1ZVHA

Crystal structure of the vhh domain d2-l24 in complex with hen egg white lysozyme
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
DVQLVESGGGSVQAGGSLRLSCAASGYIASINYLGWFRQAPGKEREGVAAVSPAGGTPYYADSVKGRFTVSLDNAENTVYLQMNSLKPEDTALYYCAAARQGWYIPLNSYGYNYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 30
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvhA00
1E4XH 2UVEA 2BVUA 3NCEB 5IBUB 3QUXD 4YPJA 4GO6B 5I19H 4OF3A 1G6RA 1QQDB 4U6XA 4R90L 3RKDC 3DBXB 5D5MA 4WI6A 1IAOB 5KANG 1D5XB 1JUFA 4Z7WE 2QEJA 2X7LB 3PABB 2HRLA 4RMSA 4LLYB 1E6JH 5JLZA 4MX7B 5K93A 1CD9B 3GSUB 4PRPB 2EXWC 4NKIH 2NY0D 1NCCL 1NMAH 3PGCB 3M17A 5J1TC 4FQ1L 1G7JB 5L8KB 2OTUA 3VFWB 3MRFA 3JUZA 3GSRB 2IGFL 1KTLB 3HNVL 4O2CB 2BCKB 4JHZA 1JV5A 2IADB 4KY1L 5TFSL 5ABDE 3WFDH 1U41A 3HCVA 2W91A 4QRSB 4NKDA 1FLRL 2OP4H 2F19H 4I77L 3CMOH 2SEBA 1XT5A 1N59B 1ZWIB 5FK9A 4XNUL 3IAGC 1AXSB 4K07A 4K7PY 1CVRA 3O6MH 1NBVL 4NZDA 2FNBA 1LK3H 3TT3L 5GHWH 4XBGA 4RA0C 5DGQA 2NY5H 1LEIA 3ARBD 2X4QA 2CDFA 5JIPA 2EDYA 4Z7VE 2AJVL 5HGAB 1WZKA 4K9EC 4L3ED 4JFEE 4J2XA 1RK1A 5A16B 1S7QB 3ZSTA 1YEIH 2WBJA 3FQTB 5ID0A 5ALCH 1YYML 2I24N 4RFEB 5GSVB 3QIWC 3ZO0A 3BN9D 4G80B 3C8KB 5DC9B 3HPJB 2WP3T 1AE6H 3BOVA 2Z31C 1CD1A 4HS6A 4UTBL 1EXUA 3VA6A 1JGVL 5IIEA 5IG7A 3O3DA 4I3SL 4P5TA 2WAHA 2HFTA 5EBMA 2DQDH 2BZDA 5DHVH 1T5WB 1N3NB 5ICXB 2CJUL 2DICA 1BOGA 1LNUA 4S2SB 3IFNH 4ZOAA 3OQ3B 4M7LT 5F88B 4NO3B 4XCCH 1IFHL 1KENH 3DYOA 1RUMH 4OKDA 4IHOA 1JYVA 3MLWH 3OR6B 5E1HB 3RAJH 1NANI 1JE6A 3DX9B 2PXYA 3PNWA 4TUOA 1P7HL 3NCJH 3UMTA 5IM7B 4OCLC 5FGCB 2E9WA 1C08B 3QDMD 2CRYA 3NIDE 4HH9A 4JFYA 3D85D 5I30L 2J2ZA 3TPUB 4JHAH 3HA0A 1TJHL 1KTDA 3KNBB 4FQLH 1UQSA 5HGHA 4YFLI 2CKNA 2K1MA 4N0YH 5TDNA 1T5XA 5I74C 2NXZB 2X4SB 3HRZB 3KAAA 1N6QL 4XMKL 2FECL 1Q9OA 4P9HC 1O0VA 4FMFA 4R8WH 1OQXA 1Q0XL 3HB3D 4E41A 3HR5A 3LEVH 2CLVA 2XZQL 1HH9A 4ZO6A 2OXGA 1NANH 5MP6H 4JDVA 2IMMA 2BVOA 1W72H 5E94B 4PRIA 3RP1A 1DVFB 3KPPA 1OAXH 2HG5B 1HSBB 3CXDH 3ULUH 1I9RH 1M6OA 5C0CA 2VLME 2QTEA 1P7KA 2NY1C 5BOZG 1K5NB 5EU5B 3V6OE 1S5HB 5F89A 2B5IB 3KLHC 1XH3B 4J3SA 3U36B 5CEYA 4D2NA 4XC1H 5B38A 2B0SL 1U8PB 5C0AE 1YECH 1V7ML 3S36L 3QNZA 1QVOA 3MJ9L 5E1AB 4QRPB 4NP4L 1Y18B 4NOFA 2AJUL 4JFXB 4EN3D 4NCDA 2DDQH 3CMGA 5GSRA 3LIZL 3OKDB 4OTXL 4E5XA 1CTNA 1IAKA 2XNAA 4OCMC 3P9MA 3VXMD 3VI4F 1VFOA 1KOAA 1MREH 1J8HE 3QFDA 4HCRA 4GMSL 5EOCH 1CU4H 4KRLB 4OKVA 3L3IB 4OUOA 4FFZH 5ESVA 3BH9B 5L2JB 3NOIA 4J7RA 4TOYL 1I1YB 4GRWF 4Z8FH 3DYPA 5DVMA 2IANA 2LAAA 4C56D 3DRTA 2IC2A 4O51B 3OKMB 4NGHH 2XG4A 4POZC 1DJSA 3LKQB 4Q0XL 4WJ5B 5IB1A 3VD5A 1BFVL 4LKXA 4BQ6A 1LK2A 5D1ZA 2NYYC 2VLRA 1AGBB 5IEHB 4AH2B 3FO0L 3BWUC 5H37H 5EOTB 3RL2A 4V1DE 4HWBL 4CVZB 4NHUB 5C0BB 2CR3A 1XGPB 3MXVH 1E6OH 3FTGB 3WXWH 1F4XL 2CIKA 5I15H 4K3DL 4LRNH 4IDJL 4HIJB 3VDAA 3HC3L 3C5ZD 3ETBF 1K6QL 1XF5A 4YGAB 4U05A 4WGWB 2B4CC 4BFGA 3PJSA 3CDFA 3OJ2C 3GKZA 2P8PA 4AL8H 1Q72H 5T5NG 5ADPH 2GJ6E 4NM8L 5IB3A 5EOQH 5A2LH 4ZTPL 5CBAA 5I8OL 2AEIT 4WUKH 12E8L 5E2TL 3O4LA 3T2PA 4U1NB 1JWMB 2Y72A 4PJ9D 5DMYA 1MCQA 2NXZC 2EE2A 4GKSB 4LLUA 1NL0L 4QF1B 1TVHB 4X4MA 4AEHH 3VD9A 5I73B 4YWGL 5HYSG 1KN4H 1R5IB 4P59L 3SQOL 3D25B 3AB0B 4IMLB 4JY6B 4U1SA 3S88H 2Y4SA 1IRAY 1ZV5A 1RUKL 1HEZA 1A3QA 1DVFC 2VAJA 3L5IA 1F97A 4X7EC 3FRUA 1FBIH 5DJ8A 5EA0L 1S9XA 2GSIA 4JZNB 3T0EB 5CIPA 2B5IC 1FYHB 1AQKH 4EBQH 1BQHB 1A5FL 1FFOA 1RZJH 3FT3B 5T1KD 5GRYA 1DL7L 2AKRA 3WIHH 1UGNA 3T8XA 3GRWA 2NY3D 3CPLB 4M00A 1A14H 3V5HA 3ARFA 4XZUB 1Q9WA 1MI5A 3EO0B 3BGFB 3OSKA 4OZGA 4ERSH 2HWZH 3VGFA 4PJ5D 2QR0B 4Y4HB 1TDQA 2XI9A 3FOLA 2FO1A 2B8OT 3NZHL 5IR1B 4M4PA 3GSOA 4CVUA 3EYVA 1VACA 1C7SA 2DQGL 4HXBL 1MJ8L 1MLBA 2EXWD 1G7MB 3MMEA 3BZDA 1B4RA 1BVKA 4F58L 1XF1A 3OGOE 1Q1JH 1G0XA 1F58H 1XGYH 1IEAA 5MEPA 4QXGL 3GMQB 3E3QC 1WISA 1ZLUH 3WKML 1WAAA 5D7JD 4M6MH 4YBLB 3V4UH 5D6CA 1Z5LA 3B2VL 2FZ3B 3TVMB 4S10A 1AO7E 4LNRA 3PWLA 5IESH 3G6JE 1MY5A 4OQTL 3HC4L 2FEDC 1XGQB 4L4TE 1NLDH 4ENEC 4JFDB 5SX4I 4M1GL 4Q6IC 4X4XB 1RULH 4Z95L 3SBWA 3GBNL 3H9YA 5FGBC 2FX9H 3MODH 1DLHB 3QNYB 3KYMB 4AYFA 4UV4H 3GMNB 5IBLD 5JOFB 4GW5B 1MCEA 3M07A 3QO1B 4AG4L 4YC2B 4FXGB 3S3PA 4JM2B 2KZ1B 2ADIB 2Q1EA 4EIGB 4KJWC 4KC3B 4MGXA 4UINL 4KVNL 3R8BB 1A7RL 4MQ7B 4X9GA 3W39B 5ALBL 3MRGA 3DTXA 4HC1L 3QIWD 2ITCB 4Y2DB 2VDOH 4NQTA 3BEWA 3HAEA 1CBVL 2HVKB 5HD8C 4DN4H 3G5ZB 1DQDL 3B9VA 1CZ8L 1C1EL 1F5WA 5LBSL 3AGVA 1FNSL 4XH2B 4TNVK 2OTWB 3T0VA 3LDBB 1KB5L 4ZOEA 4OLVL 3RY5A 3FKUS 3SGJC 3MX0A 1I1FB 4HUUB 3TBWA 4TNWF 3FT2B 1BQLH 4S0TD 4G6AC 3S37L 5CUSH 5ENWA 2XPGB 3SDCC 2XG5A 5AEAA 5I73C 2ZG1A 5MEQA 1RUQH 5MHSE 3AB0C 1SEQH 4FOMA 6FABH 4P3DA 3SJVD 1I7TA 4GW4A 1LP9E 1RZFH 1UB5B 3MLUH 4JJ5A 3QCVL 1U3HB 4LCUB 4MB3A 5IWLC 4K9EH 2Z92A 1O7SA 2HRPH 4JKMA 3VXRE 4RBPH 5GGUB 3ULVL 3DV6A 3U79A 3UTSE 3T77A 3DO7B 3RVVC 3NCFB 5L6YL 1NBQA 3MLVH 4AK1A 2EEBA 2MQ3A 2GJZA 1Q0YL 1IGMH 3FB5B 3RDTA 3BGFC 5FYKU 4RGMB 3BEVA 3VXME 1AXTH 4Y4KD 3SO3B 3VMPA 3G5XA 1K8DB 1H15B 2PTTA 3U0WH 1FO0L 1CXIA 3PL6A 3BPCB 5TF1L 3QQ3A 1FNEA 4AEFA 5KVEL 3KJ6H 1ADQH 1R5VB 5KVMC 3IU3B 1MFCH 