1ZV1A

Crystal structure of the dimerization domain of doublesex protein from d. melanogaster
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
b'QDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Doublesex protein
publication title Dimerization of doublesex is mediated by a cryptic ubiquitin-associated domain fold: implications for sex-specific gene regulation
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 24
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zv1A00
1WIVA 3B89A 1WJ7A 2JZ1A 1DO0A 1R4GA 1VG5A 2G3QA 3BBZA 1WGLA 2JY6B 2MR9A 1VEGA 1KYIA 1GO5A 1PGYA 1T43A 2DENA 2EKFA 1VEKA 1ZMWA 2LVQD 1VQ1A 3LCUA 2DAGA 1JR3E 2MROB 1BVSA 3GLGE 2H5XA 4F1IA 2WZJA 4R71A 1HJPA 1A5TA 1EFUB 2LVAA 3MMPA 2QNJA 2JY7A 1HT2E 2DAIA 3E46A 1DV0A 1HT1E 1IM2A 1P3QQ 2BWEA 2DNAA 2DZLA 2DHYA 2HAKA 1WGNA 2QHOB 1ZMUA 2OOBA 1UFZA 2R0IA 2ZTDA 3LCVB 1QZEA 2DI0A 3GLFE 1MN3A 1OKSA 2B3TA 2OO9A 3F92A 1NV9A 1OTRA 3FRHA 1TR8A 4DBGB 1HQYE 2JY8A 4UN2B 4G3OA 1WR1B 3FRIA 2LVNC 2DKLA 1IXSA 3H4JA 2L4FA 1G4AE 1VDLA 1DO2A 1XXHE 1F4IA 2LTUA 2CP8A 3GLIE 2DAMA 2MGWA 1IFYA 4GEWA 4HEOA 2K9DA 5DFLA 2JP7A 2JY5A 4F2LA 2EJSA 2RRUA 1CUKA 2KHHA 1WHCA 3T6PA 1Q02A 2JNHA 2BWBA 2LVOC 1TTEA 1Y8GA 2KNZA 2O25A 1ZV1A 2K0BX 3GLHE 2DAKA 2HWJA 1G3IA 3K9OA 2JUJA 1NV8A 1T6OA 3E21A 2KNAA 3IHPA 1E94E 2LBCA 3FE3A 2CWBA 2ZTCA 1C7YA 2QSFX 2L2DA 2EKKA 1OQYA 2LVPC 1AIPC 1SG9A 2JZ0A 3K9PA 1V92A 4WP2A 4Q7JA 1VEJA 5JI2E 3IECA 1OAIA 2MJ5B 2L4EA 1YLAA 1XB2B 2KNVA 2DAEA 1G41A 1ZMVA 2OOAA
chains in the Genus database with same CATH superfamily
1WIVA 1R7RA 1WXQA 3ZQJA 4B7FA 4IBEA 3VK7A 2XFSA 3FD9A 1W5TA 1VG5A 2MH8A 4G4OA 2YQZA 3U6LA 1KYIA 1R6BX 3SC3A 2CE7A 3V76A 3WHLA 3FKEA 1T43A 3J27B 4IBCA 1ZMWA 4KLNA 3OTOM 4B3TM 1KSFX 3TPZA 2W82A 3GQ3A 2F5QA 4K0KM 1E32A 4I4LA 4IBGA 3GLGE 3A46A 4F1IA 2Y20A 3NBXX 4LJ6A 3GPPA 3JAMS 1HJPA 1Z5AA 4AKIA 4ITQA 4KHPM 2UXDM 3FUTA 4B3RM 3AL0C 2JY7A 3AV0A 1GVNA 2DAIA 1HT1E 1OAOC 2BWEA 4LJ7A 5IT9S 3DA1A 2C98A 4NXNM 4AKGA 5EXXA 1JB0F 3VLFB 4JI2M 3FUUA 1QZEA 1N77A 3KVWA 2WSCF 1OKSA 5EP1A 1GL7A 4IBJA 3W67A 1D0KA 3LQQA 4B7HA 3RGSA 3KSJA 2ZAMA 5FTMA 2J7NA 1NV9A 3GPYA 1R2YA 2F5PA 1OTRA 4DUZM 1E9RA 2APLA 1IN8A 5E6JA 1XNQM 4LGYA 1L2DA 4L6V6 3J7BA 4LF8M 3D8BA 4G3OA 1WR1B 2NQ8C 3SARA 3CTWB 3FRIA 2LVNC 1W5SA 1G4AE 3WHKA 4WURA 1DO2A 1OJLA 4GHLA 4NSRA 1SXJC 1XXHE 2L7IA 4AG6A 4DR2M 1L1TA 2UUAM 2LTUA 2QZ4A 1Z59A 1MJGM 4GIPA 5KPZA 1QQWA 2H1RA 3U6EA 4BB9A 4KO8A 4YHHM 2DWMA 3R8FA 3H4MA 4JI6M 2YNMD 4M0DA 2RKOA 2K6BA 4DR5M 2R18A 4DV4M 2K47A 2RRUA 1CUKA 3CF0A 4LRTA 5F3WA 2Y0QA 2BWBA 3SAWA 1IQPA 1Y8GA 2KNZA 3GLHE 5EP2A 4PDGA 1G3IA 1NHWC 3RFWA 2BJWA 4FD2A 4A3VB 4CGYB 2A5YB 2JUJA 