1ZVKA

Structure of double mutant, d164n, e78h of kumamolisin-as
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
354
structure length
354
Chain Sequence
b'TAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPSGPDGHVELDIEVAGALAPGAKFAVYFAPNTDAGFLDAITTAIHDPTLKPSVVSISWGGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGNSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kumamolisin-As
publication title Processing, catalytic activity and crystal structures of kumamolisin-As with an engineered active site.
pubmed doi rcsb
source organism Alicyclobacillus sendaiensis
molecule tags Hydrolase
total genus 116
structure length 354
sequence length 354
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1zvkA00
1Y4AE 5FAXA 2W2OA 4DJ5X 1SCBA 1ST3A 1TM3E 1MEEA 2Z56A 3DYBA 1PFGA 1AH2A 1BJRE 3WIVA 2Z2XA 1Y4DE 1KE1A 1SBNE 3DE5X 3DW1X 1Y3CE 1TECE 1TM1E 1TM4E 2PWBA 1AV7A 3GT3A 2V8BA 5JXGA 4H6XA 4AKTA 2HD4A 2W2NA 1SBTA 3TI9A 1DUIA 4Z2AA 2ZRQA 3EE6A 1SIUA 2PRKA 1SCNE 1NDQA 4KPGA 3I34X 3VV2A 5I9SA 1Y48E 1EA7A 4J94A 4MZDA 2HPZA 5B1DA 1GTJ1 1AU9A 1S2NA 1C9JA 2DUJA 4JP8A 1Y33E 2SBTA 2Z2ZA 3VYVA 1KDYA 2IY9A 1SCJA 1OYOA 2W2PA 2WWTA 2ST1A 5AMXA 1P8JA 3GCWA 5JXHA 1SUPA 3DWEX 1R64A 4DWWA 4KG7A 1SUCA 1SUEA 3DE1X 1TM7E 5JXJA 1BE6A 3DVRX 3GT4A 1VSBA 2PQ2A 3WQBA 1LW6E 4NE7A 2PWAA 4M1ZA 2WUWE 3L1KA 2DP4E 3DE6X 1WMDA 3LPCA 5JMOA 1C3LA 3EDYA 1KDZA 1V6CA 1YJAA 5JXIA 1SBCA 1ZVKA 4CFZA 2W2MA 1S02A 1AQNA 3LPDA 1C9NA 1WVMA 2SNIE 3I2YX 1T1EA 1R6VA 1TO2E 3DE7X 4K8RB 5ARBA 2SICE 3QFHA 4H6VA 1GT91 3CNQS 4C3UA 4NE9A 2P4EA 1P7VA 4OV6B 3PTLA 1KE2A 4I0WB 1BFUA 4C3VA 3BGOS 3DE4X 1BH6A 1Y3BE 3WHIA 2ZWPA 4CG0A 3D9QX 3TECE 5AQEA 1IC6A 4ZARA 3I37X 2WV7A 2ZWOA 2TECE 3H42B 3AJ8A 1S01A 1YJBA 2DQKA 2Z58A 3I30X 5ARCA 3SQOA 1CNMA 1SCAA 3DE2X 3PRKE 5B1EA 4BWGA 1WMEA 1IAVA 1T1GA 3TI7A 4LVOA 1DBIA 1Y3FE 1Y34E 2SECE 3DVQX 1GNSA 1SUBA 3AJ9A 3QTLA 2IXTA 4H6WA 4FONA 1Y1KE 2XRMA 2Z57A 1GCIA 1CSEE 2QTWB 5K7SA 1JEAA 1BE8A 1HT3A 1SELA 1ZVJA 3DVSX 4RYDA 3HJRA 3CO0S 1GA4A 3D43A 3F7MA 1A2QA 2B6NA 1C9MA 1SVNA 3QMPA 3VSBA 4GI3A 1BFKA 4YN3A 2ID4A 1GA6A 2PKCA 1AK9A 5ARDA 3UNXA 2X8JA 5CW1A 2ID8A 1OT5A 2W2QA 3SICE 1SIOA 2WUVA 5AVKA 3DDZX 1NLUA 1WMFA 1THMA 3EIFA 1AVTA 4ZOQI 4NMXB 2X8JB 1PJ8A 2GKOA 3ZXYA 3DW3X 3F49S 1YJCA 2G4VA 4DZTA 1SUDA 3LPAA 1PTKA 1YU6A 4HX2A 1ST2A 1TO1E 1SBHA 4AKSA 1TMGE 3ZXXA 3A3PA 1T1IA 3F7OA 1EGQA 2PMWB 1OYVA 1SUAA 2PYZA 1Y9ZA 4OMDA 5FBZA 1AF4A 1SCDA 3GCXA 2Z30A 3A3OA 3Q40A 1MPTA 1SBIA 3P5BA 3BX1A 1P7WA 5AVJA 3A3NA 1WSDA 4CFYA 3Q5GA 2XTJA 2E1PA 1GTG1 4WOCA 3VTAA 1Q5PA 5FFNA 3WIUA 1GTL1 4WOBA 4LVNA 3AFGA 1UBNA 1TK2A 4OMCA 3DE0X 1Y3DE 3OSZA 4KB5A 4HVLA 1SH7A 4B5LA 1SN7A 1R0RE 1GNVA 1NDUA 3BPSA 5SICE 1SIBE 1TM5E 1SPBS 3DE3X 3LXUX 3VHQA 3T41A 1KDVA 1PEKE 1XF1A 2Z2YA 1GA1A 3VV3A 1V5IA
chains in the Genus database with same CATH superfamily
5F7OA 1RYYA 1ULZA 2PT7A 4X3PA 1AO3A 5CT6A 3WJ2A 5LB2A 2CEAA 4K0RA 4X1YA 1YE3A 3R3XA 4TWJA 1N4AA 1JWLA 1J8MF 2JI8A 3QUQA 2FP4A 4J0QA 2G76A 1ZX1A 3GJZA 4LJSA 4UM5A 2HTFA 4DA7A 4ZGWA 5A4AA 5AVWA 2JLRA 2AS0A 2X8AA 3WK9A 1RZRA 3MRVA 1H6BA 1TQ4A 3L0IB 4F5WA 5FQOA 2NP7A 2FJUA 2VAXA 5CLGA 4M1KA 4NU0A 3KT8A 2WJJA 3ZTTA 4I3FA 2J0UB 4JAVC 3AM5A 3D1LA 3QKTA 3ZQUA 2Z2XA 4HMOA 4P92A 4ABYA 4MULA 4GDFA 3STUA 4C6RA 2VDOB 1AY0A 2D5AA 1JEJA 5I7RA 2BTOA 3BGIA 3ZPXA 1JN0A 1J4AA 1OTHA 1N6LA 4H0FA 4WVLA 3N2KA 3VZSA 2UYHA 2OBBA 3O4IA 1PS9A 4F4CA 2J3MA 1X9HA 1H2YA 3IERA 2E7ZA 1I4LD 4IP0A 5TB5A 2ACWA 3PT9A 2GK7A 5J43A 1OFTA 4RA6B 5JS2A 1UBSB 2YZ2A 3LC1O 4ZP1A 2AR7A 3ZJ4A 2OQIA 4ZCMA 2KS6A 2PLFA 3FNIA 3H9UA 5LU9A 3NFYA 3R40A 3JSXA 4NL4H 3ZWYA 2EBHX 2IYPA 1Y5MA 4UBLA 1DAFA 1TX4B 3RUCA 2GVZC 3SEZA 3KAQA 2EQAA 3MWDA 2VT2A 5KYVA 2JIRA 2I6FA 4UJ3A 1U8YA 3VTZA 2ZB4A 1RWMA 3H4TA 4WMLA 3T3DA 3KTDA 1RRGA 3KQPA 4B4OA 4DLWA 5LP6B 1F20A 1Z3CA 5BW6B 3IB3A 1LWOA 3PFIA 4X65B 3OTOB 4FJ1A 4YT4A 5TMPA 1IY2A 2H7VA 3Q8WA 4KPGA 1M6YA 3F6YA 3B38A 4A9AA 3I6MA 2F00A 4CM5A 5TPZD 3T3IA 4FXPA 4P33A 5B3JA 4KDCA 3IUNA 5F33A 3MELA 3E1KA 3ZBQA 1T2AA 1N1EA 2ORYA 1JQDA 2OBXA 3ILYA 4TZTA 4UHFA 3FPHA 3C1OA 3IEUA 1R6DA 4EPTA 4BBAA 4FDTA 3FCYA 4XCVA 1XUOA 1K6IA 1XD9A 3DHEA 4HMQA 5JBIA 2Q3HA 4NYIR 4PX5A 1NC1A 4C0XA 2A9RA 2ID7A 2WHRA 1E4OA 4MW1A 3RBZA 1G4UR 4BVFA 2FE1A 5CD9A 3QLTA 4TWBA 3HO6A 4MQ6A 1GHTA 2HJVA 1ZIYA 2XODA 1CUDA 5IP5A 3LUFA 4WKCA 1G3IA 4Z4EA 1FL9A 2HWWA 1UP7A 4TTVA 1QBKC 3PR1A 4D8WA 1DX9A 4DIFA 3WBBA 4G1EB 4A7PA 3W5BA 2JCGA 2NGRA 5IC5A 4F2HA 5C7OO 4V39A 5DCWA 2PMEA 3L7LA 3RSGA 2Y93A 3F67A 1CUUA 4IR7A 1CJBA 2DMRA 2JJ1A 5E2AA 4EH1A 4EY5A 4PNZA 2K87A 1KAGA 4LVUA 3KHTA 5HZHA 1BE0A 2WIGA 1LB1B 3HEBA 5AJUA 4CQLB 4NI5A 3OLZA 3ZVRA 4CW7A 1UBJS 5BO5A 2J30A 4I4TA 3LHKA 4M1EA 4J90A 4G37A 2YNMA 1MB9A 3A4YA 3GPCA 4B0PA 5HX7A 1VYTA 3OLXA 5BQPA 2WWGA 3TGWA 3OEED 1DOAA 1XU7A 2CVPA 3RO7A 2DF8A 2A5DA 3TLMA 4P3YA 2CMHA 4DARA 4BO7A 3MK31 1PWHA 1OTYA 3OOJA 4D45A 1NJ2A 4LNUA 3VJKA 3Q11A 2VPXA 3C43A 1HQYE 3WZLA 3OE4A 5K3AA 5CB4F 4M1ZA 2C7RA 2WUWE 1CULC 4E2XA 5M5BA 4J16A 2M6KA 1QTIA 2PZMA 3ADBA 4WXHA 5G0VA 4JI2B 5LA6B 1E0DA 1QAOA 