  2IG0 A;  2KE9 A;  2P4T A;  3TVT A;  1YJW Q;  4M7A B;  2R5A A;  2LQW A;  1JBM A;  3NTI A;  2HZY A;  5KYW A;  1QVF P;  4B9W A;  2DJZ A;  4OGC A;  4O5V A;  3QXE B;  2DF6 A;  2RNA A;  2EGC A;  2YXY A;  3SHW A;  1KC8 R;  1YIJ Q;  4F7U G;  3JCM X;  3ZL7 C;  1I4K 1;  4CC3 A;  1WI7 A;  3HP9 A;  2I2L A;  3J7A F;  2DFU A;  2QA4 Q;  2F5K A;  1ZSZ A;  4X9D A;  2ROT A;  2YDL A;  4AMC A;  4C92 B;  4FSX A;  1AWO A;  3VRY A;  2IIM A;  1VQP T;  1ABQ A;  2K79 A;  5A2Q E;  1QVG S;  3UF4 A;  3CC2 Q;  1GBR A;  4QVC A;  4NL3 A;  4FIB A;  3CCS Q;  1VQ7 A;  2LTO A;  4MZT A;  2QAZ A;  3X26 B;  4IUP A;  3L2R A;  1QCF A;  2AKL A;  3RBB B;  1E6G A;  4D8D A;  3VKI A;  1K9A A;  5IXB A;  3PVL A;  4F17 A;  2QEX T;  3EAE A;  1VYT A;  3CCJ T;  4EMK C;  3G6E A;  4E7I A;  5CKB A;  4F04 B;  2K6D A;  1VYV A;  1TUG B;  1M9S A;  3M54 A;  2SRC A;  5HK0 A;  1NJI C;  1BCO A;  2GQV A;  1M3A A;  1AHJ B;  2IPO B;  1WPY A;  2OJ2 A;  1RLP C;  3CCL T;  1I0C A;  3THK A;  2ZPH B;  3L1A A;  3I55 T;  5KYU B;  2OX7 A;  1W6X A;  2QA4 T;  3V7C A;  2GCX A;  8ATC B;  2L5Q A;  5HKC A;  4ATO A;  5KYX A;  2DKG A;  2LQ8 A;  1GL5 A;  3CC2 T;  5I2M A;  1RAB B;  3CCS T;  2DNU A;  4Y28 E;  4ME7 A;  3Q1J A;  1G2B A;  4MDW A;  1B3Q A;  3RUX A;  2H3J A;  2KRM A;  4IIO A;  3QKJ A;  2COY A;  2BZ8 A;  3MEA A;  4WF2 A;  1IGQ A;  2NWM A;  4JRK A;  1ACM B;  3M0P A;  5FU7 B;  2Y90 A;  2CP6 A;  3H6Z A;  5D7U A;  2FYK A;  3RR6 A;  2A7Y A;  2GTJ A;  1BU1 A;  2VXE A;  3JCM e;  2WSC E;  1WHK A;  1X01 A;  2FZG B;  3CC7 Q;  2CZ7 B;  4M7A C;  4MML A;  2DYB A;  1G3W A;  4XTX A;  4X1V A;  1ZUK A;  3MHX A;  4HCK A;  5C6S A;  4RG2 A;  3VS2 A;  2R58 A;  1WLP B;  5CQY A;  3MPU B;  1ARK A;  2LX7 A;  2OI3 A;  4M7D B;  3HRU A;  4AG2 C;  5J39 A;  2JTF A;  1E6H A;  5KYN A;  1YI2 A;  2JTM A;  2ZCF B;  3CPF A;  3QZ5 B;  4M7A F;  2VVK A;  4C92 C;  3PIP A;  1SPK A;  4E2F B;  3U23 A;  1WX6 A;  2BKD N;  3S3O A;  4RUG A;  5GAM e;  3L2V A;  1YHQ A;  2CP5 A;  3PMT A;  3RKY A;  4QQ6 A;  1WQ7 A;  2RK2 A;  2QTV A;  4Y91 A;  4XQ3 A;  4XTW A;  2RQT A;  4M7A A;  1NLP C;  1JO8 A;  2V1Q A;  3BY7 A;  1PSF A;  3TRE A;  3CME T;  3CEY A;  1FXX A;  3GNF B;  5C0M A;  1H8K A;  1R0B G;  4E47 A;  1TU0 B;  2MI6 A;  2MK5 A;  2KBT A;  5KYY A;  1P92 A;  3PNW C;  2C0T A;  2COW A;  3NMZ C;  2HMA A;  1VQ7 Q;  2LT1 A;  2J6K A;  1NEB A;  3OS0 A;  4J9C A;  3C4S A;  4C92 A;  4DOW A;  4GY5 A;  5LJ5 d;  2YRV A;  5CIU A;  2YUP A;  4GLK A;  2CT3 A;  1YCY A;  1W2B P;  3VYH B;  2DXT A;  1UEC A;  1K8A R;  3OYC A;  2KYB A;  1TXQ A;  1NBE B;  1K9M R;  2VAS A;  3A1P A;  3CXC S;  1VQ5 Q;  3PTA A;  2E3H A;  2KRN A;  3G7Z A;  1IHW A;  1HK9 A;  4OMM A;  5FWC A;  1UEB A;  3VS6 A;  1VQ9 A;  3FJ5 A;  3QWX X;  3HHT B;  4JJB A;  2O9V A;  1PNJ A;  2HBW A;  3VS0 A;  4CC2 A;  