1ZV2A

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
b'LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zv2A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zv2A02
4N8UA 4HHGA 3ZBMA 3AG4B 1GYCA 5I28A 3DKHA 2CUAA 3WNIA 1HAWA 4M3HA 4HALA 3X1GA 1NZRA 2BHFA 5I26A 1AACA 1KDIA 1EZLA 2EILB 1CYXA 1HAUA 1SF3A 3AG2B 1GW0A 1SFDA 3UAAA 4FA7B 5AFAA 1J9TA 1N70A 4DPCX 1FA4A 5D4IA 1T5KA 3X1NA 1ZDQA 3FQ2A 3ABMB 2VW4A 3GDCA 4P5RA 3NYKA 3NSDA 2H5UA 2W88A 5F7BA 2GSMB 6PCYA 4NERA 2YQBA 1ET8A 4PAZA 4F2EA 2B3IA 3NJJA 3OD3A 4BXVA 3PAZA 4DP5X 1WS7A 3KW7A 2BWDA 3UGEA 1PNDA 2J56A 2YXVA 3CDZB 3H4HA 4JHUA 3FU8A 3OMIB 3FSAA 2Q9OA 2VM3A 4BWTA 2I7OA 4HCFA 2DWTA 2UX7A 3S3BB 3SBRA 2MTAA 3IBOA 4DP0X 1JZGA 3NJKA 4YSUA 1PZAA 2J57A 2ZOOA 4UF7C 5B1JC 5B7MA 4YVUA 1FWXA 4G7SB 1A4CA 4W1TA 3UACA 4E9SA 1KGYE 1BQKA 3D12B 1J5DA 2VW7A 2PPCA 4BDVA 1X9UA 1J9SA 1KYAA 3SBQA 2XYBA 1JZEA 4CSPA 2XX1A 1JXDA 3TASA 3OMNB 1R1CA 2A3TA 1JXFA 3BQVA 3NJMA 1AAJA 1KBVA 4BK5C 1A8ZA 3TA4D 5TK2A 4GY4A 5I5IA 4WKXA 1ZIBA 1NDTA 3NP3A 1CYWA 3QJSB 2IH8A 3HB3B 2ZWNA 4KNSA 3WKPA 4AZUA 1EHKB 4KOBA 1V55B 3AG3B 1NIDA 1AS8A 2QPEB 3IN2A 4KOCA 1KV7A 3EF4A 1NWOA 3NSCA 4CSZA 3N2JA 5B7FA 2YARA 4KO9A 1NINA 4Q8BA 5AKRA 1OCRB 1ADWA 1JOIA 1PY0A 1PNCA 2AZAA 2Y1AA 3UAEA 2XV2A 1NTDA 1AIZA 8PAZA 3QJTB 3SBPA 1JZFA 1L9SA 1JZJA 1QHQA 1UATA 2VSKB 1DYZA 3QJRB 4KNTA 5B1BB 2CAKA 3CZUB 2RACA 1XB8A 1J9QA 2DYRB 1KDJA 1NPNA 2UX6A 3MBWB 1MDAA 3X2QB 1A65A 3FS9A 1IBZA 4DP9X 1TEGA 1SNRA 1NWPA 1WS8A 4YSDA 3NJLA 1URIA 2UXVA 4YSAA 3AY2A 3T6ZA 3GXUB 1SHWA 1PMYA 1PZBA 4M4RB 2AZUA 4E9YA 1B3IA 2GHZA 3UADA 3L45A 2TSAA 3ASNB 1AZUA 4DP4X 2VSMB 2BZ7A 2HX7A 2FT8A 3CVDA 5AZUA 4E9VA 4DP6X 2HX8A 1GY1A 4YSTA 2AVFA 1SHXA 2EINB 1SJMA 1TU2A 1SF5A 1AZRA 4E9XA 1XMEB 4A2HA 1AS7A 2YAHA 5D4JA 1ET5A 2AFNA 3WIAA 3OQRA 5F7AA 1IBYA 3CDZA 4BWUA 4HCIA 4KO5A 1ZDSA 1AZBA 1M9WA 1TKWA 3NSFA 3PPSA 1BYPA 1MZYA 1BQRA 5I6LA 5B1JA 3U25A 4DP2X 5LDUA 3NSYA 2OV0A 3V9CA 4BWWA 2HX9A 2IDUA 5I5JA 3WG7B 3S8GB 1NIAA 3CVBA 2IWEA 2IAAC 4UAHA 3MX0B 3ASOB 1E65A 1YLBB 2YXWA 2BWIA 3PAVA 2J55A 5PAZA 3QJVB 4Q89A 1BQ5A 5PCYA 3TBCA 1ZV2A 4PCYA 5TK4A 7PCYA 3EH4B 1JZHA 2AANA 1PCSA 3DIVA 2JXMA 2FQDA 3WNJA 4YL4A 4QLWA 1PZCA 1AANA 3NJHA 3FSVA 3PCYA 3JT2A 1AR1B 2PPEA 1F56A 4DP8X 1NIEA 1L9TA 3FQ1A 2BZCA 7PAZA 2FTAA 1CC3A 4A2FA 1ASQA 1ZIAA 1A3ZA 2E86A 4W9ZA 1BYOA 1M57B 2MRYA 3H56A 3FPXA 2PP9A 2R7EB 3NJNA 3QJUB 4AI7A 5I6MA 5B1KA 2FQEA 1RZQA 1JVOA 1QLEB 4HZ1A 5I5MA 1AZNA 2FJSA 1JXGA 2GI0A 3BVDB 5I6KA 5A7EA 3PAUA 1TEFA 4JKNA 1MZZA 1GSKA 2IH9A 4YSRA 3IEAA 2I85A 3QPKA 2FT6A 3H4FA 4AKQA 5D4HA 4E9QA 1W6LA 2GB2A 2PLTA 1ETJA 4GP8B 1NIFA 4YVNA 2IDQA 3EH5B 1ILUA 4YSCA 2X87A 1PLBA 2FNWA 4YSOA 3S3CB 2OJ1A 4YSEA 1IKOP 3NJGA 3OM3B 4NB7A 1CURA 4A67A 4FAAB 1NPJA 1BXVA 1WAEA 2YAOA 3C75A 3PLYA 4G72B 1E5YA 2BP8B 1GS8A 3ZX1A 1GS6X 1X9RA 4GYBA 9PCYA 2XXGA 3DTUB 2GBAA 3T6WA 1XB6A 2FT7A 1WA1X 3EHBB 4KNUA 1OOWA 2CALA 2H3XC 2VN3A 4YSPA 5B7EA 3TBBA 3X1BA 3FU7B 3WKQA 3G5WA 4KO6A 4A2GA 3QJQB 4E9WA 2Y69B 1I53A 3PXLA 3AG1B 4HAKA 1E67A 4YSQA 3IN0A 1OE3A 4EF3A 2DWSA 3T6VA 2VM4A 2NRDA 2XUWA 2XLLA 3T71A 1WA0X 3GYRA 1W8EA 2DV6A 2IDSA 3OMAB 2JKWA 2ZONA 2FQFA 1OCCB 2PCFA 1PLAA 3AW5A 2DY2A 2X88A 1FFTB 2WSDA 4RH4A 1ILSA 4HIPA 2QDVA 3NJFA 3AZUA 4L0PB 1KCBA 2WO3B 4GP4B 1WA2X 2Q5BA 1DZ0A 4N4YB 2GC4C 1IC0A 3QQXA 2BP0B 1JZIA 2XV3A 1HFUA 2XX0A 3IE9A 3WI9A 4MFHA 1OE1A 1IUZA 1SDDB 3ERXA 4DP1X 4A2EA 2UXTA 1RKRA 1SFHA 1BXAA 2PPDA 1VLXA 1KBWA 1BAWA 4HHWA 2CJ3A 3V9EA 2EIMB 2EIJB 2B08A 4G7RB 2HLEB 1AG0A 4F2FA 4G71B 4G70B 1JVLA 1PAZA 2WO2B 2YAPA 6PAZA 3NP4A 4F7KA 3KW8A 4UANA 1OCZB 3EH3B 1A4BA 3ZIYA 4AKOA 3N55A 5E9NA 3ABKB 4HCGA 2VW6A 1AZCA 1AOZA 2R7EA 2P80A 1OE2A 3UABA 5B3SB 2N0MA 1ZPUA 4K9JA 4WTQA 1QNIA 2PP7A 3NJIA 4AX3A 1M56B 4E9TA 2YAFA 4NAJA 3CVCA 2XV0A 2H47C 4BXSV 1L9PA 5I6PA 3T6XA 1RZPA 2UXGA 2PPAA 1JERA 1V54B 3TU6A 3FYIB 5IY5B 5EHFA 1MG2C 3FSZA 3FT0A 3FYEB 2W8CA 4X4KA 4A68A 2I7SA 4DP7X 4ZK8A 1E5ZA 2J5WA 2CCWA 2XVBA 4A66A 4KO7A 3ABGA 2XXFA 2ZXWB 3HEIB 2XU9A 1J9RA 3ZDWA 3SQRA 2DYSB 2HZHA 2BP8A 2TSBA 1J5CA 4BDVB 2OCCB 1AG6A 2PP8A 4JHVA 2XWZA 2FQGA 2BW4A 2HXAA 2BW5A 2QT6A 4P5SA 3RYMA 2JFCA 1AQ8A 2EIKB 2LLNA 3CG8A 1GY2A 2QDWA 2YAEA 3JTBA 1ID2A 3FU9A 1CUOA 3FU7A 5ANHA 4DPAX 1NICA 2HRHA 3ABLB 1KCWA 1OF0A 1OV8A 1BEXA 2P80D 2PCYA 3X1FA 2VMJA 1PF3A 5B1AB 1RCYA 3T9WA 4YSSA 1ASPA 4ENZA 1OCOB 4GP5B 5I6OA 4TXVB 1AS6A 2YAQA 3S8FB 1V10A 2HRGA 4GXFA 1ASOA 1A4AA 2QPDB 1L9OA 1BXUA 2CBPA 2PPFA 3S3DB 4A2DA 1PLCA 3NT0A 2UXFA 1N68A 3FPYA 3FQYA 2BO0A 2GIMA 4QKTA 1L9RA 3X1EA 4AKPA 2FWLB 5FC9A 1L9QA 1GS7A 2IDTA 1E30A 2GC7C 4E9RA 2IWKA 1XB3A 4G7QB 1W6WA 2YAMA 2IWFA 1GR7A 5I6NA 2BP0A 1MG3C 2IDFA 3FSWA 1NIBA 1SDDA 1ET7A 4DPBX
chains in the Genus database with same CATH superfamily
