1ZV1A

Crystal structure of the dimerization domain of doublesex protein from d. melanogaster
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
b'QDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Doublesex protein
molecule tags Protein binding
source organism Drosophila melanogaster
publication title Dimerization of doublesex is mediated by a cryptic ubiquitin-associated domain fold: implications for sex-specific gene regulation
pubmed doi rcsb
total genus 24
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zv1A00
3GLHE 2LVAA 2K0BX 1Y8GA 2JP7A 1TTEA 2KNVA 2JNHA 5DFLA 1HQYE 2ZTDA 1OQYA 3H4JA 2DAKA 2HWJA 1WIVA 4R71A 1AIPC 3LCUA 1PGYA 2LVQD 3IECA 1HJPA 1HT2E 2L4EA 1NV9A 2KNAA 2WZJA 1DO2A 1VEJA 2DKLA 1IM2A 1C7YA 2DENA 2ZTCA 3IHPA 3K9OA 1G41A 5JI2E 2EKKA 4Q7JA 3E21A 2O25A 3GLFE 4F2LA 2H5XA 1OKSA 3FRHA 1ZV1A 3F92A 2JY8A 2QHOB 1G4AE 2DNAA 4HEOA 1IXSA 2G3QA 1SG9A 2JY6B 2OOAA 1VG5A 2DAGA 2B3TA 2L4FA 2LVPC 1WR1B 2CP8A 1VEGA 2DHYA 1KYIA 1T6OA 4UN2B 1WGLA 4GEWA 3FRIA 2DAEA 3E46A 3BBZA 1BVSA 2JZ0A 3LCVB 1XXHE 2EKFA 2KHHA 2LTUA 1E94E 1ZMVA 1WHCA 2BWEA 1Q02A 3FE3A 4DBGB 2JZ1A 1GO5A 2LVNC 1ZMUA 2JUJA 3MMPA 1R4GA 1V92A 2KNZA 1A5TA 1UFZA 1MN3A 3GLGE 1NV8A 2DAIA 2QNJA 2CWBA 1YLAA 2LVOC 4WP2A 1QZEA 2LBCA 1IFYA 1ZMWA 2R0IA 4G3OA 2OO9A 1P3QQ 2JY7A 1HT1E 2JY5A 1OAIA 1OTRA 2DAMA 1VDLA 2DZLA 2HAKA 1VEKA 1DV0A 1G3IA 2BWBA 1TR8A 1DO0A 2MJ5B 2L2DA 1JR3E 1VQ1A 1WGNA 1XB2B 2K9DA 2RRUA 3GLIE 1WJ7A 1F4IA 2DI0A 2MGWA 2MROB 4F1IA 3K9PA 1CUKA 1EFUB 2QSFX 2EJSA 2MR9A 2OOBA 3T6PA 3B89A 1T43A
chains in the Genus database with same CATH superfamily
4TUWA 2QZ4A 3CTWB 3GQ5A 1X37A 1N33M 2R4EA 5BR8M 3L2AA 1N36M 2CEAA 3GLIA 4FD2A 1IQPA 2V6ZM 3HWSA 3H4JA 2R18A 3MHVC 4GITA 2HWJA 3RE8A 1HQCA 3SYKA 1K3WA 2Z7JA 3JAMS 1N75A 1QUSA 2QP9X 3FYCA 3HU3A 4S12A 4I81A 2ZANA 3PFIA 5KQDA 4B7GA 2GNOA 3FTFA 4FCWA 2DKLA 3UMMA 3FUXA 4AZFA 5GKNA 2ZTCA 1T3TA 1G41A 5IT9S 2C96A 4LY6A 4G4RA 3SHGB 4Q7JA 5LMUM 3TWMA 1OKSA 2R45A 4M0DA 1N34M 2Q2EB 3H4MA 4DV6M 2QHOB 1G4AE 4YHHM 3IG8A 2EA0A 1PJSA 1GL6A 1SG9A 1VG5A 3SARA 2XFSA 3GRYA 1N77A 4YY3M 2YR0A 2QPAA 3J7AS 1VDDA 4HLQA 1OIPA 4QOSA 4X62M 3ILKA 3LW5F 4X65M 1HNWM 3VDUA 1N32M 1TH4A 1D0KA 4IBBA 4LGYA 2LXEA 1NVMA 3HY5A 4DV0M 1Z5CA 2E5LM 3MJ5A 2CV0A 2J7OA 3J80S 3K8ZA 4IJEA 2DAEA 4XK8F 2A5YB 3LMMA 1OFHA 1I4WA 2Y0QA 4DR2M 1G8PA 1SXJB 1L8QA 3KXEC 2LTUA 4L15A 1R5LA 2C99A 2CE7A 2RKOA 3KS8A 4DBGB 2G5GX 2JZ1A 5FTMA 4GHAA 3CGWA 1GO5A 4MGHA 4CGYB 4GRIA 4LRSA 1WXQA 3WHLA 5IWAM 3NBXX 3SMPA 3RGSA 1V92A 3SFZA 2DWLA 2V1CA 1MU5A 1A5TA 1UFZA 1MN3A 3D8LA 2DWZB 3I51A 3GLGE 4NL4H 2UXDM 4LJ9A 4P17A 2LNHC 5ITTA 3JR5A 2QNJA 2VIIA 3SMSA 1XMQM 2UUCM 5ITXA 1IBKM 