1ZV2A

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
b'LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zv2A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zv2A02
3FYEB 1UATA 3AG1B 1ADWA 3NJNA 2WSDA 3IN0A 3FQ2A 4E9TA 1M9WA 3OD3A 2VSMB 1DYZA 4DP1X 3QPKA 5D4HA 2TSBA 3QJSB 4YSOA 4BDVA 3V9EA 4E9VA 4HCGA 1SF3A 2FT8A 3SBPA 1DZ0A 1AS8A 2H5UA 3PAVA 4YSUA 2VSKB 3JT2A 1TU2A 3ASNB 1OCRB 3PXLA 3QJVB 2GC7C 2DV6A 2XU9A 2GHZA 2YARA 5I28A 3EHBB 2DYRB 1AS7A 2H3XC 1BYOA 3ZX1A 2PPDA 4HCFA 1ZDQA 2X87A 4AX3A 1OCOB 2HXAA 2BP8B 3FU9A 3D12B 3TU6A 3UAAA 1NIBA 3T9WA 2E86A 3CVBA 3H4FA 3C75A 3NJJA 2BP0A 1NICA 2IH9A 5B1BB 2FT6A 3TA4D 2CJ3A 1ASOA 4FAAB 4X4KA 4ZK8A 4BWUA 1JXFA 2GC4C 2H47C 3EH5B 4BXSV 4M4RB 2XV0A 3WKQA 3NSDA 2BZ7A 2UX7A 3DTUB 4RH4A 8PAZA 1SHXA 2VW6A 1AZRA 2YQBA 2IDUA 3FQ1A 3NJHA 3S3CB 4KO9A 1JZJA 1GW0A 4KO6A 3ABKB 3SBQA 3WNIA 3DKHA 4E9XA 9PCYA 4G7SB 2IAAC 4L0PB 4UAHA 3JTBA 1MZZA 1AZCA 1BQRA 1L9RA 5B1AB 1BYPA 7PCYA 2YAEA 1NZRA 4YSPA 2UXFA 1BXVA 4DPAX 1JVLA 4E9YA 3WNJA 2FWLB 2YAMA 2PPEA 2FTAA 1NWPA 5E9NA 4HALA 2MRYA 1XB3A 2PCFA 2WO2B 1AR1B 4AZUA 2B08A 1KBWA 5TK4A 2DWTA 1KDJA 3GYRA 1RKRA 2P80A 3GDCA 3TASA 4BWWA 4FA7B 4KO7A 2EIJB 1PZCA 3PAZA 3NT0A 3AG3B 1J5DA 1ET7A 4KOBA 1XB6A 2FT7A 1BXUA 5F7AA 3FQYA 2RACA 1V55B 1BEXA 3AG4B 1BQ5A 1N70A 3MX0B 1E67A 4KO5A 2XXGA 2HX7A 2VM3A 2XWZA 1ET8A 5TK2A 1ILUA 5I6LA 4A68A 3EH3B 1PNCA 1KCWA 3X1EA 3ZDWA 2HX9A 1E5ZA 1NTDA 2IWEA 1IBZA 3OM3B 3ERXA 1XB8A 1L9QA 3FSZA 1E65A 2Q5BA 4DP8X 5I5IA 4HAKA 4YSCA 3AG2B 1PY0A 3IE9A 1GY2A 1QLEB 2UX6A 4E9WA 3TBCA 2VM4A 1A4BA 2AFNA 1GSKA 3UAEA 5PAZA 1AOZA 1CUOA 2A3TA 3X2QB 1NWOA 3X1BA 1N68A 5B3SB 3FSVA 2MTAA 2HX8A 2N0MA 1NPJA 3NYKA 3L45A 1L9SA 5IY5B 3DIVA 2BO0A 3CDZB 2FQGA 4WTQA 2HRGA 3NSFA 5F7BA 3T6ZA 1I53A 1X9RA 1L9TA 1TEFA 4JKNA 1AACA 1J9SA 4JHVA 4E9RA 3WG7B 4KNSA 4DP6X 1JZEA 4Q8BA 2ZWNA 3NJKA 1AZUA 1NINA 3PAUA 5I26A 3IBOA 1AQ8A 2CCWA 4W1TA 1NDTA 1W6LA 3BQVA 2YAOA 3CDZA 3FYIB 2GIMA 7PAZA 4HCIA 1A4CA 2CBPA 4GY4A 5A7EA 4EF3A 1ASQA 2XUWA 4A66A 1ETJA 1JZHA 2B3IA 3QJRB 3FS9A 1GYCA 4BK5C 2IDFA 4E9SA 1SF5A 4P5RA 4DP4X 4KNUA 1MDAA 1SNRA 1SDDB 4N8UA 1PLCA 1E30A 2GI0A 3V9CA 1ID2A 2X88A 1M56B 2PLTA 3NJGA 2W8CA 3S3DB 2FNWA 1T5KA 2DY2A 1IC0A 2W88A 2AVFA 3H4HA 2YAFA 3NP3A 4NAJA 1ZDSA 4YSDA 1TKWA 1CC3A 3T71A 2BW4A 1AIZA 4BWTA 1OE1A 1CURA 1PZBA 4GP4B 4WKXA 4F7KA 1JZFA 2QPEB 5I6KA 1MZYA 3TBBA 1B3IA 1ZIBA 4HZ1A 1R1CA 1WS7A 2Y1AA 2QDWA 1WAEA 2OCCB 5AKRA 4BXVA 1A8ZA 1J9QA 4GYBA 3NJMA 1NIFA 4Q89A 3T6VA 1IBYA 4DP9X 2GSMB 3FPXA 4A2DA 3NJLA 5PCYA 3ZBMA 2I7OA 4YSAA 1PZAA 4G7RB 2XLLA 3WI9A 3WKPA 3X1NA 1ET5A 2Q9OA 1AG6A 4F2FA 2BP0B 4YVUA 3EH4B 4G72B 4A67A 4YL4A 4AKQA 3FU7B 4AKPA 3S3BB 1WS8A 4QKTA 3ABLB 4DPBX 1NIDA 4CSZA 2BZCA 2PPAA 1SFHA 3QJTB 4HHGA 1L9OA 5ANHA 3WIAA 2IH8A 3BVDB 1KCBA 1W8EA 2UXVA 3FT0A 3U25A 1OCCB 1KYAA 1JERA 1FWXA 1ZIAA 1A65A 2J55A 2YAQA 1KDIA 2VW7A 5I5MA 1ZV2A 3OMIB 1AG0A 2PCYA 4AI7A 3G5WA 3QJQB 2NRDA 5B7FA 4G70B 1AANA 2AANA 3IEAA 4NB7A 1RZQA 2VN3A 1MG3C 2CAKA 3SBRA 2PP8A 2XXFA 3NJIA 1EZLA 5EHFA 1GS6X 2Y69B 3S8GB 1OF0A 2HRHA 1KV7A 5LDUA 1QHQA 6PAZA 2BP8A 5B1JA 5I6NA 2WO3B 4G7QB 5B1KA 5D4IA 1PCSA 1A3ZA 4HIPA 4A2GA 2P80D 3AW5A 1JZGA 2PP9A 1ASPA 2IWKA 3CVCA 2JFCA 3T6XA 4ENZA 1IKOP 2XYBA 2FQEA 5B7EA 6PCYA 5D4JA 3IN2A 4TXVB 1BAWA 4NERA 4YSQA 2PPCA 3X1FA 2UXGA 4DP7X 1PLAA 3OMAB 1TEGA 4KNTA 1FFTB 3AY2A 3OQRA 4PCYA 3FSWA 2DYSB 5I6PA 4YVNA 4E9QA 3QJUB 1WA2X 4DP5X 4YSEA 2J5WA 1J5CA 2XX0A 3AZUA 1OOWA 1OV8A 4GP8B 4YSRA 1GY1A 4K9JA 2J57A 3H56A 3PCYA 3NSCA 3RYMA 5FC9A 3ABMB 2BHFA 1GS8A 2ZONA 1JXDA 2IWFA 3MBWB 4JHUA 2GBAA 2XVBA 1JOIA 2IDQA 4HHWA 1M57B 2PP7A 3HB3B 3UACA 2PPFA 1JVOA 3QQXA 3EF4A 2AZUA 1ZPUA 2UXTA 4DPCX 1HFUA 3CVDA 4MFHA 2YAHA 1KGYE 1PMYA 4M3HA 3KW8A 2VW4A 4GXFA 1NIAA 2GB2A 4PAZA 5I5JA 1RCYA 5AFAA 4CSPA 2JXMA 1AAJA 1NIEA 1W6WA 4KOCA 2BW5A 1EHKB 1CYWA 3UADA 4YSSA 1J9TA 3T6WA 1OE2A 1WA1X 2EINB 2FQDA 1GR7A 2CALA 2EILB 1PNDA 2FJSA 3GXUB 2EIKB 2CUAA 2AZAA 2ZXWB 5AZUA 2BWDA 1JZIA 2J56A 2QDVA 1GS7A 2I85A 5I6MA 1F56A 1XMEB 2FQFA 3ZIYA 1IUZA 1SHWA 4UF7C 1ILSA 4DP0X 1E5YA 2I7SA 1FA4A 4N4YB 2OJ1A 3FSAA 3FU8A 3SQRA 4A2EA 1QNIA 3OMNB 1SDDA 1OCZB 3NJFA 1WA0X 2DWSA 5B7MA 2XV3A 1L9PA 1NPNA 4F2EA 1RZPA 4AKOA 2XV2A 3NSYA 4GP5B 1AS6A 1CYXA 4UANA 1VLXA 2ZOOA 3CZUB 1URIA 1HAWA 2HLEB 2EIMB 3KW7A 1YLBB 1HAUA 3CG8A 5B1JC 2JKWA 2TSAA 3N2JA 1SJMA 1BXAA 2YAPA 2YXVA 1PF3A 1BQKA 2R7EB 2VMJA 3HEIB 4DP2X 2XX1A 4A2FA 1AZNA 3ABGA 5I6OA 4P5SA 1V54B 1V10A 2LLNA 4BDVB 4A2HA 1OE3A 2OV0A 3NP4A 3ASOB 3PPSA 1X9UA 2QT6A 4YSTA 4G71B 1SFDA 1MG2C 2IDSA 3PLYA 1KBVA 3N55A 2BWIA 2IDTA 2R7EA 3S8FB 1PLBA 1PAZA 4QLWA 1A4AA 2HZHA 3UGEA 3UABA 3X1GA 3FPYA 3FU7A 1JXGA 4W9ZA 1AZBA 2YXWA 2QPDB 1J9RA
chains in the Genus database with same CATH superfamily
