1ZVHA

Crystal structure of the vhh domain d2-l24 in complex with hen egg white lysozyme
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
b'DVQLVESGGGSVQAGGSLRLSCAASGYIASINYLGWFRQAPGKEREGVAAVSPAGGTPYYADSVKGRFTVSLDNAENTVYLQMNSLKPEDTALYYCAAARQGWYIPLNSYGYNYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
molecule tags Hydrolase/immune system
source organism Camelus dromedarius
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
total genus 30
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvhA00
4FQXD 4PJFB 4V1DE 4KQ4L 3KYOA 2K7PA 4WV1B 1RURH 5HDQL 2AQ1A 2VDOH 4YAQA 3ALXA 1TNMA 3VXUA 3T3MF 3X14B 1HXYA 4RIRA 5EORH 2OL3H 3MACH 4FQHA 2MCG1 3GEWB 4PB0H 3ZDZE 2ZUYA 2DB8A 3G08B 3IJHA 1YPZA 1ZAGA 4RRPA 1WV7T 4F7PA 2CGRL 1RIVH 3C9NA 3TIEB 1KPVA 5H2BA 4QGYA 3VXPA 3UTQB 5DD0H 3QUZC 1D5BA 4TULH 5I1GL 3D3VE 1IGCH 4XC3H 4PJ8A 4R4FH 3GJEB 1C1EL 1HHKB 4WU7A 2VDLL 3PL6C 4WU5B 1A7QH 5EU7E 2FX9L 4HFUH 2AJ3A 4KKLD 2FX8L 1CG9B 4XAWH 3OAZH 3VCLA 2J6EH 1DBJH 5DQ9A 4NC1E 5JHDA 2MHAA 4C56E 3S9DB 2IQAA 1J10A 3IB4A 1U41A 4Y4HB 1G6VK 4YDKL 5D7IF 3HRPA 4F8QA 5FM4A 1QFPA 4EOWL 1OF2B 4PJIB 5IMOA 4YBQD 4I18B 4GRWH 2XTLA 3V5HA 3T0EC 1NAKH 2BXZA 5EOTB 4ONGH 3QWQB 5IFJB 5INDA 1IQDB 4OZIE 4HJJH 4JRYE 3CZFA 3MJGX 5F9AC 2C3VA 3GSUA 3O9WB 1G7HB 1I7TB 5FDWA 2X40A 1FFRA 4LCWE 3GKWL 3QUYB 5DJDB 5I0DA 5I8OL 1YMMB 5CILH 3V0VB 5T1LA 1VGEL 1FZMB 3U9UB 4P9MH 4PJGA 4WFGE 3P0GB 2FX8H 4X7SL 4Z7WA 3VMPA 4OCNC 1KPRB 1AXIB 2B4CL 1JV5B 4P2CG 4GO6B 3HS0A 1OGAA 4PLJC 12E8H 5CEYA 3IFPA 4IRJC 4M48H 4JG0H 5DGQA 4JN1L 4OBRA 4LEXL 1Z9LA 1ZLUK 1KTDA 1DBMH 3STZA 3O2DA 4HK3J 1CR9H 3BD5A 4LLAA 5EUOA 5FYKL 3UEZA 1HDMA 3HB3D 4MJ4A 4ZUTA 4AENB 4LAQH 4RGMB 1XGTB 5CP3A 3TH4T 1EFXD 1YY8A 1ZHNB 2ZUUA 3H7BB 2IJ0C 3W0WD 4HUWA 1ONQB 4EBQL 1B4RA 5EU5A 2IQ9L 1Q72L 5GISL 5I1GH 2OXGA 3RI5K 1IM9B 4IHOB 2WUCL 3GKZA 4GKZA 5H37G 3H3KA 5I8OH 5E24E 4YXKH 4LRNL 2HP4A 4QOKD 3T0XA 5SV3A 4ZPTB 2P24B 1C12B 1IEHA 2DIJA 3P4MA 5IMMA 1FNEB 5L0QB 1M7IB 1B88A 5GS1B 5HHQB 1RU9H 4NZTL 3GRWH 3ZHKA 5CEZL 1KXVC 2FWOA 4P5TC 1RFDL 1FVDB 4CMMB 5FDYA 1S9WB 4G42A 2W0FA 4PRPA 4L1DA 4A2MA 1ZLSL 1N4XH 3QG7L 1YYLL 5L6YL 4MJID 5DJ2A 4EDWH 4MZ2A 3TBVB 4CNIA 1YEGH 5I9QC 1GZPB 1T22A 5IOPA 1HE7A 4KRPB 2EDHA 3L3OA 2YHGA 1W8NA 1DDHB 1FC1A 2A0LD 1J11A 2WIMA 5IBTL 4I2XE 3U7YL 3KDMB 3O4OB 1YECH 1ZA3B 4HS6B 4YDJA 3L9RB 4FQ2L 4PJCF 3T4AA 2F53E 4JFHE 4NO5B 3QDGD 4V1DD 5GIRB 4PREA 4L1HA 5IM7B 3B2UC 5A40E 3K81A 1JN6A 4LSUH 3RTQD 1Q9LB 4KUCD 5TH2B 1FHGA 2DLIA 5F9JB 5CUSH 1NFKA 5GRUH 1HKLL 4GW5A 3E0GA 1MI5B 4ODSH 4Z7WF 2AW2A 5HDLA 1I1AA 5EBMB 3OKOA 2VERN 4TVPH 1LEKB 1R3IL 5E2WH 5E6YA 4LASL 5FYJD 5INCA 2CIIB 3SE4C 3AY4C 1EHLL 2ATPB 3QEQB 1KIRA 1FH5L 1N6QL 1CFTB 3LEXB 4OLZH 1TVDA 2R0WL 4UB0H 1MAML 2WLYA 1SMAA 1BREA 3PWNB 4WU5A 3WD5L 4PIRF 4CJ0A 4LNRB 1T5WB 2NXYB 2R4SL 5DK3A 1P7KA 3ZE0F 2DQEH 4ODXB 5E1AB 1NUFA 1IFHH 3S97C 4L3ED 5EN2B 4L8SC 4JM2F 3SDDA 4LQFL 3RWIB 3ZDZF 3OF6A 1UCBH 2PF6A 2X7LA 2D03H 5IB2A 4NHUA 4DEPC 3X14A 2MFNA 1DQJA 3VW3H 1QKZH 1R0AL 1JGDB 1LWRA 3NH7L 4N0UE 4P4KC 4XPTL 5DQ9B 2R1WB 1P84K 5D5MB 3LCYA 4WUUB 3V8CA 3S4SG 1S78D 3ECBA 4F7CB 4NKDA 5T1MA 4AL8L 1QSEE 3H2WA 2E8ZA 5IV2A 4XNZC 5D7LE 3LN5A 3IFOB 2Q8BL 1MCKA 1VEPA 5IVXA 5DJYA 2V5RA 1I8MA 4I48A 4LCCA 4S10A 1N3NB 1DEEB 1WAAE 4XGZA 3BQUD 4DCQB 2VDLH 2J4WL 1AP2B 3FO9A 1ORQB 4JPVL 4S2SB 1CD9B 4Z7UB 3NH7H 4PJ5D 1EGJA 4NNYA 1MIEL 1P6FA 5GS0H 2C4FU 5DURD 1IL1B 1Z0NA 2Z8RA 2AABL 1WWCA 3JVGC 3NPZB 5CD5D 3ULUF 5T3XH 3KYKH 5TF0A 2NTSP 3D3VA 1S78C 5LBSL 4WDIA 3O0RH 4M4RA 4DOHB 5C0AD 3RVVD 3WE6B 5E9DE 3ZKSD 4Z8FH 1T5WA 1VENA 3IDNB 2KKQA 4HJGA 5K93A 1SBSL 1F3JB 4MVBC 4NN7B 3PNWB 5I6XC 1MIML 1CLCA 5ISZA 3QP3A 5FM8A 3KG5A 4S0SD 2XWBB 3ULUC 1HZHL 4M7LT 1UKTA 5AYUH 3O6KH 3QA3B 5ESAA 3BQUC 3VFNA 3ORJA 2DQUH 1E6OL 5FIEA 3ZTNH 1NC2B 2QADB 3AS3A 3IFPB 4G9DB 3BOVA 4ZPVA 1OGTB 5C0NC 2R8SH 1SY6H 2BSSA 5IF0A 3I6KB 3PJSA 5IESH 3LB6D 3WKML 1AO7D 2YD9A 1UYWH 1GZQA 3K8KA 3SDXB 3ULVE 1IARB 2DS4A 3U2SA 1MCIA 3L7EB 4JDVB 3SDYH 2MQ3A 2ZKHL 5MEOA 3QNYB 5BVPH 2C5DC 4H0HB 5KS9E 4CGTA 1N0LA 1V7ML 1KB5L 3MV9D 1HXYB 4JDTL 4X7EC 2QHRL 1HQ4A 5BQ7A 3N1GC 3HMXA 2HLFC 2JJUA 3CFJB 2Z31D 2ICWI 3D18B 4WI2A 1QQDA 1LE5A 2OZ4A 2ZPKH 4ZFGH 4HD9A 5DJXB 5HHQA 1JVKA 3KS0J 3OHXA 4M7LH 4Y8AA 4XNMA 4GG6E 2MOVA 2R2CA 4D9QE 4XXCA 2VOTA 1OTSC 5LWYH 2UUDK 3BW9B 3W0WB 2ZCKH 2QV2A 1T5XB 3FQWB 1MWAB 4N8PA 1KNOB 3O0RL 4WGWB 5K9QI 4HUNB 1BZ7B 2RCSL 5ALCL 2YPKB 1MFEL 1JZ5A 5DJCA 1TLKA 3DHMA 5JW5A 3O81A 4WW2F 2HKHL 5E2UL 2G60L 5BJTA 4WV1C 1K8IA 3WDHA 2NY5C 3MNVA 3NFPB 4OGXH 5D72H 4OZHB 1H3PL 4TUJA 3R0NA 2Y7QB 3ULSB 4K3HA 3ZDYE 3SDAB 2IBGA 4D3CH 4TVSa 1CICD 1G7MA 3HE6A 3VH8G 4U1JA 5CD5C 5HVFB 5JXED 2HLAA 3JBG7 3AU1B 5D7KD 1EFXA 4PLNC 4GKNA 5JR1L 5IJVB 4ZSOA 2VLRE 2YPLE 4BSWB 3LRGA 3T4YA 4GH7B 4Q6YA 3UPCA 4PJGB 4POYA 4AL8H 1S9VA 2I5YL 1DP0A 2MCPL 5BS0B 4BH8B 4OZFB 2Q8BH 4DK6A 3MLVL 1R5WA 2NY5H 1RK1B 1TJHH 3PJSB 2CMRL 4OZHE 5CKAA 5SWSE 1U2HA 1QBLH 1ZA6B 3H9SA 5CJOH 3PWPA 3FB7A 1JZ2A 3GSQA 1K5NB 3KPRA 4N1HB 1T6WA 5T3ZL 3GMOA 1K8DA 4OGXL 3EFDH 