2RHZ A;  3VRZ A;  2CZ6 B;  2RMO A;  4OMP A;  5L23 A;  3N5B B;  4O6J A;  4DA4 A;  3JB9 H;  1WIE A;  1SF9 A;  4LD9 K;  4FL6 A;  2ZPF B;  1BCM A;  1VQ7 T;  1OX9 A;  3G4S A;  5KYU A;  1M3C A;  1M90 U;  1UB4 A;  5FU7 C;  1JU5 C;  2RQR A;  3JCM J;  2PTK A;  3OMG A;  3I56 A;  3EGX B;  3H9N A;  1N27 A;  4AFQ C;  1WXB A;  5GAN h;  3G6E T;  1D0X A;  4PJO E;  1Z9Q A;  4IKF A;  4E7L A;  2KMT A;  1KD1 U;  1T0J A;  1EFN A;  2KT1 A;  1GCP A;  4FW1 A;  1M4Z A;  1XOV A;  4XTZ A;  1NM7 A;  1I5L A;  3GF5 A;  2DD5 A;  3JCM b;  3CXC A;  4KUL A;  2CP2 A;  1VOM A;  4M7D C;  4BD3 A;  1OYX A;  4II1 A;  2CT4 A;  4XAX B;  3CBP A;  1NE8 A;  1BBZ A;  2FPD A;  3QJ6 A;  1FYN A;  5I11 A;  1QCN A;  3OY9 A;  3ZEH A;  4RTV A;  2YSQ A;  5DY9 A;  3TCJ A;  1QVG P;  1OI1 A;  3PMI A;  4RTU A;  5CKD A;  1X43 A;  3C12 A;  2LMJ A;  4XU0 A;  1JXM A;  1CKB A;  4FYX B;  3BDL A;  4PFP A;  3JCM d;  3X24 B;  5GAN 2;  3CQT A;  4HT9 A;  1YCS B;  2G6F X;  4M7D F;  1UGV A;  4AFZ C;  5IT9 E;  3OYD A;  2EVR A;  3H41 A;  3CD6 A;  2DEQ A;  1AVZ C;  3RNJ A;  1ABO A;  2LZ6 B;  1QVF A;  4FSS A;  4FM4 B;  5L8R E;  1GFD A;  2L89 A;  1JRI A;  1PSE A;  3EG3 A;  5IN1 A;  2JS0 A;  2QI2 A;  4M7D A;  4IIM A;  2ENM A;  2EQU A;  1ZA2 B;  2RO0 A;  4ZN3 A;  2DL5 A;  4ZNX A;  4M78 A;  3CPW P;  3OBY A;  4KBM B;  1WHM A;  1BK2 A;  2BE9 B;  5D6Y A;  1S72 A;  4JS4 A;  2MOX A;  3MEW A;  1SEM A;  4F7U E;  1VQP A;  2DX1 A;  3EG0 A;  5CK9 A;  1EX4 A;  4M77 B;  1Q81 U;  3GIB A;  4BY6 C;  3FB9 A;  2OTJ Q;  1U06 A;  3MEV A;  1PG5 B;  4J9F A;  3CMA Q;  4Z8A A;  4J9D A;  4HT8 A;  2CYZ B;  2XDB A;  2CSQ A;  1N8R R;  4E7J A;  2FPF A;  5LJ5 g;  2RM4 A;  2D0Q B;  2M02 A;  1YJW A;  1MMN A;  2LC4 A;  4X34 A;  2MAM A;  2W10 A;  1VQO Q;  2XD0 A;  2XDP A;  3PFS A;  2PVG B;  3M0Q A;  2JJ9 A;  1YI2 T;  1YIJ A;  5GMK e;  3JCM P;  1WHG A;  3LX7 A;  2DZ9 A;  2EYX A;  4LUD A;  1JB0 E;  1RL2 A;  1BIA A;  2EPD A;  4ESR A;  4QQD A;  1YHQ T;  1C0M A;  2AIR B;  3M0U A;  4LN2 A;  2DEU A;  5GAN 6;  2JM9 A;  1VQ9 Q;  1VUB A;  1WJR A;  4PJN A;  4XU1 A;  3LLR A;  3DB3 A;  1Q82 U;  1G3Y A;  5IAY A;  2PU9 B;  2P84 A;  3CCS A;  2RH2 A;  1VQM Q;  1V29 B;  1NJI R;  2DE0 X;  1A0N B;  1TWB A;  2EKO A;  2EWN A;  2PQW A;  4E6R A;  3MJX A;  1X69 A;  1MUZ A;  4GBQ A;  1D1C A;  2RHI A;  4OP0 A;  1EIF A;  2GFA A;  3V8J A;  2NUT B;  3EFO A;  1VQO T;  2JMC A;  4GLM A;  1OZ2 A;  2EQM A;  3VS7 A;  3SWN B;  2XHC A;  3R6N A;  3INZ A;  4KRT A;  3S3M A;  4M7A D;  4LNP A;  2RHY A;  3QG1 A;  1BKB A;  1M2V A;  2EBP A;  1H64 1;  3UPU A;  2EYY A;  4D8K A;  1AWX A;  1UGS B;  5LJ5 f;  1XJW B;  2WSE E;  2X4J A;  2PVD B;  3CCE Q;  1I8F A;  4YTL A;  4E7S A;  2KEA A;  4N4I A;  1VQ9 T;  3HFO A;  2J6F A;  2E6Z A;  4FT2 A;  2LQK A;  1NG2 A;  2ED0 A;  3JCM V;  3QWY A;  3EH1 