3PNYA 5IREB 1E94E 1Z6TA 5EJCA 4MGKE 3U6OA 4ZPXA 4DR6M 3D8LA 2I7PA 2CWBA 3TWLA 2YFQA 3GPUA 2KA6B 4LJAA 3TQSA 2DWNA 2HKJA 5DNYA 1OFIA 2EKKA 3I51A 2UU9M 3IG5A 2G5GX 4LJ8A 3SMPA 4DV5M 3HY5A 2RGHA 4IBBA 3K2LA 2C99A 1FNNA 2N35A 4QNMA 4LZZA 2L4EA 4KT0F 4HL4A 3GRRA 2KNVA 3HJSA 3CGWA 3IG8A 2Z8YM 1TDHA 5KPRA 1G8PA 4DR1M 3U61B 2WSFF 3U61A 1WJ7A 4FWHA 2WSEF 3J80S 4REZA 3SATA 2ZAOA 3A42A 1R4GA 4LFAM 3I04M 3FTDA 3HX3A 4X64M 4AG5A 2XFTA 2MR9A 1QYRA 4NOOB 1LTMA 4MGYE 4M9XA 1GO5A 2XF3A 4Y28F 5JI3E 1YSYA 4II7A 1XXHB 2XEPA 3M0EA 3LCUA 4M9ZA 4MM3B 1IBLM 1PM5A 3C3DA 3HJ8A 1YUBA 3K92A 2MROB 1BVSA 1J5EM 2WZJA 3TE6A 2KXEA 2Z7JA 3HHZA 4B3SM 4LG2A 3DZDA 1A5TA 2LVAA 2R44A 2L09A 2Z4RA 5ITQA 1K82A 3MMPA 2QNJA 4RF1A 3NWLA 2EO2A 2L7HA 1DGHB 1P3QQ 1IM2A 2DZLA 4LF4M 4Z6YA 2UUBM 1PJTA 4GMQA 4FVMA 2OOBA 1GL6A 2ZTDA 3K8ZA 2XSZA 2V6ZM 3TWMA 1G59A 3L29A 1L2BA 2DI0A 4LZJA 2EUCA 2JA2A 3J81S 3GLFE 2OO9A 4GKJM 3HKPA 2CV1A 5C1BA 3F92A 4MGIE 3SMSA 5BR8M 2JXNA 1TR8A 3HHWA 1K3WA 3JR5A 2VQEM 3TWKA 4IBIA 3SHFA 3KSXA 4UN2B 2DVWB 3B7ZA 3VK8A 3GLIB 3GLIA 1IY1A 3SAUA 1IN4A 2VIIA 4L4UA 2X49A 2DKLA 3C9PA 4GC9A 3H4JA 4I81A 3RE8A 4OX9M 3KP0E 4OVZB 1UM8A 4OVZA 1QAMA 3KS4A 1F4IA 3LVVA 3KOXE 3SBJA 1QUSA 2P5TA 3HWSA 3TL4X 2CP8A 4JXJA 3QWLA 1SXJB 2DAMA 2QP9X 3AOGA 4NL4H 1SXJA 5ITXA 4GEWA 3PFIA 1L8QA 4LY6A 4B08A 3GRVA 2JP7A 4IBFA 5L8RF 4CIZA 3JR4A 3U6QA 5A2QS 3GRUA 1E9SA 3FTCA 4JN6A 1I94M 1NVMA 5ITTA 2KHHA 1TH4A 1V33A 2C96A 2JWSA 5FTNA 1Q02A 5KPTA 3DOAA 3SHGB 1TGUA 2BJVA 2J7OA 2QPAA 1RU3A 1NJFA 2O25A 1QANA 1R2ZA 1ORYB 4JI1M 2DAKA 3K1JA 3EIHA 2BNKA 1J7KA 1QZMA 1NV8A 2R65A 3I01M 5ITRA 1N75A 3U60B 1ZQ9A 2F4VM 3IHPA 2J5YA 3FE3A 1TH2A 4R7GA 1N32M 4D81A 4QHTA 5E26A 1NSFA 1C7YA 3T1YM 1IXRC 4XK8F 1OQYA 2CEAA 4IBDA 1AIPC 1SG9A 2I7NA 2JZ0A 3K9PA 1V92A 1OIPA 2KZSA 2V1CA 4GH9A 3KXEC 3VKHA 2O5RA 1NHGC 1OAIA 5EXPA 3T1HM 2FS1A 2FE8A 4IJFA 4MH0E 1GJSA 2UXBM 1D2NA 3UJNA 4JI4M 2RGOA 3ZC7B 3BXWA 2XSZD 3FTEA 2FOIC 2O01F 1VDDA 1X37A 4NXMM 2JZ1A 4D80A 3GLGB 1DGFA 3LW5F 1DO0A 3GLGA 2G3QA 4CHTB 3B74A 3FUWA 2JY6B 3B7NA 3HJQA 5ITUA 1VEGA 3HHYA 3U6MA 1NNJA 1PGYA 4XGIA 2R46A 1VEKA 2LVQD 4LGMA 1N36M 2CHQA 2ZANA 1VQ1A 7CATA 2Y21A 1GKIA 2KW0A 3C58A 2DAGA 2F5OA 3FTFA 3HU3A 1HNZM 2H5XA 3UK6A 4DV1M 3SASA 4R71A 3CF2A 3SYKA 1IXSB 1Z5BA 4DV0M 1Q3CA 4X66M 3L25A 2L6OA 5ITYA 4IBKA 2UXCM 1XC8A 3AOEC 1LV7A 3VFDA 5LMUM 1DGBA 2GNOA 3E46A 1DV0A 1PJQA 2DNAA 1SXJD 4CJ6A 4OU7A 3NBIA 2HAKA 2FFJA 3GQ5A 1WGNA 2QHOB 1ZMUA 1JR3A 1UFZA 2CRUA 2R0IA 4MB7A 3GQ4A 4LF9M 1D0LA 1QVRA 1ZAEA 3HGIA 4L78A 4DR4M 2M5ZA 1EE8A 3KOWE 4Z8XA 5FSWA 2AHMA 2LNHC 2QCUA 2VDBB 3GPXA 5EXTA 4TUWA 3W0LB 4LJ5A 3FRHA 1R5LA 2UUCM 3U5ZB 1D0MA 1XXHA 2FNAA 1S3SA 