4H26B 3MFGB 5I76B 4LCWB 1U95A 5C0ND 4DAGH 5DJ8B 5HI4C 3RWGB 2EDOA 4WW1A 3MV01 3RWCB 3ARZA 3BPLC 4NJAH 3MR9A 4OUUA 1IAOB 5F3HA 4ZUUA 1VFBA 3V4VH 3H9YA 3BDXA 3HC3L 4M5YL 5IFHH 1II4E 1NUDA 2YEZB 5MHSE 1DBBL 2ADIB 8FABB 4XCEB 1KLUB 1V3MA 1X5AA 2DQIL 4Y16A 5IJKC 2I26N 4R2GB 3S36X 2GTWA 1J1XL 4FFVC 3WNMA 4XP6H 1NC4B 4BH7A 3RWDB 1U91A 4MQXD 3D3VB 1CFVL 1FP5A 1ED3A 1MAKA 2BFVH 4LARL 1YPZE 2PXYC 2IFFL 3VXTB 1NMCB 5SWZA 1OW0A 5DD0L 3G6AA 1NPUA 3UJIH 5AYUL 3FB7B 1T7YA 2VZOA 4MXWH 4QF1B 1UVQA 3LDBC 3FOLB 4RAVB 2EDNA 2VN7A 1TJGL 3MGTA 1WLHA 1J8HE 3S4SA 4G9DA 1U8PB 1IGML 1PVHA 3LRSA 4GXVL 3U30B 1BQUA 1AGCB 1JZ7A 3MRMA 3G6JA 4YQXL 3EGSA 1RZFL 1QYGL 4PJ7F 3D0VA 1ZK9A 1B0WA 3BH9B 3C2SA 3VG9B 5BO1H 5DWUH 3OAYK 4RFEA 3O45A 4XNZB 4RAUA 4X5WA 3O6FB 2BVQB 1G9NC 4MNGA 3F12A 2XKNA 3WHXA 3VRLE 2HJKB 3IDMB 4X4ME 3OXRB 1A7OL 1K6QL 4HDIA 4LLVA 4FFVD 3BGFC 1V05A 1PJ9A 2ZKHH 1DVFB 3DV4B 4QRRA 1RK0B 4W6YB 3RY5A 4Y0GA 3TM6A 3O41B 1D6VH 3MBXH 4L8CA 4APQC 5JIHA 5K59F 4Z7VE 3P4NB 2FSEB 3FKUS 4ZFOB 2UUDH 3AFLA 1X44A 3K46A 2P8MB 2VDKL 4IDLA 3LQMA 1DL7H 2GITA 5L7XL 1N6UA 4J3TA 1HI6A 1U42A 2J6EL 1KJ3H 2HFFB 2Q86B 5I1AA 1T5XA 5HYJD 4U1IA 4AYFA 1I3GL 3O3DB 5IMLA 3I75B 4JPWH 1YNLH 3ARFB 2PW1A 1BBJB 1WISA 3WFEL 7CGTA 4HUMB 5ID1B 1CDHA 3HMWL 3KYMA 5IR1B 3EOTL 4DZ8B 1VDGA 2Q3ZA 1CFTA 1AQKL 1QLEH 4P49A 1TQCC 3BGMA 4B7LA 1C5BH 5C08A 2DI7A 1DZBA 4IRZH 5D2LF 5HI5C 1E27A 5ECJE 2XZQL 4M61B 4POZD 1F45A 5GRZA 2IBZY 5D70H 3S35L 2E6PA 4OKDA 2R1WA 1NMBH 3HNVL 4QY8A 4HCRA 5CJBA 4R4BB 2X4RA 3VFUA 4IOFC 3MV9A 2NY4D 4FABH 5CP7B 1UA6L 4XBEH 4JFDB 4WGVB 4NZUL 4ZFOL 1T66C 4NBZB 2Z31A 2PW2B 4M9OA 1JPSL 4F57H 1JGLH 2Q3AA 2P5WD 2EYTB 2R2HA 2JJWA 4KY1L 1X5ZA 3MRMB 1M7DA 1WBZB 5AD0B 2V7HA 3L3IB 2H32H 1KLGA 3QH3B 5KTEL 3QUZD 1BIIB 3P73A 2NY7L 4FQLL 3TZVC 3PWNA 4I77H 3EZJB 3C8KB 2ZSVB 4HUVA 3NFNB 4NBXB 3PHSA 2ARJB 4XPGL 5CEXB 4J3VA 2PUQT 3LH2L 3DI2B 1NLBH 5KVMC 3MQIA 4NHUB 2JK5B 1OLZA 3FFCA 2IGFH 1WCBA 4V2BA 4JHAL 4QRRB 1IGYA 2HT4C 2IQAB 1OW0C 3WDIA 3REWA 2A77L 1NL0L 4OIBA 2C3GA 5FYJL 5CBAB 2GI7A 1U3YA 5JOPE 4O9HH 3CDGA 8FABA 2ZSWB 4P5MB 3VDCA 4HF5H 4YK4C 3THMH 5EO9B 4Z7UF 1GRWA 4YHIA 5F9DC 1FL5B 3SJVB 1FNLA 4IJ3C 1G7PA 4OUUB 4L3EB 5F7NC 2ARJQ 3MRBA 1KYOJ 1I4FB 1N8ZB 4JHWL 2HVKB 5AYQA 3SKJL 2VJXA 4Q9BA 2VXQH 3FJTA 5E99H 1P7HL 4NNXB 4OJFH 4JFFE 4OLVL 3U1SH 4FRWA 2LVCA 3TBYA 1AQKH 1CQYA 1QLEL 4G8GB 1D6EA 1JYNA 4KMQA 1CDGA 3B6SB 3PV6B 1LE9A 3F7VB 1I8LC 1JV5A 2G2RB 3JV4B 5TH2A 3MOAH 4F9LA 1PY9A 2P44B 4BJLA 5DD1L 4NP4H 1DEDA 1PEWA 4MAYD 1NFDF 4EBQH 2AV7A 2WWKT 3IF1B 5DURB 2UWEE 3VG0H 2P49B 4MHHG 3T0WA 4M6NH 4P5MA 4R4NC 4KKAC 4YFLF 1MCEA 3MLYL 1LK2A 2H1PH 1ZTXH 2QTEA 3BIKB 4OGZA 1RMFH 2FB4H 4QRPD 4Y4KA 3VFGL 1J05B 1OTTD 3OX8A 3C6SA 4NQVB 4MA8L 1QFWL 1I85A 1DTUA 4JO4L 3S36L 5TGBB 1LE5B 5SWZB 5CD3A 4JHWH 1AI1L 3MUGB 1KIPA 2NXYC 2UYLB 4ONFH 1WZLA 4GRLD 3ZE2E 1OT2A 2IFGA 4G6ML 4RBPK 4X6DB 4MVBD 3FT4A 3MCKB 5LCVH 2BVYA 3V6BR 4N0RA 2ENYA 3DX6B 3PXHA 1TQCB 3EO0B 4DVRL 1VHPA 3TJEL 5HYSA 1CDYA 2ITDA 5BOPA 4L8SA 4ISVB 5C0CB 1KCSL 4Q6IC 3BISA 2DWEB 5EZJA 4U2ZA 4MAYC 3OGOE 4G43B 4KQ3H 4RAUB 2X1PA 4U3CA 1M4KA 1J12A 5ETUB 1U3HC 3F5WB 5CHNA 3RL1A 4WFGD 4XBPA 3T1FB 2GY5A 1X5XA 3OKDB 1KEGH 4NCDA 2D7QA 1T21A 5D6DA 3RDTA 5D2NE 1QHOA 1SJHB 3H9SE 3WLBB 4BK4A 3KPRB 4BQBA 4M43H 3UTSB 5E8EB 1E28B 3TBYB 1UZ6F 1PEZA 3TA3C 2HAZA 1NFDA 5DJYB 1A4KB 1F90L 43C9A 4FXGB 2UVEA 3FFCE 4G5ZH 1S5HB 1AC6A 4LSDA 1EEQA 4OCXL 3FN0H 3UO1H 1OAUH 3BGMB 1N8ZA 1QA9A 2J8UE 3ABZA 3RTQC 1V3KA 4X99B 2GW5A 3WIFB 1MNUH 2DQDH 2CK0H 1IC1A 5HSFA 1RVFL 3X12A 4LPUA 3VWJD 5FK9B 3QULA 3NN8A 3PWVB 4XCEA 3UP1A 1FLTX 4LDOB 3RPIA 4AH2B 4IRSD 3V7AG 3C5ZC 4NKQB 1G1YA 2V9RA 4WY7L 2OK0H 4MNHA 2B2XH 1P4IH 2R0KH 4LVNB 5C07A 3TIDA 1BBDL 1DVFC 3SDAC 3CK0H 3IAQA 1S7QA 3DTXB 5T3XL 1FO0L 4JO3L 4U3XA 5SWSA 4HWNA 4JRXB 1U8IA 3BN9D 3LKOA 3FFDA 3PWUA 4JZJA 4QY8B 2ERJC 3GJFA 5D8JL 3BP4B 3VD7A 1A4KA 4S1RH 4F9PA 5IP4A 4WWKC 4JPKH 2BHZA 3UTPD 3HKFA 2FYYA 5CJXC 2A2QT 2H32B 1BECA 4Y19A 3T3PF 4HEPG 5FUZL 2IGFL 3GGWA 4HZLB 4KHTH 4NWTH 1FPTL 4AIZB 5ABDE 3VWJC 5T3XD 4KDTC 2EYTA 2R2HB 3U79A 3EJYC 1LNUA 5D4QA 4KAQL 3MRNB 1TPXB 4TNVF 5DRXB 4YZFE 3OPZH 5DC0A 1JGUL 4NKIH 3T2NL 3WLBA 1OP5H 4AQOA 3FZUC 2OBGA 4XNYL 3P11L 2VLKE 2HH0L 3ZYOA 4RFNC 3IJYB 5D2NB 3BUTA 3CK0L 1Q9WB 1V5JA 3U1SL 1H3XA 1FLRL 3LPWA 3PP4H 1E4KA 4Q0XH 4MNQB 2WP3O 2ADJB 1KGCD 3EIFA 5GXBB 2WUCH 2WBJA 4PB0L 2DQHL 4MNQD 2HT3D 4PG2A 3N9GL 4JRYB 3PHOA 3QQ4A 1WC7B 3HI5L 2VDKH 1DQQB 5C0IA 2HJKA 4F7CA 4N5EC 1EJOH 5DZOA 1FGNH 2VDNL 3SQBA 1JZ6A 3CDGB 3T0EE 5GRWA 4M1GL 4X98B 4YHOL 2DMBA 4PJDB 5CS7A 3W9DA 4F7TA 15C8H 5FO7A 3VI3E 4QXUL 4AY0A 2NR6C 4RMUA 4ETQB 3O11A 4DTGH 1EHXA 4A6YA 4K3DL 1YN7B 3U4EA 2D0FA 4IMLB 1WWBX 4OCRL 4QRTB 3FCTA 5HVHC 5EA0L 1G6RB 4Y16D 3KPQB 2D7TL 4XP4L 3DMMC 2OR8A 4JRXE 2IWGA 1IAKA 4RAVA 3X3GH 5IFAH 3R06B 3C60B 5JXEA 3IVKA 2QSCL 4NNXA 3WFHA 4HQQH 5JLZA 4ZAKA 2V7NB 3O4LD 5F9WB 2Q8AL 1LE9B 4PY8J 3ZYIA 1HH6A 4OCYL 5C09B 1EAJA 3JVGA 1JUFA 2CD0A 4JREC 2A6IA 1H8SA 1KN4H 2F5AH 2PTTA 5IJVA 4F57L 3VE0A 2YA1A 3LS5L 2RFXB 