5KVEH 1NCWH 3FYEB 1KENH 2O93L 5CEXA 3IN0A 4KZEH 2VISA 1Z3GH 2VR5A 3G6AA 3A3YB 3MRDB 5BW7A 5F8RC 5D4HA 3RFZB 3SGJC 3F7VA 1QOKA 5D1ZA 3LIZH 5F7LB 2WXFA 3O6KH 1DZ0A 4KUZH 5C07B 2H32A 4A7QA 4NX0A 3H9SD 5DYFA 1B0RB 2WN3A 35C8L 3T3MF 1QUPA 3CTTA 3MJ7A 1H3VA 1CF1A 1B90A 2EC9U 5D7LA 4Z7UF 5JHLA 1AS7A 2AQTA 3H9HA 3AC0A 5D7SL 4MQ7B 3X3FL 5C92A 4N5ED 5KVGL 4H13C 4ERSH 2HXAA 3PABA 4LEOA 3Q2NA 5ECGA 5JZ7D 2P48B 3B9EA 4P06A 4XOBA 2MKLC 3PF2A 3C75A 5ALBL 1HNFA 3Q05A 3U0TA 4QXGL 4Y7OC 5DFVD 3WY1A 4JHBA 1MFVA 1FV1B 2KZ1B 2GFBA 3HAEB 5EBMB 1PQZA 2H47C 4KTDH 4RGNC 3L08A 2Y2YA 3ARUA 5JPNA 2V2XB 3BUIA 2UZXA 5LG1A 2EECA 5GIRA 2X2HA 2R8SL 4XRCB 5F7WC 4WW2B 1EFXA 5FHAH 2Z4TA 3DUUA 2CJUH 3TYGH 4FXGB 2IO5A 4HUKB 3GHEH 1LWRA 3U6RB 4L0PB 2YR3A 3ARGB 1QLRA 4H88H 4YWGH 4OZIB 4KRPB 4HWBL 1EZSA 4UAOB 3GM0A 5CJ8A 4PVBA 1ZANL 1DN0B 1G7QB 4FCAA 4OCMC 3UZQA 4KBPA 2Q2LA 2NY5C 3LN5A 1J5HA 4O5LL 2MSPA 4UU9B 4ZAKB 3BP6A 4GEJA 1SOSA 1U8QB 4OGQC 1R3JB 3C8HA 3PDOB 4MA1C 3TZVA 5H35B 2CDGA 4M02A 3QDJB 4H1LA 5JW3L 4LHUA 3V5HB 4YHMH 1AGDB 4Q6IB 4HG4J 2VL4A 3LV3B 4Y5VB 5CJOH 2NNAB 5D2LE 4K3DL 4FA7B 2QGCA 2A6DB 4FP8H 3WTTA 4IU2B 3AM8C 3QP3A 4R4FH 4X0KB 2VGLM 1J5DA 5E5LA 4F8QA 3JVGA 3FQYA 4ONFH 2AHIA 1V55B 4H8UA 1V7NH 2HWZH 1E3XA 4RGOL 4AM0B 2R2BB 5CP3A 2WXQA 2XXGA 3MA7B 2KUTA 4DTGH 3DIFB 2R0KH 1U21A 4HU8A 3QDHA 5EBGA 2XQYK 4KNQA 3TN0B 4U7KA 3PWLA 3JTTB 4ATWA 4XVOA 5H37H 1PG7H 2F0CA 1CGXA 2NXYC 3VH8G 4KY1L 2B1AL 4MB5A 3EGXA 3U48A 1A8JH 4ZTOH 5JR1H 3OPUA 5I0XA 2OMNA 3TWCH 3KLKA 2PR4L 1I1FA 3OKOB 3BPLC 1YG9A 5F89A 2ZD0A 3TYFA 5IHUH 1NUFA 3FT2A 3C5JB 3AG2B 3EUUA 1XGPA 4BFOA 3Q5TA 2NNFA 2AJVL 2EC9T 1DVYA 1M7UA 4PRIE 4WCYH 3ZZQA 4D3CL 2EDYA 1AY1H 2ZCLH 3O3BB 4PRAB 2CGRH 4I9WD 1FL5B 4L9DA 4QRPE 5C0AD 2QMJA 5F70A 2CMRL 4WSJA 5CWSA 2ZXBA 4F5CA 5EZOH 3IJ7A 2A3TA 2NUTA 5MEQA 5D6CB 5FW7A 2OR7A 3FHQA 2YFOA 2Z7YA 3ARBB 2X38A 3WDJA 4IMLB 5CBEB 2E8YA 2OBGA 3MLWH 4IM8A 4WI5A 3L45A 4XNYH 3U9UB 2WN2A 5HHMD 1CJYA 1OARL 3DIVA 4LF3A 1S8DA 5C07D 3U83A 4PRHA 4OCYH 5HVHC 4F7TA 4ELMA 3VWKD 2F74B 3W39A 1MCKA 4C4KO 1JPTL 1WWAX 3ENEA 4X80L 3S34L 3D8MA 5HPOA 3AU1B 4UM8A 3SDCA 4LOUD 5HI5C 1FPTL 5DRZA 1QAWA 3QNXA 4MD0B 4IJ3B 1AZUA 3PAUA 3P3RA 3SY0B 1GZHC 3UTPE 5FA4B 1Y7VA 4OQTH 4XP5L 2Y7MA 4ZOAA 3ME0B 4GO8A 5CCJA 5JHLH 1UOWA 3BH8A 1UWEH 3UBXB 4CC0A 2HKFL 2JCCA 5IG7B 12E8L 1VDGA 4ZFZA 1ZTXL 4PJ9A 1T7WA 1FFOB 3UJIH 4XH2A 1RUAL 2B3IA 2NW3A 1A7NL 2OMTB 4H2AA 4UTAL 3GJFH 1TQCC 2J8UF 4NXKA 2OR8A 3S37L 4HJJL 4YJZL 1EVUA 3LZNA 4NI3A 4DP4X 3OF6A 4YDLB 5BS0D 5E7FA 2X3BA 3FCSA 2COQA 5B7FA 5JHDA 3DURA 4AXWA 2D7TH 5I1IL 5EOQL 4W9KC 3ZZSA 4IKNA 5JIIA 3O81A 4OW6A 4TOYH 3AU0A 5E8EA 4WQOA 5D6DA 3HLAB 5FUZL 2WXGA 5DSCA 1MH5A 2X4SA 3P4OB 4F7KA 2X4TB 3GI8H 3B7TA 1I8MA 1FFRA 1QBAA 3BWUC 4KFMA 1H5BA 2CIKB 4KJYB 2WXPA 5D7KE 5F9WB 2F68X 2X70B 2RJMA 3VD9A 2Y1AA 4F20A 5CP7B 2OCCB 4QHUB 1DVFC 1W72B 4YGAB 3C5SB 1O5PA 1W0VB 3B9DA 3KPLB 3T6VA 5F6HI 4G42B 3M17B 4PB0L 2FGWH 2UZIH 4ZD3H 3CFKB 5EULV 1U4EA 4OM1H 1PDKA 3ARZA 2J25A 1ET5A 3L3JB 2MOVA 4WUKH 2Q9OA 3TO2B 3FRUA 4APQC 2J88H 3WFHA 4L1DA 1Q38A 4HZAA 1DJGA 1UWXK 3IFNL 3NJVA 1SY6A 2A38A 4UM9D 2XACC 3SBWC 3J7HA 4PWHA 3S2AA 4DPBX 3HIZA 4W93A 5B4MD 4PJGA 2R56L 2NZ1A 5EO0A 1P7QA 4U3CA 4HWBA 2RHEA 4MDIA 4TNFA 1IC5L 2K6WA 3V5KB 2NX5A 4LL1A 3L7FA 1BOGA 1N18A 3RP1A 5C0BD 5I76B 4YOKA 3PHOA 4MMYB 4WW1B 1BZ8A 4I9WE 4DKFL 3OJVC 1U3HA 5J56B 1CFSA 2IXQA 1ZIAA 2J55A 5TQ2H 2ZCKH 1BQHA 4N0UA 1AQKH 2HFGH 4YXKH 3AACA 4FQ1L 3L5IA 4F9PC 1J0ZA 3ZMNA 1WT5C 4DH2A 2MTPA 4OZIF 3BPOC 4X6EB 2P8PA 4ZW6A 4JO5A 1QP1A 5TH2B 4ZYKA 1PCXA 5JLZB 1WHOA 1PZUB 3MV9D 2MPAL 1E2ZA 5JO5B 3S8GB 4KKPA 1IM3B 5D5MA 4DOHE 3OB0H 3BRDA 4AG4L 5KVDH 4QOKD 3GSNL 4N0CC 4JB9H 5KSVA 4M62H 2D7NA 1T5WA 4UINL 1JSYA 4ZX6A 5L8KB 3CDGA 1JNJA 4A6YL 1VFAB 2B15A 3CVCA 2Y3AA 1U92A 1NGXB 5TDPB 3T2OA 2PO6B 4HS8H 1FV1A 2DD8H 2CK0L 2GFBB 3HAEA 4W6YB 5EBMA 1OQXA 2X4PA 3DSFH 3OX8B 1FYTB 3TF7C 3T8VA 4JKPH 4QGTA 2MQGA 3T3PF 5BVJA 3VI3B 4PJ5E 5FECB 4WI9A 3TPKA 2ZOTA 2H26A 1JGIA 4JN1H 2XKNB 1SXAA 5TQ0L 5HDBE 2BNUA 5E2WL 5FO8B 4XI5C 5KSBF 4HOWA 3O0RL 2MFNA 2XYCA 2JELL 3CSYB 1IFHL 5AL8A 5IT2L 3ARGC 1RZJL 2UYLA 3LKRA 4IOIB 4BEIA 4TTGA 1TXKA 5C7ZA 4YFEA 1ACYH 2AQNA 2HJKB 4GB9A 1IFGA 2XSKA 4XNYL 4B0MB 4PJ8A 3Q2WA 4LEXL 3IDGA 3ZW3A 4QAMB 3DOSB 5T3XH 2V8MA 1LEKB 3KPRA 4MMZA 4L3EA 3ZHNA 2J8HA 1RUAH 3FUFA 3H56A 1BFOA 1CFBA 1EUTA 1MEXH 2IGFH 3QEQD 3NOIA 1OM3H 4M7LH 3RJOA 3ZXAC 2H1LM 5ESVB 4G7VL 2NY0D 3G5XB 4F8PA 1U8OB 2EKSB 5ITBL 4Q6IC 1UQSA 4LESA 4BUGA 3KYKH 4Y5VC 4KK9C 5JW4R 5C0IA 4OQTL 8FABB 5MP6H 1HL5A 2E6QA 3WEBA 4JK0D 5DD1L 1LMKA 2E9WA 3IS1X 2AS5M 4TQEL 3KYMA 5HP5A 3QZBA 3KW8A 3P3UA 4OGXH 1M53A 4MS8C 3F65A 1I9IL 4RDQF 3GSNB 4S1DD 5JMOC 2F53E 2GEEA 4F9PA 4GNKB 3IJEB 4RETB 3AGVA 4ZDHA 2CIIB 1JTPA 1JGUH 4OLUL 5DRNB 3M6DA 5TDNB 4BFRA 4ODUA 5D1QC 2K4WA 3QG6B 4Y2NA 4MD4B 3T0ED 2YWYA 3KPOB 4Q4EA 4OTXH 4M8QA 1W2KT 4KQ4H 4AE0A 1OWWA 1ZHLA 3PGDA 3PWNB 4F33A 4IK6A 1BZ9B 1T1XB 5FYJH 4R4FL 3DJZA 4PJXF 5I6MA 2VDRH 3VO0A 2NDFA 1NCHA 3HZKB 1CFQA 4G80A 3R06A 4PD4K 1WZAA 4YHML 5EU3B 3QUYA 5F3FA 4KV5F 1BM7A 4QOKB 3V7MA 2O5YL 2YOCA 2N0KA 5D1XB 5IF0B 1D5IH 2WBJB 3BVVA 1AS6A 4X99A 1DJYA 1TZHB 5EA0H 3RUGB 1NAML 1D5XB 3CZUB 4MXWH 4ZOEA 1I1CA 4Z77A 2EDRA 3VE0B 2JLLA 