1ZV2A

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zv2A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zv2A02
3NJLA 1AZBA 2DYSB 2MTAA 4AX3A 1AAJA 2BO0A 4L0PB 5F7AA 5D4HA 1OE1A 2WSDA 1RZQA 1OCZB 3X1EA 4E9TA 1E5ZA 1PLCA 2BHFA 2EINB 1ZDSA 1JZHA 1NINA 3NSFA 4JHVA 2VW4A 3KW8A 2VMJA 3T6VA 1YLBB 4NB7A 1ZIAA 5D4IA 3JT2A 2PPFA 1ILSA 2W8CA 2ZWNA 1JZEA 1HAWA 3SBQA 3AG1B 1SHXA 1M56B 3CZUB 1KBVA 3ASNB 2PP8A 4FAAB 2UXFA 1E30A 1V55B 3TASA 1A4CA 2UXVA 4YSCA 1CUOA 3WI9A 2PCFA 1L9TA 1PZCA 3MX0B 3FYIB 1J9SA 1OCOB 2XWZA 8PAZA 1DZ0A 3ABMB 1CC3A 5B7EA 3NJHA 1A4BA 3G5WA 3QPKA 1M9WA 2BZCA 3IEAA 3QJVB 2ZXWB 4KO5A 2UXGA 4E9QA 1KV7A 3FU8A 1QNIA 2YAHA 1GY1A 1J9RA 5I6KA 3ABGA 5AZUA 3IBOA 1BXAA 2VW6A 4E9WA 2XX1A 4BK5C 1WA2X 1MZZA 1IBZA 2N0MA 3NJGA 2B08A 5ANHA 1AOZA 2ZONA 2VN3A 2FQGA 2XYBA 5B1AB 2HX9A 1MDAA 2J5WA 1ET8A 1TKWA 2DYRB 3ABLB 1X9UA 3EF4A 3TA4D 4A2EA 2VSKB 5I26A 3V9CA 4DP4X 2EIJB 1JOIA 2DWSA 4DP1X 2IDSA 2BWDA 2UX6A 3AG2B 3X1NA 3PXLA 1KCBA 3AG3B 2GC4C 2I7OA 1BYOA 3FYEB 3QJSB 2XV0A 5B1JC 1A8ZA 1JERA 2PP7A 1B3IA 3EH3B 3ERXA 4HCGA 1NPNA 5D4JA 4KNTA 1CYXA 1NWOA 2Q5BA 3S8GB 1A3ZA 1GYCA 4HCFA 3FT0A 7PCYA 2PPDA 4A2DA 4NERA 3UADA 1BQRA 3UABA 2WO2B 2OJ1A 4HHWA 2LLNA 4A2HA 1PAZA 2VW7A 3T9WA 1MG3C 1L9SA 2IAAC 2FWLB 4E9VA 1JXDA 3IN0A 4G7RB 3UAAA 2QDVA 5EHFA 4YL4A 1M57B 3SBPA 3SBRA 2MRYA 3T6XA 3WG7B 1V10A 1FFTB 2XU9A 3IE9A 1OF0A 5I5JA 1T5KA 2EILB 2HLEB 1BQ5A 4HCIA 3FSWA 1OV8A 1GS6X 2BZ7A 3NJIA 4M3HA 3WKPA 4Q8BA 2VM4A 4UF7C 5B1BB 2XUWA 5I5IA 1ZPUA 2FQDA 3NP3A 1ZV2A 4A2FA 1J9QA 4AKQA 2H47C 2QT6A 2DY2A 2PPAA 1F56A 4E9YA 1JZFA 3CVBA 2FQFA 2Y69B 3QJUB 1A4AA 4UANA 1EZLA 2YAFA 3PAUA 4JKNA 1L9QA 1PF3A 2AVFA 2ZOOA 1AR1B 1E5YA 2OCCB 1NIEA 2UX7A 3ZDWA 4K9JA 3QQXA 2DV6A 3ZBMA 3EHBB 1WA0X 2AZAA 1PY0A 3AZUA 2CCWA 1A65A 3N2JA 4BWWA 3HB3B 1XB3A 2QPEB 4GP4B 4AKOA 3FQ2A 3NJJA 1KGYE 3FU7A 3PPSA 4BXVA 2A3TA 1MG2C 3X1GA 1IBYA 4KOCA 1SFDA 4HAKA 2PPCA 2BW4A 5TK2A 2CJ3A 2JFCA 3NJMA 1R1CA 1ZIBA 4A2GA 2OV0A 1JXGA 2IWKA 3WKQA 3AW5A 3FU7B 2BW5A 3FPXA 3OMNB 4DP0X 1UATA 2YAQA 2HRGA 1AS6A 5B1JA 1AG0A 1OE2A 1W6WA 5AKRA 4ENZA 1RCYA 4FA7B 4GXFA 1PMYA 3S3CB 2XVBA 1RZPA 3CVCA 1IKOP 5I6MA 2FNWA 2YQBA 1L9PA 2XXFA 1TEGA 2E86A 1GS8A 3GYRA 3H4FA 3CG8A 1E67A 1TEFA 2GIMA 4DP7X 2IDTA 3X2QB 4YSRA 3EH4B 1JVOA 2CBPA 1NIFA 4DPCX 4DP5X 1GW0A 5E9NA 1GSKA 1ADWA 1IC0A 4DP8X 1XB6A 3TBBA 2EIKB 2J55A 1AG6A 2FT8A 5A7EA 2UXTA 3H56A 5I5MA 2I85A 2IH8A 4DP9X 2JKWA 4GP5B 3U25A 1DYZA 2P80A 2YAOA 4E9SA 1ASQA 3FSZA 3FQ1A 2BWIA 3QJQB 4HALA 4DPAX 1BAWA 4HZ1A 5IY5B 5B7MA 2YXWA 1JZJA 1CYWA 3ABKB 4ZK8A 4X4KA 1AZCA 1URIA 3AG4B 1SDDB 9PCYA 2QDWA 2VM3A 1NPJA 1OCCB 4BWTA 1QHQA 3OMIB 2HRHA 2PLTA 2YAEA 1AQ8A 2PP9A 1TU2A 3CVDA 1EHKB 7PAZA 5PCYA 1VLXA 1E65A 1GY2A 2GC7C 2FJSA 3NJKA 1J5CA 3AY2A 2PPEA 1PZAA 4YVNA 2P80D 1KDIA 1KCWA 1JVLA 3T6WA 2XV2A 4P5SA 1WS8A 2GHZA 3GXUB 5B7FA 1X9RA 3GDCA 2IDQA 4CSPA 4KOBA 3S3BB 4W9ZA 5I6OA 2TSAA 5B1KA 2HXAA 1SF5A 1AANA 2YXVA 3WIAA 4Q89A 1ASPA 3CDZB 2R7EA 3T6ZA 4G7QB 1NIBA 1PCSA 1PLAA 3KW7A 4E9RA 1PNCA 2FQEA 1ILUA 1BXUA 3S8FB 3NSDA 2NRDA 4YSQA 3DKHA 2YAPA 4DP2X 4DPBX 2IDUA 4KNUA 2R7EB 1GR7A 1BYPA 3QJTB 5I6LA 1OOWA 1L9RA 3FQYA 3X1BA 1FWXA 3OD3A 1AZRA 1BEXA 2YAMA 5F7BA 2IWFA 1KBWA 4F2EA 3PAVA 3JTBA 3OQRA 1MZYA 5B3SB 3NP4A 3SQRA 1IUZA 3FPYA 2XXGA 3EH5B 1SJMA 2TSBA 3QJRB 3PLYA 2CALA 1KYAA 3RYMA 3X1FA 2VSMB 1HFUA 3FSAA 2XLLA 2IDFA 4N8UA 1AIZA 1J9TA 1JZGA 1OCRB 2W88A 1AZUA 1JXFA 1V54B 2B3IA 3BVDB 4G7SB 2GBAA 4YSOA 3NSYA 3FU9A 4A67A 3WNIA 4JHUA 4YSPA 2IH9A 2BP0A 3NJFA 2HX7A 2FTAA 3PAZA 2J56A 5PAZA 4YSEA 3NSCA 2CUAA 4DP6X 4N4YB 1W8EA 4WKXA 4F2FA 3IN2A 1PNDA 3NJNA 3L45A 1L9OA 2FT7A 3NT0A 3C75A 3OM3B 4P5RA 2DWTA 2I7SA 1SHWA 2BP0B 5I6NA 4W1TA 1NZRA 4HHGA 4AKPA 2IWEA 4MFHA 1HAUA 4NAJA 2Q9OA 3N55A 2GI0A 1I53A 4F7KA 4G71B 2X88A 1WA1X 4QLWA 1NIDA 5TK4A 4YVUA 3DIVA 3ASOB 2BP8A 2AANA 1ETJA 1SFHA 4HIPA 4KO7A 1SDDA 4GY4A 3D12B 4UAHA 3ZX1A 1CURA 3UACA 4BXSV 2RACA 1GS7A 4GYBA 1ET5A 4WTQA 5AFAA 2H5UA 3TBCA 1OE3A 1N70A 3UGEA 1NDTA 4BWUA 4KO6A 5I6PA 4CSZA 3HEIB 1QLEB 6PCYA 2GSMB 2BP8B 4YSTA 1AACA 1NICA 2GB2A 1BXVA 4GP8B 4AI7A 1NIAA 1AS7A 3T71A 1SF3A 4E9XA 4YSUA 4EF3A 3FS9A 4YSAA 3NYKA 2QPDB 1W6LA 1PZBA 3UAEA 4A66A 3S3DB 4G72B 4RH4A 3OMAB 3FSVA 4KNSA 1NWPA 2HX8A 3DTUB 2YARA 4YSSA 2JXMA 1AZNA 2EIMB 1XMEB 6PAZA 2AZUA 1J5DA 4AZUA 1ID2A 5LDUA 4BDVA 3CDZA 1WS7A 2CAKA 2J57A 3H4HA 1XB8A 2Y1AA 4QKTA 1WAEA 3PCYA 2AFNA 1N68A 5I28A 1NTDA 4PCYA 1JZIA 2PCYA 3BQVA 1ET7A 3ZIYA 4YSDA 2XX0A 2HZHA 4KO9A 2H3XC 3WNJA 4M4RB 3TU6A 4BDVB 1FA4A 2X87A 4G70B 3V9EA 1AS8A 1SNRA 2XV3A 2WO3B 1BQKA 1RKRA 4TXVB 4A68A 3MBWB 1PLBA 4PAZA 2FT6A 1ASOA 1KDJA 5FC9A 1ZDQA
chains in the Genus database with same CATH superfamily