4R05A 4R16A 4QXOA 4BFSA 1TFUA 5AOBA 1JG7A 3D2BA 2WABA 4I2NA 4C78A 4D0RA 2E5WA 4B6FA 2XR1A 4RCZA 2KHZA 3QP9A 4Y2TA 2EFYA 1TIPA 2RGAA 4AJLA 2A86A 3AR3A 2WWWA 2X1MA 3GH1A 1GFIA 3M6IA 4NAHA 5FYDA 4LWZA 1Z4OA 4PHGA 3WG9A 2PUFA 3U4MA 1C0IA 4IXWA 1YIOA 1CJVC 1CUJA 3LYLA 3W2HA 4ZCIA 5LN1A 1DHTA 3EMVA 2JHGA 4OX9Y 1SXJD 4CM9D 2PZJA 3H4VA 2SNIE 4PAQA 4URFA 4HFJA 4B3GA 4YONB 2Y27A 4OATA 1AB6A 2YFKA 1MENA 1C3OB 1NAHA 1SZCA 2PS3A 5HF8A 5KNCH 2AF4C 4XIFA 4IWNA 1K2WA 2JANA 3D8HA 4II2A 3GEHA 4MO2A 5K6RA 1DT5A 2O7RA 2YJGA 2ZSFA 3WK5A 3S70A 1OFHA 4FLFA 3D6MA 5EJ7A 6AT1A 3QK7A 3M81A 2PK3A 4GWLA 1PFUA 2QM3A 1JBEA 4YC7A 4LF9B 3DXYA 1JWBB 1JJVA 2PIDA 2XDWA 3OF2A 2X5KO 4UOQA 1KXZA 4ZQEA 4B87A 4B3TB 5AVVA 4I0WB 2PANA 4HX5A 5F1KA 3SQMA 3WICA 4N3GA 3TCKA 5L9AA 2OYSA 2C0QA 1MU0A 3AI3A 4OSPA 1E1YA 4ZVUA 2OHOA 3L77A 2QD2A 4WXEA 3VPXA 4DSUA 821PA 2PA3A 5FPQA 1DTWA 5TPZA 2ZWPA 1T8YA 3AVVA 2DKOA 1VRCA 1ZGCA 1UT5A 1O58A 3G82C 4NF2A 2Y05A 3UMYA 2CHFA 4I5FA 1UEJA 3X0DA 1V5GA 1GDTA 3HXOA 3LW8A 3RSHA 2Y6UA 1XTKA 3VX4A 1JLSA 4WY2A 3JWEA 4UNIA 3ZCRA 3C6QA 2GJ9A 1RBMA 1X7DA 3C7CB 3N2KB 4S2UA 3ZEIA 4YX9A 4R0NA 1QYIA 1L4MA 4GS5A 1WPXA 1PQ4A 4PS0A 1HL3A 2GN8A 1XTJA 4LX8A 3GX1A 1UXJA 3CKMA 3IDZA 1N5RA 1CUIA 1NMQA 1WW8A 3QBTA 4MJ3A 4AF6A 4B84A 4D5GA 4YDQA 5JPDA 5AJYA 2CVHA 3ADDA 1GPWB 2W2XA 4KXQA 1YZQA 2P7HA 3LF2A 3ZTWA 2VDVE 1XOIA 5B1EA 5JV5A 1T6NA 1L1QA 4BLTA 5K99A 1OYYA 1HXHA 4ZCPA 2C1EA 2CEKA 2CLKB 3R5KA 1U94A 1RQRA 1Y5RA 2G09A 4UEKA 1J2EA 2GK3A 1EIZA 4PNPA 5H02A 3K9QO 1TQHA 3I42A 1II9A 2GUGA 2ONYA 4A73A 1AQLA 4YYZA 2R85A 5JEEA 2YHAA 4MRMA 1TLLA 4X1IA 2GASA 3C39A 3DVQX 4EI2A 2IF0A 2J9FA 3EA5A 3VR5A 2C98A 4KO8A 3OEEA 1HEIA 5JPIA 3DA8A 4IW3B 3VOAA 5EWMB 3ZTYA 1RVDA 3LHFA 4QELA 2XRMA 1QORA 2G9UA 2QE7D 2YXEA 3F3SA 1IXZA 1UINA 2E1RA 1JSLA 3O3NB 3T4EA 2UUBB 3AMVA 3K9BA 3Q2KA 5CJJA 4PGHA 4XVUA 2NU9B 2A3NA 4ENWA 2BSAA 2JIPA 2NO0A 3R3VA 4KXMA 2NVUA 4EY4A 1SHLA 1EXMA 2Y68A 3E3NA 3P71T 1K2VN 1CZKA 1L8LA 3LHDA 4OI2A 4S2EA 4WAUA 4BKUA 5AHRA 2I78A 5BSUA 4RTQA 2P5SA 4YHBA 2PH1A 4HP8A 4RU1A 2FMFA 1S9HA 3I58A 1BX1A 3H0KA 4JNKA 4JVSB 4UMDA 3UJPA 2OO7A 10MHA 4MDFA 1GFWA 2H5JA 2KPOA 3FY4A 3AERA 1QQAA 1ZFNA 4KIFA 2I71A 3D43A 3ZWXA 4J0EA 4J0DA 1KP9A 4FB5A 4LE0A 4WOPA 5ALLA 5B6IA 1RLJA 3BSSA 2P62A 4FHZA 4OFXA 5EG5A 4NYJR 3C0KA 3BCHA 2HQ1A 3ORSA 1I3LA 1QXSA 3BFPA 1M7BA 4DNQA 1SXJA 2ILVA 3HP1A 4MXDA 4CM9A 5DGCA 1CY2A 2PXHA 3ZU6A 1ZJ6A 4B3XA 1RPJA 3ZI7A 4B9AA 3HCPA 4JUCA 1S0UA 4IUBS 4J4TA 4ARIA 1T0JB 3TEJA 1EAMA 1XVUA 1TCAA 5FUBA 1SWWA 4FVTA 3BORA 4BVGA 4OBXA 3K92A 3ZGLA 1GQFA 5GQSA 1YDHA 1Z4NA 5LOVA 3CPSA 2XGJA 2FQYA 3RHTA 1D2NA 2ZJ6A 3GFPA 1QAQA 4GKAA 3OLQA 4B82A 4R8RA 3NIFB 3H16A 5DHPA 2GPBA 4E5YA 5EJ6A 1RPAA 3V7NA 4E2ZA 1NC3A 3CEAA 1UBGA 3LCRA 2GHQA 2AQKA 2H18A 3MIIA 1JG3A 3W79A 3PU6A 1T2VA 1LSOA 4JI3B 1KF0A 1ICIA 1PW7A 5HFJA 2RCYA 3L6UA 3A37A 4GI5A 3S1AB 2OCIA 1SHKA 4JJIA 3EX7C 1CIJA 1EFCA 1EZ1A 2R8EA 4PLYA 2HQRA 1PEYA 5A4JA 1T5OA 5TIIA 4S1NA 4UUAA 1H2RS 5IDXA 4II7A 1A88A 3CZ5A 4BX8A 1U28A 4I55A 2QM7A 4PG8A 3SR4A 4Z4QA 1HO3A 4OHWA 5DYYA 4BZWA 4WKGA 4F1KA 4IVPA 3WO1A 1IY0A 3GEEA 5ECGC 3EUFA 4G09A 4RPKA 3TIFA 3ZLVA 2GCOB 3QX9A 3R9WA 4L73A 4ZOQI 3K8YA 3GZTB 4OLBA 3GPBA 4RIHA 3WOHA 3PFNA 1DRVA 5LUAA 3I2GA 3TVDA 3HKCB 1Z6AA 1JR6A 2Y0EA 3KG2A 2PO7A 3EXG1 3L9XA 4WD3A 3FGPA 1TMOA 2OHJA 3FMVA 1U81A 5IEBA 2GFIA 3VKVA 3P0JA 3HU2A 3GZNA 3QEJA 4HDKA 4RJ2A 5EXSA 3PIRA 4L76A 3LPAA 1CUBA 2BGWA 3CJRA 2J6HA 2PX4A 4X9XA 3ZWAA 2YASA 4Z51A 1EP3B 5BR8B 2Q3BA 3FTQA 2BTEA 1E5XA 1JYEA 1LFAA 2AVDA 4GLOA 4OEHA 3ESXA 3M4JA 2O54A 1OI4A 2GJAA 1XZAA 3T7SA 3NDIA 1DRUA 3DP7A 4DZRA 2MWMA 3KDAA 3AFNA 4PSVA 4CFSA 4E6EA 2ON6A 3ZXXA 4EGCB 3ODGA 2KLHA 4L0QA 1X8JA 1YF3A 2J48A 3E4DA 3OCXA 3QOFA 4JEIA 1NZFA 1V4BA 4INPA 3F7OA 3A4VA 1ZMOA 3ZNOA 2XUFA 3LXXA 4PGGA 5AM5A 2Q27A 3OX1A 3U4AA 1N1GA 2X5XA 2OGTA 2OHXA 4ZU3A 1KJQA 2ZRKA 4PPNA 3WB0A 2O7VA 1NQVA 1OR8A 1DTWB 4PCUA 3UK6A 5K0EA 1J5XA 2QE7A 1FPQA 1PL8A 2WB4A 1BWPA 1U0SY 1LV8A 2FPPA 4UUPA 3W3ZB 1LUAA 1FFCA 3Q2IA 2K7FA 1EFTA 2VWGA 2WMOB 4FNGA 3FIUA 4QU8A 4NV1A 5HRCA 2NUPB 5C2JB 6REQB 5I3CA 2YKGA 1UPBA 3R3ZA 4WQMA 5HKBA 1DCKA 1Z8NA 7ABPA 2Z30A 3CM0A 2DG2A 3HLKA 4JEUA 4XX1A 4F7DA 1CS0A 1ZVVA 3VNRA 2NXJA 2YXLA 4UAJA 4Y9TA 5DASA 3ENKA 1JEOA 1F0YA 2QDKA 2Y1WA 1SBIA 5CNJA 4FR5A 1I3OA 4HB3A 1VJ0A 4IHKA 3IIIA 1SEVA 3KYCB 4KXVA 2H9YA 4B2YA 1E9VA 2DT8A 3TR5A 4YRTA 4J1TC 1U8ZA 1Y9JA 1PKEA 5DCUA 3UJ6A 2VF8A 4FGZA 1SCKA 2HHJA 1YJQA 4KXLA 3O93A 5T4HA 4BTVA 2DRIA 2J6IA 1TDJA 4YJDA 5EP2A 4ZT4A 2QW0X 3BHJA 1OILA 3D6JA 2ZWVA 3M5PA 2IE0A 3FAZA 4BQRA 2X40A 3ILSA 2OM6A 5MHTA 1C4WA 3RGGA 1Z5WA 1P61B 3IDAA 1ISRA 2FWJA 4HN2A 2E4UA 2VI5A 2ZKLA 2G04A 2OCPA 3WIUA 5BVGB 3VA7A 1CG6A 1GN9A 4N49A 2BHTA 2J9FB 4G26A 1NUAA 1NUHA 5F9MA 5A4FS 3K71B 3HB7A 2ABWA 1USUA 3L2OB 5CJ2A 5E9WA 3OU2A 1AJEA 2DJIA 5JD4A 5AKHA 4FFSA 1BVRA 1Y3DE 2QVBA 5IBQA 3HZHA 3LVBA 1VLLA 2BBSA 2YJ4A 3TW6A 1GL9B 1E0SA 4M0DA 2JGDA 3EXG2 3QA9A 5FPYA 2WM2A 4Q9KA 2OOSA 3SHVA 1IY8A 1RMQA 3Q10A 3N59A 3IUJA 4IQGA 2EKDA 2X86A 2KWIA 1PTJA 3EEIA 1P3Y1 3M82A 3QTBA 3WWZA 5B57C 2HBQA 