1ZV4X

Structure of the regulator of g-protein signaling 17 (rgsz2)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
139
structure length
138
Chain Sequence
LYFQSMNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of G-protein signaling 17
publication title Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 48
structure length 138
sequence length 139
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zv4X00
2ACXA 4L9IA 1IAPA 2PBIA 3C4ZA 1ZV4X 4WBOA 4YHJA 4WNKA 1HTJF 4PNIA 2DLRA 4IGUA 3CX8B 3C51A 2ES0A 3C4WA 2I59A 3AB3B 3QC9A 2A72A 3C4XA 3CX7B 3T8OA 3C50A 4GOUA 3CX6B 1SHZC
chains in the Genus database with same CATH superfamily
3NRXA 3MXZA 3AA6B 2LSIA 4AKLA 1MNDA 2YDQA 4TWFA 5AQRB 3UU5A 1G8XA 3V5SA 5HWYA 5AQQB 4JI5T 3AE3A 2VKDA 2BBJA 5JRCA 1BR0A 2X0YA 4IDOA 5AQOB 2H7VC 4KBMB 1MNEA 2CHOA 4H9RC 3QOFA 3Q2MA 4AQYT 5HCJA 2WSSV 3AEDA 5KDMC 1D1BA 1NWMX 2CM0A 3C4XA 1DU2A 4IDNA 2LRLA 3ETUA 3CK6A 5LBQB 4KHZF 5AQJB 3VKGA 3LFMA 2MTQA 5CA1E 2WQYA 4CXXA 3ZPOA 5ADXL 4IL4A 3EAMA 4I50E 2CBIA 2V1DB 2NW9A 4C91A 2W67A 2LRKA 3IA3A 1J1JA 1S35A 3HA4A 4DO0A 1JNZA 2ZLYA 1XWMA 5L3CB 3FBZA 2FJAA 3NRYA 1XMOT 4ADZA 4YY3T 4YSXA 4B3ST 3MA9A 3SWHA 4IE7A 1FEWA 2VVSA 4GK0E 1NENA 3ZCJA 2XSBA 3CIRA 2V7JA 2BS2A 4QKNA 3RKOA 3I9WA 2IW5B 1IBLT 4YJ2E 2BBHA 3P4QA 3QNUA 4CZZB 2ZM6T 2JIWA 2VASA 2YEVC 4CN1A 4PW8A 5AQNB 3J7Yq 5J2UE 3ANWA 2BZBA 3CX7B 3UU8A 2CHNA 4O8SA 4CI3B 2F4VT 2W63A 3KV5A 3ZSTA 2XQAA 4AKGA 3HKDE 2W4XA 4EZ4A 1I94T 1N33T 5L3GB 5AQFB 2ES0A 1W9RA 2W00A 3LSVA 5EZYE 5FVLA 1QUUA 3BQLA 3P4PA 2W66A 5HAXA 1HX1B 1VCTA 5JDFA 3AE9A 3N9NA 5FNVE 1D0YA 2VB6A 4ZI2C 5HEUA 3AE2A 3RRWA 3DP7A 4NUVA 4Z8XA 4YSYA 5JRCB 3PUGA 4I43B 4HWDA 1IAPA 1YKHB 5JVDE 4IDQA 3ZYLA 3F57A 2LEHA 2JMHA 4K0UA 4WBNE 2WMOA 4DBRA 3IEEA 5LGUB 2WU5A 2Q9QD 3O1HA 2B76A 1NAFA 2DL1A 5AQUB 2VL0A 2DHRA 4TZ4C 5FL1A 1ZKEA 1YXRA 3RYFE 3H3AA 2WB5A 3LK2B 4FI5A 4Z91A 3KV6A 3N9LA 4OYJA 4EB6E 2XSAA 4JI3T 2ACZA 5AQHB 4DV0T 2L9QA 5ABFA 1FMVA 3B57A 2FJDA 4A56A 4HWIB 2YN6A 3ZC1A 2CLYB 4QH5A 4QXHB 5LB7B 3IHRA 3Q9DA 5AQVB 3C64A 2XAHB 2XTLA 3LDQB 3F31A 2MAWA 2CPTA 3FZHB 3RHWA 5L4EA 5EK3A 3Q5EA 2WWVA 2UXNB 1V9DA 5HEHA 5KMGP 3FBLA 5AQIB 3AE5A 3ZMZB 2LHNA 3VR9A 5BR8T 4BA9A 2VQET 3M3ZB 3N9MA 1HX8A 2Y8DA 2X9YA 3NZQA 2G0UA 1Y01A 1B7TA 3OVUA 2N1GA 4JI4T 3ZYMA 3N9QA 1W09A 4ZXLA 2JMKA 4DV1T 4AQGA 3IF8B 1UK5A 4O4HE 3ZMTB 4PJMA 4UIGA 1E1HB 2AXDS 1XNQT 2HN1A 3CX6B 4NXNT 1X9BA 1FMWA 4L9IA 4MLKA 3D0TA 2PBIA 3RIAA 4WZXA 4GK5E 2M67A 1XZYA 5M4YA 2UXXB 1U5PA 2IC9A 3RIUC 3KVBA 2D2SA 4DR7T 4DR3T 2W2UA 2IDOB 4IE0A 4MALA 5L3BB 3RIUA 5LOVE 3UFGA 4X64T 4KP3C 2RA1A 2UXDT 1KEYA 3UQ7A 3CQGB 5LHHB 4YLHA 2RPAA 2XZEA 4WBOA 4UR9A 3AEEA 2ZM0A 4TWHA 4O4IE 2WCAA 4YHJA 5J1GA 4KX6A 2H88A 5LP6E 4IIJE 1WR0A 2WM9A 2WBLA 4HFHA 3OKQA 4OK0A 4HFVA 4P1NA 4PAGA 2LM2A 3BQIA 5ABGA 1IBMT 1OEDC 4LFAT 5KXJA 2KNDA 2CXFA 2K5BB 2XY8B 2MPKA 3U78A 5LJNA 2V7LA 3A7MA 2LM9A 3KDSE 1OEDA 5EK2A 4E7ZA 4HFBA 2XQ9A 4HWHA 2PG8A 2HH7A 3RQUA 4UELA 1WR6A 2M6IA 4IE5A 1UURA 3EUHA 3LK3B 4X65T 3DTOA 2FUPA 4G63A 4X1IE 1ZOYA 3UULA 3AXJA 3AE4A 3QB5A 2X0LB 5FXVA 3L3PA 3AE8A 2LSKA 5A1LA 2H7OA 2KINB 2R6GF 4NXMT 1XMQT 5IUXA 1HFAA 4OHFA 3RYCE 1YQ3A 5LYJE 2CWOA 3AA1B 4JYAT 4P0BA 5CFBA 4COFA 2N9DA 3ZYKA 3F2EA 3RYHE 5KX5E 3JAFA 2V6YB 4L0RA 4O4JE 4I55E 2JJ9A 3PUYF 5HXEA 3PUSA 2YINA 4H9OC 4LF6T 4TV8E 2SPCA 5JREA 2W0GA 1HTJF 5LMUT 3C4WA 5AQKB 1N32T 2H3RA 4JEUB 2XUEA 2QYWA 4YXDA 3PUWF 1IZNB 2YU1A 2L8KA 4Z90A 2CEAA 1UUSA 4DUZT 2BKOA 3WAJA 2UU9T 3BQKA 5H6RB 4O4LE 2MBGA 4A5XA 3GMIA 2E2AA 4H9PC 4DR2T 3KBTA 3UUNA 5AQLB 5BMVE 5DJQC 2C5KT 4EIWA 2DLRA 4DIDB 1I6ZA 3O4XE 5L3FB 2J47A 2CLYC 1SUMB 4F6RC 4EEDA 4GKKT 3VRBA 3A5XA 4AIUA 2J1DG 2OA5A 2LT3A 5LG3A 3W15B 4HFEA 3AVRA 1OEDE 2BS4A 1HCIA 1Z8UA 4CXYA 4LF7T 5F5WA 5AQPB 4CI2B 2QVAA 4DV3T 3MACA 3P50A 1OEDB 4HTEA 3R6NA 3RIFA 3T1YT 2E8IA 2KMFA 5EK4A 2D0UA 3RPUA 5C2TA 5F3JA 5JDHA 5AQSB 4PJJA 2XQ6A 3AXJB 4U2YA 3WAKA 3AA0B 4X1KE 1IJ5A 1E7PA 4JBWF 1N36T 3M65A 5L4HA 2Z6EA 2X9WA 3EHZA 2YKSA 4IDZA 3PJAJ 2FJEA 2QA7A 1OWAA 2DWGA 4AKHA 2KWIB 2E9XC 3H37A 3UU3A 3FZLB 3LJCA 4ZZCA 2WS3A 5C3JA 4EGWA 2V26A 4PJLA 1WLXA 4P0AA 2X9HA 4UF0A 2V5DA 1HNXT 3NZPA 4B3TT 4YSZA 3WI3A 4ZEYA 1GQEA 4M1PA 3GWHA 4ISSA 4HFIA 4E7SA 2XQ3A 3CPZA 3KVAA 4HFCA 1WYCA 4B3MT 2VURA 