5CJXA 2B5IB 3UBXB 2C7UB 2M26A 1MCJA 3H0TA 4PRDA 2DKMA 1KOAA 2WM0A 5E08H 1CGTA 3CXDL 1QPXA 3RIFK 3QIUD 1D5MA 4UBDC 3Q3GB 5I1HL 2Z93A 1RMFL 1HNGA 1YEHL 4EI5A 2VL5B 4PP2A 3D39B 4HWZB 3QRGL 1CGXA 1NCWH 4ODWA 2IAMB 5HHMD 1X6LA 3BX7C 1NGWB 1LO4L 1D9KC 4MA1C 1Z9OA 4PGCB 4U1LB 2HLFD 5F7YC 4NQTA 1OP9A 5DXWA 4HX1B 2V17L 3VI4F 1G0YR 3BH8B 4MXVF 3EDKA 1KLFA 4M1CD 4JKWA 4HJ0D 3JTTB 2AXJA 4EDXB 2WBJB 4X6FB 2Q86A 5I1AB 1N6VA 1QLFA 4DGIH 1M6OB 2R0LH 4ELKA 2VB5A 1RZKH 2HG5B 2OJZH 2VQ1B 1I1YB 2BSED 2QKIB 4FNLL 5D1ZA 4ETYA 2PYEB 4ZO9A 4L4TA 1H3PH 3QEGL 4P2QB 3B2VL 4P48A 3RNQA 5F6IC 4QRPE 4R2GC 1XGYH 5I1HH 1Q94B 2YWYA 5I2IB 4JDZB 1SBBA 4QYOB 4PJ5B 3RDTD 2RCSH 4U1MB 5ALCH 3MRLB 2OXHA 3O9WC 3NIFE 2D0HA 3GZKA 2JELL 1RFDH 4QHUA 4TUJB 3QNYA 2LU4A 5D7LB 5L9DL 3MBXL 4G6AD 1QSEA 2MJWA 4Z7OF 3SE9L 1CICC 1ZA3A 4X9IA 4ZXBB 4Y19E 2FDBP 2ADGB 5FGBC 4GBXB 3L6FB 3ZTJG 4TSBL 4BQ8A 1I1RA 2UZIH 3EYVA 2VDQH 1GAFH 5C0RH 5TDNB 4KKCC 4Y5VC 1ZGLA 2EYSA 1KNOA 2XG4A 4ZSOB 2FR4B 2BJMH 1T66D 2DQFB 2QR0B 1BOYA 4W81A 3C8HA 4NFBA 3FB8B 5FKAB 5F1OB 4Y2DC 3DO3A 2VLKA 2CRZA 3SHSA 1SM3L 1B90A 5KVEH 3QRFM 2MSPA 2FEDD 5JQ6L 1H3GA 4I2XA 3DURB 4H25A 4G6MH 5J6HA 3SJVE 3HR5A 4XMPL 5IUSA 3UPAA 4IRJA 3T08A 4PTTA 1WZ1H 2ZSVA 1BX2A 4DKAA 4LVHC 2OI9C 2CLZB 1MELA 3F6IA 1FQ9C 1Z9MA 2ZJSL 5TDOA 2P5WB 5I8EB 5C0FB 1KJ2B 2IPKB 2GT9B 5KS9A 3KWWA 3QUXC 4EQ2A 5CZKA 3S88H 2NMSA 1X7QB 3WUWA 3GMRA 4JFED 3SOBL 1FGNL 5EPMB 1IM3B 4UT6L 3WXVL 3HI5H 2RJMA 3AAZA 4ODUA 3WHE1 4OV6F 1YJDC 3NZ8B 5E70A 1B4JL 5CUSL 1KUMA 1HSBA 5E2VH 3QNXA 3ALPA 4PGBB 5EUOB 1U3JA 5CJ5A 1HHJB 2BJML 5C0GB 3OKKB 3OQ3B 5D2NA 2HMID 5I2IA 3MRFA 2DDQH 1UM6L 4Y2DD 5FKAA 3L7FB 4DCQA 3FAWA 1HILA 3LY6A 4OIAA 5C7XL 1WK0A 1AIFA 1X5JA 4WHTA 4LSPH 5I1KL 3B43A 3L95B 3QA3A 4FG6D 2Y07H 4J8RB 1MH5B 4MA8H 5BZDB 2APTA 5ICZB 3FRPA 1R5WB 2D9QB 1EEUA 1YEJH 3SKMB 3L6FA 2Y72A 5IQ9A 1IGIL 4O58L 5D9SB 4J1UB 4KI5E 3D6GA 4WNQB 4PJGF 4U05A 1SYSA 1IRAY 3Q6FB 3IVKB 4JG1L 1QBBA 4OTXH 2J6EA 4Y4HC 4WI9A 3X11A 2FBOJ 3IFLH 1EMTL 4Q9RL 1KG0A 5GGVH 2PO6C 3N1MC 3NTCH 1SEQL 3EFFB 3TPUB 4RFNB 4RAHA 5DTFA 1IILE 4LHUD 1G7JA 3GJFH 5SWQA 4FP8H 5EUKB 5AWNL 5TGBA 3WNNA 3GSRB 5IG7A 4B0MM 2DDQL 4OLYL 2C26A 4LRNH 4U6HA 1CXFA 3BPCB 1OAYL 3OKEA 4HKBB 2GAZA 3ARGA 4PUBH 4TSAL 4OLXH 2W65B 5MERA 2RR3A 3M1BB 3SCMA 3U7WH 2E27L 1P1ZA 1CGUA 3NN8B 3IDXH 2YC1B 2NY2D 2X4PB 1F3JA 4J12A 1RURL 5HDQH 5JORB 1WITA 4GRLA 3S6CA 5IVXF 1HH6B 5JXEC 1KB9J 5TPWL 1LO0L 4YZFF 5E6IB 2DLFH 4FQJL 3C2AL 3V5HB 4MX7B 3RTQA 1ZT7A 5L2JA 1TTUA 4Y4HD 4Z7OE 3EYQD 5IB3B 1JGEB 1FIGH 2BY2A 1UQSB 1BHGA 3X11B 4N68A 2YZ8A 2DWDB 3RWJA 2PO6D 3JV6B 2AV1B 2AQ2A 3IJYA 2GHWB 5LAXB 1G0XA 4MNHB 3UBXA 5KSAA 4H88H 3SY0B 1S7WB 4RRPG 3RU8L 3G5XA 5C9JA 3C60C 5BZDA 4MD0B 4X6EA 3QUYD 5E7FA 4PGDA 1U3HA 4YO0A 2ICEB 4UZGA 2OLDA 4OUOA 3DWTA 2VDMH 4YDLC 5KAQG 5EZLA 1NGYA 3VRLF 2G5RA 4KJYA 3MLPA 3QDME 3HE7D 1BQLH 3TA3D 2A73A 4DZBB 1LO0H 4JFHD 3DSNA 1LGVA 4NUGH 4R4BA 1OWWA 3HAEH 1DLFH 2CSPA 2H32A 2BZDA 5J1AA 4LPXA 3OKMB 2GUOA 3MXWL 3T0VA 1TVBB 4O2CB 4P5TB 5DD5H 2CDEB 3QWOA 4M7ZB 1CDJA 1P4LB 1XCQA 2X2YA 1S7QB 4HLZG 4X7FC 3RJQB 5TE6L 5J06A 4K94L 4KU1A 3ZKXC 4FG6C 3RAJL 2XTJC 3UTPE 5D1QD 1C12A 2BNRA 2CH8A 2YRZA 4KTDL 2DMCA 4K8RH 3VWJB 4PR5B 1JF1A 1F3DH 5FA3B 4ODTL 3GK8H 3CU1A 4JPIA 4PP1D 4KUZL 3B3IB 4FZ8H 5KSUA 5CMAA 5K9KA 7FABH 4DW2L 5C0JB 1JGVL 3OZ9L 3S7GA 3L5WB 2ZWLT 5GJTH 1BAFH 3ZYZA 4F9LC 5C9KA 1WCQA 2E27H 3EDJA 5FKPA 4QXGH 4MA7L 4N9OB 5JDSB 1OGAD 1IC5L 1AJ7H 1OAQH 2R1XA 3NPSC 5F7EL 5FECA 4JFZL 1F4AA 3MRIB 1MPAH 4GKNB 5HTSA 1AD0B 1BIIA 4F3FA 2APBA 2FGWL 4ZO7A 2Y9RT 1AKJA 4OZGE 3IDIB 3BYYA 2FJHB 3OKDA 4XP5H 2VLLB 3HG1E 2BOBA 1AY1L 4URTB 1D9KA 2O93L 1O7SA 3VFSB 2E9WA 4IS6A 3OGCB 4PREB 5IM7A 2I27N 1T89C 5DFTA 4PJDE 3RY4A 4XRCB 1UG9A 1FNEA 4JQVA 5CJ8A 4JKPL 1QOKA 3CFDB 1HEZB 1CICB 5ISZB 3VWJA 4FQPA 5FCSH 3MGOB 1G0DA 4N9GA 4PRIE 4S1RL 5DUPH 1ZLWH 4XCNB 5D5MF 2DD8H 3S3JA 3MLTB 5JO5B 1G9EA 3PV6A 3N85H 2X4OB 1J0YA 1PLGH 4WUKH 5GZNC 1F4YL 3QT2A 4DVBA 2OTUA 1NDGA 2A9MH 3FO2A 4XC1L 3GJFK 2IPTL 4RQQB 3D85D 3WO4C 4U1GB 1FYHB 4FQQB 3MROB 3OR6A 1N64H 1XGQB 2V2XA 1PKOA 4P46C 3MRBB 5DD1H 3ROOA 3TF7C 4D0DA 1A2YB 5I1CL 3MRJB 5FYLE 4ZS7L 1YEGL 1PG7W 1BZ9A 4LVNC 2ZNXA 3O3AB 3ZDXF 5F9WC 1UKSA 1DN0B 3EBAA 3VFWA 4PV8A 4AM0A 5IMKA 3MRPA 2NXYD 4K7PX 1NCBL 4Y2DA 1NCTA 1OTUD 3MV11 3PDDA 4KV5E 4LF3A 1YNTB 5DFWH 4OSUL 1OB1B 2C1OA 1XF4B 3U0TA 5A2LH 2D31B 2DJSA 3GI9H 5F9OL 4PGZA 4CDGC 4HUXA 5GS2D 4ZAKB 4WWID 1BVLA 3LRSB 1G7HA 2EDWA 4Q9QH 5K9JH 2AJUL 3MGTB 1R3IH 2X4SA 3U6RB 2FX7L 4E0RB 1MAMH 2Y6SD 4P46A 1AD9A 3C09B 4KDTA 2VE6B 3RVUC 3UDWC 2FGWH 3MTRA 4KVCH 4UIMB 4X4MA 1L4IA 2ICES 1QG3A 2BK8A 2X4NB 4TNWK 3GKWH 5I17A 3MNWA 1ES0A 1J8HB 3O4LB 1OVZA 3DX8A 4RZCA 3G6DH 3D39D 2WBJC 3RGHA 2Z8VC 4PLJD 1JRHL 4LKCA 3QXDA 1X7QA 1JWSA 3MMEA 5EOCJ 1Q0YL 2BMKB 5DA4A 3DX9A 5D2LA 3ISWA 1TCRA 3P9MA 4G42B 4U6VL 2EDJA 4XI5D 1V7NL 4XPBH 3K8MA 2HTLC 3LHPL 4EIZC 4M03A 4HKJB 5C0DA 1NCCL 4H1LH 5T5FL 1YEKH 1QRNE 1ETZB 2HG5A 4G8GD 1A7NH 2J12B 2ZP0T 2CLZA 3B5GA 1BJ8A 4M6AA 1BGXH 1XCTB 3I75A 4WHCA 4G9FB 1VKXB 