A;  1CKA A;  3EG9 B;  2DBM A;  4C92 D;  5GAO r;  1XQH A;  1WZO A;  1X75 C;  2QTX A;  4ZGE B;  3SEM A;  3NTH A;  1TSF A;  1RI9 A;  4QVZ A;  2OAU A;  3G4S T;  2DL8 A;  2QQB A;  3MP8 A;  4FW2 A;  1W2B S;  5KCO A;  5LJ5 j;  1YFN A;  2V8J A;  2K3B A;  1QQJ A;  4PJO B;  3SDZ A;  4A63 B;  4XU2 A;  3CD6 Q;  2GBQ A;  5LJ3 e;  1AD5 A;  3I56 T;  4CRI A;  1K76 A;  2RK1 A;  3EHQ A;  3VS3 A;  2ZPE B;  4M77 C;  4MDX A;  1ZQ1 A;  4OB0 B;  2Y4X A;  2HKN A;  2Z0W A;  4JRI A;  1MNE A;  3CCE T;  2K5F A;  1NYF A;  2HDA A;  4M78 E;  4AFU C;  1QP2 A;  2X35 A;  4LDY A;  1S72 Q;  3CC7 A;  2E4H A;  3EG1 A;  1Q81 C;  4J6X A;  4N4G A;  1WA7 A;  1M30 A;  2MCN A;  1BI2 A;  4M77 F;  2PUO B;  3OS2 A;  3OYM A;  2VV5 A;  3NPF A;  3C0C A;  2XI9 A;  1OU9 A;  1U1S A;  2EIF A;  1XNI A;  3HRT A;  1FMK A;  2HSP A;  4M75 B;  2AZS A;  4M77 A;  3QDF A;  1JEG A;  3CD6 T;  2RJF A;  4M7A G;  5CR2 A;  1W2B A;  2JW4 A;  2DK3 A;  2F2W A;  3R6O A;  2EFI A;  2HQE A;  3FRN A;  1YNZ A;  2SEM A;  1TUC A;  4F7U B;  5J26 A;  5LJ5 h;  2QGG A;  1WDX A;  1Q82 C;  1S72 T;  4HCZ A;  3CCU Q;  2JM8 A;  2FPE A;  2KSS A;  7AT1 B;  2RHX A;  4QT7 A;  3G71 Q;  1H3Z A;  2EW3 A;  1MND A;  3JCM c;  4C92 G;  3SWN C;  3NFC A;  5FRO A;  1D0Y A;  3MET A;  5I21 A;  2AT1 B;  3G1J A;  2DD4 A;  2F5T X;  2C06 A;  3C94 A;  5GAO n;  2VGM A;  1YJW T;  1KC8 U;  3EH2 A;  3QUI A;  4M7D D;  4RG8 A;  5IHI A;  4C8Q E;  2CH4 W;  4M78 D;  1VQK Q;  1VQ5 A;  1YIJ T;  4A53 A;  3X25 B;  5DLQ E;  3CPW S;  1B7T A;  2X51 A;  3DLL A;  2CSI A;  4B6M A;  5IHN A;  2D6F A;  2DYI A;  1WGS A;  2NUT A;  2L3S A;  1WFW A;  2CP7 A;  4HKE A;  2CRE A;  3SWN A;  4PK4 A;  4R55 A;  2ABL A;  5GAN g;  3F70 A;  5IHK A;  3V7R A;  3E19 A;  2EQJ A;  3QO3 A;  5CQX A;  4CC7 A;  1V76 A;  1VQL Q;  2ZPI B;  2RB6 A;  4EMK A;  5FU6 B;  3ZBD A;  1QVG A;  4DQ2 A;  4A4G A;  5GJV B;  2HBP A;  1UGP B;  3MKD A;  4OMQ A;  4J7I A;  2QYZ A;  1QW1 A;  1BI0 A;  3H0H A;  1TTH B;  2KNB B;  3EG9 A;  2EKH A;  1K1Z A;  4PJO F;  1WXT A;  2EJ9 A;  2BZY A;  1I07 A;  2J06 A;  2EQI A;  3H0I A;  2O31 A;  3LW5 E;  3LYI A;  3JCM h;  4KGV B;  3HPW A;  4JDS A;  1M1F A;  1TOV A;  2YT6 A;  1BB9 A;  1SHG A;  2VUB A;  1T3S A;  1OPK A;  4RKU E;  1PM3 A;  4N0A C;  2PVO B;  1QVP A;  2JXB A;  2X4X A;  2HD0 A;  4M75 C;  4ZGJ B;  2YWW A;  3REA B;  4LDV A;  2DLP A;  4XTU A;  3RER A;  4WCI A;  2V1R A;  4C8Q D;  2LJ0 A;  2X4W A;  2K4Y A;  4J83 A;  4WTO B;  2HKQ B;  3I9Q A;  3JV3 A;  1AZG B;  3P8B B;  5GAN f;  4RTW A;  2RPN A;  3QSU A;  3HTR A;  3A8M B;  1UGQ B;  4J6W A;  1MMD A;  4JRQ A;  4M75 F;  4M7D G;  1ZUY A;  3WVE B;  4M78 G;  4P5N A;  4QW2 A;  2P0Q A;  4J8O A;  5GAN 4;  3CCV Q;  1KQS P;  2JOY A;  1T3L A;  1M8V A;  3UAT A;  4ELZ C;  4EPC A;  4M75 A;  4Z02 A;  4Y92 A;  1IGU A;  4HXJ A;  