3TE6A 4P16A 2Z4SA 2CHVA 4CHTB 4PD2A 2R6FA 3B7ZA 4MGZE 2FFJA 1ZMWA 1G71A 2KA6B 3FYDA 1P3QQ 1SXJA 3M0EA 3K92A 3SAWA 2CRUA 2O01F 1HT1E 2D7GA 4RKUF 3VK7A 2BJWA 1QQWA 1J5EM 2HAKA 3PNYA 2QCUA 4LF5M 2XLJA 1DV0A 2W82A 4JN6A 4IBKA 1DGBA 3FD9A 3W68A 4QNMA 1GL7A 2K47A 1TR8A 1DO0A 2C9CA 2CFOA 4OVZA 4R3DA 3T1YM 5FTKA 1JR3E 1VQ1A 3HJQA 1XB2B 1R6BX 5DNYA 3QYBA 4I4LA 4DUZM 4AI6A 1MX0A 1PRBA 4DV2M 4DV3M 2I7NA 3AV0A 2X8AA 4K0KM 1QDTA 1XC8A 4JI0M 1CUKA 4JI5M 3LVWA 3HX3A 2QSFX 4GHLA 3TWLA 3T6PA 2C98A 1QZMA 1XXHB 3B89A 3NWLA 4L16A 2F5OA 5ITRA 1Z59A 2LVAA 1Y8GA 5FSWA 4LF4M 1TTEA 1V34A 4FW9A 5F3WA 4Z6YA 1HQYE 1D0MA 1TGUA 2F5PA 1GJTA 1JQJC 4XBOA 3GPYA 2RGOA 4NRWA 3C3DA 2CV2A 2DAKA 4G4OA 4R71A 3OTOM 4MGYE 4IJFA 3KDSE 1OIZA 3LCUA 4B7HA 3KW6A 3CF6E 2FOIC 4MGKE 3HJ8A 4HL4A 5FLXS 2F5QA 2AHMA 3PVSA 4MM3B 3M6AA 1DO2A 3D8BA 4AQYM 1VEJA 2XZUA 1RU3A 4GH9A 2R46A 3QWLA 2K6BA 3LQRA 4XGIA 1OAOC 1FNNA 1GVNA 3ZH9B 3U6OA 4B3TM 5JI3E 3U61A 3LQQA 2EKKA 2XZFA 5KPTA 3W0FA 5EXSA 2HCBA 1JB0F 3E21A 3GLGB 4JXJA 4D82A 4F2LA 1GABA 1ZV1A 3J2PB 1D0LA 3VKHA 4AG5A 3GLGA 4M0WA 4WW0A 2HHHM 4GMQA 1IXSA 2G3QA 4FCTA 4G6ZA 4IBJA 2DAGA 4RF0A 1QAQA 2L4FA 1Z6TA 2V1UA 5IZ7D 4G4QA 7CATA 2VDBB 3SBJA 3KOWE 1C1KA 2DHYA 2APLA 3L29A 3GP1A 4BLCA 3KSXA 3W67A 3FRIA 1W5TA 2H1RA 2JZ0A 3AKZA 1E9RA 5H37D 3NBIA 4LZZA 4AKHA 1E94E 4IBGA 1IY2A 1WHCA 2BWEA 3KOYE 4NRVA 1Q02A 2ZM6M 4GKKM 2Y20A 2QBYB 4D81A 3KOXE 3VDPA 1N78A 1PJJA 1JR3D 3E9SA 2JUJA 4A3VB 4X66M 3R8FA 2KW0A 3RFWA 2QQ8A 3AJIB 3C3EA 2C5RA 3GPXA 1W5SA 2L6OA 4QHSA 4GC5A 2CWBA 4QNRA 4JI7M 2YQZA 2WSEF 2LVOC 4IBFA 3GPPA 3GPUA 3HHZA 1IXZA 2D7HA 4DV7M 5IREB 3UK6A 3TWKA 2R65A 1ZAEA 5ITXE 2Z4RA 2LBCA 1DGFA 4PT5A 2M5ZA 4NXMM 1IFYA 3DA1A 2HKJA 1DGGA 3B7NA 2JY7A 3U6LA 4CIZA 2JXNA 1Q3CA 2JY5A 1OTRA 2DAMA 1J09A 1NHWC 2R62A 1QAMA 1VDLA 1ZQ9A 2WSFF 1XMOM 4L6V6 3KVWA 1G3IA 4QHTA 3WHKA 1NY5A 2WSCF 1PJIA 1XXHA 1HNXM 4KHPM 2EO2A 3FUTA 2UU9M 3V76A 1DGHB 2LHGA 4DR7M 2L2DA 2CHQA 3A42A 3J27B 3T15A 3EIEA 4DUYM 2FE8A 4PCZA 2DI0A 2MGWA 3DFZA 4G4NA 4LZJA 4AW4A 4FWHA 4F1IA 1TDHA 3KS4A 4IBCA 3VFDA 4B08A 2P5TA 4NSRA 2LHCA 2OOBA 1D2NA 4I5SA 2KDLA 1T43A 1IN6A 4M9SA 3CF0A 5A2QS 2K0BX 2JP7A 2KNVA 2ZAOA 4DR1M 3FTCA 2JNHA 4JI3M 2XF3A 4WURA 1TF0B 2GQFA 5DFLA 4CISA 4FWGA 2RGHA 3K2LA 3SAVA 4DR3M 2DZNB 2UXBM 1MJGM 1OQYA 3BXWA 4GIPA 3SC3A 2CHGA 1L2CA 3I4YA 1NSFA 4RF1A 2DWMA 2VQEM 1AIPC 3HJSA 3GRVA 2YFQA 3L26A 1HJPA 2XSZA 3GRRA 3GQ4A 1NV9A 4OW0A 2KNAA 3QAUA 1K3XA 3FTDA 3AFHA 2JWSA 2XEPA 1IXSB 1C7YA 2BNKA 3J7BA 4NC6A 3IHPA 3K9OA 1Z5BA 4LJ8A 4DV1M 2Y0TA 3U6MA 4LJ4A 5EXPA 3JR4A 1L2DA 1KSFX 4LF8M 2I7PA 4KT0F 3GLFE 4NSOB 5EP2A 2Y21A 1G59A 5L8RF 1PM5A 3B7QA 2FS1A 2HL7A 3CF2A 4FVMA 4D80A 4LFCM 