4DMVA 3ZJ1A 5FL0A 5DQVA 4P09A 4PJNA 3KFWX 4YTPA 4X1YE 4CXWA 2MYSA 2ODUA 4QH1A 3C51A 4K0KT 4KMCA 2A9UA 4TWDA 1YD8G 4JI8T 1WCRA 2C0SA 1KNZA 3PUVF 5LA6E 1T72A 2NW7A 1W0BA 4O2BE 3ZKRA 3L39A 2VWAA 2LE8A 3O1JA 3KINB 3I1AA 3RRCA 3OBVE 1HNZT 3ZCIA 5JDMA 2BKNA 4H63H 3L09A 3OYXA 1ZV4X 4AKIA 3K3NA 4UVAB 1UX4A 4ILAA 3PE0A 4ZZBA 4JLEA 3RKGA 2YU2A 1G73A 2IMLA 3UT5E 1W0AA 3I0QA 2ZM2A 2H89A 4YTNA 3AA7B 2I0MA 4QX8B 1SHZC 2IC6A 2A2FX 3ONLC 2LKHA 2W62A 4QH4A 2C5IT 3N2OA 4A97A 4JI6T 2VK9A 1D1CA 5FY1A 2V5CA 3VKHA 4EYUA 1AJ3A 2V7KA 4EEBA 2K24A 1LVKA 4LMKA 4DR6T 4ZI3C 3NWIA 5AQMB 3A8YC 1R8IA 2V7MA 3JAEA 4X5TA 3T8OA 3MZKB 2FBWA 2HN2A 3FXEB 4I4TE 1UX5A 2XM2A 4U33A 4FJOA 4ZI2D 3QB5K 2JQHA 2LSGA 2YDRA 3K3OA 3J9X1 2CE7A 2V6YA 3RC8A 3EDVA 5E0OA 2XAJB 3ZN0B 4UV9B 2UUAT 4IL9A 2XPKA 4N78D 2D9DA 4LF4T 3LG7A 5CJ5A 2NP9A 2I6HA 4WYVA 2XAFB 2E9XB 3AE1A 4ZS2A 3UTKA 1J5ET 4UF0B 4DVDA 4UVCB 2A72A 5LHIB 5JDNA 1KFYA 2BVMA 3ZJ2A 5LMNT 3JC6C 3AEGA 2CCQA 2EHOC 2XJ7A 1KNRA 3SFEA 2XHEB 1HG5A 5JR9C 5JDQA 2V7IA 3CQCB 2UXBT 4YT0A 4O2AE 3UFEA 4U7IA 2CWYA 3ZC0A 2YOEA 4ILBA 4TX5A 2VKJA 3MK7C 2KT9A 5HXRA 2MOZA 1T8BA 4B6XA 5F8PA 2HPLA 2YK0A 5L2LA 4PK4A 2CXDA 1FIOA 3H3MA 5HXHA 3E0ZA 4HWFA 1VCSA 3CKDA 1LRZA 3X1DA 3MKDA 4YFSA 2JQQA 4HN9A 1JNRA 3SOLA 3ONXA 5IHYA 3CX8B 3HI2A 2D0TA 1CUNA 2ODVA 4YHHT 4JI7T 1XDPA 2NTXA 2LHRA 4ZI3D 4DUYT 4PK6A 2ZM8A 3AAEB 5LJMA 3ZSSA 1XNRT 1H7CA 4ANJA 4U74A 1HG2A 5AFUL 4DBQA 5JTGA 4HE8A 2FJBA 5JQGE 3RF1A 3VR8A 3P8CD 3Q5WA 4NPPA 4DV5T 4X62T 2WZHA 4LMLA 4V1Av 1MMNA 4LMJA 5HYAA 1YKEB 2X9XA 5IYZE 2WWUA 1VRBA 3PUQA 5ETWA 4ILUA 3TLWA 3K1SA 4CQIA 2ACXA 2VVNA 5HCMA 3RH3A 2VKHA 5HEGA 2KXPB 3TKLB 5LXTE 4CN6A 3GA8A 4GYRA 4QWNB 2WP9A 3PUAA 3FXDB 2NW8A 5TAOA 2CXLA 4MHCA 2UUBT 2XQ8A 2BG9B 3R84B 3SRZA 5FMNA 2QGSA 3K3QC 4ZOLE 2WDRA 4U72A 3RC3A 1U4QA 4QXBB 4XZCA 3ZEFB 1M62A 4UVBB 4U3CA 5LG4A 3VRAA 2NR4A 3P4SA 1FJGT 3LBXA 3UU4A 2NOXA 3PTRB 4KI0F 5ABEA 4WNKA 4U7YA 3EABA 4ASKA 3TLTA 3B13A 1SE7A 3I9YA 4H63V 5L3EB 1Z0PA 2NWBA 3HKEE 3UUXB 3KV9A 2XAGB 3AEBA 4HEAA 2L3LA 2XQYA 2LLYA 4YJ3E 3PUXF 3N2KE 4PFPA 2LSJA 4EAHA 2EHOB 5CB4E 5FXWA 3LK42 5JR9B 3RLFF 3FZKB 3ABVA 2BDEA 1M7KA 4QXCB 3ESLA 5FP3A 1XDOA 3Q5XA 3HR0A 4BJNA 4EOZB 4J2CA 4HFDA 2DI4A 3S4UA 4YTMA 1L0VA 5J2TE 2IAKA 3N9OA 5LBMA 3OJAA 3N2GE 4AQFC 3OTOT 5FVKA 4XAXB 2Q9QC 3ZT6A 3G06A 3Q5DA 2PTFA 2KZ7B 5HWXA 5GONE 3EI0A 2JQKA 2WDQA 1IJ6A 4AQFA 4DR1T 3RQWA 4DMWA 3TLVA 4BAYB 1ZEEA 4GOUA 2Q9QA 5FXZA 2AE9A 3HKCE 4Q25A 1QSDA 1WRDA 3ZMSB 4GKJT 2UXCT 4IT4A 4HWCA 2A3DA 2WMNA 1CHUA 4EV6A 3C50A 4QX7B 4DV4T 1ZP0A 4DV7T 4TNWA 2VL8A 4ZI7E 5FY7A 3RX6A 2QRXA 2RP4A 3EVYA 2JPFA 4H9SE 3PURA 2VQFT 5FXXA 2OLTA 3TLUA 3JADA 1YQ4A 2WDVA 1MMGA 4OFZA 4OX9T 4TV9E 5FY0A 2IUBA 2E9XA 2X51A 4NIQA 3AEAA 2X68A 4IE6A 3CQXC 4ZS3A 1S94A 4UXNB 3ZT7A 3O1IA 2X66A 3RGLA 1LKXA 5LGTB 4X66T 3OPCA 3HL6A 2UUCT 3P4WA 4LF9T 2DNXA 2GK9A 5LHGB 3LBXB 1D0ZA 1X79A 3PU8A 2V8SV 4GIWA 2M6BA 1BR1A 3QUJA 5JDLA 3AE7A 4IHJE 1D0XA 2Y48B 4UEMA 3KV4A 2N2NA 4C90A 2WZIA 1LVFA 1T7SA 2HHHT 3N5LA 1MIWA 3EDUA 1KNPA 5LNKA 3PDYA 3IBPA 5DQWA 4A98A 5CA0E 2XAQB 4ISTA 1NEKA 4UV8B 2E5VA 4X20E 5AQGB 3AAIA 5L3DB 4LF5T 3NKZA 3B5MA 2XQ7A 2I59A 3QC9A 4JV5T 4JI1T 3C98B 4MFRA 2YDSA 2KSRA 4TUYE 3GN5A 1VOMA 3ONJA 1Y64B 4H9QC 4DNDA 2JRKA 3ZLIA 1MMDA 4CI1B 1UCUA 3CMLA 2PJQA 2Q9QB 2Y6XA 3NVOA 3UUMA 2E5LT 2E9XD 3BK9A 3HKBE 1EZ3A 4WW0A 2BKPA 5IWAT 4IGUA 2DWKA 1HNWT 4ERRA 4HGAA 4IE4A 4GYSA 3ZMVB 2P9BA 2BS3A 3VU7H 4DV2T 3NBXX 2XQ4A 3UQ4A 2BG9C 4EXTA 1E2AA 3ZMUB 5LGNB 4JI2T 3RI5A 2LOPA 2LOSA 2CMRA 4TN7B 3ANWB 1MIVA 3SFDA 2X0HA 2DCFA 1QLBA 2IIUA 3PUZF 2BG9A 1BR4A 4HKAA 3RYIE 3UUBA 4IDPA 3ETVA 2IHR1 4H9NC 1MMAA 2WY2A 3N9PA 3I0OA 5CGMA 3AAAB 3AB3B 2K48A 1HR0T 1KK7A 3U3IA 5ABHA 2D5UA 4EZHA 1HS7A 3FZFB 2C5JA 2CA5A 5HEOA 3CWZB 3TLSA 1ZHCA 4DR5T 3AE6A 4B3RT 4BJMA 4CN4A 2PFVA 2EHOA 4JI0T 5AQTB 5JR9A 3CVRA 4PK5A 5FYMA 3P4RA 1N34T 5JH7E 3OYZA 2WAUA 2LSYA 2XASB 1UGOA 2XQ5A 1J5WA 2VKOA 5H6QB 4LFBT 2K3WA 2LJLA 5DABA 4DR4T 4ILCA 5JDGA 3T1HT 3E08A 2WU2A 4JEHB 4EYYR 3P7IA 1YW0A 2B1EA 2KWHA 2V6XA 4NUUA 4AXPA 4DV6T 1OXZA 3GN5B 3O9XA 2X67A 2NTYA 3QK6A 2K9AA 5ABFB 3VHLA 4AISA 2HPJA 4PFOA 3AEFA 3SS1A 4G2AA 1SA0E 4LFCT 5HXSA 1D1AA 1BR2A 3C4ZA 4LF8T 5HXCA 3UU6A 4KUMB 3PJAA 1HF8A 4U31A 4PNIA 4AKRB 3FZMB 2CBJA 4AI6A 3ZT5A 1MIYA 5HEJA 4XBFB 2CRBA 4QHOA 4IREA 1IBKT 1KF6A 4KHPT 3K8PC 4I0UA 1US7B 3DJBA 2W61A 3AECA 5C8YE 2OV9A 5L47A 5J0ZA 3L8RA 3PV0F 4U2ZA 4F8HA 1WFDA 3E22E 2BG9E 2ZMAA 1T98A 4OYKA 3JC6D 5LCYA 2J62A 2EHOD 3ZN1B 2JQ9A 4TNVA 2BVLA 5FKYA 3FHNA 3V5UA 3FB2A 3MJXA 3AVSA 2LKGA 4MBQA 1WYBA 4JUYA 4L5GA 4ZHQE 2XM1A 3KBUA 2KLQA 1O3XA 2J4GA 3JCFA 3PU3A