2OR9H 3QWOB 4CVUA 5F6HJ 3V6ZA 5KSAD 3SN6N 2IANA 2BC4B 4Y1AB 5DGRA 1N5AB 4XVTH 1MCCA 3CXHK 4HIHB 3VGFA 5D7JA 1MI5A 1U95B 3KPRD 1QQDB 5TQ0H 2NY1D 2IALB 5HYJB 3TCLB 3QEQE 3VXMA 3ZKND 4O51B 2YK1L 4E0RA 2CDGA 3HMXH 4QXGL 1IEAA 5EIIB 3AM8C 4HS6A 1JYWA 3WKNA 4KGJA 4WW2B 5D7SH 2VR4A 2XQBH 5B3JE 1WUNT 1CK0L 4YGVA 1IKFH 3DX7B 4BH7B 4PJ7A 5FYJE 5EU3B 2QHRH 1H8NA 1GJIA 3EOAB 4NO3B 5EN2A 5SX5H 2X42A 4Y1AE 1L7TL 1D3CA 4H20H 4ZSOE 4F80A 4WWKA 1NLDL 3OV6A 1UH2A 4UIMA 4XPTH 4NKOA 3MA9H 1IMHC 1EJOL 4P59H 1C7SA 1UJTA 3CCHB 3A67H 4IRJD 4JRXD 4UINL 1A6VL 2JK5A 5D6CA 3VI4E 1CLOL 5CJQL 1FVEB 3ZKNC 4AEHL 2VLJB 4PGEB 5FGCB 1AXTL 3DI3B 4FQLH 3QIWB 4HV8B 4MXVE 1OF2A 3MUJA 4PJIA 5IMOB 2Y1VA 3VRJB 2J2ZA 5EA0H 1CD0A 5D2LB 4G80A 4LPCA 1EHAA 4BUHA 3ARDD 2OTUB 2UZIL 4YFLI 4HDIB 2GSGB 2AXHA 4ZAKC 5FO7B 3DO7A 4YR6A 1A1OA 4HSQA 3QCVL 1J0IA 3H7BA 3T2QA 5D7KE 1MAJA 2XY1A 4D0CB 1QBAA 3UYPA 4P2RB 1NGQH 1FVCB 3FOMA 2D3VA 4NO0B 4MQ7B 5JW3H 4HWBL 2DTMH 3JWNC 4C56D 4I18C 4Z7UE 1FIEA 2F53B 1BOGA 2NY0C 2VL4A 1QR1A 4XHQA 3LKQB 4JM2A 1I1FB 2DWEA 4LGSB 1D6EB 2NW2B 1YEIL 3BKYL 4OZGA 5FCUL 1OGAB 1ZVHA 2EDEA 1XIWD 4DK3A 5JMRA 2AGJL 4FQQA 1U36A 4MQTB 3TT1H 5CHNB 3TCXA 4FQHB 3PIQA 4I5BA 3BVNA 3KXFD 5E2JA 1AFVH 2B7DT 1Q0XH 4X8XA 3VRJA 3HZKB 1JGEA 3HC4H 1KIPB 4HCRL 3LMJL 1VADA 5D93B 1HH9B 4LIQE 2EDYA 3OG4B 1XGUA 5EULV 4MLSA 4P23D 1HHHB 1NCNA 4WI6A 4DZ8A 2C4XA 4Z0BH 4PJCE 3R06A 3MRRB 5JMOC 1S7RA 1JF1B 4HEME 1CGVA 1P1ZB 2XXMB 1DANT 1MY7A 2NY1C 4HWBH 4NCC2 1KCRL 2EDXA 4HWZA 2PCPA 2CKBL 3GK8L 2XPGA 1GHFH 1VACB 2EC9U 3TBWB 4U1KA 3MNWB 3C6LD 4HXBL 5GS0D 5DD6A 5KANG 3V8OA 1WZ1L 3BYTA 1M71A 5DD3L 3GO1H 4H1LB 3KVQA 5I66A 1YEDA 4K7PY 1SEBB 5ILTH 2VLJE 1GGYA 4OTXL 4BM7A 4FXLA 4HW6A 1C5DB 4ODXA 3B9KC 2XN9E 2QEJA 5IVXE 1QSFD 2DI9A 1AH1A 4LSSL 1AE6L 3JWOH 1RJYA 4L8BA 5DVNA 5J11B 1M7DB 1CIUA 5C8JB 2XKNB 3WHXB 4YK4B 2FO4B 4GAFB 1KENL 1K4CA 2DM2A 2IEPA 3MXVL 4XRCA 3GBNL 4RX4A 3PGCA 5IT2L 2I25N 5ESQB 1RZJL 1N5AA 1HCVA 4TVPE 4G3YH 5FGBA 1FAIH 3IU4H 4TSBH 4DGVH 3ULUD 5DQJB 2FECL 3CLEL 3MJ7A 4OD2A 5FUOL 5DMGC 4YC2C 3O3BA 1NANH 1PLGL 3L3KB 5LVEA 1IAOA 12E8L 1CI5A 4H8WC 1IGYB 2R8SL 4LBEA 5E2WL 1W0YT 4J6RH 2RIKA 1T04B 2Y23A 5KTEH 4TVPL 3M17A 3VXSB 5J1AB 3EYVB 2DQTH 5C0DB 3LB6C 3RWFA 3TO2B 3QHZH 4ZUVA 4WFFE 2H26A 3VMOA 5EOQL 3O2WL 3H6JA 1ODAA 5D1ZC 4PY7A 2IH1A 5DJCB 4C59B 1F90H 3FT2B 2ATKB 43CAB 4K9EC 5TF1H 1JK8B 1FIGL 4Z77A 3I50H 3EOBA 1AGBB 3TIDB 3RVTC 3WUZA 3I9GL 5C0AE 3WS3B 1LO2H 1EA9C 2VO5A 4OZGF 1BD2A 2GSIA 3BIBX 3O2VH 3GBNH 3LSOA 3V0VA 1NDMA 1N0XH 4HKBA 3QXAB 4XNMB 3WS6C 5I9QB 4XMKL 5T3ZE 5D7IB 5KVEL 3FONA 5CGYC 3RNQB 2P8MA 2CO6B 3QHFL 4OM1L 5CBEA 4Q9CA 2BSTA 3K2UH 2IAMD 4S1DD 3KNBB 3RWIA 5D6DC 4LLUB 2ZCHL 3I02B 3CZJA 2B1AL 4PRAA 3T0BA 4Q97A 2IAND 4K7FB 3BZ4B 2VZ3A 1A7PH 1WSST 1CT8A 3VD9A 4QCIB 5TJWK 4UNUA 3RUGB 2DD8L 1AD9B 2EE3A 5JHLL 3LKNA 5HHOD 4RQQA 3PWPE 4CW1A 1SJEB 5IWLC 1P2CA 4JRWA 1NBQA 5DRNB 3OXRA 3FQTA 3WNKA 3V52H 3WFDL 4S1SL 4PJ9D 5D8JH 2IH1B 4QOKB 5C0CE 5AAMA 3QIBC 2LQRA 4M8QB 5DJZB 1H15B 2W59A 4YWGH 4E9LA 3MRKB 3DX8B 2GIYA 2D31A 5DQJA 5D7SL 2C9AA 2DTML 1MFCH 1F2QA 2X70B 3K4ZA 4UU9B 5JA9A 1DBJL 3D0LA 2JIXA 2X6MA 4IS6B 1BBDH 1U92A 2YPLA 3NIGE 1TTFA 1EFXB 4B7IA 3I6GA 4A6YH 4K8RD 5IMKB 1JMXA 4XMKH 3IYLW 1VFAA 4YDLB 5GGSY 2B1AH 3VXOA 1Q9LA 1DFBH 3QDAA 4P46B 4KY1H 4RMVA 4H20L 2FJFB 2BVPA 4JR9L 1RJCA 5IJKA 1HQRA 1CGSH 4RNRA 2LU7A 1JGVH 3OZ9H 5FYLD 3RFZC 2L7UA 2P45B 4OCWL 3EO9L 4P5TA 4UIKH 3VU2A 2V9TA 4LGPB 3E6FA 3MROA 4F9PC 4NWTL 4EUPG 1CLOH 5J12C 3MV7A 4PJEA 1X5IA 2OL3L 3M45A 2C3WA 1G7PB 4JZJC 4TUKH 4KI5D 4NQDE 4NKMA 4O2EA 4LKCB 4XZUA 2ZUSA 5KW9H 1WFNA 5D70L 3IGAB 1F8TH 4GXVH 3OL2A 2H26B 5DDHA 3VCLB 5L88H 5IGXL 5DUML 3QQNA 4X4YB 2GAZB 3ARGB 3GNML 1RUAL 4NM4H 4RGNC 4OT1L 1C1EH 2DBLH 4Z5RB 1GGCL 2JB5L 4CN1A 4M48L 2YWZA 4Z78A 2VZTA 3G5ZB 3W82A 1ITCA 2X4UB 3OKYA 1OP3K 1A0QL 1KIQA 2FCBA 1JJUA 1E4KC 2G2RA 3D18A 1U93B 1FSKB 2OP4L 2C7UA 3UROR 3KLDA 4BFIB 3P4LA 3EFFA 3TPUA 2MPAH 4ZD3H 1OPGL 5FXCH 2YR3A 4YC2B 5SV4A 4BK5A 4H1LG 3HLAB 3RVTD 3V6ZB 3CPLB 4XC1H 4LFHG 4YPGA 1I9IL 1U58A 5IV2B 4OLUL 3UYOD 3KPOB 4PBWD 1Y18B 3FN0L 3UO1L 3S4SB 2D0GA 1A6AB 1TTGA 4PRIA 3K4AA 1A3LL 3KR3L 4LSQH 4G7YL 2N7BA 3ULVH 2PXYD 2X09A 4HWEL 2CR3A 4XH2B 4L8BB 2YC1A 4RA3A 4OV5B 4UMGA 4MD0A 3E8UL 4X6EB 1FPTH 3CVHB 5F1NA 3FT3B 3HG1B 3K1KC 5IVZB 5CEYB 2MNUA 5J3HC 4NQCB 2EC9T 2DBLL 1D5IH 1LP9E 5ITFA 3ARED 3NFSL 4GKSA 5CIPA 2VQ1A 3D0LB 1Q1JL 2EYSB 2OTPA 2IMNA 5EORL 4MMXC 2OX5A 1QRND 4ZYKB 1R3JA 4MS8D 1DFBL 5JIIA 1YQVH 5D93C 2YRLA 4IRZL 4LQ1A 1UT9A 1R3HB 3ZKQD 5GGVY 2NXZC 1AGBA 4O2EB 3KXFE 3E2HC 3D9AH 4QHUB 5A2FA 2N1KA 1FRGH 1MFEH 3MLUL 4QRRE 1M05A 4PRNB 2F74B 3FTGA 4K8RC 1IT9L 4X4ZA 1U8QB 1Z2KA 3IXAB 2XWJB 3P77A 3VGGA 1QBML 2PR4L 3SE3A 2R2BB 5IB1B 2BNQD 1MCSA 1T0MB 3H42L 3J7HA 3DV6B 4P2QA 2I60L 3B4NA 1Q8MA 4JY5L 5E8DL 3VXUE 3QIBB 5DMKA 1YEIH 5EBMA 5GGVL 4AK1A 3CFEA 3LAFA 1QNZL 1MUJA 4U1SB 4M1DL 1YEHH 4NQCA 2DQFA 2QR0A 4DUWA 3R8BB 1WIUA 1NDMB 3FB8A 2W9DH 4WTZG 4ZOBA 2W07A 4L4JA 4M6NL 3P9LB 1H9VA 5F7DA 1I8LA 4YXLH 4KV5F 1Z9SA 2E9JA 