2OCFD 4NQDE 4DGIH 3BVWA 2GJPA 2FGWH 1HL5A 3QIBC 3ULVF 4X9FA 3GK8H 3FT2B 1ZWIA 2HT2D 2PTTB 2Q2LA 3STLA 3ZW3A 4LSDA 2VITA 3BH9B 5KW9L 4WEUD 1F3JB 4F5CE 5IIEB 1QRNA 3ULVD 4MZ2A 4NXKA 3AB0C 2ZWLT 4ZTPH 1MFBH 3AG2B 3IJEB 5IESL 1GAFH 3UGUA 3LKPA 2R51A 4XVOA 2OMWA 1YJDL 3L5WB 4KMQA 3LZQA 2VTFA 2YQGA 2YWZA 4C4KT 4H2AA 5TQ0L 2JWYA 3DROA 3VGFA 5CR8A 1QVOB 3HMXH 3KWWA 3LQAL 3NJJA 4P06A 5T1LB 5I1JL 3PL6C 2YC1A 5A1AA 3EOAA 4OFYA 4MHHI 1K2DB 2WK2A 4JPQA 4BFGA 4KROD 1AVAA 3ELAT 4JRLA 2BSCA 2K45A 3ET9F 3V5KB 3GZOA 3WY2A 4ZDHB 1OTUD 3AABA 5D7IB 4OFPA 2ROYA 2ZUVA 2VJXA 4GKSA 4CKQA 4K3GA 4YSUA 1XF5B 1JXKA 3TXAA 4CW1B 1JF1A 4OAWB 2NX5D 1AXIB 2ODHA 4R5VA 5EBWA 3BSHA 5CNHA 4X0NA 4M8VA 3EJZC 2YSSB 5KSAA 3O41A 2YD5A 2VH5L 1SDYA 3QFJD 5D7IE 1KGYE 4Y4KD 1QBLH 3ORJA 1T83C 4MX7B 2YO3A 4F7TA 2K3TA 1J9SA 3T0EC 3BN3B 4XP9L 3IRCA 1B2WL 4MQSB 1HS6A 3PUCA 4FFVC 3IDXL 5DMIH 5IR1B 1R1CA 3N0PB 4GG6A 4MNHB 4BK5C 2CHNA 2GK2A 2NUPA 3CFEA 1NDTA 5IROC 2BSTB 1PZ3A 3MRDA 1JBJA 2AEPH 1NIDA 1KXQE 1J8HD 4POZD 3UJIL 4XNQA 2AJSH 4XX1E 1U58B 2Q1EA 1DN2A 4GW5A 1DVYA 4MQ7A 3RWFB 1RLBA 5DHVA 2O1AA 4W9KC 4IKKA 2X4RA 1H19A 2BS71 2WWOA 3CMOH 4OJYA 1PY0A 1QFWI 1OT4A 2ADGA 2JIXB 3UBXG 1LO5B 5IGXH 2EDBA 3DOIA 4B9FA 1XF4A 1Q9OA 3P4OA 1HU8A 1LEKA 4Z78B 3QT2A 2PWGA 5ISZB 4UYPA 4MS6A 3PQYA 4K3JH 1AGBA 1P5UC 3WN5A 1KB5B 1E5BA 4L3CB 3X2QB 1A65A 4LQ1A 2KLSA 4AQ8C 4N3UA 5DMGD 2G0LA 4ZPVB 1X5MA 3M45A 4Z3EA 1A0QH 3CV5A 5I15L 1YEJL 4PJGB 4HLZG 5ISZE 4KDTC 3MOAL 1UCBH 1U4EA 2ZD0A 3LB6C 5BRPA 4R84A 4TVUA 3VD4A 5GS0C 1WUZA 4LIQL 2EECA 3KLAB 1FV1B 4FC3E 1ZHKB 2EXYD 3VH8B 4F57L 4PJGE 3B9KC 3CU1A 4MXWH 5FYKU 4I3RH 3B9VA 4HUXB 3L3GB 2V6HA 1ZA6A 4RFEB 1IAMA 1JSYA 3ZGHA 1DBAH 3DX8B 3BWAB 4XC3L 3AB0B 5HJGA 3MV8B 3VXRB 1J12A 3SBWA 2BOBA 2WOYA 3U79A 5TGBA 2IFFL 5JIHA 5JW4M 5FLVA 4Z7UA 2CXGA 3QWNA 2ZUWA 1NL0H 1A3LL 1MRDL 3UBXA 5IFAH 4AW4A 4UQ3A 3RIAK 3DK0A 3MV8E 4AE0A 3FF7A 3CBRA 3LNHA 4L0ZA 2P47B 4BJLA 2D31A 4WWKC 3K2UH 3PABB 4WCYH 3L1EA 1H3TA 1HSAB 5D1ZD 3WHXB 5GHWH 1NPUA 1XZWA 2MMXA 4ZUVB 1S7TA 1ACCA 3M8OL 1IVLA 1ZK5A 3L5XL 2NXYD 5IJVB 2YA2A 1BDYA 4H5SA 4C8XA 2SEBA 1DEEB 3MR9B 1B0RA 3ASOB 1EHLL 3M17B 4L3EA 1LDPL 3BFQG 3NK4A 4KK6D 2CLRA 5FO7B 3WO3B 5KW9H 4S0SD 1J86A 1XDTT 3JWDC 4Z3GA 1AMXA 5I2IA 2FO8A 4P2OA 4A7VA 2DQFA 5IESH 3QARA 2V9RA 4R8WL 3QDJB 1MPAL 5C0BA 4AG4L 1MKFA 2B3RA 4D0BA 4P46A 3VG9B 2GY7B 3T0EB 5SV4A 3V6FB 2NZ9D 3IXAB 4HJIA 4EDWL 4RISH 1NC4D 2WZAA 4G43A 1K5NB 4J3UA 5TQ0H 3SOBH 4DUXA 1ZTMA 4XXDB 4U49A 1DUZA 1R3KB 5GS0H 3TF7C 3QDJE 3LQAH 5I1JH 4ETYA 4OZGE 2CUHA 3M1CA 3SYQA 3T0EE 3ZHKA 2BS8A 3SE8L 4DVBA 3KS0H 1CXKA 4HKJA 4N2BA 5EU7C 3B34A 4PD4J 5INDB 3DGGB 5LJYH 3ZR6A 4JBSA 3G6JF 1X4ZA 4MJIB 5J6HB 2AS5M 2F7IA 2AMGA 1HIML 5DDHA 4CVXB 2JKIS 4KNQA 3O6LH 3OV6A 1MRFL 3AGWA 5I1EL 1IBGL 1I8MB 3IGFA 2EYSB 1FGNL 4IMLB 1IC5H 2GI0A 2BY3A 4HFUL 4MJIE 2VH5H 1S7SA 1KIRB 5E4EC 2HRPL 4A04A 3L81A 2G4EA 1CTNA 1U8OA 4ZS6D 1WZKA 3B7RL 1P5UB 4P4KD 3FTZA 1IAIM 2IF7A 1B2WH 4NZDA 3S98A 1T22B 3MV9B 4UDUA 4WDIB 3ARDD 3L3KB 4YSEA 3OM3B 5DJYB 4KKAD 2VNCA 2XZAL 4NB7A 2WVSA 3TEWA 3I02B 1BXVA 2E7LC 4IBQA 3PLYA 3UJIH 1F4HA 4Y5YC 4ELMA 1GS6X 3QUKB 1HHHB 1G7HA 2Q0ZX 3GJFK 3MV9E 4C4BA 1DJXA 1XGQB 2D9CA 3JWDH 1U93B 4U6TA 2FIKA 5C9KA 5KANI 5EO1A 1A7NL 3B9KB 4PJCA 3U2SA 3WCYA 1KENL 5CAYB 4YJZL 1T0MA 3R19A 3CFIC 1RIVL 2B39A 3F65A 1RJCA 1Z5LA 3X12B 1T3FA 4Y1AB 1H6TA 1AC0A 4MA3A 5KBPA 4PVNA 5CF3A 4MMXC 2Y22A 1E3XA 3P3SA 3RWGA 3WAKA 1CI5A 2GUYA 4AIOA 1LK2B 1OTTC 2ZWYA 3LEXA 3MUY1 3O4LB 4MTMA 4X50A 4CVZB 4UM9B 3SPIA 4WWKB 1QSZA 1YEJH 1WF5A 5KVDL 5T1DL 3VG0L 1PLAA 1NOLA 4B0MB 2DD8H 1B0GB 3EYQC 5M7QA 3DOSA 3O4LE 1IV8A 1R24B 4X5RA 1MFCL 1FQ9C 3ZTJG 1WA2X 5I8OL 5FDYA 4F57H 3A47A 5CP7B 2W1NA 5GSVB 1OGPA 2Z0UA 2XV3A 4UQBA 2H26B 4MA7L 5KVEL 4LEBA 3MJ8A 1CYGA 2EO9A 3MRJA 5EBMA 4JQXC 1G7JB 2YEVB 4XC3H 4EQ3A 3MZTA 2WNGA 2EADA 3V10A 2HYMA 1Y1DA 2GUOB 3RWIA 5DJCB 3UYPA 2NNFA 3RVUD 1JP5A 1HOCA 2Z6FA 1A3LH 1MRDH 5EO0A 3C5ZC 4F2FA 4G9DA 1I8AA 5CLZA 1B4TA 3ZRCC 2HPTA 5JO5A 1DL7L 1D5BB 2AKRB 3ZDYB 4ADGA 3LX9A 1UM6L 4ELKA 1NEZG 4F8QA 5TH2A 1IC1A 4RLDA 1MHCA 4MGXA 1LEIB 1CMOA 1FN4A 3HBQA 5KG9B 4AJVA 2WWMC 2AJZB 3RGVD 3GEWB 2R0KL 1FZMB 4R4BA 1T21B 4B9GA 4D2NA 3M8OH 4LMQE 2MIZA 4NWTL 4ZT1A 3L5XH 3KL5A 4R7VA 4N2GA 3HG4A 3QXAB 4NO0D 3ZE2F 3ZDYE 2O6DA 3TNNA 1FORL 2AJUL 1IC4H 5AUMB 1RH8A 3FF8A 1EHLH 1LDPH 3GO1H 1CXHA 1WCBB 1IE5A 1XCTA 1SQMA 2Y25A 3KPRA 4RRPA 5FV2A 4IU3B 5EC1B 5KYUA 4W4NA 1S78D 2H47C 3F5WB 4PQXA 3HOGA 3T3MF 4BH8B 4PJFA 4OBSA 4HFWA 1GYVA 2NUTB 2OMUA 2JJTA 5E4EB 1AI1L 4R8WH 4PGDB 1U3HB 1JERA 1MPAH 4AG4H 1V54B 1RJZB 1RULL 1EO8L 3MNMA 2OXGA 4EDWH 1EXUB 3K6OA 1J0YA 2B2XL 3DV6A 5AZ2L 2EE9A 2CSPA 1QFOA 4QGTA 2VAJA 2WLIB 4M7LT 3DETC 1THCA 1LXMA 4QOKB 3AADB 3SE8H 1T89C 3AUVA 4OKDA 2XTJD 5KJ4A 1VEMA 4MB4A 1Z66A 3GMLB 5I17A 1A4KA 3M7FB 4LZKA 4PJDF 3UEZA 2DQEL 2LABA 2WTPA 4QIRA 2J25A 2QDWA 4P07A 5DWUH 4K7PX 4EAEA 2WLJA 1HIMH 1PDKB 1TJHL 1K4DB 3HA0A 3KBFA 3D3VE 4QOKE 2Y1VA 4OCLC 4RCAA 1MRFH 1N9PA 5I1EH 1IBGH 2Z8SA 4MDJB 2AXHA 3VDCA 1FGNH 1LD9A 3DJSA 3MDJA 4HFUH 4Z7QB 5J1AB 4QTIL 2HRPH 5J8OA 5H37A 4NHUA 3NZHH 4HV8A 4MMXB 5C09B 4GUOA 3FUFA 4XH2A 3IGUA 1ASOA 1TVDA 3TYFA 4ZOAA 3EGDB 2DLTA 3QDMD 1PLCA 2YBRB 4V2BA 1WWBX 4PP1D 5GXBB 1AQDA 1TYEB 