2JMA A;  1VQ6 Q;  2CUD A;  4F7U F;  1E7O A;  3H0F A;  5GMK l;  2B86 A;  1D0Z A;  2O01 E;  4C5G A;  3S3N A;  3CC7 T;  2DTH A;  3JB9 D;  4J9H A;  2OTJ A;  4KGZ B;  2H3E B;  5GAN j;  1YJ9 Q;  1AWW A;  1KQ2 A;  2CKK A;  3CMA A;  1VQN Q;  2DET A;  1Q86 R;  2DAQ A;  2ZZD A;  2FL7 A;  2HL5 C;  2F1L A;  3QDR B;  4JPB W;  1VQO A;  3VJP A;  5FRN A;  3PE0 A;  1KC8 C;  4IUU A;  1M2O A;  1TG0 A;  3OS1 A;  3ZFJ A;  1SRL A;  1SSH A;  1FMW A;  2E3I A;  1M1G A;  1YJN Q;  1QWF A;  2CP0 A;  2LCS A;  2HEQ A;  3GOX A;  3VV0 A;  2FZC B;  2E64 A;  4A4K A;  2KAF A;  5FU6 C;  1Q7Y R;  4N4H A;  1X6G A;  1RI0 A;  4EMG A;  2EJF A;  2DZC A;  1UGR B;  2AKK A;  2GQI A;  1GBQ A;  4RTX A;  4DBF A;  1UDL A;  2NYS A;  3HFN A;  2CH4 A;  1VQM A;  1YJ9 T;  2X3W D;  2AHJ B;  2V8I A;  2E10 A;  1VQN T;  1Q95 G;  4M77 D;  5CVI A;  4C8Q G;  2HNI A;  3V8K A;  1X2Q A;  1Y96 B;  1QWE A;  4PFO A;  1YIT Q;  2D8H A;  3OSS C;  3ASK A;  2AZV A;  2O9S A;  1K8A U;  1C6V X;  4IUQ A;  5CKE A;  3TQ7 P;  1G83 A;  1K9M U;  2QXF A;  2BZX A;  2QQA A;  3J81 E;  4E7Z A;  2E1H A;  2O4X B;  1SRM A;  2M0Y A;  5IXF A;  2VC8 A;  1YJN T;  3LH0 A;  3M4G A;  1VQ5 T;  3CCE A;  2D9T A;  2KVQ G;  3REB B;  1YN8 A;  2KK4 A;  2EYZ A;  2MYS A;  4FT4 A;  1G8X A;  1Y71 A;  4JJD A;  1VQ8 Q;  3X28 B;  5GAN e;  3VUB A;  5GAO q;  3MO8 A;  3JB9 G;  2DER A;  1D3B B;  1N6A A;  4OML A;  1KJW A;  3P8H A;  1JJ2 S;  1Y7X A;  2P0P A;  3KFV A;  1ZA1 B;  2IVW A;  4JJC A;  2L2P A;  1SG5 A;  2DVE A;  1K73 R;  1MHN A;  1K0X A;  3OYB A;  1B34 B;  2DO3 A;  2QDY B;  5CCA A;  1LOJ A;  2J6O A;  5EC7 A;  1MV3 A;  2GGR A;  3PVQ A;  5GMK m;  1LJO A;  4LDU A;  3A8O B;  4BAC A;  1ZUU A;  2FB7 A;  1MMA A;  2ECZ A;  5A0L A;  1SSF A;  5A0D A;  4TVR A;  2YHT A;  3JCM Q;  3JAM E;  2CS7 A;  4JS5 A;  1ZBJ A;  4JRP A;  4FYY B;  1WHL A;  2K3Y A;  4M7A E;  3NTK A;  1N5Z A;  3CC4 A;  1RAA B;  1LPL A;  2LP5 A;  1UJ0 A;  2RA2 A;  1GCQ C;  1PRM C;  1LNX A;  5GAM d;  4BE1 A;  4AT1 B;  3OYJ A;  1IRX A;  4J7F A;  4M77 G;  5CKF A;  3JRZ A;  3CBO A;  1D1A A;  3VS5 A;  4C92 E;  3DB4 A;  5KYW B;  1DJ7 B;  1PC0 A;  2DPP B;  4JJN K;  2L3Q A;  3HSB A;  2RHU A;  2DIL A;  4AG1 C;  2A08 A;  2HQX A;  3OA6 A;  4RTZ A;  5KH6 A;  4LD6 A;  3A8L B;  4C5I A;  1IB8 A;  2KGT A;  1F1B B;  3E9G A;  3TEE A;  5KE2 A;  2V26 A;  5FW9 A;  2FHD A;  4LDX A;  9ATC B;  3OYF A;  1Y0M A;  3CCU A;  3CCM Q;  2A37 A;  3G71 A;  4OB3 B;  1RUW A;  3OS5 A;  5GMK i;  1ZSG A;  1N8R U;  3E1S A;  3LGF A;  2BTT A;  4ZGD B;  3TU4 K;  2OTJ T;  1K0S A;  3OB9 A;  2L8D A;  3M57 A;  2RJC A;  5D6X A;  2KR3 A;  3CMA T;  5GAN 7;  4BE0 A;  1M90 C;  3E2U A;  2KI7 A;  3V7S A;  1TS9 A;  2NUZ A;  2VXF A;  2FEI A;  4M4Z A;  2LJ1 A;  2D0N A;  1RAD B;  1G3T A;  1TUD A;  4HCC A;  2EAY A;  3FEO A;  1BI1 A;  5ECA