4IF6A 1FRZA 4M9SA 1BSVA 1QIGA 1A7KA 4MUGA 4URZR 4ZC1A 3UT6A 2P4HX 2XGGA 3AJAA 4DNXA 2OCXA 3QV2A 1W4LA 4QOSA 3RK4A 4DADA 4JV5B 3R5HA 1T1RA 3JQ8A 4WFIA 2GAOA 2ZR7A 4LRWA 3BE6A 4QYSA 1Q2UA 2ZSBA 4KQFA 3JQFC 4QARA 3C85A 1SPBS 2BGKA 2QAJA 4DA9A 5A4KA 2K2WA 1VIVA 4KLNA 3BTSA 2C94A 1NN1A 4EK9A 1VZ2A 3NZEA 3NIGB 2P4SA 1T13A 3GDFA 1XEAA 1ZN2A 2ZUCA 4TGLA 4DA0A 1CIVA 3KXLA 2WUDA 4JYAB 4C7BA 4Z54A 3WRYA 3D8BA 3L05A 1NI3A 2B21A 2Y1KA 2KB0A 3GOQA 2LDXA 1USGA 3EHDA 3BK7A 3NTOA 3VV3A 4PLZA 1ZIDA 2EOAA 2Z9BA 3AOGA 4LQDA 5CHYA 1Y4AE 2IU0A 2XADA 2GD6A 4EYQA 2DHEA 4OJTA 2DECA 5IANA 4I8XA 2W2KA 5LOVB 3S2SA 1TGVA 2V6JA 5JMWA 5KNBD 3E8XA 4YA6A 2GN9A 4G9EA 1CWUA 1UBFA 4BNNA 2HHLA 5IKMA 3G9TA 2GBPA 4CE6A 1H4SA 4EJSB 2N0SA 1HDRA 1KZGB 1R9MA 3EGXB 4PLWA 5BUSA 5EI5A 4ALIA 4DDWA 2JGNA 4E5UA 1BJRE 2VP9A 3PFFA 1UC4B 5L3RA 3B3FA 3Q7QA 1UBUS 4O4IF 3OUUA 1MH9A 1NHGA 1RRVA 1HDIA 2FPOA 4WACA 4Y30A 1P18A 2D5IA 2YJZA 4X63A 1SBNE 5JFTA 5KOHA 2VPTA 1KQPA 2PBRA 3ZHBA 3KOUA 1Y3CE 4K1XA 4GBGA 2A9VA 3AF2A 1VKHA 2R8BA 1I2DA 2FMUA 3FTNA 4OKSA 3KV3O 1TVCA 2WWIA 4WBXC 1O0BA 1JDTA 2XBMA 4QULA 4GPIB 3GT3A 4O33A 5EHXA 1C3VA 2RJ3A 1KAHA 1Z5PA 3P9IA 4W9MC 1RYHA 3EXEB 1U7OA 1NVAA 4S1OA 1W85A 4RFSA 2DFLA 3ILHA 1N2EA 3SQNA 4IMRA 4KAJA 2VYCA 2XWSA 4PQEA 4R3NA 2W2NA 2C1XA 5ALJA 3FI9A 4TS4A 5LMNB 1FTQA 4AZ3B 3CIOA 3B51X 3JQCA 5FFMA 3UK1A 5JY1A 2A0YA 3DCIA 5FWNA 1UKCA 2OY0A 1MO4A 4ER6A 4G9GA 3NHMA 3PHIA 2WF5A 1I2BA 4IWYA 4M89A 3ZI4A 3THSA 1JQ5A 1ADYA 1AQYA 1M2KA 4HNAB 2ADOA 1F5SA 2CXNA 3WWDA 3WSTA 3O9ZA 1QK4A 1JTEA 1DEOA 2IYQA 1LSUA 3BC1A 3EYAA 3NOXA 1N3IA 3QG5A 4MARA 1Y6FA 3INGA 3VNSA 1XO1A 4LV5B 1DC8A 3GLHA 3SC3A 4MLPA 3NFRA 3DO8A 8AT1A 2IE8A 4HNSA 4OOEA 5D2CA 2KW5A 3DAFA 1S5PA 4CKCA 5LNK6 2IQIA 3UVEA 2CHUA 3VC7A 2FZCA 4H7JA 1LPOA 5KS2A 2W8BA 4JP8A 3TF5A 5H9VA 4OXNA 4G63A 1RDFA 4OHFA 5EERA 4CL2A 1UM8A 1Y37A 4K9QA 1YMUA 2PGLA 2FG6C 5BV7A 4D9MA 2A35A 3K05A 3AFMA 5DWVA 1K7YA 3Q87B 2WJ4A 1KDYA 1MNAA 1I0IA 3UH0A 1U2EA 4Q7JB 4C06A 2P77A 5C4MA 1X7XA 2V58A 1M34A 2BMAA 2Y0PA 5IEJA 4Q1AA 4R83A 1I80A 1CS0B 2CMGA 4LRYA 2W2PA 4XYEA 3O21A 2I76A 4WK6A 3QBJA 3FKQA 2JFUA 4TLDA 1DKMA 1T6BY 3AVPA 2WNSA 1V1RA 1TT5A 2QIOA 4X6YA 5BXQC 3VPHA 1QHIA 4E1BA 5BSMA 5FRDA 1AUVA 4ZDWA 3ZXIA 1B1AA 1EWTA 1FDOA 2K7ZA 4M55A 4RMGA 4D9HA 1D09A 4JGGA 3U37A 5A1TA 1FLDA 2CFOA 4CNBA 1QYXA 5L6LB 2R751 3Q7EA 4RO0A 3Q8MA 3KQUA 1CHNA 2XUQA 1PX2A 2FUKA 3FUVA 4M1SA 5UKDA 3U31A 5BWNA 2G28A 3WR5A 2DH5A 1BMQA 2GAJA 3AP1A 3AETA 1XRNA 3OAAA 4HEA6 1RE1A 1TNDA 1KDTA 3B7PA 1R8QA 3L7JA 1E2HA 1WDTA 2VHEA 3KSMA 3QLUC 4FR2A 2XYRA 2VDRB 3I12A 1C1DB 2HF2A 3ECSA 3TKAA 2JH3A 4WKOA 2HBRA 2QVGA 2GCGA 3GBVA 4PPGA 1W88A 1WMBA 1HE8B 1U80A 3PK0A 1FSFA 3UWOA 4XKJA 2JA1A 2O20A 3FDZA 4N65A 4OAOA 3HO1A 4L8LA 4CCWA 1LBIA 1N6NA 2ZT8A 2QF7A 1JSRA 2NQTA 1DIGA 1JH9A 2DKNA 1DIBA 3W6PA 1MC5A 3HGQA 4FX5A 4E51A 2QTTA 4KN5A 1QRTA 1SJ9A 3TPCA 2ONKA 3BREA 4GZ6A 5JDCA 1CDZA 4H1HA 4DWVA 1V6CA 1OIVA 4OVKA 3CW8X 5I7FA 1YJAA 4RFLA 1HQDA 1DIRA 2QRZA 5G1NA 1SU8A 3OZSA 4NJMB 4ZHQB 1ISSA 4A8HA 1GZ3A 2GRJA 1J22A 1LPMA 1CF2O 3X2SA 2IY8A 4OGGA 3X1JA 2N75A 4DIBA 5EJEA 5KVQA 3T3OA 3OI7A 1G8SA 3ROZA 3KK0A 2DFDA 3ZHCA 3BWCA 4PZLA 1REQB 4J07A 5EXXA 5IYZB 3USCS 3KKEA 1TOAA 1NP6A 2D0IA 5DOZA 5AWFC 4R9SA 4AUNA 3EWNA 3FHCB 4OG2A 4WJZA 2J41A 4CIDA 4KPEC 3E58A 1W4BA 4UUNA 2D7DA 2IS1A 1E6WA 1X3LA 4RYLA 4B09A 3AUKA 4EFNA 1SC1A 1HKHA 4H6PA 1U8AA 4F0JA 3CUKA 4JENA 4CMKA 4QEZA 4ROTA 3N2GB 1EE9A 4BDTA 5EXTA 2VTVA 3THXA 1D5WA 4G1CA 5TT1A 2AG0A 4DLSA 2A9FA 2NW6A 2WD7A 2B7BA 3IVCA 3UMGA 4EYEA 3N87A 1FY2A 1MR3F 3AVTA 1SMKA 4DUYB 2Q2QA 2AOWA 1BQ4A 2NUAA 2WYWA 4RADA 1EFPB 4PAOA 1NP3A 3TLGB 3JAKB 5CRIA 1EK5A 5IVHA 3DF7A 3L0DA 2YICA 3PSHA 2ZSIA 2X2PA 3F71A 1QQ5A 4LV8B 2IGBA 5EWLA 3AR2A 1THTA 3D8SA 5JQGF 1R6AA 1JIXA 1E5LA 4QOFA 2AMFA 5GJCA 5AVSA 2UXBB 3OT5A 4NBWA 4AYTA 4NYJQ 1D0SA 5IZCC 3KVYA 4EHLA 4PRZA 1JQLB 1KYIA 4QU5A 1FJGB 1R0KA 4EATA 4UEOA 3R77A 4YO8A 1UUFA 2V4UA 1GFZA 1KOFA 1LX7A 3EY9A 1RM4A 1JEQB 2GZ2A 1GUYA 3U3ZA 3CCCA 5AXBA 3FHJA 4C7XA 5B3KA 3DZDA 2WT4A 3CWQA 2VT3A 1MO3A 3F98A 4KZPA 1JDVA 1V48A 3WAKA 4CT4B 4YJGB 3NATA 1UOQA 1OBVA 2I7CA 5KOYA 1SCAA 1XWWA 1AN0A 2PV7A 2ZR0A 3E2PA 3SAJA 3Q1KA 3AHHA 2VA8A 2VQSA 2WKQA 1V9CA 1KK2A 1OKKD 3JD0A 3D3KA 2ZUTA 1RU3A 4XSHA 4CEJB 4N4AA 3UG6A 5I7VA 2HUPA 2DSTA 4GOOD 1I7QB 1D3AA 1UPTA 3ETCA 2IIQA 2O9JA 4TM8A 4D56A 3EWIA 4Z9BA 1IATA 2FN4A 4ITRC 6NULA 3KR0A 1RZUA 5IVIA 5L6MB 4F85A 1NT4A 5ICEA 4RTOA 4MR8B 3N7TA 3AL3A 3LIPA 1C81A 4Q39A 1KQ3A 4ISCA 2FZWA 4LY9A 3DHWC 4FGJA 4P0QB 3HR4A 4EG5A 1J8VA 4V0SA 3L49A 2PZGA 3EVZA 3SBEA 2JPDA 2I66A 2YL2A 1ISGA 3F4KA 1DGQA 4PZ9A 1ZVMA 2RGXA 5FPPA 3VO9A 2O8CA 1BQ3A 1H2FA 4FFRA 3WMFA 2FSIA 4YCMA 2Q3JA 1MJFA 1DPGA 1Z8HA 1PR0A 3HUUA 4RJIA 4BV2A 3RSFA 3H1EA 1OZFA 2NLOA 3MMXA 3V4RA 1C8VB 1FTSA 2XF8A 5L53A 2LR0A 4JX8A 1IQ0A 1LH0A 3ZJVA 2G9RA 1JQKA 2BTQB 4OHXA 5EZSA 4IDDA 4JU8A 3EIEA 2JJQA 3GDOA 3ZZ1A 4IHAA 1ADJA 3OPXA 4B34A 4QWMA 4FWIB 4DC9A 1W5FA 2JF0A 3T7IA 3AWDA 3WB9A 4B80A 4Q24A 5F77A 5CD1A 2EGGA 1JFRA 2WWHA 1G64A 2BBTA 4GI1A 4JT4A 3UW1A 1TT5B 5G40A 2OORA 