5IFHL 2VXVH 4LLVA 4GG6B 5KVFH 2AXGB 2NY1D 2NZ9C 5EBWA 4F9LA 3GJFB 1NGYA 2BMKA 3MLYH 2QSQA 1HSAB 3GIVB 4HK0B 4NC1C 3C60D 1P5VA 3P0YH 2VWEC 3O3BB 3QXTA 2AABL 4Y4FB 4NRZB 5FYKD 4IRZH 1MJJB 4YBLC 4YHPA 1ZHLA 3TVMC 1P4BH 1U3YA 2P5WB 3S6CA 2XRAL 1VGKA 3VFNB 1YN7B 2ZOLB 1A47A 2BSRA 2WM0A 3FQRA 3KPRA 2VLJB 3GI8L 3ZTNH 1S7XA 4Q9QL 3Q2CA 3B9DA 2MKWA 3PWNA 2QHRH 4Y19A 5ISZB 4X80L 5E8NA 4HUXA 2MMXA 2OTPA 1JNJA 5FKPB 2PYFB 2DLFL 4OAWA 4P9HH 2CMRH 2NQCA 3C5JA 3EHBD 4IM8A 4OFYA 1GAFL 4JM2C 5BMFL 4K8RC 4WFEE 3FN9A 4H20H 2FB4H 1G6RB 3P11H 3QEQA 2Q76B 4U6XB 5J1AA 3WNPA 4JVUA 3CFIC 3PGFL 1EBAA 4ZNCD 5D5MB 1JUFB 4NQVA 4POZD 4I48A 3OAYK 1X5GA 5JLZB 3G6DL 2I5YH 2FX8L 4DGVH 4YQXL 4Y2DC 2VKXA 4OCXL 4WFGE 5GXBB 2L0DA 4K94H 4PJGE 3IS0X 1IAII 3M17B 4H25A 4XNQA 8FABA 3FAXA 3SDXE 2NYYD 1VEPA 1DBML 2OTUB 2H8PA 1P4IH 3LDBC 3MRFB 1U42A 2E7HA 1IARB 5F96H 1JV5B 5EIIA 4L4JA 5C70A 3T3MF 3HCVB 4LU5L 3MXWH 5K33A 4NKDB 2H2SC 1DUYA 4PJFE 1MCSA 1NKOA 3LH2L 2A77H 4KAQH 4JEGB 2SEBB 1I1CA 4PS4L 2XTJB 5FK9B 1C7TA 4JKPH 3ZL4L 1F11A 2OBGA 4K23H 1G9NC 2ZUYA 5CBEA 4C4KO 3NTCL 5E2JA 5IW6A 1DLFL 1IAIH 1U3HC 4KPHH 4XBGB 5B4MC 2QQKH 1LEIB 3X3GL 3WD5H 3HFML 2HLAA 2X4QB 2CDFB 1KSRA 2LQRA 3V6FA 1PG7X 5I17B 1IKFH 4GBXD 2H1PL 5JO5A 5K9OA 1I8LC 1EAPA 2VDLL 2AV1A 3SDDD 1RK1B 3QXVA 4N9OB 1O7VA 2DKUA 3ZDXF 3UJTH 2WBJB 4RGMC 4XXCA 5EU3B 5ID0B 4LSTL 3SO3C 5C6TL 4FQ2L 1ZXQA 4UDUA 4EDXA 1Y6NR 4YBQD 1CD1B 3BKJH 2OZ4A 4HS6B 1SY6H 5JIHA 2AS5M 4FTVD 5IIEB 5IG7B 3HE7D 4JRXA 3SKJH 3O3DB 5L2KE 3ARDD 4Z0XA 4P5TB 3JUYA 3I02A 3CVIH 5EBMB 4NQED 5F7YC 5I1KH 3MRCA 1QUNA 3WYRA 5D72H 2BFVH 1GJIA 3I75A 1BOGB 1LNUB 1RMFL 1Q9LA 1T7WA 5L9DL 3OB0K 4FN0A 2B4CH 1P84K 1RJLA 2ICES 4PP1C 3LPFA 4AJ0A 1NAKL 2KBGA 3DXAD 5I18L 4XI5C 4Y4FC 3VA2C 2YD1A 1GGTA 2CGRL 4HEPG 5MEND 5TQ0H 4HT1H 4IHOB 3ISWA 4MQXD 2ESVD 1JTOA 2PXYB 3PNWB 4TUOB 1PZUB 5EH1A 2WBWB 5HY9A 4I0PD 4HH9B 1BECA 5BV7B 5T3ZD 3Q0HA 2FBOJ 1KTDB 1UQSB 5JW4R 2ZUSA 2ZJSH 5HGHB 5C6WH 5TDNB 1T5XB 2Y36L 4H26A 4YPGA 1GZPA 3VD3A 3IGAA 3QISA 2C1OA 1Q9OB 4U6TA 5AYQA 1B9ZA 4E41B 4O58L 3HR5B 2CLVB 3UJJH 3VMNA 3P4LA 5L7XL 3WFEH 3QCTH 1FPTH 4MA8H 2KPNA 4JDVB 2ORBH 1KGCD 2FGWL 4PRIB 5JR1L 4MA7H 3KPPB 3FO2A 3MV9D 3N06B 1M6OB 5C0CB 4GKNA 4XNYL 3IFLH 2PUQT 1P7KB 3TC9A 5GS2H 3RHWK 1AR2A 1OAZL 5F89B 1RU9L 1I9JL 1EMTL 5C0DA 5B38B 4HULB 3R06B 1UFUA 1KELL 5DRZA 1QVOB 1TTFA 2PTUA 3W9DA 4GJTB 2AQ2A 4PBWD 5T33H 1RY7B 2X1OA 3SJVE 4FZ8H 1RI8A 2NMSA 2R69L 5GSRB 5BZWB 3UCRA 5I2IA 5KAQF 4E5XB 1IAKB 2XNAB 3P9MB 1A3LH 5D71H 2XTJC 3TO4D 1X5IA 1G7IA 1FAIH 4DGIL 4OF8A 2YWYA 4XAWL 1AR1C 3QFDB 1LVEA 1UM4H 5C0NC 1HCFX 1ZGLM 4KI5F 5F70A 4WU7A 3MLRL 4OKVB 4ZDHA 3QQNA 4F57L 3O0RL 5ESVB 4HJJH 1ITBB 3S8WA 2Z4QA 3NIFE 3FQUA 4UI2A 2K7QA 2JIXA 2UZXB 3IFOA 3UPAA 1J10A 3DRTB 5LCVH 3SDCD 3DMMA 3HNTH 4K2UL 2WBJC 2O5YL 5I1EL 2OL3A 5IB1B 3QULA 1V05A 2Q3ZA 4PP2A 4LGRB 3SGDI 4MDIA 3UTOA 4NFBA 4LKXB 3EUUA 1C16A 1LK2B 3D2UD 5D1ZB 3U0PA 2NX5A 2VLRB 1QRKA 4LVHB 1L0XA 1CGXA 4OF5A 5DFVD 4EUPA 4NN7B 3RL2B 2QADB 1PDKA 5JIIA 1IC5H 1CQYA 4ZAKC 3ESUF 2NY2B 1U36A 2GAZA 3U82B 1P2CB 3RU8L 5AD0A 1Z3GH 5I16B 1XF5B 3GMMA 4Z78A 4NNPL 2BK8A 1CICA 4DCQA 3SGDH 2P8PB 5LAXA 1IM3A 5SWZA 5IB3B 5BV7C 5CBAB 5DUBA 2FHFA 3IJYA 1NCUA 5JHDB 3O4LB 2NZ9D 2XN9A 3MNZA 2P43B 5GRUH 1UM6H 1JBJA 2NTSP 1BGXH 1TNNA 2HFGH 5LQBH 4LLUB 3UYPA 1OB1A 4AIZB 3PP3H 4RDQF 3LS4H 3QDHA 3STBA 2AJSL 3E2HB 2ZCHH 4JLRA 4U1SB 4F7EA 3MRNA 3P30H 4YHNA 1HEZB 3EFDL 4UNUA 1JF1A 1X5LA 5CLWA 1HKLH 4D9LL 1BBDH 1OTUD 3FRUB 2BNRA 1OPGH 5DMGC 2LE9A 1TJGL 1INDL 1S9XB 4Y0GA 2DQCH 2BY1A 5CIPB 5CMAA 2E27L 1FFOB 2AKRB 4LGPB 5FO8A 3T8XB 3V5HB 3ARFB 2DN7A 2F58L 3BISA 5ACMA 1Q9WB 3RX8A 1MI5B 1BF2A 4UT7H 4DZ8A 4OZGB 4JFFD 5I8KL 1DN2A 3MLZL 3S36X 3FOLB 2P48B 1X5FA 5GRJL 3UDWA 2E9BA 1BWWA 4LF3A 4P23D 5AZEL 4RWYL 3GSOB 1IAMA 2ADFH 2PW1A 3EYVB 4MAUL 1VACB 4Y2DD 5HHQA 4JPIA 1OP5K 4JREB 4KDTA 2EDXA 1MLBB 4FQXA 3TCXA 1EHLL 3MMEB 1BVKB 4GSDH 5IUSA 5FA4A 1IEAB 5MEPB 4IOSD 1QKZH 3CX2A 2AGJL 3DX6B 1AGCA 4RGND 4KRPD 1KEGH 1OTSD 5D6CB 1Z5LB 5DYOA 1TZGL 3LEXB 1ZA6A 3WUWG 5GISH 4LNRB 4GMTH 4PGEA 3PWLB 3FOMA 4RRPA 3V2AR 1RQ5A 5JTWA 4FTVE 1X4ZA 4XPGH 3O8XD 4CAGA 5DJ2A 1MFDL 3H8NA 4NQEE 1NUFA 3GK8L 1X5ZA 5GGTA 2PO6A 5D1ZC 4LVHC 2ZCKH 3NCYS 1F3DH 4K8RH 3ZHLA 2VC2L 4NN7C 2A2QT 1N5AA 5TQ2H 4JJHA 5B4MD 4OGXL 3DXAE 1FNHA 1B6UA 4QRPE 2I25N 5EDXA 2JB6A 1CI5A 3S34H 4DKFL 5KS9A 3QUYC 3CFBA 2ESVE 2DI9A 2AAVA 3O2DH 1BOYA 4XP5L 2Q86A 3TFKC 5CEZD 3MRGB 2A9ML 3DTXB 3MSPA 4LAQL 3KVQA 3HG1D 4TRPL 3FT4A 3BEWB 4XCNA 1EJOL 4P2RA 2GI7A 4JGUA 1T89A 5KZCD 3KJ4C 5IB5A 3QH3A 1A3RH 4W70A 3E3QE 2J6EH 3QEGH 3RIAK 3PQYD 3MV7B 4OCWH 3TBWB 2H32A 3FN0L 3M1BB 5ENWB 5C2BL 4PP1D 5DRXB 4BUGA 4X5LA 5T5FL 1KGCE 5CJBA 3TJHC 1QBLH 5MEQB 1L7IL 1P7QD 3MJ9A 3NCMA 4JG1L 1IGTA 4GQPH 3V4VL 3R8QA 4M1DH 3MV9E 1IKNA 3KR3L 1W8NA 1AI1L 1DE4A 2VLKD 1I7TB 4GW4B 3WEXA 4PV8A 1N2RA 3OX8A 4DGYL 4HS3A 5I1HH 4JJ5B 4QY8A 2DQIH 2YA1A 2W9LA 4U7MA 3EOAA 2Z92B 5FYJL 3OKLB 5C0BE 3DV6B 4YXHH 3T77B 3DWTA 1WZMA 4FP8H 3MUZ1 4G8FA 1FQ9C 1QA9A 1NFDA 2H26A 2Y7QA 