4GKJM 4HEOA 1QAOA 3HZJA 3GLHA 4DR6M 1QYRA 2JY6B 1OJLA 3SYLA 2B3TA 2LWXA 8CATA 4AG6A 3KP1E 2LVPC 1WR1B 2OQ4A 2CP8A 4LJ5A 1JR3A 2J5YA 1VEGA 4LG2A 3RGPA 3E4RA 1ORYB 1T6OA 4UN2B 4OVZB 1EIJA 5E26A 1WGLA 4MH0E 1E32A 4GEWA 4DV5M 3E46A 3LCVB 4JI8M 3C9PA 2F5SA 3TL4X 5KPZA 1R7RA 1XXHE 2EKFA 5C1BA 3ZCBB 3U6EA 4EIWA 4L78A 1K82A 2ERCA 1IN8A 3FE3A 1V33A 3HU1A 1H6UA 3KSJA 2XSZD 2KZSA 4MGIE 3R9XB 1TDZA 4ITQA 1QDRA 3ZQJA 2EUCA 1R4GA 2KZUA 3VKGA 5KO3A 1GJSA 3UJNA 5ITUA 4DR5M 1QUTA 1SXJE 1SXJC 1NV8A 1XWIA 2YNMD 4LJ6A 3U6PA 2KEBA 4PDIA 1YLAA 1Q39A 2X49A 4NXNM 4OX9M 2N35A 5DYGA 4AKGA 3U6SA 2ZBKB 1XNRM 3U60B 2DVWB 3KP0E 1QZEA 4DR4M 2R0IA 3GO8A 3KOZE 4G3OA 2OO9A 1Q3BA 3A45A 4JYAM 3GLIB 3VLFB 2DXIA 4BB9A 4CJ6A 1OAIA 1L2BA 3KFUG 1VEKA 3AOGA 2BWBA 3AOEA 4FWDA 1L1ZA 3L25A 3FUUA 5EXXA 3FTEA 2MJ5B 3A46A 4BBAA 1WGNA 4JI6M 2O5RA 2RRUA 3GLIE 1WJ7A 3SHFA 4I8OA 2MROB 3HHYA 2G8LA 2UXCM 1IY1A 5EP4A 2M60A 1EFUB 3I04M 2EJSA 2MR9A 1Z5AA 2FNAA 3Q8XA 4LF6M 1FJGM 3SASA 1TH3A 2ZAMA 5EP1A 3C58A 2KXEA 3GLHE 4Y28F 4LFAM 2DHRA 5FTNA 3GLFB 3U61B 1XNQM 1PJTA 5BPVA 2ZTDA 2J7NA 1NJGA 2CUZA 3FUVA 4MB7A 1GLNA 1WIVA 3B9PA 3VK8A 1PGYA 1UM8A 2LVQD 2NQ8C 1LV7A 3IECA 2L7HA 1HT2E 4DV4M 3U6CA 2L4EA 2DWNA 3PXGA 4PDGA 2VF8A 2WZJA 4LF7M 1R2YA 1IM2A 1YUBA 4LRTA 4L4UA 1I94M 3MK6A 1HR0M 4LF9M 2DENA 4W5WA 2Z8YM 4M9ZA 5JI2E 4R7GA 3M7GA 3EIHA 1IY0A 3UGJA 3HHXA 5ITYA 2MH8A 2LH0A 3SAUA 2O25A 3GQ3A 2UUAM 4AKIA 2H5XA 1IXRC 3FRHA 1YSYA 3F92A 2JY8A 1OFIA 2DNAA 4ANRA 2FH0A 2OOAA 3I01M 1QVRA 4II7A 3TQSA 3W0LB 4JI2M 1XHBA 3HGIA 1R2ZA 4NOOB 2UUBM 4B7FA 4B3SM 5C18A 1DGHA 4RNAA 1KFVA 1IBMM 1HNZM 1S3SA 2CV1A 2QENA 4LJ7A 1KYIA 1TH2A 4LCBA 4X64M 3BBZA 1BVSA 3GLHB 4Z8XA 3L28A 5FTJA 1NJFA 4M9XA 2R4JA 2QBYA 4IBEA 2KHHA 3DOAA 2F4VM 5ITQA 1NHGC 3U6DA 1ZMVA 3AL0C 5EP3A 3FKEA 3HKPA 3I4VA 4JI1M 1NNUC 4ZPXA 3TPZA 1IN5A 2DZOB 3HU2A 3U5ZA 2VF7A 2LVNC 3Q8GA 1ZMUA 4IBIA 4KODA 1IBLM 4L8RC 3MMPA 3J81S 1EE8A 3T38A 4IBDA 2Z3XA 2KNZA 2F5NA 2DAIA 2KRKA 5EJCA 1YE9A 3QYEA 2XFTA 4LFBM 4FCVA 3IG5A 4WP2A 3A98B 5FTLA 2JA2A 3T1HM 2XGNA 1LTMA 1J7KA 3LVVA 1NY6A 1NNJA 3K1JA 5LMNM 4QOZC 1IN4A 3BOSA 4KLNA 2L09A 5EXTA 3FUWA 3GLFA 1E9SA 5E6JA 4JV5M 2DZLA 2X4AA 2C9OA 2R44A 3B74A 2L7IA 3DZDA 4IIWA 5DYIA 3U60A 4B3MM 1L1TA 3SATA 4B3RM 1NO1A 3GRUA 4LJAA 2OPFA 1QANA 1PJQA 4GC9A 2VQFM 5KQ8A 5EQTA 2K9DA 2KRUA 4JI4M 2D7EA 4REZA 3THGA 1F4IA 1AUAA 1GKIA 3HHWA 4KO8A 4OU7A 3U5ZB 3K9PA 1SXJD 3L27A 3ZC7B 3U6QA 3AOEC 3PNVA 2XH9A 5KPRA 1IN7A 2BJVA 3UZUA 4LGMA
chains in the Genus database with same CATH topology