1LP9A 3CZFB 4ODBD 1ZE3C 4AYDC 3E6HA 3ESMA 2NZIA 4Y1TA 3W2DH 3QK0A 4UM8B 5C09D 5FF6A 3HKZA 4PJBF 4DW2L 5LQBL 1S5IL 4MD0A 4LLQA 3MBEC 4LKCB 3PJSA 4PS8A 1WBYB 3NTCL 4NN5C 1C5BL 4HIHA 4ZRGA 3VRLF 4LOEA 1TTFA 5AVXB 1DQMH 3BLPX 2X1PA 3QXDA 4Z3EA 2XPGB 1HNYA 2DWXA 4HLZH 2HPOA 5T1KA 2O6PA 4HIXL 2HFFB 1QLEL 2OJZL 1A6VH 5GRJL 1VEOA 3N55A 4UT6L 1S7UB 3R8QA 2WMPA 5E6ID 4F1ZA 3FPYA 5ICZB 2GJZB 3L17A 4ZW3A 3FCSB 2WLIB 5GZNA 3RBSA 1EAJA 1WV7T 2A7BA 1E5BA 2UUDK 2W59A 5MEPB 4OBRA 3DURB 2BOLA 4FG6C 5FLVA 3DX7A 3WKML 4QAWA 1A7RH 4E9TA 5SWZE 4NUJB 6TAAA 3ZKXB 1H3PH 4FXKC 4NWTH 3WEXA 3UTZA 1QG3A 4JFWA 2FT8A 3HOGA 3R4DA 5EU6E 1WVZA 2OFQA 3CCHB 3PAVA 2BHUA 3K46A 1M3IA 4KTEH 2EE6A 4HZLB 3ASNB 1RK7A 2YGPA 3MA9H 4PRDA 1AH1A 3Q1SH 4PVNA 1OAUL 4N0CD 3EYQD 3D2UA 5GQBA 3KYNA 3NIFE 3L3GB 1NSNL 2YARA 5FYLD 3Q6GH 3S5LG 3WKYA 2NY4D 2Z7UA 2DYRB 4JM4L 4Z7OF 4KAQL 4OLYL 1SN5A 2MIZA 3ZX1A 4HJIA 1IEBA 2I9LA 4UUJB 2XWTA 3F58L 2CR6A 3KPMB 4EI0A 5HPMA 4G3YL 1LYQA 1PKOA 3CVBA 4OZHB 5C3IA 4G5ZH 2IH9A 3RX8A 1E8WA 5C0DB 5C3TA 1IM9D 4BWUA 4ZK8A 3VFRB 4PG9B 1AQMA 1UYWL 3ATDA 4OLXH 5LN8A 5EOQH 5TJWK 3KLHD 3WKQA 1FIEA 2BZ7A 1FCCA 3KBFA 3GI9L 4LLYB 1F3DJ 4MMXA 1AZRA 4FYSA 4FG4A 2YC1B 4PV1C 4B9KC 5HJ3B 5C70A 5IFAH 1KTLA 3INUH 4NZRL 2WWOA 1F4HA 5E2VL 2Q8BH 1HTYA 1YNTB 1GGTA 2ZUVA 4L3EE 1LO2H 3S5LA 4QRPA 4JFDA 2A83B 3BFWA 1J87A 2FO4A 1DFBL 3RBGA 1AZCA 2DMBA 2VIRA 1F5WA 3OR6A 5B1CA 4K55A 1XTMA 3ZL4H 4QYAA 1OGAD 1R34A 5EWIL 3RHWK 3AADB 3RTQA 5E9AA 3KPSA 4JRXD 1CR9H 4OLWL 2WLYA 4XP6L 5DD5L 3VGEA 3WE6A 3VXUD 4G83A 3FN0L 3M1OA 3KZ8A 1ZGLA 1DQDH 2IG2L 3HG1D 4KJPC 5TK4A 3IGAB 5IIEB 1CBVH 4X42A 4X50A 1JPSL 1RJLB 5FIEA 5C09E 2CJTA 4L3CA 1GRWA 2F19L 3RHWF 1W0WB 2LAGB 2W5PA 3B37A 5I1DA 1JYNA 1IBBA 3ROLA 4AQEB 1WFTA 4UQAA 1PZCA 3MOBL 3MBXH 5L4IA 4RZCA 1ZLSH 5JNYB 4LNRA 3PGCB 4BFIA 1Z5YD 1F0LA 3WV0A 3F05A 3MODH 5J0BA 1HYSD 2LFEA 1ET8A 3DJTA 4JHZA 3ZTEA 4S0TD 3DHPA 2XKNA 3TPUA 1S78D 1MCWW 2C1PB 4QO1B 1U0QA 1INDL 4C4UA 3QPXL 4XOEA 3FOMA 2BVPA 5BV7L 3CSYA 4KXAA 3X1EA 3IPBA 1KXQA 4XE5B 1T22B 4LAQL 3ERXA 1F6LL 1NM4A 1MFDH 1ZK9A 3BZEA 2CBTA 1OD7A 1HSBA 2EP6A 4BZ1A 1P5UB 5ISZA 2O5XH 5K33A 3F7PC 2ZOLA 1A4JB 4I89A 5C9JB 3DOSA 1XV8A 2Y7OA 3CN2A 4GQQA 4N2MA 3V5DB 5SWSE 1BFOB 1F58L 1CFVH 2VM4A 3MQIA 2ED9A 5ESVA 3MJ9H 3ARRA 3GIZH 3NFNA 4FFYA 4YC2B 3H3KA 3MBWA 4L48A 1ZVSB 2YPVA 1H6EA 1U8OA 4XVUD 2OP4H 4Y16C 3UOAB 5KSBE 3EDEA 1XWVA 1HE8A 3RPIB 2UV3A 5DF0A 3FB7B 3PV7A 4JFZH 3W82A 1MCJA 1J1XL 1NBQA 1OLZA 4PJDB 3N5AA 3O2WH 4JFYA 5HJBA 1H3WM 3MNVB 1WFIA 5IBTL 2LAAA 1FN4A 4OI8A 1G0DA 2RD0A 3MUJA 4WY7H 1CMOA 3BGMB 4POZC 4NBXB 2W60A 2YBGA 3MROB 3IJEA 2XXCB 1ROCA 2AQ3A 2J73A 5ESAB 1VF5C 3AT0A 3O8XA 4WHYH 2BIQA 5IEKA 3LB6C 2X4QA 3BLBA 2E75C 4PBVC 4QTIL 3KYAA 4ZMTA 1TVHB 2G3XA 3OKMA 5D1ZC 2PYFA 4LPTA 4G43A 3GRWH 4CMMA 2YUZA 3SQOL 2DWDA 3GZQA 1ZS8A 1YEKH 4L8SB 4LSSH 5AKTA 1A6ZB 3KM1A 5FLUA 4UQBA 3TJEH 3NFSL 3VXTB 4J2XA 2F5AL 1J86A 2ADIB 3O9WD 5EU3A 1E9PA 4A7SA 4L4VE 4MVBD 3UDWC 5EUOE 1U8NA 5ANMB 5JXAL 2BS8A 4JGMA 5JYLA 2IADB 3FB5B 3S3DB 3US1A 2N1TE 1XGYH 3QPQD 3LRSA 4AC2A 1TZIB 2PXYA 3RWCB 1N4XL 4JS7A 1DP0A 3BP7A 2CDFB 5IJVA 4YO0A 1GXEA 4B6ZA 1IC1A 4BWTA 5FYJL 4JBSA 4HKJB 2BNQA 5L88H 5I1KL 3P40A 3MRMA 5KYUB 1ZIBA 2LOEA 3VXRD 2FWOA 5C08E 5JHMA 2DQHH 2AKRA 1AP2B 1SQMA 3AROA 3NAAL 4K8RD 2DDQH 5AYUL 5IOPA 4GYBA 3QUZD 4JLRB 1T20B 3OKDB 3IU4L 2GABA 1F8TL 4FD0A 4GKNB 1TKWB 3EFDL 4JW3A 2YFNA 2E9GA 3DV6B 1IZJA 1MEXL 2Y24A 3DHJA 3DBXA 4O2FB 1ZTMA 4QRUA 1MI5D 3X13B 2DH2A 3ILPB 3CHOA 1JXKA 5D1QB 4GRWH 4A67A 5ITBH 2D7QA 4ODWA 2VLKE 4NLHA 3RIKA 2YZ8A 1WS8A 3NFPA 3ZDYB 3TWYA 3BSZA 2OJEA 4YDVA 2ZKXA 5DUPL 5DD6B 3ZRCC 3MOQA 1B2WL 2HYMA 4HEPG 4LSPL 4YHYB 3BPCB 1Z32X 1G9NL 2H0FA 1YQ2A 5DJAA 4DN4H 4UQ2B 5TD4A 1CD8A 3F8UB 2PW2B 5T1LD 3GJFK 2ARJB 3ZDXE 5I30L 1UUSA 4FXKB 4DJMA 1ED3B 3AS0A 4HZLA 5AKSA 4X6FB 3TBSA 4D9RE 1OXYA 3DO3A 3WFBH 3O45B 3NCBB 3VH8A 3KYNB 3VNZA 3KMDA 1I31A 1ACZA 5JPMA 1QVOA 2VAJA 3FU6A 1VB9A 3D3VE 2AJ3B 3SE3C 4BM7A 2NCMA 3G9VA 1IEBB 3FTYA 4I4WB 3JSSA 5E51A 2DM2A 2E9BA 4FKEA 2LHAA 2XNAB 4A37A 4JRYA 3RPBA 4I2XA 3IJYB 3U7WL 2QSQA 4G7YH 4GT0A 4HS8L 2BRRL 4HC1L 4NPKA 4OJYA 4JL1A 3ZTDC 1N2RB 3O3AB 3LZFH 2CR3A 4AVIA 1CL7L 5IMLA 1O5DT 1T04A 2VZUA 1BMZA 1NCAL 4CBZA 2BJML 3QORA 3QI9C 1T4WA 4PMEA 4UV4H 3QCUH 5DU7A 5JMRA 3MX0A 4JQIA 1YEFL 4NOBA 1RK1A 5BRZE 5LKNA 2ZICA 1UB5B 2QQKH 4GBXD 4UTAA 3TESA 4N2IA 3HRPA 5SWSA 3QUKB 3EJUA 3S5LB 1ZVNA 3MRJB 1IC7H 1IC5H 1BIIA 3CN4A 1NDMA 4G8EA 5I5RA 4MCYA 4IOFC 3TBTA 3NIGF 4NN7C 1JTTA 2AJZB 3K81A 2R0ZL 4HWEH 1BCIA 3I3EA 4YBLB 5A6LA 2Z35A 1DEDA 1JHLH 2HVKB 1G1CA 1BW8A 1KJVB 4XNMA 3U0WL 3HR5B 3QG7L 2IOOA 2EZ0C 5E8DL 3P4NB 1T1YB 3DTXA 5KW9L 2QADD 4M1GH 4M7KL 2RCSH 2WGNB 4PWEA 1AMYA 1AHWB 2OXGA 4XP9L 4GRLB 4GSUA 4QNPE 5CUSL 1IGCH 2GCYA 1NMAH 5DZ9A 5A2LH 4JY5L 4C56E 3U7AA 5F6HJ 1THCA 3MPCA 2VLLA 5DHVB 4OFIA 2E7BA 1BLNB 2H1XA 1LO5B 1DBJH 5EC1B 3UAJC 5MHSE 3GSVA 3F62A 5F0JB 2WAHA 2R2EA 3PNWB 4XI5D 2PWDA 2F61A 3QEGL 4NHUA 4WO0A 2GITA 3MMEA 2AXGA 4K23L 