4FCTA 4HLQA 3HHXA 1KFVA 2D7HA 5ITXE 3AFHA 2DZNB 2KZUA 2R4EA 3E9SA 4IIWA 1C1KA 3Q8GA 4GITA 3U6SA 1XNRM 3KS8A 5DYIA 2G8LA 5IZ7D 1IN6A 2L4FA 2QBYB 2QBYA 3FYDA 1N33M 5BPVA 2CUZA 1DGHA 2R62A 3PXGA 3AKZA 3KP1E 4DUYM 4FWDA 2X4AA 3LVWA 3Q8XA 2DXIA 4B7GA 2Z4SA 4FCVA 5EP4A 1MX0A 2HL7A 2K9DA 2C9OA 3GLHB 3GRYA 3LQRA 4HEOA 3GLHA 4JI0M 2FH0A 4PD2A 5H37D 3THGA 2QENA 4JI5M 1Z5CA 4LRSA 4AKHA 4GHAA 3PNVA 4L16A 4LJ4A 3T6PA 2XZFA 3I4VA 4BBAA 3VKGA 2DHRA 3T15A 2OPFA 3HZJA 1L2CA 4QOZC 2LVOC 1N78A 1TTEA 1L1ZA 3UZUA 1Q3BA 1YE9A 1ZV1A 2K0BX 5EQTA 4JYAM 3K9OA 3U6PA 3KOZE 2R6FA 1T6OA 3E21A 3L27A 2KNAA 4P16A 5IWAM 2LBCA 4DV3M 4P17A 4G4RA 3GO8A 2DWLA 2LXEA 3RGPA 1XMQM 2D7EA 1XWIA 2QSFX 2LVPC 4I8OA 1TF0B 1HR0M 1HQCA 3PVSA 3QAUA 5FLXS 1AUAA 4MGZE 4WP2A 3FYCA 4LF7M 4NRWA 3IECA 3MJ5A 4DR3M 1HNXM 2MJ5B 2QQ8A 1XHBA 1YLAA 1XB2B 4G6ZA 3J7AS 2EA0A 1G41A 2DWZB 3L28A 4WW0A 2XH9A 1JR3D 1Q39A 2OOAA 3AJIB 1NY5A 5EP3A 5FTJA 2XZUA 1IBKM 1NY6A 3E4RA 4JI7M 3B89A 1HNWM 2HCBA 1NJGA 2ZM6M 2V1UA 2D7GA 2LHCA 3T38A 3U60A 1FJGM 3BBZA 1WGLA 2DZOB 2LWXA 2VF7A 4D82A 4G4QA 2LH0A 2ZBKB 4ANRA 4L8RC 2DENA 2EKFA 1QDTA 3BOSA 4L15A 3KDSE 4I5SA 2R4JA 4LF5M 1V34A 4M0WA 3ZCBB 1IBMM 1JR3E 4QOSA 1TH3A 4RNAA 3FUVA 2Q2EB 3M7GA 3LMMA 2C5RA 1GJTA 2M60A 1EFUB 3GLFB 3SAVA 3GLFA 3KFUG 4PDIA 2F5SA 3KOYE 5KQ8A 1IY2A 3A98B 4LCBA 2E5LM 1HT2E 1DGGA 4AW4A 3W0FA 3I4YA 3SFZA 2DHYA 3AOEA 1OFHA 5FTKA 2X8AA 3LCVB 3SYLA 3UGJA 3L26A 2XGNA 4W5WA 1MN3A 1JQJC 2B3TA 2KRUA 3L2AA 4G4NA 4DV6M 4DV2M 1J09A 1IN7A 4NC6A 4X62M 1EIJA 4FWGA 4X65M 4RKUF 4DBGB 1HQYE 2JY8A 3HU1A 3J2PB 2HHHM 2XLJA 1GABA 5LMNM 2C9CA 4JI8M 2KEBA 3ZH9B 3QYBA 4XBOA 1GLNA 2VF8A 4FCWA 4LFBM 2F5NA 3W68A 1IXSA 3C3EA 3FUXA 5GKNA 4B3MM 1PRBA 4QNRA 1VDLA 4YY3M 2ERCA 5DYGA 4S12A 3MHVC 4BLCA 4LF6M 1QUTA 5EXSA 4GKKM 3GLIE 1PJIA 2MGWA 1IFYA 3B9PA 3U6CA 2CFOA 5DFLA 2LHGA 3HU2A 2JY5A 3R9XB 1NO1A 4F2LA 3B7QA 3M6AA 2VQFM 2EJSA 4JV5M 3UMMA 2KRKA 2GQFA 3EIEA 3VDPA 4GC5A 1MU5A 1WHCA 4NRVA 2KDLA 3VDUA 2CV2A 2CHGA 3U5ZA 1IXZA 2JNHA 4PT5A 5KO3A 1SXJE 4GRIA 4NSOB 1IN5A 4CISA 2HWJA 4LJ9A 1TDZA 1QDRA 3CF6E 1H6UA 4IJEA 1XMOM 1N34M 4DV7M 4DR7M 8CATA 1T3TA 4AI6A 3U6DA 4PCZA 3DFZA 5FTLA 4FW9A 3KW6A 4KODA 3GP1A 2ZTCA 4EIWA 1OIZA 1NNUC 2L2DA 4JI3M 2R45A 3QYEA 2OQ4A 2Z3XA 2YR0A 4Q7JA 1QAOA 1VEJA 5JI2E 1G71A 3ILKA 5C18A 2CHVA 5KQDA 3MK6A 1PJJA 2Y0TA 4MGHA 4QHSA 1K3XA 1QAQA 2DAEA 2CV0A 4LFCM 4AZFA 1ZMVA 3A45A 4R3DA 1PJSA 4RF0A 1IY0A 1I4WA 4M9SA 4AQYM 4OW0A
chains in the Genus database with same CATH topology