1Z2AA 1KH3A 4ND1A 2WIBA 2VYND 5M34A 1P4GA 4DJAA 3VSBA 2J87A 3TGPA 1K75A 2WSSD 4TTSA 3V7FA 2FVYA 3DUFB 4F4IA 4YN3A 1IHDA 1W36D 3PP8A 4WLFA 4AY6A 2X19A 3AVXA 1PT8A 4MS1B 3RVMA 3K6RA 5JSZA 3NHSA 3OMLA 2J3IA 5DM0A 3UN1A 5JSFA 3IBGA 3TM5A 2Y0BA 2ZJ3A 3ZOZA 3DNPA 4WZBB 4O4LF 8ABPA 1FFBA 3HBNA 4PHTA 3U62A 1T3SA 3MTAA 3D0KA 1ZAKA 2ZU0C 3GA0A 3GCGA 4Q3OA 4LQLA 3VVLA 1I5RA 4YRFA 1O8CA 2IU6A 2C7QA 1QFMA 2PKRA 3RC7A 5LM3A 1L5WA 2GD1O 4IHJF 4M83A 1Z6GA 1THGA 1DJMA 4JBWA 4G4IA 4L5YA 3TTTA 1GKUB 3W5VA 1MOSA 4MS4A 4ZAYA 1V45E 1VE5A 3AVOA 1L7OA 2C5BA 1C1HA 2JLZA 4DUZB 4JD5A 1QK5A 4Q9LA 4BS9A 1QH8A 3EIFA 5E3HA 4FE4A 1G8HA 1NKSA 16PKA 1C0PA 2LNDA 3C5WP 1XA3A 5EIAA 3SDBA 4ZN6A 4HKTA 2O8DB 5ERXA 3IEVA 4YAIA 5TEWA 4OYLA 1XCJA 2YYSA 4LS3A 1WF6A 3O1LA 4PX3A 3DEYX 1WZUA 2B1JA 3EVEA 2GKOA 5BN5A 3KOMA 3R9XA 1GYQA 3UJBA 1RLTA 3HS3A 2VHZA 1KBZA 3FPLA 1ZJYA 4DMLA 2NU7A 1Z6YA 2XRFA 4EA9A 2EEZA 1T43A 2ZIXA 3NHKA 1I4WA 4K6MA 4E33A 2I6XA 3T94A 4KLCA 5CNIA 1SKAA 3SF0A 2GK4A 2QBYA 3NBZC 5LBUA 1CERA 5LNK1 4OHCA 1K63A 1SXHA 1IWOA 2PGIA 2LIPA 4HGYA 4HXGA 2YUTA 1RI1A 1T5IA 4TM7A 4BFVA 5ESRA 2LZ0A 3X43A 4B4KA 4BO3A 3TMKA 1DFGA 3N2NA 4HWPA 4WASA 4XB1A 3NOVA 4DIOA 1I01A 2BFWA 2IYYA 1GU7A 3ADOA 3JPWA 1RJGA 3KFXA 3M5DA 2BHNA 3OEWA 1UPAA 1H5UA 1YULA 4RV9A 4UHEA 1DEKA 1SVSA 2BI8A 3H3FA 4PG4A 2WMYA 2C7OA 2HMUA 1ZXBA 2AI3A 3FJOA 3ZCTA 4D8VA 1VLZA 4QYTA 2WNIA 4AKIA 4KIUA 4OXQA 1P81A 3R3SA 2PYZA 2FSVA 4FFVA 1JZSA 4OMDA 1YQTA 2CXXA 3MLBA 3DOIA 2BSXA 3GFTA 2OUIA 4PIPA 5FI3A 2GWRA 3H3JA 1BCSA 3NJ4A 3NB0A 4AG3A 3I32A 5EJ8A 1OLXB 3T5MA 4R8SA 3GLQA 4KTVE 1X0XA 2JFGA 2WM8A 3H1FA 3VVMA 2PZKA 1ZD9A 1X8LA 3K1ZA 1BCRA 3ADCA 3BA6A 2B7CA 3CLSD 2HYIC 3W4JA 1MAAA 3DZHA 1D2MA 2JATA 4RY8A 3RU9A 4BKPA 1OFUX 3VH2A 4DR3B 5FPKA 1WCIB 4HEA1 5IULC 3IGFA 1YVEI 2FWMX 4CF5A 5A1JA 3BGSA 1I1QB 3M9XA 2F3SA 3AKCA 1KEEA 5K5EA 2FRDA 1H2WA 2F8MA 3OEHD 5CTJA 4N3AA 4C7MA 5KOJA 5HNKA 3IHWA 2HPHA 5CVUA 3OCCA 4UUQA 2IOFK 2VYNA 3Q3JB 4UHKA 4L5CA 4H4CA 1UBOS 2ZAMA 2IS6A 3GNQA 1JIJA 2YYZA 3OZ7A 4G4GA 2YOFA 4UAGA 3EBLA 3H5TA 4RMJA 2XTMA 2ADMA 3ZDFA 3CGGA 4BQSA 3INTA 1ECPA 1J9ZA 1NVDA 2QPTA 3M3DA 2CT8A 3D4OA 4K9RA 1GQYA 2GI4A 1B42A 1KO1A 4R98A 3NONA 4QPZA 1O96A 1AS2A 2HFKA 1HKUA 1L9XA 1XZQA 1MJGA 3FR7A 4GE3A 4PO3X 421PA 2ACKA 2VPIA 4OMCA 4RZSA 3BRSA 4RHUA 3V42A 3A6LA 2FWIA 3JQDA 5KVAA 3WGZA 3OQOA 5HILA 5E1OA 5JLAA 4DCTA 4F71A 3I5AA 4LHVA 2WAOA 3F8TA 4YYEA 5CDHA 4OFZA 4RK7A 3RTAA 4YJFB 3F73A 4AO8A 4HDMA 3I4FA 2NO6A 3GROA 2BR5A 1AHPA 4N76A 1NQUA 5J63A 1YTUA 4RD6A 4CTJA 2C9MA 3P9CA 1X1RA 4YAOA 4J4BA 5CYOA 4AY5A 2WNHA 4HYEA 3T52A 2I22A 1Q3KA 3AF4A 3DAHA 1RLOA 1ZITA 3RRZA 3RTDA 3IJPA 3K0AA 4Q01A 3JAWA 3VH1A 4GOND 3IMCA 1M1XB 1F06A 4Z3DA 3I6YA 1MC4A 1ZL2A 4MJXA 3VJMA 2YV4A 1OH6A 2PH7A 1KDVA 1IONA 4ID9A 2CB0A 1EUZA 3NG1A 2R7LA 1HUQA 4ZRDA 1BA3A 1X39A 2ZDQA 1LDNA 2RGEA 3ADKA 4HAOA 4PSDA 5DI9A 3RVNA 1LTKA 3LQQA 1IN5A 1L7VC 4XVCA 2WKSA 4F12A 3W5AA 2HA4A 1MA0A 5CB6A 2FLKA 5CA0B 4EIWA 4D3DA 2RSLA 5FUVA 2JAQA 5ELMA 4CUKA 3I1YA 4OK3A 1O0CA 1ISMA 2P2NA 9MHTA 2OHFA 5JSZB 3I4LA 2IHKA 2IP1A 1E8NA 1R0CA 2ZZKA 1TCBA 4QJIA 3VUFA 4BFZA 1O6FA 2NT4A 3T1QA 1QAMA 2Y67A 1PV2A 1MEEA 1DC7A 2A5YB 3PSAA 3I0NA 2AC7A 3Q85A 4LYFA 5J4YA 1GR1A 1B8UA 2YJNA 3DQZA 4UHDA 5IM4F 4LFAB 5AJTA 2Z8ZA 3H86A 4OUKX 3L6BA 3PFKA 3KQLA 2X0NA 1MP0A 1PQYA 1Z47A 4N7RA 4PAGA 3RJ9A 1MLDA 1GAQA 2HIGA 3E70C 1NPTO 4MS4B 5AW9A 2PRZA 2GYWA 3DE5X 4B7ZA 3HYCA 4BVJA 3E18A 3QLEA 1H6DA 4IGEA 1S2IA 5KHLB 4M46A 3DEFA 1FB5A 4B40A 3WGOA 4QDOA 3Q7RA 1SAYA 4F6CA 1A8PA 4KAXA 4Q4AB 1ZMBA 2GGSA 3B7WA 1EDBA 3MGBA 4GLFA 2IHNA 2ODPA 3PVZA 1HNWB 3FOCA 3VR6H 2CD9A 4HEJA 4NK4A 1U5AA 3NHYA 5KWSA 5F12A 2J7KA 5FBLB 5JISA 4BMPB 1ZH2A 3DTYA 1L5NA 5BN5B 1IK4A 1COWD 1I4DD 3QFRA 3FSGD 4CTKA 4C1BA 4Q7EA 1FEZA 4U9HS 1NJFA 3BIFA 3DOUA 4EG4A 3HN2A 4AP9A 5CT8A 2HSGA 1KPIA 1HZZA 2A9KA 2XNSA 2ZIXB 2WRZA 4U6QA 1N0UA 3L1VA 1VA5A 3OEHA 2NZJA 2DLNA 4JEHA 4URHA 4Z0TA 4Z2YA 4C4ZA 1QGAA 4GRDA 4XJXA 3CINA 5HPYB 4F1WA 1NR5A 2X1VA 5I51A 2G72A 2DETA 4CEHA 1H1TA 4RKRA 1U6JA 5A5DA 2ZI6A 3HGTA 4WXYB 5J2TF 3BB1A 4BNWA 3MGKA 5LLTA 4CLOB 2Q5LA 4DV4B 1N5LA 4ND3A 3FNBA 3OOEA 5K0BA 2FMHA 1NJGA 3DZBA 1P1RA 1OU4A 1U7DA 1NE7A 2W2VA 4GSKA 1QF9A 2XYHA 1J2JA 1CKEA 4U6NA 5KPJA 3A4MA 4BMVA 1WOMA 3IILA 3SLRA 3FJYA 1X1AA 2WP0A 3PDUA 1IQPA 4O29A 3OG9A 4KP7A 1PFKA 3O9VA 5A71A 3K70C 3PUZA 4FZ5A 4OPMA 1SQ6A 1M1NA 2P9ZA 2Z2ZA 1RAGA 3OIFA 2D0DA 4G67A 4H17A 3VYVA 3W6ZA 2IZ5A 4HWSA 4ZEOA 2XMRA 1BCSB 4AUMA 1ATZA 3STWA 3LT1A 4F4JA 2A7XA 3EVAA 4ZZ1A 4HWTA 4NDNE 4K40A 2DPYA 3THRA 3RC8A 3BHIA 5DW0A 2JK1A 4RA9A 3BDAA 1R8JA 2GO1A 2O0KA 3TTSA 3B85A 4P3XA 2PX0A 4LAFA 3UW3A 1HA3A 1UKVY 3VPFA 3OZAA 1F2VA 1NVWQ 1X7WB 4IJ6A 4XFKA 4AZ0A 4W5WA 3FFAA 3FPKA 4E7PA 2P9JA 3ZDYB 4EL5A 1J7JA 1I36A 3RUDA 2I1WA 3DWEX 1GV1A 4CT0A 3VC2A 5FBRB 1I6WA 1F8XA 4D80A 4YRBA 2O2IA 3JZMA 2AFIE 2Y1GA 3WWYA 4P86A 5LZ9A 4Y9SA 1MQSA 3DE1X 2X3FA 2MCFA 4E94A 5CDFA 3LZCA 1JR3D 1T9CA 2PT5A 4QJ3A 2QXUA 2Z3WA 4B8WA 1W36B 2C29D 1FFSA 4G0ZA 1LRJA 4DOMA 3IHKA 4HTFB 4NJEB 1NVTA 4B76A 4D0NA 4GMXA 4V1CB 4HDAA 5TPWB 3GT4A 