chains in the Genus database with same CATH topology
3NRXA 5LHHB 2A2FX 2VL8A 4YLHA 4ZI7E 5FY7A 3RX6A 2W62A 2RP4A 3EVYA 3MXZA 3AA6B 2LSIA 4AKLA 1MNDA 4WBOA 1G8XA 2C5IT 2JPFA 2ZM0A 4H9SE 3N2OA 4O4IE 4YHJA 3PURA 5J1GA 3V5SA 5HWYA 5FXXA 5LP6E 4IIJE 2VK9A 1D1CA 2WM9A 2WBLA 5FY1A 3OKQA 4OK0A 3VKHA 4HFVA 4EYUA 1AJ3A 2VKDA 5JRCA 2V7KA 1BR0A 4PAGA 3BQIA 2H7VC 4KBMB 1MMGA 2K24A 1MNEA 4OFZA 1LVKA 4TV9E 4H9RC 5FY0A 2KNDA 2CXFA 3Q2MA 2E9XA 2X51A 2WSSV 2K5BB 4ZI3C 5KDMC 3U78A 5LJNA 1D1BA 2X68A 2V7LA 2V7MA 1NWMX 4IE6A 3CQXC 2CM0A 4ZS3A 2LM9A 1S94A 4UXNB 3KDSE 3C4XA 3O1IA 3T8OA 2X66A 3MZKB 5EK2A 1LKXA 4E7ZA 5LGTB 3ETUA 5LBQB 2PG8A 3FXEB 3HL6A 4I4TE 1UX5A 2HH7A 4UELA 2DNXA 1WR6A 2GK9A 5LHGB 3VKGA 3LBXB 4IE5A 1D0ZA 1X79A 4FJOA 3LFMA 4ZI2D 3EUHA 3LK3B 3PU8A 2MTQA 2LSGA 5CA1E 3DTOA 3K3OA 4G63A 3J9X1 2CE7A 4GIWA 3RC8A 4X1IE 4CXXA 1BR1A 3UULA 3EDVA 5E0OA 3ZPOA 3QUJA 5ADXL 2XAJB 5JDLA 3ZN0B 4I50E 4UV9B 4IHJE 1D0XA 2Y48B 2V1DB 2NW9A 4N78D 4C91A 4UEMA 3KV4A 3LG7A 2NP9A 2N2NA 1S35A 2X0LB 3HA4A 4C90A 5FXVA 3L3PA 4DO0A 2XAFB 2E9XB 1LVFA 4ZS2A 2LSKA 3UTKA 5A1LA 4UF0B 3N5LA 1MIWA 2H7OA 3EDUA 2ZLYA 2KINB 5LNKA 3PDYA 3IBPA 5DQWA 5L3CB 4DVDA 5CA0E 3FBZA 4UVCB 2XAQB 2A72A 4ISTA 1HFAA 3NRYA 4OHFA 5LHIB 4ADZA 5JDNA 4UV8B 3RYCE 2BVMA 3ZJ2A 3MA9A 3SWHA 4IE7A 1FEWA 3JC6C 4GK0E 5LYJE 2CWOA 3AA1B 2CCQA 2EHOC 3ZCJA 4X20E 2XHEB 3AAIA 1HG5A 4P0BA 5JR9C 5JDQA 5L3DB 2V7IA 2V7JA 3CQCB 4QKNA 2N9DA 3RKOA 3ZYKA 3F2EA 4O2AE 3UFEA 3RYHE 5KX5E 3I9WA 2IW5B 2I59A 4L0RA 4O4JE 3QC9A 2CWYA 4I55E 3ZC0A 2JJ9A 4TX5A 3C98B 4MFRA 5HXEA 4YJ2E 3PUSA 2VKJA 2YINA 4TUYE 4H9OC 3GN5A 1VOMA 3MK7C 4TV8E 1Y64B 4H9QC 2SPCA 5JREA 4DNDA 2W0GA 4CZZB 2KT9A 2JRKA 5HXRA 2MOZA 2VASA 4B6XA 1HTJF 2YEVC 4PW8A 5F8PA 2HPLA 3ZLIA 1MMDA 2YK0A 3J7Yq 5J2UE 3ANWA 1UCUA 4CI1B 3C4WA 3CMLA 2BZBA 5L2LA 3CX7B 4PK4A 2CXDA 1FIOA 2H3RA 4JEUB 2PJQA 2Q9QB 2Y6XA 5HXHA 2XUEA 3UUMA 4O8SA 4CI3B 2E9XD 2W63A 3BK9A 3CKDA 3E0ZA 3KV5A 1LRZA 1IZNB 2YU1A 4AKGA 3HKDE 2L8KA 4EZ4A 3MKDA 4YFSA 2JQQA 4HN9A 3HKBE 5L3GB 1EZ3A 4WW0A 3SOLA 2CEAA 4IGUA 3ONXA 5IHYA 3CX8B 3HI2A 2D0TA 1CUNA 2DWKA 2ODVA 2ES0A 3WAJA 2W00A 2NTXA 3BQKA 5H6RB 4ERRA 4HGAA 5EZYE 2LHRA 1QUUA 4IE4A 4O4LE 4GYSA 3BQLA 4ZI3D 3ZMVB 2P9BA 5HAXA 2MBGA 3GMIA 3VU7H 4PK6A 4H9PC 5JDFA 2ZM8A 3AAEB 3NBXX 3KBTA 3UUNA 5LJMA 5BMVE 3N9NA 4EXTA 5DJQC 2C5KT 1H7CA 4ANJA 4U74A 4EIWA 3ZMUB 1HG2A 2DLRA 5AFUL 5FNVE 1D0YA 2VB6A 4DBQA 4HE8A 5LGNB 4ZI2C 2LOPA 2LOSA 2CMRA 4TN7B 3RRWA 3O4XE 5JQGE 3DP7A 3ANWB 4NUVA 4Z8XA 5L3FB 1MIVA 3P8CD 3Q5WA 5JRCB 2CLYC 2DCFA 3PUGA 4I43B 4F6RC 1IAPA 1YKHB 5JVDE 3A5XA 3ZYLA 3F57A 2J1DG 2OA5A 4V1Av 2LEHA 1BR4A 2JMHA 2LT3A 4K0UA 4HKAA 3W15B 3AVRA 1MMNA 3RYIE 4WBNE 1HCIA 3ETVA 5HYAA 2WMOA 1YKEB 4DBRA 3IEEA 5LGUB 4H9NC 2X9XA 4CXYA 1MMAA 5IYZE 2WWUA 1VRBA 3N9PA 3I0OA 3PUQA 3AAAB 3AB3B 4ILUA 5ETWA 2K48A 4CI2B 2Q9QD 1KK7A 3O1HA 3MACA 3U3IA 4CQIA 2ACXA 2D5UA 4HTEA 3R6NA 4EZHA 1HS7A 3RH3A 2VKHA 1NAFA 2KXPB 2C5JA 2CA5A 2E8IA 2KMFA 5EK4A 2D0UA 3RPUA 5F3JA 3TKLB 5JDHA 3CWZB 2DHRA 4TZ4C 5LXTE 1ZHCA 1ZKEA 3GA8A 4GYRA 4QWNB 3PUAA 3FXDB 4PJJA 4BJMA 2NW8A 3RYFE 5TAOA 2CXLA 3H3AA 4MHCA 3LK2B 2PFVA 4FI5A 3WAKA 2EHOA 3KV6A 3AA0B 3N9LA 4X1KE 4OYJA 1IJ5A 4EB6E 3R84B 5JR9A 3CVRA 4PK5A 3SRZA 5FMNA 5FYMA 2QGSA 3K3QC 4ZOLE 4U72A 3M65A 3RC3A 1U4QA 4QXBB 2L9QA 1FMVA 3B57A 4XZCA 2Z6EA 2X9WA 4A56A 3ZEFB 1SHZC 5JH7E 3OYZA 2WAUA 4IDZA 2LSYA 2XASB 3ZC1A 2CLYB 4QXHB 4UVBB 2QA7A 5LG4A 3IHRA 3Q9DA 2VKOA 1OWAA 3C64A 3LBXA 5H6QB 2XAHB 2DWGA 2XTLA 4AKHA 2KWIB 2E9XC 2LJLA 2NOXA 3H37A 3F31A 3PTRB 5DABA 4WNKA 5JDGA 3E08A 4ASKA 5EK3A 2UXNB 1V9DA 3B13A 4JEHB 4EYYR 3P7IA 1YW0A 3I9YA 4H63V 5L3EB 3LJCA 1Z0PA 2NWBA 5KMGP 3FBLA 3HKEE 2V26A 2B1EA 2XAGB 3KV9A 4HEAA 4PJLA 3UUXB 2L3LA 2XQYA 1WLXA 4YJ3E 4P0AA 2KWHA 3N2KE 2LSJA 4PFPA 4NUUA 3ZMZB 4AXPA 4EAHA 2EHOB 1OXZA 2LHNA 2X9HA 4UF0A 5CB4E 5FXWA 3LK42 5JR9B 3GN5B 3NZPA 3O9XA 2X67A 4BA9A 2NTYA 3WI3A 3QK6A 2K9AA 2BDEA 4M1PA 