5A16A 4AX3A 1A6ZB 2X6UA 4TULL 4XTRD 4YHIB 1Y6MR 1OE1A 1HE8A 1KB5B 5L6YH 5FO9A 3NJVA 4YAQB 5TDNB 3IGAB 1FNEA 4UNVA 3NSFA 4GRMA 1XIWD 1ONQA 3DGGB 5DVKA 4B5ZA 1ZWIA 5DJ8A 3D85A 3VFMB 4OLVH 1I3RA 2ICEC 1FYTB 5HGBB 1COBA 4LEXL 2YA2A 1R3IL 1BQUA 2B5IC 3SDAA 1OHZA 1JD7A 3SDYH 4ZMWA 1TJMA 4ZT1A 1I9JH 3BP5A 5I30H 4M1GH 1TO5A 5D1XD 1SHXA 3CZUB 1MJJA 4PP1C 2ZCLL 4EVNB 2MNWA 4B5EA 3W1ZA 4O2EA 4ZAKD 1RMFH 2ZPKH 3MLTB 3WELA 3LKPB 3LSOB 3MRIB 1CGSL 1PZCA 4FNUA 2DQGH 4NKDA 3B4NA 4TV3A 1T0NA 1WIUA 4HHAA 4EOWH 2NNFA 5DHDA 5EEZA 2CRMA 1NBCA 5E8OA 3EHBC 2JMRA 1SBSH 3VCLB 5AYUL 2DLIA 3WNPA 3DHJA 5I73C 5FHBL 2OJEA 2VR4A 1HHIB 2C3WA 4B27A 1V3JA 5EPMA 3SGEH 5IB4A 4MNQA 3N04A 3LPWA 4FF9A 2WNWA 2VDMH 4GRLA 4KY1H 1A47A 3FT3A 2E0PA 1R3KB 1WA2X 4N0CC 1G5GA 2IPKB 3EYQC 4R2GB 5HHPA 1XBRA 2B1AH 4NZRH 4XC1L 5ANHA 3OAYK 1B90A 2C8NA 2YGVA 3MLVH 3ZL4H 5D8JL 1R5IA 5E5RB 1A0QL 1FF5A 2DYRB 3DTDA 2WNXA 3CZFA 1UZGA 2AXFA 5I26A 4DP4X 3A4AA 3U4BL 4JM2D 2AQSA 3ETBJ 1CE1L 3C5SA 5KYYA 3TIEA 1JGDA 1ODAA 1QBLH 1RZIB 2J2ZA 2YPVA 5DF0A 4ZTPL 3SKUD 2QSVA 4ZDHA 2YMTA 4X4XA 4D9QD 5E6UB 3RGVD 1Z6JT 4KX9A 2IGFH 3TVMA 1CFNA 3CIAA 2XZCL 2OMXA 4MJID 1XBDA 3U7WL 4HS8H 1JGVL 1DN0A 3C9NA 3UDWC 3MJWA 4N2DA 3HPLB 5B1JC 5C07D 5JPMA 5D96C 3GM0A 3TN0B 3EH3B 3ERXA 4CC4C 1NPNA 3LPGA 3RZCB 2CGRH 1BF8A 4JFZL 1J5IA 1HH9A 5HHQB 4H0LC 4RESB 1IO4C 4MA3A 1U3HC 3TWYA 2NY6C 4HT1L 1P69B 4U1IB 3X11A 1FRGL 3R1GH 2AEIT 4XP1L 3EFOB 1DQDL 4JL1A 1LO0L 4KROC 4KMTL 3MROB 4YZWA 3R4RA 5CIPB 4QJ3B 2AJYL 1JTTA 2G3MA 3FCSA 4K23L 3T0ED 4HWZA 2VXQH 2V8LA 1O7DC 3IPEA 4YL4A 3SBPA 5KBKA 2WLIB 1PD1A 2MRYA 5KS9A 2F7IA 1OF0A 2H6UA 2IBZY 3OKDB 5BOJA 3HI5H 4QT5B 4WFGE 5LCVA 4DGVH 5AAPA 4NZ8A 3IJ8A 2ODIA 1T20B 3CXHK 4F5CE 1KIPB 1QSFD 4FQXA 2WTRA 5GGTL 5TJWK 4JO5A 3IMWA 1G7IB 3AVEA 3PNRB 1DQML 2LFEA 4XN2A 1QHPA 1P7QD 4P4RB 1CBVH 5KVFH 5KJ7E 4ETQB 4X7TB 3J27A 1GZQB 4MKMA 2EVJA 4WTZG 5JHMA 5IIEA 1L0QA 4ZZFA 1B2YA 1A4JB 5KVGE 3ZRSA 2FL5A 4N2IA 3SDXA 1TQVA 4WK0B 5EUOB 1UH4A 2ZTBA 1FL3B 1TQSA 3S35H 1WVZA 2R4RL 3ZKNC 1EHXA 1KTBA 2LU3A 1BFOB 1S5HA 2CIIA 4DF9A 1MPAL 2MIZA 3ETBF 4N6QA 3TCXA 1DJYA 2BVPA 1NL0L 1KGIA 3IJYB 3T1FB 2B3RA 3F62A 5HGHA 2WZPA 1FGNL 1NLBL 1C8PA 1DJGA 4RSVA 1SHMA 2AABL 3FH5A 3RY4A 2NXZC 1AKJB 3ETTA 3QEGL 3DXAA 1OIOA 1RUML 4MSWB 1W72A 3RWGA 2WXPA 1ZIBA 1AJ7H 3WKQA 2Q86B 4XRCA 3BSZL 4WIQA 1H3WM 1PG7W 3CZSA 3BFQG 1T6VN 1U58B 2AV1B 4B50A 4JGJA 5F72S 2EDJA 5FW8A 2BSSA 3MJ9A 1YN6B 1ZSDB 1BJ1J 2H2PD 4DGYL 1PW3A 5C0IA 1T1ZA 3AU1A 3CVCA 4PJGB 4QXWA 4YWGL 5BMFH 1B9ZA 1PY4A 3AQDA 3ULUL 1WIPA 2LHAA 1D7CA 1YECL 3D8MA 3NPZB 1PLGL 4KTEL 4CADA 12E8L 3QQ4B 4P05A 2MEJB 3EH4B 2FAUA 4AEEA 1JD9A 4ORGB 2CBPA 4KKPA 4XVSH 5A7BA 1NIFA 3CHPA 5F2FA 4E42B 4AENB 4JFHD 3HZ3A 1B4JL 2AV7B 5IQ7H 3TBSA 3VD2A 1VZIA 5E9NA 5GGVY 4MJ5B 1WAAA 3PF2A 2ZXAA 5DJ2B 4YDJA 5I1AA 3ARED 3FN0L 5EBGA 4PFEA 1VZHA 3EO0A 4BH7A 3FUNA 4GS7C 1QZNA 2UXTA 3OAUH 1HHJB 5IGXL 3TONA 4DP9X 1KLFB 5DMIH 5L2KA 2EE2A 1XAKA 4E9SA 4KXBA 3GLZA 4YDLC 2HTKC 4HXBH 2WBXA 1XGQB 1GSMA 4AGPA 1IAII 4HALA 2CRZA 4XVTH 1UXWB 4K5MA 5DJCA 5IVOA 3V0HA 3BH9B 4X4KA 3FQXB 4MNHA 1SYSA 3CSPA 3AG4B 3KJ4C 3OXSA 3QS3A 3M7FB 2DYPB 3MV8B 1NCOA 2R2HA 1OK0A 4JRWA 4GEJA 2IFFL 5JXEC 4TQEL 3WYRA 1QFWH 4M93B 1CVRA 3N5AA 3X3FL 1G7JB 3EGSB 3SKJH 1SJEB 3HN3A 2EO9A 1LK3H 3RTQB 1MCDA 2BOBA 1DEEA 4OF7A 3D0VA 2DEXX 5CP7A 1AQDB 3VM7A 5AVZB 1B6DA 3RWHB 3EJTA 3K1KC 3KHOA 4P5TC 1GGBL 5B1KA 1NGPL 3CDCA 3UZEA 1UM4H 3GSVA 3D4YA 1QBML 2FX8H 3G08A 1M1SA 3JV5A 2CDEA 5D5MB 2QSCL 4G9DA 1CF8L 2XTJE 3CSYA 2WKOF 4E9RA 1C5DB 3MRKA 4JRYB 2VMFA 4ODHL 3VXSA 3K3QA 3CJJA 2VL5A 4R90H 3WXVH 2BINA 5DRZA 3NIDE 3F7YA 5J56B 4PJAE 1WCQA 5EMYA 2IAMB 2IDUA 4XVUD 5E00A 2JCCA 5CLYA 2DRUA 4LEEA 3EH2A 1D5ZA 1Q9KA 4C56E 5F71A 4EN3C 5JMRA 5JMOC 1TQCC 3MKKA 3I2CH 4LPTA 4DGIH 3B6SA 5C0FA 4AM0B 1LEIB 4JHBA 4XMLH 2V0AA 5FV2A 1GXEA 4YK4B 1EMTL 3ZZ1A 3IXTA 3WV0A 3A6CH 1DSFL 1KPRB 5KVFE 1QATA 3ETSA 4I0PB 4WQOA 5CKAA 2VSMB 3IXAB 4NDMB 1P53A 4ONOA 2HJFA 2FK9A 3FU5A 1TDQA 1I7TB 3OF6D 3VXNB 5HHOA 1OCRB 3WLBB 3NCFB 1PS3A 3F3HA 3P77A 4H8WH 4XP9L 2A74B 5F9OH 1YEKH 1DLFL 2C7FA 1QWNA 5G4NA 1V05A 3CN3A 3NACL 3O3DA 1KNOB 1TJHH 5GGRB 5E6YA 2GHWB 3JWNG 2HT3D 1HSAA 4J3VA 4QF1A 2X0VA 4WKXA 3TBVB 1PIGA 1S4IA 2F53E 2FT7A 3P02A 3M1BA 3RWDA 3D52A 4FI6A 4OVVA 3O6LL 1KCUH 3PG2A 2QKIA 1YNTF 1FV1A 2PUQT 3B2PA 3STZB 1NZRA 1UYWL 2A73A 1V7ML 4X6BA 3RQ3A 5AKSA 3QO1A 3E8UH 4YUEL 5GXBB 3KLQA 3KLHD 1JF1B 2V2TA 4QLWA 2IALB 3VTAA 4YVUA 3CAFA 1LD9A 3BN9D 4APQC 4KO7A 5F89A 1Q0YH 1V8HA 3CLFH 3HFFA 4TLKA 3U6XS 4N9GB 3KPNA 4U3HA 4N2EA 5DMJB 1VACB 5ETUB 4Y5VB 4AL8L 4F20A 4PBXA 4M56A 1Y18A 2H0FA 3FUKA 4KO6A 4O2FB 3KWUA 4BV1A 1BYNA 3FOLA 4JR9L 3N85L 1R0AH 3VXRA 2VUOA 2VWEE 5DZVA 4X7SL 5ESQB 3ARDB 3APCA 3SKNA 3TH2T 5HHNB 3N41F 4F2MB 2DMCA 1I7ZA 3HG5A 1J5HA 3ZTDC 1IGIH 4RH4A 3H7BB 1DANU 5ANME 3VH8A 4L8CB 1XCTA 1OB1B 5IB1B 1J1XH 5GRVK 1KJ2L 3BPOB 4ELKB 2NOYA 3OQ3B 4Y4HB 4KZ0A 1PFOA 1QWUA 3QDAA 1HOCB 4M48L 4P3CH 5DJ0A 5AVVB 3RA7H 6PAZA 1QTPA 1RQ5A 1U8IB 2K45A 3KM1A 1WBZB 4X4ZA 5A43C 1TJGH 3EUDA 2OPCA 3QWOA 5I2IA 4GSUA 1L4IA 3D39E 4HUUB 5K39B 4XXWA 2DIAA 3MV9A 3C5ZB 1MJ7H 2L7UA 1DANT 1TITA 2NW2B 3PDGA 4PRPB 5GGUA 3PP3H 3NH7H 5EFIA 3TO4A 5CSZA 1OL0A 1O6SA 3LPFA 4OFDA 3GUTB 4NKMA 4KO9A 2DIEA 4PRAA 3ABZA 4NPYA 1AGEA 4EUPB 3D2UD 