1T4CB 4Z4GA 5HA5A 5JALA 2UVPB 1TW3A 3HJUA 2G83A 3VO1A 3IEMA 1YR7A 1D07A 3SM9A 3X1DA 1AHIA 2CWWA 1HFKA 1N9GB 5G0SA 1M5TA 3RFVA 2QV0A 1DS6A 4H2DA 3W9BA 4D79A 3BK1A 4R2JA 3DMGA 2Q8NA 1BDHA 1EFRD 3C14C 4JLBA 5EIBD 3VSCA 4NICA 5KSWB 6PFKA 5BNFA 3RR2A 5CB4B 1WCV1 4KGXA 1HG1A 1AKWA 4XZ3A 4PVCA 3TAXA 2Q1SA 2CUZA 1CUSA 2JGFA 3TW8B 2NADA 2QL6A 5A03A 3B7GA 3ZVLA 1A1SA 2RK3A 4UBNA 5HUJA 4B4VA 4LSWA 2OCYC 1VRVA 3LUBA 1K7EB 4QO7A 3AESB 5DN6D 4KO3S 3O03A 1K3UB 4JNCA 3HG7A 4OQDA 3R6GA 1A9OA 2JBAA 1JVSA 5K45A 5DPMA 3TINA 3QH4A 5HKLA 3IURA 1RQNA 2CBGA 4J76A 4ZWNA 4NESA 3UENA 1XA0A 2WJPA 1U02A 1QCYA 4P34A 3TLCA 2VWHA 3MCTA 1M2WA 1A50B 4F5ZA 1COWA 3FSGA 1JJFA 4G0YA 4ZTUB 4K8RB 1ZINA 3NLLA 5EVJA 5BN4B 3RFTA 5F2NA 2AYXA 3RG8A 4OP3A 5KPDA 4D6XA 2TSYB 5EFZA 2Z8YM 4FR0A 1RC1A 3WNVA 5AVYA 3MJVA 5GVSA 1E3TA 3ICQB 1K97A 1P2FA 2FR8C 5BSGA 3HY6A 1S7GA 3R3UA 4RTKA 3VAZA 3WL8A 4EMBA 4IOMA 4KNVA 4ZYYA 1XLUA 2V6BA 3L4JA 4N8DA 3PXCX 1WZCA 2F6RA 3BGOS 2BM0A 3OQBA 1JW9B 3DE4X 4LQ4A 3S2EA 3CUYA 2ECFA 1JB9A 2W6NA 1U7UA 1J2UA 3PA6A 5DU2A 1WCXA 1PR9A 5T8KC 4HS4A 1K3TA 3CLUC 3VVCA 2OYCA 5AI9A 1MAWA 1SHJA 1L5FA 3ZI0A 4E5DA 2MMGA 2XKBA 1ZGHA 4Z7OB 3QEMA 1Z37A 1NT2A 1TL7C 2M9MA 2BGIA 3PL5A 1QQBA 3L4KA 3H42B 3PUJA 4LXUA 2PSDA 3AXTA 1S01A 3PUXA 4GQIA 5IU6A 5AM4A 4H60A 1UWVA 2B83A 4U8HA 5BWBA 4D98A 4JR1A 3CC8A 4PYIA 3GI1A 2NUTB 5GTDA 4B3DA 2ZRDA 4W6QA 2NYAA 2QVZX 3NM6B 4JROA 3L02A 4RVDA 5JQWA 2J7PD 3GPIA 4NAUA 4ATNA 3IESA 2VWPA 3MAGA 3O5AA 4DBLE 3KJEA 2WF9A 1TCUA 5U4QA 5TGDA 3V48A 3TLAA 3FCXA 3BXFA 5BOVA 2A3RA 2O8VA 4NECA 3IAXA 4D3SA 4BWGA 1YRQA 2BKXA 3COSA 3N8NA 1P31A 1PZMA 1XRLA 4PZAA 5ECYA 2HGSA 2ICAA 5CIYA 2PGDA 2VP3A 1JJBA 3H65A 3LO8A 2MSCB 4KVZA 4BX0A 4JHLA 4Z86A 2G9NA 3VDNB 1AQIA 2DHCA 1SKYB 1YBAA 3DMYA 3HCWA 5CFOA 3UT0A 2PD4A 3QKIA 2PUTA 3M4NA 1TQDA 4UARA 3FI0A 3ND7A 3WQHA 4CEHB 4GLBA 2ZRPA 1KEKA 4X60A 5D87A 3VZQA 1WVGA 2ZIFA 1RTTA 3BFKA 2PMCA 4MUMA 5ECWA 3FKJA 3IDQA 1YZGA 5K51A 2HA5A 1QVAA 2X9GA 4FONA 1ZI6A 4I9GA 4K28A 2Z57A 1MDBA 3G9XA 1RHQA 4AX4A 1PDOA 1RXVA 3FVTA 1R74A 5CUQA 1TYAE 4NPAA 2B2NA 4ONEA 3HK2A 3R6TA 1RQLA 2FPXA 1PL7A 2J9XB 4L5IA 3RV4A 2Q4OA 4H77A 5FV4A 2VEOA 3ZCPA 1EFRA 1XK6A 3WC4A 4CF6A 1SA0B 4B43A 3K09A 5E7JA 4J49A 2OTCA 3OA0A 2BUBA 3SDSA 4OHBA 1E1CA 1XZNA 1G42A 3T4PA 1Q21A 5CVCA 2YS7A 4PZYA 5IDWA 4TQ9A 5A9SB 3LUKA 621PA 2PXAA 521PA 1LK7A 2Q2OA 5DN6A 1IOWA 2D3TA 1KR5A 1HH4A 4UW9A 4XE5A 2YN4A 4LJ6A 3LFUA 4O59O 1TYBE 4QFBA 5IXSA 2CYCA 1QIDA 1XCOA 3AGQA 5JDIC 2ZJ4A 4WDRA 1C4OA 1NR1A 3BEOA 3SCZA 3B36A 4JB2A 4XXHA 4KOEC 4ALLA 1KDRA 4F60A 5H7XA 3KD3A 2AJDA 5DNAA 2QT0A 1NYQA 1G0OA 4D02A 2Y71A 1VKZA 1QX4A 1IJFA 2QU8A 3DBHB 3NTXA 2WQ6A 2HB6A 1LBHA 3T7CA 4EHKA 2BUAA 5K6TA 5HE8A 3QHPA 1W2WB 4MCJA 1YJXA 1PCXA 2FMXA 4JSYA 4U0KA 2Q46A 2JIMA 5K03A 4JY7A 1W87A 4NVRA 3ZQ4A 1L7BA 2QTVA 1TTTA 3HFSA 3ENZA 1MZVA 1OT3A 1RXEA 4JX9A 1X8KA 1SXPA 3NS7A 3P26A 2GTHA 1RXIA 4LHSA 2KBEA 2CLLB 3L7NA 2GBGA 3H05A 4B3BA 2LCFA 2RGBA 2CLSA 2FN7A 3DDNA 2Q99A 3K5PA 1FNDA 1Z4QA 2C5FA 2DBRA 5FOVA 3T38A 2J8ZA 3OOSA 4O8CA 1M10A 1J8QA 2JLUA 2O23A 4QNMA 3DDZX 3KAPA 1QYDA 4P7JA 4OK5A 4EM6A 2QL9A 3A2MA 3OFVA 4TT3A 1F60A 2R6AA 2VTBA 3HNPA 2XKJE 2AKEA 3KQOA 2BGJA 1RP1A 4RY0A 4GPBA 3WLKX 2B4QA 1Z06A 1ND5A 1XMVA 3MQ2A 4OHZA 4AS3A 4Z7QB 2ZEJA 5JJBA 3T7AA 1A9YA 4KQJA 4N7MA 1J2RA 4BJ1A 1IPHA 4L8FA 5FOWA 2XTZA 3TIIA 4JJZA 4KGDA 4YMTA 1ZJJA 5KDDA 1JPNA 3N0TA 5AVUA 4HQRA 2IRWA 5AW8A 2VRCA 3ML1A 4MGZR 1QQ6A 3N5CA 4MYDA 2Q1TA 4RVCA 3V4FA 1NXWA 1EB9A 2ASVA 2PKYX 4CT5A 5K4AA 4HV4A 4DE5A 2IYUA 4E12A 3KSBC 4WLNA 3EW9A 1JVNA 1ST2A 4JJ8A 4YRCA 4F06A 2CK3D 4CI0B 4YV7A 3NW9A 4UVIA 2R4QA 2CNKA 3NAQA 4EO7A 3GPLA 1QOZA 4P35A 2IH4A 3LFHA 5A2QA 2ANCA 1B93A 3QELB 3UEOA 2C2ZA 1KIAA 5IJZA 3BBLA 5LVAA 2OSBA 2D1SA 1KYWA 3EQZA 2VXCA 4JHXA 1LJUA 4OA5A 4IQ8A 1DHRA 2C7BA 3DDWA 3DZCA 3A26A 3BGDA 3F5QA 2ZI4A 1OUMA 2B37A 4MEBA 4X3CA 4XX0B 4J0CA 4JBLA 2XE6A 4MQFA 4UHHA 3SEFA 2XMSA 4IKEA 3BN3A 5C31A 1VPLA 1OLUA 5D84A 1XPJA 2AN4A 1ZJ5A 3HM2A 4MW9A 4Z9YA 3FMOB 3HCEA 4HRYA 3QFFA 4PG5A 3GHYA 1NF9A 3CVYA 2C3PA 1QGED 4E32A 4ZU1X 3LPNA 2QZSA 4NMWA 1ACMA 2YDYA 4FI3C 1VBNA 3IEKA 3AI2A 3Q40A 3IJ5A 3L1IA 3A58B 4XGIA 1KNXA 3H13A 3QWHA 5F2EA 5G2OA 3CCFA 3ROXA 3D3NA 5FO0A 3G17A 4KMRA 4C22A 5COQA 5DLPA 5I8WA 1G6KA 1N6OA 1P7WA 2Q9AA 5EKUA 7ADHA 1CFZA 4QD3A 2ZAIA 2AK2A 1GUBA 3EIOA 1TJPB 1CYEA 1AXEA 4AQYB 3CFYA 2EJBA 5HZMA 1Q19A 3RJZA 1ESNA 3N1UA 3BKXA 5FI0B 4AJ2A 2I55A 5DHUA 4L7QA 1PHRA 1GTG1 4U1RA 5FEUA 3ESQA 4P22A 1NX9A 5G53C 4WW0A 4X3OA 3E9RA 3J81A 4GX5A 5BT9A 1MT3A 2H2IA 1TE2A 3MBIA 3KZ1E 3PJEA 3KJXA 2QY9A 2WQZA 5G4LA 4G0WA 1U63A 4MX8A 1AGNA 5DFAA 1C3XA 2ZT6A 4GSLA 2V98A 4HAZA 4QJ4A 3RASA 4BNKA 5FBKA 2FWAA 2UDPA 3BRQA 3MILA 1VE3A 2HMVA 2ZUUA 3ZE0B 2GHIA 1R0YA 1SHTX 2QTCA 2F3QA 1NW6A 1JDBC 1K08A 3R44A 3FRJA 4Q3BA 3TLKA 1SOMA 2IEYA 3M33A 3ED1A 2J5QA 3DH0A 4HDCA 4KU4A 4LY0A 4EB6B 2ZUFA 3BE8A 1EP1B 1YFLA 2IYZA 2VTKA 1DKOA 3H5NA 4LZNA 1DKNA 3GEGA 2ACEA 3GUYA 2YZGA 3G6WA 4I4IA 1XQ6A 1YOVB 4RZQA 4RDHA 1M83A 1ZBQA 4UDOA 3PI6A 5KWJA 1E1CB 3IR5A 1FRNA 1JV2B 1ML4A 2FEAA 1LC3A 4XI9A 