3GLHE 2LVAA 2K0BX 1Y8GA 2JP7A 1TTEA 2KNVA 2JNHA 5DFLA 1HQYE 2ZTDA 1OQYA 3H4JA 2DAKA 2HWJA 1WIVA 4R71A 1AIPC 3LCUA 1PGYA 2LVQD 3IECA 1HJPA 1HT2E 2L4EA 1NV9A 2KNAA 2WZJA 1DO2A 1VEJA 2DKLA 1IM2A 1C7YA 2DENA 2ZTCA 3IHPA 3K9OA 1G41A 5JI2E 2EKKA 4Q7JA 3E21A 2O25A 3GLFE 4F2LA 2H5XA 1OKSA 3FRHA 1ZV1A 3F92A 2JY8A 2QHOB 1G4AE 2DNAA 4HEOA 1IXSA 2G3QA 1SG9A 2JY6B 2OOAA 1VG5A 2DAGA 2B3TA 2L4FA 2LVPC 1WR1B 2CP8A 1VEGA 2DHYA 1KYIA 1T6OA 4UN2B 1WGLA 4GEWA 3FRIA 2DAEA 3E46A 3BBZA 1BVSA 2JZ0A 3LCVB 1XXHE 2EKFA 2KHHA 2LTUA 1E94E 1ZMVA 1WHCA 2BWEA 1Q02A 3FE3A 4DBGB 2JZ1A 1GO5A 2LVNC 1ZMUA 2JUJA 3MMPA 1R4GA 1V92A 2KNZA 1A5TA 1UFZA 1MN3A 3GLGE 1NV8A 2DAIA 2QNJA 2CWBA 1YLAA 2LVOC 4WP2A 1QZEA 2LBCA 1IFYA 1ZMWA 2R0IA 4G3OA 2OO9A 1P3QQ 2JY7A 1HT1E 2JY5A 1OAIA 1OTRA 2DAMA 1VDLA 2DZLA 2HAKA 1VEKA 1DV0A 1G3IA 2BWBA 1TR8A 1DO0A 2MJ5B 2L2DA 1JR3E 1VQ1A 1WGNA 1XB2B 2K9DA 2RRUA 3GLIE 1WJ7A 1F4IA 2DI0A 2MGWA 2MROB 4F1IA 3K9PA 1CUKA 1EFUB 2QSFX 2EJSA 2MR9A 2OOBA 3T6PA 3B89A 1T43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLH E;  2LVA A;  2K0B X;  1Y8G A;  2JP7 A;  1TTE A;  2KNV A;  2JNH A;  5DFL A;  1HQY E;  2ZTD A;  1OQY A;  3H4J A;  2DAK A;  2HWJ A;  1WIV A;  4R71 A;  1AIP C;  3LCU A;  1PGY A;  2LVQ D;  3IEC A;  1HJP A;  1HT2 E;  2L4E A;  1NV9 A;  2KNA A;  2WZJ A;  1DO2 A;  1VEJ A;  2DKL A;  1IM2 A;  1C7Y A;  2DEN A;  2ZTC A;  3IHP A;  3K9O A;  1G41 A;  5JI2 E;  2EKK A;  4Q7J A;  3E21 A;  2O25 A;  3GLF E;  4F2L A;  2H5X A;  1OKS A;  3FRH A;  1ZV1 A;  3F92 A;  2JY8 A;  2QHO B;  1G4A E;  2DNA A;  4HEO A;  1IXS A;  2G3Q A;  1SG9 A;  2JY6 B;  2OOA A;  1VG5 A;  2DAG A;  2B3T A;  2L4F A;  2LVP C;  1WR1 B;  2CP8 A;  1VEG A;  2DHY A;  1KYI A;  1T6O A;  4UN2 B;  1WGL A;  4GEW A;  3FRI A;  2DAE A;  3E46 A;  3BBZ A;  1BVS A;  2JZ0 A;  3LCV B;  1XXH E;  2EKF A;  2KHH A;  2LTU A;  1E94 E;  1ZMV A;  1WHC A;  2BWE A;  1Q02 A;  3FE3 A;  4DBG B;  2JZ1 A;  1GO5 A;  2LVN C;  1ZMU A;  2JUJ A;  3MMP A;  1R4G A;  1V92 A;  2KNZ A;  1A5T A;  1UFZ A;  1MN3 A;  3GLG E;  1NV8 A;  2DAI A;  2QNJ A;  2CWB A;  1YLA A;  2LVO C;  4WP2 A;  1QZE A;  2LBC A;  1IFY A;  1ZMW A;  2R0I A;  4G3O A;  2OO9 A;  1P3Q Q;  2JY7 A;  1HT1 E;  2JY5 A;  1OAI A;  1OTR A;  2DAM A;  1VDL A;  2DZL A;  2HAK A;  1VEK A;  1DV0 A;  1G3I A;  2BWB A;  1TR8 A;  1DO0 A;  2MJ5 B;  2L2D A;  1JR3 E;  1VQ1 A;  1WGN A;  1XB2 B;  2K9D A;  2RRU A;  3GLI E;  1WJ7 A;  1F4I A;  2DI0 A;  2MGW A;  2MRO B;  4F1I A;  3K9P A;  1CUK A;  1EFU B;  2QSF X;  2EJS A;  2MR9 A;  2OOB A;  3T6P A;  3B89 A;  1T43 A; 
#chains in the Genus database with same CATH topology