4KJWD 4K2UH 2EE0A 2AERT 2DMGA 3PRZA 4OD2B 4X6DF 1D6VH 5IB5A 5TQ2L 5F88B 4F8TA 2VDQH 2LLGA 3AM8A 5CWSB 4LSVH 1K6QL 5LCVH 1DJHA 1VFBB 1T4KB 1HESA 5CO1A 1Z66A 5JYMA 1XL4A 3QORB 4I3SL 1MFBH 1Z0MA 4HEMA 2P5WB 2X2JA 5L2JB 4P2QA 3CXDH 4PJ9A 1RURH 5BQDA 4R0LA 1BIIB 3EADA 4GAAA 5DFWH 3JV6A 4MZRA 2HJLB 3VGAC 3BQUB 2BS8A 2VMJA 4UUJB 2A4ZA 2JQAA 5K1VA 2F19H 2LTQC 1HXYA 4AT6B 2GI7A 1RP8A 3CH8A 2HT2C 2FWOB 43CAA 4Y2DD 1R3LA 4V1DB 5GRJL 4BE5A 5EC1B 5ACMA 3T4AA 1QVOB 2X38A 3ZGIA 1U8HA 2ADJB 3PQYD 2OYKA 1ML0A 3VH8G 5CR1A 1FORH 2CHDA 2F18A 4J3WA 1BD2E 1HWWA 4X6FA 3RPBA 5D2NC 4YSCA 5C7ZA 2OA9A 1ZE3H 4GKNA 5I18L 1G4MA 2AJSH 5HDQL 8PAZA 3ABMB 3JWOC 3BKYH 3MUJA 2EUVA 4AM0Q 4UOJA 3L5IA 3BP6B 2IMMA 4I85A 4G7VH 4HKBA 2XVKA 3NOIA 3WUWB 3TNNB 1W72H 1QNIA 2DBLH 3S5ZA 4PG2C 1R3HB 4LIQL 5F9WC 3MLSL 1OXYA 3U9UA 3QG7H 2Z1KA 4LEOA 3GGWB 4GRWB 3WIHH 1RZKL 4NO5B 2DICA 5HGGS 1GVIA 4X8GA 2NSXA 4PJCB 3FCTB 3PNWB 1XCQB 5E2WL 2Y1ZA 4JHWH 4LZKA 4YDVB 2PWGA 4DSYA 1AGCB 1OTSC 1QR1B 3QUYA 1AFVL 1X9UA 4MCNA 5EU6D 5L0QB 3K8KA 4RSYA 1H6FA 5DUMH 4K7PL 1B4LA 1X5JA 1YPZB 1GJWA 1OWWA 3EZ8A 1JOIA 2DWDB 3LD8B 2DQTL 4LCCC 3W37A 2BWDA 4L4VB 5I1JL 3BFOA 2AJ3A 3RNQB 3GHBL 2HVKA 2GC4C 4H8HA 3QQNA 3KCPB 1I7RB 1F4HA 1NANH 4L5FH 4NCC1 5GHWH 4G5AA 1T3FB 1RJYA 5IOPB 5AOLA 5C3TA 3T2LA 3ZRFC 5IZ7A 4MNQE 2MPAH 1OSZB 2Z34A 4N0RA 3FN3A 2E5EA 2OTWA 4HETA 4N25A 1CG9A 4YHYC 3FFCB 3UPRA 4QXVA 5LXGL 2ITCB 3FT0A 5DDHB 5I75C 4DKFL 4YBQC 1F4XH 1ID5I 3KWVA 4EAEA 1RPUA 3ZR5A 4UTCA 4X5PA 1OAYL 1Q9OA 3W57A 5I17A 4I9XA 3ESNA 1QBAA 3G04B 5GS0C 3IWUA 3OLGA 1I1AB 2FWLB 5GIRA 3TIDA 1CD1A 1KB9J 3OG6B 2UZYA 5B38B 1AH1A 3G5VB 4HH9B 4NUQA 3UAAA 5TE4L 2ATPB 3B1TA 2E9BA 3ILPB 4F9LA 4XXCA 2X0WA 4KV5E 5ICYA 1GOGA 3FB6A 4POZD 1OALA 5ID0B 4IU2A 4W9GC 1J0IA 4XP6L 3VXOA 4RGOL 2NY4D 3K74B 4XMUA 5T1KA 4QXTB 1WJ3A 2RIKA 2Z91B 4L3FA 2DLTA 5C7XL 2A0LD 1M6OB 1PAMA 2O61B 4IRJB 4LSSL 4H7VA 1CT8A 2NTSP 5I0ZA 3G6DH 3WJMB 1MFEL 3H9HA 4YBHA 1F1GA 4QY8B 4KZDL 2EH7L 3DO7A 4LKCA 1ZV2A 1JUFB 4AXWA 2BMKA 5DLMH 4ZFOL 2NY5H 2QT6A 3JWNH 1SBBA 1C5BH 4E9YA 5D1QB 4RMQA 3RL1A 3S3SA 1FAIL 3D69A 3Q2WA 4YDZA 5DJ6B 5DEGA 3F5WB 2WGXA 3KGTA 1ZT1A 4MNGB 4RFNC 5E70A 3FOMB 3IDMA 2DI9A 2WQ8A 4JFPB 1E5YA 5LBSL 4NO3A 4MDJB 2JJWA 3FTGB 4UM9A 3N9GL 1CXKA 4MZ3A 4U0RC 4IOIB 3AXIA 3FU6A 5KS9E 2CCWA 5LGJB 3VD1A 1OB0A 2VDLH 2YPKA 2ADIB 4N2NA 4JE4B 4QKXB 1NEPA 4PV1C 4PI2A 5SWZA 3QRBA 4Y7OC 2R8SL 1FBIL 2X1WL 1N10A 5AAWA 2WINA 2BSEA 4HXAL 3WTXA 2OX5B 4OGQC 4WU5A 3HFML 2X9ZA 2AMGA 4G3YL 4M6OL 3VJ6B 2BW4A 1X4ZA 1HYSD 3VFPA 1T04B 4TSCL 3EO1B 2EXTA 1BFSA 1MVUB 4KKBD 4KKCD 4OCYL 4JZOB 2NUPA 2C1OB 3AS3A 3GRGA 3MLPA 1LGVA 3T65B 4Y2NA 4R3SB 2HKHH 2FNBA 3PHOB 4HMCA 1C16A 3HHRB 4HWEH 2Q7YA 3EGDA 5T3ZH 4YXHL 1D7DA 4HJJL 4AQZA 2J4WL 3P3RA 2E3VA 3SDXE 3ATFA 2D3LA 3LJ3A 4ONHB 1ED3A 3QCVL 5KZCD 1AD0B 3OV6A 5CILL 1HIMH 1N0XH 4HK3N 4PWGA 1S9XB 4LDCA 1JZ7A 2J8UB 1WT5C 1LE9A 1EAPB 3ZE0F 3WNOA 2CA3A 3W81A 3VFTA 4ODUB 4CMHB 2RBLA 1BJ8A 3PFUA 3I6LE 4A04A 4X50A 1GW0A 3AC0A 3B7SA 1ZAGA 3DXAE 3NJXA 3TBWB 4L3ED 3S4SA 1CS6A 3VWKC 1GGCH 2VN7A 3P4MB 4LMQI 2V5YA 1I8LA 1P7BA 4N0FA 1N7ML 3DSNB 1AG6A 2HG5B 4UOW1 5D7SH 2ATAA 4NGHH 1ZTMA 3KPQA 3OC5A 3VSVA 1IE5A 4DFIA 2EDQA 3I74A 2FGWL 1JRHL 5F21B 4HJEA 4L23A 5EEXA 3L4TA 1Z9SB 4D8PA 1EEQA 3ZYZA 3QJQB 4IIZA 1T89C 5IY5B 1NCTA 4IGBB 4KKZA 1FPTL 5FA4A 5EBLB 2W95A 1RK0A 3ABKB 5HYIA 2OTPA 1MHEA 4G7YH 4CSTA 4AEIH 2VDKH 2AC0A 1IFHL 2OXHA 5M94B 1OM3H 1YY9D 2LV4A 4ZS7L 1PGRB 2ICWB 2MPVA 4M3KB 4XP4L 5FWQA 3T04D 4H8VA 3GSNH 2A1WL 4MS8D 5B3JF 1WZ1L 4YO0B 4GQ9L 2GC7C 4X6CB 3ULVD 1BGXL 4P46C 1IL1B 4HOWA 1WAAE 3B9VA 3C2SA 3C8HA 5AVWB 1N59B 2WUCL 4MAYD 1KDIA 4XNYL 5H2BA 1PKOA 4F37K 2IG2H 3QHFH 4AGNA 1SXSA 5AZEL 1X9RA 3GDCA 5L2KE 2E7DA 2R2CA 3MACL 3LQZA 4HUXB 1Z9MA 2BPBA 2EKSB 2BRRL 4U3SA 3UAFA 3AT8A 3BHBA 4CGTA 1VCAA 3MNDA 1DBAH 2D3NA 3BVNB 3KYKL 4IKNA 2G75B 2I9TB 4Q89A 4Q9QH 2ADFH 3ULAB 3TT3L 3KH3A 4JZJC 4LQ1A 3W82A 2EO7A 1PCSA 3TEYA 1T0MB 3MUY1 1FFPA 3EJQA 3GMLA 3MRHB 4LMQE 4XBPB 2EC8A 3MRMA 3ZU8A 3S7GA 1R17A 2NY7H 3RDTB 4NM4L 3A24A 4F57L 1ZT7B 4IYKA 5D7IB 1VGEH 1L7IH 1TQUA 3QUXD 4JDVB 4KJYB 1IAOB 5AW3B 1AO7A 2O30A 5SX5H 3W0WA 5LG1A 2F5BL 2HFEB 4AMXA 2C9QA 2XY2A 1E2WA 3DRQB 2VR6A 5T3XD 3SY0A 4GOSA 1PY9A 4NUJB 4QHMB 4X5XA 5F70A 3FQRB 2ZWYA 2C26A 3MNWB 1XH3A 3O2DH 4LRNH 3GKZA 4XTRC 1MFDL 4O4YL 4PJ6A 3UERA 5CZVL 3CFEB 4YXLH 1PZ3A 3JWNE 3ZYJA 1IUZA 2KYIA 3ARGD 1XIWC 3Q8BA 2P8MB 4ZUSB 4DUVA 4D0BA 1MRFH 4MASA 2IO5A 3KWWB 5E1AB 4GG8A 2DQDH 4MX7A 5E1HB 1HNGA 5DSCA 4JUTA 4Z7VF 5HPMB 2B2XH 3VXSE 4N8UA 5D1XC 1J9TA 3L1EA 2J71A 3A0OA 5IJVA 3FULA 3DK2A 1CPUA 1LMKA 1KGUA 1SEBB 3E80A 5FKPA 2CPUA 2GJZB 2VDNL 2JIXB 3AMKA 3DJTA 2FBJL 2JCCE 5FO7B 4RLDA 5ACZB 2FTAA 4R7DA 4Z7WA 4YSEA 4CNIB 1P5UB 2FBOJ 4TL5A 4F2FA 5I76A 2ID5A 4OFQA 3IYLW 3KPRD 3QUHA 2D03H 3PDOB 4HX1B 4GG6A 4NN6B 4N2LA 3RX5A 2QZ5A 4BQBA 1LO2H 1MLBA 1U42A 4UQ3A 3BIKA 3FW6A 2PYED 2ENJA 3MCYA 1GMEA 2D7OA 1OCWL 3CBRA 5K9KB 3BD5A 1ETB1 1MCRA 5DK0A 4CVWA 1A14H 1H6EA 5HHOE 