A;  4M75 D;  1KD1 C;  1KQS S;  2ESW A;  3S6W A;  1VQK A;  3SD4 A;  3E9F A;  1Y96 A;  4XTV A;  3T9N A;  4OMF B;  1VQ4 Q;  3EGX A;  4F16 A;  1OU8 A;  3H8Z A;  3LWH A;  4C0D B;  3L2W A;  4D6W A;  1QKX A;  2O4X A;  2J7I A;  2EQK A;  3CCM T;  3M59 A;  2NLU A;  1NJI U;  3FJP A;  1IHV A;  5D6W A;  4PNO A;  2DMO A;  2YRD A;  1VQL A;  3NHN A;  3JCM g;  1VQM T;  1FWZ A;  4L6V 5;  1M1K U;  1ZHI A;  1PHT A;  2LQN A;  3CCR A;  2MIO A;  1OQK A;  2VKN A;  1AZE A;  5GAO m;  2E12 A;  2E41 A;  1UFF A;  3C95 A;  1D1B A;  4HVW A;  2C0O A;  1B34 A;  2A36 A;  3MP1 A;  4RMO A;  4M7D E;  1KQS A;  2XK0 A;  2MWO A;  1I5O B;  2AK5 A;  2MPX C;  3CC4 Q;  1VA7 A;  3MEU A;  5GAM g;  3X20 B;  4BI4 A;  3VS1 A;  2KRO A;  2QG9 B;  2QQS A;  2YUO A;  1NEG A;  3OYG A;  1QKW A;  3BW1 A;  4ORZ A;  3KBG A;  1RAI B;  3P8D A;  3JCM W;  1KHC A;  3J80 E;  1HJD A;  2RQU A;  3QYH B;  2FG0 A;  3OBW A;  2XMF A;  3QYG B;  1KSW A;  1UJY A;  2EGE A;  4PJM A;  1UE9 A;  2LCL A;  4ZTJ A;  3OW2 P;  1X2K A;  2NUP B;  1MV0 B;  1UTI A;  2CUB A;  1AOJ A;  1FMV A;  1GFC A;  2DRM A;  2XID A;  3JCM f;  4M75 G;  4F14 A;  1WNL A;  1JXO A;  1M27 C;  3CCV A;  3BE3 A;  5GAN 8;  2HQH A;  2QEX Q;  2X3X D;  1YP5 A;  5M9O A;  4BI3 A;  3CCJ Q;  3RES A;  2MMP A;  1S1N A;  3PT9 A;  1VQ6 A;  4HA8 A;  2P0K A;  2DXU A;  3WVD B;  3CC4 T;  1BI3 A;  5KYY B;  2MF2 A;  3OYY A;  3OYH A;  1N8R C;  3OQ5 A;  4C0F A;  2KYM A;  1YJ9 A;  3DLM A;  3VS4 A;  4QVD A;  1SHF A;  3CCL Q;  1VQN A;  2JZ2 A;  3M0S A;  3I55 Q;  1HSQ A;  2COZ A;  2KT8 A;  2V8K A;  2DL3 A;  3QPH A;  3JSC A;  1JJ2 P;  2WSF E;  3PIO A;  2KDS A;  3JB9 J;  2A28 A;  5LJ5 e;  2CP3 A;  1Z9Z A;  5GAM f;  4EMH A;  2K3X A;  2GF7 A;  2OAW A;  3M9Q A;  2F2V A;  4J9I A;  3QJY A;  2M0O A;  4C0D C;  2R57 A;  2HSE B;  1YJN A;  1RAE B;  2CZ1 B;  2DL4 A;  2KY9 A;  2LNV A;  4PLL A;  1U3O A;  2X9H A;  1ZBX A;  3RKW A;  3EHR A;  1AWJ A;  2DA9 A;  2KQW A;  3FDR A;  5AYF A;  2ED1 A;  1R77 A;  5CKH A;  3O5Z A;  3CCU T;  4ZTF A;  2M16 A;  3ULR B;  1W70 A;  5GAM j;  1V1C A;  3G71 T;  4PJO C;  4CI0 C;  1RAH B;  3RDV A;  3AT1 B;  5CAI A;  3LH5 A;  1R0C B;  1RAF B;  1U1T A;  4DBQ A;  1M1K C;  3OYE A;  4E7K A;  1NPP A;  3OMC A;  4OB1 B;  4RTT A;  1YIT A;  1IO6 A;  2FZK B;  1T0H A;  2K2M A;  2VYT A;  1NZ9 A;  3OYL A;  1UG1 A;  3CCR Q;  1RAC B;  4NL2 A;  3M58 A;  2LNH B;  4LXC A;  2JTE A;  2E5Q A;  1OOT A;  1PCX A;  2KXD A;  2RI5 A;  1VQK T;  1WJS A;  1MMG A;  3I35 A;  1PKT A;  2YLC A;  5KE3 A;  2JN0 A;  2QAS A;  1YWO A;  4PJO A;  1YBY A;  3A98 A;  3CPW A;  2M1H A;  1VQ8 A;  5LJ3 d;  2K57 A;  1H3H A;  1UHF A;  4C0G A;  4X9C A;  2L3P A;  2RN8 A;  4JUV A;  3QII A;  2QK0 A;  3CCQ A;  4ELY C;  2HCK A;  1KK7 A;  2FO0 A;  2K7A A;  3A8H B;  3EFR A;  1JQQ A;  1VQL T;  3CME Q;  4HVV A;  4OVA A;  2JNG A;  2E70 A;  2LCC A;  4J6Y A;  4LDW A;  2QQR A;  2K5I A;  4NOY A;  3CCR T;  1WYX A;  4DBH A;  4M77 E;  5GAM h;  1UUE A;  5A0G A;  1B07 A;  4DEY A;  1M3B A;  1Y07 A;  1CSK A;  4PKC C;  4N0A A;  1W1F A;  2EYQ A;  4M78 B;  2DTI A;  3KUF A;  4R0K A;  2FRW A;  5HCK A;  1OUL A;  2NUP A;  5EG2 A;  4BI8 B;  3HL8 A;  1AT1 B;  2YRC A;  4LE9 A;  3HRS A;  3URG A;  4KUI A;  3SB2 A;  2E5K A;  4MZP A;  2ATC B;  1WQW A;  1U8R A;  3MP6 A;  1IRE B;  2XKO C;  2DVJ A;  4F7U A;  3M0T A;  1PD0 A;  4HVU A;  3L2Z A;  2M51 A;  2A3L A;  4OGE A;  2L3R A;  2EGA A;  4C92 F;  2LT4 A;  4FCY A;  2RJE A;  3M0R A;  3QZ9 B;  3BFM A;  4BDY A;  3VU3 C;  3EGU A;  4DBR A;  2LDM A;  2LJ3 A;  4XTY A;  4RCC A;  2BIV A;  5GAN 5;  2HAX A;  1HD3 A;  1GRI A;  1UHC A;  3CCV T;  1OPL A;  4UC4 A;  5DM7 R;  2H8H A;  3GBQ A;  4AFS C;  2DM1 A;  5HK3 A;  4BY6 B;  2VWF A;  2RD1 A;  1M90 R;  5CO7 A;  2BUD A;  3VYG A;  1OX8 A;  3G6E Q;  2F2X A;  5FLX E;  1C1A A;  1VQ6 T;  1G5V A;  4L5G A;  3CCM A;  3CBM A;  4Z88 A;  4DEX A;  4KUD K;  4HCB A;  3SFM A;  4EIK A;  1Q86 U;  3RIR A;  4E7H A;  2RJD A;  4BB7 A;  1KD1 R;  4ZN1 A;  1OEB A;  2DIQ A;  3UWN A;  2RF0 A;  3D7S B;  1KQ1 A;  3OW2 S;  1RLQ C;  2D1X A;  3EFO B;  4C8Q B;  1WXU A;  2RI2 A;  3KXT A;  2QQ9 A;  2OTL A;  2A0F B;  4A4E A;  2X4Y A;  4XU3 A;  4C0Z A;  1M2V B;  1WHH A;  1PD1 A;  2GTO A;  1QVF S;  1Q7Y U;  1XTD A;  3QBY A;  3UA6 A;  3V8L A;  2KXC A;  4CC4 B;  3EGD B;  3RMQ A;  2QDL A;  1VQ4 A;  4KH0 B;  4C5E A;  2G3R A;  5LJ3 g;  2YUN A;  4OMN A;  4RTY A;  5HY6 A;  2Y4Y A;  4JZ4 A;  2FRY A;  4PL6 A;  2O2O A;  2JS2 A;  4A54 A;  1LVK A;  2JUF A;  5GMK j;  2DBK A;  1KIK A;  2DXC A;  2ZAE A;  3CCQ Q;  2HL3 A;  4V2S A;  2BE7 D;  3OSV A;  2L0A A;  1N9R A;  1AEY A;  1KG1 A;  1YIT T;  2WAC A;  2FVU A;  4M78 C;  1M5Q 1;  4J9B A;  1QMC A;  3M55 A;  2J05 A;  3FC3 A;  3ME9 A;  3OW2 A;  4DOV A;  1Q81 R;  4MMK A;  3RMS A;  1RAG B;  3TSZ A;  1NYG A;  1PKS A;  1QP3 A;  2XU8 A;  4PFZ A;  3I5S A;  3WXM B;  1X27 A;  2DJQ A;  1YI2 Q;  1KFZ A;  4M78 F;  4M75 E;  2DIG A;  1TH7 A;  5GAO l;  4ANJ A;  5KCH A;  2E6N A;  3EFS A;  2JT4 A;  4JZ3 A;  5GAO p;  3L2U A;  1VQ8 T;  5IH2 A;  4OF1 A;  2XG8 D;  3FIF A;  1YHQ Q;  1K73 U;  5FRM A;  1ZX6 A;  3QHS A;  1O75 A;  2YLB A;  4K11 A;  4BE2 A;  3CCQ T;  5LJ3 f;  2P4R A;  2GNC A;  2ZPB B;  2PZ1 A;  1SKU B;  3DKM A;  5FWB A;  4C5H A;  4Z89 A;  1JJ2 A;  4FYW B;  4FU6 A;  1U5S A;  3GNG A;  1HYO A;  5GMK h;  1Q82 R;  1WJQ A;  5I22 A;  4FYV B;  3L42 A;  4IUR A;  1HXD A;  3NGP A;  4NS5 A;  1OZ3 A;  1D09 B;  3UT1 A;  4PJO D;  2QEX A;  3JB9 I;  3ER0 A;  2KRS A;  3CCJ A;  3AHU A;  1GCQ A;  2DXB A;  2GFU A;  1Y57 A;  1ZSZ B;  3OYN A;  1J3T A;  1H92 A;  2K2V A;  3RKX A;  1BYM A;  2JVV A;  1X6O A;  2D8J A;  5LJ3 j;  3UA7 A;  2F69 A;  2LX9 A;  6AT1 B;  1Q86 C;  2M9U A;  2ZGW A;  4R56 A;  4C8Q C;  4EDU A;  4B9X A;  4L59 A;  3CCL A;  2R5M A;  3I55 A;  1G3S A;  2ROL A;  1IXD A;  2QA4 A;  4IUT A;  3OYK A;  2VB6 A;  1OV3 A;  5DLO A;  2DRK A;  2QGF B;  1YWP A;  4VUB A;  1WHJ A;  1N9S A;  3I5R A;  3TSW A;  1MGQ A;  2EYW A;  1K8A C;  3M56 A; 