3QWOA 3ARFC 2CRZA 3RDTB 4DVRL 3BEVB 4OB5H 4CN1A 1HILA 3LMJL 1CGTA 4ELME 2X41A 3G5XB 5DUPH 2PTTB 3PL6B 2YOCA 4JY5H 3GJFH 3QQ3B 1FNEB 1YNLL 2BDNH 5D1XA 3VGGA 4JREC 4NZUL 1YC7A 4LLVB 1R3HA 2H3NA 2KL6A 5EBWB 2GHWB 4HQQH 4LSDA 1NGYB 2BMKB 5KOMC 4GAJH 4M1CD 2IEPA 2FO4A 2NCMA 4FFVD 1T83A 4D3CH 4OGAC 5IHLB 1G6VK 3LS5H 5AG8A 4P5KA 1I3VA 4GAFB 4YHPB 1ZHLB 3I6KA 3GNML 4FRWA 3OKYA 1VGKB 1I7ZA 1UH2A 4R97B 1HYSC 3ZTJG 2BSRB 4CN4A 5JDJA 3KPRB 3FQRB 3C08H 1S7XB 3SBWC 3TNNA 5HBBA 2WWMD 1LD9A 3PWNB 4Y19B 3DSNA 1ZTXL 5E8NB 1U0QA 1EO7A 4HUXB 5GGVY 2DQFB 5DT1L 1CK0H 3C5JB 4IJ3C 4KGJA 1G6RH 4J1UA 3ZYJA 4K3HA 4P3CH 3RJDA 2Y25A 5F6HI 4AM0A 4QHKJ 5E5MA 3CLEH 3D69A 3QEQB 5J1AB 2YD9A 5CZVL 1OSZA 4JFOB 4NQVB 1ZVYA 4OFIA 1MHHA 2QQLH 1S9KC 1CG9A 5I75C 4PLJC 1EEQA 3LKNA 1YQ2A 3BO8A 3L5XH 3STZA 5I1DA 2F54A 1MLCA 3U1SL 5EUOA 4H25B 8FABB 1KUMA 4XNQB 4Y8DC 1UG9A 2DS4A 2OLDA 2V2XA 1T03L 1DSFH 2H8PB 3MRJA 4JPKH 4NC1E 2KKQA 5E56A 3UAJC 1JWUB 3NACH 4FHBD 4TNVF 2DWDB 3EOTH 2KDGA 4LARL 2VWEE 4JFHD 5EIIB 1UB6A 1X7QA 3X3FL 4ZAKD 2EH8L 3JBG7 4JQIL 5HDQL 4YDJA 3DHJA 3VFUA 4HWEH 1DUYB 2V2WA 4R4ND 4MNQD 1J1PL 1N64H 3DVNA 1PLGL 3ZE2F 4JFDE 4XP4H 4QO1A 3S37X 4AMKL 2G2RA 1F11B 4YXLL 3E8UL 1OAQH 3T4YA 5CBEB 4WCYL 1NGXA 5IW6B 1FGVH 4FFYH 1BM3L 3MYJA 5E4IA 4M5ZL 3T1WA 3NN8A 5F7MC 1QFUH 3CGTA 2YSSA 2HLAB 5HDBF 3V6BR 3V6FB 3JV5A 4LHUD 1KJ2L 5JO5B 5K9OB 1TETH 4KZDL 1EAPB 2R0KH 2AV1B 3DSFH 4O02H 3RDTC 3BPNB 3W2DL 3H3PH 1MPAL 2LTQB 2ZKHH 5FYLD 1KJMA 3EOBB 1KJVA 4PUBL 1EK3A 1ZLSL 4HSQA 1NUNB 4UDUB 4EDXB 4QTIH 1FE8H 3PL6C 3NABL 4A2MA 2V7HA 4HZLA 3VI3F 4OQTA 1R3IH 5T1DH 2A6IA 3S3SA 4JRXB 3STLA 4R26L 3FFDA 4Z0XB 1FZJA 2HN7A 2R0LL 1N26A 3I02B 4OQ1A 4KZEH 1GGYA 3MRCB 4JDZA 4OT1H 5HPOA 2EDRA 2FX7H 3I75B 3KYKH 3Q6FA 1KCSH 4NO2A 1F6FB 3QHZL 5B39G 4I13B 3F7RA 4OM1H 3VD7A 1Q9LB 1PX4A 4JO1L 4N68A 1RJLB 2GTWA 4PB0L 3EGSA 3VRLF 1PKQA 1YPZA 3T2OA 1YUHA 3GJEA 2NXYD 1NUGA 3LB6D 5EOCJ 5BV7H 2P24A 2GY5A 3MNVA 1JPSH 4B7LA 5JW4Q 3TV3H 4R97C 3DVGA 1T66D 1NFDF 5EC2A 1I8KA 1V7NH 1QSVA 5HY9B 4KKBD 3UYOD 1ES0A 4HC1A 1DN0A 4WU5A 3ZZ1A 3FQXA 3DYMA 2UYLA 4FZEH 4H26B 3RTQA 4YPGB 1GZPB 2WK2A 4D9QE 3IGAB 4C58B 3TWCL 2C1OB 1KB5A 4JFZH 2HTKD 1CD8A 1YDPA 1NEZB 4YXKH 2IAND 5IQ7L 5CEZE 3CVHL 4KI5C 1NCBH 3I50L 2V5YA 2K9UA 5EUKA 3FO2B 3V7AG 1HNGA 1M05A 1X3DA 3DJ9A 4GKNB 1ZK9A 4GG6E 3L5WA 4Q9RL 3WFCH 3O11A 3Q6GH 4XPAH 5C0DB 1OVZA 5T3XL 1Q9KA 3F7YA 3UTTA 2R0ZH 1MEXH 2V5MA 3VWJD 2X4OA 3L3OA 3W9DB 5ID1A 2XYCA 3TJEL 4QGYA 5HSFA 5DD5H 3QUYD 4TSAH 1DQTA 2P5WE 1VENA 2VLKE 2IWGA 3C09B 1KCVH 3LD8B 3N1QC 5I2IB 4G8GA 1WEJH 5JQ6L 1MSPA 1QLRA 2DQUH 2PF6A 3L3GA 3CUPA 3WV0A 3TFKD 1G7IB 2VLJE 4KDVA 4KMTL 4HS8H 3O3AA 4EQ3A 5ISZE 1IGYA 4DVBA 2EDNA 4WU7B 4ZDHB 5JOPD 1RIVL 1E28A 5C07D 2Z4QB 3GMPA 4OZFA 3VI4E 3FQUB 4WEUD 2JIXB 5C09D 4PJEA 3IFOB 1B2WL 5EUOF 4TULL 4XVJL 3S98A 3BPNC 4XTRD 3DMMB 5D5ME 2LTQC 2W0LA 1JZ8A 4XXCC 1SEBA 5E08L 4PJBF 3NCCB 3AC0A 2OL3B 3AREA 1IC4L 4M7JH 2XWBB 1UA6H 3QULB 4OSUH 4U31A 4GRWE 4PP2B 2Z0BA 4MDIB 4YAQA 3MUHL 1K2DA 1CE1L 2CDEB 1C16B 2ZUQB 3K7UA 3U0PB 5IKCA 2NX5B 4PTUB 4JO3L 5FHBH 1U8IA 3GIZH 4EUPB 3GHEH 4J6RH 4EEEA 2JCCF 5E99L 3P9LA 1JYNA 3VDCA 1CFNA 3K4DA 4MD4A 5DEZA 2GAZB 1QFWI 5AD0B 3HZMA 5IMOA 4X0KA 3GMMB 4W68A 4Z78B 1MCPL 2XTJE 1MHEA 1MJ7L 1CICB 2FD6L 4DCQB 1TITA 4GOSA 5E8OA 4LPTA 2GK2A 3TH4T 1NCAL 3MOQA 5LAXB 1IM3B 3CAFA 5LGHL 1YY9C 5DWUH 5SWZB 5I1CL 5DUBB 1MFEL 3AROA 1DEDA 2XV6B 3IJYB 2IH1A 2VDPH 2KQMA 4MQTB 3RWCA 5EO9A 2YMXL 2XN9B 3MNZB 1BQSA 4R3SA 4RIRA 1RJYA 1HKFA 5DMIL 5GGRA 1QFWH 2YBRA 3QHFL 4DK6A 1BP3B 4OGAD 2YD4A 4RAUA 5C92A 4JLRB 2DOCA 1HINL 1GGIL 3LN4A 3MRNB 4PGCA 2VZOA 4YHNB 4KHXL 2Q8BH 5FAAA 1JF1B 4ZTOH 4P3WA 5CIPH 2QHLA 3L6FA 5GRWA 4X6BA 2BNRB 4K3EH 1YPZF 5HYSA 2Y07L 1MVFA 3GRWH 1S7RA 3CFDA 3IRZA 4QXUH 4M7LL 3RHWF 4LOUC 5JW3H 5FO8B 2F53D 4JHWL 1F4HA 4KK6D 5C9JA 3F58H 1I1AD 3I2CH 4HXAH 1YEKH 3WLWD 3FB8A 4HMDA 1ZLUK 2V5TA 4MHHG 3QUKA 3C09C 3LD8C 3TYGL 2VL4A 3FZUD 4MZ2A 4LF3B 3THML 4KVCH 4HWZA 2A0LD 2PW1B 4KK8C 5HHQB 4JPIB 2ZPKL 3MCLL 5HHOA 1FZMA 1MOEA 4ZSOA 4FQXB 4M7KH 2DD8H 2J7LA 3BD5A 1VERA 1JVKA 5FA4B 5JUEH 2YKLH 2OR8A 3DV4A 3BT2L 2D0HA 4KK5C 1RVFH 1KLGA 1GCFA 1AGCB 3DPBA 4I3RL 6CGTA 4E41E 4XVTL 3QPQC 2W60A 5J11B 1ZA6B 1H0DA 3DMMC 3GZKA 4PGEB 3FOMB 4AQ1B 4PRIE 3GSXA 2AQ1A 5C0CE 5E5RB 4JDTH 4LLMA 2FR4A 5DJ2B 1H9VA 3SDYL 4WUUA 5DF0A 2ED8A 2ZUTA 2PO6B 2W9EH 1A2YA 4P2CG 2B2XL 2XA8H 4YHKL 3JWDL 4PRHA 3BP5B 4OFDA 3RNQA 1N5AB 1GIGH 3QCUL 3KDMA 3HI5L 1R5WB 1EHNA 2ED9A 2JB6B 2AJXH 5KS9B 3GSNA 3CFBB 1EIBA 3KLDA 4Q9BA 1NLBL 1X44A 1YJDL 3W0WD 3T09A 1ZGLP 1KULA 2Q86B 2FATL 3VXNA 5IGXL 1CICC 4PJEF 3PE9A 4LSRH 3FT4B 4XCNB 4XVUC 2D03L 43C9A 4P2RB 5IT2L 1UWGL 1KC5L 2P42B 1BQUA 3QH3B 4DTGH 4U1MA 4LEXH 2NW3A 1A7BA 1OGAB 2PW2A 1JZ2A 1NCNA 3KPOB 1T6WA 2BNQA 2IANE 3KXFB 1EEZA 4NM4L 3O9WA 2H32B 2PKDA 4Z76A 4M62L 3H9SA 3WUZA 3QDAA 4KTEL 1IGTB 2HLFC 3QJFA 5DFWH 5DQDL 5FCSH 4JZOB 3QZWG 1UEMA 1DE4B 1DBAH 4Z7UA 3WEXB 2N4IA 4LKCA 4PV8B 1N2RB 3F12B 3OX8B 4HS3B 4OZIA 4Z7WF 5EU4A 1VADA 2VLRE 1CDUA 3H7BA 