4XPTH 1ETJA 4GSQA 3UZVA 2CWRA 3ULSB 4G9FB 1QLEH 4Q9RH 3LKNA 5AQ0A 1ZANL 1MF2L 3HZMB 5ISZD 3G5ZA 1SVCP 4K0OA 4JM2C 4X6EB 5A40E 3VFVB 2V9RA 2VZSA 3MUGB 4U3CA 3I6GA 1CLVA 5C0CD 3K1DA 4EJ1C 4UB0H 5MHSE 4MD0B 4N0YH 5E6IB 3RGVC 1JHLL 3ARBD 3LH2H 3CZKA 3DI3B 2YD1A 1QO3B 2Z93B 2WBJA 2QPDB 3O2WH 1XV8A 4Q2ZA 5I15H 3BEVA 1WLHA 3BYYA 3UAEA 5HJ3A 4H2CA 3CSFA 1C12B 1H5BC 4JEGB 4M1DH 3KS0H 1IEBA 1N18A 3IB4A 1AC6A 3G6JA 3TPUA 3AWGA 4YOKA 1J5DA 2F5AH 4GO9A 3NEOA 4ABVA 1WFOA 2RJMA 4HIIB 2X42A 4M9PA 4OGXH 3UJTL 3GUFA 2O5YH 5IMOB 3V4PB 3NRQA 3GS7A 4NO0D 3TLRA 2YD7A 1A6UL 3LN5A 2W07A 3H55A 1JGIA 1VIWA 2IGTA 3EUUA 4BH8B 4BDVB 3PIQB 2CO3A 3DOSA 3T0EC 2DIJA 4H0IA 1SPDA 1UENA 2PABA 4QHNB 1KBGH 1YSOA 3VXRE 3UBXB 5F8QC 3ZKMD 4CW1A 3GKWH 5KSBA 1URLA 2CO7B 4XMWA 1U2HA 1BW8A 1P4IH 4OUUA 1I85C 2O5XH 1T21B 4J23A 3D09A 4MRCA 4TLUA 1NPUA 1PLBA 1TQBC 4K3DH 5IUCA 4LCUA 5FC9A 4MCZA 2NUTA 3REWA 4BFRA 3QIBA 4B0MM 4BFKA 5DC4B 2WSDA 1RZQA 3QIUA 5IR1A 3DDGA 3RWCB 3KS0J 5DYOA 2CH8A 2PW2B 4U3XA 4WY7L 5MENB 5DA0B 3MRCB 5LNEA 3MV9E 4ALAH 4R26L 3MLWH 3T6VA 5INCB 1IGYA 4PIRF 2TAAA 4P3DB 3S37H 4I77H 2Z0BA 3BD4A 3Q5OA 1JNLH 3LXBA 1ZA3B 1HKLH 3MX0A 3BEWA 4ZFOA 3GBML 2E9GA 3V7MA 3EJJX 2WZAA 3BUYB 3DJZA 1OM9A 4K9EC 4OZGA 5E6SB 2AXGA 5CBEA 4TVPD 5IW1A 1IGMH 1CL7L 2Y0SA 4JPWL 3I02B 3BGFB 4OJFH 3RKPA 2WQVA 3IFOA 3FYIB 4S11A 5AOZA 1ZLWH 3FONA 4B41A 3CFBA 4HEME 4LF3B 3B9KB 3IPFA 3L3HA 4P2QE 3HS8A 3HCVA 4KO5A 1L9NA 5FYKL 4E9QA 5AL8A 2XWDA 5EH1A 4AQ1B 4AK2A 1J9RA 4YHLH 2JTDA 4OSUL 3EW3B 1P2CB 2HWZH 4IK6A 4HPYL 4EO5A 5BVPH 4LGPB 5I1DB 3W3BA 1EEZA 2CLZB 3NJGA 3MDJA 4LSTH 1YCSA 2VDMB 1TVBB 2H2PC 4WO4B 4XNXL 1DVFA 3GLAA 2QHLA 3TV3H 5LG6A 5AUMA 3TA3B 1MDAA 4CMMA 4OAWA 2GSIB 4FFYA 3AAZA 3AQXA 3ZE2E 1H3PL 5E8DL 5HHXL 2XWCA 2EIJB 3OC8A 1S7SB 3QQ9D 4NNXB 1UB5A 1JHTB 4WSKA 4GSDL 3T09A 2IDSA 3RWJB 3U7AA 5HGAB 1EZVX 2UX6A 5GGQL 1YYLH 3QI9B 1H8OA 1KCBA 2Y5QA 2I7OA 1BYOA 2JKRM 2R9HD 1W0VA 2WBWB 3S3JA 3DK0A 3L4UA 4AZ8A 1TEYA 4P04A 1FE8H 3AREC 1K4CB 2IAND 4LBAA 5I8CA 4HYTB 5L8JB 1JK9A 1E5AA 5MP6H 2Q5BA 1U4EA 4K7FB 3UO8B 2MWCA 2W0FA 2GFBB 4WNJA 1OD7A 3MRLB 2OW7A 2P28B 3AABA 2HG0A 2VW7A 1FFRA 4QHKI 3L5XH 5FX3A 1AQKL 1QRNE 4HU2A 1CIDA 3CZLA 1V3MA 3O6KL 2ARJB 1UWGL 3IN0A 4JFFD 3THMH 4NP4L 4Y4FA 3MXVH 3FH7A 4YPGB 2J72A 2XTJB 3U79A 1J10A 5CJXC 4WFGD 1L3WA 4GFXA 1V10A 1FFTB 3ULUE 4M02A 3CLEL 3IT8D 2YMXH 4J8RB 4OTXL 1T2QH 2HRPL 5HVHC 1KGXA 1U36A 3GINA 3L3KA 3OX8A 1QLFA 2HFFB 2N7SA 1EK3A 1QA9B 2CUMA 3ESPA 3TFKD 1T2XA 2B1HH 3C5JA 5TFSH 3QEQB 4L2LA 2EXWD 5JOPD 1KC5L 1VGKA 2ZKXA 4FEIA 4HLJA 4P2RB 2Z92B 4G42B 4AKQA 1W16A 3WL9B 4E68A 5EULV 2A99A 3Q6GL 3F12B 5KUKA 4WK2B 5CCHE 4QTFA 2VC2L 1W8NA 1XH0A 3ZQWA 1E6OL 1FNHA 4PV9B 5EUKB 2PW1B 1OGAB 4QUOA 4ZFGL 5EBMB 4HUWA 1D5BB 1T1XB 3CQFA 2AJUL 1MHPH 2ZSWB 4XCCH 3HE7A 3S34L 1PY0A 4J3TA 3UAJD 4XVUC 1J12A 3NABL 1BBJA 2VXSL 5D7LA 5IW3A 5DI8A 3JYCA 1XZWA 3MODL 5AVRB 3UPAA 2V2XA 1NCBL 1UGKA 3KYOA 3QG6A 4AKOA 2XKUA 2V2WA 5DGQA 3S96B 4PB0H 4JG0H 3ECBB 5B3NA 2J1XA 4O5LH 4LP5A 3L2NA 4ONGL 4KZEH 4KOCA 1LO5A 1B2WH 1JPEA 1I1YA 2SODB 3NJMA 5HHVL 1HHGB 1YNKL 4Y1SA 1GZPA 4TOYH 2F53B 2D7TH 2JF1A 2UY6A 1UJ3C 3MRPB 5JIIA 2YAQA 3CUPA 4NQDD 4PLJD 1B3JA 1RUPH 1DBML 2YN3A 5JW3H 4LARL 3OGOE 4FA7B 5G4OA 3VG0L 1PMYA 4JZNB 3I9GH 1D6EB 4AGQA 2APWA 1IVLA 4NN5B 1D9KB 1X4YA 1MUJA 3UJJL 3U30C 4POYA 2W59A 3C6SB 2P7TA 2FUQA 1IBGH 1S3KH 5GGSA 2XWEA 2DI8A 2KL6A 3H0TB 4W6WB 5SWZE 5BZXA 1NMCC 2HT3C 3L4XA 3VU2A 3QPXL 2YSSA 2OKMA 1F2XK 5DC2A 1AIFA 3D3VA 4YGVB 1YNTB 3SDDD 2VH5H 4YGAB 4H8UA 1RZJH 1HQRB 2J5LC 4BELD 1JFQL 3P3YA 3QYCA 4WGWB 3BVTA 4O02A 5FW6A 4XB7A 5GZNA 3ZDXF 4AYSA 4HAFA 1WWWX 2L3BA 1XB6A 2P3YA 3SKOA 4G8EB 4LE8A 3GIVA 5KOVC 3GI9L 3KLHC 5FW7A 3GMNB 3L95B 4K3EH 2VQUA 1IARB 2BS9A 4FLHA 5FK9B 2MKWA 3BN9C 3V5KB 4V33A 3R8BB 1EAJA 1QQDB 1JZDC 4CGUB 1JZJA 3N40F 2V3EA 1DUYA 3IFNL 3CC5A 4JKPL 3QQDB 4W4OA 3PAYA 4XMPH 3B7TA 1QHQA 1K3ZA 4F7TB 3SIKA 4QRRB 1DQLL 1JYVA 2YK1H 4EZMA 1A7NL 2DAVA 3K6NA 3M17A 3RI5F 2GYSA 3S9DB 1BZDA 3DMMB 3VI4E 3NJKA 1KG0B 3UJIH 5E4OA 2YFOA 2ZNXA 2VQ4A 4YVNA 3MXWH 4GO6B 1CD8A 3FFDA 3TBTA 3PWJB 4P5SA 1WS8A 1F86A 1HXKA 4ZOCA 4WI3A 2AJXL 5I6OA 1UWXK 2W81C 2WXMA 2JXMB 1LEGB 1NDMA 4M6NL 5IREA 5L4MA 5D7KD 4PW4A 4FTVB 3SCMA 5C9KA 5HYQB 1ASPA 1XGRB 4ZMXA 3CVHL 4NFDA 1HCFX 1P4LA 5IT2L 2L04A 3NZHL 2ARJQ 4X6DB 1KT2A 2OMWA 3AXLA 1PEWA 2BJML 4W6YB 4KJWC 2Z0UA 1RPQA 2CKBH 2YAPA 3S36L 4DPBX 4C56D 4DEUA 2A4EA 4KKRA 3MYJB 4B7LA 4M7KH 1IGCL 4Z6AT 4L9DA 1J11A 3SOBL 1ZHLB 4LGSB 4NFCA 3LZPA 5K9JH 3PAVA 3KEDA 2CK2A 2Q3XA 4CVUA 1FL5B 3L5WB 3IPBA 4JFEA 4U1MB 2JB6B 2O6EA 3L1FA 4JNXA 4EI6B 1RSYA 4PJ7F 2EUXA 2DZEA 3HMWH 1JG9A 3DV6A 5FO9B 4YDNA 4L9LC 1HXMB 4HMEA 4XCYA 3MNVA 1DE4B 3BE1H 1WDAA 1P7HL 1FNEB 1VESA 1U95A 5IFAL 4YHKL 4Y2DC 5SWSA 3SN6N 2FIKA 5DJ8B 3N42F 4U49A 4XMVA 1I3RB 4U1GC 5FYKU 4Z0XA 4EIGB 3QISA 1F4YH 2Q8BH 3SDAB 2Q10A 3BP5B 5TDPA 1KZYA 5ID1A 3FU9A 1AO7E 3W0WE 3DRTA 2CJTA 4XOEA 4JFQA 1TETL 4OM0L 5IP4A 3BKJL 3GMPB 4G6ML 2XQYK 2X70A 3LHPL 4HDIA 4OLZH 