1WIVA 3B89A 1WJ7A 2JZ1A 1DO0A 1R4GA 1VG5A 2G3QA 3BBZA 1WGLA 2JY6B 2MR9A 1VEGA 1KYIA 1GO5A 1PGYA 1T43A 2DENA 2EKFA 1VEKA 1ZMWA 2LVQD 1VQ1A 3LCUA 2DAGA 1JR3E 2MROB 1BVSA 3GLGE 2H5XA 4F1IA 2WZJA 4R71A 1HJPA 1A5TA 1EFUB 2LVAA 3MMPA 2QNJA 2JY7A 1HT2E 2DAIA 3E46A 1DV0A 1HT1E 1IM2A 1P3QQ 2BWEA 2DNAA 2DZLA 2DHYA 2HAKA 1WGNA 2QHOB 1ZMUA 2OOBA 1UFZA 2R0IA 2ZTDA 3LCVB 1QZEA 2DI0A 3GLFE 1MN3A 1OKSA 2B3TA 2OO9A 3F92A 1NV9A 1OTRA 3FRHA 1TR8A 4DBGB 1HQYE 2JY8A 4UN2B 4G3OA 1WR1B 3FRIA 2LVNC 2DKLA 1IXSA 3H4JA 2L4FA 1G4AE 1VDLA 1DO2A 1XXHE 1F4IA 2LTUA 2CP8A 3GLIE 2DAMA 2MGWA 1IFYA 4GEWA 4HEOA 2K9DA 5DFLA 2JP7A 2JY5A 4F2LA 2EJSA 2RRUA 1CUKA 2KHHA 1WHCA 3T6PA 1Q02A 2JNHA 2BWBA 2LVOC 1TTEA 1Y8GA 2KNZA 2O25A 1ZV1A 2K0BX 3GLHE 2DAKA 2HWJA 1G3IA 3K9OA 2JUJA 1NV8A 1T6OA 3E21A 2KNAA 3IHPA 1E94E 2LBCA 3FE3A 2CWBA 2ZTCA 1C7YA 2QSFX 2L2DA 2EKKA 1OQYA 2LVPC 1AIPC 1SG9A 2JZ0A 3K9PA 1V92A 4WP2A 4Q7JA 1VEJA 5JI2E 3IECA 1OAIA 2MJ5B 2L4EA 1YLAA 1XB2B 2KNVA 2DAEA 1G41A 1ZMVA 2OOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIV A;  3B89 A;  1WJ7 A;  2JZ1 A;  1DO0 A;  1R4G A;  1VG5 A;  2G3Q A;  3BBZ A;  1WGL A;  2JY6 B;  2MR9 A;  1VEG A;  1KYI A;  1GO5 A;  1PGY A;  1T43 A;  2DEN A;  2EKF A;  1VEK A;  1ZMW A;  2LVQ D;  1VQ1 A;  3LCU A;  2DAG A;  1JR3 E;  2MRO B;  1BVS A;  3GLG E;  2H5X A;  4F1I A;  2WZJ A;  4R71 A;  1HJP A;  1A5T A;  1EFU B;  2LVA A;  3MMP A;  2QNJ A;  2JY7 A;  1HT2 E;  2DAI A;  3E46 A;  1DV0 A;  1HT1 E;  1IM2 A;  1P3Q Q;  2BWE A;  2DNA A;  2DZL A;  2DHY A;  2HAK A;  1WGN A;  2QHO B;  1ZMU A;  2OOB A;  1UFZ A;  2R0I A;  2ZTD A;  3LCV B;  1QZE A;  2DI0 A;  3GLF E;  1MN3 A;  1OKS A;  2B3T A;  2OO9 A;  3F92 A;  1NV9 A;  1OTR A;  3FRH A;  1TR8 A;  4DBG B;  1HQY E;  2JY8 A;  4UN2 B;  4G3O A;  1WR1 B;  3FRI A;  2LVN C;  2DKL A;  1IXS A;  3H4J A;  2L4F A;  1G4A E;  1VDL A;  1DO2 A;  1XXH E;  1F4I A;  2LTU A;  2CP8 A;  3GLI E;  2DAM A;  2MGW A;  1IFY A;  4GEW A;  4HEO A;  2K9D A;  5DFL A;  2JP7 A;  2JY5 A;  4F2L A;  2EJS A;  2RRU A;  1CUK A;  2KHH A;  1WHC A;  3T6P A;  1Q02 A;  2JNH A;  2BWB A;  2LVO C;  1TTE A;  1Y8G A;  2KNZ A;  2O25 A;  1ZV1 A;  2K0B X;  3GLH E;  2DAK A;  2HWJ A;  1G3I A;  3K9O A;  2JUJ A;  1NV8 A;  1T6O A;  3E21 A;  2KNA A;  3IHP A;  1E94 E;  2LBC A;  3FE3 A;  2CWB A;  2ZTC A;  1C7Y A;  2QSF X;  2L2D A;  2EKK A;  1OQY A;  2LVP C;  1AIP C;  1SG9 A;  2JZ0 A;  3K9P A;  1V92 A;  4WP2 A;  4Q7J A;  1VEJ A;  5JI2 E;  3IEC A;  1OAI A;  2MJ5 B;  2L4E A;  1YLA A;  1XB2 B;  2KNV A;  2DAE A;  1G41 A;  1ZMV A;  2OOA A; 
#chains in the Genus database with same CATH topology