3ME0A 4QY8B 4WFHE 3U4BL 4P5MA 4WY7L 5E2UL 3EOAB 5HHXH 2QSTA 3ELAT 1TLKA 5F3HA 5HI3C 2X09A 4MZ3A 1KFAH 4LP4A 4XNMA 3QR2A 2VN4A 4G8FB 2Y7QB 1QA9B 1EUTA 1NFDB 2H26B 3QWOB 4UV7H 3RVXD 4U1JA 4N8VA 1I8MA 5EB9A 1N0LA 5JXED 2A9NL 1QSED 5B3NA 3RBGA 3C2AH 3AU1A 1HILB 5TE6L 1G7QA 2IFGA 2R4SL 4P2OD 4KKLD 2HTLC 1OLZA 5BO1L 2UWEA 1RJZA 1YEHL 3UDWC 5HYEA 2X2YA 3L3KA 5JOPE 4QWWD 2CLRA 5D1XB 3CZJA 5C3LD 4KDTC 5C07E 1R3HB 2H3NB 4FQXC 4OLXH 2FEEI 3PHQA 3O4LE 4PJHA 4XMLH 3WO3B 4FQIL 1MRFH 4TSBH 4AIOA 1MUJA 2FO4B 3K4AA 3DX8A 2BOCA 4X4ME 3SGKA 2B39A 32C2A 5D7KD 1U2CA 4Z7VF 2R1XA 1S8DA 1AJ7L 4NBZB 2VDRH 4P5KB 1JMZA 2OQJB 2CKBL 5GJSH 5J11C 3I6KB 4WHYH 4NKQB 2DJSA 1LE5A 1I7ZB 5AZ2L 2BJMH 5B21A 3G6AA 2AK1H 2V9QA 5K9JL 1IT9H 3OG4B 2F74A 2YPKA 1RZGA 1U3JA 3TNNB 2DWEA 1LD9B 2PO6C 3GSVA 2IBZX 4ACPA 2D7TL 1F3RB 4JR9H 3BFOA 1MHPH 4KHTH 35C8L 15C8L 4J1UB 3K74B 4L9DA 2FDBP 4L4VD 4X4ZA 4XCFH 4AM0B 4K55A 2FHCA 1MI5E 4OZ4A 1FIGH 5E5MB 5FV1L 4OZGE 4XB7A 3RGHA 3D69B 4JO2L 1PSKH 1OSZB 4Z18A 2GFBA 1IL1A 2XACC 4FMKA 4M61A 1MHHB 3PHOA 4M6NH 2J8UA 5EU6D 1CG9B 3LKNB 3BO8B 1N6UA 3STZB 5I1DB 2F54B 1MLCB 1T89C 5EUOB 5J4MA 2PN5A 3CU1A 4UDTA 5IMKA 5F1SA 1ZEAL 3BDYH 4LPWA 1CLOH 3MRJB 3MO1A 4MB5A 3CC5A 3ZE0F 5E70A 1UB6B 4M3JA 3SPVA 4F7PA 1WAAE 1U8HA 2Y23A 3RIAF 4OI8A 4HIXH 1CLZH 4U1IA 3D3VD 4YDJB 5J6HB 3VFUB 5ADOL 2V2WB 1MJUL 1DQJB 3OXRA 1QNZH 5CSGA 1CL7I 1IC7H 1QSFA 3DVNB 5F9DC 1RIHL 1IKNC 2IG2L 2G2RB 4MD0A 3KPSD 1SYSA 1U93A 3T4YB 3T3ME 2P5ED 1NGXB 5JHLH 1E0OB 2D7MA 3M8OH 1HHIA 5EO1A 3ZHKA 3MYJB 5FB8A 4OLUH 2VZSA 3NN8B 3RVWD 3UYRH 2XZCH 2YSSB 4E0RB 3JWOH 2VZVA 5AWNH 4HK3N 3MACL 2YPVH 4RMWA 1MAMH 3D9AL 5F7WC 4O9HL 2C4XA 3GM8A 2OZ4H 1MCRA 1KJMB 1IMHC 5HYJA 3EO1A 3OGCA 5CILH 1KJVB 3QIBD 1X5XA 4WHDA 1T7VA 2YD8A 2QQQA 2V7HB 2WP3O 4XBEH 2A6IB 2ENSA 3STLB 4XWGH 1X5HA 3QXUA 5D1XC 3ZDXE 3FFDB 4PJDA 1FZJB 2HN7B 1PQZA 2E7LA 3L7EA 1QACA 1S7SA 2JJTA 4JDZB 1VKXA 5DO2D 2DLGA 3JTTA 3Q6FB 4NO2B 5SWSD 1A6ZA 1FHGA 2EYTA 3EGSB 5EU7C 1T83C 3GM0A 4HKJA 4HLJA 4OCSH 1PKQB 1YPZB 4U7KA 4OD1H 3GJEB 4BH7A 1QP1A 2EZ0C 3MOBL 2G5BA 5CJQL 2P24B 4R2GB 1QBMH 3MNVB 3SE9L 3DVGB 5EC2B 1I8KB 4WI3A 3MJ6A 4FQJL 5FYJU 3MCG1 5C08A 4WI5A 1TJIH 4PV9A 3I3EA 1D9KD 1DN0B 2DBLH 3WFZA 4G6KL 1A7QH 1QSZA 2UWEF 3FQXB 4GQ9H 2UYLB 4N5UA 3RTQB 1PY9A 4IRSD 4ZD3H 3VFSA 3GMOA 2MCPL 1KB5B 3W0WE 1BD2A 1YDPB 1IGCL 2VZUA 2R2CA 3QUZD 4PJHF 3JSSA 4QOKA 3QPQD 1KXQE 1FZKA 1IGIL 4MD5B 3ALXA 2R9HD 4JO4H 3IVKA 3ORJA 5EUKB 4HUWA 1PG7H 1M05B 1DBBL 1HI6B 5D70H 1YNKL 5C71A 3L5WB 3ABZA 5IW3A 1YEGL 3B3IA 5E00B 3FHAA 5KTEL 3BDBA 1CCZA 1IC1A 2APXA 4BH8A 3O11B 1INQA 3EJZC 4X6DA 1Q9KB 3OZ9H 5DQJA 3UTTB 1S3KH 2X4OB 3L3OB 5ID1B 1D5IH 1KLFA 3IXTA 2A1WL 4P46D 1MIEL 2IAMB 5GGSY 4LPXA 1NC4A 1QD0A 1MAKA 4QGTA 4G8GB 5TF0A 4G6FD 1QLRB 2Q6WA 3L3GB 3NVQA 2PYED 3K80A 3U9UB 5D1QA 5E8DH 3L3JA 1VFBA 4ISVA 4EI5D 3O3AB 2ATKB 4Y19E 1IGYB 4DVBB 1FO0B 3FMGL 3NMEA 4PRBA 1CFQA 2Z35B 5D7IF 2HKHH 4XP6H 2H2PC 5DUMH 4YHLL 2J8UF 3P4MA 3BRDA 1E28B 3GMPB 1IGFL 2NY6B 5E4EB 1B4JH 1LK3L 2NNAA 3BKYL 4PJEB 2XQBH 3WSQL 4HLZH 4ZOCA 3QEQE 2OL3H 2V7NB 2OK0L 2NY5L 3NAAH 4KI5E 4LPCA 5JZ7D 4NQCB 2HKFL 5BVPL 1SEBB 1ZT7A 2N1KA 4X7SH 2BVPA 3HUJA 2HLFD 3AREB 1OSPL 4OIIL 4KQ4H 2NTFA 1IEBA 5GZND 1RZ7L 4YAQB 1CR9H 3SCMA 4EUPH 3Q5TA 1K2DB 1YQVL 3ZKNC 1S9YA 1URLA 5IKCB 1KB9J 2Q8AL 4OLYH 4XAKE 4XHJD 1U8IB 4JZJA 3MBXL 3DROA 4B50A 3W5MA 1AFVH 3QQ9C 1EBPA 1YMHA 2H6PA 3BP6A 3P0GB 2R0WL 3TM6A 4S11A 1JIBA 1CFNB 4MD4B 2W59A 4MNHA 1WCBA 2OR9L 5BVJA 4XPHL 1JGLH 5GZOD 4R90H 4YIQA 2WW8A 3HZMB 3QXDA 5IMOB 4OLWL 5IJKA 4X0KB 2WMPA 3BGMA 3PP3K 4R2GC 1MHEB 4XCCL 3ILQD 5E8OB 3WL9A 2HTLD 2J8OA 4GXUM 1WVZA 1JWSA 1NCCH 3RI5K 4NWUL 4FQ1H 4X5XA 3HE6D 3RWCB 3BQUA 3VXSD 2HFEA 4HIEB 4IOIA 5EO9B 5FKAA 2IGFH 3C6LA 4UT9L 3HNVH 3ULUF 2EIZA 1E27A 1WIOA 3RTQC 4R3SB 4KY1H 5TFSH 1ORQB 4WGVB 4WTWA 3DO3A 1FLRH 5GGRB 2YBRB 1CDCA 4NO0A 4PJDF 4M7ZB 3QDJA 3ARGD 1WTLA 4I77H 4YFLF 4J3TA 5CGYC 4ZOBA 4RAUB 2W07A 4UBDC 4IIQA 1F3DJ 4PGCB 4TUJA 4XNUH 3O6FD 5AUMA 3L6FB 5DDHA 4X6BB 5EN2B 4JRXE 2A6KA 4X7DC 5HYSB 1CXKA 1NBVH 3D0LA 3FHQA 1AIFA 3TPKA 3TT3H 1S7RB 3CFDB 3W11C 1L4IA 3QBTB 2AJYL 5TE4L 5HYIA 1WZ1L 2AJVH 5GGSA 3VFRA 4YDVA 3HI1B 4HGWA 5C9JB 3PXJA 5C0FA 2HFFA 4LCWD 3ULVC 1EGJL 5D7LB 4KKCC 1KJ2A 1JRHL 2GCYA 4ONHA 1FFPA 1MCDA 3FB8B 4JFPA 4KK9C 1YYMH 1CGUA 3KPSE 1OY3B 4L8BA 4ONFL 5E9DB 5FOBA 5C7XL 1ZT4A 2P5EE 3CFCL 4UTBH 5HHNA 4HWZB 1JGVH 4I3GA 5HHOB 1FZMB 4ZSOB 4I3SH 1DTUA 3ARQA 4PJIA 4MXQC 2O61A 3NBNA 2YZ1A 2CJUH 4H88L 4TPRL 3S35L 1E4KA 2NY6C 4OIBA 4NUJA 3CH8A 4KKAC 1KLGB 4XPTL 2FECI 1CU4L 1IFHH 4HKBA 2ZZUT 2W60B 5DSCA 1H0DB 1LO0L 3MJ8A 4PY7A 1A7OL 5DJCA 1EUUA 3BVNA 3J8F7 2YHGA 5CCKL 3HS0A 2HT4C 3AREC 2EH7L 1A6TA 3GSXB 3F5WA 1MRCL 4QRRA 2FR4B 4LLMB 3I6GA 5I30H 4WUUB 3QDGD 3OR7A 1HIML 1A2YB 1TJHH 2X9XA 4I9WE 4PJXA 1R0AL 5SWSE 5K9KA 3D5OF 4PRHB 3RNQB 5FECA 5IBUG 1XIWD 3KDMB 3QI9A 3WHXA 1N6QH 5CHNA 4XMKH 3DUHA 1DZBA 1Q0XH 3VCLA 3LEYL 5BRZA 3R0NA 1S7TA 1QBBA 2XZQH 4YDLB 4HIIB 3GEWB 3VXNB 3SN6N 3CVHA 5LGJA 1ADQA 3EFFA 2FWOA 3UO1H 43C9B 