5ABZA 1XO8A 5CSGA 3H9ZA 2GPZA 1BEYH 2MOQA 1ZKAA 5KSVA 2BP0B 1T0NB 2VSCA 3FCBA 1OAKH 4GAGL 5I6NA 3PUUA 4HHAB 3KEHA 5FYLL 4PTUA 2FJUB 3VMPA 5AWNL 3ZT5A 4OLXH 5K5YA 3MUHL 4MFHA 5L88H 1A7PL 2HKFH 1ETA1 5IB4B 2QV4A 5AG8A 2I5YL 3IDJB 3GRWA 1F1AA 4DOHB 3FT3B 3WS6A 5D7JB 2QSQA 3SE3A 3V95A 5MI0B 3UBFA 5TPWH 2MQ3A 3HNVH 2J8OA 4FFYH 4CVZB 4LK4A 4GMTL 4EEEA 5A2AA 4IMKA 4LSDA 1R5IB 2BS71 4P9HH 2Y22A 1AQMA 3FB8A 2BHZA 4Z7WE 1AACA 4Y16D 1NDGA 5CEYA 2AXFB 2JJSC 5D6CB 1AHWA 3K71A 2VDOL 4Z7QF 1PZBA 4A66A 4GG6E 1XTLA 4ZDHB 3TL5A 2OSWA 4JFYA 4OFVA 1TOXA 4MCYA 3U2SA 1MIMH 1FH2A 3TVMB 1M9SA 5E9DA 3D39D 5CXPA 1DN0B 3EDFA 1G7QA 2QPUA 3F83A 3HLAB 2J57A 1XB8A 3MREA 3HC0A 4NZTL 4RDQF 5E7BA 4AIEA 3C60C 3G6JF 3WFBH 5I28A 4TUOB 1WFIA 2ZF9A 1ERNA 3WEOA 2YOCA 3BFWA 3KYMB 3VXTA 4EBQH 1ACXA 2C5DC 2CM6A 3ME0B 3K6FA 2OMUA 4MTMA 8FABB 5CNHA 1MW2A 3QIWB 4IRSA 1DJWA 4Y4KC 2AJVL 3PWPA 1IIIA 4FCHA 2ATKA 4OT1H 2VJ8A 1W8OA 3DX1A 3L3IB 4POZC 5G4MA 2XV3A 3FCSB 4JO1H 2VLMD 2D31A 3BZEA 2NY4C 3P9LA 4XO9A 1GOFA 1WCBB 4HWZB 4X8JB 3L9EA 4ODWA 1J8RA 2A0LC 1GL4B 4PS4L 4N2AA 1TTBA 2W0LA 1KDJA 1ZPLA 2JB5L 2VDQB 3G6JE 4Z5RA 2P46B 2MTAA 3NIFE 3QJFA 2QGEA 3SYCA 1ZHBA 5DLLA 5C0DA 4AQAA 4WFFD 5JW4N 3WSQH 4BZ2A 2F68X 3B1UA 1YEJH 5E2VL 4DEPB 4KI1A 1YLBB 4FL4C 4Q0XH 4NP9A 1RHHA 1P4BH 3IRPX 4WO0A 4HOZA 5IJKA 4JN2A 2ROXA 4FABH 1KIRA 1RUKH 2BIMA 1BD2D 2I32A 1Q94A 1A21A 4WWNA 1ZK5A 5FCSH 4RGNE 4E36A 2FD6H 4WWOA 5KSBE 4DAGL 1E30A 2D0FA 2ZUUA 1SY6A 5IIEB 1S9KC 4L3CA 5JHDA 2FL5B 3RWFA 2PCFA 1L9TA 1IEAB 3GBNH 1CGUA 3CVIH 3GHEL 5J1TC 3V6FB 3TEZA 2ZWLT 5J89A 1A6AA 5GRUL 3V55A 3V4UH 1A4BA 3MMEA 3SE4C 4C47A 3V52L 2WIIA 4EI5B 1E9PA 3CSBA 2BVPB 2QQQA 4FZEL 4RA3A 1HYSC 3D85D 3CGTA 1E50A 4U4BA 5F1SA 5HGHB 1GZHA 4LLAA 4KKBC 3P3SA 4KKCC 3DUUB 2VW6A 4LSRL 1ND0A 1FFNB 2VJXA 3QP3A 3WHXB 2DJUA 2GJ6D 15C8H 1W72B 3RWGB 1IBZA 2NX5B 3M07A 4JDTL 1GTFA 4PJ8B 5KVDH 2B08A 2O6PA 2VLJD 5FA3A 4XRCB 4WFHE 4OCMC 4PB9L 4HWBH 2ZYHA 3C6LA 5CZXC 2GEEA 5A2LH 2ZP9A 2J5WA 1NMBH 3Q8AA 4UQBA 3HC4H 4OZGE 1AE6L 4W9EC 2ZT9C 3ZE0B 3GDBA 5J4MA 2CJSA 4E2OA 1C08B 1DO6A 1T1ZB 2ZG1A 1NGXA 4QI3A 2B4CH 1XHHA 5CD5D 5IQ9B 7CGTA 1YJDL 4CADB 4QNPF 1MLCA 2JI1A 2N7BA 3PXLA 4ZXBA 2A9DA 2EJ1A 1KFAL 2BP5M 3MRGA 4BYHA 4MNQD 4N85A 4NHCH 1RV6X 4GRLD 4GI9A 4O02H 1JRHI 1ZK9A 4R4BB 3WNLA 5FGRA 4MKTA 1FL6A 2CHXA 3TBSB 4JFDA 4RFOH 4NQEB 1CFQA 4MD5A 5LAXB 4AEHH 5C08D 2C9SA 2XRAL 5I0WA 5I6XB 4YDJB 2YIHA 1ORSA 4XCNA 1BQRA 1H15B 5JOFA 1OAQL 1F90L 5F6IC 1PYWA 5I8OL 3EO9L 1ZY9A 4X9IA 3CZGA 1MFCH 1JNHA 1KB5L 3JWDH 5L2KB 1P6AB 2NY3D 2WXRA 4ZJ9A 5ELIA 4N2BA 5CS7A 3S36X 3IS1X 1TFPA 4L4JA 1DUZB 4KDTC 2HPTA 3QWRA 4U1LB 3OKNA 5T1DH 1UGNA 3D4CA 4CU8A 5LNGA 2YZ1A 1YY9C 4ZW6A 3WS3B 4MNHB 5DZAA 1FYHB 2VR8A 4MS8C 5EA0H 5J12C 5C92A 4J4PA 1M1XA 3ULVC 3BMWA 3WO4B 4XWOD 1ESOA 4P4KB 1X5MA 3HUJF 4MAYC 4QMEA 1I3GH 4TQ8A 4FZ8L 4PWIA 4Y2OB 4NJ9H 1P6WA 4FADA 3IU3B 3N1FC 2LVEA 1EERB 5AB1A 4QRPB 3SPGA 1Q9LA 2X4TA 1NLDH 2DY2A 4I0CC 5AOKA 5EIIA 1AGBA 1JZFA 2FJHA 4X99A 4X9GA 5CP7B 3D0VB 2D9QB 2F74A 2XV6B 4Q6YA 1QYGH 1ZVHA 1A7QH 4ZUTB 3LVTA 4IMLA 1PD0A 4IIQC 2EIZA 2FH6A 2R2BA 3PP3K 3LS5L 1NIEA 2VMCA 1S7RA 1RJCA 3GMOB 3GSVB 4M7JL 2QVIA 3HRZA 4K9JA 4MXVE 5JO5B 2OYPA 3RL2A 1PSKL 3ROOA 3QQXA 4G1MB 4G9DB 3O4OB 4NC0B 3QFJB 3CSYB 5EU3A 3MRKB 4P49A 3QUXC 1OAUH 2JK5A 1J18A 1U8LA 2L7QA 4KMLB 5L7XH 4PGJA 3SGDI 3GZQA 4FQXD 1NAMH 2Y3AA 5DRZB 2ZKHH 3F7YB 2K0RA 3FQ2A 3IDYB 1G0XA 1AR1D 1MXDA 2VDLB 4OGAD 5FUOH 4AK1A 2ZUWA 1Z3RA 1WEJH 1OEZW 1U0QA 2A9BA 1UADC 3VFSA 1IBYA 1Y0LA 3BI9X 1E2ZA 3UTSA 2GTWA 2IC2A 3ARGC 5FYJH 2BY3A 2V17L 3KPSB 2R23A 3PV6B 5BVJA 1MREL 4Z7VB 4DP0X 3IXTB 2C4FU 3U1PA 3WTYA 4I18A 3L2LA 4I1NB 3GNML 1DBBL 1VAHA 2WWKT 3BLPX 1MCPL 2AAAA 1W0WB 5IHWA 1IGJA 1TENA 2Y23A 3EJCA 2VIRA 1IKOP 1T7XA 3STLA 4YX2H 4YIQA 5D7LE 1PDKB 1S7VA 1WC7B 4XVOA 5ICUA 5HHME 2BIIA 1CD9B 2AXJA 2DOCA 2GUYA 3CG8A 3M45A 4YHPA 4DK6A 2C4FT 4U0QB 5HHOB 4JM0A 2WZPD 3X2QB 1M7XA 3KDMA 4ELMA 4ZTOL 5DMYA 4WUKL 3UIYA 3P77B 5TDOA 5IV2A 1G7HA 3R4DA 1XF3A 3KLSA 1MFAH 5EIIG 1YEHL 2OR8A 2Z3FA 3DXAD 3ARFA 3WD5L 2F54A 3P4LA 5DZJA 3SPIA 3O3DB 2XOTA 2NNAA 3M6DA 3RHWF 1MCOH 1OAXH 1IBHA 1G4RA 3RY6C 5B39A 2ZWSA 3VXPA 1WIOA 5E99L 2WCSA 1RZGA 3BRDA 3M1BB 1UCTA 5EF3A 4OGYH 3C60B 3QXTA 3EDDA 4LHJB 3BRFA 2QKIB 4CU6A 2GAZA 1FV1B 2JKWA 4JANA 3U25A 3LDBB 4H88H 4PLOB 1AGFA 1RERA 3QO1B 2B7DT 1PZUB 1CICB 4M1CD 1KB9K 3GRWH 4Y4KB 3N44F 3I3BA 1FZKB 1NC2A 3UYRL 3QXWA 4AIZB 3AMLA 4LASH 5HP5A 1LD9B 2DEYX 1URIA 5F89B 3B37A 2MCG1 2DWXA 9PCYA 3RX9A 4LSQH 1J87A 4U6HA 3W56A 4FQQA 2Y5EA 4YR6A 3ARBC 3TBYA 2BNRA 3D3VE 5E2TL 3MAWA 2VDKB 1VLXA 4UV4L 4HJIA 3FOLB 3P0YH 4RMWA 4YFDB 1PKQA 3QNZA 1YEIH 2OK0H 3GSNB 5EZLB 3EJZD 1OANA 3QHTC 1W0YT 3H2QA 3WIIL 4AGLA 1ZLSH 1NGYA 3JV0A 1U8KA 2OCJA 1VJSA 1ZLVH 2WB1A 1P9MC 5CN3A 1XCTB 4DW2H 3FT2B 1IC4H 2GKIA 2YD9A 4QTIH 1FG2A 5DJ0B 2HXAA 1LVEA 3WIAA 2AAVA 1MELA 2CIKB 2FATL 4KHTL 1FNLA 3MV9B 3KPMA 3ARWA 4GIPD 5CSZB 3ZKMC 3KJ6L 1TLKA 3HVDA 5B39G 1O6SB 1TZIA 2WJ7A 4RETB 3BIAX 4M5YH 