 4TUW A;  2QZ4 A;  3CTW B;  3GQ5 A;  1X37 A;  1N33 M;  2R4E A;  5BR8 M;  3L2A A;  1N36 M;  2CEA A;  3GLI A;  4FD2 A;  1IQP A;  2V6Z M;  3HWS A;  3H4J A;  2R18 A;  3MHV C;  4GIT A;  2HWJ A;  3RE8 A;  1HQC A;  3SYK A;  1K3W A;  2Z7J A;  3JAM S;  1N75 A;  1QUS A;  2QP9 X;  3FYC A;  3HU3 A;  4S12 A;  4I81 A;  2ZAN A;  3PFI A;  5KQD A;  4B7G A;  2GNO A;  3FTF A;  4FCW A;  2DKL A;  3UMM A;  3FUX A;  4AZF A;  5GKN A;  2ZTC A;  1T3T A;  1G41 A;  5IT9 S;  2C96 A;  4LY6 A;  4G4R A;  3SHG B;  4Q7J A;  5LMU M;  3TWM A;  1OKS A;  2R45 A;  4M0D A;  1N34 M;  2Q2E B;  3H4M A;  4DV6 M;  2QHO B;  1G4A E;  4YHH M;  3IG8 A;  2EA0 A;  1PJS A;  1GL6 A;  1SG9 A;  1VG5 A;  3SAR A;  2XFS A;  3GRY A;  1N77 A;  4YY3 M;  2YR0 A;  2QPA A;  3J7A S;  1VDD A;  4HLQ A;  1OIP A;  4QOS A;  4X62 M;  3ILK A;  3LW5 F;  4X65 M;  1HNW M;  3VDU A;  1N32 M;  1TH4 A;  1D0K A;  4IBB A;  4LGY A;  2LXE A;  1NVM A;  3HY5 A;  4DV0 M;  1Z5C A;  2E5L M;  3MJ5 A;  2CV0 A;  2J7O A;  3J80 S;  3K8Z A;  4IJE A;  2DAE A;  4XK8 F;  2A5Y B;  3LMM A;  1OFH A;  1I4W A;  2Y0Q A;  4DR2 M;  1G8P A;  1SXJ B;  1L8Q A;  3KXE C;  2LTU A;  4L15 A;  1R5L A;  2C99 A;  2CE7 A;  2RKO A;  3KS8 A;  4DBG B;  2G5G X;  2JZ1 A;  5FTM A;  4GHA A;  3CGW A;  1GO5 A;  4MGH A;  4CGY B;  4GRI A;  4LRS A;  1WXQ A;  3WHL A;  5IWA M;  3NBX X;  3SMP A;  3RGS A;  1V92 A;  3SFZ A;  2DWL A;  2V1C A;  1MU5 A;  1A5T A;  1UFZ A;  1MN3 A;  3D8L A;  2DWZ B;  3I51 A;  3GLG E;  4NL4 H;  2UXD M;  4LJ9 A;  4P17 A;  2LNH C;  5ITT A;  3JR5 A;  2QNJ A;  2VII A;  3SMS A;  1XMQ M;  2UUC M;  5ITX A;  1IBK M;  3TE6 A;  4P16 A;  2Z4S A;  2CHV A;  4CHT B;  4PD2 A;  2R6F A;  3B7Z A;  4MGZ E;  2FFJ A;  1ZMW A;  1G71 A;  2KA6 B;  3FYD A;  1P3Q Q;  1SXJ A;  3M0E A;  3K92 A;  3SAW A;  2CRU A;  2O01 F;  1HT1 E;  2D7G A;  4RKU F;  3VK7 A;  2BJW A;  1QQW A;  1J5E M;  2HAK A;  3PNY A;  2QCU A;  4LF5 M;  2XLJ A;  1DV0 A;  2W82 A;  4JN6 A;  4IBK A;  1DGB A;  3FD9 A;  3W68 A;  4QNM A;  1GL7 A;  2K47 A;  1TR8 A;  1DO0 A;  2C9C A;  2CFO A;  4OVZ A;  4R3D A;  3T1Y M;  5FTK A;  1JR3 E;  1VQ1 A;  3HJQ A;  1XB2 B;  1R6B X;  5DNY A;  3QYB A;  4I4L A;  4DUZ M;  4AI6 A;  1MX0 A;  1PRB A;  4DV2 M;  4DV3 M;  2I7N A;  3AV0 A;  2X8A A;  4K0K M;  1QDT A;  1XC8 A;  4JI0 M;  1CUK A;  4JI5 M;  3LVW A;  3HX3 A;  2QSF X;  4GHL A;  3TWL A;  3T6P A;  2C98 A;  1QZM A;  1XXH B;  3B89 A;  3NWL A;  4L16 A;  2F5O A;  5ITR A;  1Z59 A;  2LVA A;  1Y8G A;  5FSW A;  4LF4 M;  1TTE A;  1V34 A;  4FW9 A;  5F3W A;  4Z6Y A;  1HQY E;  1D0M A;  1TGU A;  2F5P A;  1GJT A;  1JQJ C;  4XBO A;  3GPY A;  2RGO A;  4NRW A;  3C3D A;  2CV2 A;  2DAK A;  4G4O A;  4R71 A;  3OTO M;  4MGY E;  4IJF A;  3KDS E;  1OIZ A;  3LCU A;  4B7H A;  3KW6 A;  3CF6 E;  2FOI C;  4MGK E;  3HJ8 A;  4HL4 A;  5FLX S;  2F5Q A;  2AHM A;  3PVS A;  4MM3 B;  3M6A A;  1DO2 A;  3D8B A;  4AQY M;  1VEJ A;  2XZU A;  1RU3 A;  4GH9 