1NAMB 1NKGA 2PXYB 3CVHH 4X7CC 5I66A 1OZTG 2J73A 2XZAH 3I9GL 1DQDH 4E9RA 2IWKA 2A73A 2ITCA 1W6WA 2VDNB 3T4YB 5J11C 3B56A 1MG3C 3V95A 1WBZA 4NM4L 5FKPB 5KBMA 3FSWA 4N1CA 1NSNH 4GUPA 3RAJL 1XSIA 3CE1A 4HH9A 3F3HA 3ETTA 4EN3D 2ZJSH 1KENH 4GQPH 3GIVB 1IGFH 1AGFB 1ZHBB 2NTFA 4HETA 3L1OH 4CU7A 1JGUL 5AW0B 3HE6C 3FT9A 3BZFA 1SXAA 3ES6B 3FAXA 4U6YB 2ADYA 2ZKMX 3SD5A 2F15A 2C3VA 4N22A 5CBAA 2EILB 3QWRD 4LCWD 3G6AA 1A4JB 2R1WA 1WV7T 3U7WL 1EH9A 1LK3L 2DM2A 4J23A 3VFVB 4L4VA 3UAAA 5EEYA 2A77L 1TSRA 3BP6B 4OJCA 1WBXB 4U7SA 1SEQL 1F2XK 5BJTB 4YDZA 5GZNA 2JMRA 2HFFB 5T1DH 5KVDH 3VG0H 2P49B 4KV5E 5KVGE 5EULV 1L7IL 2ILLA 3O6FD 1VADA 3D0LB 4PAZA 4BXVA 4U1NA 3CVHB 2PETA 5D70L 1MFCH 1WS7A 5I8OH 4L1SA 2ZOTA 5FM4A 4K7FA 1YEIL 2QKIA 3OKYA 2BC4A 4S2SB 4MHHG 3WIHA 4MA7H 2ZG2A 2FJFB 4JO3L 5KVEH 4GBXC 3F05A 1R46A 4K94L 3OXRB 1NCDL 2PCPB 1AD9A 3FSAA 3UG4A 4BFNA 2WIIB 2NR6D 3A22A 2IQAB 5GGRA 3IBOA 4PRHB 4CVWA 2Y3NA 1PKOA 3DX1A 5ANMB 3BQUA 4BFKA 1FWXA 2FEEI 4HIEA 4EN2A 1O9ZA 2W0LA 1PS3A 4AVKA 4QRSA 4J3XA 2Z93B 2Z91B 2IV9A 4OZIF 5AL0A 4P5TD 4N8CL 2BMKB 4NQEA 4PRHE 1DL7H 4X6CF 1X9UA 1OKEA 3LNIA 5SWZB 1CICC 5ANME 1ZHLA 4ZW3A 3IPBA 1HE8A 1HHKB 2CG9X 3STZA 1CO1A 2X1PA 5JHLA 4ONHB 4Y5XC 3NJMA 4AGPA 4KPHH 3UP6A 4NWTH 5HDOA 4IHBA 2YK1L 4LEOA 3EJJX 2UVEA 1DQLL 3MCYA 5SWZE 2W92A 2UY6A 1J11A 1FORH 2AJUH 4QHNA 4LLWB 4KK9C 4LRIC 1EHKB 4MVBC 5DSCA 4N0CC 1X7QA 1OOAA 4MJ5B 4CSZA 2G0KA 3HI6L 1E2ZA 2WQXA 2ZOLA 3DO3A 3H3PH 2W0FB 1JWMA 3U1SL 1AI1H 3FT3A 4MMZA 2WSPA 5B8CC 1HYSD 5F8RC 3WD5L 1RAMA 4J39A 3ZRSA 4JFXA 4LCIL 2Y1AA 1RULH 2YD6A 1EO8H 1RMFH 1NTDA 1I7TB 1PD0A 3MRCB 5TD4A 2CKBA 1DQTA 5AZ2H 3TWYA 4APXB 4LPWA 1EZVX 4JPWL 2OSXA 3B2MA 4MAUL 4TUOB 3VD9A 2NW3A 1MW3A 2VR8A 1SM3L 2AITA 5JHDA 5K9QI 2YD7A 4ZW7A 1MDTA 4LK4A 4NNPH 3MV7D 1TZIA 2APBA 4RMQA 4UV4L 4DETA 2BY1A 5D7LE 1ETZB 5J11B 2DQEH 4N8PA 2YD1A 2WM0A 2Z31D 3N0AA 2WLLB 1TJHH 3AY2A 4PIRF 1ZT7A 5FGSA 32C2A 2AQ3A 3HE7D 1P7QD 2HT3C 3AQXA 1OAUL 2BIOA 3VI3F 3APDA 3QIUC 3I3BA 1U21A 2E4FA 3R0MA 2IQ9L 3TBYB 5KTEH 3MPCA 5MENA 3DX3A 3W39B 3EDKA 3C9NB 3FFOA 1N0LA 3BIAX 3DX7B 4K94C 4LCYB 4DP4X 1WO2A 1SVBA 4I85A 1D7BA 2YHGA 4RX4D 5E2JA 1NANI 1WWWX 1YEDB 1YMHB 4JO2L 3QJZA 2AVFA 4JX0A 4WTZA 1JWSB 5I23A 3WEXA 1Q8MA 1QACA 1BZ9B 1Z9SA 2LAAA 4AK1A 2BVQB 1AY1L 1KEML 3EFDL 1Q9LB 3I9GH 4WO4D 2QMJA 1XMEB 3NDYE 1QQDA 5DJXB 4A2HA 1JYXA 3JYCA 4PJEB 3MN8A 3D48R 4NM4H 5EIIG 1WJ3A 1NBZB 3FTYA 3RAJH 3UTSA 2YA0A 1H3UA 5B4MC 1G94A 2D0FA 1AZBA 3Q1EA 5M94B 2MHAB 1VKXA 1UD6A 2WTRA 1INEL 4NS0A 1LP9F 3CVBA 3RVVC 4BFFA 4N6RA 3MRMB 5E00B 2Y6SC 1MCPL 1JGUH 3LS4L 1OTSD 1RIUL 3VTAA 3TBVA 3MODL 4HWNA 4N85A 4HWZB 2DQMA 3BO8B 3TV3L 3KS0J 4G5ZL 4ZX3A 3KDMA 3R0NA 4M8QA 4U1SA 2F74B 5JPNC 2MNJB 3CPLA 4I3SH 5PAZA 3U7WH 2XJKA 4PG9A 1LK3H 4G8GB 5E1HB 3VFGH 2A77H 3KYKH 5T8IA 1SEQH 4K3HA 5C0GA 2Z8WC 2VXTL 4HGMA 3NEOA 5FM5M 1CICB 1Z9MA 3DBSA 2FQDA 2OMXA 4AUYA 5JXED 3QEUB 2ZXEB 1L7IH 1PZCA 1BMZA 2O61B 4Y5XB 3QUYA 1PKQA 4G8GE 5DLMH 4E0RA 1F56A 1HEHC 3HZMB 1DVUA 5ESQB 3ILQC 1IL1A 1AMYA 1YEIH 3MKGA 3P0GB 1U8HA 4J4PC 3JTTA 4PJXF 4JO3H 2VLME 4K07A 4K94H 3H7BA 2ZUSA 1AYOA 1ZLWK 1B2YA 2MRYA 3TZVB 3ROOB 5AG8A 1G9HA 5B39G 5EIIA 1BJ1H 1INQA 1W0WA 2H9GA 3H9YA 5B8CB 3LKOA 1RUAL 2ZF8A 4RIRB 4GQZA 4GAYA 3WIIL 3DUUA 4D9RE 4Q56A 2QELA 4NP4H 4AXWA 1TNNA 1J05A 1MZZA 3IMUA 1AJ7L 1JPGB 1DFBL 4IOFC 4N8CH 5JQIB 4NNYA 1KY6A 5JORB 3RFZA 1HILB 4JRXA 1A7RL 4ECNA 3Q8BA 3B37A 3HMWL 1E9PB 4LLMB 2C9XA 2R29A 5H2BA 5KSUA 2Z7WA 1SEBA 3FRPG 4H8WC 5G4MA 2ESVB 5AOZA 5JZ7C 4GXVH 2YK1H 4JPIA 4OZHF 1IAII 4B95C 4I1NB 2Q76A 1CFQB 4ODUA 1DQLH 3DURA 4PV9B 4RNRA 1RZIB 2RCSH 5CEXB 5CIPH 1ZANL 3CZNA 4M9OA 4MJHA 2PYEE 5E1GA 3PWVB 3V8OA 5BVPL 3N42F 4YXHL 3WJJC 5E6YA 4WJG3 2ESVE 1YMMA 3HI6H 3E6HA 1D5ZA 5KANG 4OV6F 3IPEA 1T0NA 2UWEA 3GFUA 3U1SH 3WD5H 1T2QH 4LCIH 3GMOA 4N5UA 2XWBB 1KGIA 1YCSA 3HZ3A 4QYOA 4UTBA 1EZUA 5M95B 4GG8A 5GZOC 1YY9C 2ATAA 4NCDA 4P2RD 5EU3A 5CFAA 4HAKA 4HUCA 4KZCA 4S1DD 2FH6A 4X6EA 4MAUH 2NCEA 3I3EA 3W5MA 5F7DB 4X9IA 3OC5A 3LKSB 3CXHK 5AOIA 1SM3H 2X4QA 2VABB 2XWXA 3T71A 4PJ8A 4FXKC 3C5JA 1RHFA 1W8EA 4LLVB 4N3TA 2ENPA 3I2CH 2YRBA 1MHEB 2VQUA 4O9HL 5C2BL 1D5MA 4QEGA 2DEWX 2PCFA 5KS9A 5D7JD 4G6AD 4EMZA 1A14L 5FYLD 1WD8A 2AGJL 2EIBA 1OAUH 3HRZA 3I85A 1Q1JL 2Q6WB 2DYPD 1F45A 4N0UB 4NX0A 5C07B 1FDLL 5CIPB 1ECZA 2ZSWA 1JWUA 2HJKB 3GZQA 1Z6JT 5HGAA 2G3ZA 1XH3A 3NMEA 4GO6B 4OCSL 5DD5L 3B2DC 4K15A 1ZEAH 4B3VA 4E41B 2QHRH 2UXTA 1FFQA 1HI6A 3G5YA 2PTUA 4JO2H 2OTPA 4JPSA 4N0UE 5ALCH 1U8KB 2GI7A 4JZJC 5C07E 2DEXX 1BIIB 3WELA 1HINL 2EXSA 1MLCB 1ZLEA 3AVEA 4JM2D 4E41E 1A02N 4ODVL 1KEMH 3I9PA 4HK0B 3TJHC 4X9HA 2B5IC 2H0PA 2YAPA 4BH7B 4NKDB 4MD0B 2E7DA 2QADC 2BRRL 4LLDB 4XWOD 5HPMB 5IHZA 3FOMB 4L23A 2C1OB 3WFCL 4I9XA 1B88A 3QI9D 3TWCL 3TL5A 3VFPB 4FDWA 4EBQL 3TO2A 4NT6A 4KTEL 5ECGA 1INEH 3MROA 3FH5A 3UBGA 2GBTA 2VDQB 2XVKA 1OE2A 2PW2A 2N0MA 1SHMA 3K71B 2R69L 3LS4H 1RIUH 2CDEA 3KLLA 1CG9B 3MODH 5JOFB 3X13B 5GJTL 3TV3H 2E5EA 4TTGA 5E6ZA 5LXGL 5HHMB 4KDWA 3CTTA 1QA9A 3IU3B 