4MCMA 4RNRB 1AGEB 4HPOH 3QJTB 5DHEA 5EU7E 1YQ2A 4ZW7A 2HTLD 2O72A 1H3VA 1U41A 4KH2A 2CRYA 4OIFA 2WKGA 2F8IA 3V0WH 5JZ7D 3PABA 5J6HA 2W80C 5GJTL 1VFUA 1S5IH 4WSGA 3V4VA 1IE4A 2WXFA 1OW0C 2ZYIA 1J8HB 4GAYB 2GIYA 1DO5A 1N6QL 4HFWB 1MNUH 4UBDD 1JS4A 2UYLA 3O81A 4C4BA 2CALA 4PJ9B 3V5HB 3VXSD 4R0LB 3CDGA 1VSCA 4NPJA 3TCTA 3TT1H 4EZKA 3JV6B 2IDFA 4QRUA 1CL7I 1N19A 2JV6A 5IHZA 2QL1A 4JM4L 5GRVL 5C09B 1HXYB 2B3IA 3BVDB 5EZIL 1I8UA 2OZNA 4FEMA 4NWTH 2ZAGA 1AY1L 1R3LB 2JTYA 3HG4A 3PP4H 1ETZA 2IH9A 3T4AB 4YZFF 3LZQA 4C4KT 2HX7A 4GUQA 3JXAA 2J56A 2C9PA 3BKML 5DZPA 1S7WB 4WI0A 3TNMA 1JWUB 3K6OA 4N8PA 4O9HH 3RURA 3WEAA 2NZIA 4MJ2A 4XC3H 3INUH 5AAMC 4HSQA 5KTEL 4M62L 3NJNA 3L45A 1JPTH 4GKNB 2EIBA 2IPUK 1UVQB 2MKLC 3DROA 4QHUA 2AXWA 4JFEE 5F7DB 4NQXA 5DS2A 4NAMA 3GZKA 3MOBH 2H6PA 2JSFA 3APNA 3IDNB 4MMXB 3EF7A 4L8BB 5EO0B 4OV5A 1SXCA 5T8IA 4EDWL 5IVZB 1EHAA 1HAUA 1EHNA 4F58L 4PJFA 4XGZB 3WMQA 2KKQA 4ISVB 4H5SA 3VDCA 2WNKA 4KDWA 3U9UB 4LEOB 2XKNA 3K2KA 3HG1A 4QOKA 4ICWA 4KX8A 2A77H 5AFAA 4KXDA 2N01B 3NVQA 3OKEA 2NLJB 5MHSD 3BPNC 1A7BA 1QLEB 2GSGA 4W9CC 3QQ9C 3QUYB 5IMMA 2AEQH 1KWKA 3RFZC 3MCLH 5B21A 1OPGL 5KBNC 3NBNA 1HE7A 1M53A 2CBOA 3T71A 1SF3A 3HS9A 4E41A 3QJOA 3WKML 3ALPA 1HK6A 3FS9A 1BLNA 1MCNA 1EJ6A 2R9HC 2QGCA 4HF5L 4PM1A 4TSAH 5ABDE 3UEZA 3U4AA 1S78C 4BCXA 3HE6A 1RIHH 1LO4H 1W15A 3ZL2A 3UMNA 4Z3GA 5KSAA 1EJOL 3MBEB 4PJXA 4HIEA 4PTTA 4OLWH 2GUOA 4U33A 4WI8A 1GGTA 1XMEB 1H9DA 2HRLA 1W9XA 5CU9A 1BECA 2P48B 3KAAA 5K69A 2FECL 4PGZA 1NCNA 4OZIF 2CAKA 4YPJA 2Y1AA 2YUVA 4M4PA 4H25B 4B3EA 3PCYA 2Q20A 4XVJL 3CIQA 3OKOA 3VSUA 5CCGE 4QO1B 1LO3H 1TG8A 4HC1L 4G6KH 2JKJA 1XMWA 4YSDA 3VXRD 2QADB 1HC1A 2AK1L 3G6AB 4UDTB 3MLZL 1DQTA 4TLTA 5GIRB 1A6ZA 1CD1B 4S1QH 3MV7A 3LN4A 2OL3H 4QLRA 2AQRA 2K7PA 3O6FB 1EGJH 2GCYA 5TDNA 5A2FA 4GUPB 1FO0H 4R97B 5D2LA 3IGAA 1BPVA 1F4AA 2EDLA 2EDNA 1PIFA 3E9TA 3TFKC 4Y1TA 1KTRL 4LCWB 5E9DE 2D0GA 2HJKA 1KTLA 2ZUQC 2EXWC 4OF3A 5F9AC 1GHFH 4FQLH 3F00A 3WNNA 1OCZB 3FTXA 5C0ND 1CT8B 3TO4D 1RIUL 2BHFA 3TS8A 3ESVF 2BDNH 3LIUA 1JV2B 4JHVA 4OH2A 1G1YA 1KIQA 1G9NL 3S8WA 3GMRB 5DJZB 3MLTA 4D94A 2VRQA 3LKPA 3LSOA 3MRIA 3D69B 1H8NA 3NDYE 1ZT1B 5DYFA 5HGDB 5EORL 1ZA6B 1CDIA 3PWPE 5D6DA 3ASNB 4DT2A 3E1F1 2EC9U 4PVBA 4IJ3C 1LLAA 4NO3B 4K71B 1KXTA 3VCLA 3MNZB 4UM9B 4KI5F 4Z1PA 3OKLB 4GB9A 5SX5K 1HHIA 4N90E 1NUDA 2QSTA 4KRPD 3HI1A 4P2QD 4HSAC 4IRZL 1R4XA 4U6VH 2YPKB 1NUFA 5F6HJ 4Q9BA 1R3KA 2QR0A 1KUMA 2A6KA 2IPKA 3PL6B 2EC9T 3QZMA 5SWZB 1M9WA 1R3IH 1K9TA 1T83C 1HJCA 4M7ZC 1AMYA 2WINB 2DQ6A 3D06A 4PCTA 3EDEA 4HISA 4QXUH 4PLJC 1CFVH 4ZRGA 4Z76A 1W2KT 3QH3B 2DD8H 4HIQA 1CLZL 1RZIA 1GAFL 2FQGA 2HX9A 4RWYH 3AUWB 2XY1A 1C16B 2X40A 4NI6A 3EGDB 2Q7YB 4A2EA 5CUSL 4YHOL 2ZWKA 5DHVA 4DP1X 2Y36H 1WGOA 3OSKA 5EDSA 1MAJA 3T0AA 3L81A 3F58H 3L3DB 4JDZA 1CZ8L 2WLHA 3OKKB 4XMXA 3ZE1E 1SHSA 3ZDXB 4JCLA 4ZMQA 1H3XA 2ITEA 3SDDC 4F8LA 3RZCA 4NNYB 5HHQA 2J73A 3CK0H 4NXKA 3P0GB 4KQ3H 4R8WL 4ANVA 2QQKL 4XC1H 1TPXB 4ZS6D 5E1GA 3BXNA 3DIDA 3BO8A 2IXQB 5TQ0L 1A0QH 3F7VA 1MY5A 4MAUH 3RUGA 3MROA 4WNQB 3LNGA 5CIPA 1G7PB 2XPYA 4J28A 4MQSB 3VMOA 2C3GA 4Y9FA 5ALCL 3CV5A 4OCSL 4ZTPH 3EOTL 1QRND 3VRJB 4A2HA 4ZNEA 1E3ZA 3MRQA 4JB9L 5LB1A 3OKDA 5GGVH 4HLEA 3P0VL 1N2RA 2GTZA 3L4CA 2XZCH 2UY7A 4QT5A 4ES9A 1OP5H 3MHZA 3ROLA 1JGVH 1VFAB 1T20A 4YFLI 3ULUD 1KIPA 3MR9A 5J6GA 1INEH 1RHFA 2VN5A 3SBRA 2ALAA 1NUNB 3D2TA 1G7IA 1AHKA 2ARWA 2P52A 3NCBB 5B8CC 4PREB 4JFZH 5I1CH 3QPQC 3CHOA 1YC7A 4J3OH 2AHIA 4P4RA 3GSRB 1THAA 4ETQA 3L7EA 4JRXB 1OV8A 4X7TA 1MHCB 1XXFC 3IBEA 5F3FA 3OLEA 1VEMA 2VM4A 4XE5B 1DQDH 4XX1G 1LO0H 3TTSA 1I8AA 5C97A 5LQBL 5DJXB 4LRIC 4PJ5A 1JPSL 2AJYH 4WU7B 4K23H 4FQCL 1FL3A 4PGCB 3VD9A 3PFQA 3DV4A 4MA7H 4FNTA 1PF3A 4H1LH 1LK2B 2E9IA 4U3SB 2OZ4A 1ZTXL 3HA0A 1FG9C 1C8QA 1EFXD 4XMZA 2XFGB 3NSXA 3IJYA 3CFJB 3C8KB 3T1FA 1F8TH 1NFDF 1G9MH 5GZOA 1E4XL 3LVEA 1BLIA 4XBEL 5T1KD 3BC9A 3EFDL 1Q0EA 2AI0H 3GMLB 1AKJA 3MRMB 3N2JA 3HB3B 4MSWA 4MMZC 3H3PL 1XD0A 2Q86A 1MH5B 1PEZA 1TYEB 1U58A 5CCJA 4HBQA 3V6OA 4GXVL 3V4VH 4J2XA 2CGZA 4FTDA 4PJ7B 1ZSDA 1XH3B 1BCIA 4F91B 4YE0A 2CXKA 3AW5A 4AJ0A 1HCZA 5JXAL 2JQZA 3MYZA 3AITA 3WKYA 1AS6A 3L3OC 3QQ4A 2R4RH 7FABL 3DX9B 3PXJA 1AG0A 3N42B 1E7UA 1W6WA 5DURD 4FOMA 3TWCH 2PETA 3QZWA 4D0BB 1EDYA 2W0PA 5JPNC 1IC1A 4MX7B 2J7LA 2X6AA 3JTTB 1YEFL 5DSCB 4FLRA 5I1LB 2EE3A 1NLBH 1CU4L 4HLZG 3QUMA 1ZVSB 4JJHA 4HV8A 5I5RA 3WKNA 4FFZL 5FHAH 4A38A 4OB5H 5FDWB 3QEGH 5DJ2A 1KENL 1RUMH 1PZDA 1G6VK 3GXIA 5FKPB 3T77B 2YQ2A 3QWNA 2IF7A 3RU8L 4ODXA 4XAWL 5TF0A 3WJLC 1HHJA 1IGFL 5DMKB 1KLFA 2X1PA 3IVKB 2Y5TB 1AVAA 2K8MA 3ILQD 3BD3A 4KTGA 2X2UA 3I85A 3UTSE 1XGQA 3BVUA 3H2PA 4A6YL 1NM4A 2FT8A 2CO4A 1M05B 3H56A 4Q6IA 1GYAA 3BH9A 3FQXA 4OKDA 4BFIA 1RULH 3C8DA 4YFEA 3CN4A 2DYPA 1MLBB 1G94A 1F3JB 4UQ3B 3S88L 4OFIA 2X9XA 3BIKB 2BWIA 3WHE1 4NCDA 4FFTA 3QR0A 1YVLA 2DL2A 1G7JA 1B4JH 2Z8VC 2ICES 2ZCHL 3EGSA 3EOYG 3BDYL 3K72A 4Z95H 3QXVA 4ELME 3EZJB 3KLAB 1ZGLM 1X4XA 1AP2B 2MCPH 3Q01A 4NIKB 4Y16C 4N2GA 2YZ8A 3G5ZB 4JFOB 3V0GA 4Z7QB 