 1WIV A;  1R7R A;  1WXQ A;  3ZQJ A;  4B7F A;  4IBE A;  3VK7 A;  2XFS A;  3FD9 A;  1W5T A;  1VG5 A;  2MH8 A;  4G4O A;  2YQZ A;  3U6L A;  1KYI A;  1R6B X;  3SC3 A;  2CE7 A;  3V76 A;  3WHL A;  3FKE A;  1T43 A;  3J27 B;  4IBC A;  1ZMW A;  4KLN A;  3OTO M;  4B3T M;  1KSF X;  3TPZ A;  2W82 A;  3GQ3 A;  2F5Q A;  4K0K M;  1E32 A;  4I4L A;  4IBG A;  3GLG E;  3A46 A;  4F1I A;  2Y20 A;  3NBX X;  4LJ6 A;  3GPP A;  3JAM S;  1HJP A;  1Z5A A;  4AKI A;  4ITQ A;  4KHP M;  2UXD M;  3FUT A;  4B3R M;  3AL0 C;  2JY7 A;  3AV0 A;  1GVN A;  2DAI A;  1HT1 E;  1OAO C;  2BWE A;  4LJ7 A;  5IT9 S;  3DA1 A;  2C98 A;  4NXN M;  4AKG A;  5EXX A;  1JB0 F;  3VLF B;  4JI2 M;  3FUU A;  1QZE A;  1N77 A;  3KVW A;  2WSC F;  1OKS A;  5EP1 A;  1GL7 A;  4IBJ A;  3W67 A;  1D0K A;  3LQQ A;  4B7H A;  3RGS A;  3KSJ A;  2ZAM A;  5FTM A;  2J7N A;  1NV9 A;  3GPY A;  1R2Y A;  2F5P A;  1OTR A;  4DUZ M;  1E9R A;  2APL A;  1IN8 A;  5E6J A;  1XNQ M;  4LGY A;  1L2D A;  4L6V 6;  3J7B A;  4LF8 M;  3D8B A;  4G3O A;  1WR1 B;  2NQ8 C;  3SAR A;  3CTW B;  3FRI A;  2LVN C;  1W5S A;  1G4A E;  3WHK A;  4WUR A;  1DO2 A;  1OJL A;  4GHL A;  4NSR A;  1SXJ C;  1XXH E;  2L7I A;  4AG6 A;  4DR2 M;  1L1T A;  2UUA M;  2LTU A;  2QZ4 A;  1Z59 A;  1MJG M;  4GIP A;  5KPZ A;  1QQW A;  2H1R A;  3U6E A;  4BB9 A;  4KO8 A;  4YHH M;  2DWM A;  3R8F A;  3H4M A;  4JI6 M;  2YNM D;  4M0D A;  2RKO A;  2K6B A;  4DR5 M;  2R18 A;  4DV4 M;  2K47 A;  2RRU A;  1CUK A;  3CF0 A;  4LRT A;  5F3W A;  2Y0Q A;  2BWB A;  3SAW A;  1IQP A;  1Y8G A;  2KNZ A;  3GLH E;  5EP2 A;  4PDG A;  1G3I A;  1NHW C;  3RFW A;  2BJW A;  4FD2 A;  4A3V B;  4CGY B;  2A5Y B;  2JUJ A;  3PNY A;  5IRE B;  1E94 E;  1Z6T A;  5EJC A;  4MGK E;  3U6O A;  4ZPX A;  4DR6 M;  3D8L A;  2I7P A;  2CWB A;  3TWL A;  2YFQ A;  3GPU A;  2KA6 B;  4LJA A;  3TQS A;  2DWN A;  2HKJ A;  5DNY A;  1OFI A;  2EKK A;  3I51 A;  2UU9 M;  3IG5 A;  2G5G X;  4LJ8 A;  3SMP A;  4DV5 M;  3HY5 A;  2RGH A;  4IBB A;  3K2L A;  2C99 A;  1FNN A;  2N35 A;  4QNM A;  4LZZ A;  2L4E A;  4KT0 F;  4HL4 A;  3GRR A;  2KNV A;  3HJS A;  3CGW A;  3IG8 A;  2Z8Y M;  1TDH A;  5KPR A;  1G8P A;  4DR1 M;  3U61 B;  2WSF F;  3U61 A;  1WJ7 A;  4FWH A;  2WSE F;  3J80 S;  4REZ A;  3SAT A;  2ZAO A;  3A42 A;  1R4G A;  4LFA M;  3I04 M;  3FTD A;  3HX3 A;  4X64 M;  4AG5 A;  2XFT A;  2MR9 A;  1QYR A;  4NOO B;  1LTM A;  4MGY E;  4M9X A;  1GO5 A;  2XF3 A;  4Y28 F;  5JI3 E;  1YSY A;  4II7 A;  1XXH B;  2XEP A;  3M0E A;  3LCU A;  4M9Z A;  4MM3 B;  1IBL M;  1PM5 A;  3C3D A;  3HJ8 A;  1YUB A;  3K92 A;  2MRO B;  1BVS A;  1J5E M;  2WZJ A;  3TE6 A;  2KXE A;  2Z7J A;  3HHZ A;  4B3S M;  4LG2 A;  3DZD A;  1A5T A;  2LVA A;  2R44 A;  2L09 A;  2Z4R A;  5ITQ A;  1K82 A;  3MMP A;  2QNJ A;  4RF1 A;  3NWL A;  2EO2 A;  2L7H A;  1DGH B;  1P3Q Q;  1IM2 A;  2DZL A;  4LF4 M;  4Z6Y A;  2UUB M;  1PJT A;  4GMQ A;  4FVM A;  2OOB A;  1GL6 A;  2ZTD A;  3K8Z A;  2XSZ A;  2V6Z