2Y2TA 3HG1A 2X89D 4JFED 2R1YB 3F12B 1TF4A 4NBYB 4W93A 1TOXA 1COBA 3V5DA 4YDJA 5HHME 1FL5A 3FONA 3A6OA 4C56A 1JHTB 1UTDA 4HCRL 2H6PA 3K4DA 4YDMA 1WHOA 1J9RA 3SQBA 2HZHA 1O9WA 1YN6A 4TUKL 2ZKXA 1JFHA 4Y2DA 4NZUL 4PVMA 3N1FC 3PV6A 1OANA 2FECL 3GKWL 5IEKB 5T33L 2A5UA 3OKDA 4TMPA 4JKPL 4AYSA 2CKNA 4DPAX 4NN5C 5DS8B 1KCWA 2HB0A 3VSUA 3C8KB 1OF0A 4KXDA 1VRSA 2PCYA 3QQ3B 5KBKA 1M6OB 1RUAH 2VWEC 3N40F 5IVOA 5EG6C 5CCJA 1DVXA 1FVDA 3WIIH 5HSFA 2YMOA 1MLBB 4DO5A 1AJ7H 3O6MH 4ZAKB 1DFBH 3TIEA 2YD4A 5KYYA 4WIQA 3HVNA 1A7RH 5GS1C 3LN4B 1IJNA 4JHAL 5CCKH 3HMWH 4WFFD 4WFHD 1W80A 3GNML 3O4OC 4FXKB 4WAFA 3D18A 3FPYA 4AYDC 1XCXA 3WS6A 4QKTA 4WK0B 1GZHA 1YUHB 2V2XB 5EZJB 4AIZB 4L4TD 1I82A 1OLLA 4WW2C 4F58L 3FQRA 5BVPH 1FYHB 3T4AA 4XT1C 1WZMA 4YXHH 4Z7OB 2IDFA 3HTLX 1CT8A 1M42A 4LQFH 5C0AB 1CGSH 4MJ2A 1GCYA 1VGKB 3DC0A 5DF0A 4X2UA 1CPUA 5I28A 3DMMC 4OZ4A 2EDHA 1QRKA 1V5JA 4Z7OE 4ZMOA 4L1LA 4ZUTA 1SUJA 1HAWA 5C0AE 4MAYD 4QHMB 4JL2A 1AACA 3DUHA 4ELME 1G7QA 4A6YA 1R5IA 1G9NL 4GXUM 3FQTB 1D9KD 2BNRD 2JQAA 4BQ9A 3KGTA 3CDGB 4S1SL 4YEFA 3EH1A 2XWJB 3EFOA 2AQ2A 2B5IB 4G7VH 4FA7B 3VFNA 4QNPE 3KGSA 4YBHA 5K1JA 4O9HH 3HS9A 2D73A 4N9GA 1BLIA 3NIFF 5ILTH 1QR4A 4F91B 3UP1A 2VLRB 4FZ8L 2I32A 4HHAA 4XPFL 1A14H 1JE6A 4Y8DC 4DKFL 2DZEA 2XDHA 1Q1JH 4P2CG 3MV01 3FB7A 4KJWD 2HT4D 3KW7A 1SVCP 2G5UA 4LKCA 1NGXB 4HPOL 1UJ3C 1KB9J 3CHSA 2VLRE 1IFHL 5DD5H 1H15A 3AITA 4OCSH 1KELL 5DO2C 3D30A 3PP3K 5JIKA 5CD3A 1G43A 2ZKHL 3CDYA 1FYTA 3MUGA 4EI5A 2NY1C 2IALA 3UZQA 3G9AB 4LSQH 4KJPD 5C0CD 1PZAA 4XNYL 1HINH 3OXSB 4CNIB 3OG4B 3MQIA 4UNVA 5DXWA 3V52L 5B7MA 1N4XH 1OGAD 2OK0L 3OBAA 5EOTB 4HOMA 4QJ3B 1DQIA 1H0DA 3F7YA 2BRRH 1J5DA 2ZX9A 4M6OL 3S35L 1S3RA 1QLRB 3RLSA 5LLIC 3PWNA 1H6UA 8CGTA 3WFCH 1CXLA 2NY2B 3TWCH 1IMHC 1UWXH 2VMFA 4F2MB 4DW2L 1Y18B 3BQVA 4KTEH 3E8UL 3GSOA 5HYFA 2ADIA 1IM3B 2Z92B 3EGSB 4WSKA 2WVUA 4V1DB 3VFMB 2WUBL 3US9A 2IADA 2R9HD 3ARFC 3NCJL 5F0MB 4U2ZA 2RA1A 3DSFH 5IVNA 4PREA 4LLUA 4NN5B 1L0XA 1TXKA 1AS8A 5L4JA 2X1QA 5MHSD 1JAEA 3M88A 3IPFA 2FEDD 2PO6D 3REVA 1O7DE 1KPUB 2X38A 5E6IB 2Z4QB 2XKSA 1W2KT 1PNCA 4UT6A 5SWQB 3UAEA 2XV2A 5GS1B 5TDNA 2ZP0T 1K6QL 1RHHA 3O4OB 3CFCH 1NBQA 4L3AA 4B9YA 3KLKA 5INCB 1WFJA 4NENA 5DVLA 2DYRB 4FXLA 1KDJA 4GRWB 1U4FA 4JGMA 1PX3A 3N40P 5K9QG 1QZNA 1A3RL 2B4CL 4TUKH 1E5UI 4HKZA 3E6FA 3X11B 3TYGH 4M7KH 1MY7A 2HTLD 4NZUH 5T33H 3GKWH 5CUSL 2PWDA 1HEJC 3QJHB 4GRWE 2FJUB 1OIOA 3LRSA 2B59B 1MH5B 1NC2B 1BQSA 1XSOA 2G5RA 3VQMA 2ICWJ 4N20A 1DVFA 1RY7B 4WHTB 1XGYL 1AD0B 4RSYA 4ESKA 4KK5C 2EIEA 5DJ2A 1KJ2B 1WYJA 4YMPA 2F61A 2FZ3A 2WANA 1UZ8B 4JHAH 4E9VA 3Q3GB 1FNFA 4LP4A 1WK0A 4I77L 3GNMH 4FLOA 2NQDA 5HHPA 3IDUA 4QRRA 1TU2A 2X7LB 4F58H 2IBGA 1A7QL 3D85A 4XVJL 3BAJA 1IO4C 4Y19B 2JV6A 3I75A 3E9UA 3EYVB 3QEQB 4OLUL 1JYVA 1ED3A 2BFVH 3VMOA 4HCIA 1ZDSA 2WWNA 4OQTL 3SZKC 5K59F 1UJ3B 2CLZB 1TQCC 4BUHA 3VQ1C 5IHBA 1L6XA 5I5JA 5IQ7H 4Z77B 4RA3A 4Y19E 4C59B 2XG4A 5I0YA 5AB1A 2NY1B 2VAAA 3HPLB 3S5LG 2OJEB 3TC9A 4Q6IA 4R2GC 3O8XA 5MEQB 1YLBB 1SBSL 1G9NH 2JI3A 3SJVA 4ISVA 2BCKA 2OL3B 5DHYB 4S1SH 3GJFA 2JB5L 2GCYA 3T0DA 4UBDD 2ZXDA 1JZHA 1ZV5A 4OCNC 2VDLB 4AL8L 4DNLA 1WGOA 1Q38A 2YGOA 1HQRB 1XX9C 3POCA 4R90H 4OCMC 2YXFA 3WE1A 4FZ8H 5ES4B 1G4MA 4XPFH 4XC1L 4Y1TA 2H8PB 3HLAA 3ARFB 4NQCD 4KXZH 3CX2A 1Q9WA 2B4CC 4Y9FA 4X9YA 1IFRA 1ASQA 2E86A 4B7LA 3T3PB 1IFHH 1AR1C 2BOLA 3FCTA 3Q2NA 1KELH 4CSTA 1TIUA 2KL6A 4NKOA 3FPXA 1INDL 2ZKHH 1HVXA 2FYVA 3HS8A 3OB0K 2G75A 3MRPA 2WYTA 4Y4FD 3S48A 5IUCA 1X5KA 3BZ4B 4HZ1A 3OR7B 5I5MA 2K8QA 4PEEA 1A7BA 1E5CA 1I9JH 3H9SA 3V52H 1NGWA 4H8QA 3BZEB 3IDIA 4EI6B 2Q8BH 4JKNA 4TQ8A 1DQJA 5IW6A 2ARWA 2X70B 4M6OH 4QHKI 2VMEA 3S35H 3HG2A 2APVA 3PWPA 5FYJH 3SDDD 4PJ7B 4O5LH 1X44A 1KIQA 4QF1A 4XE5B 4DW2H 2R23A 3E8UH 5E2VL 4NUQA 5ICYB 4YSCA 1H6EA 1PLBA 2WUBH 2ZG1A 3FTSA 3D50A 3NCJH 3OLIA 3WJMA 3EJYD 3RWCA 4M4RA 1UZ6E 4XGZB 4PJ7E 1FNSL 3RY6C 1GGIL 4PTUB 4QHLA 5IBUG 5FF6B 1BZ8A 3MLRL 5F72S 3UGXA 2V5TA 1EWHA 4HSAC 1TYJA 2WV3A 1SYSB 4HPYL 1HXKA 1XB6A 3MGOA 4LFHD 3RDTC 5FECB 5JNYA 2ODIA 1XIWB 1WAPA 4D8PB 3L3OC 3S97C 4P5MB 2CA3A 4EIBA 3K3QA 2FO1A 4ODWB 1S8DB 4A2GA 2DS4A 4MDIB 3UYRL 4GO8A 5ENWA 1K6QH 2XBDA 4MCYB 2L4OA 2O5ZL 2P8LB 2CIKA 5DO8A 3QHTC 3WL9B 2NRDA 1BD2A 1X5FA 5I1IL 3FT1A 1A3RH 2A83A 2B4CH 4DVRL 2JF1A 1SN2A 1ONQB 5A2KH 2CQVA 2ZONA 5KOVC 2GFBB 3RTQB 3SGJC 2BVPB 5CUSH 4NO2B 3IMWA 3BP4A 4JFPA 4NQDD 1T4WA 3BEWA 4ANXA 1TQCB 1E9QA 4R96A 4Z23A 4FA6A 3RNKB 2J43A 1OALA 4FQJL 4JJHA 4IS6A 2P8MA 3VFWA 1T7VA 4IBYA 3NESA 1OSYA 3IJSA 1C5BL 4BGDA 2AHIA 1XGYH 1SDDB 3GB7B 4NZJA 1I1RA 3ILPB 4FE9A 3FO9B 2X4PB 1THAA 1U91A 3W38A 1JZ7A 2CDFB 1X5YA 4YL9A 1GGCL 2P24B 5E7BA 1QFPA 4W6XB 5CMAA 4EIGB 4F33A 1NGZA 2VQ1A 4UWQB 5J1SC 4UTCA 1GVIA 4OLXL 5I1AB 3ISYA 2Q86B 2E6JA 1A7QH 2IAMD 4XVJH 1N5YL 4W4OA 4GRLC 1F8TL 1BFOA 4ERSH 4OF5A 5AAMA 3ZIYA 1J8HA 4BCZA 4H26B 6TAAA 1NBVL 3E7JA 3FUNA 2R2HB 2X2UA 3CX5K 3QIWA 3X14A 4AQZA 1RFDL 3LIZA 4X98A 3SDAB 1R5VB 3ZK0A 2A6IB 4MWFA 2PWFA 2QVIA 3FCSA 3ARBD 3K2MC 4YGVA 1I8LA 4JFOB 4WTQA 5D7IF 