1ZVKA

Structure of double mutant, d164n, e78h of kumamolisin-as
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
354
structure length
354
Chain Sequence
b'TAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPSGPDGHVELDIEVAGALAPGAKFAVYFAPNTDAGFLDAITTAIHDPTLKPSVVSISWGGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGNSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kumamolisin-As
publication title Processing, catalytic activity and crystal structures of kumamolisin-As with an engineered active site.
pubmed doi rcsb
source organism Alicyclobacillus sendaiensis
molecule tags Hydrolase
total genus 116
structure length 354
sequence length 354
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1zvkA00
3I34X 1MEEA 5AVJA 1SIUA 2P4EA 1SBHA 1BE8A 1SUAA 1WSDA 1NDQA 3VV2A 2Z56A 3I2YX 2V8BA 3EDYA 3EIFA 1GTG1 1HT3A 3L1KA 3BX1A 5B1DA 1R6VA 2HD4A 1TM3E 2Z2YA 4NMXB 1CSEE 4Z2AA 1Y34E 2G4VA 1BFKA 3LPCA 2SNIE 1SBIA 2PWAA 2SECE 1Y3DE 4CFZA 3DE2X 3GT3A 3DE4X 1Y3CE 3LPAA 1SN7A 4H6WA 1NDUA 1ZVJA 3WIUA 2QTWB 1SH7A 1TM7E 5JXGA 3VYVA 3AJ9A 1SELA 5AQEA 1SUEA 1SCJA 3DE0X 3WIVA 3GCXA 4YN3A 1WMEA 3D43A 3DE1X 2PKCA 3TI7A 4JP8A 4HVLA 2PWBA 1P7VA 1DUIA 4I0WB 3A3OA 1KDVA 3DVRX 1SBTA 1EA7A 2Z58A 1AQNA 1SUCA 1THMA 3HJRA 4CG0A 3I30X 1KDYA 1C9NA 5SICE 1TO2E 2B6NA 1XF1A 4DJ5X 2Z57A 1S01A 4AKTA 1WMDA 1SUBA 2DP4E 1Y3BE 5AMXA 5ARDA 1GNVA 1CNMA 3BPSA 3OSZA 2ST1A 2ID8A 2WWTA 2PYZA 1ST3A 1GA4A 1TM1E 1GTL1 3Q5GA 1NLUA 1TECE 2IXTA 1S2NA 1P8JA 1T1EA 3LPDA 1SIOA 3VTAA 4WOCA 1C9JA 3DVSX 1V5IA 2W2MA 1YJCA 3QFHA 3WHIA 2W2OA 1SPBS 1KE1A 1BH6A 3TECE 3DE7X 1TMGE 1C9MA 2Z30A 4FONA 1Q5PA 4KB5A 4OV6B 1KE2A 1BE6A 3WQBA 3LXUX 2WUWE 1SIBE 3SICE 1AH2A 4KPGA 4C3UA 1Y4DE 5JXHA 1IC6A 5AVKA 1S02A 1SBCA 2PMWB 2DUJA 1GCIA 3P5BA 4CFYA 3PRKE 2PRKA 4OMCA 5FAXA 4MZDA 3VSBA 2ZWPA 5FBZA 2ID4A 1YU6A 2Z2ZA 4DZTA 1A2QA 3QTLA 1TK2A 1JEAA 2W2NA 4J94A 3F7OA 3ZXXA 3DW1X 3CO0S 1AU9A 1SCNE 5ARCA 3T41A 4AKSA 2WV7A 1GNSA 1GTJ1 1Y33E 1P7WA 1LW6E 1R64A 4NE9A 5FFNA 1DBIA 4H6VA 1SCDA 2SICE 5JMOA 5JXJA 1YJBA 1SUDA 1OT5A 3EE6A 2SBTA 4B5LA 1PEKE 1WMFA 3D9QX 1R0RE 1SVNA 3GCWA 3PTLA 2ZRQA 3DE6X 3DE5X 3AJ8A 1Y1KE 2PQ2A 1C3LA 3ZXYA 4DWWA 1VSBA 2TECE 1Y48E 3CNQS 2E1PA 3VV3A 4ZOQI 3F7MA 1Y3FE 5K7SA 1PJ8A 4M1ZA 1TM5E 1SCBA 1GA1A 4OMDA 3A3PA 3DWEX 3GT4A 1OYOA 3F49S 3UNXA 4H6XA 1V6CA 1SBNE 3AFGA 