4U4BA 5TDNA 3QO1B 1ZGLB 4M61A 2ADGA 5T5NG 4S1SH 1MLCA 4F15C 4PJ7B 1T89A 3BKCL 1PDKA 1H15A 2W91A 5I8CB 1AKJB 1AXTH 3ZDXE 3HB3C 2Q7YB 2YZ1A 4QO1A 5GRJH 4K7PH 4APQA 3G08A 2F8VA 4D8PA 2R9HD 3FB5A 3QDJA 5JNYA 3CSBA 1CDCA 5FO9A 1QBLL 5CJOL 4HC1A 2GCYA 5BZWB 1FCCA 4JZJB 1W72H 2VDQL 4HT1H 3WLWC 4KJQC 1WIOA 3C08H 4LNVA 4LQFH 3HI6H 5DWUL 3TT3H 5D6CB 3TVMA 3OWEA 3UX9B 4V1DA 2OK0L 4X80L 1HHJA 3CX5K 3VGDA 3CCHA 2X4OA 1AGDA 4OD1L 2OQJA 5HGHB 4BSVA 1QFUH 5C09A 5HYFA 4YUEH 1RK0A 4E42B 1KEGL 1CL7H 1NKRA 1QVOA 4XMPH 3QO0A 3H8NA 1WIPA 3S34L 3HMXL 3BPOB 2J8OA 3BKJL 5F1IA 4MNGB 3TYGL 4ZYKA 4OFDA 5I1IL 5D72L 5D7JD 5GHWH 4LLDB 2GYSA 3BWAA 2PR4H 1NCDL 4FOMA 2AJVL 2F54A 4L9LC 4FXKA 1TFHA 4N5UA 1VSCA 4DVBB 2PCPB 1YMMD 2JIXD 4U7SA 5MP6H 4JM2B 1UB5B 4TYUA 2BNUA 2EH7L 4MAUH 4YHYB 3KJ4C 2VIRA 1HEZA 3EAKA 5IB5A 4JM2D 3ZKMD 5IB4A 1UACL 3ZHLA 2VXVH 1HWGB 2DKUA 4J1UA 4QXTA 2FEEI 3O3DA 3BPLB 2BSRB 2HFFA 5E08L 3CZFB 4FTVE 3DROA 4LOUC 3TBTA 2EDFA 5EOCH 1GOFA 2HFGH 3U30C 3V6FB 1FFOB 1B0GA 4U1MA 3GJFB 1L6XA 4KXZH 1I9JH 3MCKA 3EYUL 5CSBA 3CGTA 1ZT7B 3EDDA 4PJEE 4PP1C 3OKEB 2EDBA 2YUWA 5FOBA 4I0PC 1BWWA 1HIMH 1C5CH 2IC2A 3NCCB 5BV7H 1NEZG 2X4PA 3O3EA 4GMSH 4FZEL 4XHJD 1CU4L 5EUOF 1FYTD 3WIIH 3OTTA 3VFOB 1MRDL 1ZHLA 4RGMC 4WDIB 3ZE1F 3KPMB 3NABL 3VXRA 1OM3H 3MRGB 4I77L 2BNRE 3OAUH 1H3UA 3C8KA 5F88A 3WV0A 2JB6A 4XP4H 2ZZUT 5KZCB 1Y18A 2X9XA 4IRSC 1INEH 1G7LA 1VERA 2R4SH 3C5ZD 4OZHF 2W60A 4ZTOL 4HUWB 1A14H 1P53A 2ICWJ 2Y5TA 1XEDA 5BS0A 3ZE2F 5C0AA 2KBGA 2BFVL 3VG9C 1T2JA 1GGTA 1MRFL 1S9XA 1MCRA 4X5XB 3OF6D 1MCPH 1MNUL 1FFOA 5J9PB 1G9MH 4HIIB 5IIEA 3ES6A 2CKBB 3GSNH 1KTLB 1OQOA 1T0NA 3HC0A 1AXSB 4E41B 2BERA 1IE5A 2J7LA 2HT4D 3N9GH 5I16A 5GIRA 4LLUA 4WJ5A 1YN6A 3O6KL 2YD3A 3IAPA 4P23A 3PL6B 1NUGA 3W0WE 3ZDYF 5TQ0L 1WZMA 1CGYA 3U2SB 2YN5A 2AJ3B 4FQJH 4OGYL 1EK3A 2RQ8A 3CSYA 1JHTB 5C0EB 1P7KB 2YD4A 4OZFH 5DJ2B 2IG2H 3VGHA 1MY5A 5DEZA 1CXHA 3GSUB 4QTHB 5HYQA 4X9GA 4K3DH 1X4YA 4RFOL 3G9VA 2ID5A 4NOBA 3PF2A 3S8WA 2MMXA 2NX5B 2XWJA 3P77B 4P5KA 3VRIA 5E56A 1KFAH 5HJ3B 2DYPA 2EE2A 2G75A 1MRCL 1NDGB 4MJ5B 1EZVY 3D3VD 3B3IA 5KSUB 1OAKH 4UOW0 5F9JA 5D9SA 4PR5A 4PTUB 2I60H 1MCWW 3UTTA 4GG6F 1QRKA 3BW9A 3W0WA 3T1WA 3RA7L 4M6OL 1CFNB 2GJJA 1QD0A 1ORSA 3TZVD 3PL6A 3EOTH 3UJTL 2DL2A 3ME0A 3RNKA 3PP4L 1YA5A 5DZNA 4QT5A 4PRIB 4HK0A 3VDAA 1BJ1J 1MFBH 3G6DL 3JV5A 2A6JA 1EEZA 1DR9A 5E94A 1YEJL 4I0CC 2LTQC 3U0WH 4EI5B 1XFPA 4MNQA 1BM3H 2DQGH 2H6PB 1DVFA 3QIBD 2OCFD 1JZ8A 2HRPL 4O2FA 4PJBA 3WXWH 5E5MB 3U48A 5MEQB 5IHZB 2HKHH 3BP5A 4L4VA 5E2UH 4UILL 4NJAL 4KXZI 4KVNH 3SGKA 4QOKE 4NZRL 2LFGA 5AG8A 1F13A 1ZGLM 2FATL 2ADFH 3EJYD 4PJHF 1OAZL 4XI5C 2OMNA 4F58H 4ORGB 4CMMA 3GUTB 4G43A 1IZKA 3CX5J 3AMLA 5EBGA 1UB5A 4U6YA 4X7SH 4LGRB 4PV9A 3RWDA 1TZGL 4I9WE 4I3SH 4RWHA 3NA9L 2B0SH 4WCYH 3FMGL 5MENE 3SE8H 2VLJD 4NC0B 3QEGH 5ESAB 1A2YA 1V7NH 2EECA 4XPBL 2DM7A 2PO6A 1RUMH 4X99A 1PG7X 3G5YB 5EU4B 4NUGL 3QCTL 5BV7B 1FFPB 1VPOH 9CGTA 5JPNA 3QB7C 1QBMH 1JWMB 4R7NB 4OF5A 1WZKA 3ZT6A 1KN4L 3KPPB 4Z7NE 4KVNL 5EH1A 4G7YH 3RWCA 1ZOXA 2E7CA 1KCSH 1LO3H 1KBGH 4XP9L 4Y7MA 4CU7A 3RBGA 1AP2A 1F6AA 1X4XA 3DVFA 4X6CE 2R15A 1FV1A 5FYKD 1NGXB 3BQUA 4KRPD 3QQ9C 5BO1L 3O8XD 3SGJC 1T0PB 4NQDD 2BVQA 4RISH 5IVNA 1RZFH 3QO1A 3T0EA 1GOHA 1Z5LA 2AKRA 2Z31B 3CDCA 2PW2A 4AMKH 4ZDHB 1CLYH 4JFPA 5B22A 1DLHB 2X05A 4OZ4A 1NCBH 5DTFB 4KFZC 3CFCH 1GGIL 1N2RA 1IGTB 2OS7A 4ZFFB 3RY6C 3BRFA 3CFBB 4X6BA 4Y16C 1S7SA 1A14L 4KGLA 5E1HB 3OR7B 3MZTA 1WBXA 4HHAB 3F7RA 1IKFL 4NZJA 3B8SA 4DQOH 1MFDH 1HOCA 1BM3L 1F11A 5F7FA 3KPTA 5L88L 5JPNB 3PWUB 3RX7A 3RDTC 4HT1L 3BE1L 5LGKA 5IT2H 3BH8A 3BXNB 1NFIB 3MRHB 3HR6A 4F33B 2NCMA 3MLZH 5BW7A 4NKIL 1W0WB 2PW1B 1IGCL 3PQYE 5FUCC 3E3QC 1HIML 2VC2L 2MPAL 3HMWH 1K8IB 2B1HL 4I4WA 5C8JA 3IDIA 2AJYH 2VL5A 3PWLA 2IG2L 4PJBF 5EZIH 1MHPH 4U6HB 4LSTH 2E7BA 3AVEA 2Q76B 4XT1C 4C56B 2A0LC 3DNKA 3SDAA 2JELH 4X9BA 2DKSA 2ZCLL 3I3DA 4YXLL 1E4XL 1RULL 3FQWA 4O02L 3J8F7 4K55A 1UADC 5I1IH 5IHLB 3ZE0E 5CEXA 4BQCA 3MRQB 3C5ZA 4JO1L 1X5YA 1U8QA 3D48R 2BVOA 4G8EB 4XTRD 5C0IB 3H3PH 4OLUH 4G6FB 1BFVH 1D9KD 3NA4A 4X7CC 5IW1A 1Q9WA 3ARGC 2CR6A 4HBCL 3MFFB 4EI5C 2DQUL 2GK2A 2CUIA 3HZVA 4NJ9H 2ADJA 3M8OH 2VXVL 4I0PA 5E7BA 1W0WA 1CCZA 5C09E 2CXGA 1A6WL 4YXHL 5F7DB 3IKCA 4RMTA 1DUYA 4NQSB 5CKGA 5I30L 3TBSB 4GXUM 3W9EB 1QUNA 2WINB 1A7PL 2BNRD 3AU1A 4LFHD 4E5XA 5LGHL 5DT1L 1JNLH 4AIXA 1JIBA 2YPVH 3TBVA 2J8UA 5JZ7C 3IS1X 4P57B 4OCSH 1YC7A 4LHUA 3U0WL 5IROC 3NOIA 4JJ5B 2VLMD 2GJ6A 2V2WA 5AEAA 1CE6A 2R29H 4ZUWB 3O9WD 4LSRH 3CLFH 3QDJE 2KQNA 3WXVH 1IGTA 4MXWL 2CLVA 2DQEL 3GMNB 3ARRA 4RMWA 4YEEA 5E8OA 5DD5L 1UWGH 3GMRB 4Q74A 4FFWD 3EO9H 3VFNB 1OQXA 4O9HL 3E8UH 4YHNA 2DQDL 2MQ0A 4P4KD 3RVVC 3CMOL 4CKVX 4TTGA 5FYJH 1UWEL 1AKJD 1YEEH 5JPMB 2L7JA 1RZ7H 4XVUC 3I84A 1ZHBB 2UWEA 5HGDB 3B5TA 3FAXA 4XWOD 3SDDC 1I7TA 5FV1L 1I8IB 4ONHB 4HK3N 5DT1H 3GMLB 4H5SA 1HSAA 2CDFA 3SCMC 4FN0A 3FOLA 4M5YH 4G80B 4WI7A 1S8DA 4RDQF 5FOBB 2WUBL 5HHPB 1S7XA 3G6AB 5GRJL 3WFBL 3QIUC 3O41A 4OFPA 2ZUWA 3FTGB 4PJ8C 3IGAA 3P3YA 1B9ZA 1EJ6A 3KPSB 1CL7I 1I9RL 3SPVB 4KRMB 3DX9B 