1NLBL 4MQXC 1SBSH 4GIPD 1AXTL 4OUOA 2YAFA 4LHUG 5AYQA 3KGRA 1C08A 2HFGL 4U1LB 1DLHB 5HVHC 5I6PA 2X0WA 2JB5H 3MJWA 4QTHA 3EJQA 5DJAA 1NFKA 1G1KA 1CZ8L 4DK5A 4MQTB 3FYIB 1WGVA 1D5XA 1CVSC 3U6RA 1FBIL 1OAQH 3KEHA 3QDGB 5E0FA 1EMTH 4TS6A 1CLVA 2B1HL 3EBAA 2QEJA 2LLLA 4XC1H 2ZXWB 4JB9L 5AL8A 5JW4Q 2NYYD 4QRUB 3N43B 1O7VA 4W68A 2E9BA 1RK0B 5AAWA 2PP8A 3MV11 1GYWA 3MRIB 1ND0B 3QDGE 4BKLB 5DQ9A 5IQ9A 3BN9D 2C34A 4UMGA 4YPJA 2VDKL 1INDH 3JTBA 3VMNA 1PLGL 4N0FB 1OPOA 4KRPD 3RDTB 2WXHA 3MLXL 1M7UA 1OP9A 5CR1A 5DFVC 2B1AL 2K7PA 4JY5H 2H41A 1ZE3C 1MELA 4GP5B 3K80A 4M1GL 5I6OA 2WQUA 3ZTNL 1FZOA 4UIKL 2A6KB 3HZYA 3G08A 5EC2B 2JIXD 2P3YA 1IFGA 3IETA 4KI5F 5AW7B 4X6DB 2UY7B 2CGRL 1GTFA 3QO1A 5E2VH 5FO8A 1A1NB 2GITB 5DD1H 2IPUG 2XY1A 4G8EA 4JAMA 5ISZD 3ZKMD 2FBOJ 4Z3FA 4HUWB 4AKPA 3MBEC 1J8KA 3MNVB 2V7HA 2VDML 3IF1B 4PJGF 1R0AL 3DSNB 1DN0B 5IG7A 2GC7C 2BOCA 1FNSH 4FLRA 4L8SB 2YAMA 3NACL 3PS6A 4X6DE 4D9LL 1JUFB 2BH0A 3P0YH 4GSXA 3MLRH 3IXTA 1FFRA 2OXHB 4HPYH 2APWA 2ZX5A 5LO7A 3NBNA 2P52A 5E5MA 2X44D 3DKHA 5CZXC 4U1IA 2CUAA 3F7VA 1R6VA 4ZO9A 5DEFB 1NZRA 3QXWA 4UOW1 3LDBB 1NC4A 2HCZX 2R2BA 5T3ZL 4L0YA 4XMUA 3UMNA 3LHAA 4NKMB 4OM1L 1MQKL 4MD4A 2O5ZH 4U1KA 5B39B 4M6AA 1AIFB 4PLKC 3IJYA 3MV8D 3TN0B 5I1IH 2ZOUA 3ULUF 4DVRH 4UOJA 5D6CA 3D2UA 4AY0A 5C0JB 4GRLB 4YDVB 2VERA 1FA4A 43C9A 1I7UA 4R3SA 4YE4H 5EZLB 5DHEA 1I1YB 5AEAA 1JGLL 4G8FA 2O5XL 1P2CA 5CKAA 4YZWA 2LU5A 4FQJH 3G6JA 3UGEA 1ZHNA 5B3JE 1ZE3H 3EO9L 3RWEB 3TEYA 1I7RB 4M7JL 2GK0A 3VTMA 4PTTA 2HN7B 2VR6A 1OVZA 3BESR 2XV6B 2F54A 5KN5A 2GBVA 3QZWA 5ECJE 1BJ8A 1MI5B 1MWAL 2AK4D 4P4KA 5FLUA 1EANA 1GGCH 3LV3A 3NZ8A 2NYZA 3D0AA 4WHYH 1TZHB 1EAPA 4G8IB 1S5HA 5B38G 4EEEA 2ED7A 1XGUB 1S2EA 3ARDA 4N8VG 3MA9L 4E9SA 3EJZD 4P59L 2VN6A 3G5XA 1ADQA 2OA9A 5J9PA 5CEYA 1HCZA 5DK3A 1N5YH 4BDVA 4I3GA 1F8TH 2XIDA 1IB5A 4G8AC 5KVGL 4EKJA 3QO0A 4DCQA 3T0ED 1W0VB 4G3YL 1NBVH 1JV5A 4HX1B 4URKA 3NSJA 2VXUL 2VZ1A 1RFDH 3VYOA 3QUZC 5C0RL 4PS7A 2CDGB 2E7MA 1KCLA 5JDSA 5J6GB 2UZXB 1UXMA 5IV2B 4L5FE 3QH3A 1IKNA 1R17A 4EVNA 4KZEL 3SCMB 4TRPL 3NCCB 5AW8B 1UASA 4AC4A 5EH1A 3JVGA 3IN2A 2VLJA 3L13A 2GTWA 2NY4B 2X3AA 2EE0A 3BCFA 2HFGH 3HR5B 5IK3B 4MJID 2YARA 4PYHA 2FEJA 3VGAC 1CZ8H 1CQKA 2HG5A 2AV1B 2WXGA 4YFDB 5AVUB 1FBIH 1XF1A 3LXUX 2HVKB 3T0AA 3WFHA 1NOFA 3VRLF 3QR1A 1L9SA 2B1HH 4K55A 4JB9H 4XCFL 5T1KB 4HUNB 5HHOA 3JV5A 1J9QA 1CFNB 4JN2A 3ZSSA 2AJYL 3CFUA 4UIMB 4FI6A 4B9PA 5MEOB 4XN7A 2E9GA 1M71B 1TEGA 4KHXL 4TQEL 5AW5B 2VDKH 3MNWA 1PLGH 1URIA 3MMEA 4JQIA 2X28A 3T6ZA 1M2VA 3MLXH 2F58L 4XCNA 4E9YA 5EU4B 2B1AH 4N2LA 2HVJA 1E27A 2TSAA 3HBPA 4N2KA 3EJSA 4H13C 4M1GH 3ZTNH 5IJKA 3B9KD 4UIKH 3KGUA 2ED8A 2C5DC 4M5ZL 1D6EB 1QLFA 4ZW6A 5AZUA 5D6DC 3PNWB 4PRBB 1OCWL 3OJVC 4LSVL 1KLFA 3WNOA 1KCKA 4X8CA 2QPFA 2CGRH 3RGVA 1UT1A 5HJ3A 4RMBA 5D7KE 1FFNB 1I1FB 4MCNA 3OJDA 4BZ1L 4NO0A 3KPTA 4QTFA 2VDMH 1IM9B 2VL5B 1A6VL 5AW4B 2WYIA 1HKLH 3FUIA 5D4JA 3O4LD 3NACH 4D9LH 2VE6B 2EICA 4DGWC 3QQ9C 4UM9D 4DGVH 4NLHA 4Q2ZA 4ODSH 1MZYA 1A6WL 2OV0A 3MZGB 3Q0HA 4FS0A 4QO1B 1OQXA 4IRSD 5GSRB 1CD9B 3U36B 2DWXA 3KWTA 4K8RD 4FQ1L 4UAHA 2GJ6A 3BFWA 4KKLC 3L95A 3H6JA 4QYAA 3WFBL 5KVMC 3CFJA 2O72A 5T3ZH 3RUGF 2BSSA 2YXWA 4WFED 3SHSA 4OM1H 3NH7H 1MQKH 5ID1A 4OGZA 2YA1A 3EGXB 1H3XA 2WOBA 3MYJB 3R7RA 1KNOA 5G5DB 5TK4A 3FRUB 2JB6A 3TA3D 3GMPA 1KPRA 3D06A 4R97C 3ZDYF 5F9JB 4L1HA 1D3CA 3MRKB 2V4LA 3R1GL 4HIHB 4MZIA 1AANA 4FMFA 1XAUA 2QPSA 2A9NL 3LN5B 2VRKA 3QUZB 5I1HL 1SN0A 4ODBD 2O5XH 1CDGA 4HSCX 2CE6A 2JJWA 4PJDA 3UCRA 4CC0A 2YGPA 5K9OA 3KAAA 4R83A 1R3JB 3BEVA 1JK9B 3EO9H 4BYHA 1YNTB 3UL4A 1G5AA 1TVBA 4W9ZA 1I8KA 4JGUA 1CLOL 5EORL 4F7MA 3SPCA 5FCUL 3P9LA 1MWAH 5C08D 4LPTA 3VGAB 4FNQA 1ERNA 1AZNA 1IGYA 1UWYA 2HLAA 5JTWA 1MCQA 3PAUA 1TEFA 3MA9H 2YUVA 4WW1A 5DQJA 1GHFH 4P59H 4DZBB 2DWDA 2I85A 1TETL 2ZUTA 3TNMA 1U3HD 5D4HA 4NRXA 3QNFA 1CDUA 5C0EA 2WQVA 4HKBB 2OMVA 3KYNA 5K5YA 4XMKL 2VXUH 4EN3A 1HXYB 4JRFA 5C0RH 3S3CB 5CJQL 2CM6A 3QA3B 1H3PL 3LD8C 4HS3A 1CURA 4AQEB 2OX5B 4QOKD 5IVXB 4NC2B 3D3VD 5SX5H 1GMIA 2YPVA 4KTGA 2PWHA 2XVGA 3TIDB 3GPEA 5DEGA 4LCWA 2EABA 2FT7A 3TBBA 1CCZA 4Z7QF 3PAYA 3LEYL 5HYJD 5IVXE 1CU4L 4YQXL 1O6SB 2V37A 1W72B 1T4KB 4ELDA 1YQVL 5T3ZD 5SX4I 2J6EH 2WN3A 4BIKA 3QJQB 3CBKB 2AVGA 1TQVA 3GXFA 1BZQK 5D1QD 4LGSB 3HFMH 2D3VA 4MA1B 5I6XC 1B9KA 2XKUA 3DX6A 3IN0A 4XCFH 1BVKA 1G9EA 4DERA 2C3HA 5E8OB 1DQML 3T6VA 5TDOB 1XR8B 2X6UA 2IANE 1D7CA 2GIYA 2JSFA 3C08H 4OCYL 3DXAD 3U9UB 4OUUA 3H85A 3FQWA 5AW6B 4DZ8A 3NFNB 5FOJA 1U8CA 4KHXH 2PXYD 4JHWH 2QV2A 1E43A 2R4RL 1JN6B 3CGTA 3QC5X 3U1PA 2OBGA 3N50A 1KF9B 2WLHA 2Z35A 5LGJB 3NJFA 2DLEA 4OI9A 2YPLB 4EZLA 3O11A 4FTVB 4QRPB 5JIIA 2GC4C 1K85A 1G7PB 4X5XA 4NAMA 4YNYB 1QSVA 4BSWA 5CLYA 1I3RB 4HG4K 1WRFA 4GAFB 2BLFA 4M5ZH 4DP1X 4P5TA 4RMRA 5DD6B 1BQLL 5LQBL 2YPLE 3RL1B 1YC7A 4FTVE 4F15C 1OCWH 4QRPE 3V0FA 5IP4A 2FYYB 4LSVH 1U8MB 2YD9A 4BE5A 1RZJL 4OZIA 4BZ2A 4ZTEA 5CN3A 3IJHB 4G7RB 5EUOA 4X6CA 4BZ1H 2LAGB 5EEVA 3NEEA 4ZPTB 1A6VH 4P57B 1IKFL 3MJ9A 1S3KL 1MCOH 5FV1L 2BNQB 5IB2B 1AOHA 