5B1EA 1GT91 1AF4A 3H42B 1KDZA 1PFGA 4NE7A 3TI9A 3DW3X 1Y9ZA 5I9SA 1BFUA 4BWGA 5CW1A 2XRMA 2XTJA 4RYDA 2DQKA 3SQOA 1AK9A 2Z2XA 1AV7A 1PTKA 2IY9A 2X8JB 4KG7A 1EGQA 5ARBA 1UBNA 1TO1E 3DE3X 1T1GA 1SUPA 1TM4E 4C3VA 1T1IA 1ST2A 1MPTA 1SCAA 2HPZA 4LVNA 1YJAA 3QMPA 5JXIA 3Q40A 3DDZX 1IAVA 2W2QA 3DVQX 1AVTA 2ZWOA 4HX2A 2WUVA 4GI3A 1WVMA 4ZARA 2GKOA 4WOBA 1OYVA 1ZVKA 3I37X 2W2PA 2X8JA 3A3NA 3DYBA 1BJRE 4LVOA 1GA6A 4K8RB 3VHQA 1Y4AE 3BGOS
chains in the Genus database with same CATH superfamily
1L0BA 3M9XA 4PZ0A 3A1CA 4UE2A 3PL1A 2DR0A 4NP6A 2PZ8A 4GKJB 1DQSA 5EJ7A 1E66A 3O8QA 3SZRA 3WLQA 1E9BA 3CUVA 4UHEA 2IX9A 1KYXA 4P54A 4HT3B 2JI7A 2JI9A 3DKPA 4FMCF 4NZNA 3WLLA 2OUIA 1KWKA 2JH3A 3AXSA 1Z33A 1I51A 3SM9A 1C8KA 1DJQA 5E3HA 5HS4A 4PLVA 2P4UA 4D6YA 3WKCA 2CHQA 4F4CA 1JG1A 3P9CA 3VV2A 2IQ5A 4IYJA 4CR7A 3ZY2A 2Y92A 1GU7A 2I55A 4R1OA 2FEXA 3FUTA 4D43A 2ID7A 1NQOA 2XF8A 2CNWD 4XGQA 3DHEA 4OHYA 2FWIA 3J81k 3R24A 3H9UA 4WKBA 3F98A 3OE7A 2GN0A 5H70A 1UXKA 1Z0KA 5H82A 1N0IA 3P52A 4AMVA 1W5AA 5GV7A 4MV1A 3KR9A 7ABPA 5LJIA 2GD0A 2GOYA 1JP7A 1ZXBA 3K0AB 1GKYA 1Y8AA 1LJLA 3I53A 3ZCPA 5ITVA 3G02A 2EIXA 1R18A 1DU4A 1EP1B 1T8WA 1H3FA 2X5XA 4OU5A 2NUTB 2QUKA 4JODA 5BVGA 4G5FA 3UKOA 2WFLB 2BR5A 2I6QA 5EI5A 2JFFA 4E08A 5A06A 5B57C 3E82A 3BXHA 4U2CA 5DLQC 4MVJA 3WTBA 2MINA 5DGIA 4XQEA 1KHTA 3PXAA 2P5SA 1KPIA 2CCJA 5CCXA 3UYKA 1ONNA 3BMNB 3B8HA 5C1OA 5KVQA 1MA3A 1KC3A 3UMYA 4X9XA 1D4OA 5LOVA 3QVGB 5AW1A 4BKOA 4URFA 4O4LB 3SX4A 4MCHA 2BCGY 2IUTA 2HDOA 5ALMA 4L8FA 1NAIA 5D2CA 1BJTA 1Z6YA 5JVDA 2O19A 3UWMA 1PDOA 3BL8A 1R0BA 2IH4A 2W2VA 2Q1UA 1FQKA 2Q0SA 2XSZD 3CNLA 2HLNA 2W11A 4R2KA 3V33A 5CG2A 2VHVA 1QP8A 2A5LA 1Y3CE 4HDSA 2QJFA 1RAGA 5J40A 3T9CA 2C3UA 3VPSA 3QG5A 1U8CB 2XMZA 2HZ7A 3QI7A 1EK6A 3L7OA 2CV0A 1ONPA 2XOKA 5D51S 3JATA 5FO1A 1T13A 3DOHA 3AR6A 1IN7A 3HPQA 3T4EA 3LL4A 4MUKA 4BFSA 3BFVA 1SC4A 2V5VA 1KJ8A 3PWSA 3PEFA 1EDEA 2CUZA 3BFXA 3IR5A 3TRKA 4HEA1 3AETB 1EMDA 4YIHA 2O59A 3TSCA 1MEJA 5CK5A 2R8BA 1D2MA 2C2XA 4YUYA 5U9CA 1BEZA 4LGMA 4YN3A 3CUWA 4LJ5A 1A4RA 1UMBA 4IGAA 4V0KA 3HKCA 3TUIC 2D13A 3FZEA 4EI9A 1K0FA 1YR2A 2GUGA 4IQFA 3ZE0B 2ILVA 3DMDA 1UBMS 1WW2A 2B1QA 2XIQA 3EXFB 3BERA 2Z5FA 3OX3A 3TL3A 1PQYA 4B7CA 1RVV1 3DEHA 1JHAA 3ZR4B 4JFAA 4I55B 4AMGA 3Q88A 1U3CA 3AW8A 1EGAA 4I0WB 4PLYA 4YASA 4EFLA 3GGJA 1KZHA 3QWFA 1RHKA 5FLKA 2O7SA 3KT8A 4WLOA 