A;  2R46 A;  3QWL A;  2K6B A;  3LQR A;  4XGI A;  1OAO C;  1FNN A;  1GVN A;  3ZH9 B;  3U6O A;  4B3T M;  5JI3 E;  3U61 A;  3LQQ A;  2EKK A;  2XZF A;  5KPT A;  3W0F A;  5EXS A;  2HCB A;  1JB0 F;  3E21 A;  3GLG B;  4JXJ A;  4D82 A;  4F2L A;  1GAB A;  1ZV1 A;  3J2P B;  1D0L A;  3VKH A;  4AG5 A;  3GLG A;  4M0W A;  4WW0 A;  2HHH M;  4GMQ A;  1IXS A;  2G3Q A;  4FCT A;  4G6Z A;  4IBJ A;  2DAG A;  4RF0 A;  1QAQ A;  2L4F A;  1Z6T A;  2V1U A;  5IZ7 D;  4G4Q A;  7CAT A;  2VDB B;  3SBJ A;  3KOW E;  1C1K A;  2DHY A;  2APL A;  3L29 A;  3GP1 A;  4BLC A;  3KSX A;  3W67 A;  3FRI A;  1W5T A;  2H1R A;  2JZ0 A;  3AKZ A;  1E9R A;  5H37 D;  3NBI A;  4LZZ A;  4AKH A;  1E94 E;  4IBG A;  1IY2 A;  1WHC A;  2BWE A;  3KOY E;  4NRV A;  1Q02 A;  2ZM6 M;  4GKK M;  2Y20 A;  2QBY B;  4D81 A;  3KOX E;  3VDP A;  1N78 A;  1PJJ A;  1JR3 D;  3E9S A;  2JUJ A;  4A3V B;  4X66 M;  3R8F A;  2KW0 A;  3RFW A;  2QQ8 A;  3AJI B;  3C3E A;  2C5R A;  3GPX A;  1W5S A;  2L6O A;  4QHS A;  4GC5 A;  2CWB A;  4QNR A;  4JI7 M;  2YQZ A;  2WSE F;  2LVO C;  4IBF A;  3GPP A;  3GPU A;  3HHZ A;  1IXZ A;  2D7H A;  4DV7 M;  5IRE B;  3UK6 A;  3TWK A;  2R65 A;  1ZAE A;  5ITX E;  2Z4R A;  2LBC A;  1DGF A;  4PT5 A;  2M5Z A;  4NXM M;  1IFY A;  3DA1 A;  2HKJ A;  1DGG A;  3B7N A;  2JY7 A;  3U6L A;  4CIZ A;  2JXN A;  1Q3C A;  2JY5 A;  1OTR A;  2DAM A;  1J09 A;  1NHW C;  2R62 A;  1QAM A;  1VDL A;  1ZQ9 A;  2WSF F;  1XMO M;  4L6V 6;  3KVW A;  1G3I A;  4QHT A;  3WHK A;  1NY5 A;  2WSC F;  1PJI A;  1XXH A;  1HNX M;  4KHP M;  2EO2 A;  3FUT A;  2UU9 M;  3V76 A;  1DGH B;  2LHG A;  4DR7 M;  2L2D A;  2CHQ A;  3A42 A;  3J27 B;  3T15 A;  3EIE A;  4DUY M;  2FE8 A;  4PCZ A;  2DI0 A;  2MGW A;  3DFZ A;  4G4N A;  4LZJ A;  4AW4 A;  4FWH A;  4F1I A;  1TDH A;  3KS4 A;  4IBC A;  3VFD A;  4B08 A;  2P5T A;  4NSR A;  2LHC A;  2OOB A;  1D2N A;  4I5S A;  2KDL A;  1T43 A;  1IN6 A;  4M9S A;  3CF0 A;  5A2Q S;  2K0B X;  2JP7 A;  2KNV A;  2ZAO A;  4DR1 M;  3FTC A;  2JNH A;  4JI3 M;  2XF3 A;  4WUR A;  1TF0 B;  2GQF A;  5DFL A;  4CIS A;  4FWG A;  2RGH A;  3K2L A;  3SAV A;  4DR3 M;  2DZN B;  2UXB M;  1MJG M;  1OQY A;  3BXW A;  4GIP A;  3SC3 A;  2CHG A;  1L2C A;  3I4Y A;  1NSF A;  4RF1 A;  2DWM A;  2VQE M;  1AIP C;  3HJS A;  3GRV A;  2YFQ A;  3L26 A;  1HJP A;  2XSZ A;  3GRR A;  3GQ4 A;  1NV9 A;  4OW0 A;  2KNA A;  3QAU A;  1K3X A;  3FTD A;  3AFH A;  2JWS A;  2XEP A;  1IXS B;  1C7Y A;  2BNK A;  3J7B A;  4NC6 A;  3IHP A;  3K9O A;  1Z5B A;  4LJ8 A;  4DV1 M;  2Y0T A;  3U6M A;  4LJ4 A;  5EXP A;  3JR4 A;  1L2D A;  1KSF X;  4LF8 M;  2I7P A;  4KT0 F;  3GLF E;  4NSO B;  5EP2 A;  2Y21 A;  1G59 A;  5L8R F;  1PM5 A;  3B7Q A;  2FS1 A;  2HL7 A;  