4PN6A 5BZDB 1D6EB 4PS3A 2G4EA 3NCMA 5TE7L 5DURD 1SYVB 3KWWA 4AH2B 5K9OA 3ZHLA 5AVSB 4N9GA 3N06B 1YMME 4PRNA 2QGBA 1WBZB 1PNDA 4CRPA 4YQXL 2WCPA 2VJ8A 1F11A 4LU5H 4X9HA 1IRAY 5F7DA 1G1KA 2NNRA 1AMXA 3F7YA 5DMGD 3UPRB 2I24N 2VXVL 4KROC 3CVIL 4XHJD 4UB0H 3UAJD 1SUJA 3T0BA 4A2EA 35C8H 1XH2A 12E8H 1QNIA 3LNGA 3HG1B 1A0QH 5LBVA 1NCBL 2DLFL 1OT2A 2K6ZA 2FH8A 4R5XA 2J4WL 1MXDA 2ZWKA 4XP5H 3NSYA 5EOCJ 4AKOA 4BD4A 2YGVA 3JWNE 4LVNC 3DGCR 4P4KD 1FN4B 2MQ3A 4WEBL 5F9OH 5IP4A 3SGDH 4D9QE 2R4RL 1SJMA 3BGMA 4HXBL 1X4ZA 3CLEL 3VG0L 4YE4H 3M07A 5MI0C 5AVRB 1LP9F 1X6LA 4L2YA 3DARA 5I82A 1T4KB 3WS6C 3DJRA 2XX1A 2EUVA 4DCQB 3O8XB 4XPFH 2CRZA 3Q48A 1ZY9A 5BS0A 1MCEA 4OCSH 2EUWA 1CLZL 3FW6A 1P7KA 2GYSA 3S3SA 1EMTH 2PYFB 4LIQE 2JKLA 4Q9QH 4JPVH 1J0KA 2AXFB 5D1ZB 1IILE 4Y4HC 3QQDA 4ABVA 2YXMA 3F85A 5C07A 1FVEB 4K15A 4M5ZH 3UYPB 3V6ZB 3VXTA 4D3CH 1NGYA 1OB1A 3KLSA 1PAZA 4HDIA 5H4YA 3B9KC 3WTVA 2EVFA 1BJ1H 4JVUA 3QWQB 3MRBA 4X6DE 4ORZC 2ZXGA 4IOSA 3MNZA 2NT1A 1RZIA 2YXWA 1TJXA 2X9WA 5D7LB 4PY8J 4ONGH 1GZPB 2WSDA 3G7TA 3H9SE 3MV8D 3QXAA 2ZSWA 3LEYH 4HWNA 1M9WA 1ZWIB 4G6KL 4JJHA 4PGCA 4BDVA 3EYVA 4Z8FL 5I18L 4HCGA 4JFXB 3TS8A 4PJFA 4PU2A 4PYGA 4LEOB 1OO2A 2DICA 4O02H 5E1QA 2X1XR 4FLRA 3A0OA 3OZLA 1OCRB 2O5ZH 1XZ0A 2CKNA 3U0TB 1CXEA 5TDOA 3IAPA 1XO8A 4YBQD 5GGQH 2Y4SA 4AK2A 1Q9KB 2B1HL 2HVJB 2WANA 4KXBA 1T0PB 3MV7E 4X8JA 5IVZA 2Y2TA 4N8CL 1E7UA 3KGRA 2VISB 4NQDD 3ZY7A 4ZUSB 3QDME 3B83A 5IQOA 1OCOB 3FOLA 3RFZA 2BVOA 5DK2B 3QWRD 1MELA 4OIAA 4P2QA 2WB1A 2WKOA 3DUUB 3D4YA 4FFVD 4ORGA 4N2FA 3OHXA 4QRRE 3SDXA 2HG5B 3AS1A 4OD2A 4MJHA 5E8PB 4P9HH 4HIXH 2VCOA 1WSST 1CK0H 3MJ7B 2CM5A 1LWHA 3E80A 4EI6B 4JFFD 4MBRA 5DFTA 1K4CB 2GC4C 4MNQD 5F1IA 2NT0A 5IQNA 2H3NA 4AENA 4TUJA 2VW6A 4RMTA 1I9JH 2WOYA 5HYIA 3PFUA 4YNYA 4POZD 3IGKA 3SBQA 3ZQWA 4NDMB 1FL6B 1S5IH 1S7TB 3GC3A 3F12A 2CUHA 3E8UL 2BSSA 3TNNB 3SJVE 4PBXA 2JJSA 1R0AL 1MHPL 3FFDB 4RAUA 2ADFL 3IJ8A 4NN6B 3NA9L 4KPHH 3IVKB 1MHHA 5EU5B 1NZRA 5DHVH 3TFBA 4AZ8A 1CLVA 1EHLH 1OPGH 3JTSB 2UZXB 5TPWH 3BZFB 5HDQL 1U3ZA 3F6IA 3X12B 2JB6A 5ALBH 1S46A 2ROXA 5GGTL 2MRYA 4MD5A 4CC4A 2V7NB 3ZHFA 4XO4A 3P73B 4PREB 3O41A 1AR1B 1KWGA 3A6BH 4FYTA 5FGBC 2DWTA 1YCSA 3VG9C 3TFKC 5BOZG 1I8LA 1NM9A 4LCWD 1ZLSL 3SHSA 5J57B 5J3HC 4WFFE 1BVNP 4PG2A 1X9LA 5BO1L 1XH3B 3KVDD 5BQ7B 1BAFH 3JWOH 1ZD6A 5IMLB 4CVWA 5HHOB 3I9GL 2B0SH 2Y07H 3SGKC 2ICEC 2FT7A 2KBGA 3SO5A 5AOKA 3ARDC 1E5CA 1SLWA 3DX0A 3I75A 2FEDC 2JNZA 1BX2A 4AITA 5E00B 3N44F 4H8HA 5HVFB 4DEUA 3APDA 5IHLB 3O6KL 1ACCA 2QV2A 2VXSL 1AIFA 4MJJA 5EIIA 3VG0H 2D0FA 3QIWC 3MRJA 4U1KA 1BD2B 1I9EA 1K2DA 2QL1A 3LB6D 4L4VB 4QRTB 3TBTB 1QQDB 4WWKA 1G5GA 2ICWI 3OXSB 4HV8B 4UI2A 5HYEA 2IWEA 2RMNA 3MHZA 4K9EH 1S8DB 1E65A 1GIGL 3RY6C 4NP9A 2HVKA 3FT1A 4K3JH 5EPMB 3II1A 3H42L 4BA0A 3PXJA 2BSDA 2K7QA 4IRZA 2F74A 2ICWB 2VN5A 3CBRA 3ZTNH 4L5FL 5I8CB 1EPFA 2IANA 4NQDB 5FUCC 1R3KA 4GXVH 1MFCL 3MLSL 3QWNA 5KEZA 3RZCA 1DJSA 4K7PY 4HOMA 15C8H 1IAIL 1TYEB 1Y18B 1L0QA 2WQRA 5DR5L 3X1BA 3Q7JA 1ULVA 3QDJD 1ROWA 2VLLB 3MRHB 3ZE0B 1RV6X 4IMKA 4N2GA 3MRLB 4QRAA 1PVHA 3BH8B 3OKOA 5IHHA 5F89B 4HBCL 4XBPB 1MCDA 3EJYD 3H85A 3VD2A 4KDVA 1XGPB 2A1WH 3EH1A 2JELH 1CICB 2JH2A 4XH2B 1MJJA 3L2NA 2NW3B 1X5JA 1UCBH 3CVHL 3UBGA 5CD5D 3MREA 5I24A 2FSEA 3CPUA 3ZQ9A 1A02N 2X6BA 5C07E 1BJ1J 2WZAA 4ONHB 1FSKB 4NNPH 5HI3C 4E41E 1TITA 2NUTB 2VLJE 2B14A 3M7FB 1YJDH 3ARFB 3HRZC 3ARBA 3D07A 5CBEA 4IMLA 1MJ8L 4RSVA 2P26A 1JPGA 3CK0H 5AZ2H 1FYHB 3UEQA 4N2LA 1KGCE 1XXFC 3UTPD 4UB0L 5DSCB 1KBGH 1QFOA 5A2BA 2WINB 2X4RB 1WISA 4YDMA 5HVGB 4MLSA 2XN9E 4X4XB 2GTWA 2PTTA 3KL0A 1MDAA 4GKZA 4PWFA 1ID2A 3SGEI 4Y19B 1QX1A 4PJ8C 3EFFB 3ULUL 1V27A 2ZAIA 3P0VH 2GKIA 4FFTA 4I0PD 4XE0A 3ASWA 3MLRH 2XWEA 3VA6A 1QZ1A 5CLXA 3HE7A 2L7EA 4XO5A 1EXHA 1INQA 3HNTH 4HWUA 4UIKH 2FO1A 1MJUH 1NC4D 1P1ZA 4OVUA 2HJFB 3LN4A 4WSGA 3IKCB 1IC7L 1QLFA 2YMOA 1JHKL 1GC1H 1L7IL 1R47A 5C0RH 3IMRA 5DJDB 2FYYA 1R3HB 3P0VL 1P4IL 3O6FB 4HGKC 1AZVA 1T4KA 2ZUXA 4N6RA 2E5EA 2R1YA 2XWBB 4Z7OE 4NAMA 1EAOA 2JCCF 1MXGA 3ETSA 4JO3H 4EDXA 5BV7H 5HY9A 1NIFA 3HC2A 3MKKA 2HSIA 4Y9GA 4MDIB 4M6ML 2F54B 3AMLA 1JHTB 3SPIA 1FNEA 5PCYA 5CFHA 1A7OH 3V6ZA 4NNXB 4Y9CA 5JHAA 2Q76B 2BP0B 1TIUA 3OTTA 1BVKB 3VXRA 4Z95H 3IAGC 4PI0A 4PV8A 3N1FC 3MRIB 1JZ2A 1K9TA 2E0PA 5DYOA 1ZA3B 3EJQA 1NOLA 2YOAA 3SODB 3IRCA 4XAWH 3V0IA 5JLZA 1ZWIA 4KVCL 3ULVD 4I3SH 1SN0A 5FCUH 2OQJA 5D5MB 4Y4HA 2Z6FA 3S9DB 2IH8A 1YMHB 4QHNB 4KFZC 5TFSL 3UYRL 4F9LA 1OF2B 1BZQK 3G5WA 3QJQB 4Y2LA 3BD3A 2HVJA 5TDPA 1JGUL 1DANU 1ETA1 1CL7H 1FYTA 1YN7A 2BC4B 2VLJB 2XXFA 2GSIB 4IK7A 6FABL 1T66C 5BVJB 2HKFH 2Y69B 4MJID 5FX3A 4HUWB 1NCIA 5FYKH 5I8EA 4DGYL 1J11A 1GIGH 4MWFB 3TV3H 2V17H 4GKSB 5FKPB 1W0YT 1BQHB 4OD2B 4F8OA 4V11A 4X4YB 3LYRA 1A2YA 5F97E 3DMMC 3GXPA 3P9MB 4U1GC 1JK9A 1G6RH 5J6HA 2DQMA 1AO7A 1LD9B 2EDOA 4OD3L 4OD1H 4TQPA 5FKAA 3SGJA 3T8MA 5BXFB 4TXVB 5AWNL 1BAWA 3ESVF 4ZYKB 2ATPB 4BRJA 4OCWL 5GGRY 1QEWA 1B9ZA 5I1EH 1T0NB 3IMVA 3TO4B 1KCUL 4NQVB 5EU4A 1TPXB 1W15A 4PCYA 4XP1L 3T5WA 3C5XA 5H2BA 1D6VL 