5GJWC 5LA6F 3T1VA 1M7BA 2V55B 3PKIA 3T61A 1HRKA 3HZZA 3IXMA 3EZLA 3AY7A 3AR5A 4O4IA 4CQMD 3HUUA 5EEHA 1O3YA 2GYVA 1MB2A 4HAYA 3KNZA 5AKKA 5JSUA 1QTQA 2G1JA 4TS4A 4PTZA 1FNMA 2J6HA 1IUNA 3PFKA 5TMDA 3TLJA 4OY3A 1JW9B 2HDHA 2JGEA 4EO7A 5DVZA 4JFRA 1KEPA 1S01A 5L7YA 4M1TA 4D46A 4FNMA 1D09A 1AE1A 1NC1A 4Q1DA 1X7ZA 3S68A 4BJ1A 4Z6KA 3IOCA 3ZY3A 3VPGA 1US8B 3DDUA 1V0JA 2GDZA 4NWIA 1KAGA 4O25A 1EUDA 3K09C 2NXNA 3LGSA 2VDWA 3ECSA 4JU9A 3A7DA 2ECQA 1MRNA 1ZK1A 3QLJA 4DAEA 2DHEA 5HWSA 1I3CA 1ZJZA 3SLGA 4UZFA 3UT5B 1Q0RA 2GEFA 3T4XA 3W6UA 5KNCA 2JJ2D 4L4RA 2JK1A 5K3FA 4XYEA 3L84A 1VRWA 5GJCA 3RSSA 2XOEA 1YZHA 3H75A 5BQOA 5CFLA 4GM0A 5E38A 5AXAA 2C4KA 1GTL1 2QTFA 3A6EA 5EP1A 1OFUX 3BOSA 4DBZA 2P9EA 1QJ4A 4EYKA 1RRMA 2FW0A 1CIVA 5CVVA 1G2IA 3S40A 1E2LA 1QH0A 3GJYA 4FYIA 1Z6ZA 3GCZA 1RAAA 1U3DA 4N4AA 4ZRMA 5F52A 2RD2A 2CCGA 2AFHB 1N2OA 1X2BA 3LZCA 3LKZA 3PE3A 4QTUB 3R7NA 3FPSA 5GZ1A 4G1VA 5IN5A 3IPLA 4U8GA 2A67A 4QVGA 3OZAA 1T2VA 2VT2A 4QPZA 4BMNA 2YWRA 4J9UE 1IIBA 2OTCA 3TOCA 2X9VA 4X7BA 4BEBA 5JJBA 4YK7A 1XTJA 2ZK7A 1TQ4A 2I76A 2PVPA 3GARA 4PSKA 1U7DA 5DLYA 3AF6A 2AVNA 4ZVPA 4C9BA 4ZMRA 1HDCA 5BW4A 2JLWA 1QZZA 1SEVA 2K4MA 2JJ1A 5LQCA 2RGDA 3ZVLA 3MAJA 5D3MB 1S9HA 3OJOA 4A8JC 1II8B 1WVIA 2O3TA 3WLIA 3OWOA 4JK3A 4K6GA 4LJAA 2R8XA 1PR6A 2WVAA 4PZDA 4YACA 4IS3A 2JB9A 1A2OA 1NP6A 3FMGA 1FSFA 1A9XB 3E84A 2DPLA 2GA8A 3CIOA 1WETA 2B4AA 1N7JA 2VJKA 1KZ4A 3ABOB 4XFJA 3WS7A 3OT1A 1RWMA 4DJDC 1XDBA 3UN1A 4O2BA 1A4XA 1DT3A 3I76A 3QVTA 3SMVA 4PLWA 3VVMA 4MQEA 2WFMA 3HDYA 2BEKA 1E79A 1DCTA 3PNBA 4ZWNA 2EJUA 4LEIA 1MOZA 3BKWA 4NBNA 2QZ9A 2QW0X 3T0IA 1X1RA 3ZWVA 5KHLB 1UFOA 5H16A 1UM9A 2XUFA 3E7WA 4G5OA 4R3UC 4X1IB 4CLRA 3WV5A 4MUAA 3KU4A 3ZDYB 1JXQA 4GRDA 2JAQA 2SCUB 2XNDA 4AX4A 3T1YB 5HS6A 3EUWA 3C7CB 1EFKA 4DLZA 2GZSA 4MNTA 4RCZA 1EVKA 5FR1A 2QTAA 4GEGA 2V4MA 2NZJA 2IK8A 3DC7A 4DCGA 1J0EA 5JO9A 4HGPA 4MB6A 5AVRA 4HG2A 3PR2B 3QTLA 1OD6A 1V1RB 2BIFA 5E6UB 3QMVA 1U3FA 4ZTBA 1X3LA 2BUBA 1H4VB 4HNGA 4D74A 1SWWA 5CB4A 1NHWA 2X0RA 4FE3A 4EB3A 5IWAB 4O02B 3VDXA 1D03A 4CIAA 4X8MA 2HDNB 3GJ3A 4BBAA 1Y8ZA 4BRWA 3PYMA 4GMDA 1IHUA 3KETA 3LQ4A 1X9HA 1PWYE 3MWYW 2IEAA 3DBHA 1PQPA 4JQOA 5CJPA 4ENTA 3IJRA 4Z3KA 1FX0A 1I5RA 4EUHA 1ZWLA 1G5IA 2NSJA 1Q7CA 3E8MA 3HYTA 1AX9A 1B76A 4KFUA 4N5NA 2C7OA 2QY6A 3L5OA 4RWEA 3OCVA 1DBWA 3L6RA 2Q99A 5G0SA 4NJEB 1G4HA 1OFVA 2DT8A 