3VHLA 3N9MA 3GWHA 1HX8A 2HPJA 2Y8DA 2X9YA 4ISSA 4PFOA 3NZQA 4QXCB 3SS1A 4E7SA 4G2AA 3ESLA 1SA0E 5FP3A 2G0UA 3CPZA 1B7TA 1D1AA 3KVAA 3Q5XA 5HXSA 1WYCA 2N1GA 1BR2A 3C4ZA 4DMVA 3ZYMA 3N9QA 3ZJ1A 3HR0A 5DQVA 5HXCA 4BJNA 4EOZB 4J2CA 2JMKA 4P09A 4AQGA 3IF8B 2DI4A 4PJNA 3S4UA 4KUMB 3KFWX 1HF8A 4PNIA 4O4HE 4X1YE 4AKRB 4CXWA 2MYSA 3ZMTB 2ODUA 4PJMA 4UIGA 5J2TE 3C51A 2IAKA 1E1HB 3N9OA 4KMCA 5LBMA 3OJAA 4AI6A 3N2GE 4AQFC 1MIYA 3CX6B 1YD8G 4XBFB 4XAXB 1FMWA 4QHOA 4L9IA 2Q9QC 4MLKA 3D0TA 2PBIA 3K8PC 1US7B 2KZ7B 3DJBA 2C0SA 4GK5E 5HWXA 2M67A 1KNZA 5LA6E 5M4YA 2W61A 5GONE 5C8YE 2NW7A 2UXXB 1U5PA 4O2BE 2IC9A 3KVBA 1IJ6A 2VWAA 3E22E 2LE8A 3O1JA 4AQFA 2D2SA 3KINB 4DMWA 3I1AA 3RRCA 3OBVE 4BAYB 1ZEEA 4GOUA 2ZMAA 2Q9QA 1T98A 4OYKA 3ZCIA 5FXZA 5JDMA 3JC6D 5LCYA 2EHOD 3L09A 4H63H 4IE0A 3ZN1B 3OYXA 1ZV4X 3HKCE 4AKIA 2BVLA 4MALA 5L3BB 3FHNA 3V5UA 1QSDA 1WRDA 3ZMSB 3K3NA 3FB2A 1UX4A 4UVAB 5LOVE 3MJXA 3AVSA 4KP3C 3PE0A 4MBQA 4JLEA 2A3DA 1WYBA 2YU2A 1G73A 2WMNA 4JUYA 4L5GA 3UT5E 4ZHQE 3I0QA 2RA1A 2ZM2A 3KBUA 2KLQA 1O3XA 3AA7B 4QX8B 3C50A 3CQGB 3PU3A 4QX7B 2IC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACX A;  4L9I A;  1IAP A;  2PBI A;  3C4Z A;  1ZV4 X;  4WBO A;  4YHJ A;  4WNK A;  1HTJ F;  4PNI A;  2DLR A;  4IGU A;  3CX8 B;  3C51 A;  2ES0 A;  3C4W A;  2I59 A;  3AB3 B;  3QC9 A;  2A72 A;  3C4X A;  3CX7 B;  3T8O A;  3C50 A;  4GOU A;  3CX6 B;  1SHZ C; 
#chains in the Genus database with same CATH topology
 3NRX A;  3MXZ A;  3AA6 B;  2LSI A;  4AKL A;  1MND A;  2YDQ A;  4TWF A;  5AQR B;  3UU5 A;  1G8X A;  3V5S A;  5HWY A;  5AQQ B;  4JI5 T;  3AE3 A;  2VKD A;  2BBJ A;  5JRC A;  1BR0 A;  2X0Y A;  4IDO A;  5AQO B;  2H7V C;  4KBM B;  1MNE A;  2CHO A;  4H9R C;  3QOF A;  3Q2M A;  4AQY T;  5HCJ A;  2WSS V;  3AED A;  5KDM C;  1D1B A;  1NWM X;  2CM0 A;  3C4X A;  1DU2 A;  4IDN A;  2LRL A;  3ETU A;  3CK6 A;  5LBQ B;  4KHZ F;  5AQJ B;  3VKG A;  3LFM A;  2MTQ A;  5CA1 E;  2WQY A;  4CXX A;  3ZPO A;  5ADX L;  4IL4 A;  3EAM A;  4I50 E;  2CBI A;  2V1D B;  2NW9 A;  4C91 A;  2W67 A;  2LRK A;  3IA3 A;  1J1J A;  1S35 A;  3HA4 A;  4DO0 A;  1JNZ A;  2ZLY A;  1XWM A;  5L3C B;  3FBZ A;  2FJA A;  3NRY A;  1XMO T;  4ADZ A;  4YY3 T;  4YSX A;  4B3S T;  3MA9 A;  3SWH A;  4IE7 A;  1FEW A;  2VVS A;  4GK0 E;  1NEN A;  3ZCJ A;  2XSB A;  3CIR A;  2V7J A;  2BS2 A;  4QKN A;  3RKO A;  3I9W A;  2IW5 B;  1IBL T;  4YJ2 E;  2BBH A;  3P4Q A;  3QNU A;  4CZZ B;  2ZM6 T;  2JIW A;  2VAS A;  2YEV C;  4CN1 A;  4PW8 A;  5AQN B;  3J7Y q;  5J2U E;  3ANW A;  2BZB A;  3CX7 B;  3UU8 A;  2CHN A;  4O8S A;  4CI3 B;  2F4V T;  2W63 A;  3KV5 A;  3ZST A;  2XQA A;  4AKG A;  3HKD E;  2W4X A;  4EZ4 A;  1I94 T;  1N33 T;  5L3G B;  5AQF B;  2ES0 A;  1W9R A;  2W00 A;  3LSV A;  5EZY E;  5FVL A;  1QUU A;  3BQL A;  3P4P A;  2W66 A;  5HAX A;  1HX1 B;  1VCT A;  5JDF A;  3AE9 A;  3N9N A;  5FNV E;  1D0Y A;  2VB6 A;  4ZI2 C;  5HEU A;  3AE2 A;  3RRW A;  3DP7 A;  4NUV A;  4Z8X A;  4YSY A;  5JRC B;  3PUG A;  4I43 B;  4HWD A;  1IAP A;  1YKH B;  5JVD E;  4IDQ A;  3ZYL A;  3F57 A;  2LEH A;  2JMH A;  4K0U A;  4WBN E;  2WMO A;  4DBR A;  3IEE A;  5LGU B;  2WU5 A;  2Q9Q D;  3O1H A;  2B76 A;  1NAF A;  2DL1 A;  5AQU B;  2VL0 A;  2DHR A;  4TZ4 C;  5FL1 A;  1ZKE A;  1YXR A;  3RYF E;  3H3A A;  2WB5 A;  3LK2 B;  4FI5 A;  4Z91 A;  3KV6 A;  3N9L A;  4OYJ A;  4EB6 E;  2XSA A;  4JI3 T;  2ACZ A;  5AQH B;  4DV0 T;  2L9Q A;  5ABF A;  1FMV A;  3B57 A;  2FJD A;  4A56 A;  4HWI B;  2YN6 A;  3ZC1 A;  2CLY B;  4QH5 A;  4QXH B;  5LB7 B;  3IHR A;  3Q9D A;  5AQV B;  3C64 A;  2XAH B;  2XTL A;  3LDQ B;  3F31 A;  2MAW A;  2CPT A;  3FZH B;  3RHW A;  5L4E A;  5EK3 A;  3Q5E A;  2WWV A;  2UXN B;  1V9D A;  5HEH A;  5KMG P;  3FBL A;  5AQI B;  3AE5 A;  3ZMZ B;  2LHN A;  3VR9 A;  5BR8 T;  4BA9 A;  2VQE T;  3M3Z B;  3N9M A;  1HX8 A;  2Y8D A;  2X9Y A;  3NZQ A;  2G0U A;  1Y01 A;  1B7T A;  3OVU A;  2N1G A;  4JI4 T;  3ZYM A;  3N9Q A;  1W09 A;  4ZXL A;  2JMK A;  4DV1 T;  4AQG A;  3IF8 B;  1UK5 A;  4O4H E;  3ZMT B;  4PJM A;  4UIG A;  1E1H B;  2AXD S;  1XNQ T;  2HN1 A;  3CX6 B;  4NXN T;  1X9B A;  1FMW A;  4L9I A;  4MLK A;  3D0T A;  2PBI A;  3RIA A;  4WZX A;  4GK5 E;  2M67 A;  1XZY A;  5M4Y A;  2UXX B;  1U5P A;  2IC9 A;  3RIU C;  3KVB A;  2D2S A;  4DR7 T;  