5T3XD 4A6YL 4LDOB 2F15A 5GS0C 5D8JL 4U1MB 4GFTB 3HUJF 5E6ID 2NW3B 4U1LA 1J9CT 2PW2B 4AL8L 5ADPL 2B0SH 3LKPA 1V7MH 4MNGA 3S36H 2BNQB 1QLEL 1EEZB 3MJ9H 3O9WB 4NP4H 2AJUH 2R56L 4Z76B 3H9SB 1T4KA 1RV6X 4UOW1 3QJFB 3LIZH 3WMSA 4OTXH 2DM2A 1CE6A 4U0RB 5BZDA 3U46A 3VGEA 4AEHL 2E7BA 4BQ8A 4Z7UB 2JELL 4LKCB 4WFFD 4OZIB 2DM3A 5EU4B 1VADB 2NX5E 3H7BB 4GMSH 4P5MB 1EO8L 2ARJQ 3O45A 4P2QD 3GJFK 5F3HB 2VSCA 4LSSL 2ADJA 3TA3A 5FHAL 5EPMA 1FBIL 4TOYH 3SDXF 4XNMB 1RURH 5C2UB 3WS3A 1GRWA 3EJYC 3JV0A 4NQDA 1AY1L 2F5BL 1QEWA 4U1JB 1TCRA 3ZKQD 1I8MB 4U33A 2XA3A 3TBYA 5J3HD 2PYEE 2Y6SD 3AU1B 2WUCL 4Q0XH 3L3HA 4PJFF 2WBKA 3PGCA 4OFPA 1RJZB 5FO9B 1BFVH 4R4BA 5SWZE 5I76A 3AS3A 3BDXA 5F6HJ 3L3KB 4O2CA 4XNZB 2CLRB 4KJPC 3FO0H 4G7VL 4LSPL 4PJHB 2XN9E 2VDNH 3O81A 2BHUA 2X89D 4DN3L 1V3KA 1E4WL 1MUJB 3EJZD 1F4XH 1CGWA 2FL5A 3DX8B 4RWHA 4K3DH 3U7YL 4ZFGL 2P8LA 2W1NA 4H0IA 4IDJH 2R1XB 2NLJA 3QPXL 4C57C 1BEYL 3HC3H 1LDPL 2YEZA 1S8DB 5KSBA 1K6QH 3R0MA 2HJFA 4NNXB 4KJYA 1KCUL 1LE5B 4R7NA 3G6AB 2BNRE 1UZ6F 4NM8H 1FC1A 1NMBL 5KANI 1WBYB 5I8OH 2F74B 4ZTPH 2YPKB 1RZGB 5HGAA 1B0GA 1GXEA 2DWEB 1T1ZA 12E8H 4QTHA 3MRLA 5E2TH 3LZFL 5ITBL 3WJLA 3FJTA 3G5YA 5FFLA 2CO6B 5C0JA 2K7PA 4GAYA 4G43A 1NL0H 1ORSA 3WFHB 4OZ4B 4R4FL 4YWGH 4P59H 3SQOH 3O2WL 1U8NA 4OUUA 1VEOA 2AEPL 1MF2L 3EO9L 2GFBB 3CIQA 4MA3A 5DR5L 1IL1B 4RCAA 3FB6A 1RUKH 5H35A 3KG5A 4M61B 2RAMA 3PHOB 2J8UB 4RAHA 4HKXA 2F8OA 1TVBA 3QUML 3GBML 5DK0A 1N3NA 3MBEA 3QWQB 5HVFB 3QXAA 1CT8B 5EA0H 2AK4D 4ODTH 9CGTA 4LLAA 1QRND 4UDTB 5IMKB 3RY6C 1A5FH 2CSPA 3PWPA 4RMTA 4W6YB 4KMQA 3GUTA 3CC5B 3WXVL 2APFA 1DL7H 4ZYKB 2P8MA 1J12A 4F7PB 4I1NB 3SPVB 1XR8B 4X98A 1U8HB 3O9WC 1FFQA 4LVNB 4X6EA 4BK5A 3VXUD 4MAYA 3UTZA 2MTPA 1C08A 3OXRB 2CK0L 4N1EA 2GT9A 1QSFB 5DK3A 4U0RC 3NZHH 4QCIA 2NPLX 3UPRA 2YPLA 1SYSB 1U93B 3VDBA 4HXBH 5CLTA 1JGEA 1MJ8H 1A7PL 4P49A 4ZFOL 5E6YA 5FB8B 1HHIB 5EO1B 5JPNA 5DHXB 2BSED 4P4KD 1SMAA 3P4OA 4LCWE 3MA9L 4P9ML 3ZE2E 4N0CC 4QXGH 5DD6A 3OG6B 3WKMH 3BIBX 2ZG3A 3BUYA 3ZKMC 1VFAA 3RY4A 4WIQA 2EDDA 2EEAA 3B2VH 4JY4B 4PLNC 5HYJB 3EO1B 5IV2A 3OGCB 4OQTH 1K5NA 3SKNA 4UBDD 1ZHNA 3QIUA 3FFCA 4M1GH 4P2RE 4Z95H 1BWMA 3GBNH 3U6RA 4XNZC 4HX1A 2HMID 2Y06L 1NGQL 4PJDB 1PQZB 3L7EB 4NQSA 1Y18A 1LWRA 3FL7A 4GG8A 1S7SB 1FORL 4JFXA 3KPQA 1VKXB 5EC1A 4M03A 4AG4H 1ZKAA 2XQYG 3KJ6L 2J88L 2WIIB 1BZ7A 1A6ZB 3CX5J 3OKDA 2EYTB 3SGKC 4MDJA 3VI3E 3UTTD 3NIFF 3MLYL 4HKJB 3NA9L 2W92A 3D87B 2VR9A 4BH7B 2G5BB 4KKCD 4KVNH 1A7RH 4OD2A 4KK9D 4DUVA 5ALBH 25C8L 4HC1H 4XRCA 3DUUA 5F7UA 3WIFA 5C08B 1CBVH 1F8TL 2C7UA 2Z93A 2DM7A 5EZJA 2DLEA 1DQDH 1UZ8B 4PV9B 4HIHA 3VRLE 1CZ8H 1C1EH 4OLZL 5EBLA 5LBSH 3VWKA 1FNSH 1I75A 1UYWL 3EDDA 2UY6A 3KPTA 4DKAA 1KB5H 4O51A 1MCOL 4FFWC 4WEBL 4OLVH 4MXQD 4TSCL 5HGBB 2R4RL 4FQPA 1NFDE 3VFSB 1VHPA 3GMOB 3S37H 4KKAD 2F8VA 1BD2B 3RWJB 4HBCL 4DQOL 5I8CA 1Z2KA 4QOKB 1DQQA 3C9NA 1CDHA 1FZKB 1H5BC 1OP3H 2AEQL 4AH2A 3IVKB 4LPYA 3B9KD 4HUWB 4HFUH 4PLKC 3QCVH 1OL0A 1WFNA 4CVZA 5CD5C 1XGPA 4APQC 4PG2A 3B3IB 1T2XA 3CX5K 3OF6A 2AV7A 4HGKC 2MQCA 4MJ5A 5DHYB 3X13A 3ULVH 4BH8B 2V5SA 1INQB 1KPRB 2CO7B 3ZKXB 4XP1L 3LRGA 4X6DB 1IM9D 2VMFA 5EU7E 5IVZA 3TZVD 1Q0YH 4LVNC 4QXTA 1XCQA 4JFQA 1NC4B 1EZVY 2LV4A 4TUKL 3RKPA 1D6VH 1FO0H 4DZBA 5D1QB 5TF1H 1VFUA 5GRXG 3L3JB 4P0DA 5KVEH 2X4TA 2WUBL 4ISVB 4U49A 1JWMA 1WBZA 1FCCA 4OLEA 4PRBB 5C1MB 5IP4A 3EYOB 3MLSL 3CDYA 2VSDA 5GS0D 1CFQB 4NHCL 4M48L 5JPMA 2EO1A 3BJLA 2NNAB 1KNOA 2AABH 4U1GC 4UT6L 3T0WA 1RJCA 3HMXL 3WD5L 2D7NA 1CWVA 5IVNA 3JTSA 1ZT7B 3B4NA 2XRAH 2BVPB 3BIKA 1XGUA 3T0EA 1OHQA 2NTFB 1IEBB 3ULUC 1EV2E 1BQHA 4UNVA 2F54E 3GI8H 3SCMB 4Q9QH 5EUOE 1S9YB 2R2BA 4JRYA 5J06A 3BKML 3MV11 4JN2A 4X80H 1EFXD 5CZXC 2Q87A 4EVNA 4JZJB 3DROB 2DLFH 3QFJD 3BKJL 4HPOL 3EO0A 1YMHB 1GAFH 2H6PB 1N8ZA 5BMFH 3BP6B 1LMKA 2DIAA 5AG9A 3EJYD 2NZIA 3VG0L 4MNHB 1WCBB 4BZ1L 5BVJB 4YIQB 5DJXA 3PGFH 3QXDB 1JF6A 1JI1A 1NKRA 1R6VA 4GT7A 3BGMB 4IS6A 1JHLL 1RZ8A 3G6DH 4YQXH 3WL9B 4PJ8A 5JDSA 4OCXH 1ZHBA 3GMQA 1JWSB 2LVEA 4CNIA 1FRGH 4G5ZL 4X5XB 1JYXA 3DLQR 2EKJA 3BQUB 2HFEB 1HYRC 4ZXBA 5FKAB 3C6LB 2EIZB 4OFVA 2FZ3A 1E27B 2ZSVB 5ILTL 2B7DT 4J4PA 3VGAB 1OP5H 4LU5H 3TIDA 1YMMA 4NO0B 2NR6C 3G9AB 1JNNH 1KYOK 5TDOA 2NY7L 4PS4H 1XZ0A 4IIQB 3CK0L 5KJRL 4TUJB 3D39A 5AUMB 5DDHB 1H3PL 3NTCH 2A6KB 4RA3A 1DLFH 1KBGL 3D0LB 1U58B 1AIFB 4WUUD 3EW3B 3K8MA 3X3GH 2ADGA 4ALAL 3HFMH 3ZDYF 3NH7L 3ARWA 3ZKXC 5GGSB 1GC1C 1PEZA 4K3JL 3IFLL 2H1PH 4YDVB 3VFRB 4HGWB 5C0FB 2VDLH 1HE7A 5CAYB 1PKQE 1YPZE 4LFHD 4QHNA 4UIKL 1KJ2B 2GCYB 3ARYA 4ONHB 1FFPB 3M45A 4JFPB 4LSTH 2GEEA 4Y1AA 4FQ2H 5C6TH 4L8BB 5FOBB 1SYVA 5A2FA 1AC6A 1ZT4B 1WT5A 2VLMD 3MGAA 2BXZA 4R9HA 5D1QC 1PG7W 3L5HA 1QFOA 5T3ZL 1I1FA 1DFBL 4X5WA 3NGBC 1X5KA 4S1RL 4PJIB 4LQFL 4L9LA 2XPGA 4DOHB 2O61B 5C0AD 3LHPL 5DS8A 1UXSA 1RMFH 5L9DH 2HT2C 4NUJB 5I18H 1NAKH 2VXQL 1ZS8A 1YC8A 1MCWW 4HKBB 5DVLA 3IJSA 4F15B 1G7LA 2CGRH 4YHIA 5DSCB 3MJ8B 1UKSA 2EYSA 3GSWA 4LCUA 3QNXA 1TXKA 3DX7A 4XHQA 3BVNB 4OCNC 2YR3A 3HS0B 1J8HD 1A6TB 3F5WB 4QRRB 3ARPA 1B3JA 3RVUD 1NDGA 3I6GB 3SCMC 3HKFA 4QHLA 