4GOLD 1P2UA 4XJXA 2C4UA 4HWOA 3COVA 1C1XB 3A1TA 5FJJA 4CGYA 1AMOA 3WLHA 4CEIB 1U2RA 1GU1A 1HL7A 1G0OA 4ZT6A 5EUQB 4QJBA 4UUAA 7AT1A 1WDMA 4AI6A 1TVEA 4PLCA 3EISA 2CFOA 4TMVA 1TK9A 3FMPB 5CT8A 1KK2A 3WV4A 1OLSA 3EZYA 4WCVA 1VCMA 3OFKA 3RWMB 3RU7A 3RFTA 2IV3A 1GN8A 1JR4A 3OIVA 1Q1GA 4CL8A 1L3CA 2D4AA 2QR5A 1LB1B 1MNAA 3K8YA 3DQPA 4X41A 1DZ3A 2VPIA 4F5EA 4TMFA 1I2CA 3I09A 5ALKA 1FRQA 3BWDD 2JIZA 2EBHX 1P2VA 5DI9A 2O8BA 2IQIA 3ENZA 1UM8A 5IH3A 4GICA 3QXXA 1SVNA 4Y30A 3KJGA 1MKYA 2D5LA 1XLUA 5AK5A 3EBPA 2VAPA 2RGUA 3IA7A 2IT1A 3C3DA 5THXA 1NUTA 1CD5A 4O2AB 4D8UA 5BT9A 5IKEA 1P3JA 4MGHA 2J0UA 1EVLA 2RGNA 3HCBA 1JHZA 2HMTA 1VHLA 4K46A 1F17A 4KIWA 1P1CA 3UFXB 1FE8A 1YZTA 4L57A 4MPTA 1HNXB 2Y1WA 4K88A 2H1RA 4NCNA 3VC7A 3LK6A 4L4XA 3QNMA 4FN5A 2DH6A 3A70A 5IBRA 4YMVA 3DV0A 3Q0TA 1A5BB 2ODEA 3SHFA 3KUDA 4BB9A 4DXDA 3ROKA 4FHCA 3DC2A 4A23A 1ECBA 4F6RA 1E92A 4F4IA 1HLFA 3CMMA 1OXVA 3ND9A 4N40A 4QQKA 2HUPA 2QZPA 4U8HA 5J9FA 2O2EA 4ES6A 3OCJA 1XA0A 3WNVA 2JBHA 1PFWA 3GXBA 2R6AA 5HJEA 2WF9A 4ZA2A 4BLPA 2ZJYA 1T5LA 3IBSA 1SQGA 5H80A 5DX8A 2WSMA 3EIWA 5H3HA 3BGDA 4ZMSA 5IK2D 1OOEA 5KB3A 4ECAA 4HN2A 2AE2A 2AC7A 4EY5A 2C58A 4FJ0A 5K3EA 3ZJ5A 1CZOA 1E1NA 1IEQA 1VSUA 2BGMA 2IEZA 2ZSDA 2V7EA 3DOFA 1W8DA 2G04A 3L49A 4NBVA 3UENA 4YAWA 2C2BA 4B3SB 4JXXA 4YRLA 4C7KA 1PJRA 3FFBA 4IXWA 3F49S 1EDOA 5A2GA 1LI4A 2WIBA 2FJ0A 2CFIA 3PJGA 2I34A 4FT2A 4RLQA 5G4KB 1P77A 5EUBA 5GONA 2XD4A 2P0YA 3ZDQA 1Y1TA 3U16A 1FP1D 1V95A 4WZBA 3DZCA 4PHCA 4LFBB 4UUBA 2FK8A 4NHOA 1HXHA 4Q1AA 1N0UA 4TMKA 2WFAA 2YNMC 5LCXA 5IM4A 4D8XA 3NMUF 3KLBA 1EP3B 2GAIA 3IE2A 3SZLA 5EGNA 1YR8A 1KDZA 2HMAA 4RXMA 1WY7A 1E3WA 3GPBA 3DW3X 3F4KA 3QLUC 2ZDHA 5FA5A 3IELA 1XZ8A 3NIGB 2YL2A 4LIPD 2WIKA 4GHWA 5DTEA 5HMMA 1X1TA 2APJA 1BN7A 3JYQA 1DARA 3FUWA 3PDUA 3TLYA 5CW1A 1WP4A 5KDLA 2QUHA 1ESEA 2XTJA 2ENWA 3UWDA 4FFPA 5EXSA 1H6DA 1RNLA 4G4SO 2HREA 4YT4A 3WK8A 3BC1A 2AS0A 2X8AA 3N28A 2P8JA 3GEDA 2PKRA 2RHTA 1W88B 4HDKB 3VHXA 4F7DA 4OX9Y 1JYEA 5DRTA 2O50A 3I58A 3R8CA 1BC5A 3S1AB 1DAMA 3UAVA 3DFIA 3T1NA 3HTXA 1NJ6A 2L42A 3BILA 3UMGA 4CZ2A 1JDTA 4YCDA 3URMA 1GDHA 3OAAD 3NP7A 4GE3A 4H35A 2AYYA 5LBUA 5CB0A 4EOGA 4E1AA 2ZRNA 4JUDX 4OQ4A 1BKDR 4CIBA 1EGVB 3QVVA 1Z5WA 1PL0A 3QITA 4L8WB 4EG5A 3RC2A 5BV0A 4V02A 2QYTA 1BFDA 3PC2A 2IELA 5ELXA 1MPTA 4EFDA 2ZSAA 5G3ZA 5FWAA 2OCXA 3NM4A 3NQ41 1UBFA 2W2LA 