4GW5B 1S7WB 5HYQA 2VDQB 1LDPL 4ZMNA 3DVGB 1JWMA 1VFAA 4O51B 4N2HA 3PE9A 4NN6C 2R27A 5C0GB 3ATBA 2X4PB 5C7XL 4P9ML 2GTQA 4LT7A 1OOWA 2VDQL 5KJRL 2A9DA 2BSRA 4I77L 4O2CA 4E68A 2W81C 1RZFL 4CSSA 2J6EA 4NO0A 4Z76A 3MRNA 5EB9A 1CFMA 4R0LC 3HNVL 2R0LL 5KYNA 1AR1C 2AK4E 1HXMA 3ABZA 1JXDA 3BDYH 3VG9B 5J11C 1FNSL 4P59L 4B9PA 4ADGA 4R2GD 3SE9H 2YD7A 5HHOE 1M6OB 4JO8A 1M57B 4LHUD 1CTOA 3TF4A 3PGFL 2Y1ZA 3VW3H 4FQHA 2CLRB 2WBXA 3DGGB 1BZ9A 2H4EA 3GQFA 2WTPA 3K8KA 3Q9PA 4MFHA 2YAHA 1KGYE 2PYED 5HYFA 3W0WB 1WFUA 4M3HA 2VW4A 2H9GB 5E00A 4WO4C 4ZSOA 1MQKH 3CFNA 3EF7A 5AFAA 2AJYL 3GK8H 5L88L 3S5ZA 1K8IA 4EDWL 1H8SA 3BRGC 1AAJA 3MYJA 1CDHA 1W6WA 3L1OH 1HJCA 5D1XE 4KOCA 4U6XA 4AEFA 4DIXA 4U1KB 4YLQT 1N0XH 2XN9A 3AREA 1D5MA 2EINB 4X8CA 2A6IB 4XPAH 1QQDA 2NY1B 4HGWA 2YN5A 1YYCA 3MV7B 4JQVA 2VZVA 3EYSL 2CWRA 4BCXA 2BFVH 2VSCA 3VQLA 1UM4H 2OTUA 2FB4H 4DGWC 3C5JA 5HDBB 3ULVH 2WLHA 5I8CA 1WCBA 3U9PH 2CO2A 1N0XL 2GG1A 4WFHD 5DQJA 4U6TA 3WFCL 3RZCB 4HJGB 5I0ZA 2IPTL 4HUMB 1KYOJ 4O58H 5CWSB 5SV4A 1Q0EA 1MQKL 2RQ8A 1XF5B 2C4FU 3FNKA 3IJHB 4L1HA 3C9NB 3WIHH 1NPNA 3REVB 3WFEL 2F53B 3DPDA 2N7SA 2A9NL 3MRHA 4Z3TA 4J2QA 2Q86B 3BPNC 1KZYA 1X5FA 2AXJA 2BVUA 2JIXB 3JV5A 1TJGL 1YLBB 4K94L 1RPKA 5EUKB 3W39B 4HVBA 4YHPB 3GMNA 2SODB 3G6JA 3LXBA 3R06B 3MREB 1CICD 3HZ3A 1XGQA 3AU1A 4PRHD 1CB4A 3SDXE 3VVWA 1HZLA 3OBAA 4ONGL 5F7NC 3MCYA 4YHIB 3QUYB 3PDGA 3FAXA 4Y19D 2G60L 3ZVVA 2J8UA 2GJZA 4DP2X 3QRFM 1DZBA 1N10A 3HFMH 4ZXBD 4CVZA 2VXQL 2NR6D 4OFVA 4PJHF 3KWTA 3EYFB 3QAQA 5DZPA 1V3JA 2FJHB 5C7XH 1TZHA 3JWDL 2JCCB 2VQUA 5T1KD 5HGHB 4B9YA 2Y06H 1S7VB 5IVXE 4NM8H 3NP4A 4NCC2 3CXDL 5HD8D 2QT6A 3D48R 3IFOB 2YMXH 3BE1H 3RVVC 5DD0L 1E9OB 3TJHC 4QLWA 1OTSD 5MENB 5GZND 3ZKQD 1MW0A 3QBTB 2AGJH 4IRSB 4FS0A 3TVMC 2H3KA 4HIHB 2FJFB 2WXMA 1JNHA 1QSEE 1ADWA 1PGRB 4OLVH 3D69B 4MBOA 3VXOA 2VSMB 4Y1AD 1NCJA 3FUKA 4DP1X 5DRWB 3UFIA 1G43A 3JV4A 4NZTL 5DEGA 1S7SA 3GINA 3OXRB 3B8YA 5IJKC 1DVFD 2NY6D 2X4UB 5JHLL 1S7UA 4DGYH 5IVXB 3V0HA 2HN7A 2DV6A 3SDDC 2ZXEB 4JREB 4A39A 5ICZA 2F7OA 2Z0BA 3G3LA 3CJJA 5HHOD 4TQHA 1GMIA 3MRFB 1Q9OB 2Q8AL 5KS9F 4H26A 4EVNA 2RAMA 1KMGA 1OD9A 1SEBB 1E4JA 2AJUH 2YQGA 4G6JL 2VLME 1UVQA 5GGSY 1MFEL 1JYVA 5E4IA 2LABA 5IHZB 1DCEA 5J12C 1WAAE 1AKPA 3F2LA 1C5CH 1F97A 4NNXA 4P23A 4XC1H 5DD5H 4LVOC 4KX8A 3V0VB 3ZN6A 1TMQA 3BW9B 5JDSA 4FAAB 3CFMA 3EO9H 2VDKL 3ARDD 4JPIB 1NC2D 3B43A 1V05A 2VZOA 3OWEA 1ACXA 4XNAA 2BSEA 1A3RH 3V0EA 2EACA 3NJHA 2IPKA 3GSNH 5BVPH 2EDXA 4BQBA 1KY7A 4WF7A 2J1ZA 3W11D 3UTTD 5GS3A 4LPXA 1DBJL 2IDCA 1BSIA 5KVGE 3THMH 1RIVH 3PP4H 5KBPA 5GGTA 4P46D 4R4BA 2Z91B 3C8KA 3AFLA 1LO3L 1O9ZA 4JFFA 2FEEL 1ZSHA 1EEYB 1OGAA 4XPBL 1SHMA 2GJ6A 3FT4B 3R7RA 2NW2A 4E9YA 1GZQA 3WNJA 4TL5A 2OA9A 4GAFB 1BMWA 4KRPC 1EGJL 1X5YA 1F90H 4FMFA 1SUHA 2WYZA 2FO8A 2Y6TE 5HI4C 2J1YA 4CADB 1L0PA 1RULL 2VDLB 2JCCE 4AZUA 4LCUB 3T09A 2P24A 3GS7A 4PW3A 4XC3L 1JHLL 1KDJA 4I3SL 2W9DH 4JFDB 3VU1A 4FJ6A 1QATA 3QPQC 3Q9QA 4I5BA 5EBWA 3FOMB 4RA3A 4OCXL 5C0NC 2ADYA 5B39G 4J8RA 1F58H 1NUNB 1JNNH 3CFCH 4RMRA 3K3QA 3BKCH 3L3HB 1CGTA 2Y1VA 4GRMA 1XB6A 2QADB 1AQDA 5B38B 4RA0C 4BGDA 2J6WA 1CL7I 3TM6A 5FECA 4XMLH 1DEEA 2AJSH 2M8XA 3BWAA 2PUQT 2AABL 2NLJB 4O5LH 3GS0A 5L9DL 3DC0A 4Y1AB 4JR9L 4U3XA 1AJ7H 3S4SA 3QXWA 1ECZA 5I1DB 4XP9H 4NHCL 4IOIA 3ARGD 3W5MA 5KYWA 2AJSL 3BUBA 3SCMD 4DP8X 1DO6A 4X7DC 5C0ND 4F8NA 3II2A 3BVWA 3UZEC 1N64H 4FQXB 5KAQG 5DJ0B 4MMXC 1QLEB 3EO9L 1P5VB 3QDGA 3ZDXB 1M7IB 3QQ9D 2N7AA 3RB5A 2QZ5A 3TPUB 2WO4A 4IGBA 1HOEA 4XMTA 1GSKA 1M05A 1C8QA 1OAQL 3KXFB 5E1AB 4F27A 4R0LB 3MCLH 2WTRA 3G5XA 2GEQA 1E5UI 3CFJA 4HXAL 5DC9B 1JG9A 3AWEA 3SKOA 1XIWA 5HHPA 3L3IA 5K5YA 4AGQA 2FL5B 5E24E 2R69A 1MRDH 2HRGA 2DIJA 1VSCA 5AVTB 5CLWA 2KPWA 3L3DA 2QVMA 4M6NH 4LOVA 1KBGL 5CSGA 1XH0A 1IIKA 1PY4A 2RQEA 4TUOA 5HVHB 4U6XB 4MX7B 5E4EC 1N67A 4MNQA 4JX0A 3UZVB 2V5YA 2V5MA 5IJBC 4HIEB 1NINA 3UTTB 3CDFA 5AZ2L 1RVFL 4KI1A 3WJLC 1YHPA 1VFBA 3CDZA 5C6PB 1QSEA 4H8WC 5CR8A 4GY4A 4K4KA 5E95B 1GOFA 3CZKA 4KUZL 5A1AA 1QFWH 3QJFA 4BCYA 4ZBJA 1WCBB 2BNRA 4HT1H 1CFQB 2NY2C 1XL4A 4P5KB 5T5FA 1MDTA 4G2AA 5HYSG 1FFPB 2LTQB 4RWYH 4UM9B 1NBVL 1WG3A 4P5RA 1G7PB 1FZJA 4KNUA 3MLUH 1RUMH 1I1YB 2GT9B 4D2NA 5C0JA 1BAGA 3I9GH 3C9NA 1IAOB 4X5QA 4LSRL 3ALXA 3H0TA 3IXAB 4LMQE 4PJBA 1IGJA 1YRKA 2AMGA 2ZUYA 2PTUA 3WIIH 1DBKH 1SVBA 4RMVA 3NIDB 5KBLA 3INOA 1DJZA 3QZNA 2JIXA 4IMKC 1BAFL 1QSFD 2W9LA 3WSQL 3T71A 3Q6GL 1GHFH 2D9CA 5DGRA 2O61A 3KR3L 3X13A 3QXTA 5DWPA 2WBJD 2WQ8A 1XGQB 4OGXL 4XPTH 4GI8A 3SCMA 5CF3A 2YD1A 2F54E 5D2LB 4JMXA 4PGEB 3ESPA 3G04A 4LLQB 4O2EB 4F80A 2O72A 1MNNA 4Y5YA 4ODWB 3VUAA 1I3VA 4HWZA 4PSPA 3CHXA 4WTZG 1BJ8A 5HDQH 1MLBB 5DD6A 4YR6A 2HUEA 2CO7A 5LN4A 5F9WC 3TNMB 4JFHE 1KB5H 3US9A 1XBRA 2PW2A 1EJOH 5SV3A 1OLLA 4AL8C 2A73A 4B96A 2HFFA 3N91A 4PTTB 4FXKA 4ODVL 2XDHA 2OYLA 3BDXA 3AITA 2JI1A 1HI6B 3L4UA 5H37G 4YVUA 3QC6X 5I1KH 1I7ZB 4M5YL 2J43A 4OV6F 4YL4A 2MEJB 2YD3A 5EDXA 4BJLA 2BDNH 2QJDA 3MV11 1EA9C 5J6GA 4JDZA 3U4KA 2P43B 4B9JA 1QA9A 5G5DA 4FLSA 3SGKA 1T03H 1RURH 3I2CH 