3MRKA 4H8WH 1ZLSH 4ENEC 1BQHB 3QUXD 4XCNA 1NGWA 1ADQA 3ARPA 5IGXH 2CLRB 5GGRA 2NYYD 3H3PL 3EYOB 5E8NA 5GRVK 3IKCB 4ODHL 5AZEL 3P30L 4KK8C 2ICCA 3PGFH 1FBIL 5CSZB 4K3GA 4KH2A 3WO4B 4IIQA 2DQJH 1YDPB 3ARWA 2HA1A 1EGJH 2I9LB 2FATH 2P42B 3DMMD 3SCMD 5GRVL 1HZHH 3EW3B 2P46B 2XZQH 5CWSA 2SEBB 5KS9F 4N0CD 4YUEL 5I1KH 4GBXD 1OARH 4BFBD 1F02I 3BPNC 1ACZA 2XYCA 4Z5RA 3UJJL 3U46B 3MNVB 4X6DE 2YD2A 1ZV5A 4WV1A 5GRXG 5MEPA 4U6TA 5ANME 5CLTA 3IETA 1DQJB 5HVHB 2EXYC 3JUYA 1EEYA 1RJYB 1VA9A 3KYMB 2XPGB 2FYYB 1NCAH 2A6DA 2W0PA 3HE7C 1NGZA 1SJVA 2NYYC 3ARFA 4LSUL 4NRZA 1U8LA 1LK2B 4DKDC 4NWUH 4ZUVB 5D7IE 5AZEH 4BSVB 3HN3A 1A3RH 1VB9A 4MLIA 2ESVE 4MS8C 4UNVA 2IMMA 5J11C 1RD6A 4K3JH 2GITB 1S8DB 1GGUA 3LOWA 4YHNB 1HHKA 1BFOB 4WU7B 1CGWA 1J86A 1INQA 3E3QE 4OF6A 3UTSA 4KROD 3L1OH 3QUML 1J1XH 3DETC 1A5FL 4NGHL 3FB6B 5JDJA 1MCOH 2FEDC 4KROB 4Z7QE 3Q2CA 2FR4A 1CS6A 3HG1A 4ZFGL 3G6JF 4I48B 4LCCB 1WBXB 4KK9D 5E4EB 1GC1C 5I8KL 4CMHC 3OBAA 5ESQA 4PBVC 3MLTA 3GJEA 5L2KD 2Z35B 4M1CC 5HGAA 3EYOA 4NSKB 5EZJB 2LE9A 3BT2L 3DSFH 5IHUL 3ZSSA 1CDUA 2XACC 3EYQC 3OMZA 4XCYB 4LLMB 4TSCL 4WJ5B 4FQ1H 2F8OA 5E00B 2P8PB 4YXKL 5F3BA 3NA9H 4P4RB 1WAAF 3F7PC 4CDHA 5TE7H 4JHBA 4DTGL 3T09A 2GSGA 4JO2L 1INQB 2VAAB 3OKKA 3CDFA 4ALAL 1A7BA 1NCWL 3RVWC 3SDDB 4R3SB 1F4XL 1QZ1A 1JPTH 3MLSL 2XOTA 2GCYB 1G9ML 3GSQB 3VGBA 1MCQA 2E7MA 4KKNA 5FFLA 2D2OA 1P6AB 3WS3A 4QWWC 1WC7A 3QIUB 1R5IA 4I3RH 2QQKL 5B39G 2DYPB 4LK4A 1FAIL 5B21A 3T0EB 3NVQA 4QRPA 1H3VA 2DYPD 3ARBA 3LEXA 2FL5A 2CJUH 3HPLB 4M9PA 1Q9KB 3HNSL 5GZOD 3I02A 2EXWD 4Y5YC 4IM8A 4XPFL 1KYOK 3P9WB 4NQED 4GBXC 3U36A 4OLXL 1MRDH 2NX5D 2HT2C 4Q2ZB 5T33L 2VXSH 4MSWA 1G9NH 3UTTE 1VFAB 2AQ3A 5EC1B 1JP5A 4ZUTB 4D9RE 4IMKC 2BXYA 4Z7QF 5LJYH 5D7JC 3QUZA 3T2OA 1ZA6A 3MGAA 3BWUC 2HN7A 5J0BA 5JDSA 3NFPA 4ERSH 1JPTL 4TN9A 1I9RH 3HUJF 2CLRA 1OL0A 4K2UL 3MV8D 1KFAL 4M00A 2NY4C 2GJZA 4GAYB 4GRLB 5BVJA 3UPRB 1FBIH 3BMWA 4NKDB 5T1MB 5GISH 1KTDB 3ZHDA 3SY0A 4JE4B 5CILL 2O5ZL 2ARWA 2XA8H 3MJ8A 4P4KA 2EO1A 3HHRB 1JGDA 3U4EB 3DRTA 5FB8B 2BHUA 3DUSA 4LU5H 2ZCLH 1YMME 2HT2D 2AV1A 1NLDH 4DGIL 2QBWA 3P0VL 1QSFA 2PYEA 3SO5A 5E9DD 3ARSA 4WVRA 3RWJB 1NAMA 1NBVL 1JWMA 2VDML 1K4CB 4R7NA 5IMMB 4JN1H 1G7IB 4F2MA 2VLRD 4D9LH 5EU4A 3CSPA 3RKDD 3LN5B 1UZ8A 3MFFA 2UZXB 1BQHA 2AAVA 4I0PD 3W11D 4BQ6A 2CK0L 3X12B 5HI3D 3KPPA 5GZND 3P4NA 3KXFA 4UT6H 4XXDA 1FZKA 1KC5L 1RPQA 4D0DB 2YMXH 1PZ5A 3ROLB 4XHJC 4OFYD 5EIVA 4BZ2H 3QQ3A 4CMHB 2E7LC 2HJFB 4LHQB 4PTUA 4P9HH 3I50L 2F5BH 5F3HB 4TOYH 4G9FE 4G8FB 3BH9A 4MAYA 1NFDB 5T1LD 4ZTPH 5FYLL 1QP1A 1D5ZB 5LQBL 4R26H 1CK0H 2H3NA 4CADB 3UTQA 1EVUA 2I07B 4KMTL 4NQUA 1G6RH 1OAXH 2CDEA 1K5NA 3HI6L 1EIBA 3TT3L 4G3YL 3DMMA 5HHXH 3OJMB 1IC4H 1ZHKB 5J1TC 3L9RA 4HKXA 2WW8A 2FIKA 4PJ9B 1TZIB 3A6CH 1ZANL 3B9DA 2GY7B 1TETH 5KVDL 4HIXL 1LQSR 2GFBB 1JHLH 3MODH 3MV9E 1YZZA 5FA4B 4BKLB 3HI1B 1A1MA 3X3GL 1DQLL 2NW3B 5DO2D 4I5BB 1YEEL 2YN3A 1F4WH 5JA8B 3ECBB 1FJ1A 3TPKA 2WANA 1PQZA 1RZ8B 3IDJB 1BQHG 4YEFA 1J87A 1CT8B 2NNAB 3I9GH 3ARFD 2BVEA 1IAIL 1RIVL 2AXGB 4XP5L 1S7XB 4LCIH 1K9TA 3GHBL 3VG0L 4YLQT 1BFOA 2XZCH 1PSKL 1H0DA 3GSOA 5DUBB 1J0KA 4MQ7A 1T20B 3CAFA 2H1PL 3LV3B 5DJ6A 5B4MD 5B38A 1ZEAL 4M93B 2MCPH 4OKVA 5FO8A 4M62L 3ILQC 3I6GB 2F74A 2C1PB 4R90L 3MZGB 5EBWA 3UAJD 4JFOB 1F42A 2NPLX 3U82B 1QSFB 4Y5VA 1Q0YH 4HX1A 3S96A 4NQDA 5HGBB 1FO0B 4PJ7E 1MJ8L 1JRHH 5E99L 4KI1A 1J1PL 4HG4J 4Z7VA 4LHJB 4R8WL 1TJIH 4LCUA 4N0FB 4U0QB 5EIIA 1FYTB 2DIAA 5EUOE 1SVCP 1T04A 3HCVA 3BMVA 1OSPL 1RIUL 4WTZA 1E6JL 3L7FA 1WBZA 5AD0A 1PSKH 1MI5E 2CIKB 2Q7NA 4LCIL 3GHBH 2VUOA 4LCCC 3OJDA 3MV7D 4M7JL 1F3RB 2HN7B 4U1HB 3FN9A 4M43L 4JLRB 3MCG1 4PJXE 3EHBC 1JZ3A 3S37X 3QCUH 4CU8A 1N59A 4JCMA 5FA4A 5SWSD 3U4BL 4PJBE 3UAJC 1DSFH 3O3AA 5E5MA 3VGAB 3AY4A 1P4BH 1MF2L 3QPXH 4KKAD 3MJ9H 2OZ4L 4GQ9H 3D39E 2Y7QA 3ULSA 3GM0A 2IBZX 3IDYC 3HZMB 3TFKD 1ERNA 5IMLB 4CJ1A 5DK0A 3U7AA 5IQ7H 4OF0A 1T7WA 1R5VB 4NO2B 5C0BE 1GC1L 5I30H 3GIVB 5D2NC 1H0DB 1NC4A 4WTWA 3QUMH 2B2XL 3WO3B 1F58H 5EFIB 5MHSD 2EDRA 4BZ1L 2CJUL 4H5SB 4YNYB 1BLNB 4Y4KB 4C56A 2X1XR 3SDDD 3ZL4L 1KLGB 1QRNB 3KAAA 3PUCA 4E41D 3MMEB 2EIDA 4ZPTA 1T1YB 1XGRB 3HPJB 1NSNL 4L9LB 4OT1H 2YD5A 1TXKA 4PRID 2R29L 3T4AB 4EUPB 4P2QE 2GT9A 5LKNA 1KJ2A 3TJHD 4LASH 4GJTB 5SX4I 1PAMA 1T1ZA 5DVKA 1KC5H 5ID0A 4QNPF 2A73B 4P5TD 2XZZA 4F2MB 2BSRA 3QUMA 1CD1B 3S5LB 2FEEL 4G6AC 4UV4L 3JTSB 3O45B 4P0DA 3VFVA 1EERB 4KK5D 5CLWA 4DFHA 4R4ND 2HKFL 2RAMA 3DVNA 2A1WL 2Z93B 2RB8A 1YNKH 4MMZC 4KK8D 2UVFA 3F65A 3QCVH 1ZVSA 3CJJA 4GFTB 5J12B 5DSCB 3OXSB 2F19H 2R2EB 2PTTB 5GGTA 5IBTH 5IB2B 2ZG3A 4PGDB 4QF1A 5D1XA 3PABB 2H9GA 1K3ZA 4OFIA 5KSVB 4PJXA 1I3VA 3IXAA 4GW1B 1D7FA 4N0CC 3MC0A 4B50A 2EKSB 2AI0H 3NFSH 1QR4A 3CH1A 4QRUB 2ICWA 1IAMA 4JFFA 7FABL 3OHXB 4Y1AD 4OM0H 3OJ2C 4YHZL 4AIOA 5DVMA 3KPNA 3D25B 5DK2A 4ODTH 1UXSA 3BEVB 1PKQE 1L0XA 4LSTL 2IAMA 5I1DA 1C5DA 2UZYB 2XQYG 3CVIL 1OY3B 4G9FD 3S35X 4G8GE 5C0AB 1T1WB 3EZ8A 2AEQL 1OAKL 1T2QH 4N0UA 4JFXB 3WHE0 1AFVL 4UNTA 3MBEC 1BLNA 3D69A 3GSRA 3TN0A 1FJ1B 3DVIA 4HXAH 4ONHA 2GK0A 1L6ZA 1J5OL 1NBZA 4WI4A 5HHOA 1BZ7A 2HTKC 