4H0FA 1N2GA 2AR0A 3V4VB 4NYIR 3T7CA 2CBZA 1KK3A 2ZSHA 1P2TA 3ABSB 3FZNA 3K0CA 4DIFA 5JXIA 1MJGA 2ZEJA 3OZWA 4GKAA 2XMCA 4JI0B 3CRMA 3CRRA 2E6KA 2IH2A 4J03A 1BXGB 5IN4A 1GUDA 3IDAA 4NIMA 3SBEA 4I14A 2ZJ5A 3SBOA 3VBEA 3FWZA 5JDIA 5I7HA 1ZWKA 1EU1A 2DY0A 4PM4A 2HIAA 4A0QA 5LZ7A 2GKOA 1WUIS 4J1TC 4QYTA 1UK8A 4MI9A 1L4EA 5DOVA 2W2PA 2J9ZB 3FVRA 4X60A 3ZW9A 4C0XA 3T15A 3U3ZA 1K75A 3C3JA 4FI3F 1ZK4A 4K1LA 3K0FA 3UUWA 4MUXA 4NZZA 1O03A 1C1HA 1HNZB 1FF9A 3TW8B 4JLVA 4C4AA 2VSOA 9LDBA 4NCHA 4H3HB 1JHUA 1YZFA 4KN5A 2B25A 1DBSA 2WHPA 4DSZA 1H2ZA 2UYOA 4FW8A 4XDYA 4AYTA 1F3OA 2NXCA 4XSHA 4WZAB 2CFCA 2G9UA 2BGKA 2JBAB 2VDRB 4U4AA 1QKIA 1LSSA 1F7VA 3LGXA 1W36B 2V1UA 5E6SB 1J0CA 2GPBA 1JEYA 3DYIA 1D6JA 1UDWA 1V7PC 3JQQA 4CUJA 3H1PA 1UDRA 1G5RA 1P6QA 1MT3A 1QRRA 3OM9A 3NT5A 5ALZA 2P6OA 2QD1A 1R50A 1SFRA 3NHRA 3DBRA 2NACA 2UUPA 3LZ6A 1RRKA 3FBTA 1UQUA 2FOLA 1LVHA 1NBEA 3Q2IA 5FCDA 2ZSUA 2GF9A 3BZWA 3THXA 1YK1A 1TYDE 2PMCA 1EBUA 2EBUA 1FDTA 2JLSA 1RCTE 4FPXA 3GLIA 4WW0A 2GETA 1N6NA 3FFXA 3GRCA 1F3LA 2RI1A 2WKSA 4DV6B 2OENG 2BM8A 1XAIA 3TRHA 4CM1A 2ODBA 1RWKA 3FDZA 3MILA 3T5AA 2NZYA 5TMBA 4KXUA 1TEZA 1TM2A 3ZWNA 1LI5A 5K3CA 3GNLA 3GFTA 4TMXA 1JB1A 5BN5A 2YVKA 3LY8A 1M73E 4Q39A 1N78A 1YDMA 1YVEI 1MP0A 2X8WA 2XQVA 1SQ0A 1EUCB 2VDVE 3EMKA 5IVHA 1KJWA 3F6EX 3WP0A 1SCIA 2WTEA 3K5IA 3VKUA 3BWXA 4PS1A 4UHCA 1JIQA 1NZJA 2CVZA 4JP3A 3L7IA 2O8EA 1LBSA 4TXMA 4MB0A 3TIXB 2QG4A 1KQPA 1VIAA 2EYUA 4C20A 3NUGA 1SC6A 2VQ6A 3V1UA 1FVOA 1EZZA 4PG4A 4INPA 4HLDA 2HMWA 4YV2A 4P4GA 1PK7A 1Z28A 3CHYA 3K9LA 4ZXFA 4Z2AA 1QP0A 1N2ZA 1YTLA 3LW8A 3VI3B 3EOAI 4QUBA 3NDIA 4PINA 1GOTA 3S27A 1L5YA 1SBIA 1SOAA 4D99A 3MA0A 4WESB 4MV3A 1C30B 1VLLA 1BS9A 1NXXA 1ZZGA 4QODA 3WHLA 3GZNB 3V8MA 2E4UA 3KPUA 2AD5A 3MMPA 5FOSA 1NVAA 1TC1A 1SULA 2R8PA 4OH1A 2D0PB 4B3JA 3B20A 1GGNA 2OGWA 3OHMA 4AQYB 3UJHA 1IJBA 4IZ6A 4X20B 1ZC3A 1R00A 3G1WA 2IDZA 3A6JA 1Q1AA 1TTHA 4HGQA 4RY2A 2W6ID 3DOUA 4AUNA 3E9ZA 1CY6A 4R54A 1X7GA 3NIWA 4PC6A 3ZQ4A 1TQ2A 3FYUB 1ZM7A 2QTWB 3I73A 1B8UA 1SH7A 3AQ4A 1EA5A 5DHSA 4CM6A 1PSZA 3CZQA 1CRWG 1X74A 1T8UA 2ZAMA 3OU7A 2FMTA 1KO1A 3JQ8B 4H4EA 2QR3A 4EITA 2IF0A 3JPYA 3WICA 5E2IA 4U7PB 2AQIA 3O26A 3TTTA 5K0NA 2MYUA 3B85A 4CYMA 3I9V6 1YJ5A 3KC2A 3LECA 4GLOA 3TBKA 4HUQB 2DQ4A 1W73A 1GQ2A 1AA6A 3N2GB 1ZFNA 1QO9A 2HRQA 3H2IA 1DAGA 4QXOA 4V1CB 4IGFA 4RTLA 3TTSA 5KEIA 