M;  3TWM A;  1G59 A;  3L29 A;  1L2B A;  2DI0 A;  4LZJ A;  2EUC A;  2JA2 A;  3J81 S;  3GLF E;  2OO9 A;  4GKJ M;  3HKP A;  2CV1 A;  5C1B A;  3F92 A;  4MGI E;  3SMS A;  5BR8 M;  2JXN A;  1TR8 A;  3HHW A;  1K3W A;  3JR5 A;  2VQE M;  3TWK A;  4IBI A;  3SHF A;  3KSX A;  4UN2 B;  2DVW B;  3B7Z A;  3VK8 A;  3GLI B;  3GLI A;  1IY1 A;  3SAU A;  1IN4 A;  2VII A;  4L4U A;  2X49 A;  2DKL A;  3C9P A;  4GC9 A;  3H4J A;  4I81 A;  3RE8 A;  4OX9 M;  3KP0 E;  4OVZ B;  1UM8 A;  4OVZ A;  1QAM A;  3KS4 A;  1F4I A;  3LVV A;  3KOX E;  3SBJ A;  1QUS A;  2P5T A;  3HWS A;  3TL4 X;  2CP8 A;  4JXJ A;  3QWL A;  1SXJ B;  2DAM A;  2QP9 X;  3AOG A;  4NL4 H;  1SXJ A;  5ITX A;  4GEW A;  3PFI A;  1L8Q A;  4LY6 A;  4B08 A;  3GRV A;  2JP7 A;  4IBF A;  5L8R F;  4CIZ A;  3JR4 A;  3U6Q A;  5A2Q S;  3GRU A;  1E9S A;  3FTC A;  4JN6 A;  1I94 M;  1NVM A;  5ITT A;  2KHH A;  1TH4 A;  1V33 A;  2C96 A;  2JWS A;  5FTN A;  1Q02 A;  5KPT A;  3DOA A;  3SHG B;  1TGU A;  2BJV A;  2J7O A;  2QPA A;  1RU3 A;  1NJF A;  2O25 A;  1QAN A;  1R2Z A;  1ORY B;  4JI1 M;  2DAK A;  3K1J A;  3EIH A;  2BNK A;  1J7K A;  1QZM A;  1NV8 A;  2R65 A;  3I01 M;  5ITR A;  1N75 A;  3U60 B;  1ZQ9 A;  2F4V M;  3IHP A;  2J5Y A;  3FE3 A;  1TH2 A;  4R7G A;  1N32 M;  4D81 A;  4QHT A;  5E26 A;  1NSF A;  1C7Y A;  3T1Y M;  1IXR C;  4XK8 F;  1OQY A;  2CEA A;  4IBD A;  1AIP C;  1SG9 A;  2I7N A;  2JZ0 A;  3K9P A;  1V92 A;  1OIP A;  2KZS A;  2V1C A;  4GH9 A;  3KXE C;  3VKH A;  2O5R A;  1NHG C;  1OAI A;  5EXP A;  3T1H M;  2FS1 A;  2FE8 A;  4IJF A;  4MH0 E;  1GJS A;  2UXB M;  1D2N A;  3UJN A;  4JI4 M;  2RGO A;  3ZC7 B;  3BXW A;  2XSZ D;  3FTE A;  2FOI C;  2O01 F;  1VDD A;  1X37 A;  4NXM M;  2JZ1 A;  4D80 A;  3GLG B;  1DGF A;  3LW5 F;  1DO0 A;  3GLG A;  2G3Q A;  4CHT B;  3B74 A;  3FUW A;  2JY6 B;  3B7N A;  3HJQ A;  5ITU A;  1VEG A;  3HHY A;  3U6M A;  1NNJ A;  1PGY A;  4XGI A;  2R46 A;  1VEK A;  2LVQ D;  4LGM A;  1N36 M;  2CHQ A;  2ZAN A;  1VQ1 A;  7CAT A;  2Y21 A;  1GKI A;  2KW0 A;  3C58 A;  2DAG A;  2F5O A;  3FTF A;  3HU3 A;  1HNZ M;  2H5X A;  3UK6 A;  4DV1 M;  3SAS A;  4R71 A;  3CF2 A;  3SYK A;  1IXS B;  1Z5B A;  4DV0 M;  1Q3C A;  4X66 M;  3L25 A;  2L6O A;  5ITY A;  4IBK A;  2UXC M;  1XC8 A;  3AOE C;  1LV7 A;  3VFD A;  5LMU M;  1DGB A;  2GNO A;  3E46 A;  1DV0 A;  1PJQ A;  2DNA A;  1SXJ D;  4CJ6 A;  4OU7 A;  3NBI A;  2HAK A;  2FFJ A;  3GQ5 A;  1WGN A;  2QHO B;  1ZMU A;  1JR3 A;  1UFZ A;  2CRU A;  2R0I A;  4MB7 A;  3GQ4 A;  4LF9 M;  1D0L A;  1QVR A;  1ZAE A;  3HGI A;  4L78 A;  4DR4 M;  2M5Z A;  1EE8 A;  3KOW E;  4Z8X A;  5FSW A;  2AHM A;  2LNH C;  2QCU A;  2VDB B;  3GPX A;  5EXT A;  4TUW A;  3W0L B;  4LJ5 A;  