4JFZH 2WQRA 3UZQA 2Y25A 2WBJD 1KEMH 3SGDI 4K3EH 2AXFB 4EN3D 1NGYB 1NH6A 1DQDL 4TTDD 3STLA 5A1AA 3O4OC 3DETD 4XH2A 3OGCA 3WIIL 5KSVA 2AABH 1LNUB 4MJ5A 4OLYH 3DRQA 3L3JB 4F33A 3C6LC 3MREB 2GJZB 3ARGD 4O5LH 2BDNH 2IFFH 4GLRH 1CL7L 4XCFH 3VW3L 4MJ2A 3GMOB 3IJHB 2AK4B 3DO7B 2A9ML 3FMGH 4P2RD 3JV6A 3STBA 3FO2B 2FHCA 3AS2A 3BO8A 5E2VL 4HS3B 3CC5B 4PRHA 5EU6E 5BRZD 2VMFA 1FZJB 3QH3A 4NRYB 5TE6H 1UM5H 2XN9D 3IFOA 1YMHA 4MDJA 1NGPH 1BZQK 2IPUK 4YHYC 4L29A 3KJ4B 3PGDA 1CTNA 2FGZA 1IC7H 4R97C 4UBDD 1BBJA 2IBBA 2ICEA 2HT3C 2Y07L 1WFOA 5IK3A 2W9EL 4KUCF 5D7IA 5I1CH 1RZIA 3G04A 1UZ8B 3CLEH 3AUVA 3QJHA 4TTDC 2AXFA 2WSKA 1FVCA 4HUUB 2FH6A 1I1AD 3LKRB 1A9EB 4U1NA 4ZTOH 3W81A 4QHMB 5C6WH 4O00A 3WUWB 3ULUE 1UKQA 4L8SB 1FNGA 2LAGB 3INUH 3WFHB 2ED9A 3S96B 4KQ4H 1FGVH 1MQ8A 4MA7H 2R1XB 3ARQA 2BVOB 3FT2A 3VRIB 1OD9A 3QZWB 5LBSH 3MLVH 2VLME 1EO8L 2A83A 3K74B 3RZCB 4QNPE 2DQCH 3T0AA 3RGVB 3L5JA 4BELD 2VZ1A 3DGGB 5KS9B 2HJLA 3KPNB 4FP8L 3R1GL 1R3LB 4X6CB 3S3SA 4NM8L 4JFEB 1P7QD 1YEFL 1CE1H 4PB9H 3WEXB 1X4ZA 5EIQA 4ELMF 3O6FA 3M1BA 1U92B 1CICA 2YPLB 3HE6D 3B5HA 4MA3B 4OAWB 3TBSA 3DURA 4H25B 3D2UA 3ULUL 5DQDL 5KOMC 2GK0B 2E9BA 1AGCA 2VC2H 1FZMA 1GH7A 4X83A 5IHZA 4WFED 4L4VB 1ACYH 3S35H 5MENB 1MJJB 3O6MH 1MVUB 2P48B 4N5ED 5CAYB 3MNZA 3CC5A 3IDUA 4XNUH 2NY6D 4DW2H 4U0RB 1A6ZB 4CBPA 1JUFB 1JNNH 3IDMA 4YDIL 4EXPX 4XB7A 4ZNEA 4MB4A 1TZIA 4N8CL 5ADPH 4NM8H 1AO7A 2JF1A 4JFYA 4R6UA 2J5LC 3P4MB 2VISB 4K94C 5DHYB 3HE6C 5MI0B 4X80H 6FABL 5TE4H 1S5IH 1XGRA 2P43B 3QPQD 5ACZA 1KJVA 4MZ3A 3MOBL 4JO2H 4UQ2B 1A7RL 1AHWB 5HYSB 2FWOB 4GKZB 4M1DH 5LXGL 3BI9X 1DBKL 1LILA 4W4NA 5IWLA 2QQQA 4U1KB 3BAEH 4PY7B 4LMQI 1QYGH 5L8JB 2AXGA 1DLFL 4I1NB 4JGMA 2AERT 3W11C 4R7DB 1KJ2H 2VDPH 2W0LA 2EEBA 3L3HA 3MXWH 4HIXH 4HMCA 2HYMA 4R2GD 4NQVA 3JXAA 3UMTA 1FYTE 2DQCL 3D85A 4JGUA 2DOCA 3D25A 5DK2B 4WEMB 4XXCC 5DC4B 2B39A 4CVXA 3RVXD 1JHTA 4DKEH 2EIBA 2MWCA 4DEPB 1EAPA 1YDPA 5TE4L 1MSPA 5EZLB 1RV6X 3V4PL 3O4LE 1INDH 1F8TL 3PGCB 5GSRA 3PABA 1Q1JH 3DMMB 1JK8A 1L7TH 1A5FH 1UWEH 4H88L 4NGHH 4QRSA 4QXWA 1BAFL 3LQZA 3N1FC 3B9KB 3U4BH 2BNUB 1QA9B 5I76A 4R97B 5JW4M 1LDSA 1NMCC 2EKJA 4KKBD 1ADQH 3U6RA 4HFWA 3CFCL 1MPAL 1A6AA 2NZ9D 2G9HB 1IGIH 4FFZH 4GKOA 5IB3A 3MRCB 4HV8A 5HDBE 4PRHE 5EU6A 4HK0B 3ZT5A 5EBLB 4PJHB 5A3IC 1WT5A 3KPSD 4XNUL 1ITBB 2VLRA 4NO0D 1EZVX 4M6ML 4UUJB 3ULVD 3TZVA 4P46D 3QDMD 1A22B 4R4FL 3F5WA 4UOW1 2UV3A 4CW1B 3QIWD 4YHIB 1TJHL 5BV7L 3QUXB 5DS8A 5F70A 4I3RL 2XNAB 4WHYG 5DMGD 3U83A 3RVWD 3F7YB 1T03H 1OAYH 4IBLT 1J0HA 2W9EH 3ARDB 3PXJA 5HYEA 1LK3H 5T1KD 5E2TH 1U8NB 1MCBA 2R9HC 4WEUD 2DJUA 4DAGL 1MUJB 4JVWA 4U1SA 1A4JA 2Q6WB 1QTYT 1OM3L 4ENED 5DHVH 5FF6A 4MA1B 5C2BH 5F8RC 5DC9B 2A83B 2VSDA 4EQ3A 5JHLH 5FYKH 4WW2A 4H1LA 3SE8L 3OKMA 1SY6L 4S1QH 3NZHH 5T3XE 2OM5A 4O02H 4GW4B 1CE1L 4HJJL 4PB9L 3CVHL 3E6FB 4HWUA 1FNAA 4GG6A 4N9GB 4LCYA 5DEFB 1JWUA 3CFDA 3MOAL 5C0BB 4YBLC 2BC4A 1CVRA 3OJDB 1LO5A 3EO1B 4OCYH 3QUZB 3UC0H 2BOBB 3I2CH 3RU8H 3A67L 2IALA 3V5KA 3LIZH 2FHFA 1G7QA 3EJZC 4AJ0A 4OD2B 4GG8B 2D03L 1IEBA 4YQXH 1SMOA 1IC4L 4Z78B 3QR2A 4BSJA 1LP9B 4ZD3L 5I74B 1MI5D 2R1YB 3V0AC 5HHOE 4PLKC 4N0UB 3T0DA 1UEYA 3BZFA 2VTFA 4PRBB 3GMMA 1LP9F 4HUKB 1MJUL 3RIAK 3TFKC 3MA7B 2V5SA 5HYQB 3SDXA 3T0ED 4U7KA 4Z95L 1UH4A 4KZDL 5GS1A 4NHCL 3OX8B 4HWEH 5T5NF 5HGGS 4Y2DB 3PDOA 3U0PB 4JFFB 5JW4R 1NC4D 1K2DB 4JCLA 1E6JH 1GIGL 1S9KC 1EX0A 1OP3H 4LU5L 1T1YA 3F58L 4OKVB 5FO8B 3ARVA 4OQTL 3TO4A 2OQJB 2RHEA 3LIZL 4DKFH 4QRRD 3TZVB 4L3EE 2ZUTA 4FQ1L 5CBEB 3LDBB 3I2CL 1MVUA 1P9MA 3VXUB 5HPMA 4L4TE 4GSDL 4C55A 2OTWA 1BEYH 1KN2H 3CVHA 5FHAL 4R0LC 2OP4H 3HFML 3VE0B 4BFEA 4HS3A 1U8HB 1K3IA 2GUOB 1I7UA 4WO4B 4JZNA 4J23A 5FUZH 1J8HA 2HFGL 1L9NA 1GXEA 5IQ7L 3MUZ1 3DSFL 1N4XL 4GAYA 3PGDB 2X4NA 4KK5C 1JWUB 5GGTH 4ELME 2J88H 3CVIH 4P9HL 5MEPB 3SBWC 1EMTH 3PDGA 1G7IA 2COQA 5FGSA 2NY5L 3DOSA 3H3BC 43C9B 4POZC 1MFCL 4BA8A 1KCVH 4HBQA 1CF8L 3BHBB 4U1HA 4JQXA 4Z76B 2AK4A 2ZUQB 4HAFA 1GHFL 1XGYL 3WBDA 1NBYA 3CNKA 3TNNB 3JWDC 3KPQA 3OB0K 2PN5A 3TV3L 4WY7H 3AM8A 3QNZA 3KNBA 4Z9KB 3DV6A 5F72S 4YHPA 3ZKXB 4YE4L 1T7XA 2P7TA 5ICXA 4AEEA 4XCCL 3SKJH 5LGJA 1YQVL 5E95B 5FDWB 1AGEB 2PO6B 3WEXA 3BEWA 3SDXE 3D69B 3D2UD 3C8DA 2G60H 2QLVB 1MFBL 1ZSDA 2O26U 1GL4B 5EO0B 3BZFB 4YWGL 3UJIL 2ARJA 4WWKB 3ULUH 3QXTA 1B2WL 5B38B 4KHTL 4JRXA 3CH8A 3ILPB 3MO1B 3BPCA 1PD6A 1XR9B 3BDBA 4LLQA 5GGUA 4GRWB 4GW5B 4FQIL 1R3KA 1ZEAH 5D96B 4KHXL 4PLKD 3BIKA 4I0KA 1MHEB 1F00I 2APVA 4YGVB 1TPXC 2B4CH 4MCZB 4OI9A 2DIBA 3C6LA 4AT6A 4J6RL 1DBAL 4HQQL 5CGTA 4OGAC 1SYVA 4J3WA 5B8CA 3RIFF 4NO3A 2O5YH 1OPGH 1XAUA 3MRNA 1SHMA 4UIKL 1RHFA 3WIHA 3VXNB 3QEHA 3HFMH 4M8QA 1RUQL 1U9KA 3LQAH 4X6DF 5GJSL 4YPGB 3MYJB 1S7UA 3VFRA 1GCFA 4JFQB 3T4YB 3K7UA 1L0YA 1RZGB 2IF7A 4W70A 3QCTH 2AJSH 4QTIH 4AEIH 1MJ7H 1MQKL 1N7ML 4GRMB 4WFEE 5SX5K 1P4BL 1YECL 2G5BA 4JFOA 3KPSA 4HGKC 4PG9B 3G5XB 5C9JB 2P5EB 2VXQL 4DGYH 4IRJB 5DUMH 1JCKA 5LXGH 5KJRL 3QIWA 3QISA 5F1IB 4QRTA 2DLGA 3IAGC 1G1CA 5KW9L 5DJ6B 3Q6GH 5C07E 1FNFA 1A4JB 2D4DA 3QBTB 1QEWB 1X5HA 2DICA 4PJCA 3ZTNL 3SQOL 4PJFF 2J1KA 2VITA 