3VJ6A 4U1HA 3WUWB 3OR7B 3PXHA 3RRQA 3DVIA 3RZCD 4PJXB 3TBSA 5K9KB 4JZJC 1A4JA 2YUXA 3T3PF 2QSVA 1F6AA 1RZJC 2FIRT 5FDWA 5FECB 5I1JH 2Y36H 3UTTE 3QI9B 3WHXB 4Z9KB 5CHNB 3ULVE 5F1NA 1V5JA 3QWRA 4U3CA 5KW9L 4B5EA 3ET9F 4O58H 3VCLB 4CMHB 1A6VL 4YHZL 5BRZB 2H9GA 2ICEA 1S7TB 5L7XH 4G8GE 3UC0L 4BQ9A 2FGWH 3TCLA 5JR1H 4GUPA 1K3IA 5I71B 1L9MA 3CVHB 3RGVC 4WO4D 5LGJB 1U8MA 3EFFB 2FWOB 4RZCA 4XNYH 3I3DA 1OAKL 4MCZA 2BRRH 1E4XI 4V1DD 1OAZH 1RU9H 1I9JH 3RI5F 4NN6B 4X83A 1EMTH 3BQUC 3KHQA 4OZHA 5EWIL 1A22B 4U1LB 2FLRT 2R39A 4RX4D 3C6LC 3LKPB 5C3TA 4MNGB 1KELH 5DD3L 4PJEE 4JPVL 1TTGA 3VGAC 2F8XC 3F7VA 4C83A 4NN5B 1CIUA 1T4KB 3SE3A 5DK2A 2R69H 1P9MA 3MR9A 1CE6B 5BZDB 5F7FA 3VW3L 3BYYA 2GJ6D 3P77A 4DGIH 4C55A 4XAWH 2AJZA 4G9DA 2OMBA 2J4WL 1BREA 3DI2B 3MLRH 3O45B 3UBXA 4F57H 1XF4A 3Q1SL 1MVUB 3O0RH 3QZWA 4PJ7B 2ADJB 2Q76A 3TA3B 5EPMB 1K9TA 2WLZA 3MV8A 2C3HA 3WS3B 4LSVL 3UXFA 2UZIH 4NQDB 1KN2L 3ARVA 1QEWB 2DQCL 1TCRB 3BXNA 1F2QA 1S7VA 4Y16D 4XXDA 3EIFA 3O6KL 3HTLX 4G6JH 4K2UH 3U0TA 3TBYB 4OI9A 1A6WL 4Z7NF 1C5DA 3W9EA 4GH7B 2O5YH 2GITA 4XPBL 3L3HB 5I1EH 4NZRL 1UJTA 4R4BB 1GGBL 5I76B 4KROB 4PLKD 5CD5D 1AGFA 2Q20A 2IQAA 4APQD 4W6WB 1SM3L 1Z9LA 5KG9A 1T0PB 3I84A 3V9FA 1T2QL 1A9EA 1KF9B 1E4KC 2FL5B 1HDMA 1IQWL 2P8LB 4JM2F 2NLJB 3RU8H 2YEZB 5KSBB 5KN5A 1F6LL 4LLWA 3CLFH 4M93B 2HJFB 2X1WL 4KJYB 5H8DA 1NC2D 1UH3A 1EEUA 4NNPH 3S35X 2HT3C 4R7NB 3N50A 2AEWA 4G6ML 5F71A 5JXAL 4H1LG 5I17A 1B0GB 3QFJE 1T1ZB 2RQ8A 2IBBA 3MFFA 3N1GC 4LHUG 4O4YL 5CKGA 1S9WA 1X4XA 4QTHB 3MRLB 1ODAA 2JKXA 4NZTL 2IPUG 4XPGL 1ETZA 5CGTA 3SDAD 1NAMA 4Q74A 4NC2B 3G5YB 5EU3A 4ZPTA 5C0JB 4GAYB 4G43B 1ORSB 1RAMA 1T1WA 3ARBA 3SO5A 4K8RL 5ETUA 4UTAL 1AO7D 5IHUL 4CMHC 2AJSH 4WWKD 2R23B 4L3EA 4UUJA 2EIEA 1U8NB 4WENB 4OUUB 4I0CC 4L4TD 1A02N 1GGCL 4MA3B 3FB6B 5H35B 3MGOB 3BPOC 3EFDH 4Y5YA 2IPTL 4D9LH 4HKXB 4FG6D 1TVBB 5I71C 3RWFA 4NO5A 5DK0B 1NJ9A 3MBEB 5HHOE 4JM4L 3ULUD 3QXAB 1MNUL 1TJGH 4ORZC 4ZSOE 3I9GL 1JPTL 2ENYA 1DBKL 1N6VA 5JW5A 5L0QB 2E27H 4NN6C 5CZXD 3O2VL 1WJ3A 3PWPB 3GUTB 3DOSA 2P8MB 2X4UA 3MUY1 4X98B 2F58H 5FXCH 4X6EB 4Y8AA 4WI8A 3IT8D 4MAYB 2AXHA 3UTZB 1QFPA 3ZE1F 5I8KH 1NCWL 2GT9B 4XGZA 4G8IA 1A6AA 3ZE0E 5GRJH 4LDLB 4RWYH 4QCIB 3UPRB 2YPLB 4WUUE 4MVBC 5ESAA 4MAUH 4PB9L 1G9NL 1JGEB 7FABL 1EHLH 2LABA 2E6JA 2EDJA 5JPNB 4YEFA 4PRHE 3QDMA 3D85A 3MCKA 4GG6F 4PGDA 3P4OB 3AXLA 5DD6B 4ZUSB 5JQHC 3L9RA 2AGJH 1P53A 2P7TA 4ODSL 5M94B 4Z0BL 4F8QA 3BUYB 5MHSD 1VFAB 3DUSA 3RNKA 1TZGH 1FNAA 4OZHF 4FA8A 3LRSA 2J5LB 4TTDC 3LVEA 5CJXA 5IV2B 4NNYB 3FQWB 4OI7A 5CEZL 4A2LA 3MC0A 3SKNB 1HWGB 1ZHNB 1P69B 1M7IA 2D7PA 3QIUB 3FFCB 4U2ZA 4BA8A 1MFDH 3R06A 3GK8H 2CQVA 2CUMA 3U6RB 4K94C 1MFAL 3QG7L 4HX1B 4KROC 3VXRD 5GS1A 1EVTC 2ARWA 2FJGB 3UTSD 4NQSB 2VC2H 4GG8B 3KPQB 5EC1B 1LP9A 1L0YA 4OGXH 1H8NA 1DQML 1T0NA 2BNQE 2ZUUA 1BZ7B 5BZWA 3D0VA 3PF2A 4Q2ZB 4BK4A 4NSKA 2P44B 4UNTA 5INDA 4MDJB 4DKFH 3H9SE 1OTTD 4G9FB 3H42L 5CD3A 3WLBA 4MJIA 4M93C 3K3QA 4XP5H 3OTTA 3V52L 1REIA 4OD2B 5FUCC 3SGEI 5B39B 3GDBA 4EN3A 4XRCB 3HZVA 5D5MF 3DUUB 4LAQH 3I85A 4EDWL 5I0ZA 1UM5L 4OZIE 4TRPH 3WIFB 2X1PA 2A6JA 2C7UB 2Z93B 5EZJB 2IBGA 3VXMA 3HI6L 4HIHB 3VWKB 5EBLB 5T1LD 3CFJA 4GKOA 4A6YA 1SJXA 4BZ2L 3WJLC 3FN0H 2PCPA 1OOAA 5M95B 2EDKA 2DQHL 5C2BH 1E4JA 5I8CB 5T5FH 1L7IH 4JG1H 1DQQB 3C9NB 5CFHA 3LN5A 3INUL 3V4VH 4NT6A 4C56A 5C0IA 1Z6JT 3SGEH 3KR3H 4KUCF 2UWEE 5A2IH 3UTQA 2HAZA 1AI1H 4LLDA 2GIYA 5HJ3A 4BFIA 3MBEC 1GC1H 1QHOA 1FYTD 4PJHE 5FYJH 5L0QC 2AV7B 4MJ5B 3X13B 1P2CA 2EICA 3L5XL 5I16A 2EKSA 5GRVK 5HI5D 2B1HH 2M1KA 4WFED 4KRMB 5IVZB 4DVRH 1SBBA 4QNPF 1XCQB 1DSFL 3CXHJ 4QXTB 4JFQB 3BZEA 5CSZA 3LMJH 2ZNXA 1IE5A 5KSUB 3C5ZA 5JHDA 4H8WL 4DZBB 1UKTA 4M8VA 4WFGD 1XF3A 1U3ZA 4UMGA 2X4TB 1YNLH 1WICA 3RGVD 4D9RE 4NZUH 1WBZB 5DURD 4QRTA 4AIZA 1CGVA 4XWOD 5DJAA 4KUZL 4DW2L 5JPMB 4ONOA 4FQQA 4FFYL 5HHMB 4PJGA 1KNOB 4PJ9A 2IF7A 2FH8A 3GNMH 3JTSB 3QDJD 5H2BA 5AAMA 2J5LC 5D7IE 3BIKB 3WCYA 1OCWL 2J8UE 1XGUB 1J86A 1P5UA 1WITA 3QIUC 4X9HA 5KOVC 2R2BB 4JRYB 3MYZA 3TN0B 1ZTXH 2C3GA 4JN2B 4NZJA 4EVNB 4JPWL 2W65A 3CXHK 5DT1H 2V6HA 1UC6A 4PY8I 1N8ZB 1OP9A 4YHOL 4MS8C 3RKDD 4U7SA 4HUKB 5T1KA 1IEHA 1BZ9A 4HUVA 3AMKA 2P45B 1MCCA 4CL7A 3QSKB 5CZVH 3L95A 5DJXB 1QSFE 2C9AA 3MRDA 3DNKA 1QYGL 3U2SA 4IS6B 1RZ8B 3HAEG 4OGYL 1T1YA 4MLSA 4PJ5A 1YJDC 4PJ8B 2VQTA 3N1PC 3PDOA 1FH5L 1OGTA 2MHAA 1A0QL 5IB4A 5JDSB 5L2KD 3MV01 3U1SH 1U9KA 1ZHBB 4CNIB 1G0YR 1B6DA 3DX6A 3IDGA 1MRDL 1I7UB 1T03H 3TV3L 4ZXBB 4LARH 3VRIA 3LEXA 1FG9C 5F97E 2AP2A 8CGTA 3SKUD 3X3FH 4RFOL 5JW4M 2EH8H 5DLML 5B8CA 5HDQH 3TIDB 1YMMB 4N5EC 2RGSA 5TDOB 1CLYL 2J8HA 5FYLL 1KPUB 4FZEL 1J1PH 5HYJE 5D7JA 1PLGH 1XZ0B 4JFZL 2AJ3A 3ULUE 1D5MA 1FIEA 2HT3D 3D39B 1OAYH 4YXKL 3RWIB 4YXLH 3EOYG 3WS6A 1L7TL 3E8UH 4ELKA 2EDHA 4WCYH 2EE6A 4PJDE 1BM3H 1FNGA 4PG2C 3CDCA 1C5CL 3FONB 4DAGL 1INEL 1HHGA 3VXTA 2ADGB 4E42A 4N9GA 1W0WA 2CXKA 1N5YL 2ATPA 1VEMA 4MXWL 1KJ2H 4ORGA 1T20A 4KZDH 3F6IA 3L1OL 2FSEB 5HI4C 3WFCL 1JPFA 4QHNB 4NDMA 1J7VR 3BPLB 3W2DH 1I1RA 1I8IA 1MPAH 5FM8A 2Z31D 1VA9A 4Y1AB 1MEXL 4PUBH 1SYVB 