4DR3 T;  2W2U A;  2IDO B;  4IE0 A;  4MAL A;  5L3B B;  3RIU A;  5LOV E;  3UFG A;  4X64 T;  4KP3 C;  2RA1 A;  2UXD T;  1KEY A;  3UQ7 A;  3CQG B;  5LHH B;  4YLH A;  2RPA A;  2XZE A;  4WBO A;  4UR9 A;  3AEE A;  2ZM0 A;  4TWH A;  4O4I E;  2WCA A;  4YHJ A;  5J1G A;  4KX6 A;  2H88 A;  5LP6 E;  4IIJ E;  1WR0 A;  2WM9 A;  2WBL A;  4HFH A;  3OKQ A;  4OK0 A;  4HFV A;  4P1N A;  4PAG A;  2LM2 A;  3BQI A;  5ABG A;  1IBM T;  1OED C;  4LFA T;  5KXJ A;  2KND A;  2CXF A;  2K5B B;  2XY8 B;  2MPK A;  3U78 A;  5LJN A;  2V7L A;  3A7M A;  2LM9 A;  3KDS E;  1OED A;  5EK2 A;  4E7Z A;  4HFB A;  2XQ9 A;  4HWH A;  2PG8 A;  2HH7 A;  3RQU A;  4UEL A;  1WR6 A;  2M6I A;  4IE5 A;  1UUR A;  3EUH A;  3LK3 B;  4X65 T;  3DTO A;  2FUP A;  4G63 A;  4X1I E;  1ZOY A;  3UUL A;  3AXJ A;  3AE4 A;  3QB5 A;  2X0L B;  5FXV A;  3L3P A;  3AE8 A;  2LSK A;  5A1L A;  2H7O A;  2KIN B;  2R6G F;  4NXM T;  1XMQ T;  5IUX A;  1HFA A;  4OHF A;  3RYC E;  1YQ3 A;  5LYJ E;  2CWO A;  3AA1 B;  4JYA T;  4P0B A;  5CFB A;  4COF A;  2N9D A;  3ZYK A;  3F2E A;  3RYH E;  5KX5 E;  3JAF A;  2V6Y B;  4L0R A;  4O4J E;  4I55 E;  2JJ9 A;  3PUY F;  5HXE A;  3PUS A;  2YIN A;  4H9O C;  4LF6 T;  4TV8 E;  2SPC A;  5JRE A;  2W0G A;  1HTJ F;  5LMU T;  3C4W A;  5AQK B;  1N32 T;  2H3R A;  4JEU B;  2XUE A;  2QYW A;  4YXD A;  3PUW F;  1IZN B;  2YU1 A;  2L8K A;  4Z90 A;  2CEA A;  1UUS A;  4DUZ T;  2BKO A;  3WAJ A;  2UU9 T;  3BQK A;  5H6R B;  4O4L E;  2MBG A;  4A5X A;  3GMI A;  2E2A A;  4H9P C;  4DR2 T;  3KBT A;  3UUN A;  5AQL B;  5BMV E;  5DJQ C;  2C5K T;  4EIW A;  2DLR A;  4DID B;  1I6Z A;  3O4X E;  5L3F B;  2J47 A;  2CLY C;  1SUM B;  4F6R C;  4EED A;  4GKK T;  3VRB A;  3A5X A;  4AIU A;  2J1D G;  2OA5 A;  2LT3 A;  5LG3 A;  3W15 B;  4HFE A;  3AVR A;  1OED E;  2BS4 A;  1HCI A;  1Z8U A;  4CXY A;  4LF7 T;  5F5W A;  5AQP B;  4CI2 B;  2QVA A;  4DV3 T;  3MAC A;  3P50 A;  1OED B;  4HTE A;  3R6N A;  3RIF A;  3T1Y T;  2E8I A;  2KMF A;  5EK4 A;  2D0U A;  3RPU A;  5C2T A;  5F3J A;  5JDH A;  5AQS B;  4PJJ A;  2XQ6 A;  3AXJ B;  4U2Y A;  3WAK A;  3AA0 B;  4X1K E;  1IJ5 A;  1E7P A;  4JBW F;  1N36 T;  3M65 A;  5L4H A;  2Z6E A;  2X9W A;  3EHZ A;  2YKS A;  4IDZ A;  3PJA J;  2FJE A;  2QA7 A;  1OWA A;  2DWG A;  4AKH A;  2KWI B;  2E9X C;  3H37 A;  3UU3 A;  3FZL B;  3LJC A;  4ZZC A;  2WS3 A;  5C3J A;  4EGW A;  2V26 A;  4PJL A;  1WLX A;  4P0A A;  2X9H A;  4UF0 A;  2V5D A;  1HNX T;  3NZP A;  4B3T T;  4YSZ A;  3WI3 A;  4ZEY A;  1GQE A;  4M1P A;  3GWH A;  4ISS A;  4HFI A;  4E7S A;  2XQ3 A;  3CPZ A;  3KVA A;  4HFC A;  1WYC A;  4B3M T;  2VUR A;  4DMV A;  3ZJ1 A;  5FL0 A;  5DQV A;  4P09 A;  4PJN A;  3KFW X;  4YTP A;  4X1Y E;  4CXW A;  2MYS A;  2ODU A;  4QH1 A;  3C51 A;  4K0K T;  4KMC A;  2A9U A;  4TWD A;  1YD8 G;  4JI8 T;  1WCR A;  2C0S A;  1KNZ A;  3PUV F;  5LA6 E;  1T72 A;  2NW7 A;  1W0B A;  4O2B E;  3ZKR A;  3L39 A;  2VWA A;  2LE8 A;  3O1J A;  3KIN B;  3I1A A;  3RRC A;  3OBV E;  1HNZ T;  3ZCI A;  5JDM A;  2BKN A;  4H63 H;  3L09 A;  3OYX A;  1ZV4 X;  4AKI A;  3K3N A;  4UVA B;  1UX4 A;  4ILA A;  3PE0 A;  4ZZB A;  4JLE A;  3RKG A;  2YU2 A;  1G73 A;  2IML A;  3UT5 E;  1W0A A;  3I0Q A;  2ZM2 A;  2H89 A;  4YTN A;  3AA7 B;  2I0M A;  4QX8 B;  1SHZ C;  2IC6 A;  2A2F X;  3ONL C;  2LKH A;  2W62 A;  4QH4 A;  2C5I T;  3N2O A;  4A97 A;  4JI6 T;  2VK9 A;  1D1C A;  5FY1 A;  2V5C A;  3VKH A;  4EYU A;  1AJ3 A;  2V7K A;  4EEB A;  2K24 A;  1LVK A;  4LMK A;  4DR6 T;  4ZI3 C;  3NWI A;  5AQM B;  3A8Y C;  1R8I A;  2V7M A;  3JAE A;  4X5T A;  3T8O A;  3MZK B;  2FBW A;  2HN2 A;  3FXE B;  4I4T E;  1UX5 A;  2XM2 A;  4U33 A;  4FJO A;  4ZI2 D;  3QB5 K;  2JQH A;  2LSG A;  2YDR A;  3K3O A;  3J9X 1;  2CE7 A;  2V6Y A;  3RC8 A;  3EDV A;  5E0O A;  2XAJ B;  3ZN0 B;  4UV9 B;  2UUA T;  4IL9 A;  2XPK A;  4N78 D;  2D9D A;  4LF4 T;  3LG7 A;  5CJ5 A;  2NP9 A;  2I6H A;  4WYV A;  2XAF B;  2E9X B;  3AE1 A;  4ZS2 A;  3UTK A;  1J5E T;  4UF0 B;  4DVD A;  4UVC B;  2A72 A;  5LHI B;  5JDN A;  1KFY A;  2BVM A;  3ZJ2 A;  5LMN T;  3JC6 C;  3AEG A;  2CCQ A;  2EHO C;  2XJ7 A;  1KNR A;  3SFE A;  2XHE B;  1HG5 A;  5JR9 C;  5JDQ A;  2V7I A;  3CQC B;  2UXB T;  4YT0 A;  4O2A E;  3UFE A;  4U7I A;  2CWY A;  3ZC0 A;  2YOE A;  4ILB A;  4TX5 A;  2VKJ A;  3MK7 C;  2KT9 A;  5HXR A;  2MOZ A;  1T8B A;  4B6X A;  5F8P A;  2HPL A;  2YK0 A;  5L2L A;  4PK4 A;  2CXD A;  1FIO A;  3H3M A;  5HXH A;  3E0Z A;  4HWF A;  1VCS A;  3CKD A;  1LRZ A;  3X1D A;  3MKD A;  4YFS A;  2JQQ A;  4HN9 A;  1JNR A;  3SOL A;  3ONX A;  5IHY A;  3CX8 B;  3HI2 A;  2D0T A;  1CUN A;  2ODV A;  4YHH T;  4JI7 T;  1XDP A;  2NTX A;  2LHR A;  4ZI3 D;  4DUY T;  4PK6 A;  2ZM8 A;  3AAE B;  5LJM A;  3ZSS A;  1XNR T;  1H7C A;  4ANJ A;  4U74 A;  1HG2 A;  5AFU L;  4DBQ A;  5JTG A;  4HE8 A;  2FJB A;  5JQG E;  3RF1 A;  3VR8 A;  3P8C D;  3Q5W A;  4NPP A;  4DV5 T;  4X62 T;  2WZH A;  4LML A;  4V1A v;  1MMN A;  4LMJ A;  5HYA A;  1YKE B;  2X9X A;  5IYZ E;  2WWU A;  1VRB A;  3PUQ A;  5ETW A;  4ILU A;  3TLW A;  3K1S A;  4CQI A;  2ACX A;  2VVN A;  5HCM A;  3RH3 A;  2VKH A;  5HEG A;  2KXP B;  3TKL B;  5LXT E;  4CN6 A;  3GA8 A;  4GYR A;  4QWN B;  2WP9 A;  3PUA A;  3FXD B;  2NW8 A;  5TAO A;  2CXL A;  4MHC A;  2UUB T;  2XQ8 A;  2BG9 B;  3R84 B;  3SRZ A;  5FMN A;  2QGS A;  3K3Q C;  4ZOL E;  2WDR A;  4U72 A;  3RC3 A;  1U4Q A;  4QXB B;  4XZC A;  3ZEF B;  1M62 A;  4UVB B;  4U3C A;  5LG4 A;  3VRA A;  2NR4 A;  3P4S A;  1FJG T;  3LBX A;  3UU4 A;  2NOX A;  3PTR B;  4KI0 F;  5ABE A;  4WNK A;  4U7Y A;  3EAB A;  4ASK A;  3TLT A;  3B13 A;  1SE7 A;  3I9Y A;  4H63 V;  5L3E B;  1Z0P A;  2NWB A;  3HKE E;  3UUX B;  3KV9 A;  2XAG B;  3AEB A;  4HEA A;  2L3L A;  2XQY A;  2LLY A;  4YJ3 E;  3PUX F;  3N2K E;  4PFP A;  2LSJ A;  4EAH A;  2EHO B;  5CB4 E;  5FXW A;  3LK4 2;  5JR9 B;  3RLF F;  3FZK B;  3ABV A;  2BDE A;  1M7K A;  4QXC B;  3ESL A;  5FP3 A;  1XDO A;  3Q5X A;  3HR0 A;  4BJN A;  4EOZ B;  4J2C A;  4HFD A;  2DI4 A;  3S4U A;  4YTM A;  1L0V A;  5J2T E;  2IAK A;  3N9O A;  5LBM A;  3OJA A;  3N2G E;  4AQF C;  3OTO T;  5FVK A;  4XAX B;  2Q9Q C;  3ZT6 A;  3G06 A;  3Q5D A;  2PTF A;  2KZ7 B;  5HWX A;  5GON E;  3EI0 A;  2JQK A;  2WDQ A;  1IJ6 A;  4AQF A;  4DR1 T;  3RQW A;  4DMW A;  3TLV A;  4BAY B;  1ZEE A;  4GOU A;  2Q9Q A;  5FXZ A;  2AE9 A;  3HKC E;  4Q25 A;  1QSD A;  1WRD A;  3ZMS B;  4GKJ T;  2UXC T;  4IT4 A;  4HWC A;  2A3D A;  2WMN A;  1CHU A;  4EV6 A;  3C50 A;  4QX7 B;  4DV4 T;  1ZP0 A;  4DV7 T;  4TNW A;  2VL8 A;  4ZI7 E;  5FY7 A;  3RX6 A;  2QRX A;  2RP4 A;  3EVY A;  2JPF A;  4H9S E;  3PUR A;  2VQF T;  5FXX A;  2OLT A;  3TLU A;  3JAD A;  1YQ4 A;  2WDV A;  1MMG A;  4OFZ A;  4OX9 T;  4TV9 E;  5FY0 A;  2IUB A;  2E9X A;  2X51 A;  4NIQ A;  3AEA A;  2X68 A;  4IE6 A;  3CQX C;  4ZS3 A;  1S94 A;  4UXN B;  3ZT7 A;  3O1I A;  2X66 A;  3RGL A;  1LKX A;  5LGT B;  4X66 T;  3OPC A;  3HL6 A;  2UUC T;  3P4W A;  4LF9 T;  2DNX A;  2GK9 A;  5LHG B;  3LBX B;  1D0Z A;  1X79 A;  3PU8 A;  2V8S V;  4GIW A;  2M6B A;  1BR1 A;  3QUJ A;  5JDL A;  3AE7 A;  4IHJ E;  1D0X A;  2Y48 B;  4UEM A;  3KV4 A;  2N2N A;  4C90 A;  2WZI A;  1LVF A;  1T7S A;  2HHH T;  3N5L A;  1MIW A;  3EDU A;  1KNP A;  5LNK A;  3PDY A;  3IBP A;  5DQW A;  4A98 A;  5CA0 E;  2XAQ B;  4IST A;  1NEK A;  4UV8 B;  2E5V A;  4X20 E;  5AQG B;  3AAI A;  5L3D B;  4LF5 T;  3NKZ A;  3B5M A;  2XQ7 A;  2I59 A;  3QC9 A;  4JV5 T;  4JI1 T;  3C98 B;  4MFR A;  2YDS A;  2KSR A;  4TUY E;  3GN5 A;  1VOM A;  3ONJ A;  1Y64 B;  4H9Q C;  4DND A;  2JRK A;  3ZLI A;  1MMD A;  4CI1 B;  1UCU A;  3CML A;  2PJQ A;  2Q9Q B;  2Y6X A;  3NVO A;  3UUM A;  2E5L T;  2E9X D;  3BK9 A;  3HKB E;  1EZ3 A;  4WW0 A;  2BKP A;  5IWA T;  4IGU A;  2DWK A;  1HNW T;  4ERR A;  4HGA A;  4IE4 A;  4GYS A;  3ZMV B;  2P9B A;  2BS3 A;  3VU7 H;  4DV2 T;  3NBX X;  2XQ4 A;  3UQ4 A;  2BG9 C;  4EXT A;  1E2A A;  3ZMU B;  5LGN B;  4JI2 T;  3RI5 A;  2LOP A;  2LOS A;  2CMR A;  4TN7 B;  3ANW B;  1MIV A;  3SFD A;  2X0H A;  2DCF A;  1QLB A;  2IIU A;  3PUZ F;  2BG9 A;  1BR4 A;  4HKA A;  3RYI E;  3UUB A;  4IDP A;  3ETV A;  2IHR 1;  4H9N C;  1MMA A;  2WY2 A;  3N9P A;  3I0O A;  5CGM A;  3AAA B;  3AB3 B;  2K48 A;  1HR0 T;  1KK7 A;  3U3I A;  5ABH A;  2D5U A;  4EZH A;  1HS7 A;  3FZF B;  2C5J A;  2CA5 A;  5HEO A;  3CWZ B;  3TLS A;  1ZHC A;  4DR5 T;  3AE6 A;  4B3R T;  4BJM A;  4CN4 A;  2PFV A;  2EHO A;  4JI0 T;  5AQT B;  5JR9 A;  3CVR A;  4PK5 A;  5FYM A;  3P4R A;  1N34 T;  5JH7 E;  3OYZ A;  2WAU A;  2LSY A;  2XAS B;  1UGO A;  2XQ5 A;  1J5W A;  2VKO A;  5H6Q B;  4LFB T;  2K3W A;  2LJL A;  5DAB A;  4DR4 T;  4ILC A;  