3DEJA 4ZFNA 5K6AA 3LCRA 4PZZA 2R6JA 4HRXA 2JIBA 2HWWA 2P0EA 3RC1A 1LY1A 3T9EA 2DCMA 3GLHE 1XZMA 1XMXA 2JIOA 1S2IA 2H0AA 2Q5CA 4WOJA 5AM0A 4ZVQA 2Q2VA 3R0IA 5FPHA 2BHSA 1RAFA 4EHKA 1HZJA 1FRVA 1N2BA 1VLZA 1M1NB 2HU8A 2XEXA 5HZHA 1TKAA 5CFNA 3WB1A 2EJCA 4M9XA 2AOUA 4BMXA 2I3DA 3VDNB 3M34A 1XZJA 1Y8QA 1PLKA 4FEEA 4ALLA 4RA9A 3C5WP 4JI1B 3FKSA 3MGCA 4AY5A 4LJ6A 1XVTA 5FLEX 4LCEA 4YGXB 4QBKA 5JNLA 1IXZA 1F6BA 3UF0A 3ZHCA 1G21E 4PYQA 2WVHA 3D3WB 3FD8A 3OZEA 4R6XA 1OWNA 1UAGA 1ML3A 1M0SA 4ZCLA 3W2TA 4C4RA 4NR0A 4EELA 4U6SA 1H05A 2WAAA 3G85A 5JC8A 3THYA 2E5LB 2CHFA 1DTWB 4UDNA 3BQNB 2D1TA 4A16A 2OD7A 5LC1A 1NI3A 2A6PA 1PDWA 3F96A 4GSYA 3UC9A 2IH5A 4L6AA 4CCWA 4JBHA 2W6CX 1K8ZB 2C99A 4DZZA 5I7EA 4JS0A 3DKRA 2GD1O 4G4GA 3C98A 4M9QA 4RM2A 1EFTA 3LOUA 1UBOS 4AWBA 5IKPA 2ONYA 1ZNYA 1QOZA 1U28A 4LV6A 3OQOA 3I52A 3R7DA 5BYBA 4B81A 1CFJA 3DO5A 5CMLA 3ADOA 3NU1A 4WX2B 5B3KA 2HA0A 3WQQA 1ST3A 3TXAA 2A9OA 4NU8X 1MB3A 4YCMA 1VZ2A 3IPCA 4N3GA 3E7XA 4FHZA 3AVVA 1WRBA 4J75A 4EQZA 4DA4A 3EVZA 4N0EA 3VGJA 2WNSA 2QP3A 4ND2A 3ROEA 1ADJA 3I2HA 4Q3DA 4A6PA 3E9DA 4FR0A 1GU0A 2Q8QA 3T8YA 4ACBA 2FAXA 5GMOA 4ZCIA 2DLNA 4KNYA 3PSAA 4BBPA 4WCDA 4RJLA 1PJQA 1S2NA 3UGJA 2HIHA 2R8OA 2XUPA 3WQSB 1JJBA 4BO3A 4JHXA 1SIOA 3DZFA 3QU7A 4ARZB 5LLSA 1FP6A 5AKLA 4R3NA 1Q21A 3GFPA 2JGMA 3KEGA 3QVWA 4LCJA 3V8QA 3PI7A 1J25A 4XH9B 1XPJA 1T3TA 5TY0A 3PPVA 1Y5IA 3O0TA 4GOOD 4DGSA 1U7OA 2X2FA 1SPBS 3E5RA 2WW8A 3UICA 1MIHA 1LLQA 3DOEA 1A96A 1WCIB 2BMJA 4AURA 1O95C 1TJ5A 3C43A 2YJGA 4XFKA 5HMLA 1L5MA 4AF7A 1SVMA 2VNJA 1QNFA 1GV0A 3LC1O 1U0BB 4I9UA 5CNKA 4JROA 4O8ZA 3PPYA 4DA0A 2FP4A 1V8OA 1NVMB 3LXUX 4LCBA 2QA5A 4JUAA 1T4MA 1BN6A 4XIFA 1OX4B 2VPXA 5G0UA 3A2MA 1BMTA 4PONA 3L04A 1RP1A 1CZLA 1KMMA 1A97A 4OMFG 1QHXA 1F8GA 3C3MA 5JXHA 2CXOA 3UHOA 4W9NA 5AVKA 1JTEA 1BCRA 1Z4LA 5DN9A 3QLEA 2VTBA 4BFYA 2GD2A 1B41A 2VF7A 4KACA 3H1BA 3AP2A 1NOJA 2FJUA 2YW2A 1W5BA 4GX2A 4PAMA 3T95A 2XUZA 1CRZA 2JATA 1HRDA 3IIEA 4L5AA 1PJ2A 2WWGA 4D6XA 4MZDA 4MQBA 1PQ4A 2G8LA 4PLGA 1MQSA 2A7XA 3K8QA 3ZWQA 4F86A 2PGIA 1BOOA 3MT8A 2JD0A 1ZGJA 3C4QA 3HDGA 2FLWA 4DZTA 2EL7A 2AIRA 2DPXA 2MMGA 1NVEA 3D4IA 3O4RA 4M1SA 1RJEA 2DSNA 4QHTA 1B8NA 3KOYA 5F3WB 4KN6A 1VMDA 1NFRA 3W78A 2VPZA 2GI4A 3K0KA 1IM2A 4Z51A 4XAQA 3I2KA 1ETUA 1EK0A 3Q9NA 3R3WA 1EHIA 4MA0A 2O54A 3RUCA 3E81A 1D2RA 1LNSA 4QTTB 4G65A 3SHQA 1C7QA 