1TZIA 4BSWA 1T22A 1ZLVH 1T7XA 4K7PL 5C08E 3NABH 2DKMA 5D4QA 4HJGA 3GKWL 1P6FA 4R26H 3MV7A 1AH1A 4HCRL 1W0YT 4X5WB 2R0LH 3MRPA 4IOFC 3M1BA 1LO2L 5F9WB 3N0PB 4L9LB 5DRXA 3LPWA 3PP4L 2RIKA 3V95A 1ND0A 5F7HA 1KPVA 3L7FA 5DS8B 1UXSB 1AKJB 4JO1H 1ACYL 2CRMA 4PB0H 4CDGC 5DJZA 1ZS8B 3IJSB 5HPMA 2KQNA 3SOBL 1G7LB 4QOKE 4YHIB 2MSPA 3GHBL 2CLZA 2EYSB 3GSWB 4YO0A 3QNXB 4BUHA 3DX7B 3T0EC 3OKLA 1VESA 4WHYG 3UPCA 5BS0D 2ED7A 3C2SA 1NDGB 5K9QG 1UCTA 3EZJB 2LU4A 4QHLB 4KWUA 4MVBD 4U1HB 3VJ6B 5E2WL 4HG4K 3VH8A 1JGUL 2HJKA 3WDJA 3TBSB 1JZ3A 4YLQT 5KAQG 1A4JB 5FDWB 1F6AB 4X6DE 3QJHA 3I6LE 4WI2A 3TWCH 4Y4HC 5F1NB 2G75A 1KEML 5IQ7H 5DC4B 2H9GB 2ICEB 4ZO9A 3ECBA 3CVHH 1SBSL 1A4KA 2VDML 2IJ0C 3TCLB 4PRPD 4MA1B 4GUPB 1FL3A 4W81A 4Y4KA 3KLHD 1U8MB 2BHYA 2L7JA 4PJ8C 4RZCB 4GW1A 4LASL 1NSNL 4MCZB 1QHPA 4RGOL 4Q9RH 2A6DA 4TQEL 4KROD 1A8JH 4MQSB 4OZHB 4XNXL 4YZFF 4ZXBC 3K4ZA 3CH1A 1Y6KR 1DANU 5FCUL 4J4PC 3WIIL 5KSAA 3F7VB 3TJEH 4C83B 2A74A 1BJMA 4ZFZA 3TBVA 2FJFA 3C60A 3S4SA 3NZ8A 3N9GL 5DK2B 2I07B 3HUJE 3MR9B 4OIAA 5JQ6H 4OZGF 3P77B 3T65A 5DRNA 4N0UA 1NFKA 2AJZB 2DQFA 4KMTH 3RWGA 1FYTE 3S5LG 1TZHA 4DEPB 4G9DB 4Q7DA 5IROA 4YC2C 4X7TB 4CU7A 4NWTL 3UBXB 1TQBB 1XF4B 4GXVL 1RIVH 3QZWB 2EDBA 1WWAX 4ZODA 1YEFH 3OL2A 3MV8B 1Q8MA 4JFOA 3F6LA 2OI9B 1B2WH 4QLRA 2E7CA 3BXNB 4QXUL 4TULH 1S7VB 2HH0L 3P9WB 4KMLB 4XVJH 1H8OA 3OPZL 4XXDB 3U0TB 1WAAF 4Z7QF 5I8EA 1C5DB 3W9EB 5E08H 4BQCA 2GITB 1ULVA 1IC4H 3HMXA 5LWYL 1WT5C 2YUVA 1LO4L 3R1GL 1JWUA 1CE1H 1ZE3C 4ESKA 2DWDA 4RDQG 3BD3A 1AGFB 4JO3H 3KPLA 2IQAB 4FQHA 3VE0A 2G5RA 1MWAL 5F9WC 1Z9OA 4L9LC 2WZPD 5KG9B 2GYSA 4OCRL 2JK5A 5E99H 1H3VA 3ARSA 1A9EB 5IQ9A 2X42A 4NJAL 1CGSL 1M71A 1CYGA 4RQQA 2XT1B 4ZFFA 1TQCB 4HAGA 2VE6A 1HDMB 1P84J 3QDJE 4ODBD 3OB8A 5KN5B 4LLWB 4NQUA 1IQDA 1I9IL 1J88A 1CDIA 1MCPH 2FRGP 1MJ7H 1TENA 2FD6H 2Q3AA 4KJQC 1NCAH 2EIDA 5LGHH 5I1CH 1MFEH 3B8SA 3MFFB 1QO3B 1S9WB 1F4AA 5EZOL 2NXZD 1LEGA 2YMXH 4M6OL 1ETZB 1NAMB 5F1IA 4ZUVB 3FO1A 5GIRA 2O5ZL 4ZPTB 3KPNA 3EOBA 3REVA 1UZ6E 1T1WB 1XMWA 2Z8VC 3ARBB 2XA8L 5DMIH 1FFRA 1ZA3A 3VFPA 4CU8A 5ETUB 2VL5A 3EZ8A 4GBXA 4L3EB 1DVFD 4UUJB 4MYWB 3SDDA 1HINH 1R24A 3IXAA 1GGIH 4KDWA 4KHXH 4YE4L 3B6SA 4MA1C 1L0QA 3MLXL 2ZP0T 4Y5YB 3RWFB 4NO5B 3GO1L 1NJ9B 2Y07H 4PJIE 5JW5B 1IBGL 1IGJA 5K59F 5C0RL 5GS2D 3V8OA 4DOHE 4M7LH 4FTVA 3G04B 3HE7A 4QRPD 3VG9B 3BAEL 3ARDA 3T2NL 1CF8L 4JHWH 2DI7A 2X4UB 3CFEA 1FNLA 4LEXL 4MS8D 4KFZC 1QFWM 3SE3C 3GFUA 3CCHA 1P9MC 4XGZB 3TYGH 5CZKA 3LQZA 4G8IB 1A6AB 5MENA 4QRRE 3THMH 1U8JB 2ESVA 5ESAB 1VGEH 1MCIA 3MCLH 2FH6A 4PJXE 1P4LA 1UACL 1NMCB 4I0PA 3QDMB 1TQBC 1NEZA 3D85B 3MCKB 4N1CA 4JN1L 4PGDB 4RMVA 3AXLB 5EZLA 3BT2H 1ZVHA 4JVPA 4KI1A 3L9RB 2P7TB 2OI9C 4I3RH 3UJIL 4XVTH 4ZO8A 2DLIA 2EDEA 4LSQL 3DUSB 3RNKB 5ESQA 2FEDD 4LCIL 4AT6A 4ENED 2WWKT 4JCMA 3LRSB 2X4RA 2B1AL 1RD6A 1VCAA 2YD3A 1M7IB 3TESA 5I6XB 2OJZL 2R15A 3HMWL 1NGZB 2ICWA 3SDYH 1HHKA 1CFBA 1BIIA 1GOHA 1NBZA 3LV3B 5GS1B 5DA4A 5DEFA 2B2XH 5C0BD 3HNSL 4YHKH 5HXMA 5DEGA 4HK3J 3JWDH 2XTLA 1LP9B 3QCUH 1JFQH 4HHAA 4MNGE 4KJWD 1T0NB 2RCSL 3HI5H 5D6DA 5FOJA 3D0VB 2EC9T 4NSKB 1G1YA 3W5NA 4UB0L 5INDB 1ZANL 5CD3B 3RPIA 2WNGA 1NLBH 3WLBB 4MJIB 5FM5M 1YJDH 5IOPA 4LK4A 5BS0E 4JVWA 2FATH 4U2YA 5HD8D 2Y5TA 4EN3B 5IGXH 3HZVB 2A6JB 1LO3L 2D03H 1FGNL 5IT2H 1UWGH 1KC5H 3VXMB 1OP3K 1BVLB 3TO4A 4CJ0A 3ARZA 4ELMA 1PEWA 3A0OA 3CFJB 4G6AD 4A6YB 5EIQA 4NQDE 5HHPA 4NM4H 3BHBA 2PCPB 2FEEL 3ARBC 2XWBA 4M62H 3TIEA 2RFXB 1KT2A 4P2YA 4PRPE 4KTEH 3IYLW 2CDEA 3LN5B 4NT6B 2C4FU 4C56B 5C0IB 3VFGL 4YBHA 3RX5A 4PTUA 3UTQB 4P5TC 4LLDB 3T0ED 5HJ3B 3SKOA 1PSKL 1S78C 4BFIB 2Z8SA 3LQAL 4PGZA 5DZNA 3BN9C 4WY7H 3RVVD 5E2UH 5D7SL 1W2KT 2UUDK 4G8EA 4YUEL 3D2UA 2EKSB 3VG9C 1JHKL 1KV3A 1G7PA 2JB5L 3ZT5A 4I18A 2PXYC 2XZAL 1U92A 3PWJA 4Y4HD 3BZEB 1CLOL 2A9NH 4UQ2A 4LIQL 5ICYA 5JA8B 5CSZB 5FUCE 4KGLA 2YWZA 1CFVL 2R4SH 1JNLH 5BO1H 3C5ZB 1YEHH 3T0AA 1XF3B 1CD0A 3AMLA 4B41A 3RZWA 3OAUH 4ZUWA 4QRTB 1NMCC 3RA7L 1J18A 4FQIH 4PRNA 5DJAB 2V17L 2OMNA 4HBQA 2X6MA 4XX1E 1J1XL 1YYLH 5JHLL 4PJAA 3RIFK 4FQQB 4Y2OA 3TVMD 4PJGB 3BW9A 4PJ9B 2EDWA 1AJ7H 3D1MC 2BOBA 2CKBH 3BGAA 4RRPG 4JFDD 2MFNA 5H2BB 4CVWA 2JJVA 1N0XL 5CJXC 2IFFL 5AZ2H 4M6AA 2NW2A 4HKZA 5I6XC 1NCTA 2WIMA 4S1SL 4TN9A 3D39D 1CL7L 3WBDA 1HHHA 4PD4J 3FCTA 1RK0A 1YEJL 2D7TH 2O5XL 3PWPE 2W65B 4JM2D 4PRDA 4K8RD 4O2EA 3WNKA 35C8H 3OJDB 5CJOL 3D6GA 5C86A 4V2CB 5T1KB 1OAUL 4WDIA 1BZ9B 4JO2H 4UQ3A 5FGCE 4N0FB 4HUVB 3U7WL 2NY3B 2X70A 3L95B 4UAOB 1IZJA 3GI9L 3MRDB 1JZ7A 3U2SB 3BYTA 4EN3C 2VZ3A 4JFFA 5C0GA 1T1YB 4RAVA 4PJ5B 5IB4B 3PDOB 4CUCA 1OGTB 2MHAB 4FS0A 2VNCA 5GJTL 1RUAL 4P23A 4B0MM 3IDGB 3FB7A 3K2UL 5I1GL 2VB5A 1ZEAH 2KZWA 4DUWA 3H2WA 5DJ0A 3VRIB 2H2SD 4D0BA 4TVPH 3VFMA 5B8CB 1BHGA 2VDKL 1CXEA 5FF6B 1L9NA 5ADOH 4OD3L 4DK3A 1WFUA 1MJUH 2P46B 4ODHL 1N4XL 3RFZC 5FDYA 4PD4K 1UWEL 5D7JB 1RIHH 3T2QA 2IG2H 2AJ3B 3FFCE 4CGTA 1D5MB 1U3HD 2XY1A 3BP5A 4MHHI 5DXWA 4ELKB 4NRYA 2QADC 1HQ4A 1DUZB 4ZS6C 1R5WA 1FNGB 1UVQA 2WV3A 3O8XA 3BE1L 1HHGB 2NY2C 3VXTB 4E42B 4N9GB 4D9QD 4M4RA 5F8RC 4HW6A 1W0WB 