3CF2 A;  4FVM A;  4D80 A;  4LFC M;  4GKJ M;  4HEO A;  1QAO A;  3HZJ A;  3GLH A;  4DR6 M;  1QYR A;  2JY6 B;  1OJL A;  3SYL A;  2B3T A;  2LWX A;  8CAT A;  4AG6 A;  3KP1 E;  2LVP C;  1WR1 B;  2OQ4 A;  2CP8 A;  4LJ5 A;  1JR3 A;  2J5Y A;  1VEG A;  4LG2 A;  3RGP A;  3E4R A;  1ORY B;  1T6O A;  4UN2 B;  4OVZ B;  1EIJ A;  5E26 A;  1WGL A;  4MH0 E;  1E32 A;  4GEW A;  4DV5 M;  3E46 A;  3LCV B;  4JI8 M;  3C9P A;  2F5S A;  3TL4 X;  5KPZ A;  1R7R A;  1XXH E;  2EKF A;  5C1B A;  3ZCB B;  3U6E A;  4EIW A;  4L78 A;  1K82 A;  2ERC A;  1IN8 A;  3FE3 A;  1V33 A;  3HU1 A;  1H6U A;  3KSJ A;  2XSZ D;  2KZS A;  4MGI E;  3R9X B;  1TDZ A;  4ITQ A;  1QDR A;  3ZQJ A;  2EUC A;  1R4G A;  2KZU A;  3VKG A;  5KO3 A;  1GJS A;  3UJN A;  5ITU A;  4DR5 M;  1QUT A;  1SXJ E;  1SXJ C;  1NV8 A;  1XWI A;  2YNM D;  4LJ6 A;  3U6P A;  2KEB A;  4PDI A;  1YLA A;  1Q39 A;  2X49 A;  4NXN M;  4OX9 M;  2N35 A;  5DYG A;  4AKG A;  3U6S A;  2ZBK B;  1XNR M;  3U60 B;  2DVW B;  3KP0 E;  1QZE A;  4DR4 M;  2R0I A;  3GO8 A;  3KOZ E;  4G3O A;  2OO9 A;  1Q3B A;  3A45 A;  4JYA M;  3GLI B;  3VLF B;  2DXI A;  4BB9 A;  4CJ6 A;  1OAI A;  1L2B A;  3KFU G;  1VEK A;  3AOG A;  2BWB A;  3AOE A;  4FWD A;  1L1Z A;  3L25 A;  3FUU A;  5EXX A;  3FTE A;  2MJ5 B;  3A46 A;  4BBA A;  1WGN A;  4JI6 M;  2O5R A;  2RRU A;  3GLI E;  1WJ7 A;  3SHF A;  4I8O A;  2MRO B;  3HHY A;  2G8L A;  2UXC M;  1IY1 A;  5EP4 A;  2M60 A;  1EFU B;  3I04 M;  2EJS A;  2MR9 A;  1Z5A A;  2FNA A;  3Q8X A;  4LF6 M;  1FJG M;  3SAS A;  1TH3 A;  2ZAM A;  5EP1 A;  3C58 A;  2KXE A;  3GLH E;  4Y28 F;  4LFA M;  2DHR A;  5FTN A;  3GLF B;  3U61 B;  1XNQ M;  1PJT A;  5BPV A;  2ZTD A;  2J7N A;  1NJG A;  2CUZ A;  3FUV A;  4MB7 A;  1GLN A;  1WIV A;  3B9P A;  3VK8 A;  1PGY A;  1UM8 A;  2LVQ D;  2NQ8 C;  1LV7 A;  3IEC A;  2L7H A;  1HT2 E;  4DV4 M;  3U6C A;  2L4E A;  2DWN A;  3PXG A;  4PDG A;  2VF8 A;  2WZJ A;  4LF7 M;  1R2Y A;  1IM2 A;  1YUB A;  4LRT A;  4L4U A;  1I94 M;  3MK6 A;  1HR0 M;  4LF9 M;  2DEN A;  4W5W A;  2Z8Y M;  4M9Z A;  5JI2 E;  4R7G A;  3M7G A;  3EIH A;  1IY0 A;  3UGJ A;  3HHX A;  5ITY A;  2MH8 A;  2LH0 A;  3SAU A;  2O25 A;  3GQ3 A;  2UUA M;  4AKI A;  2H5X A;  1IXR C;  3FRH A;  1YSY A;  3F92 A;  2JY8 A;  1OFI A;  2DNA A;  4ANR A;  2FH0 A;  2OOA A;  3I01 M;  1QVR A;  4II7 A;  3TQS A;  3W0L B;  4JI2 M;  1XHB A;  3HGI A;  1R2Z A;  4NOO B;  2UUB M;  4B7F A;  4B3S M;  5C18 A;  1DGH A;  4RNA A;  1KFV A;  1IBM M;  1HNZ M;  1S3S A;  2CV1 A;  2QEN A;  4LJ7 A;  1KYI A;  1TH2 A;  4LCB A;  4X64 M;  3BBZ A;  1BVS A;  3GLH B;  4Z8X A;  3L28 A;  5FTJ A;  1NJF A;  4M9X A;  2R4J A;  2QBY A;  4IBE A;  2KHH A;  3DOA A;  2F4V M;  5ITQ A;  1NHG C;  3U6D