2WBJB 4UANA 1OCZB 5I74C 3SDYL 1T66D 4LGPB 1MJ8L 4X4ZA 1F6FB 4MLSA 1BOGA 8FABA 1KTLA 3ABKB 1A6WH 2DBLL 4ANVA 1BEYL 4O2FB 4MSWB 3J7HA 4OF7A 3BP7B 3P4MB 4X8JB 4UTAA 2VC2B 1ZPUA 4FQ1H 5SV3A 1ZLSL 3WUWA 3WFBH 3FH7A 2HJFA 3SYPA 3T8XA 5JPMA 1YEGL 4H25B 3F8UB 4F9LC 1EGJH 3FO1B 3AXLB 2X3BA 5FDWB 3IM1A 1HHGB 3L6FB 5DD0L 3MV7A 1QBAA 3Q1SL 3T0VA 2CJSA 3A5VA 5A43C 3KD4A 3B83A 5JW3L 4IRJA 3OGOE 3R1GH 3SGDH 2Z31A 3ALWA 5IB5A 3VJ6B 4KX7A 1GZPB 1AKJB 2A9NH 2XXFA 2W07B 3HAEA 3HE7A 1P7QA 1UXLA 1SZNA 1EVUA 5SWZD 3AAZA 3LD8B 2F08A 1LEGA 1YO4A 3GXTA 2ZT9C 3N1PC 3Q6FB 4XBPB 5KSAC 3B2UC 1DVQA 2IPTL 5IQLA 2QFPA 3VI3A 1JJUA 2VDOL 2LLNA 3HZVA 4FNPA 5EORH 3DVFA 5FCUH 3KHOA 3FU9A 1U8PB 3KYOA 4RX4A 5CP3A 5LHDA 2CRMA 1WSST 1OAZL 4AQOA 4OD1L 3D2TA 3U4EB 2O30A 3GLEA 1DANT 5B1AB 6FABH 1BQHG 3LKNA 4MMYB 2E59A 1KIUA 1N18A 1ZLUH 5L88L 4PBXA 1ZMYA 1P4LA 1KYOJ 1JK8A 2NDGA 4WO4A 4HU2A 3LQZB 1JTOA 3IMTA 5FUCE 5I6XB 3QXDA 3BYTA 5TJWK 2C3XA 4HGWB 4QCIA 2QPDB 3S5LB 1YY8A 1T7XA 2ADJB 2UYLA 4BE6A 2AQSA 3ESNA 4ZMQA 1ZTXL 3H9SE 4ZUUB 1IAKB 3QUMB 2GIMA 2QVMA 3MFFB 1OHQA 2JELL 3O0LA 5CJQH 5D7LD 5I16A 1H3PH 1G7MA 2XPGA 3F04A 1ZT1A 3L3HA 3F62A 3BPCA 1LO3H 4PJHB 1I8IA 2WCSA 1LP9A 5C3IA 2PTVA 1RLWA 1OM3L 2AC0A 3KYMB 3S3BB 5B3NA 4WHCA 3C6SA 3PJSA 1BF2A 1NUFA 3QRGL 3NA9L 4YDIL 4LBEB 4YQXH 2YKLL 3ZUCA 1YQVH 3E3QC 1NCWL 4N2IA 4PJHE 1MQ8A 2CPCA 4AK2A 4OIIL 3N3EA 4JO1H 3QSKB 5K9KA 3AT0A 3KPOB 1N6QH 4IBWA 1HHJB 1FLRL 1KN4L 4Y89A 4LEEA 4HS6A 1DQMH 1QSEB 4LLQB 3ETBF 2Y2YA 2ZP8A 3IGAA 1QKZH 3Q8EA 4OCYH 2OZ4H 1ZWIB 4M62L 2Y06H 3VSQA 4CSSA 1J5OL 4MKMA 1A9EA 1HOEA 3PHOA 4G11A 5I74B 4PJEF 1NLDL 1XR9B 3QUXC 4P5RA 3NSDA 4AMXA 2H5UA 2W88A 5F0PB 1QSEE 5E8NA 1S7RA 1FVEA 4Y5VB 4PJXA 4AEIH 2ZUYA 2DQGL 2B3IA 3OD3A 4UU9A 1MAML 5C0ND 4A55A 5DURB 4JLRA 4HSQA 4YX2L 2BWDA 4OJEH 4FQQA 5H35A 1PY4A 1PNDA 3CDZB 5CD5C 4KVNL 4PWEA 1TKWB 1VACA 2RBLA 1PIGA 4QLRA 1BQLH 1G6RA 2MTAA 3BFOA 2OTWB 1EDHA 2Z7YA 4XB8A 4LNRA 2UZYB 5DHVH 3LZFH 4XCCL 5IBUB 1Q1PA 3X3GL 4NFDA 3LXCA 3UJTL 4F7EB 4Z3JA 3MC0A 4K5MA 4YVUA 2CO1A 1JV2B 4RETB 4DQAA 2DM3A 4U6XA 1IKFH 4G5AA 4NLAA 1QRND 1WTGT 2CA4A 4G8GD 4L48A 1B4JL 2QQKL 1ZXKA 3KPQB 4UQCA 5T3XL 1OP5K 3SDYH 4R7NB 1MFAL 2YEZB 3MTRA 4OZHA 2HG0A 2NZIA 1JXDA 1T7ZA 2AXGB 1CIUA 5GRVL 4RWYL 1UB5A 3S3SA 4WLCA 1LNUB 2A3TA 5EA0L 4JR9L 2DBLH 1JGEA 3ARYA 3GZPA 5FKAB 3SB3A 2ZSVA 1PYWA 4R6UA 2A9DA 1KGJA 4PR5B 4ZUWB 2G3NA 1IQDA 1ZLSH 4NQTA 1PD6A 2YLHA 3EZ8A 3D39B 3F7LA 4EUPG 1NUNB 1WAAA 3C60A 4P2RA 2G60L 3NCEB 4JRWA 1ACYL 3G5VB 4GKZB 4U3SB 3TZVD 1H5BA 1ODAA 3RWJB 3CFEB 5E1AB 4X5WB 2AF2A 2VKWA 3I6SA 5DD0H 2F7QA 3D39E 1C12A 4NOFA 3B7SA 4Y88A 4OB5L 2GYSA 1E9OB 1HE7A 1AIZA 4EJ1C 5JW3H 4IIQA 5L2JB 5CEZL 5D7JA 3CFBA 3RZCB 5MI0C 2XN1A 9CGTA 4JVWA 1NCUA 4ZG1A 3CHQA 2DYPA 2PKDA 1BPLB 1P1ZA 1KPVB 2PYED 2DIBA 3MJ7A 1JHKL 5ALBH 1SUHA 4RQQB 4L9LA 2EACA 5FO9B 2IPTH 1MVUA 2ESVD 4X4XB 2D03L 1AGDB 4XRCB 1GH7A 2J88L 5DTFA 4KKCC 4FG6C 2WLNA 2B9BA 2F5AL 3TFKC 1E42A 3Q2VA 4PI0A 3GXUB 4OD1H 2OMYB 4MJ4A 1L6ZA 2XOTA 3GTVA 2VO5A 1Y0LA 4LT7A 4LVEA 5J3HD 3GM0A 3WNNA 5KSVA 2OQJB 1OP3H 2XIBA 3HR6A 5L88H 4KQ0A 3FN3A 4OBRA 4ZFOA 3I6GB 1Q9KA 4CAGA 3HHSB 4GQ9L 1TYRA 2R39A 2VQTA 1JZDC 1NBYA 3OC8A 5F9OL 2YPKB 3QI9A 5DK0A 3GUTB 1G87A 2IV8A 1ZVSB 1ZTXH 5KOMC 5KAQF 3EH2A 3LNGA 4LHUB 4P8QA 3NN8B 4G9FB 1QEXA 4P99A 3LYRA 2NXZC 3QUXB 1CTOA 3FTGA 4PRPB 4J8RA 2FO4A 4AUUA 3BGMB 4PB0L 3TURA 2JE8A 2NY0C 2NSMA 3VYNA 4WHDA 3W5NA 3L3JA 3X3FL 1OM3H 1ROCA 2P43B 1S7QB 1J1PL 3N44F 4OFIA 1LE9A 3OR6B 1HT6A 4G9FE 4CU8A 2BWQA 2NY3C 4PRPE 1VDGA 4P9HL 1Y07A 3IB4A 4YPGB 4I18C 3VD3A 1AO7B 2IXQB 4RMVA 5LBSA 3JV6A 3QRGH 4LOFA 3NA9H 4XNAA 4ZNCD 5EU6B 1NCWH 5FYKH 5HYQB 2D31B 5KYWA 4OIIH 3RA7L 3CWGA 5C07D 1N2RA 4X7SL 1TPXC 3H9ZA 4IGBC 1AO7E 1FVCB 1FLRH 1KN4H 4E41D 3PGCA 3GSNB 2YRPA 2EP6A 5EU6E 5IWLA 5JHMA 4ANUA 2XNAB 5PCYA 1YYML 5FOBB 1IAOB 2G9HB 1HSBA 4G42A 1B0RB 4JY6A 4M62H 4W9LC 1J5OH 1YEFL 3V7AG 2ZYIA 5LAPA 1NLDH 2JXMA 3FFDB 2ZTBA 5BOPA 1QD0A 2NZ1A 2DQGH 1ORSA 1MCEA 1OWWA 3ARSA 1MAMH 4DP8X 1T0PB 2Y7QB 3DVGB 4YK4C 4TLUA 3L9RB 4G1EA 4YX2H 3QHFL 5BVJA 4DJMA 5D2LB 3OZ9L 5MEPB 3HC0B 2WNKA 3WYRA 4KVNH 2HUEA 1XEDA 4WEBL 3H56A 3SY0A 4FXGA 1JPTL 3SYAA 1CL7I 5D2LE 3HCVB 4XCCH 3X3GH 1YDPA 3HI5H 2CPUA 4WV1B 3UJTH 1WWAX 3SE3A 5HHMD 2ITFA 1UXSA 3SE4A 5DR5L 2W94A 4JPVL 1B4JH 2QQKH 2ZOKA 4P2OD 1KCVL 5T3XH 3LS5L 1MFAH 4IOIA 1NQBA 3HS0C 4GRMB 1EV2E 4RWYH 3TPUA 1F18A 2IIJA 2MOVA 3M1BB 3SPJA 4HJJH 4P46D 4JR9H 3V4VL 2DDQL 3K8LA 2VN7A 3FQXB 1KTRL 2YD3A 1VFOA 4FNSA 4XI5C 3VXTB 2LTQB 3CZFA 1HQ4B 1BA9A 4JFFB 5GGUA 4MAYA 5F9DC 3W9EB 2W65A 5AOMA 2G60H 4JFDA 1U2CA 4C54A 3U6XA 3NCFB 4E5XG 1ACYH 4JJ5B 5KSBB 3O3DB 3PWUB 1WA1X 3BXNB 3WBDA 4JFFE 1TJIL 3FU7B 3M07A 1F11A 2A0LD 2EO7A 1CGTA 1GOGA 4LOUD 4OB5H 4M93B 5DUJA 3TPKA 4DKTA 3LNFA 2VR9A 3VWKD 3W3BA 5KSBE 2F5BH 1LL1A 2FX8L 3CQFA 5CEZH 1E67A 2DBJA 2C4XA 4ZAKD 5DHMC 4QRQA 3ARZA 4GLRH 4OCRH 1X5ZA 1P4BL 1U3NA 2NXZB 7FABL 3CFDB 2EDTA 3UPCA 25C8L 3DUSB 4FFZL 3RQ3A 1JHKH 3VXNB 3BDXA 1TT6A 4NCC2 5B38B 