5JDG A;  3T1H T;  3E08 A;  2WU2 A;  4JEH B;  4EYY R;  3P7I A;  1YW0 A;  2B1E A;  2KWH A;  2V6X A;  4NUU A;  4AXP A;  4DV6 T;  1OXZ A;  3GN5 B;  3O9X A;  2X67 A;  2NTY A;  3QK6 A;  2K9A A;  5ABF B;  3VHL A;  4AIS A;  2HPJ A;  4PFO A;  3AEF A;  3SS1 A;  4G2A A;  1SA0 E;  4LFC T;  5HXS A;  1D1A A;  1BR2 A;  3C4Z A;  4LF8 T;  5HXC A;  3UU6 A;  4KUM B;  3PJA A;  1HF8 A;  4U31 A;  4PNI A;  4AKR B;  3FZM B;  2CBJ A;  4AI6 A;  3ZT5 A;  1MIY A;  5HEJ A;  4XBF B;  2CRB A;  4QHO A;  4IRE A;  1IBK T;  1KF6 A;  4KHP T;  3K8P C;  4I0U A;  1US7 B;  3DJB A;  2W61 A;  3AEC A;  5C8Y E;  2OV9 A;  5L47 A;  5J0Z A;  3L8R A;  3PV0 F;  4U2Z A;  4F8H A;  1WFD A;  3E22 E;  2BG9 E;  2ZMA A;  1T98 A;  4OYK A;  3JC6 D;  5LCY A;  2J62 A;  2EHO D;  3ZN1 B;  2JQ9 A;  4TNV A;  2BVL A;  5FKY A;  3FHN A;  3V5U A;  3FB2 A;  3MJX A;  3AVS A;  2LKG A;  4MBQ A;  1WYB A;  4JUY A;  4L5G A;  4ZHQ E;  2XM1 A;  3KBU A;  2KLQ A;  1O3X A;  2J4G A;  3JCF A;  3PU3 A; 
#chains in the Genus database with same CATH homology
 3NRX A;  5LHH B;  2A2F X;  2VL8 A;  4YLH A;  4ZI7 E;  5FY7 A;  3RX6 A;  2W62 A;  2RP4 A;  3EVY A;  3MXZ A;  3AA6 B;  2LSI A;  4AKL A;  1MND A;  4WBO A;  1G8X A;  2C5I T;  2JPF A;  2ZM0 A;  4H9S E;  3N2O A;  4O4I E;  4YHJ A;  3PUR A;  5J1G A;  3V5S A;  5HWY A;  5FXX A;  5LP6 E;  4IIJ E;  2VK9 A;  1D1C A;  2WM9 A;  2WBL A;  5FY1 A;  3OKQ A;  4OK0 A;  3VKH A;  4HFV A;  4EYU A;  1AJ3 A;  2VKD A;  5JRC A;  2V7K A;  1BR0 A;  4PAG A;  3BQI A;  2H7V C;  4KBM B;  1MMG A;  2K24 A;  1MNE A;  4OFZ A;  1LVK A;  4TV9 E;  4H9R C;  5FY0 A;  2KND A;  2CXF A;  3Q2M A;  2E9X A;  2X51 A;  2WSS V;  2K5B B;  4ZI3 C;  5KDM C;  3U78 A;  5LJN A;  1D1B A;  2X68 A;  2V7L A;  2V7M A;  1NWM X;  4IE6 A;  3CQX C;  2CM0 A;  4ZS3 A;  2LM9 A;  1S94 A;  4UXN B;  3KDS E;  3C4X A;  3O1I A;  3T8O A;  2X66 A;  3MZK B;  5EK2 A;  1LKX A;  4E7Z A;  5LGT B;  3ETU A;  5LBQ B;  2PG8 A;  3FXE B;  3HL6 A;  4I4T E;  1UX5 A;  2HH7 A;  4UEL A;  2DNX A;  1WR6 A;  2GK9 A;  5LHG B;  3VKG A;  3LBX B;  4IE5 A;  1D0Z A;  1X79 A;  4FJO A;  3LFM A;  4ZI2 D;  3EUH A;  3LK3 B;  3PU8 A;  2MTQ A;  2LSG A;  5CA1 E;  3DTO A;  3K3O A;  4G63 A;  3J9X 1;  2CE7 A;  4GIW A;  3RC8 A;  4X1I E;  4CXX A;  1BR1 A;  3UUL A;  3EDV A;  5E0O A;  3ZPO A;  3QUJ A;  5ADX L;  2XAJ B;  5JDL A;  3ZN0 B;  4I50 E;  4UV9 B;  4IHJ E;  1D0X A;  2Y48 B;  2V1D B;  2NW9 A;  4N78 D;  4C91 A;  4UEM A;  3KV4 A;  3LG7 A;  2NP9 A;  2N2N A;  1S35 A;  2X0L B;  3HA4 A;  4C90 A;  5FXV A;  3L3P A;  4DO0 A;  2XAF B;  2E9X B;  1LVF A;  4ZS2 A;  2LSK A;  3UTK A;  5A1L A;  4UF0 B;  3N5L A;  1MIW A;  2H7O A;  3EDU A;  2ZLY A;  2KIN B;  5LNK A;  3PDY A;  3IBP A;  5DQW A;  5L3C B;  4DVD A;  5CA0 E;  3FBZ A;  4UVC B;  2XAQ B;  2A72 A;  4IST A;  1HFA A;  3NRY A;  4OHF A;  5LHI B;  4ADZ A;  5JDN A;  4UV8 B;  3RYC E;  2BVM A;  3ZJ2 A;  3MA9 A;  3SWH A;  4IE7 A;  1FEW A;  3JC6 C;  4GK0 E;  5LYJ E;  2CWO A;  3AA1 B;  2CCQ A;  2EHO C;  3ZCJ A;  4X20 E;  2XHE B;  3AAI A;  1HG5 A;  4P0B A;  5JR9 C;  5JDQ A;  5L3D B;  2V7I A;  2V7J A;  3CQC B;  4QKN A;  2N9D A;  3RKO A;  3ZYK A;  3F2E A;  4O2A E;  3UFE A;  3RYH E;  5KX5 E;  3I9W A;  2IW5 B;  2I59 A;  4L0R A;  4O4J E;  3QC9 A;  2CWY A;  4I55 E;  3ZC0 A;  2JJ9 A;  4TX5 A;  3C98 B;  4MFR A;  5HXE A;  4YJ2 E;  3PUS A;  2VKJ A;  2YIN A;  4TUY E;  4H9O C;  3GN5 A;  1VOM A;  3MK7 C;  4TV8 E;  1Y64 B;  4H9Q C;  2SPC A;  5JRE A;  4DND A;  2W0G A;  4CZZ B;  2KT9 A;  2JRK A;  5HXR A;  2MOZ A;  2VAS A;  4B6X A;  1HTJ F;  2YEV C;  4PW8 A;  5F8P A;  2HPL A;  3ZLI A;  1MMD A;  2YK0 A;  3J7Y q;  5J2U E;  3ANW A;  1UCU A;  4CI1 B;  3C4W A;  3CML A;  2BZB A;  5L2L A;  3CX7 B;  4PK4 A;  2CXD A;  1FIO A;  2H3R A;  4JEU B;  2PJQ A;  2Q9Q B;  2Y6X A;  5HXH A;  2XUE A;  3UUM A;  4O8S A;  4CI3 B;  2E9X D;  2W63 A;  3BK9 A;  3CKD A;  3E0Z A;  3KV5 A;  1LRZ A;  1IZN B;  2YU1 A;  4AKG A;  3HKD E;  2L8K A;  4EZ4 A;  3MKD A;  4YFS A;  2JQQ A;  4HN9 A;  3HKB E;  5L3G B;  1EZ3 A;  4WW0 A;  3SOL A;  2CEA A;  4IGU A;  3ONX A;  5IHY A;  3CX8 B;  3HI2 A;  2D0T A;  1CUN A;  2DWK A;  2ODV A;  2ES0 A;  3WAJ A;  2W00 A;  2NTX A;  3BQK A;  5H6R B;  4ERR A;  4HGA A;  5EZY E;  2LHR A;  1QUU A;  4IE4 A;  4O4L E;  4GYS A;  3BQL A;  4ZI3 D;  