#chains in the Genus database with same CATH homology
 1PWT A;  2LJ0 A;  1S1N A;  2DL7 A;  1T0J A;  1EFN A;  2KT1 A;  1GCP A;  3JV3 A;  3I9Q A;  1AZG B;  1XOV A;  1NM7 A;  3EG2 A;  4RTW A;  2RPN A;  1ZLM A;  2KYM A;  3VS4 A;  1SHF A;  5GJW B;  3M0S A;  1ZUY A;  1HSQ A;  2CT4 A;  2KT8 A;  2DL3 A;  1BBZ A;  2FPD A;  1FYN A;  5I11 A;  2A28 A;  4RTV A;  1T3L A;  2YSQ A;  3UAT A;  1Z9Z A;  4RTU A;  4Y92 A;  1X43 A;  2LMJ A;  4HXJ A;  1JXM A;  2JMA A;  1CKB A;  2CUD A;  2OAW A;  2F2V A;  4J9I A;  3CQT A;  1E7O A;  3H0F A;  2B86 A;  1YCS B;  2G6F X;  1UGV A;  2C0I A;  4AFZ C;  2EVR A;  3H41 A;  4J9H A;  4LUE A;  1AVZ C;  1AWW A;  3RNJ A;  1ABO A;  2DL4 A;  2LZ6 B;  1LCK A;  4FSS A;  1K4U S;  1U3O A;  1GFD A;  4OMO A;  3EG3 A;  3IQL A;  3EHR A;  2JS0 A;  1AWJ A;  1QLY A;  2DA9 A;  2K9G A;  2ENM A;  4IIM A;  4JPB W;  3PE0 A;  2DL5 A;  4ZNX A;  2ED1 A;  1TG0 A;  3O5Z A;  1BK2 A;  3ULR B;  1W70 A;  1V1C A;  2MOX A;  1SEM A;  1SRL A;  2DX1 A;  2RQV A;  1VYU A;  1SSH A;  4J9G A;  3EG0 A;  3LH5 A;  1QWF A;  2LCS A;  2HEQ A;  4RTT A;  1IO6 A;  1I1J A;  1U06 A;  1T0H A;  2K2M A;  4J9F A;  4Z8A A;  4J9D A;  2CSQ A;  1UG1 A;  1PRL C;  2FPF A;  2I0N A;  2O88 A;  1X6G A;  2LNH B;  1M8M A;  2JTE A;  2PNI A;  2W10 A;  1OOT A;  2AKK A;  2GQI A;  1GBQ A;  4RTX A;  1UDL A;  2KXD A;  2CH4 A;  3M0Q A;  1NLO C;  2X3W D;  3I35 A;  1PKT A;  2YUQ A;  2EYX A;  4LUD A;  2CDT A;  1X2Q A;  1YWO A;  4J9E A;  2EPD A;  4ESR A;  1QWE A;  3A98 A;  2D8H A;  3M0U A;  2W0Z A;  4LN2 A;  2RQW A;  2AZV A;  2O9S A;  1X6B A;  1H3H A;  2KE9 A;  1UHF A;  2JM9 A;  2L3P A;  1G83 A;  2RN8 A;  3TVT A;  2BZX A;  1SRM A;  2LQW A;  2M0Y A;  5IXF A;  2HCK A;  2FO0 A;  2K7A A;  1JQQ A;  4HVV A;  2DF6 A;  2RNA A;  2EGC A;  3SHW A;  3REB B;  2DE0 X;  3ZL7 C;  1YN8 A;  1A0N B;  2EYZ A;  4CC3 A;  1WYX A;  1WI7 A;  4E6R A;  4JJD A;  1X69 A;  1MUZ A;  1UUE A;  1B07 A;  4GBQ A;  4DEY A;  1M3B A;  2JMC A;  2ROT A;  4GLM A;  2YDL A;  3VS7 A;  1CSK A;  3R6N A;  4OML A;  1AWO A;  1KJW A;  1W1F A;  4KRT A;  4JJC A;  3KFV A;  4LNP A;  3VRY A;  2IIM A;  2L2P A;  1ABQ A;  2EBP A;  2K79 A;  4R0K A;  1K0X A;  2FRW A;  2EYY A;  3UF4 A;  5HCK A;  1GBR A;  4D8K A;  1AWX A;  2J6O A;  1QCF A;  2AKL A;  2KEA A;  4LE9 A;  5EC7 A;  1E6G A;  3RBB B;  1MV3 A;  4D8D A;  1K9A A;  2E5K A;  5IXB A;  2GGR A;  3PVQ A;  3PVL A;  4F17 A;  2J6F A;  1VYT A;  1NG2 A;  2DVJ A;  2ED0 A;  3QWY A;  1ZUU A;  