1EFXB 3U4EA 5DS1A 4ICWA 1Q9WA 2PCPB 2AEPH 1E4WL 2XWDA 3P3TA 1GH7A 2XNAA 1XEDA 1UT1A 4OQ1A 5T3XE 1KYAA 4DAGL 4IRZH 4IJTA 5D7IF 1KB9K 3M46A 4UT7L 2WK2A 1MCHA 3O3AA 4ACPA 5GRWA 2K9FB 3RWIB 4CC4C 1G7MA 4NRZB 3P30H 2OJEB 5AW4B 5CKGA 4XVJH 1J0IA 4A6YH 5DGQA 4UU9A 4ZAKA 5EHFA 1B4TA 1JDAA 1KLUA 3BUDA 3RL2A 1R3JA 3IFNH 3PDOA 4MSWB 5J8OA 2KZWA 4LQFL 3LZRA 5KVDL 1CIUA 4AG4H 2ROYA 2B4CC 5BMFL 3ARBD 3FK3A 4BSVB 4Q6IA 4LLUA 3T0VA 4HIPA 4X6FA 1TQVA 4XNBA 3TBSB 4LAQH 5J1SC 3WD5H 3L3KB 2BIPA 2MH4A 3GUFA 3ATAA 2A6DA 1MIEH 1UM6H 2VLJD 2KZBA 2VQ1A 5CCGE 1TYRA 1Y0LA 4HQQL 2ZUWA 3VU2A 5ID1A 1PY9A 4OVVA 1AQKL 3HW7A 3QJOA 3TBVA 1M2OA 4AM0A 3MLZH 4HC1A 4BZ2L 1HEHC 3RDTA 4JFSA 3FT3A 4DVBA 4LB8A 1T5XB 4OLEA 1LDPH 2ZQKA 3NN8A 4IS6B 2AQRA 1FIGH 5KTEH 3TVMB 4RFEA 1MJUL 3V6FB 2F8VA 5CD3B 3KWVA 4C83A 4YS4A 1F3RB 1CDJA 2GJ6B 1T04B 2Q3XA 2NW2B 4G1EA 1A3QA 4LHJB 2B1HH 2WJ5A 4M5SA 3EW3B 5LGKA 4OCSL 2R4SH 4B5EA 1N8ZB 1TZ8A 1LJMA 2DJMA 3DMMA 4EMZA 2AK4A 2R2EB 2VC2B 3PNWA 4MDJA 3T3ME 3ZE1B 4HFWB 43C9B 1C16A 4I48A 4CADA 2X7LB 4HSAC 2AXGB 5DT1L 5BZDA 4LCUA 1YEIL 1DL7H 3D85B 4UQIM 3SE9L 3EDKA 2XBTA 3LKPB 2C8NA 5HGGS 2CR0A 3HFFA 1J8HD 5ILTH 1I75A 2VZ1A 4Q2ZB 4KKNA 3QHFH 3U9UA 3L3HA 3BDBA 4LNRB 4KU1A 3NDZE 1D5BB 4QT5B 2AZUA 4NEHB 2DLFH 3T0AA 4DPCX 1AQDB 2EDLA 4NXSA 1M3JA 1OGTB 2DQTL 3NSJA 4NZTH 1JRHL 2GB2A 3ZE2F 2WXRA 4W9DC 1Z9SA 1F4WH 3K6OA 4PJDF 4HFUH 3T0EE 3OGOE 4B9GA 3W5NA 4DVRH 3OLGA 3D05A 1C12A 1F86A 5D5MF 1Y1UA 1EHKB 5EEVA 5EF3A 3IMTA 5FEBA 1KJ2H 2OMVB 1MVFA 2NSQA 2G9KA 2XQBH 5LCVL 3PHAA 5EF2A 1KCUH 4WI7A 3E8VA 3FN0H 2EIKB 5DC4B 1HKLH 4LLMB 4M43H 2NTSP 1A7PL 2ED7A 4OM0L 4Y4HD 5JHDE 3SOBH 2VDPL 2PNDA 3MACL 4S1DC 1FNAA 1YMMD 3B2XA 4HJEA 5D7HA 3ZIYA 4FQXA 3ULVE 4QWWC 5A2FA 1DHKA 3EHBD 3TTSA 4XXWA 4K23H 4GUPA 4PHXA 3N1QC 4X4ZA 3TJHD 3WTYA 2CMRH 2ATKA 5TE7H 2OJ1A 4IGBB 3ZE0F 2W0FA 3CPLB 4PRNB 2WTRB 4GQ9L 1W8OA 5EOTB 1TZAA 4QJ5B 2YRLA 4MYWB 2P5EA 2P5WD 4NO5B 4Z7VB 2EH8L 5LCVA 3RPIA 1TJIH 1J8KA 1MI5A 2RFXA 3CU1A 2XIDA 4BH7B 1T7XA 2EIMB 4MA3B 4V1DA 2ICES 2Y5TB 4U1MB 1CDBA 4ZUUB 4Z0BH 2D3VA 2KQMA 3N3EA 3OWRA 1CLCA 4FI7A 1CS6A 4QTHA 3F7QA 2YAPA 4ZMZA 2X4TA 4ABUA 3WTWA 4ADIA 2ZCKL 3ZDZB 3MRBB 3PWPD 4PCTA 4HIEA 5TE4H 5E6IA 4F3FA 1G87A 1Q1JH 1F2XK 4F7PA 1LE5A 2C9PA 3NIFB 3U2JA 4AOFA 3REWB 4D9QD 4P2RA 4XVSL 2Z8RA 1FH2A 5IVOA 3QEHA 3WFCH 3RX5A 3KJ6L 3MLRL 2JV6A 3DXAA 1JDCA 1BM3H 3ASOB 3R19A 4C56A 5JIMA 2OK0H 2AAVA 1Q1JL 1XGYL 4KUCF 4HF5L 5D71L 1EJFA 2ZWYA 1CD9B 3BSHA 2IEPA 3ISWA 2DM3A 1FGVL 3E2HC 4NB7A 4UOW0 1J9RA 1N9PA 1EO8H 3T4YA 4DW2H 1P7KB 2VZTA 1K5WA 4XOCA 1H6UA 2AJYH 3GK8L 3L7EB 5LGHH 1E9QA 3QPKA 5FXCH 3RTLA 2ZSVB 3LPFA 1ZCRA 4CSTA 2UVEA 1UASA 3L7FB 4E9VA 3LKOA 2GBTA 2OULB 5HD8C 2PXYD 1QFWI 2LU5A 2X09A 3ET9F 4MNGB 5CCHE 4QTIH 4D0DA 3PWUB 3S98A 5GS1A 5D7LE 3MGOA 2GC7C 5KVFE 3OKYA 3G04B 3JT0A 4JE4B 3ECVA 2VR3A 1A6VL 1FORL 4R9HA 2WBJC 4DO4A 4XHQA 3C2SA 2ADGA 3U9PL 3ZDXF 2ZKHL 2IOMA 2VXQA 2IOIA 1SDAB 4AV4A 3B3BA 2X3AA 3FQ4A 2A73B 3DBXB 4O2FA 4QRUB 1HSAB 4P2YA 4BKLA 2BOCA 2YD0A 2LW3A 2BSSB 2E86A 5D1XD 2VQ4A 3SPGA 2QV4A 1FI8C 2CLVA 5CINL 4KK5D 1GHFL 4BKSC 4RAUB 1I7ZA 1MCPH 3N85H 4FQCL 4BKTC 3T8XB 1MHHB 3HZVB 3NFPB 1CU4H 3S48A 2ENSA 3A6OA 4NO3B 5E03A 4P07A 1S7XB 4X8JB 1QA9B 4EOWH 4CGUB 4PS4L 1ZA6B 5DCCA 8PAZA 4U6VL 3VI3A 4EDWH 4ZUSA 2D2CC 2JJTC 4OFYD 4UQ2A 2APVA 5AVQB 2DQIH 4I7ZC 2V7NA 3P73A 5C1MB 1Q9WB 2D3JA 2PCPA 3QHFL 4S11A 3WNIA 4FNUA 5KWYC 4OD3H 3MLYH 4FQLL 3OHXB 4JRXE 3WOVA 3NABH 3Q1EA 5E8PA 4XN8A 2ZAGA 5BQ7A 1UJ3A 4JJ5B 3MI6A 3L4VA 3VH8B 1IM9B 3GS4A 1OZTG 5F1IB 2YAMA 2N1KA 1RIHL 3S97C 2ZOKB 2AJ3A 5IB3B 4PJ8B 4G8GD 2R39A 3NAAH 3ZKXC 5F0LB 1F4YL 3IDIB 1LEKA 1WP6A 1DLFH 2Z93A 4L1TA 2Q1EA 4Y89A 1N5AB 3BISA 1KBWA 5F3BB 2WVTA 1IIIA 5KVFH 3VFGH 3DO4A 3F12B 3WFDL 4GG8B 1OY3B 3X3FH 1L3NA 2P80A 2CQVA 1OAZL 1HC1A 3MOBH 4KJQD 4YXHH 3IVKA 2X9XA 3C6LD 3PAZA 5FYJD 3EXJA 1MW3A 3RU8L 1EEZA 3MRKB 3RVUC 5FGRA 4KOBA 1G5AA 1F4YH 2ZKWA 1KYUA 2XBDA 3BZFA 5AAMC 1N70A 3MX0B 1JFQL 3OJDA 5TE6H 4WUUD 2EDKA 2C7UA 1I7UA 3MCLL 3SPCA 2GY7B 4XAWL 1QUNB 1NJ9A 2WWNA 3RVTC 3RIAK 4KY1H 4GT7A 2OTWB 3GRWL 5AW8B 4MCZB 2XTJD 4ZDHB 1MHEB 3FRPB 3GWJA 2NNAA 4G8EB 4LLVB 4YZFE 1RZKH 3W38A 5IROC 3N40F 3OM3B 1ZT4B 3QDMA 4M8QB 4WFEE 3KJ4C 3D2UD 5L7XL 3QDGE 3VNYA 4EKXA 4M56A 1J0JA 1J8SA 1U8MA 2A9MH 4GMSL 3EIFA 4JPSA 4DKAA 5ES4B 4WWNA 4LSVH 4RWHA 1WTGT 1C16B 3DIFA 5F6IB 1T0MB 3PHSA 2NYYD 3A6CH 1JPFB 4FFYL 2PO6D 1P5UC 4XZ4A 2IIJA 1ZHNB 1MRCL 3ARQA 4LMQI 5PAZA 4LOUC 2H8PA 5HHVH 1AOZA 3KM2A 5I1AA 1HWHB 4QHKJ 3FSVA 3CZLA 2DJUA 3TIEB 3GSWB 4R3SA 4BFBD 1JPGB 3O8XD 2EXWD 4CN6A 3BKMH 1TENA 1PJWA 1T03L 3NRPA 4XP4L 5EO9A 2Q0ZX 1MW2A 1JF5A 5CEZH 1I1AA 3BT2H 2VLMD 3GXNA 4EUPB 2DD8L 2YJQA 1AACA 2LGNA 1IMHC 4E9RA 2R69L 5AAWC 1J5IA 2K3HA 3DROB 4BQ9A 5B8CB 1OW0C 1DVXA 3KCWA 3FCTB 4NO0D 5I26A 2NYYC 2IFFL 3B2VL 3BGFC 3HC0A 1N64L 4PJXB 1AKJD 3ISYA 4ZMYA 3BAKA 3NRQA 2EDFA 5KYXA 1I9JL 1BG9A 2ZX5A 4PP1C 4XPBH 3LKQA 2VN4A 2VXUH 1KXTB 1XH1A 3HRZA 2QHLA 1K6QH 1RZFH 4MNGE 1ZRUA 5I1HL 3O2WL 1XGUA 