2WSKA 5I75C 2FQFA 4ANWA 4M1CD 3BAIA 4A7SA 4FQIH 1PAMA 3MUUA 4Z7OF 4N8VB 3QORB 1U8IB 1A2YA 2WSDA 3IWVA 2YLKA 3VE0A 4HIPA 1QR1A 5F3BA 2F5AH 2NY3B 3U4AA 4JDZB 4I18B 1OB1B 2EYTB 5C0DA 1KCBA 1RZ7L 5JHLL 4KQ3H 2WINA 4AOFA 4HPHA 4NQVA 4AEFA 5C0AD 4OLZL 1KULA 1OGAA 3M6DA 3L9BA 3UG5A 3F6IA 1OE1A 1TZAA 5CJ8A 1TPXB 2APSA 4IGBB 4WJ5B 1NCAL 5GJSL 4GQ9H 2LT9A 1WTLA 4WKZB 5F9OH 4AYFB 3RI5F 5GGVL 3KM1A 1ORQB 1Y6NR 4F9PA 3CZJA 3B2XA 4PWHA 3GSWB 5AB0A 4XNZC 3WEOA 5HPOA 3EJRA 2H45A 5ICZA 2OYMA 1I9RL 3QR2A 3JYBA 3WE6A 4I0CC 3TVMB 2FL5A 5I8CA 2CKBL 4FNRA 4XNBA 1B0IA 3X3FH 3PP4H 1G7LA 3O2DA 4P3WA 5CJXC 5LUMA 2VLRD 2PO6A 3UTTE 1Y1UA 2C9VA 2EDFA 4JUTA 1BVNT 3I6KB 1BSIA 3HC3L 2X1WL 4XCYB 1P1VA 5GZNC 2F6AA 4OKVB 3VFTA 4PMFA 3NJIA 4G6MH 4F37F 3ZMNA 4X7SH 3APNA 3UFIA 2VKXA 2FGZA 4PRAB 5CSGA 4FQ2L 2XV0A 3WIFA 4ZOBA 4A7GF 1YYMH 2IDCA 3RWDB 1FG2B 2QKIC 5IEHA 2PPAA 3CH1A 5HXMA 3BD3A 1YEFH 4UZGA 4RFNB 2GJ6E 2XHNA 3L9EA 4G2AA 4AH2A 5H37H 4I87A 3T3ME 3HS0B 3RB7A 1R19A 2XN9A 3LRHA 4QXTB 1EJOL 4KITB 4PJIB 4A1RA 1CGXA 5F1OB 5BCAA 3TBWB 3WFZA 4FQXB 4U1HB 1BCIA 2WZ6A 1HXMB 4P23C 3ULUC 2NY2D 4XE0A 5CJOL 2EYRA 3O3EA 3Q2CA 1TDQA 1G1OA 2GTZA 3OZ9H 5TF1H 1IGJB 2R8SL 4PJIE 4HLJA 3ZHFA 2NNXA 4WEBH 1RZ8A 2JCCF 3V6OA 2H3NB 4OCWH 5AW9B 2AJ3B 1JPTH 2AAVA 2VMDA 3LH8A 4MYPA 4I0PB 3KPLB 1MJJA 1OT1A 5E1QA 4DN4L 3BW9A 1XH2A 1RXLA 1UFUA 3TCTA 3VXSB 4MZRA 1VF5C 4LAJH 1IILE 5IOPB 4ZMWA 5DR5H 2R15A 2HFEA 3T1FA 5E6ID 4JPVH 5D7SL 3LS5H 1KB3A 5HI4D 3EFFB 4UQIM 1A6TA 1M1XB 3VXSE 2VZVA 3WTTA 1E6JL 4GRWF 2R69A 4WW2F 3UCQA 5D2NA 3GSUA 3U48A 4MMZC 1PTZA 1UADC 2Y5TA 1B3JA 3B2VL 1L9QA 4QHUB 5DWPA 3TT3L 4AZ8B 4LEXL 5IW1A 5KWYC 1XBRA 1XB3A 2HPOA 5E1IA 5HDWA 2DM7A 4KX9A 4P2QB 2CO7A 1OGTB 2D0GA 3NQKA 2ZUQC 1U95B 1JGDA 1PQZB 4NDMB 3W9DB 3AG4B 2DIJA 4J1UB 1GYCA 2F8VA 1TJIH 1XQ4A 3WIHH 3WMQA 1EEZB 4HCRA 1WUNT 2OZNA 3MLZL 4XHJD 4P2QE 1IIIA 2QQQA 4UILH 1TMCB 4K7PL 1MFUA 4GUPB 3ZTCC 4ZMYA 5AKSA 5EUKB 2FX8H 3T0WA 3MRBB 2J1KA 2DB8A 5C92A 2PNDA 3VGEA 4BSVB 1ETA1 3M86A 1P4BH 2XFXA 4NQCA 4ZOCA 4N2OA 5DQDL 1VFBB 4NYLA 25C8H 3JZ7A 2CO6B 1WG3A 3NRPA 3JWNG 4QGYA 1E28B 4PS4L 1JFQH 4FQHB 3G6AB 3UEQA 1KTDA 3HPJA 4CA4A 3D0VB 3IDNA 2YQBA 3QG6B 5HDRA 4Z0XB 2G5BB 3SO3C 3PAZA 1AXSA 1UOLA 4Y19D 1RZ7H 2R29L 2X4SB 5JHLH 4PY7B 1MFDL 1EBPA 2BY2A 4PJ5A 4QMEA 5EFIB 1QFUL 5BRZB 3ARRA 2YRZA 2R83A 1VFAA 4Y1SA 3ZGIA 1NCAH 5GJSH 4MCZB 3SBRA 1JZGA 5JMOC 2IGTA 3SDDA 2NY1D 5GGVH 5LB1A 3ZZQA 5BRZE 1JS4A 1RJYB 3MOQA 3OKMA 4YR6B 5GGSA 1C16B 2NNAB 3OKNA 4W1TA 4YZFF 2KMWA 1ZVYA 2XG5B 3BJLA 3O3AB 4FFWC 3ZHLA 3WLBA 1I9RH 3O45B 4OZFG 1FNEA 2FSEA 4A7TA 1AGCA 2VIRB 4HBQA 3VXMB 3CHOA 1GIGH 4Q0XL 4UTBL 2CKBH 3RWHB 4L4VD 1OP4A 3HN3A 4P23B 2X10A 1J5IA 5ABDE 1SPDA 2OW7A 4RZKA 1LHZA 2B8OT 4NXSA 3TA4D 4NUJB 3T3PF 2IPKB 4ODHL 1HEZB 2C9PA 3F01A 3VXME 1NGPL 5D96C 4I5BB 1WFNA 2X4UB 2DWEA 2F1AA 3ARFD 4Q9RH 5AYTA 5SWSB 4N90E 3GI8L 4KOBA 1G0DA 5E51A 5K39B 3ULUE 3KLHD 3HZKA 1KV7A 1WIPA 3PWLB 2WAQA 2F7RA 4FQ2H 3KPSB 3D6GA 5AKRA 1MHHB 3HKZA 5SWSE 4XXWA 1T04A 4OD2A 2HWZL 1KJVA 3LPGA 4IBUA 1JNHA 1N12A 4YDNA 4HUVB 1WH0A 1UZ6F 3O9WB 3UPRA 3ME0B 1EJOH 4PJ7F 5B1BB 3T77A 3U2IA 4NQDA 3C6LC 3WHE1 2J12B 2XQYG 3CZGA 1FPTH 3IU4H 1RPKA 4MMZB 2FHCA 3VGHA 4MDRA 2KI6A 5KYXA 1MDAA 2I9TB 4OCXL 4NQED 5CJOH 5T1MB 1MUJA 2EDJA 4KBPA 4TNGA 4DP9X 4B60A 2R2EB 2R8SH 1KFGA 2Q3XA 4F5CA 4KDVA 4YSDA 2ZUQB 4PRIB 3RFZC 6CGTA 1A7PL 3AS0A 5JMRA 5AD0A 3LPPA 5A3ID 3FT2A 2GJZB 1NGQL 2PTTA 3KBHE 5CFHA 5JHDB 5GRYA 3Q13A 3BH9A 2IOIA 1F3JA 1CFMA 1KLUB 2ZCHL 5IIEA 4LLYB 4PRIE 1CR9L 4HUMB 2Z65C 5F88B 2MQCA 5JYMA 3SDXB 1VZGA 2P44B 3IJEA 4GB9A 1BREA 2BZ7A 1XIWD 5FGBA 4XO4A 3HUJB 32C2B 5D7SH 3T09A 1YEKL 1LE5B 5CBEB 2RIKA 2Y24A 4YWGL 3TBSB 3A4DA 1AC6A 1FRGL 1PG7H 3SDXE 3GRGA 2X9YA 3QRLA 1QVOA 2XICA 3HUJE 4G6KL 3GS4A 2VO8A 3B2VH 3N41B 5T1LA 3LTVA 1LO0L 2YAHA 2LHAA 4LEXH 1HDMB 5DJZB 1K2DA 1IBYA 3SO3B 4XAKE 2R0LH 2X4TB 1RPUA 2XQYA 4Z95L 3V5KA 3RTQD 1KY7A 4ZDHA 3U25A 4X4YB 5LDUA 3NSYA 5D7IA 3LJ3A 4XBGB 1DQQB 2CBTA 1MNUH 1XF5A 4CW1A 5EPMB 3MLZH 4OAWA 3REWB 3WY1A 4X0KB 4K7PH 5DZJA 1A3QA 2VR5A 1SXSA 2VXQH 3WKNA 2YSSA 4KKZA 1LP9E 4KXBA 4JNXA 4E36A 3WTUA 2WTRB 4YHLL 3CDFA 2J55A 1G1YA 4OIFA 3HRZC 4MX7A 4KAQL 2ZX8A 3QCUH 3RL2B 3GI9L 4Z9KB 5ETUB 5IR1A 1BQHB 2AANA 1KXQA 4MJJA 4U05A 3IMSA 4PS4H 2ZE0A 3VH8G 4D3CL 4MNHA 4HIXL 4M4PA 1P4UA 5AVQB 2WXFA 2BSTA 1JPSL 2R29H 4NHCH 2HLFC 1MFDH 1UURA 2VUOA 5D96B 1JDCA 1U58A 4FGMA 3RWFA 1LWHA 3CXDL 3H0TB 1QFUH 4NM8H 5GRVK 1M3IA 1L5GB 3SDAD 3K4AA 4LAQL 4YHNB 1C5DA 4W9GC 1QWUA 2XBZA 3HVDA 3MRNB 4N6QA 5TFSL 2EO1A 3VXQA 2JIXA 1LO5A 3B9AA 2FQEA 5JQ6L 1KN2L 3GBNL 3NABL 2ZF9A 4FMKA 5JW4N 5LAXB 4CRPA 4Z78A 1PGRB 1UB6B 5ISZA 3WXVL 4FEIA 4E9LA 2BSEA 2IH9A 5FA4B 1KB5A 3ENEA 1RJLB 3C6LB 4L3CA 4G6JL 3AU0A 4E9QA 2GB2A 4UTBH 7TAAA 3VU2A 4ZPVA 4A6YL 2UZIL 3APMA 1DDTA 1JZ8A 1II4E 4PJGA 3N43F 2ZIDA 3QDGD 3L54A 4AVIA 2ZG3A 4ABWA 2X87A 5JW4R 5IKCA 4JDTL 2YUWA 2E7CA 5E5UB 1G7IB 1F58L 1NGPH 1U3ZA 1X4XA 3AREB 4UUJB 3KLAA 1FV1A 1KC5L 2OTUB 3QUYD 5DLLA 5BOZG 1ZHKA 