3FN0H 2HRHA 4FXTA 5DFAA 4F8QA 2F54E 2PP9A 5DQDL 7PAZA 4RQQA 2V5RA 4FI8A 1QPPA 1JFHA 3QZWG 3ZKXC 2J88L 4LVNB 1XTMA 2WBJB 4Q2ZB 5D5MA 4K5NA 3TYFB 5I1HL 5HSFA 2JJUA 3Q9QA 1CXHA 3GSXB 3T4YB 1QHOA 4JRYA 4PY8I 1NC4B 4H44C 1A6WH 3G6JB 3TPUB 4J3OF 5KVEH 3MOAL 3JTSB 4AY0A 4ZSOA 3G5YB 4G5ZL 2IAMA 5ABAA 3EKCA 1G1KA 4AYFB 2R69A 2YPLD 4UU9A 3RI5K 3FCGA 4QPEA 2OXGB 3VM5A 4R5XA 5AW7B 3DO4A 2W07B 3RBSA 1E5BA 3GC3A 4AM0A 3QRGH 2ZF8A 1YYML 2BNRE 2NNCA 4JDEA 4D9RE 4C83B 2AEWA 3HG3A 4RGNB 1PKQE 2CKBB 3Q5TA 1YC8A 1MHHB 1KPRA 4FDWA 2QLVB 1NGPH 3P4NA 4I0PA 2DPKA 1N64L 3K91A 1MFNA 3IAQA 3IXAA 1D3CA 4NDMA 4K3GA 1OVZA 3AWFA 4HD5A 3ZUCA 1A3QA 4JCMA 4XHJD 2JKXA 2N59A 1I7TA 4LCUB 3VXNA 3H85A 4UMSA 3REWB 5HYJB 2VB5A 4JREB 5G2NA 1EANA 5IR1B 2APTA 1Z5YD 2A74A 5DYOB 4PQXA 3FJTA 1KNOA 4LO9A 3UDWA 5GGRA 5BS0A 2ITFA 1AO7D 3JQOB 3W0WD 4IBVA 2H2SD 3TBVA 3HBQA 4CC4A 3OPUA 1J48A 2ZQKA 3NSYA 3LKSA 2HVJA 3BEWB 4GXUN 4YHML 1E8YA 2Y7OA 4LVOC 3WE6A 1U3HA 3A4DA 1EMTH 3QK0A 3STZA 2WD0A 3MA9L 3LZFH 5CBEB 2K4AA 5IW1B 1KXQA 4N4YB 2KT6A 2C4XA 4PH8A 5ICXB 2D7QA 3VUAA 4FA8A 1JF1A 2W5PA 3S6CA 3NT0A 2DQHL 5ILTH 3OPZL 3IFOB 5JYLA 1EEYB 2I7SA 1FJ1B 3FAXA 3IFLL 3L9RA 1NEZB 9CGTA 3INOA 4NZJA 4V2BA 2BC4A 2VDPB 3FONB 2HA1A 3UMTA 1VACA 2R4SH 3GXMA 4KHXH 2RGSA 4Y5VA 3K5SA 5KWYC 4D0CB 4XP9H 1I53A 3W2DL 4J6RH 4I9WE 5TK4A 1Z5HA 1OD9A 4BQ8A 4F80A 2XJKA 1T7ZA 1E28A 2OR9L 3V10A 3I3EA 3LMJL 4UT6L 4X5QA 5J1AB 1EEZB 1UCBL 5EBWA 3D08A 4BK8A 4ZMPA 3ARDA 4NQCD 4M8QA 5IHUL 4XNDA 4R4NC 1DVFB 1WD8A 5I6PA 4HUMB 3HEIB 5AUMB 4BFJA 3H7BA 2VAAB 1IM3D 3O6LH 3RWEA 5DHVH 4OAWB 5CD5C 5BUAA 4FXLA 4TNGA 4YSTA 5DS8A 2XWBB 4ELKA 4DO5A 4Y4HA 1HOCA 4LVHC 3BN3B 3PWNA 1BSIA 1U8IA 4QCIB 3GEFA 4GRLC 5TD4A 4NNPL 1PQZB 2BFVL 2JI2A 3Q8CA 3OMAB 1QSED 1U92B 3MJGX 3S3PA 4I1PA 4HIXH 1EH9A 1FIGH 4XPAL 4PJFE 4AL8H 4AZ8B 1XVSA 1C1EL 5SX4I 2DEWX 3GUTA 1MRCL 2EDHA 1FLRL 5LDUA 1Q72H 1OGTB 4XBGA 5I8CB 3H4HA 4EUPA 3QUZB 3R19A 5CJQL 3LRHA 3ZHDA 2MOVA 4LCYB 3HG1E 1N68A 4OD2A 4QOKE 4WUUD 2NY3C 2R0WH 4N2MA 4GW5B 5F88A 4F8OA 2E9JA 1EAQA 4X7SH 1NGZA 2HFGL 3ZIYA 4AW7A 1MNNA 3ILDA 5CWSA 3PPEA 1VFBA 2XIBA 5CSBA 4YQXL 1WYJA 1JYNA 1QOKA 2KH2B 3H9YA 4S2SA 4AVJA 4FJYA 1KJ2H 4E41E 1GPOL 5L2JA 2K6YA 4M48H 3HMXL 5JPMC 3HUJB 1BIIA 2WTOA 2MJWA 4XWOC 3VFWA 1B0WA 3SQOH 4L8DA 2HJLA 4PJXE 4UUJA 1QEWB 4HLZH 1JPST 2A9NL 1O5PA 3O3EA 3MGAA 4U1HB 4N3UA 4JHAL 3L3KB 1QLFB 2FWOA 1ODUA 4UNUA 4E9TA 1R46A 5KVEE 6FABL 3SD2A 5EC1A 1KZQA 4XPBH 1QVOA 1M2OA 2ADJA 4AC4A 5J13C 1VGKB 2ZCZA 1RH8A 5D4IA 5TQ2H 1NCWL 2OZ4H 2XIDA 4CSSA 1XGYL 1FNGA 4BE6A 4B97A 2WLMA 1K6QH 1HL9A 3ATBA 3K6IA 4HD9A 4C57C 3D7PA 1TTFA 4JO3L 3ZGHA 3ZN6A 3MV7E 3BP6A 4OJAA 3L2MA 3S5LA 4JO4L 4HBCL 5CCKL 4HUWB 3GLEA 3U46A 1Q90A 3WUWA 4FQXC 5DUBA 3TNNA 5MEPA 5D2LE 4AG4L 1LM8V 4OFYA 3QIBD 4Q74A 1AR1C 2LQRA 4OGAC 5D7LB 2X6BA 5C0EB 1UHVA 3QIUD 1R3HA 5EU4A 4EUPG 2D4DA 2F7PA 3QEHB 3SQBB 3TYGL 2CMRL 4N26A 3SDCD 4PJCA 3FCTA 1XCQA 4MB5A 3FU8A 4Z3IA 4P06A 4N8VA 2CR6A 1IQDA 4JPSA 2XZQL 1BXAA 1LO5B 4X0NA 4BK5C 3TURA 1A3RL 2DWDA 2CDGB 2DTMH 2UY6B 1D5RA 4L4VA 3CUPB 4Z7AA 2WLKA 3I50H 1NFIA 3VRIB 4KVCH 3RNQA 3CFKB 1I7RA 2Y06L 2GTQA 2NYKA 3QCUH 3QUMH 1GC1C 5FGSA 2CNYA 3VXUA 2RALA 5IOPA 3TJHC 3V4PL 5EIQA 1MUJB 4JQXC 1OSZA 3MFFA 5BV7C 4PJHF 2P7TB 3X12A 3ILEA 4M9OA 4GMSH 5GGSB 4A7VA 3AG3B 2UWEF 1UASA 4NFBA 4LIQH 2IOIA 4XPGH 4OD3H 5HPOA 1TQTA 5DDHA 3B5GA 1RZKH 1X9LA 3FB5B 4NENB 5C2UB 1KJVB 4ONFL 1AIFB 5E2WH 5LLIC 3MQIA 5KVGL 3G04A 2A9MH 4O02B 1WBYB 1DVFD 5F1OB 3VFGL 4BFOA 4ERSL 2Z6FA 4K7PH 3DSFL 3N40P 3N44B 4HH9A 3S5LG 5L4JA 2ATPA 4EN3A 3ILPA 4M1CC 3WUWG 4HHWA 4FI7A 3WN5C 5ID0A 2XC8A 5I1JH 1S6NA 3RUGF 4GUOA 3T9WA 4MQ7A 1ITCA 1CGTA 1T2JA 4ZMTA 4YE4L 4OZHA 4QXTA 1KEML 1UACH 2Z91A 4TUUA 4OQ1A 5L6YL 1M6OA 2FO8A 3TZVB 2O61A 4IRJA 2ZICA 1OSYA 4KBPA 2XA8L 3BZ4B 1DUYB 4N8VG 2ZJSH 4HQQH 4QY8A 2XQ0A 4PBVC 5T5FA 1QFUL 1JUFA 2Z31B 3J7HA 4OJEH 3IU4L 2BWQA 5I1GL 1DZBA 4P2OB 3SDYL 4DKFH 2GW5A 4ZI8A 1I9JL 3EJZC 5DJ6A 4HU8A 5I30L 3F5WA 4M1GL 1OAYH 3RUGE 4WENB 1ULVA 4Q8BA 4JFPA 1ZPUA 3FQWA 2D7PA 1JYXA 3BPLB 1RK7A 3FTGA 4PPTA 1J9QA 1XF2B 2FWSA 4FCAA 2F08A 2ZPKL 1FUNA 4IOIA 5AYQA 4Z7NE 5ADPL 2XQBH 3BW9B 4ZNEE 3U9WA 3HPJB 4TN9A 2K3TA 4Y4FD 4XP6H 4EOWL 1ECZA 2R69H 4FD0A 1NDMB 4ECNA 1BP3B 1LWRA 2HPOA 3ZTJG 1TF4A 3ZBMA 5C7XH 4BRVA 2E6QA 1SYVB 4FHKA 4LSSH 2OX5A 3FT1A 3P69A 1MFEH 2JWYA 4KY1L 4XPFH 1FDLH 1JTOA 1KT2B 2OMWB 3F7LA 2EH7H 1E4WL 2C7UB 2ROYA 1T04A 1Q38A 1BVNP 1Q1JL 2HTLC 4APQA 2E4TA 3NJJA 2B1AL 2AVGA 1MVUA 4NZRL 4UIKL 4UINH 5D1ZB 3EYOA 4JZOA 3VGDA 1FAIH 2C1OA 5F3HA 4GAJH 4R3SA 5JZ7C 1NAMB 5FGBA 3UZEC 2WVUA 2AK4D 4BM7A 3DHPA 5E8NA 5TK2A 4PJ5E 5LBSH 5DO2D 4JKKA 5KBPA 1FSKB 4UBDC 1BVOA 3E0GA 1GIGH 1K3IA 4Z77B 2VABB 2WQRA 4NS0A 2J8UA 1S9YB 2IGFL 3HE7D 1GJIA 2VR9A 2P8PB 1A2YB 1VEOA 3S3CB 4HEPA 5HHMD 3ARSA 5IQOA 2AW2A 4ODUA 4XCYB 2XG4A 3MNVB 2LFGA 3LS4L 1L9PA 4OKVA 5SWSB 4FG6D 1OK8A 3VX0A 1SMAA 1JF6A 1L6ZA 1E67A 2GVYA 4ZFFB 3HFMH 4L8SB 3TBWA 2H4EA 5E56A 2CGRL 1CDCA 4G3YH 3P4MA 4M6OH 1TR7A 3A22A 