1FFXA 5JYBA 3MTGA 4XQ9A 3SIRA 1P5HA 1WJGA 2FRVA 4K9PA 2AV6A 2H92A 3J7TA 1E2IA 2W6PA 4I66A 1RM5A 2XNCA 1K89A 4ON9A 4RPIA 5IHXA 4NARA 1P44A 3VTFA 1CR4A 1UK7A 4P9NA 1G38A 1PNQA 3I5MA 1U7TA 4ESEA 2IZOA 1FCJA 3QOWA 3GJ8A 2E55A 4RULA 2IKQA 4JA0A 2I8LA 1SQSA 4DYDA 1F4PA 1GCAA 4GO1A 4ZXFA 3KLNA 2L69A 2AK3A 4KO2S 4EPXA 5JYCA 3E3AA 2XUHA 3W90A 2O8EA 1Y8RB 3SZUA 1GRNA 2NYVA 1WTAA 2OV4A 3L92A 3MB5A 3P9QA 4QJBA 4BV9A 3PQ4A 3BHMA 1UQRA 2C83A 3EXIA 3G0OA 4U9IS 2UZIR 1NU6A 4NZOA 4CG1A 5LU8A 1GM5A 4G5HA 3PL1A 3UO8B 3PIIA 1SCBA 4BIMA 3A1NA 1A82A 3DMTA 3OY2A 2QRKA 1QQ7A 1R16A 3O47A 1EUDB 3JV7A 4G07A 2BOVA 1XN4A 2ORED 4QAJA 1U5BA 1AH2A 3A10A 4BWFB 2VQDA 3FDJA 1IXSB 3WIVA 5K0LA 5B7NA 2ODWA 5ER6A 1KYQA 1EUCA 1UMBB 2FXIA 2WIFA 3DFKA 2WFZA 4LJ9A 1MTZA 2YMQA 5MDHA 1P0IA 2YX1A 3KO8A 5FCDA 2EVWX 5DP2A 5H81A 3RSSA 3TQHA 4YRNA 5JCJD 5JQGA 2A2ZA 1TAUA 3UYKA 1YMQA 4UCFA 4O4IB 3IT3A 4WVFA 5DXAA 4UHCA 5JAHA 2D13A 4LE2A 1OX4A 1KMHA 4CI9A 4TMFA 1UBMS 2IHVA 3OZDA 3E9ZA 4JOBA 4NKRA 4YMIA 3K6SB 1E2LA 4KGVA 3EVFA 4DCUA 1V6SA 1ISJA 1V7ZA 1MV5A 3BRWA 1EQ2A 1UT6A 3LBHA 4K46A 1XCMA 1SNYA 5KKAA 4A0HA 5JXGA 4KNWA 2IL1A 1UZNA 4EPYA 1JH8A 3BRCA 3VR3D 5FWAA 1YS2X 4K6CA 4B3SB 5T4FA 4BKMA 1JHVA 4D4GA 1P33A 5AKKA 5LZ8A 4DANA 5JD5A 3FDXA 1RCFA 3NHBA 4KIGA 2QX7A 4GKJB 2X7XA 3N3AC 1BEUB 3HU3A 1QHEA 1Y0BA 3DEZA 2M1XA 5DF1A 2X8WA 4K87A 3HN6A 5HCUA 3B78A 1K4KA 3ASVA 2GEFA 5EKXA 3SC6A 4DA8A 1ZO8A 4ZQFA 1TMKA 3WLFA 4DNFA 4YV1A 4ZO6A 2IEBA 2RHDA 3CURA 4X00A 1HI9A 4TRNA 3ZZTA 3LY9A 4CIBA 3LQFA 2E5FA 1VBFA 3M6UA 1VJRA 3DB1A 1NXTA 4IRUB 2ZCUA 3ROQA 2DPLA 3TSZA 3CZRA 3I73A 4FNMA 4A0SA 4EY3A 1ZGZA 4OJNA 4P58A 3VV2A 1ESZA 4H7IA 1Y48E 2EFHB 5I9SA 1OA1A 3CX7A 4XTRA 4Z7JA 1LBQA 1LZKA 3GWGA 2O6HA 4KK3A 2BDTA 2B5WA 4RNCA 4RPLA 4RD3A 3SIWA 3EZ7A 1CRZA 5JH7F 5FOUA 1M2EA 3TZCA 1Y33E 2ZYAA 2GN4A 1NYRA 2QTLA 2Z09A 3SYLA 2A88A 4C5CA 1QIHA 3LLCA 1OLUB 1Q84A 3D6FA 1F8GA 1XCPA 2O2ZA 3EXAA 3VYUB 3ZWOA 3IH5A 5DGIA 3K32A 3PX7A 5IKXA 3KB1A 3HDHA 3L6EA 3DV9A 1WXHA 3M7IA 3QYFA 5C1IA 4PHHA 4YDRA 4FYKA 3TQTA 2OWEA 4KQGA 4IXNA 4JI1B 4RTMA 1AN9A 1QH1A 3AGPA 1JA1A 1Z2EA 3KXKA 5SV2A 5TEVA 2VAPA 2C54A 1GPAA 3D31A 3RSZA 1D1TA 2BP7A 2I1QA 3O8NA 1R5NA 4MKIA 3I5YA 5HUQA 1XHLA 3A9UA 2W8ZA 2J0VA 2OUKA 3NRJA 4GZ5A 1O7JA 1FW8A 2C7GA 3BXHA 1CXZA 3IAHA 5L7YA 1FDIA 1T9BA 3AUJB 4E2WA 4KH1A 4NV3A 4TXJA 3KKQA 5KYXB 1XNJA 3QLVA 4CHTA 1WHSB 3LVQE 2D5LA 4YJHB 2PLRA 4M9UA 3QSYA 4RS3A 1CLUA 3TKYA 5CCXA 3CF4G 4CDNA 1U3WA 4KYVA 3CZQA 4G8JA 5ILOA 3ETDA 3L6RA 1CDOA 4ZAWA 3SSOA 3EGEA 4HD8A 3KQQA 1FJ2A 2HA2A 3MHTA 4AIIA 3WOVA 4EY7A 3IP3A 2Y9MB 3PB3A 4B6EA 1JP7A 4Z7NB 4US0R 4PBTA 2RKBA 1L1EA 3ICVA 2GH1A 2EZ8A 1WUYA 3NNDA 1F1JA 1U1CA 2W6JA 3KTAB 4Y6RA 2WILA 5CFPA 4G8BA 4DPMA 4NU5A 2YQZA 2PDAA 1NTOA 2IFTA 2ZW9A 3WDKA 4EW1A 1LF5A 3I8XA 1Y9EA 4IHJA 1WPGA 4XUCA 3C6YA 3GIWA 1ICEA 1PJSA 2HX1A 4MQMA 4MWGA 3ZH2A 2BMFA 4TLLB 4PSAA 4U5XA 3RU7A 3NYIA 3U7QA 5JCJA 2QJWA 1AUOA 3KQSA 4QREA 4OHVA 4OXRA 2PU7A 2V74B 4NRDA 1FYDA 1RCUA 5FL3A 1U9ZA 3I04M 1ZYUA 4YRPA 5AUOB 3EH2A 1X1CA 1UP4A 4RL4A 3LK6A 1L4HA 3WNZA 3JQ7A 4O2AF 4X20A 2IEAA 2AUNA 1EKXA 2FPIB 4JKIA 4XIIA 3SKXA 3ZD8A 3GNTA 3KUKA 3OIWA 3DZIA 4MUEA 1FRVA 5E9JA 4BE7B 5A0TA 4OXYA 2G8NA 1PR4A 2PGAA 2SICE 5IK2D 5DLDA 3MRTA 1HL7A 4N3NA 1B43A 2PUHA 1U3VA 5ALTA 1JFSA 3DOJA 3IO3A 4JLPA 1JE0A 1QONA 5E6RB 3OPYB 1Z0JA 1JR4A 4KLAA 2ZT7A 3UMRA 2FP3A 3PEEA 4Q93A 2IH2A 1L3CA 4JODA 3P9RA 4WNAB 4DPKA 1T2CA 2QVCA 5F64A 3KELA 2IDMA 1RYZA 1ILWA 5JYEA 2GEKA 2HU5A 4NBLA 4G0QA 4QTYA 1U31A 3RVRA 4D97A 4N41A 2H31A 2NTEA 2QR5A 4IO0A 4JASB 4OBWA 5FPHA 5JD3A 3I0MA 4HN4B 3PXDA 5B64A 3IP5A 5JJKA 2A5FA 2XUPA 3IUMA 4E4RA 4HLUA 3TTVA 2EGHA 1P1JA 2CFSA 4CMAA 4L8GA 3HA5A 3ZUGA 1B3RA 1J8FA 2XUOA 1VPEA 2VRWA 3DAYA 1NOIA 3GARA 2QNBA 4P7GA 5JQGB 4MNTA 3I5XA 1XE3A 4GAEA 4L9RA 2PZFA 2IELA 2Q41A 1BXGA 3C2QA 3OJFA 4XWKA 4A8JB 3I30X 1FLAA 2AF3C 5KYTA 1NVGA 2C2HA 3PKIA 1JDPA 1A3CA 1ETUA 1MO5A 1YZFA 2YV5A 4U9UA 5CDGA 4K8OA 3G0DA 1EK6A 3ENNA 3HV2A 5AM2A 1XL1A 2QRVB 2Q50A 1JNYA 4IJMA 2I67A 1BEEA 3B82A 5K8TA 3U5TA 1IZ9A 3RABA 4QG3A 1XAGA 5FB3A 2ZBPA 4H31A 1EWQA 4ISBA 5LBIA 3ZY6A 1WKBA 1Z8DA 3MFQA 3IIKA 1IEXA 1JLRA 1O1YA 3K0FA 4M0UA 3E82A 3CW9A 2EKBA 1NNSA 3VR0A 3U0BA 2SECE 3NBKA 4OP1A 1GNSA 5EOVA 5AKIA 3I01M 4S24A 4RIIA 4L7VA 4IGFA 1KQFA 3MSCA 3P0FA 2WUFA 1YK0A 4E7OA 4MEJA 1ZZEA 2C77A 3ESZA 1ECJA 1TZKA 3IP1A 4BLWA 4BP8A 1KAQA 4WZAB 1H2AS 5ENVA 2UXDB 2R1ZA 1GYPA 2OHVA 3HKEB 4WH0A 2IOFA 1J70A 1HT3A 2FPGB 4HUJA 1LI7A 4PLFA 4FLEA 1SELA 4PTZA 5GVRA 4PRYA 3I52A 3VC3A 1HEUA 2WVAA 4D99A 4RABA 1O94A 5HTOA 3OWHA 4I99A 2RONA 1E5VA 1IJEA 1AGYA 3CWCA 3TXAA 3H7IA 3P9PA 3SSMA 4J43A 3CNOA 2G1AA 3HKBA 1SKUA 3OTQA 1FMTA 1Y6RA 3ZLUA 4A36A 1PNVA 1U7PA 4YNBA 3H2IA 4FW9A 1FF9A 3OKCA 1E4EA 4IWXA 4IO1A 1XAJA 2P3LA 4C6SA 3NHJA 4KDFA 2A78A 5BV0A 2D8AA 3PCRB 1DAIA 2BEVA 3RUIA 2IDZA 4DSZA 3RVPA 2Q7DA 5C52B 1K0UA 1ZCZA 2V3WA 3A1UA 2OEPA 4NPHA 1Q0TA 1GGNA 3G2LA 4JXJA 3JD1A 3QVMA 4PNHA 2CLOB 4YMVA 5IK2A 5C3UA 4HH1A 2F3TA 4BUZA 4IZIA 2YXBA 4LOLA 3CV3A 4K9LA 4LK3A 2WUEA 4FDAA 2VYVD 4Y3UA 1PZEA 1NIPA 1TAQA 3I9NA 