2H63A 2H52A 5FOVA 5DF1A 2WV7A 4MUMA 4O1HA 3PCTA 5ITZB 4GL4A 3CVUA 3H8VA 3P9RA 1IZ7A 3L0YA 5EIBC 1P1RA 4A92A 4YRQA 4NJMB 1RBQA 2NW6A 3GL9A 3W5HA 2O8FA 1YKGA 1Z56C 3IKJA 4IIJA 3RS4A 4ETWA 1IB6A 1XZNA 1P19A 2O8CB 4IVPA 3OEWA 2GGSA 1TIBA 1L4KA 2RGXA 3IA2A 5G4LA 3UFXA 1NPYA 3SLRA 2R1UA 2ISSD 3JAWB 3MIZA 3RQSA 3IKLA 3SG0A 2NSHA 1IBLB 1WZNA 1YBVA 3ABZA 3Q7QA 2F3RA 5LVAA 1EXDA 4EHNA 4YPVA 2EF0A 1R5OA 2I65A 3K7EA 2OILA 1E58A 4CKWB 1IN4A 1H2BA 2FW8A 4DAOA 3ANNA 3AUFA 3AEUB 3I6IA 4FFWA 2FFRA 4I50A 4M8LA 3VVCA 3O8DA 3NPAA 3MPUA 1O87A 1XNQB 5JISA 1AKEA 5EHZA 4TPKA 4AJLA 5MGNA 2ODAA 2P2CA 4RSMA 1OJ7A 3V4SA 4DR2B 3DV2A 3QFCA 4KW7A 4GP9A 1U0TA 4Y1GA 4YUVA 2D1FA 1M8PA 4DLKA 3GAAA 5F9MA 4IMJB 4GPAA 4QTZA 2NPFA 4N0DA 3RSQA 1DWOA 3GCWA 4ZU3A 2LWIA 5REQB 1HG0A 1KOGA 4YREA 5EIHA 1PZXA 3ER9A 1KZ6A 1BWPA 1ITZA 2BTQB 3X2FA 4EB8A 5AK4A 1PK8A 5BN1A 2JL1A 3THWB 4OI0A 4G89A 4M46A 3NRJA 1KEVA 1QCZA 2HWXA 5J2UB 1CK4A 2PA3A 2HLPA 3AOGA 2ZSFA 1HV8A 2CYAA 1TKRA 1TTPB 3L4BA 1TXGA 1C3LA 4RF5A 4KGVA 2H2IA 4TLEA 1AURA 2AA3A 3U4CA 1THGA 3A25A 5EG5A 4UXJA 2YCBA 4OLAA 1GIAA 3HJNA 5DNAA 2C5GA 2B3DA 2CVHA 5SYMA 2AWNA 3OPYI 3BJIC 1HLGA 1HI9A 1MD9A 3KL4A 2OSVA 1KMHA 3MMXA 3OFNA 2OB1A 2HMVA 2DM6A 3ER6A 2VL7A 4QOIA 2EDCA 3C7AA 3L8CA 4CDGA 5BW8A 1V8DA 1USIA 2VAWA 3DAHA 4YDRA 1UKEA 4Q21A 3V9AA 2XCUA 1L5RA 3WE7A 3GQBA 1V3VA 2VHEA 1MV5A 2E5WA 3STUA 3F9RA 3OMWA 3UJAA 3OFJA 4GNKA 3MPOA 2I2DA 1NOKA 2A9RA 2DETA 2G0TA 4F38A 1U2DA 4CODB 1QV7A 1EFPB 3D6TB 4BRSA 1MW8X 3Q8KA 1HNNA 3CH7A 3OEED 2AJCA 1SXIA 4TMWA 3MBOA 1CYDA 3IQWA 2A0XA 2GBPA 4Z8YA 3VYTB 4JN6B 1DL5A 2A59A 3AIOA 3AFGA 1EE1A 3FOFC 3G2KA 3LHIA 4LYFA 3AU8A 2CFTA 4TX1A 5FOXA 3WGKA 1QQ7A 2ZCVA 4Y2PA 3R9WA 2M32A 3SOZA 3L1HA 2PFSA 1ORTA 1RS0A 1E2IA 1P8AA 5CYPA 4BO6A 3A4NA 3RS8A 1FQJA 1BDBA 4EHIA 2DF8A 4G5YA 1W85A 1WO8A 4LZNA 3WLTA 3C5HA 1QDLB 1BFUA 2JAXA 3O38A 4TWZA 3V1MA 5EMLA 2JAHA 1N2SA 3GHYA 4IWNA 5DBGA 4EA6A 3PGMA 1W6UA 1K27A 4O2RA 4IQ0A 4AWAA 2OXEA 3A1UA 3ESBA 5K03A 4AROA 3DDNA 2CD9A 3ZDCA 4CCSA 1GKLA 1G4UR 1WHSB 2EJWA 3KQSA 4OO3A 5TT0A 3WG9A 5FBVB 2Z2XA 2NV2B 2B2NA 3BD8A 1H42A 4YV0A 1ZCFA 2F00A 2XXBA 3PZRA 1U0HC 2NO9A 3ORSA 3ZU6A 4TYPA 1TAGA 4MR9B 3EGCA 3DZDA 2FKNA 5I7UA 5AKGA 4H16A 2RGEA 1W4RA 4FB5A 2Q1TA 5JYBA 2P5YA 1TCBA 2PZEA 2R8EA 4BN4A 1E2FA 2PRJA 4D80A 5IG2A 1C2YA 3E9RA 4Q4DA 5JZMA 5HGXA 3GYBA 3I0NA 1B4DA 3EBOA 