1JVOA 4TSCH 2HG5A 3SE6A 3DRTB 4P9MH 4L37B 4XP5L 3U0WL 1U9KA 2YBGA 4J8QA 5I8KL 2RH0A 3V6OE 2NNRA 2EVGA 1FNSH 3EJUA 4HDIB 3ESMA 4HJJH 4PJGE 4XO4A 2J12B 3TH4T 3FO9A 4LLMA 2A38A 4B0MB 1TSRA 4G83A 4IGBA 2VXQL 5KSVB 1NJ9B 2I85A 2WPGA 3QCVH 4NT6B 4PI0A 2DM7A 3LTVA 2YAOA 2YJQA 1F2QA 1HZHH 4DGVL 1F97A 2ICWA 5BZDB 1XSKA 4Z3JA 1O9ZA 2LU5A 4CBPA 4CUCA 4WWKD 2NYYD 4JRFA 4AE1A 4ODSH 5DO8A 1MCQA 1IL1A 1ZXKA 3D3VD 2ZSVA 5FDYA 1N59A 2B39A 3UEQA 3BH8A 1CLOL 1VEPA 5GZND 1CBVL 5KVFL 5JHLL 3C2AH 4ZQKA 4FJ6A 3HG2A 1DDHB 1K8DB 1GY2A 3AQZA 1MWAL 4HUXA 5E8EB 2EKSA 1AHWB 2FECI 4XPHL 2I9TA 1WO2A 2ESVA 3MCG1 4ZPTA 4HEPG 1B0RA 3FUIA 2OMTA 3ZDZF 4OZIB 4JFYB 1XL6A 1FPTH 1T0MA 3S35L 4NKOA 4PR5B 2BY0A 4MCYB 3U2SB 5GJSH 3MV8E 3S3BB 3MRHA 2HAZA 5F44A 2TSAA 5T33L 4UQAA 3RPKA 1OSEA 1ZT7A 5D7IA 4I2XB 3U6RA 1SM3H 4JDVA 3WAJA 1G7QB 4ZMAT 3BAWA 3DX7B 4IJTA 3MREB 2MH4A 3DRQA 2VISB 3KW7A 4NZDA 3FC8A 3RIKA 4JG9A 1U3NA 3PJSA 4K8RD 3BRGC 4Z7OF 4QHMA 4P23B 1UT2A 3E1ZA 5DEJA 3FQRA 2V4LA 3U36B 3MNWA 4UQEA 4RFEB 1AJ7L 5HVGB 4ACTA 2OMUB 1K72A 2V7HB 3CFEA 4R5VA 1A1OA 4IRSB 1QP1A 5F97E 3K0WA 5IROA 3VQ1C 4ZUSA 2P8MA 2QFRA 3UG5A 2BRRH 4X5WA 4YBLC 4DNLA 2D31B 3VYNA 3P9LB 3BZEB 5FFOA 5D5ME 5CM1A 2VLRD 1MCIA 1WFTA 4WEUD 3L4ZA 3P2TA 4IKJA 3TT3H 4DKEL 5HPMA 4JRYE 3SCMD 5HI4D 5C0NC 3EFFB 2WOBA 3KH4A 2HN7B 3TO4C 4LCCA 4Z5RB 3O8XB 3QJFB 2OBGA 2OYMA 3ZXAC 1SEBA 1V3KA 1IAMA 2OJZH 4ZSOE 2GJZA 5C0DB 4AQAB 2JIXA 4FQPA 2QQLL 2DQJH 4XVSL 5LVEA 3D07A 3NGBC 5DEFB 5AW9B 2OSYA 4G8GD 5ACZA 1CLYL 1BMGA 4CNIA 1N8ZA 4IBWA 5E03A 4AH2A 4RMUA 3S0PA 4JN2B 1ZXQA 4KDVA 2EDBA 1KWGA 4O4YH 3SO3C 3SGDH 4YSPA 4HX1A 1FVDA 4TKWA 5LDSA 1JAEA 3QQ3B 3L1OL 2E8YA 2JELH 4KRPC 1M3IA 4ZX5A 3KCWA 1KJ3L 4Z0BL 5IBTH 5JHDB 1QTSA 3RIFF 4JFED 2VERN 3QDMA 5DHYB 1KLUB 4ODTL 1H9VA 3GSWB 2DQIH 4XVTL 2NY2D 2DJMA 4W1TA 1WFMA 4UZSA 5CGMA 1FIEA 3ULSA 1A6AB 4G9FA 3MMEB 3NCJH 2VITA 4HHGA 4A39A 5JTWA 2WIIB 3QDGA 1F6LL 2WCPA 3RJDA 3CZEA 1TZHB 4B53A 2VDNH 2Y72A 5IVXF 4X6EA 4K5LA 3VFVA 2R39A 3DIVA 4W9LC 2NY0B 5BS0E 3D12B 3C08L 3SE8H 1A1NB 1UT1A 4N3TA 5E6IA 3UACA 4N6RA 1LK3L 5FOJA 1I4FA 1ET5A 2Z93A 3FTSA 4MS6A 5FA3B 1Q9WA 1MVYA 4CSZA 3C6LB 3KXFA 5FUZH 4TPRH 2W9DH 4PEEA 4PU2A 5DK2A 1I9EA 3PREA 4IEFA 1KXQE 4N2FA 1U2YA 1AS7A 5IMLB 4Q52A 3Q1SL 3BWUC 1UM4L 4J7RA 1J0JA 3ZTJH 1OCWH 5IFJB 4OY9A 4L2YA 1MLCB 4ZS6C 4XBMA 4ZXBB 2RCSH 3IRCA 1HL5A 5IMOA 2G2PA 5F7LB 4BEIA 1O7DE 2HX8A 5D70H 3VA2C 1AZNA 1CGVA 4LLWB 3BZ5A 1RZ8B 1DVXA 1MF2H 3GXNA 3OHXB 1G84A 1JGEA 4ZW3A 1ID2A 1WP6A 4PJEA 4BDVA 3CDZA 5BO0D 1NMAH 2YGQA 4JFDB 1YMMD 5FB8A 4OQTL 4MD5B 4QHNA 3DBSA 5CJ8A 3VNYA 1ORSB 1DHKA 2OP4L 1B88A 4LL9A 4RZCB 5FFGA 1JHLH 4L0YA 1DBKL 2PCYA 4DGIL 2ERJC 5E2UH 1FAKT 1PYWB 2CBMA 1D7BA 4KTDL 4W4NA 1JWSB 1JNHB 3ULUC 2VT0A 3A6CL 2OTUA 3VWJD 4FQ2L 3RDJA 3OKNB 4BGDA 5T5FH 3FQNB 2PW2A 1HNYA 5E9DD 3KE0A 3T2NH 2X44D 3MRCA 2H1PH 1G43A 4HW6A 2BCKB 2OL3B 3T0XA 1BWMA 4BA0A 1FO0B 4HIHA 5INCA 1P5VB 5IESL 3CFTA 3M1OA 4H8WL 4TQPA 1XR8A 1ZLVK 4FYTA 1ZA3A 2W60B 2X09A 1YEKL 3QNYA 5F9OL 1FQ9C 5CHNB 1TJHL 1Q0XL 3EJRA 3JVGC 4F9LC 1BM3L 2Q7NA 2X4TB 4UYQA 1E4XI 4UCFA 3BUIA 5EIIB 3LB6D 1AGBB 3PWPD 5FUCC 2YWYA 1NFDB 4X99B 3LEXB 2F74B 2H7WA 3D25B 3PWVB 1JZEA 3AG1B 1NGWB 1HL8A 2R2BB 2P9RA 2CHNA 4OJCA 1UUSA 3L1GA 3B9KA 5DD1H 3CFQA 3HRZB 5ITFA 5JNYB 1SLUA 2UXVA 5HDBF 3E8UL 3ROOB 3LYRA 5CR8A 4ZYKB 5EU3B 2XWZA 1N6UA 4BFGA 2FO1A 1T89A 2G5BA 1U8LB 4KQ4H 1Q0YL 3CLFL 4LCIL 5F9JB 1YYCA 1S7UB 3LXCA 5KYWB 4JL2A 1BM7A 1UQSA 4EIUA 2KPWA 5A2BA 2ZXWB 3D33A 3DHMA 1KV7A 4WO4A 4V1DE 4HKJB 3TA3A 2HSIA 1GY1A 4P5KB 3GBMH 4QAMB 3VFSB 3KZ8A 2GSIA 4WZ9A 5BO1L 2C9AA 4UOW0 3QA3B 3ZTEA 4ESKA 1S7SA 3GK8L 3NDZE 5ADOH 4JPWH 1AOZA 2C1PB 3K2IA 1JHTA 2QEJA 2R23B 4N8CL 1KGWA 2IV8A 4R96B 3RWJA 3SZKC 3EBAA 2NXYD 3GXDA 4O51B 4IW4C 4XNZC 3QI9A 1U8PB 1LWJA 3EF4A 1J1XL 2ENYA 3TA4D 1VA9A 1DJXA 1F11B 2XG5B 1IGJB 5AAWC 3RA7L 3EJSA 2VIRB 1B4TA 1INDH 4AVIA 2DWSA 1E9QA 1ZTXE 2WXQA 3CZNA 5FYKH 2X4OA 1K4CA 3STLB 1TJGL 2QTEA 3AG2B 4OSUH 4RBPH 1T4WA 1YEGH 3IDIB 4M6NH 1U3JA 4HPYH 1MJ7L 4LPYA 4ELMB 4GRWE 4IOSD 2UZXB 4K7FA 5TDOB 3ILQC 2R0KH 1G7HB 3NH7L 1XF3B 4JGMA 2X3CA 3AT0A 4PJCE 4PJIA 3F7PC 2GFBA 2YUZA 4M03A 3MRLA 2F54B 3S35X 2WSPA 2NR6D 5HJGA 4J39A 5K59F 3GXPA 4KVNH 4ANUA 1HVXA 3GPSA 5B39B 2MOGA 1TCMA 2LLLA 1H3PH 1RZGB 2X4UB 5E8DH 5LO7A 5HHXH 2ARJA 2SEBB 5I24A 2VDQL 4Y5YC 4YPGA 4L4VE 2AQTA 4KWUA 1KLGB 4X8XA 5LCVL 2ZUTA 1IC5H 2IBGA 1Z9NA 3TGXA 4NSKA 5E5MA 1XZ0A 3BPCB 3IFPB 4J8RA 4Y5XB 5K1JA 3NAAL 3VXUE 5I16B 4HAGA 1QA9A 1RURL 2BXYA 5GSRB 1UXMA 1Y6KR 4S0TD 5E95B 3VFOA 2NTFB 3KPLB 5IJDC 3QEQA 1F1DA 4P2RA 5C0BB 3GEWB 4G42A 4OZHF 4U6HB 4N2CA 3WL9A 4NJAL 4FQQB 4YR6B 1X6LA 4NRZA 3VTTA 3TBYB 3I9IA 2B9AA 3RRQA 3U7YL 2WKOA 1ZEAH 3Q9PA 1JCVA 3F6IA 4UF7C 1FORL 1CYGA 3O9WD 4PV9A 1U91A 1VKXB 2JQMA 5EUKA 2RD0A 5JDSB 1OGAA 2I60L 3DURA 1D5BA 1NGYB 1BWWA 1T1XA 1RVFH 1VENA 2YQGA 4G1EA 1UWGH 2ZSWA 4RISH 1Z5LB 2IBBA 2BSTA 3GPEA 4DVRL 3JWOH 4JKNA 4MD4A 4LNRB 4BA8A 4U1NA 2GJPA 3MRDB 4XMTA 1N5YL 3BKYL 1GC1L 4OZHE 1FG2B