4YRMA 1DG9A 2P91A 1O0SA 2OCAA 4YK7A 1KK3A 1QU2A 4ZI2A 3JQRA 3MJDA 3KKLA 3OM0A 1RWOA 1PDVA 5CEEA 8ADHA 5LWQA 4AKGA 1UKAA 2F48A 4BGEA 1XROA 2CXTA 4IDHA 4KV9A 2VJMA 4O4LB 2QTGA 3TTYA 2ID8A 2YOHA 1WD5A 2B1RA 4ZVRA 3ASZA 3C7DB 3CUUA 3FBTA 3WLNA 3A27A 1IQRA 2W0SA 2WU8A 4ZT2A 3ZWVA 5I5EA 1HGXA 3BHNA 4ZOCA 2F7SA 4UZSA 5BMOA 5IM4A 2WUVA 3AH8A 3JS5A 1M9NA 4J9UE 4S0ZA 2BR4A 1NMSA 1UWKA 1NLUA 4P81A 4FHDA 4LDPA 4TWIA 3LTEA 4IHJB 4Y1RA 5KAPA 4PSCA 1I9CA 3BILA 3CHYA 4H27A 2R47A 2INGX 3RJ5A 5AVZA 1FP2A 4LWOA 4HK4A 3P4UA 3O2JA 2X8JB 3QMWA 1VHJA 2O52A 1QVWA 4PF1A 4ENRA 3JRWA 4QYMA 1SVOA 4GMFA 1CUWA 5CBPA 3VNBA 4FGLA 1A2KC 3F0TA 1RWQA 4HGZA 4TV9A 2IUEA 2AOTB 3F1KA 1KBQA 5IJWA 4KN9S 3WAJA 1J9EA 3TO5A 3AQ4A 1MG5A 2ES4A 5JCOA 4K5QA 1CVLA 3LNCA 2IU4A 2H4HA 3C70A 4YV2A 3A7EA 5AJXA 3I3SR 4BVEA 1SVWA 1TMYA 5LQAA 4GKVA 1ZH4A 3Q5EA 2QN7A 3EOZA 1P9RA 3ESYA 3KKKA 1GD1O 2I54A 3KOYA 3P0HA 1RJDA 4DJTA 1Z56C 4S1TA 3VXKA 4UCWA 5EWJB 2O1WA 2WSYB 3S7TA 4RVUA 4DKJA 2PZAA 5HS6A 4HH4A 4DBLC 5IF9A 4MHTA 4IJVA 1PP4A 4QUBA 2RFLA 1KY3A 3I2KA 1NP7A 2WHPA 2C2OA 2O05A 4HZUA 1KEUA 1O6CA 3FVRA 3C4JA 4XGKA 3B6IA 1VIDA 3AHGA 5B3AA 3VSAA 1BGWA 1CX9B 1E2KA 2VHQA 4ZEVA 3L4SO 5LWHA 1B6SA 2CHEA 2V6FA 4KUGA 4C2TA 1H0RA 3WL5A 1Y9ZA 1FMLA 1N57A 2H07A 3B2NA 3VR2A 5IT9A 3U44A 4IZOA 4LMPA 3TM4A 2PIAA 1UMDA 2YJ3A 4OQ4A 2OBMA 4DAOA 2C9ZA 4FT4A 2CLCX 3G2PA 3P9ZA 3BTOA 3L01A 3MLEA 3PLRA 2J3KA 2HDOA 3GCXA 1WNFA 1E3IA 4R81A 1BXGB 4FFOA 4W6ZA 1X1QA 1AGPA 1GLGA 1IEWA 2ZJAA 5E2BA 2N46A 1O9HA 1GQOA 1GSAA 1EHCA 3AY3A 1IZ0A 3GMTA 3V2UA 3ZHQA 5DM60 4E03A 3GZJA 1BS9A 2EG9A 3T12A 4EHIA 3B1XA 3GVPA 2W2LA 5THKA 2HSJA 1LCIA 1PJLA 2JFOA 1IY1A 2DCUA 2VG8A 3FFBA 3NBFA 3ND6A 4WRRA 4WESA 4XVQA 5FBHA 4YCLA 4WIAA 3QVUA 1WKVA 1YASA 2ATIA 2FI1A 1OW3B 3QRWA 2GILA 2RBEA 2VPQA 4X7RA 3SLKA 1MG0A 5EHGA 1W94A 1V16A 4L4UA 4FUTA 1ZU5A 3O8LA 1EE1A 1GL6A 1CJTC 2Q4DA 4COOA 1TB4A 3PDCA 2E1PA 3S2YA 3A9TA 4J1NA 4LI0A 5BNZA 3WLTA 2R60A 5P21A 1H2HA 1MEJA 1NQXA 2WG1A 1WWKA 4ZJZA 5ADHA 5C8YA 1CYDA 4QBIA 1YRBA 1ZESA 2IP2A 2WIKA 3MGAA 2A94A 2HCBA 3ROPA 2VYVA 4MPDA 5D1HA 4BZPA 1IL0A 2WE8A 2DUWA 1GNRA 2HLHA 3DLBA 2ZS8A 1E3MA 2FOLA 5EJGA 4DT1A 4B83A 1QH9A 2VH2A 3ZY2A 3A2LA 1RAAA 2EX1A 4N0MA 2R6CA 3DYVA 1RW4A 3U19A 4BE4A 2IYRA 2H1IA 2O8BA 1E2BA 2WVHA 4WINA 1B0AA 4YMLA 2PJZA 5F9HA 2BJWA 2R00A 3QPCA 4R8LA 3OH8A 1TU3A 4CLEA 2XCIA 4O2BF 1R0RE 4YRQA 4DHEA 3RRXA 4O4JA 1K1EA 2R87A 4CKEA 4F56A 3ABZA 2AL7A 1PJZA 1PNRA 5PNTA 4INAA 3L8MA 1HLGA 1ORRA 4Y2UA 2BEUB 2XV1A 3BM5A 5EJMA 4DVJA 1JKJA 2AGVA 3TL3A 3PYLA 4NQZA 3UUWA 4I08A 4UMEA 1L5LA 1ECBA 1UK6A 3AU8A 1IB0A 3S40A 2G40A 3T41A 1N7JA 3QKSB 4FFMA 2CDRA 2HUNA 2EHJA 4NBRA 1GEGA 3C1UA 3M0EA 5F3DA 4IIJA 1FU8A 3PEWA 1UDCA 2WU0A 3E8SA 2PQ6A 1D5CA 4RBNA 4N5DA 4JXXA 4CN8A 3L07A 3ONNA 1E79D 4LY3A 4QPCA 4P83A 1M67A 5HQ3A 2QXTA 3I2IA 2YFYA 2ET6A 3DGFC 2YWCA 4CMHA 3LP8A 1DSSG 2P1DA 1H4VB 2CN1A 5EE9A 3C1AA 4TPKA 2K5UA 3IEIA 1ZRHA 3JATA 1K5GA 1XTRA 3QW2A 2EIXA 1Z3IX 3GUZA 3L46A 4G97A 1Z68A 3QI7A 4CMEC 3SGLA 3U3XA 1BJKA 2R4TA 1FJHA 2CVQA 2PEYA 4RD4A 5D5HA 5J5AA 3KVNA 3P97A 3SZOA 4B45A 4CIWA 1OX6A 3ESRA 3C3PA 1PT5A 3WGNA 1A4RA 1HK7A 1RZVA 2RIRA 4RHFA 4DW8A 4AFNA 5DI3A 4GX2A 2Q07A 4WCVA 2QVLA 2AR0A 4Y2HA 2A9JA 3I6BA 4JQOA 1AC5A 5BMVA 1KC1A 1Z18A 3BQNB 1KE1A 1TF5A 1M6EX 1FQJA 2GESA 3CLHA 3GQBB 4MW4A 3BMCA 1T3ZA 1Z6PA 3M6FA 3AB8A 4ZIRB 3REQB 1A1VA 4XA8A 4MVJH 4UJ5A 1SOWA 3ZWPA 2EU8A 5FWXA 1XEWX 2BVNA 4Y2PA 2IF2A 5CA1F 5KTRA 2VWQA 1SC4A 5AHXA 1YCDA 1FFEA 2PBLA 3U48A 3GVHA 1WSWA 2VS1A 1SVLA 3KJQA 4AS1A 2HN9A 2VQ3A 1D2CA 1E6EA 3EQ9A 5E6UA 1L7XA 5CBPB 1YFJA 3IO5A 2YVLA 1MZPA 4LY6A 2ZB8A 5FLYA 1G7TA 2IZZA 4N12A 1KO7A 3HC7A 3FCAA 3IR7A 3JQGB 1FYWA 3QF7A 1GZ7A 3NKLA 5FOXA 3TSAA 2PUGA 1BKYA 3TI9A 2BFEA 4OQYA 4AP5A 5K8IA 4CXMA 5T7BA 2WJZB 4MUFA 2IXBA 1QPZA 2JBHA 3Q41A 4AJJA 2VFAA 3LUAA 2F43A 3FUCA 1ARZA 3ET4A 1RWWA 4RPGA 2NPFA 2I91A 4BC0A 1KVQA 4ZVLA 5I7OA 2PCJA 2Z2JA 2AEEA 4PO1A 2EEPA 3GLKA 2AT1A 4HRXA 1UFVA 1GUFA 3BH6A 3NBQA 3Q3GE 5EZYF 2IHUA 2FDCA 1XSEA 1E2NA 5D01A 2XVXA 1FP7A 2QAIA 1G16A 1M2VB 1NJ1A 2NSLA 1M54A 4OIFA 3AIMA 4R2XA 2CGEA 4TL6A 4US1R 2CHGA 2PX5A 2ZJZA 4IL5A 4EFKA 5J2TB 1GTJ1 4ZKDA 4CQMD 3QVLA 1S3SA 3D7NA 2DFVA 3EZYA 4H3VA 5B4UA 3O1HB 1A72A 4QICA 2Y0DA 4BTLA 4ID3A 5KTMA 3EFBA 3C3XA 1UMDB 3CJTA 3I1IA 4Z4FA 3ESDA 5AW7A 3N70A 1VKJA 1I2ZA 1NRJB 1Y63A 1A77A 1FBTA 3IV6A 3CLRD 1L5HA 2OG1A 3RLFA 1YH3A 2Q6IA 3LUPA 5GGYA 3WS7A 4JT2A 2IYOA 4HAIA 4EYSA 4Z9FA 5DNCA 2WWTA 2PVCA 4A0RA 3CX4A 3OFND 4KW7A 1KXJA 3TOSA 4B7CA 1EI9A 2Q62A 4I1PA 1TU0A 2NSJA 3MT7A 2HR1A 2X41A 3F5MA 3QNWA 1E59A 2J46A 2KE5A 2XECA 4GR9A 3IPXA 1YK1A 1ELOA 4IG4A 1G18A 5DLEA 1GZ6A 4NCIA 3ONWA 4IPTA 4DWWA 2L17A 4U2FA 4HDNA 1NI4B 5ALEA 2EFGA 1WABA 2G77B 3DVAB 3V32A 3N07A 3TL2A 4DR7B 1RLMA 3WBKA 5JMPA 3GFOA 3BT7A 1TM7E 2PPLA 2C58A 2NV2B 4H59A 4BNDA 3A4NA 2DBZA 3DVRX 4PQYA 1C3JA 1JA0A 3MJ4A 1J0AA 1TJ3A 1XQXA 4FCVA 4I5IA 4NZPA 4PYQA 4R2KA 1NF2A 5AHOA 5DHTA 3X1KA 1X38A 3ILVA 1AUXA 1DB3A 4JC8A 1VSQA 4JSRA 3VOTA 1ESEA 1M0SA 2C9CA 5G0TA 4DMFA 4E46A 2NVWA 8GPBA 3O3MB 4DT1B 4YQYA 1WLSA 