3HG1A 5DRZB 5EORL 5TGBB 4BFGA 2VABA 4N6RB 2R1YB 2XWBA 5HDOA 2YLHA 4WSKA 5E2UH 4BGLA 4HS3B 3AWFA 2PABA 5G2NA 1KBKA 2P5EB 4PJIB 3H4HA 4Z7VA 3CQQA 4Y8AA 4OCRH 4M6OL 3RILA 1F41A 4BH7A 5IG7A 1JNNL 2VMFA 3CFCL 2F54A 5DEZA 1AXSA 4ZO6A 4XCCH 2BW4A 5GJSH 1IT9L 3AMKA 4QTHB 4ELDA 1EERB 4ODSH 3ATFA 3ZOAA 1LNUA 1N12A 3L5XL 5E2TL 1RUKL 3ILQC 1V5JA 4JHAL 4LPUA 5GZOC 3NTCH 1KPVA 2JI3A 1S3KL 3D39B 3QYCA 4WIQA 4DK6A 1KXHA 2V7HB 1MRCH 2GIYA 4FJZA 5JHDB 1CTMA 4OLZH 4O00A 3EH2A 4QGYA 1WICA 5EH1A 2F2HA 5B39A 5I17B 3HE7B 2HPTA 3RVVD 4W4OA 3TC9A 3HN3A 5LJYH 4FQXD 3QRGL 3S7GA 1DFBH 2HJFA 2X4SB 5BZZA 1UWEL 1FVEA 3P4OA 3T2LA 1AGEA 5DJDA 3GTTA 4PJGE 4RGND 3KGSA 4XZUB 5C6TL 5ID0A 5C0DA 1KN4H 2O5YH 3PRZA 2RR3A 4AYGA 3MNZB 4PG9A 4BE6A 3U1SL 2WUBH 4QHUA 4IBVA 1KPRB 3AXLB 3UJTL 1EAPB 1UKTA 5HY9B 1W0VA 4FLQA 3GBMH 3QJTB 3DO7B 2YC1A 3UG3A 1JPSH 5CAYB 1YNTA 3A23A 5DVMA 2IBGA 4OCYL 4B60A 3QUHA 2Q76A 3FRUB 5E0FA 3GZPA 1A2YB 2C9SA 4ZUVA 4PV8B 3ZE2E 2R1WB 1KEGH 4P23C 4M7JH 2HCZX 3EGSA 1YA5A 5DURB 4KAQH 1VEPA 1WZKA 5D5ME 4N25A 2XQYA 2D8KA 5EO0B 3T2PA 2VXQH 5L2KA 2BXZA 3ZRSA 3ES6B 2ATPA 2BHYA 4FYRA 1DVTA 1ZLUH 1B9KA 3MFGB 4NHCH 1WFNA 6PAZA 2ATAA 2AQPA 4V2CB 4ORGB 3PHOB 3HI1A 4MMYA 2PKDA 4WW1A 2OZ4L 4GXUN 1JIBA 1K6QL 1MCSA 4FL4C 2AK1L 1EAQA 2IXQB 3RNQA 4K9EL 3QUXC 3EBGA 4YEEA 1ASPA 1MAKA 3QZPA 4QY8A 4K5NA 4PJ5A 1PG7L 1E2VA 3HZVA 4ODTL 3HI6L 1USQA 3WKMH 3QIUA 2WWMD 3STZB 3CMOH 3CMGA 2DQUH 4ZFOL 1L0XA 1IGMH 3FBQA 4LU5L 3BKCL 3H6JA 3T0EB 2JKSA 3MLWL 3PQYE 5GJSL 2JKJA 1S7TA 3QI9B 1BEYH 2F1BA 3OQRA 4UILL 3FUNA 4OIIH 5KYYA 4OIBA 4LKXB 4PJAF 5FFLA 3MC0A 3OHXC 3FSWA 2DQCL 4XAKD 1QFPA 2Z0UA 4DSYA 2EDTA 5DVPA 3CBJB 1CVSC 1RULH 4AZ8B 4IRZL 4GG6A 1ZHKA 3GMQB 1E6OH 3GXFA 2BSTB 2CLRA 1IBGH 1YNKL 1J5CA 1I8AA 4LLDB 1AO7B 1LD9A 2ZOKA 2ZXDA 3MLXL 1E5AA 2XOTA 4X8GA 3W0WA 1EZVY 1JN6B 4Z7UA 1M6UA 2R29H 2ZF9A 3BAIA 3QCVH 3QULB 1IBDA 4K9JA 1K8IB 3OB0K 4X6BA 3I02B 2R23B 5EU7C 5MHSD 2ZONA 2CPCA 3QUGA 5CUSH 2BDNL 1D5MB 4GW5A 4HJSA 4H44C 4QCIA 1P4BH 4XR8C 2QGDA 1DTUA 4OZFA 5BVPL 2G2RB 2C3HA 3SDDB 1ZPUA 1UEYA 4JY6A 1N59B 1PMYA 1BX2B 4KKRA 4XNUL 4YDIH 4IHBA 4H20L 4FXTA 3IDYB 2ESVA 5CGMA 3MRNB 4NZJA 2R0LH 2OTWA 4ENED 1MF2L 2XRAL 3ECQA 3SQBB 4LSDA 3ZPDA 2WM0A 1WA1X 3X14B 1K2DB 4L4VA 1GR7A 4QRTA 4GBXB 2F53A 2PWGA 3LXAA 4WFHE 1KCSH 4HV8A 4AEIL 5TQ2L 2CUAA 4XPTL 2NNCA 2BWDA 4PSRA 5BZWB 4ZZKA 2G5RA 1TUPA 3UGXA 1DUYA 1F56A 5L0QB 1CYGA 2ICWA 1ZVYA 1GKOA 4WFGE 3GMNB 3GKWH 4P4KA 4EXPX 1R3KB 4OCNC 1L6ZA 3RWEA 4JQVC 3ALPA 1OP9A 2Z65C 3OG6B 3PNRB 4AEHH 4TS6A 3CSBA 4TVPL 3VFOA 4KROB 2XN9B 3AREB 4G7YL 5F21B 4UTBL 2A74B 5C0BA 1L9PA 1AVAA 2OCJA 1SXSA 2YA0A 4MD4A 1SLVA 5E94A 1NBVH 1Q72L 3EYFA 5KSAC 1ZHLB 3PWNA 4EZMA 5I9QB 4Y19E 4GIOA 3KYKL 2E47A 1RZGB 1QFWL 1G7IB 4PP2A 1PLGH 4JM2D 4MB4A 5GISL 4HKJA 3K72B 4LVNB 1SEQL 3FC8A 1LP9E 4M00A 2NR6A 5ICUA 4Q9BA 5EZLB 2EDHA 3FB6B 3HC0B 4TSCL 3DXAE 1KCRL 5MI0B 4ERSL 4EAEA 5D1ZD 5IQ9A 2W0KA 4QXWA 4X99B 3SPJA 4TNEA 4JLRA 1T20A 1R5IA 2APXA 1AYOA 4Z77B 2NYKA 3PPSA 2B2XL 3DV6A 1J1OH 4JCWA 2BHZA 4TOYL 4Q4IA 4XBGA 1OTUD 3E6HB 4YSTA 4JN1L 1SFDA 3ZE1F 2IGTA 3ILPA 3ZKND 1CDUA 1IB5A 1B4RA 3MUHL 4PTUA 2HN7B 5J13C 1JI2A 1Z9LA 1BPLB 5ERWB 5TGBA 4IBSA 1MFNA 2ZKHH 2HMIC 1AZBA 1OAQH 3EFFA 1S9WB 1SJEB 4TVSa 2YPVL 3GM8A 3RA7L 1MWAL 4QJ4B 2P1YA 1QNZL 1F4WL 3DIDA 1QW8A 3UERA 2K9UA 4Z78A 3SBPA 1G9NC 4M93B 4YSUA 1EDQA 3UJJL 3X11A 5IW6B 5K93A 1LWJA 4NQDE 1AXTH 4F57H 3O6FA 5AOZA 1WCQA 4E5XB 3IAQA 1UH4A 5GS0D 3UTOA 3D0VA 1MQ8A 1THAA 3EAKA 4JPIA 1JNHB 2RGSA 2Y7SA 4EBQH 3BOVA 1CD1B 2YD8A 3V52L 1U42A 1BYOA 1XHHA 3FUHA 1UM4L 3TA3D 2IPKB 3N41F 4J3UA 3OPZH 4NAQA 4P3WA 1SY6L 4ALAC 2ERJB 4FNLH 1M1SA 4PLJD 3DETC 3HE7C 5D9SB 2YD5A 3EYUH 3JYCA 3N6YA 4LCCC 5E2JA 3GIZL 2BCKB 2BSBA 2C9AA 1P1VA 3IE4A 1U91B 2CJ3A 1OGAB 1ODAA 1T3FB 4K7FB 1BVLA 3O3UN 1IGIH 4N22A 1GZQB 3MRFA 1Q9OA 3UTTE 1NCTA 3KPPB 2F58H 1UH2A 3FN3A 5EUOF 2X12A 3C6LC 4LOFA 5GRZA 1X7SA 3BYYA 1EIBA 5SWQA 5KVMC 2P9RA 4I18C 1MFBH 4KO6A 1XDTT 1DBBH 3Q1SL 4Y4HB 1M4KA 4OT1H 4Y9FA 5DC0A 5HHQA 1RI8A 2XWJA 5IHZA 2P8MA 3Q8EA 4G8FA 1OTTD 4UAHA 4I5BB 1UT9A 4C59B 3BW9A 4M6MH 4Z7QB 1TF4A 2BVQA 5AW7B 2FWLB 2BC4A 2E7HA 2VLJA 5BMFH 1KJVA 3NH7L 4P4RA 3SE6A 5BOPA 4EJ1C 2D0GA 2WIMA 1DEEB 1SJXA 2WLNA 5LXGL 3H8NA 3WN6A 3HB3D 3GI8L 5FOJA 3VI4B 3RNQB 2FO4B 4UILH 1NFDF 1EEYA 3MZGB 2NSXA 5DMKB 1BLNA 1JDDA 2AV1A 2VLRA 3FT4A 1ET7A 2BVYA 4JFPB 2RACA 3UGUA 4MZ2A 1F90L 4FFWD 3V4PB 5BO0D 2MPVA 3V4LA 1E27A 3L4CA 2AXWA 5DJ0A 4KO5A 1MFDL 2WXIA 2VM3A 3FFCE 4XGZB 3WUWB 5TK2A 1EDHA 3RUGE 4QRRB 5KJ4A 5GS0L 2NDGA 3IGAA 3ARDB 4N90E 1B2WH 4I87A 1KJMB 3KWWB 2HLAA 2E8ZA 3QH3A 1W0WA 2VMCA 5MERA 3VFMB 1JAEA 5IFJA 2KI6A 4IHOB 4N5EC 1BFVH 2MQ0A 1NTDA 4GG6B 1XCTB 2EJ1A 3H2WA 3RWHA 2VAAB 1C08A 4E36A 4F58H 3QULA 1UJTA 4ZJ9A 1DQTA 2LT9A 3VD4A 4P5MA 5EU6D 3FTWA 5CJQL 5ISZE 2H1PH 5ITFA 2DDQL 4MNQB 2AVGA 3MR9B 1OARH 3C5ZB 1D9KD 1X6NA 1M9SA 5IW1A 4ZS6D 2OSWA 1LO0H 2QHRH 4FRWA 4OZFB 3G5YB 5IY5B 1ZK5A 1G7LB 2HT2D 5E56A 2NNXA 4QRPD 3W1ZA 1CE6A 4WTQA 4OLYH 1EEQA 3VFUA 