4ZFOB 2ATPB 5D70L 4ORGB 2EEDA 3MACH 1T20B 4DFHA 3D9AH 3IS1X 1JNHA 1JPFB 4XVSL 2E8ZA 2HYMA 5IJVB 4NDMB 4O9HH 3ARUA 3QWRD 2A73A 1I8IB 3AAZA 4YX2L 5F7DA 1C5BL 3ZDYE 1TZIB 4BSWB 2DRUA 3BRGC 3C5ZC 1T22B 4J3XA 5DZLA 2MPAL 1OGAA 1PY4A 5GGQL 4LHJB 4HJGB 3KPOA 4UIMA 3KXFA 3HG1A 5EIVA 2AXFA 3MRPB 1WTGT 2R2HA 4G7YL 1X9QA 2BSTA 3TT1L 4XI5D 4Y4FD 1ND0B 5KVGL 3O6LL 1KPVB 3E2HC 3L7FB 5JIKA 5DJZB 3QEUA 1OARL 2P5WD 4JZOA 3PQYA 1UCBL 4PJ9C 5HPMB 5DUML 1A21A 3F12A 3T08A 2MNUA 2CLZB 1YZZA 3ILPA 1J1OL 1A1NA 4YO0B 2VLJD 3SE9H 2DQJL 2DTMH 3IF1A 4PREA 4BKLA 1P7QA 3QAZB 3MZGB 3QRGL 4FQJH 5ISZD 1I3GH 3BP7A 3SJVB 5F7KC 2VLKA 1NCDH 5HGGS 5SX5H 1HH6A 3VH8B 2HJKB 3B9EA 1KLUA 1S5IH 4G6KH 2VYRE 3KPMA 3QJHB 3RJQB 3LQMA 1GHFL 2DQEL 1BIHA 2MCPH 3IDMA 2G75B 1IGCH 4WI9A 4V2BA 2BRQA 5J6GA 3ECBB 4RNRA 1IGIH 3T3PE 2KH2B 1A4KB 4UAOC 3A6CL 4JGJA 4PJAF 1HWHB 3UEZA 3P0VH 1FL3B 1JGLL 4Y4KB 3UBXI 2XZZA 2IALA 1DBBH 1MCKA 1YNKH 4GW1B 2R29L 4RMUA 1JHTA 1F02I 1YEGH 3WDIA 2A6DB 3QHTC 5KTEH 1CIDA 4HWBA 5CSBA 1AD0A 1F90L 2QQNL 3CH1B 1RFDH 2NY1B 2OQJA 5HHME 1GPOL 5CS7A 2VERN 4KUCD 3KS0H 3MFGB 5KSAB 5B8CC 5L8LB 3O41A 2A1WH 2A74B 1MIEH 4ZFZB 3TBVB 2FJFB 3C60B 1PW3A 2VLLA 3S4SB 3CSBA 2XTJD 3NZ8B 5CP7A 1KJ3L 1WUNT 3T0EE 3DVFA 1YN6A 1AR1D 5D7JC 5C0ND 4HF5L 2MOVA 2BC4A 3T65B 5DRNB 2VXTL 4N0UB 3RWGB 3WS6C 2DQTH 2VR4A 1TZHB 4JRYE 2QSCL 4YGVB 3WN5A 3DRQA 3FMGH 3TH3T 2FJHA 1JMXA 3EYUL 4QHKI 4YHLH 2R1WA 3G5VA 1IGFH 1ACZA 1BBJA 2WBJD 3BKYH 5IBLC 3WSQH 1GOFA 2OK0H 1DANT 1MCWM 1R3LA 4X99A 3ZHDA 5L88L 5F9OL 3UTPD 5I8EB 5BVPH 2HKFH 4M8QA 3Q5OA 1OSPH 4Y5XA 4OIIH 2H41A 1RZ7H 5IHBA 4P5TD 1YQVH 1S78D 2D4FA 4HJ0C 1MQ8A 1MQKL 5AAWA 2Q8AH 3KPLB 4FQHB 3VE0B 3BX7C 3CZFA 4Z7NE 3MBXH 7CGTA 4K7PX 5J6HA 3JZ7A 2JK5B 1DQJA 1BAFL 3KYNA 5BXFA 3BKCL 5IQ9B 1UJ3A 4ZFFB 1M71B 2R0WH 4RQQB 1YMME 1YNTA 2VE6B 1XCTA 3X11A 2OR9H 4N8CH 4XPHH 4TVPE 2PXYD 5KS9F 2ZCLL 1IQDB 4OLWH 4ZAKA 1C8PA 4S1QL 3D39E 3F7QA 3V4PL 4ONGL 4MNQA 3QAZC 1V8HA 2QL1A 4FABL 3RL1A 4OJFL 4E0RA 1RZKC 1NAMH 5IMMA 1U91A 3IU4L 4NWUH 5GGTL 4AIXA 4PBVC 1LEGB 4UT9H 5F1IB 3JV6A 3IDIA 3FO1B 5GIRB 4E41D 3KPNB 2Y1VA 3REVB 4H1LA 1BFOA 1ZA3B 4LHUA 3VFPB 2VL5B 4GBXB 5IF0A 1JRHI 2DM4A 4PRID 1I9EA 4Y1AE 3SDDB 4L3CA 1R24B 3IXAB 3NFSL 5C0CD 1KIUA 5DMGD 1WF5A 3B6SB 3V0WL 5MI0B 4F9LC 4WNQA 2I60L 4OCYL 4Y4KC 4ODVL 5EZIL 3RWEA 1A6UL 1IGJB 1VFMA 3MOAL 2AJYH 4FTVB 5TE4H 3HE7B 5F9JA 1WZ1H 3ARDB 3EYFA 3UO1L 2EDFA 3ZMRA 3CFEB 4NQEB 5EBGA 1FVEA 1S7UA 1EGJH 2Y9RT 4RISL 5KSAC 1D5ZA 3B83A 5IBTH 1JRHH 2ZNWA 3C60C 3CDGA 4AENA 1KACB 3CCHB 3DXAB 4MJID 5IMLA 4ONFH 1FC2D 3LQZB 5IW1A 5C7XH 5MENB 4OF7A 3CFCH 1AXIB 4HMCA 2ESVB 4KTDL 3Q3GA 5IROC 1P4LB 2VDQL 3ZE1E 4F3FA 4I0PB 3LOWA 4PG9A 4OZFG 2EC8A 4H88H 4TPRH 1K4CA 5EZLB 1ZMYA 4G42A 3S35H 4XPTH 4MD5A 4X9BA 5SWQA 3EYSL 5GGRY 1LO5A 4WHCA 5D2NA 3EHBC 4ZUUA 4BSVA 3MNWA 2RJMA 5ESQB 1OQOA 1GVIA 4AT6B 1LO0H 2PTVA 2F5AL 1D3CA 5CINL 2VXSL 1A7OH 1HI6A 1RURL 2X4RB 1XGTA 5F72S 5HYFA 5CCKH 2EH7H 5E00A 4OBSA 1MRCH 5D1ZD 2VLRD 4WFHD 3LKOA 4E9LA 2ICWB 5E8EA 1HHKB 3IB4A 1BIIB 1NBZB 4K7FA 1HIMH 2QADD 5DEFB 1UWXH 5L8JB 4OZHE 3MV9B 5DEGB 3V7MA 4ZS6D 1R0AH 4N90D 1WWCA 4Q6IB 2IAMA 2NY2D 4HHAB 5HHVL 4U0QB 2W38A 3LEYH 2VDNL 3U9UA 3RPIB 3VWJA 1HOCA 5IVOA 5IOPB 2ATKA 1FO0A 2Y5TB 3QUYA 1R3JA 5IVXA 2Z35A 1ZOXA 4PYHA 5JHDD 5FUZL 5SV3A 4U6YA 3O4LD 4A6YH 3TO4B 1F3JB 5D8JH 3BWAA 2IQ9L 4JE4B 4ELMB 1VPOL 2V7NA 1ZLWK 2APVA 3JWOC 3MV8E 2X05A 4CW1A 5HHPB 4NQCA 4FNLL 4XT1C 1QLEH 3TJHD 3BHBB 5C07A 2R56H 4MXVF 4Z7OF 3TIEB 1CVSC 1KT2B 4GBXC 5C09A 3MRHA 4GRLA 2VJXA 1F4YH 3SDDC 1JI2A 3GSQB 5KBNC 3SDCB 2JELH 5MI0C 5I9QB 3SKMA 5T1MA 5DFTA 3SKOB 3NCYP 1TNMA 4UU9A 5DD1L 1EO8H 3H9HB 3QA3A 4YBQC 4PR5A 4G8EB 1V3JA 4LSSH 3ARFD 3D2UB 3HE7C 5FHAH 2BNUA 1TIUA 3ARDC 1G7PB 1MI5D 1LE9A 2I9LA 1AY1H 2F5BH 4ODTL 1WBXA 3KYAA 4I18B 4JCLA 1U92B 3PWJB 1T1XB 4UQ2B 43CAA 2RBLA 5ICYB 4ZG1A 3GMRB 2WUCH 2XWTA 3BSZL 4QHUA 2DMKA 4U6HA 4JKKA 4UILL 4MMZC 3GMLA 4PY8J 2C4FT 4HIEA 4MQXC 2OJEA 3N85L 1AHWA 4QNPE 1ORQA 2ZOKA 3PIQA 2VXUL 1A7NL 4G7VH 4ZUWB 4LSPH 4GAGL 4I0PC 3VRJA 1OM3L 4PRNB 3SE8L 4DN3H 4P48A 1E4WH 4PJAB 1MWAA 1CDJA 3U7YH 3UTPE 4ZFGH 1HK6A 3BW9B 3QPXH 4XBPA 1BEYH 3V0AC 1LDPH 1OWWA 4L3EE 3LKSA 5JORB 2ILLA 2BOBB 1HYSD 2R8SL 1OD9A 5EN2A 3RPKA 3ZYOA 1KCUH 2NW2B 1X6LA 4G3YL 4HKZB 2BHZA 1NMBH 3MUGA 5FM4A 5KSVA 3VFTA 4XC3L 1HHHB 2EXYC 3HI1A 3FCTB 1RK0B 4YHML 3NFNA 4PRDB 4PPTA 5D7LA 1P1ZA 3LZFH 4DKDC 4O2EB 4LFHG 5ITBH 3SEPA 5LJYH 1ZGLA 4GKZA 1MH5A 4YNYA 5D6DC 4OM0L 4Y88A 4J23A 2GW5A 5E9DA 3EDEA 2OSLA 5IEKA 4R4FH 3JVGA 4CVXA 3KWWA 4WDIB 2F53A 4UQ3B 3TYFA 4EKXA 2X70B 3O2WH 1CTOA 1I1AA 2AEPH 1MF2H 3EO9H 5DR5H 2J12B 4PLJD 3MRKA 1CFTA 4JFFB 5C0GB 4O5LL 4RAVB 4Q9CA 3QUMH 2J3SA 3GBMH 5F7EL 4Z6AT 3E6HA 5DD0L 1F42A 4F80A 5GGVL 3UAJD 5HYQA 5B3JF 1UEYA 4P23B 4I2XA 3QDME 5HDOA 4HJ0D 3TO4C 3LKRA 3FB7B 3MV7D 5SX4H 5DJ0B 3WXVH 4OGZA 4D0BB 5E24E 1MFBL 4HMEA 4KV5F 3VFMB 2ID5A 1JZ6A 1RPQA 1DR9A 4J12A 3WFBL 1GH7A 4WW2A 3U4EA 5JW4N 3ULVF 4ZS7L 1XR9A 4MWFB 2CK0H 2QBWA 3V0VB 4RGNB 4KRPB 4J8RA 2ZUQC 2VITA 1F4WL 4BELD