4UHBA 1J39A 4LYJA 3HBAA 4BMOB 2DP4E 1TW2A 4OFBA 1ZBDA 1XZGA 4YAWA 5TNXA 3H5AA 4C89A 2O8BB 1ORWA 5EIFA 2VF2A 4MUAA 4B6QA 1QNFA 4HRAA 4IINA 4DDTA 4KIWA 4MV4A 3EDYA 4DEYA 1EAYA 2ZM6B 1X1EA 1CY4A 3FUUA 4G2TA 1K86A 4F92B 3JD2A 4TRJA 3I1JA 1KYVA 2BZ1A 3FLMA 5F4BA 3W9UA 5JXIA 4WFQA 4K1LA 4KOAA 4E11A 4IMPA 4NBUA 4CKEB 3EZFA 5HWSA 3C3YA 1ES9A 5JAOA 1S02A 2JCYA 3FPSA 1G63A 1JKJB 1SG9A 4EAQA 2IYNA 4RSRA 4OL0A 2CLMB 4PC2A 4R2WA 3E1SA 1X19A 1PYOA 5JZOA 1H93A 2FUEA 2O8NA 1JLLA 3K4HA 1T1EA 1C30A 3HSYA 2EC5A 4QYXA 3ET5A 4JOCA 3GNSA 4D82A 3DE7X 3R4VA 3QVWA 2OB1A 1EFHA 2PGOA 3P19A 5AKGA 3OIDA 2PQMA 3PX3A 4QATA 3W8DA 4REOA 3R7SA 3MWFA 4GICA 5ICFA 1GT91 4NPCA 2AFHA 2M98A 4NFSA 1M75A 1T2FA 4V1CI 1EZZA 2NX2A 2VJCA 3AB3A 3H8VA 5AIAA 4G1MB 3A6ZA 3W2GA 4BCBA 2YHIB 3OFSA 5A7GA 2H5EA 1S3IA 1EM6A 2ZSEA 1AZLA 3FYUC 3L8FA 4YRZA 1FA9A 3KZNA 3QITA 1BFUA 3LRTA 3COVA 4MRPA 3EPPA 1LDEA 2YVKA 1IN4A 4PR0A 2JIOA 3BL8A 2I9KA 1I2AA 2QW1A 3K6JA 3V1TC 1UPFA 3SZGA 3F74A 3UAYA 4QQFA 1YHZA 2WYHA 4UAUA 1UF9A 4QT0A 3RK0A 1PG5A 1E4YA 4MVYA 1EE2A 2Z2IA 3EDOA 1W52X 4N0DA 4C4YA 1N77A 1J1IA 2RGUA 5LIPA 2E5LB 2CUNA 3W5HA 1Y82A 5FJJA 2C4KA 2IX9A 4N9WA 4OOFA 3P45A 1R8XA 4NCJA 1VL8A 1NBHA 2HAEA 1T26A 2IXAA 3KQYA 4W9RA 5E9QA 5EZ6B 3UB2A 4BGDA 2XVYA 4OHRA 5I8PA 3P2KA 3ETHA 1Z12A 1IUPA 1YHYA 3C5VA 3Q2OA 2ZYWX 4PXAA 2H52A 3QPAA 5C4GB 2CV0A 3OFNA 2H2WA 3G9QA 3T5AA 1GZUA 2I99A 5AYVA 3RRMA 4BCDA 2Q3CA 1G8YA 1U4NA 3LP5A 1JL3A 1RD4A 4XCXA 5C5CA 3KETA 1X7YA 2A30A 3WJ1A 1QSGA 4F3NA 5A62A 4Y6SA 4C88A 3QEBZ 2XZPA 4RGQA 3W3AH 2HHHB 4GHWA 1DBIA 2F43B 4N8SA 2FGKA 2ZUDA 3DFZA 4P4UA 2AMYA 4BMZA 1JHQA 2I8AA 4CWAA 3O8DA 3SHTA 2P4UA 1NA5A 4IOLA 4MGHA 2OBYA 3Q7IA 3MWGA 4JLKA 4L1KA 4AZVA 1YU9A 4XD7A 4B47A 4C0LA 1KORA 3QIVA 3L1JA 4NYMR 4ZT6A 5F3WB 2B4KA 3IP6A 4EHJA 1SU6A 4FOOA 1YACA 1JBKA 2HV9A 3CF0A 1CSEE 3OTIA 4JQYA 1OAOC 3QGMA 1I6KA 1U2DC 3OCYA 4ZT7A 4C0WA 4DBVO 2V0CA 3HP4A 3TQIA 2CL7X 1Q91A 5K0CA 4MCIA 3OLYA 5CT4A 2RHLA 2W22A 4QHSA 1FNCA 1ZVJA 3EG5A 1X0VA 2G63A 4GYWA 3PGA1 4AMVA 4AULA 5J58A 1FNSA 1R0WA 4LA4A 4CEIA 4P4SB 2QX4A 4MI6A 3GLIA 2GDJA 1DMRA 2ZPTX 2M1ZA 2EBUA 5DNWA 3ASUA 1CFJA 3RS7A 1AKTA 3J7AC 1FSGA 3B20A 4LZOA 3CQ9A 5J2UF 2G25A 4IV0A 3AIKA 4EJ0A 2BC9A 3VBCA 2JZOA 2YYYA 4Q03A 1A2BA 2QMHA 1TJ5A 1N92A 1YE5A 5BQFA 4IGAA 1HFWA 2JIZD 1XZHA 3G0BA 3LLUA 1VCIA 4ARVA 3FROA 3P0IA 3EH1A 1VCMA 4MITA 5JCXA 1V6AA 2V9ZA 1J24A 2VO1A 1OF1A 1R4MB 4HDNB 1SXJE 4BQOA 2AB0A 4WCFA 4GKBA 2I6QA 2O57A 1WKCA 3OEYA 4GBJA 3VX3A 3AEXA 3EMDA 2JJ2D 3DWGA 3LT0A 3D4IA 2C5GA 2ZSKA 4JA2A 4AUEA 4UNPA 3FOEC 1V5FA 2YIJA 3R74A 4BNDB 3OM9A 4DHWA 5CHEA 1GV0A 1XDGA 1QV6A 1QS0B 4GR4A 4N5MA 3KT0A 3UV6A 4M7RA 1X42A 1YQQA 1Z8FA 3TKLA 1H5NA 2ID9A 3WQSB 3EVBA 2YV1A 4AQ7A 5DBHX 5DBEX 4C03A 5LZ4A 1OT5A 1XZIA 4JDPA 4LK2A 2JH8A 2EFJA 3K72B 1AK1A 1DU4A 4B6OA 4YBZA 4D57A 1T3LA 2XOXA 3MWJA 2C57A 2Y4NA 3OM8A 4KN8A 4W7SA 5CLQA 2QJFA 4BNFA 2FSUA 1I7LA 2OKCA 5IJ9B 1PNTA 3A1DA 2G8LA 2G67A 2FQWA 2V4MA 1N2BA 2NAFA 3NOOA 5C32A 1DJLA 1THMA 2RGRA 3PA8A 4YLEA 1SHUX 1DDGA 4TXLA 3Q15C 5G1OA 2XDQA 4TLAA 2PT6A 4D42A 1XBTA 3FIJA 1Z07A 2GYVA 2QU7A 4TKZA 4Q1VA 3L0SA 4EDFA 3SR3A 4QDKA 2D1YA 3TNLA 4ARSA 4F6RA 2PTGA 3KDPA 1U0EA 1NW8A 2QYHA 1L4BA 3DLIA 4RE6A 4JVNA 4QUDA 1RWPA 2RHHA 5EMMA 2HRDA 3OETA 1C30B 5FYQA 4ZZ0A 1TRKA 4RDXA 2ZWAA 5D8DA 3H6GA 5ADUS 1UFRA 4I14A 2AKYA 4NG5A 1N1DA 1BRMA 1T2NA 1OLSB 4S1WA 4CV1A 1KZ7B 1TO1E 4PN3A 3I8OA 1I4TD 3Q7SA 3S2ZA 4LDRA 4WOKA 3ZC3A 4QXMA 5BOSA 4N01A 4EI8A 4GGMX 5AXAA 3TIGA 3HKDB 1SK9A 3DPIA 3IQEA 3K5HA 2BFPA 2XF2A 3MZ0A 1GL3A 2DB3A 1E5QA 1HM5A 3K31A 1U8EA 4FOSA 2NNLD 3D8NA 4UUMA 5D7NA 1XLTC 4KR2A 5CW2A 1QO0D 1KZHA 4G1FA 4O8ZA 3F46A 2XUIA 2D00A 1SB9A 4CDGA 2VSYA 4WGGA 2LVBA 4UTRA 5HW0A 4W5TA 1OPXA 3QW4B 4K9KA 1ADCA 4M0MA 1KRXA 5HEKA 2CC2A 5T67A 5TQ2B 1J99A 1OYVA 3E2IA 1N25A 3EJ6A 4OJKA 3OCWA 4RF4A 4CQMB 4ZEMA 1K7SN 2BEWA 1NNI1 4M7OA 1IN8A 3OHSX 2QRLA 4OBEA 4QBKA 4UXJA 5JH7A 5JW6A 1SC6A 1QIIA 3U9TA 5H5JA 2P6OA 1ZIPA 1UDXA 2FCRA 4REQA 1R9GA 1NNUA 4D43A 5CYGA 1XGKA 1XVTA 3NAGA 3SVTA 4FWTA 5C4IA 2C42A 5KQLA 3TG8A 2E87A 2ONZA 3EEFA 2FEXA 3RIGA 1JHDA 4OAPA 1CUYA 4B3MB 4MVJI 1FNNA 2CDNA 5TQ0A 1P77A 3P5BA 3PR2B 4G2NA 4XQGA 2VNSA 1QRAA 2H9IA 2XNDA 1K27A 2H2GA 4NFLA 5AVJA 1VYVA 1LLUA 2J33A 2JVKA 4DBZA 1ZGBA 1N9KA 1WSDA 2FX5A 1GG8A 2Y99A 3N7UA 1ZD1A 4JBXA 2NSDA 2WSBA 3JQAA 1UJ2A 2AOUB 3KYBA 4BBPA 1MF7A 2JIZA 5AI0A 4BO4A 4XDGA 5JANA 4IKOA 1X7YB 2BIFA 1VE1A 2PRSA 1NLFA 1YI0A 3A6JA 3GY0A 4MR9A 4RH3A 2R5WA 3NBMA 1WR8A 3VKWA 3HBFA 3KJGA 4WKBA 2RJNA 4I36A 3R8CA 5LC1A 3FPBA 3WYEA 5FR1A 4F46A 2DUUA 1DLJA 2ZSHA 2D3WA 2GLUA 3LJKA 3BS4A 3O94A 1II8B 4M87A 5EQFA 4DDVA 1E9SA 2RI6A 1F3OA 3QPWA 5CGQB 1LW7A 3RDPA 5MFPA 1GDDA 2F1KA 4AN0A 5A2GA 1JDBB 2APJA 3KHKA 4XSVA 3WGMA 4EB3A 2QG6A 4LVNA 3H1GA 1KI7A 1OD6A 4RDCA 2V96A 3EXHA 3T5CA 5KVCA 4JYPA 4KVFA 3URKA 3U4QA 3ZX4A 2C8KA 4P7FA 3X44A 3JWGA 4NOJA 4WXMA 1E6LA 3NTLA 3AEQA 5EKSA 1NXQA 2AEFA 4B3FX 1PJBA 4H7EA 1CJKC 3K16A 4F7WA 1HYHA 3MG9A 4KI7A 5E4FA 1XI2A 1Z5UA 3GIDA 2ZJ7A 3HMQA 3KKZA 4QBGB 3GUHA 4X6UA 3RTEA 4B5LA 3ZDDA 4CEIB 2OO5A 3BGVA