3HB3D 3GI8H 4GSUA 1YSOA 4RZCB 1OD9A 1JPEA 4LARH 4N2AA 2WW8A 4HUXA 1U8JB 3L3GA 5E7FA 4PSPA 2GBAA 4RFEA 2N1KA 2EVFA 3LCYA 3DX8A 3BWAA 2XIIA 3VXPB 4CGTA 3MV8A 2VRQA 3VXRA 1H9DA 2I69A 3QZPA 4Y2DC 1M6UA 2BVYA 2CK0L 2HWZH 4XOEA 3RIFK 5BMFL 1IIKA 5JW5A 3EHBC 3DTXB 3FTUA 4YAQB 1D7DA 3QEGL 4JFVA 4OM0L 2CJUH 1OE3A 2ICWI 2E8ZA 4EF3A 1BLNB 1QWHA 1A1OB 3OAZK 2XLLA 4OCXH 1U8LB 3PABA 4OIAA 4IW4C 4JRXD 2DMBA 4ZUVA 4FZEH 4O02B 1MAKA 4DOHB 4Y4HC 2DY2A 4EZKA 2EAEA 3V79C 5IJVA 1Z0MA 1DEEA 4NRYB 4CC1A 3MR9A 1BBJB 1NGQH 2FHBA 3M17A 5FO7A 2EUVA 1RURL 3WS6C 4XTRD 4DOHE 1IC0A 1EJ6A 2BP0B 3ILEA 5DS2A 2ZCHH 2OI9C 2HVBA 2JJSC 2PCFB 2O5NA 5I76B 5DZLA 4D9QE 3TT1L 1YN7B 3S0PA 3W81A 4WTWA 3QDJA 1CF8L 5FFLA 4OZGA 2HTKC 1BXAA 2MOGA 3CC1A 2PPDA 3T0EA 3V6FA 3IXAA 3OX8B 4EUPB 5DMKB 1DDHB 1OF2B 1FRGH 4KJYB 4X7TB 3B43A 4HJGB 1K5NA 4XXDA 4G71B 4F20A 3BIKB 1R3KA 5ICXB 2KHAA 3IS1X 5B3JF 4UT6L 4DUWA 4DK6A 1LO0H 3D09A 3ECBB 4XBEL 3TN0D 3RX9A 4C58B 4Z7WB 4GAJL 5I73B 4CADB 2E6QA 1A7OL 2E46A 2PMZA 3ARGB 4PJ8D 5INDA 1F4AA 3DGGA 1IZJA 4YHML 4MJIA 5J6HA 3QCTL 2BVOB 1ROWA 4Q58C 3DV4B 4CVXA 2VXVL 2K78A 4Z7WE 4KZDL 1UM5L 1I8MA 4JM4L 2EYSA 4IMLA 4QJ5B 4WI0B 1MOEA 3S4SA 5EEXA 3VX1A 3K1DA 2V2TB 1KIRA 2YSTA 3K81A 4ZMXA 1KGUA 1N3NB 3B5HA 4GMTL 3KDPB 4J3WA 4KAQH 4G82A 3BCDA 3IJ9A 3ML8A 1P5UA 4JMNA 4ZXBB 3U46B 5TDPB 3GI9H 3ULSB 4CGUB 2P5EB 1KWGA 1MG2C 1T22A 2W8CA 1XF3B 3QYNA 3MV9A 4WDIA 3L3KA 4HIXH 5DJYA 4EI5C 2XSKA 2YEQA 3ABGA 5LCVH 3ISWA 2WY3B 2V8LA 3I02A 3Q44A 3ZDWA 5HYSG 1JPSH 1UXWB 2P5EE 3FOLB 3N91A 3IT8D 4IBVA 3QUKA 3EO0B 1HHHA 2BW4A 1FL5B 1KIPB 4HBCL 4LB8A 1XGQA 1U93A 1U8QB 3B9KA 1I1AB 5H94B 3BX7C 4LAQH 3R8QA 4OLEA 5ANHA 5TFSH 1KTKE 3PIQB 5E56A 5L2KB 2YZ1A 4U2YA 2WD0A 1RQ5A 3X12A 1HZKA 5JQ6H 3SCMD 1J7VR 1KN2H 3GBNH 3FZUC 1DQVA 3NABH 4Y1AA 4BKSC 4YSSA 3HNTL 2AQTA 3FBKA 3LPOA 3GUFA 2NY4D 3WXVH 4JO4L 1F4YL 4QRAA 1KYDA 4R7DB 3BVNB 3GTTA 4TV3A 4D0DB 1LK2A 3O4LA 1AZVA 4G6JH 5B21A 4GJTB 2V3DA 4OT1H 4A6YH 1Z9NA 2XZZA 2UZIH 2VT0A 3CSBA 4UM9A 4WWKA 4CVZA 4PVBA 3R4RA 4JDTH 4PBDA 4GNKB 4C56D 3L16A 4Y4HB 2WVVB 1R24A 1KC5H 1KFAL 5CP7A 4J28A 5GSVA 2H26A 3JWOL 3QK0A 4GSDL 4QXUL 4AMKH 4EZJA 3BAWA 3KPMB 4N8UA 3B7UX 4OVVA 1G7JA 2OI9B 3PGFL 4NBZB 5L0QC 2BX5A 3FFCB 2AERT 1K3ZA 3WTVA 2KLRA 3V7AE 2D8KA 5D8JH 1V3JA 5CINL 2GUOA 1QI3A 1Y6KR 5DJCA 2W91A 4ANKA 4CMHC 4PV8B 2FAUA 1O5DT 3OKKB 4HZLB 1EZLA 3FFCE 3PU7A 3GRBA 4FTDA 1BV8A 2F9BT 4OM0H 4RGND 1HAUA 3RVXD 3VSVA 4ATTA 1SF3A 2YFOA 5IW3A 2AMUA 1D5BA 2AKRA 4OZ4B 1ZGLM 3RB5A 2EEFA 5AFAA 1LEIA 5F21B 5KG9A 4O51A 2AJZA 1FZMA 1T21A 1KBPA 4OGYH 1R5IB 3TJEH 2C9AA 1JDAA 1E50A 3QXAA 4JZNB 3MLTB 3FAWA 4J6RL 5AUMA 3QUML 2VZ3A 1IBDA 1RURH 2MCG1 2GSIB 1WCBA 3KBPA 4J3OC 5D1XB 2FX7L 3DJRA 4IU3A 5EC1A 2BNUB 3F5WA 4P4RB 4BH8A 2G3XA 1I9EA 3ZO0A 2FB4L 4M6NL 2X5PA 1CF8H 1U3HA 4PGDA 2WBXA 4J3SA 1RJZA 4N0YH 4JRYE 5D1XE 3B4NA 2J57A 5G2NA 3BUIA 3ULVL 2F53B 1EXUA 1QP1A 2Q8AL 3ISRA 4XPBL 5BO1L 2Y5QA 4E5XB 1T1WB 1B9ZA 3LSOB 4WK2B 2WLIA 2MQ3A 4UT6H 4LU5L 1K4CB 4QOKA 4XBEH 4NC1C 5CGYD 2FLBT 4X4ME 3VFRB 4H8HA 4U0RC 3SBQA 5AYUL 3UO1H 2F53E 3EIFA 4BHUI 5E6SB 4GAJH 1JMXA 1A7OH 3GMLA 4O2EB 4TVPL 5EDSA 3I74A 4YHMH 5GRXG 1P53A 1JXFA 1USZA 4KHTL 5FA3B 1YNTF 5TQ2L 1PDKA 2Q87A 2YGQA 1K4DA 1TG8A 4WKXA 5TK2A 5FX3A 2VXVH 3H7LA 4KJQC 1B6UA 1UM5H 4MDJA 4JM4H 2E9IA 4UT9A 1R3LB 1V55B 4K5NA 2H1PL 5J1AA 2H32B 4GMTH 4XN1A 5F7UA 4MMXA 2ERJB 4ZMVA 5E08L 2VISB 3UTZB 5DVPA 2OMZB 1ULVA 2D9QB 3EGDA 4DKEL 1TQWA 1FYTD 2XQBL 4ZZKA 3HBGA 4L37B 2YBRA 2BHYA 4EXKA 2EDWA 4R0LC 3IRPX 2PXYA 1NAMA 3GD1C 2VSKB 1KBKA 3HW7A 2EDNA 1FI8C 1OSZB 3P4NB 3EADA 3T4YA 2EXWD 4CN1A 3EDFA 3TX4A 5FKPA 4UNTA 5J57B 4J3OH 5JHAA 4LLAA 4TN9A 1YAIA 1I4FB 2EIDA 1FCGA 4HBCH 5IVXF 4D0CB 4HDIB 4MS8C 3ZO9A 3SGKC 3ARXA 3GMNB 2XN9E 4LKXB 1NMAL 3GIVA 4PN6A 1AGFA 1ZHBA 4PUBH 1EVTC 5GPRA 4KTDL 5L0QB 1ZAGA 1SHWA 1N5AB 1E8XA 3L7FB 3ES6A 4U6YA 2W60B 5BQ7B 3V4PB 3HNTH 1YEHL 4OJAA 4CMHB 3LIZL 3FSOA 1H8LA 4JO4H 4M48L 1F4YH 1A4JA 4JQVA 1FO0B 3BZ5A 3CLWA 3BDYL 4GW4B 2DRUA 1QLEL 3W56A 5DFAA 3VFVA 2HT2C 3BP6A 1WBXA 2NPLX 3BVTA 4FJ6A 5LBGA 5BJTA 2IAND 4A7QA 3VFUB 1VPOL 3ULVC 2HFFA 3U4BL 1BECA 2WJ5A 5EF2A 1KCUL 3GJFH 1BMWA 1TCRB 1KT2B 2E27H 2DQIL 4I1RA 4BSJA 3D0LA 4JUSA 5I1KH 1MW2A 1KFAH 1WFOA 1MCHA 1E2VA 5CWSB 3WIAA 5KVFE 4S2SA 3RPIB 5JIDA 4PBWD 2FJFA 3JWOH 4P3CL 4YC2C 2APXA 2VZOA 2DN7A 4QRRB 1BYPA 1E5AA 2PCPA 3WFEL 3PGFH 2WIIA 2IQAA 2RQ8A 4PRHA 4KROC 4U1JB 2YPLD 5K59E 5HYEA 4QRPD 5ANMA 2DH3A 4FQLL 5D5MB 5I8EB 1OTUC 1J8RA 5IMLB 2Z93A 2Z91A 3B9DA 4JDVA 1KTCA 3SPVB 3T8VA 4XPHH 2BMKA 2CNZA 1DVFD 3DHPA 1KZQA 2X6CA 5SWZA 5BV7L 2BVEA 3TBCA 3QNXB 4Q74A 5D5ME 5CU5A 3W1ZA 3N5AA 1HHKA 4Z3IA 4H20H 1T89A 4ONHA 4Y4KC 1I3VA 2QQLL 3MU3A 3QXVA 3ZTEA 4LPCA 3T1WA 3ZOAA 1OGSA 1MCWM 1T5WB 2BCMA 3WEMA 4L05A 2JVUA 3FSVA 4RFOH 4N9OB 4H0IA 1UD4A 4J6RH 4LLWA 2FLRT 2WBJD 5LBVA 2KZKA 4LSPL 3EO1B 2FTAA 1CC3A 4N0RA 4MJ5A 2F18A 3PDDA 4RVBA 4FNLH 4K3DL 2W0FA 2FB4H 4M6NH 2MPVA 1C7TA 4P3DB 4POZC 3UJJL 3FHAA 3F7QA 1N7ML 1ZLDA 1UOVA 3ULVH 1DCEA 4NKQB