3M0T A;  4HVU A;  1CKA A;  2DBM A;  2ECZ A;  2K6D A;  1VYV A;  2M51 A;  2EGA A;  1ZBJ A;  2SRC A;  3SEM A;  3M0R A;  1RI9 A;  1N5Z A;  1M3A A;  3EGU A;  2DL8 A;  2LP5 A;  1UJ0 A;  2OJ2 A;  1RLP C;  2LJ3 A;  1GCQ C;  1I0C A;  1PRM C;  3THK A;  2K3B A;  1W6X A;  4A63 B;  2GBQ A;  1HD3 A;  1AD5 A;  1GRI A;  1UHC A;  1OPL A;  1K76 A;  2H8H A;  3GBQ A;  3EHQ A;  2DM1 A;  4AFS C;  3VS3 A;  2VWF A;  1GL5 A;  2F2X A;  2DNU A;  3VS5 A;  4Z88 A;  4DEX A;  1NYF A;  2HDA A;  4EIK A;  4AFU C;  1G2B A;  2L3Q A;  1B3Q A;  2DIL A;  3EG1 A;  4AG1 C;  2A08 A;  1WA7 A;  1OEB A;  1M30 A;  2KRM A;  4RTZ A;  2RF0 A;  4IIO A;  2MCN A;  1RLQ C;  2BZ8 A;  2KGT A;  2D1X A;  3NPF A;  2NWM A;  3C0C A;  3M0P A;  1WXU A;  5FW9 A;  1FMK A;  1Y0M A;  2HSP A;  2A37 A;  2GTJ A;  2AZS A;  1BU1 A;  1RUW A;  1ZSG A;  2GTO A;  1JEG A;  2BTT A;  1K0S A;  3UA6 A;  2KXC A;  4CC4 B;  2KR3 A;  2QDL A;  2JW4 A;  2F2W A;  2DYB A;  2YUN A;  4OMN A;  4X1V A;  2NUZ A;  1ZUK A;  4RTY A;  4HCK A;  4JZ4 A;  2FRY A;  2FEI A;  4M4Z A;  3VS2 A;  1YNZ A;  2SEM A;  1TUC A;  2O2O A;  1WLP B;  2LJ1 A;  2D0N A;  2JS2 A;  1ARK A;  2LX7 A;  1TUD A;  2OI3 A;  4AG2 C;  1WDX A;  5ECA A;  2DBK A;  1KIK A;  2ESW A;  1E6H A;  2JM8 A;  2FPE A;  4QT7 A;  2EW3 A;  2VVK A;  2L0A A;  1SPK A;  3U23 A;  1WX6 A;  1AEY A;  4RUG A;  4J9B A;  4F16 A;  2J05 A;  2RQT A;  1QKX A;  2J7I A;  1NLP C;  1JO8 A;  2V1Q A;  3TSZ A;  1NYG A;  2DMO A;  1PKS A;  5IHI A;  2CH4 W;  1H8K A;  3NHN A;  3I5S A;  2KBT A;  1X27 A;  2DJQ A;  1KFZ A;  2C0T A;  3NMZ C;  1PHT A;  2CSI A;  2LQN A;  4JZ3 A;  2JT4 A;  2J6K A;  5IHN A;  5IH2 A;  1NEB A;  2MIO A;  4J9C A;  2VKN A;  2L3S A;  1ZX6 A;  1WFW A;  1AZE A;  2CRE A;  2ABL A;  1UFF A;  4K11 A;  5IHK A;  2P4R A;  2YUP A;  2GNC A;  4HVW A;  2CT3 A;  2PZ1 A;  2C0O A;  2A36 A;  4CC7 A;  1UEC A;  5FWB A;  4Z89 A;  2KYB A;  1U5S A;  2KRN A;  2AK5 A;  4OMM A;  1VA7 A;  5GJV B;  4OMQ A;  5I22 A;  5FWC A;  3VS1 A;  2KRO A;  3NGP A;  2YUO A;  3VS6 A;  3FJ5 A;  1NEG A;  3H0H A;  1QKW A;  3QWX X;  2KNB B;  4JJB A;  2O9V A;  1PNJ A;  2KRS A;  4ORZ A;  2EKH A;  1K1Z A;  1GCQ A;  1WXT A;  1Y57 A;  2HBW A;  2BZY A;  3VS0 A;  1I07 A;  4CC2 A;  2J06 A;  3VRZ A;  2RMO A;  4OMP A;  2EQI A;  5L23 A;  1J3T A;  1HJD A;  3H0I A;  1WIE A;  2RQU A;  1H92 A;  2O31 A;  2FG0 A;  2XMF A;  2D8J A;  3UA7 A;  1KSW A;  1UJY A;  2EGE A;  1UE9 A;  1X2K A;  1M3C A;  1MV0 B;  2YT6 A;  2CUB A;  1BB9 A;  1SHG A;  1UTI A;  1AOJ A;  1GFC A;  2ROL A;  1JU5 C;  2DRM A;  1T3S A;  2RQR A;  1OPK A;  2JXB A;  2PTK A;  4F14 A;  1JXO A;  1OV3 A;  1M27 C;  3REA B;  2DRK A;  2DLP A;  4AFQ C;  1YWP A;  1WXB A;  4WCI A;  3I5R A;  2X3X D;  1YP5 A;  3TSW A;  2EYW A;  2V1R A;  1Z9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...