3ZMV B;  2P9B A;  5HAX A;  2MBG A;  3GMI A;  3VU7 H;  4PK6 A;  4H9P C;  5JDF A;  2ZM8 A;  3AAE B;  3NBX X;  3KBT A;  3UUN A;  5LJM A;  5BMV E;  3N9N A;  4EXT A;  5DJQ C;  2C5K T;  1H7C A;  4ANJ A;  4U74 A;  4EIW A;  3ZMU B;  1HG2 A;  2DLR A;  5AFU L;  5FNV E;  1D0Y A;  2VB6 A;  4DBQ A;  4HE8 A;  5LGN B;  4ZI2 C;  2LOP A;  2LOS A;  2CMR A;  4TN7 B;  3RRW A;  3O4X E;  5JQG E;  3DP7 A;  3ANW B;  4NUV A;  4Z8X A;  5L3F B;  1MIV A;  3P8C D;  3Q5W A;  5JRC B;  2CLY C;  2DCF A;  3PUG A;  4I43 B;  4F6R C;  1IAP A;  1YKH B;  5JVD E;  3A5X A;  3ZYL A;  3F57 A;  2J1D G;  2OA5 A;  4V1A v;  2LEH A;  1BR4 A;  2JMH A;  2LT3 A;  4K0U A;  4HKA A;  3W15 B;  3AVR A;  1MMN A;  3RYI E;  4WBN E;  1HCI A;  3ETV A;  5HYA A;  2WMO A;  1YKE B;  4DBR A;  3IEE A;  5LGU B;  4H9N C;  2X9X A;  4CXY A;  1MMA A;  5IYZ E;  2WWU A;  1VRB A;  3N9P A;  3I0O A;  3PUQ A;  3AAA B;  3AB3 B;  4ILU A;  5ETW A;  2K48 A;  4CI2 B;  2Q9Q D;  1KK7 A;  3O1H A;  3MAC A;  3U3I A;  4CQI A;  2ACX A;  2D5U A;  4HTE A;  3R6N A;  4EZH A;  1HS7 A;  3RH3 A;  2VKH A;  1NAF A;  2KXP B;  2C5J A;  2CA5 A;  2E8I A;  2KMF A;  5EK4 A;  2D0U A;  3RPU A;  5F3J A;  3TKL B;  5JDH A;  3CWZ B;  2DHR A;  4TZ4 C;  5LXT E;  1ZHC A;  1ZKE A;  3GA8 A;  4GYR A;  4QWN B;  3PUA A;  3FXD B;  4PJJ A;  4BJM A;  2NW8 A;  3RYF E;  5TAO A;  2CXL A;  3H3A A;  4MHC A;  3LK2 B;  2PFV A;  4FI5 A;  3WAK A;  2EHO A;  3KV6 A;  3AA0 B;  3N9L A;  4X1K E;  4OYJ A;  1IJ5 A;  4EB6 E;  3R84 B;  5JR9 A;  3CVR A;  4PK5 A;  3SRZ A;  5FMN A;  5FYM A;  2QGS A;  3K3Q C;  4ZOL E;  4U72 A;  3M65 A;  3RC3 A;  1U4Q A;  4QXB B;  2L9Q A;  1FMV A;  3B57 A;  4XZC A;  2Z6E A;  2X9W A;  4A56 A;  3ZEF B;  1SHZ C;  5JH7 E;  3OYZ A;  2WAU A;  4IDZ A;  2LSY A;  2XAS B;  3ZC1 A;  2CLY B;  4QXH B;  4UVB B;  2QA7 A;  5LG4 A;  3IHR A;  3Q9D A;  2VKO A;  1OWA A;  3C64 A;  3LBX A;  5H6Q B;  2XAH B;  2DWG A;  2XTL A;  4AKH A;  2KWI B;  2E9X C;  2LJL A;  2NOX A;  3H37 A;  3F31 A;  3PTR B;  5DAB A;  4WNK A;  5JDG A;  3E08 A;  4ASK A;  5EK3 A;  2UXN B;  1V9D A;  3B13 A;  4JEH B;  4EYY R;  3P7I A;  1YW0 A;  3I9Y A;  4H63 V;  5L3E B;  3LJC A;  1Z0P A;  2NWB A;  5KMG P;  3FBL A;  3HKE E;  2V26 A;  2B1E A;  2XAG B;  3KV9 A;  4HEA A;  4PJL A;  3UUX B;  2L3L A;  2XQY A;  1WLX A;  4YJ3 E;  4P0A A;  2KWH A;  3N2K E;  2LSJ A;  4PFP A;  4NUU A;  3ZMZ B;  4AXP A;  4EAH A;  2EHO B;  1OXZ A;  2LHN A;  2X9H A;  4UF0 A;  5CB4 E;  5FXW A;  3LK4 2;  5JR9 B;  3GN5 B;  3NZP A;  3O9X A;  2X67 A;  4BA9 A;  2NTY A;  3WI3 A;  3QK6 A;  2K9A A;  2BDE A;  4M1P A;  3VHL A;  3N9M A;  3GWH A;  1HX8 A;  2HPJ A;  2Y8D A;  2X9Y A;  4ISS A;  4PFO A;  3NZQ A;  4QXC B;  3SS1 A;  4E7S A;  4G2A A;  3ESL A;  1SA0 E;  5FP3 A;  2G0U A;  3CPZ A;  1B7T A;  1D1A A;  3KVA A;  3Q5X A;  5HXS A;  1WYC A;  2N1G A;  1BR2 A;  3C4Z A;  4DMV A;  3ZYM A;  3N9Q A;  3ZJ1 A;  3HR0 A;  5DQV A;  5HXC A;  4BJN A;  4EOZ B;  4J2C A;  2JMK A;  4P09 A;  4AQG A;  3IF8 B;  2DI4 A;  4PJN A;  3S4U A;  4KUM B;  3KFW X;  1HF8 A;  4PNI A;  4O4H E;  4X1Y E;  4AKR B;  4CXW A;  2MYS A;  3ZMT B;  2ODU A;  4PJM A;  4UIG A;  5J2T E;  3C51 A;  2IAK A;  1E1H B;  3N9O A;  4KMC A;  5LBM A;  3OJA A;  4AI6 A;  3N2G E;  4AQF C;  1MIY A;  3CX6 B;  1YD8 G;  4XBF B;  4XAX B;  1FMW A;  4QHO A;  4L9I A;  2Q9Q C;  4MLK A;  3D0T A;  2PBI A;  3K8P C;  1US7 B;  2KZ7 B;  3DJB A;  2C0S A;  4GK5 E;  5HWX A;  2M67 A;  1KNZ A;  5LA6 E;  5M4Y A;  2W61 A;  5GON E;  5C8Y E;  2NW7 A;  2UXX B;  1U5P A;  4O2B E;  2IC9 A;  3KVB A;  1IJ6 A;  2VWA A;  3E22 E;  2LE8 A;  3O1J A;  4AQF A;  2D2S A;  3KIN B;  4DMW A;  3I1A A;  3RRC A;  3OBV E;  4BAY B;  1ZEE A;  4GOU A;  2ZMA A;  2Q9Q A;  1T98 A;  4OYK A;  3ZCI A;  5FXZ A;  5JDM A;  3JC6 D;  5LCY A;  2EHO D;  3L09 A;  4H63 H;  4IE0 A;  3ZN1 B;  3OYX A;  1ZV4 X;  3HKC E;  4AKI A;  2BVL A;  4MAL A;  5L3B B;  3FHN A;  3V5U A;  1QSD A;  1WRD A;  3ZMS B;  3K3N A;  3FB2 A;  1UX4 A;  4UVA B;  5LOV E;  3MJX A;  3AVS A;  4KP3 C;  3PE0 A;  4MBQ A;  4JLE A;  2A3D A;  1WYB A;  2YU2 A;  1G73 A;  2WMN A;  4JUY A;  4L5G A;  3UT5 E;  4ZHQ E;  3I0Q A;  2RA1 A;  2ZM2 A;  3KBU A;  2KLQ A;  1O3X A;  3AA7 B;  4QX8 B;  3C50 A;  3CQG B;  3PU3 A;  4QX7 B;  2IC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...