A;  1ZMV A;  3AL0 C;  5EP3 A;  3FKE A;  3HKP A;  3I4V A;  4JI1 M;  1NNU C;  4ZPX A;  3TPZ A;  1IN5 A;  2DZO B;  3HU2 A;  3U5Z A;  2VF7 A;  2LVN C;  3Q8G A;  1ZMU A;  4IBI A;  4KOD A;  1IBL M;  4L8R C;  3MMP A;  3J81 S;  1EE8 A;  3T38 A;  4IBD A;  2Z3X A;  2KNZ A;  2F5N A;  2DAI A;  2KRK A;  5EJC A;  1YE9 A;  3QYE A;  2XFT A;  4LFB M;  4FCV A;  3IG5 A;  4WP2 A;  3A98 B;  5FTL A;  2JA2 A;  3T1H M;  2XGN A;  1LTM A;  1J7K A;  3LVV A;  1NY6 A;  1NNJ A;  3K1J A;  5LMN M;  4QOZ C;  1IN4 A;  3BOS A;  4KLN A;  2L09 A;  5EXT A;  3FUW A;  3GLF A;  1E9S A;  5E6J A;  4JV5 M;  2DZL A;  2X4A A;  2C9O A;  2R44 A;  3B74 A;  2L7I A;  3DZD A;  4IIW A;  5DYI A;  3U60 A;  4B3M M;  1L1T A;  3SAT A;  4B3R M;  1NO1 A;  3GRU A;  4LJA A;  2OPF A;  1QAN A;  1PJQ A;  4GC9 A;  2VQF M;  5KQ8 A;  5EQT A;  2K9D A;  2KRU A;  4JI4 M;  2D7E A;  4REZ A;  3THG A;  1F4I A;  1AUA A;  1GKI A;  3HHW A;  4KO8 A;  4OU7 A;  3U5Z B;  3K9P A;  1SXJ D;  3L27 A;  3ZC7 B;  3U6Q A;  3AOE C;  3PNV A;  2XH9 A;  5KPR A;  1IN7 A;  2BJV A;  3UZU A;  4LGM A; 
#chains in the Genus database with same CATH homology
 3GLH E;  2LVA A;  2K0B X;  1Y8G A;  2JP7 A;  1TTE A;  2KNV A;  2JNH A;  5DFL A;  1HQY E;  2ZTD A;  1OQY A;  3H4J A;  2DAK A;  2HWJ A;  1WIV A;  4R71 A;  1AIP C;  3LCU A;  1PGY A;  2LVQ D;  3IEC A;  1HJP A;  1HT2 E;  2L4E A;  1NV9 A;  2KNA A;  2WZJ A;  1DO2 A;  1VEJ A;  2DKL A;  1IM2 A;  1C7Y A;  2DEN A;  2ZTC A;  3IHP A;  3K9O A;  1G41 A;  5JI2 E;  2EKK A;  4Q7J A;  3E21 A;  2O25 A;  3GLF E;  4F2L A;  2H5X A;  1OKS A;  3FRH A;  1ZV1 A;  3F92 A;  2JY8 A;  2QHO B;  1G4A E;  2DNA A;  4HEO A;  1IXS A;  2G3Q A;  1SG9 A;  2JY6 B;  2OOA A;  1VG5 A;  2DAG A;  2B3T A;  2L4F A;  2LVP C;  1WR1 B;  2CP8 A;  1VEG A;  2DHY A;  1KYI A;  1T6O A;  4UN2 B;  1WGL A;  4GEW A;  3FRI A;  2DAE A;  3E46 A;  3BBZ A;  1BVS A;  2JZ0 A;  3LCV B;  1XXH E;  2EKF A;  2KHH A;  2LTU A;  1E94 E;  1ZMV A;  1WHC A;  2BWE A;  1Q02 A;  3FE3 A;  4DBG B;  2JZ1 A;  1GO5 A;  2LVN C;  1ZMU A;  2JUJ A;  3MMP A;  1R4G A;  1V92 A;  2KNZ A;  1A5T A;  1UFZ A;  1MN3 A;  3GLG E;  1NV8 A;  2DAI A;  2QNJ A;  2CWB A;  1YLA A;  2LVO C;  4WP2 A;  1QZE A;  2LBC A;  1IFY A;  1ZMW A;  2R0I A;  4G3O A;  2OO9 A;  1P3Q Q;  2JY7 A;  1HT1 E;  2JY5 A;  1OAI A;  1OTR A;  2DAM A;  1VDL A;  2DZL A;  2HAK A;  1VEK A;  1DV0 A;  1G3I A;  2BWB A;  1TR8 A;  1DO0 A;  2MJ5 B;  2L2D A;  1JR3 E;  1VQ1 A;  1WGN A;  1XB2 B;  2K9D A;  2RRU A;  3GLI E;  1WJ7 A;  1F4I A;  2DI0 A;  2MGW A;  2MRO B;  4F1I A;  3K9P A;  1CUK A;  1EFU B;  2QSF X;  2EJS A;  2MR9 A;  2OOB A;  3T6P A;  3B89 A;  1T43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...