3FRH A;  1R5L A;  2UUC M;  3U5Z B;  1D0M A;  1XXH A;  2FNA A;  1S3S A;  4FCT A;  4HLQ A;  3HHX A;  1KFV A;  2D7H A;  5ITX E;  3AFH A;  2DZN B;  2KZU A;  2R4E A;  3E9S A;  4IIW A;  1C1K A;  3Q8G A;  4GIT A;  3U6S A;  1XNR M;  3KS8 A;  5DYI A;  2G8L A;  5IZ7 D;  1IN6 A;  2L4F A;  2QBY B;  2QBY A;  3FYD A;  1N33 M;  5BPV A;  2CUZ A;  1DGH A;  2R62 A;  3PXG A;  3AKZ A;  3KP1 E;  4DUY M;  4FWD A;  2X4A A;  3LVW A;  3Q8X A;  2DXI A;  4B7G A;  2Z4S A;  4FCV A;  5EP4 A;  1MX0 A;  2HL7 A;  2K9D A;  2C9O A;  3GLH B;  3GRY A;  3LQR A;  4HEO A;  3GLH A;  4JI0 M;  2FH0 A;  4PD2 A;  5H37 D;  3THG A;  2QEN A;  4JI5 M;  1Z5C A;  4LRS A;  4AKH A;  4GHA A;  3PNV A;  4L16 A;  4LJ4 A;  3T6P A;  2XZF A;  3I4V A;  4BBA A;  3VKG A;  2DHR A;  3T15 A;  2OPF A;  3HZJ A;  1L2C A;  4QOZ C;  2LVO C;  1N78 A;  1TTE A;  1L1Z A;  3UZU A;  1Q3B A;  1YE9 A;  1ZV1 A;  2K0B X;  5EQT A;  4JYA M;  3K9O A;  3U6P A;  3KOZ E;  2R6F A;  1T6O A;  3E21 A;  3L27 A;  2KNA A;  4P16 A;  5IWA M;  2LBC A;  4DV3 M;  4P17 A;  4G4R A;  3GO8 A;  2DWL A;  2LXE A;  3RGP A;  1XMQ M;  2D7E A;  1XWI A;  2QSF X;  2LVP C;  4I8O A;  1TF0 B;  1HR0 M;  1HQC A;  3PVS A;  3QAU A;  5FLX S;  1AUA A;  4MGZ E;  4WP2 A;  3FYC A;  4LF7 M;  4NRW A;  3IEC A;  3MJ5 A;  4DR3 M;  1HNX M;  2MJ5 B;  2QQ8 A;  1XHB A;  1YLA A;  1XB2 B;  4G6Z A;  3J7A S;  2EA0 A;  1G41 A;  2DWZ B;  3L28 A;  4WW0 A;  2XH9 A;  1JR3 D;  1Q39 A;  2OOA A;  3AJI B;  1NY5 A;  5EP3 A;  5FTJ A;  2XZU A;  1IBK M;  1NY6 A;  3E4R A;  4JI7 M;  3B89 A;  1HNW M;  2HCB A;  1NJG A;  2ZM6 M;  2V1U A;  2D7G A;  2LHC A;  3T38 A;  3U60 A;  1FJG M;  3BBZ A;  1WGL A;  2DZO B;  2LWX A;  2VF7 A;  4D82 A;  4G4Q A;  2LH0 A;  2ZBK B;  4ANR A;  4L8R C;  2DEN A;  2EKF A;  1QDT A;  3BOS A;  4L15 A;  3KDS E;  4I5S A;  2R4J A;  4LF5 M;  1V34 A;  4M0W A;  3ZCB B;  1IBM M;  1JR3 E;  4QOS A;  1TH3 A;  4RNA A;  3FUV A;  2Q2E B;  3M7G A;  3LMM A;  2C5R A;  1GJT A;  2M60 A;  1EFU B;  3GLF B;  3SAV A;  3GLF A;  3KFU G;  4PDI A;  2F5S A;  3KOY E;  5KQ8 A;  1IY2 A;  3A98 B;  4LCB A;  2E5L M;  1HT2 E;  1DGG A;  4AW4 A;  3W0F A;  3I4Y A;  3SFZ A;  2DHY A;  3AOE A;  1OFH A;  5FTK A;  2X8A A;  3LCV B;  3SYL A;  3UGJ A;  3L26 A;  2XGN A;  4W5W A;  1MN3 A;  1JQJ C;  2B3T A;  2KRU A;  3L2A A;  4G4N A;  4DV6 M;  4DV2 M;  1J09 A;  1IN7 A;  4NC6 A;  4X62 M;  1EIJ A;  4FWG A;  4X65 M;  4RKU F;  4DBG B;  1HQY E;  2JY8 A;  3HU1 A;  3J2P B;  2HHH M;  2XLJ A;  1GAB A;  5LMN M;  2C9C A;  4JI8 M;  2KEB A;  3ZH9 B;  3QYB A;  4XBO A;  1GLN A;  2VF8 A;  4FCW A;  4LFB M;  2F5N A;  3W68 A;  1IXS A;  3C3E A;  3FUX A;  5GKN A;  4B3M M;  1PRB A;  4QNR A;  1VDL A;  4YY3 M;  2ERC A;  