1N59A 2OX5A 1E8ZA 2H9GA 1TYJA 4LL4A 3ML9A 4ZSOB 3WGVB 3U36A 1AGCA 4LIQL 4P5KA 1TEFA 1P5VA 3QDGB 1RP8A 1LGVA 1S7RA 1G7PA 3WG7B 1L0YA 2OR9H 1KBBA 5HYJB 3TJPA 3X14A 2I07B 2WP3T 5G4OA 1KNOA 1XIWB 5HHPB 3CGTA 4PPTA 3TEXA 1M71B 3BQVA 2YAOA 3LNDA 3QR2A 1OPGL 1MUJA 2Q7AA 2J71A 2DJSA 2WB7A 4ZMXA 4U4IA 4ZTOL 5I66B 1FQ9C 1MCFA 1JZHA 4PJEB 3FCBA 4HJGA 3RI5F 5K1VA 5A3ID 3LXCA 4MASA 4HDIB 4UYQA 3QG7H 4QDGA 1SNRA 1P53A 1P6AB 4J3WA 2ZPKL 4O2EA 1IL1A 1XF5A 2X88A 3AB0B 3IJHA 4S2SA 4TKWA 1LMIA 4KXZH 1AC6A 3TLRA 2IQAB 4U6VH 1BZEA 1QRNB 1IKFH 3CLFH 4AIOA 4ODXA 1PG7X 5D2NB 5C9KA 2CO7B 4K3DH 3JUYA 1QSEB 2B0SL 3VFTA 3FTVA 4ZPTA 2BLFA 3IS0X 5AYTA 5E08H 5KSAB 1NEUA 4FQCH 4XTRC 2DWDB 5EUKA 5KSUB 4XWOD 2K3TA 5CJOL 1CURA 4S1QL 2V8LA 3WTXA 2P44B 1HI6A 1QPXA 4UM9A 3RY4A 3K4DA 3NIFF 4PG2C 3QQ3B 4YHIA 5JOPE 2XIIA 4HJUA 1D9KB 2BMKA 3IXAA 1WAEA 4TRPL 4N8CH 3O6LH 4X7SH 5IQ9B 2KQNA 3U4BL 4G6MH 1XF3A 1UM5H 5AUMB 3VFSB 3BWUF 3ESOA 2GSMB 5CO1A 3E8UH 1U8LA 2CDFA 5CZVL 5IJVB 1P7HL 3NJLA 4F5CE 1U8IB 4P2QB 2XVGA 4G7RB 2VLKA 3WI9A 3SDXB 5AZEL 3QIBB 8CGTA 5F7KC 1HQRB 1B6DA 1V7NL 2QELA 2V2WB 4LARH 5DUJA 3W9EB 2E74C 5ERWA 2DMCA 4L9LC 5KYUA 4PGEA 2VDPB 2W95A 3P11H 3GXIA 1UM5L 3ABLB 1FC1A 4KGLA 1S9WA 1AP2A 1AD9B 1SJEA 5ALCH 1PAMA 5E8OA 3EOTH 3S36X 3AQZA 3RGVC 1F00I 4IBTA 2BY0A 1TTAA 4TUJB 1QSFA 4B7IA 4JKKA 5FYKD 5CGYC 3BI9X 1IGFL 3ILEA 4RIRA 3I6LE 4AYMC 1OQOA 1PFOA 2EH7H 4P2AA 3WUZA 4YUEL 4Z78B 4P9MH 1X7QB 1KCBA 2UWEE 5F1KC 2YRBA 2X10A 1JERA 1NL0L 4EUPH 1QBML 4ZOCA 5IW6A 2XTLA 5FK9B 3R1GL 1KDIA 2VW7A 4ECNA 4LLWA 1BGXH 3WYRA 3ULAB 4AJVA 3AQXA 3CC5B 3GRBA 1MRFH 4IGBC 4PJBE 2XXMB 4NKOA 2W9DL 5I9QC 4J39A 1KTBA 1GVIA 2VLRE 5ADOL 3BPCA 2VR8A 3E0GA 2EXYD 5CN2A 1FE8H 5KN5A 3N9GL 4AYID 5CN1A 1ZJAA 4DVBB 5IJCC 4AV5A 1VEMA 5I6NA 2YQ2A 5B1KA 4HISA 2XN1A 5FFOA 4DKEH 1Z3GL 1EJ8A 3L5WB 1J8HA 3DRQA 3O6FC 2PP9A 4DZBB 4JG5A 1ORSB 5C71A 4C83B 1MAML 1UD4A 3GMPA 4K7FA 4NRXA 2K7PA 4N87A 4ANVA 4L8CB 3BT0A 4C47A 3QFDB 3T6XA 4NFDA 4FI6A 2W94A 3DMMB 1WQVT 4OSUL 5LBSH 2OMZB 1JL8A 4U1GB 1NCBH 1NC2A 3FH5A 4JDVA 3EO0A 2KLTA 3C6LB 2VDNH 3D85A 5HJDA 3RWJB 1CE1L 2WXOA 4I18B 2MOGA 3WFDH 2IV8A 2FGZA 4JFFB 5J9PB 1F18A 4NGHH 1MRDL 2EE3A 1WD9A 1IC4L 4LRIC 1D5BA 1TQTA 3ZZ1A 4JAMA 2AK4D 3TN0C 5JQ6L 1OGTA 3TBVB 4R7NA 4U0RB 4PW4A 4HPHA 1UHVA 1Z9SB 2W92A 5DTFA 1UB5A 3TA3B 3PCYA 1C12B 3P2BA 4WWID 3CZGA 2FEDD 2BCMA 4LL9A 1U95A 2Y5EA 3BZ5A 1T21A 4MCYB 2XVBA 4S1RL 1ADQL 5E5UB 3HNSH 5G4NA 5CD3A 3IDUA 4Y5XB 2VXTL 1WGVA 3LSOA 5I1GL 1HN1A 3VGHA 5GRXG 1C8PA 1H0DA 2BM3A 3BLKA 1OSZB 5FA3B 1N8ZA 3B1TA 2AP2A 3UTSD 1QPKA 2XJLA 1EJ6A 4HFWA 3D30A 4I48B 1S9VA 4MA1B 3FU5A 4RESB 5CZKA 4BQ6A 5IT2H 2OS7A 1IE5A 3DX8A 1AHWA 2OXGB 3NZHL 4HU2A 4P5TC 5AVYB 2G3NA 4Z7WA 5MERB 5EF0A 3LCYA 2GTZB 2EILB 3SDYL 4QHLB 1UACL 3A67L 4Q2ZA 4N8VA 3RKDD 1NQBA 3FO9B 5CU9A 2AZAA 4KZCA 5FV1L 2ZXWB 5CGBA 4CNIA 1FVCA 2I85A 2ARWA 1HHGB 1PSKL 3GSVB 2Y7NA 1FYTD 5LB1A 1XTLA 2WCSA 1KEML 3P69A 4BA8A 1S9KC 2X4RA 1M1XA 1ZPLA 5T3ZD 1FZKB 2CGRL 4H25A 3TT3L 4JQXC 3MR9A 4JO1H 4N9GB 2W38A 5LWYL 4B95C 4F7PB 2O30A 4Y19A 1LE5B 3C5ZA 4J3VA 3HG4A 4M1DL 4WI2A 2QKIB 4CN1A 2IFFH 3B2VH 3G5YA 1DQVA 2HJLA 4ZXBA 5AZEH 5F7DB 1NMAL 4ZQKB 1IGCL 2O6DA 2HTLC 3QVAA 2VWEE 3W2DL 4MYPA 1HAWA 3IT8D 4NKIL 4JO3L 1JMZA 2OX5B 1MHCA 4IYKA 3BUTA 1WPCA 3QUML 2E4TA 4TUOB 4ZNCD 3ZL2A 5DO2D 2VMJA 4NNYA 4CVXB 2IWGA 4Z7QF 3T2NL 2WSPA 2P4AB 5IB4A 4M5ZL 1II4E 2KLSA 2V33A 1O6TA 1M71A 3FCUB 1DQQA 1YVLA 3LKNA 5IB5A 4XCEB 2K8MA 3EZJB 3MYZA 3ATEA 4P5SA 5LO7A 3V7AG 4TUKL 4ZUUA 3PP3H 4WO4B 1CN4A 5CLYA 4NQCB 4WHDA 3RX9A 2HZHA 1UWGH 1QW9A 1X5KA 1AXTL 2DQGH 2EEAA 1I1YA 4PJIF 4W9LC 5D7JA 3CIQA 3VACA 3WO3B 5E9DE 1IL1B 1HL9A 1HEJC 4JM2B 4EIUA 1UOKA 2F8XC 4JMNA 1LO3H 2BRRH 1UENA 3QEHB 4HC1H 4EI5C 3I85A 2XN0A 3VD0A 3IDJA 4G9DB 2J4WH 3OSKA 4PCKA 4L4JA 2FHFA 1HSAA 4BKLB 1IKNC 5EA0L 1D7BA 1TU2A 3CHPA 3A47A 4K8RC 2CLVB 3BD4A 3UC0H 4NNPL 3C5ZC 3MXWL 5D2LA 1Q0XL 2C1OA 4YDLC 1NGQL 2YKLH 4HWZB 3O0LA 1UCBL 1R3LB 5I28A 3R4RA 2XKSA 1J1OL 4YR6B 2B2XH 4M7LL 3SCMC 3ZHKA 3TH2T 4JREC 1FZOB 2ZSWB 1AO7E 5DLLA 2PPDA 3SOBL 3TNMA 4HIJB 5HDWA 4JFDD 1O6SB 3EYVB 4G1MB 3FU9A 4MQTB 3BCFA 4P8QA 5FYLE 5HDBF 2CO1A 3D09A 2F53D 3AVEA 3JVGC 4OF3A 1PD0A 3DSNA 2CO3A 2WSKA 1Q9KA 1FRGL 4PJ7A 3P9MA 3EH5B 2WXHA 5E2WH 2XV0A 1UKQA 5BXFA 4AUJA 2IAND 3GIVB 3ELQA 1G9MC 1NGQH 1OAXL 4DK5A 4JFQB 4KHXH 3FOLB 3S3CB 1Q72H 3WGUB 1GW0A 4G7SB 2G0LA 4M5TA 2F1AA 5ILTL 3AXHA 3RZWA 2J3SA 4KKCD 4RFOL 4TLTA 2EEBA 2Z92B 2HG5A 4P2RE 4NPYA 1S7WA 5HYQB 4DUXA 4DERA 3S88H 5HHXH 4HJ0D 3AJ7A 2MQCA 1N7MH 1CU4L 1BXVA 5DHMC 1B88A 3P4LA 3PJLA 2F7PA 5EBLB 3NIGB 2PPEA 2QTVA 1ZA6A 3E38A 1MCOL 4LGRB 3QCTL 1SVZA 3VVVA 3OJ2C 1E90A 1ZJBA 3ZTCC 1NFAA 2Y07L 1Q8MA 1XB3A 1WT5A 2OI9C 4BSJA 4AEIH 2B08A 1U8PB 4TVPH 5F88B 1IX2A 2IPTH 1IGFH 4JGUA 2JB5H 2VJ0A 1D9KC 1MCBA 4LLVA 5I1LB 4L8DA 4J3TA 4Z7WE 4DZBA 1S4IA 4AMXA 5ALCL 1G0XA 3VGBA 2X2UA 1YEFH 1BXUA 2ZKYA 1DFXA 4IBUA 1RPQA 4MQXD 1S78C 2ZWLT 2W07B 4PJ8D 1NC2B 4Q56A 5GRYA 3L1FA 5IMKA 5E9DB 1QBLH 1J7VR 1ZHNA 2OAAA