1KXQE 5DHVA 1A1OB 3LMJH 2VISA 4K9EH 1GZPA 1T22B 5IOPB 4JM4L 4X6CA 3HC4L 2CXKA 3UJJH 4EIGB 4YE4H 3CSGA 2OJEB 3KYAA 3WXWL 3TP4A 2XT1B 1NLBL 2WBWB 5DJAA 3UTZA 4U2YA 3MLUH 4QHLB 4DWHA 3DARA 4A6YL 3GB7A 3HZYA 3SBWA 2VSCA 3CFKA 1U0QA 4W4OA 2ZNWA 1TQBC 3EFDL 2BSSB 3LKPB 1OAXL 1ORQA 5EC1A 1FFNA 5MENA 3O2VL 5H35B 3HRZA 4E41E 2IADB 1CR9L 5KSBE 1N59B 4QT5B 4Y4FC 4AQ1B 4OB5L 4X5WB 5DD3H 4UQ3A 2ZCKL 1VCAA 4X9HA 3QZWG 3UPRA 4ZS6D 4KRPC 3F6LA 1U8OA 3H9HB 2NY6C 3MLXL 4QOKA 1RZKC 2FO4A 5E4IA 3ARTA 5GGTL 4JQVC 4I3GA 1BF2A 4NT6B 3RRQA 2XQYK 4JZNB 1NCCH 4K2UH 3KLHD 1QSVA 4ORZC 3NCYS 3VFMB 2Q8AH 1D9KB 4Q58C 4BFGA 1S9XB 5J13B 3VFWB 2NY2B 2KUTA 4YHML 5CINL 4DGYL 5I73B 5GS3A 5HPMB 5BOZG 3ZE1E 1QEWA 4TSCH 5E6IA 4NN7C 1M71B 3LKPA 2R0LL 1BOGB 1XF4A 1ZT1B 3DYOA 5E0QA 2IPUG 1UB6B 3IXTA 3BRGC 4U33A 1M6OA 4JPWL 5E8NB 3WL9B 1OCWH 3JTTA 5F1SA 1MCNA 3SDCB 3G5YA 4UINH 1I8KB 1BVKB 2GTZA 3NAAL 3NIDE 3EOBB 4DQOL 4HKJA 1KACB 3TYGH 5ILTL 4FA8A 3KS0H 4G6JL 3DX7A 1LO2L 2YA2A 2VITB 2W9LA 5BXFB 4OD3L 2NY1B 1XGTA 3ESVF 1K8DB 4ZUWA 4PJ9C 4DFIA 2WK2A 1CYGA 1HN1A 3UC0L 3QI9C 4M5ZH 3CUPB 4BZ2L 1URLA 2BVUA 3QNZB 3QWRA 4S2SA 4NQCE 5GS2H 4PJAB 3R8QA 1NBVH 4Z7VB 4ZFZA 1NBYB 4WUUD 4JKKA 1OSZA 4EJ1C 5D7JB 1I7RB 4NC1C 1HKLH 5IKCA 5DD6B 4OZ4B 4ODSL 1FNSL 2CO7B 1N26A 1E4JA 1OCWL 2WWKO 4OCLC 4PGBA 5DYOA 1MFAL 2X9YA 3FRUB 5IB5B 4ZUSA 4RISL 2AJZB 35C8H 1DBAH 2VZVA 3BD3A 1WGOA 3HPLA 5CP7A 1DDHA 1Q0XL 4I8DA 4GQ9L 4JN2B 3PP3H 5HHXL 5EZOH 2NZ9C 2IH3B 5CP3H 1ETZA 5K9OA 1NAKL 4ZOAA 2VZSA 4YR6B 3A6BL 3NTCL 1QFWH 1I9JL 4JFXA 2HWZL 5BXFA 3V5DA 1MCDA 1BFTA 5DFVC 5KSAC 3CVHH 2FD6H 4LCUB 3HR5B 4OF8A 4FS0A 4ESKA 2A6JB 4PGEA 2VXUL 4MQSB 4LEOA 5LCVL 2HFTA 4MYWB 4HIHA 1C16A 1FNGB 5HJ3A 5TDOB 3PWLB 3FQRB 3GI8H 4P9HC 3WJLA 1JFQH 3EYFA 3GRWA 2C1PA 5T1DL 2VXSL 3GBML 1FO0H 4JO3H 2EIEA 4ZUUB 3HC3H 2O61B 5AZ2L 5HYJE 4ZXBD 3LN4B 1K85A 5MP6L 4L9DA 5FHBL 1MHPL 1I1CA 4Z7NF 5HVWA 4OJFL 3MJ9A 4WENB 1G9NL 4JM4H 4JFQA 4MJIB 3MCLL 3GMMB 5DEFA 1EV2E 1VADB 3MA7A 1QSZA 2CIIA 2IQ9H 1U8PA 5C6PB 3AC0A 2JJVA 4JGJA 4OZIB 2YBRB 3BP7A 3VWKA 2OSLA 4TNWF 1AIFB 3FQUA 4WHTB 5CSGA 4XP6L 1PYWB 5CEZD 5EUKA 3V0WH 3GSNL 1QFOA 5DJZA 4XP1H 3I6LD 2HVKA 4OCXH 5EO1A 3IJSA 5FKPB 1U8MB 1U8JB 4U3HA 2KZ1B 1JE6A 1DLHA 1LDPH 3R0MA 3P0YL 3CFKB 4XWGL 1KPUB 4YHLH 4PD4K 3RIAF 1YN6B 4NUJB 2APWA 3EGSB 4W68A 4KC3B 3PQYB 5H35A 3B9EA 3HPJA 1DUZB 2YOCA 4OFYA 5IEKA 4ACPA 2Y36L 2OJEA 2P5WE 4G8IB 5JW5B 5ISZD 1ND0A 4Y5YB 3PQYD 1D5ZA 2DF3A 2FSEA 2LAAA 3QI9D 5EU5B 3ILPA 2CMRH 3LD8B 1S7SB 3UTZB 1NMAH 4WHDA 4FQ2H 1G84A 2B20A 3JSSA 2X4UA 1TDQA 1QACA 5FYKE 5DR5L 4LPYA 5CINH 3QDJD 3HG1D 4GMTH 1AR1D 1M7IA 4JFDE 3T8XA 5B3NA 3VXMB 2Q6WA 2CK2A 4NZUH 3L3KA 3LRHA 4YHLL 2Z91A 1RHHA 2WIIB 1A7RH 1Y0LB 4KK6D 1GGCH 3P0YH 3MLYH 1NGXA 2EICA 3WKMH 2AV7B 4JANA 1X6NA 5C3TA 2WLZA 1NFIA 3MRHA 1HHIA 1PZUB 4AMKL 1CLZL 2VABA 1ZTXL 3MYJA 2ZUQC 3DHJA 4IMKA 3VH8B 5H2BB 1FL6B 4GW4A 5DFVD 1ZHNA 1J8HD 3REVA 4KZDH 5ERWA 3O6FC 4L4TD 1IT9H 2CKBA 3OR7A 4NQCD 1JNHA 4MCZA 5I71B 1C5BL 1T2XA 2Z92B 4Y89A 3KPOA 1NMBL 3HNVH 3RGVD 3FN3A 1E0OB 4G6FD 4LMQE 3B9KA 4LPWA 3W5MA 1FO0A 4ZMAT 2HRLA 2YD6A 5EO9A 5LGHH 4LF3B 1DCLA 5DHVB 4N1EA 1I8KA 1YMMA 1MRCH 2HJFA 3KDMA 1J7VR 2XXCB 1A9BB 5DEGB 5F71A 2D9CA 1XGPA 3UJTH 3K4DA 3IFNL 5DQDH 4ZG1A 3MPCA 2BX5A 1A64A 1PW3A 4ZNEE 3MRIA 2HWZH 5D96C 5JQ6H 2NX5A 1BX2B 3CLFL 3B8YA 1TVHB 3F8UB 5HI5D 4RGND 3DTXA 2BVTA 2HRPH 1PKQB 1TCRB 4MHHI 4Y4HA 4NRXB 3BP6A 2GJ6E 2JCCE 3FONB 5CMAB 4MB3A 4FFWC 1CZ8L 3VXOB 4EI6A 3HS0B 3F58H 1IKNA 1J18A 3WNPA 1CFNA 2QADD 5CZVL 1VFMA 4GLRI 4PJAF 3BZEB 1EDQA 2EIZB 3FB5B 3NIGF 2VLRB 5EFIA 1WWAX 5EU3A 5JUEH 3LZFH 4MCYA 3GHEH 5KBNC 4GRWE 4Q9QL 1RHHB 4MXQC 1EO5A 4W6WB 3VXRD 2X4QA 4NZDA 4ODVH 2E6QA 2EXWC 2FJHA 5H37H 5ENWB 2G9HA 3TESA 1FFNB 3FQUB 2H6PA 5B38G 4HIIA 3N85L 1CLZH 5IVXB 3V0WL 1EH9A 3OAZK 4PJ5A 3B9VA 1DSFL 2MQCA 4HUXB 3MBEA 1JPFA 3O8XB 2R69H 2R23B 3GSVB 5ANMB 4NQDB 1UWGL 1ZS8A 1LO3L 1MJUH 3LD8C 5KSBA 2LABA 3BJ91 1KCKA 3RHWK 1SM3H 4EKXA 1T1XA 4UAOB 3TYFB 2P5EE 3IRPX 3LZFL 1TNNA 1T3FB 4MDIB 4MSWB 3QQ4B 2PXYA 1BZ9B 1AGDB 4HS8H 5T1DH 5IG7B 2OL3A 4XNQA 1A1NB 4Y5XB 1UCTA 3FO0H 2VLKB 2R4RL 1ZLUH 1IM9D 4HAGA 1FFPA 5HHVH 3T65A 1T7VA 4P5KB 5CZXC 1IGJA 1FFQA 1AQDA 4LLWA 4JQXC 4A6YB 2JIXB 5D1QC 4CRPA 1H5BA 2A6KA 1F4HA 4YAQB 5DZLA 4BKLA 5I1LB 1N64L 1OT1A 5F89A 1N5YL 4X0KB 3WN5B 4MWFA 1RJLB 1S9YA 4L5FH 3MV7E 1T21B 2RGSA 3R1GH 5ALBH 1P84J 4XP1L 1EBPA 1GZQB 4ZDHA 3OKOB 3C6LB 3A0OA 1E28A 3FHAA 1XGUB 4PJ8B 2M1KA 2YKLH 3L3OB 4OIIH 2DL9A 1OWRM 1P4IL 5IVZA 2Z35A 4FFZL 2X7LB 3QSKB 4C58B 2AEIT 5DMIH 1KGCE 4OCRH 1RZGA 3W2DH 1NUNB 5AUMA 2V17H 3FT4B 4K07A 5HI4D 1MIEH 3T65B 1EHNA 2BRQA 1L7IH 4R7DA 5DRZB 2Q1EA 2P8LA 3VFPB 1MVFA 2F5BL 3KXFB 2ZG2A 4ISVA 5C0CA 3U0PA 4OD3H 4Z18A 3C5SA 1N5YH 3UCRA 3D85B 2AJXH 3NCYP 4PPTA 4CU6A 1A8JH 1I7UB 4WO4A 3SGJA 5EOTA 4RSVA 2B8OT 5E6ID 5HY9A 1AHWA 1WWWX 1A7NL 4LHUG 2FHBA 1NEZB 1SEBA 1JPST 1U8LB 4P3DA 3QULB 4MQXC 3S3PA 4XNXH 1YJDL 4WEBL 2BNQB 3T77B 2EE6A 3RKPA 4HS8L 5LWYL 5GGSB 4LEOB 4P2OD 3HC0B 3F7YA 4PJ5E 1WVZA 4FXGA 2P8PA 4G8GA 4YPJA 5SWSB