5DYG A;  4S12 A;  3MHV C;  4BLC A;  4LF6 M;  1QUT A;  5EXS A;  4GKK M;  3GLI E;  1PJI A;  2MGW A;  1IFY A;  3B9P A;  3U6C A;  2CFO A;  5DFL A;  2LHG A;  3HU2 A;  2JY5 A;  3R9X B;  1NO1 A;  4F2L A;  3B7Q A;  3M6A A;  2VQF M;  2EJS A;  4JV5 M;  3UMM A;  2KRK A;  2GQF A;  3EIE A;  3VDP A;  4GC5 A;  1MU5 A;  1WHC A;  4NRV A;  2KDL A;  3VDU A;  2CV2 A;  2CHG A;  3U5Z A;  1IXZ A;  2JNH A;  4PT5 A;  5KO3 A;  1SXJ E;  4GRI A;  4NSO B;  1IN5 A;  4CIS A;  2HWJ A;  4LJ9 A;  1TDZ A;  1QDR A;  3CF6 E;  1H6U A;  4IJE A;  1XMO M;  1N34 M;  4DV7 M;  4DR7 M;  8CAT A;  1T3T A;  4AI6 A;  3U6D A;  4PCZ A;  3DFZ A;  5FTL A;  4FW9 A;  3KW6 A;  4KOD A;  3GP1 A;  2ZTC A;  4EIW A;  1OIZ A;  1NNU C;  2L2D A;  4JI3 M;  2R45 A;  3QYE A;  2OQ4 A;  2Z3X A;  2YR0 A;  4Q7J A;  1QAO A;  1VEJ A;  5JI2 E;  1G71 A;  3ILK A;  5C18 A;  2CHV A;  5KQD A;  3MK6 A;  1PJJ A;  2Y0T A;  4MGH A;  4QHS A;  1K3X A;  1QAQ A;  2DAE A;  2CV0 A;  4LFC M;  4AZF A;  1ZMV A;  3A45 A;  4R3D A;  1PJS A;  4RF0 A;  1IY0 A;  1I4W A;  4M9S A;  4AQY M;  4OW0 A; 
#chains in the Genus database with same CATH homology
 1WIV A;  3B89 A;  1WJ7 A;  2JZ1 A;  1DO0 A;  1R4G A;  1VG5 A;  2G3Q A;  3BBZ A;  1WGL A;  2JY6 B;  2MR9 A;  1VEG A;  1KYI A;  1GO5 A;  1PGY A;  1T43 A;  2DEN A;  2EKF A;  1VEK A;  1ZMW A;  2LVQ D;  1VQ1 A;  3LCU A;  2DAG A;  1JR3 E;  2MRO B;  1BVS A;  3GLG E;  2H5X A;  4F1I A;  2WZJ A;  4R71 A;  1HJP A;  1A5T A;  1EFU B;  2LVA A;  3MMP A;  2QNJ A;  2JY7 A;  1HT2 E;  2DAI A;  3E46 A;  1DV0 A;  1HT1 E;  1IM2 A;  1P3Q Q;  2BWE A;  2DNA A;  2DZL A;  2DHY A;  2HAK A;  1WGN A;  2QHO B;  1ZMU A;  2OOB A;  1UFZ A;  2R0I A;  2ZTD A;  3LCV B;  1QZE A;  2DI0 A;  3GLF E;  1MN3 A;  1OKS A;  2B3T A;  2OO9 A;  3F92 A;  1NV9 A;  1OTR A;  3FRH A;  1TR8 A;  4DBG B;  1HQY E;  2JY8 A;  4UN2 B;  4G3O A;  1WR1 B;  3FRI A;  2LVN C;  2DKL A;  1IXS A;  3H4J A;  2L4F A;  1G4A E;  1VDL A;  1DO2 A;  1XXH E;  1F4I A;  2LTU A;  2CP8 A;  3GLI E;  2DAM A;  2MGW A;  1IFY A;  4GEW A;  4HEO A;  2K9D A;  5DFL A;  2JP7 A;  2JY5 A;  4F2L A;  2EJS A;  2RRU A;  1CUK A;  2KHH A;  1WHC A;  3T6P A;  1Q02 A;  2JNH A;  2BWB A;  2LVO C;  1TTE A;  1Y8G A;  2KNZ A;  2O25 A;  1ZV1 A;  2K0B X;  3GLH E;  2DAK A;  2HWJ A;  1G3I A;  3K9O A;  2JUJ A;  1NV8 A;  1T6O A;  3E21 A;  2KNA A;  3IHP A;  1E94 E;  2LBC A;  3FE3 A;  2CWB A;  2ZTC A;  1C7Y A;  2QSF X;  2L2D A;  2EKK A;  1OQY A;  2LVP C;  1AIP C;  1SG9 A;  2JZ0 A;  3K9P A;  1V92 A;  4WP2 A;  4Q7J A;  1VEJ A;  5JI2 E;  3IEC A;  1OAI A;  2MJ5 B;  2L4E A;  1YLA A;  1XB2 B;  2KNV A;  2DAE A;  1G41 A;  1ZMV A;  2OOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...