3O82A 4FR5A 4IUDS 4CMHA 1QIFA 3VISA 4G5SA 2WFLA 1ST2A 1GCGA 10MHA 2QTRA 2QN8A 1D2AA 1XCPA 1K7FB 2HA2A 4LE2A 4NLLA 1CY8A 3UJ9A 4C1BA 1NXQA 4KN8A 4KPUB 1R8JA 1F2VA 1M2EA 3BMNA 1NKTA 2ZP1A 3EAGA 1A95A 1YXMA 1G7SA 3PQDA 1BDJA 4K1XA 3U6KA 2Q9AA 2PMKA 3DTVB 5AVOA 4ASUD 2PZGA 1SQSA 1CF2O 4TL9A 3KEFA 3OF5A 1IIRA 4Z1MA 3DVAB 2JCYA 4KAFA 4RPGA 4PNEA 4HX2A 3H5OA 4CG1A 3UMMA 5ISMA 3PT9A 4UU7A 4GE0A 3R8FA 4WA7A 5AJXA 1IWBB 1PBNA 1GZUA 1ACJA 1U0JA 2XCQA 1ZNXA 3EOZA 1OC2A 2H1SA 3FPAA 3CPJB 3G7UA 3IMEA 2PHZA 1VDZA 2HY7A 2A4MA 2ZYGA 5EIAA 4EUNA 3DL2A 1WBBA 3TTVA 4GOKA 4XEUA 1ZM2A 1FZTA 4PZ9A 1YDWA 1ZITA 1QIHA 4HB3A 4B31A 4FP9A 4K5QA 4CM9D 4LVOA 5ER6A 2O06A 4M87A 2AX4A 2H9AA 2FG7C 5CLLA 4YX9A 1RKXA 3YASA 3FYTA 4BUCA 2QJTA 4PSDA 4E2YA 1KI8A 1VKNA 2ET6A 5BWOA 1SXPA 1T43A 2QUZA 1TQDA 1R5JA 3IODA 1UBJS 3BHNA 3K96A 4QFMA 3SSOA 5BMVA 5JD4A 4DMCA 5JAIA 1G8GA 1OV6A 5A6SB 5KQSA 3RIGA 2Q4TA 3AETA 3HWSA 1JFLA 1F1JA 2MYTA 1HG1A 4FIZA 2BV3A 3GLFB 4P4LA 2QPAA 4XLLA 3SP1A 1E1CB 3QPAA 1CVRA 4DLWA 4D9KA 3L1JA 4Q7KA 3HABA 3U44B 1YQDA 4Z54A 2DPYA 4ARUA 1Z4NA 2CVFA 1IXKA 1H93A 3HBMA 4X24A 2VEDA 3NHYA 1O08A 4C30A 5IFLA 3UWSA 5LKAA 2I80A 1ID8A 1QG0A 2MSDB 2A1IA 5T67A 1I1NA 1L7XA 1GGEA 1U7XA 4KRYA 1Z7WA 4YRPA 1YZKA 3AC0A 3VH3A 4O08A 4EFKA 4NMWA 4OGGA 3R7LA 1J5XA 3RM3A 2WHQA 1Q6YA 5BSHA 1BS2A 5DYTA 4CV1A 2W98A 3GH3A 4WEOA 3ZK7A 2FMIA 3GRAA 4GNRA 5LA6A 4DQLA 1EB8A 1CIJA 1P45A 3D81A 4LK3A 1ZISA 5DM4A 3U17A 3R6TA 1JZTA 1Q20A 1V1MB 3FH0A 2J5BA 1Q0UA 3LCMA 1Q92A 3B48A 3MTGA 1HY3A 4MULA 5GJBA 2YV5A 2AXPA 2GHIA 5EZYF 3NC0C 2FN8A 2IJGX 1RWWA 2I6GA 4EIWA 2OHVA 3HYSA 5IDXA 3MRVA 1JEJA 1US8A 2P62A 4IQ8A 4NNOA 1D2EA 5E2AA 5FUVA 4HH3C 5LZ5A 3VX4A 4ENWA 1N5LA 3LBIA 4ITVA 4KPYA 1P74A 2AG0A 3TXYA 1XRPA 3BEDA 3AJEA 3ML1A 2G9QA 3HZRA 1N2CA 2C4WA 1CHDA 1NY6A 4CJXA 2CLOB 3TMAA 1OIVA 3NDRA 4N41A 3I0ZA 1UCFA 3MTQA 2ORWA 3HZHA 3UT5A 4HWTA 1V8BA 3SM3A 2X6RA 5T41A 3OPMA 2WZBA 2O8NA 3TZHA 2FWAA 3O5AA 4OQLA 3ZDXB 2A84A 3TAXA 2IYAA 3EB9A 4U7FA 3OLZA 2HNAA 3NETA 4JU8A 2EL9A 2PFGA 3PHCA 4RY8A 5E4FA 5EIWA 2HNKA 3S2ZA 3HM2A 3U5TA 3LQKA 4S24A 4BASA 1BE0A 2C03A 1V45E 2Q2NA 3LF1A 5IZ4A 2QN3A 4OBBA 1IH8A 1I36A 5JUWA 3ECCA 2AFHA 2O5VA 3EHDA 2EJVA 3WMRA 1IK4A 1WBJB 1NDUA 4Q00A 1ADFA 3CGGA 3DULA 5TVKA 3ZGXA 3WIUA 3H99A 5BSEA 2GFQA 2GVDC 3MGAA 3BE5A 1I2BA 1NRXA 3ZQKA 1QRTA 1SR8A 2H4YA 4DYVA 3S2SA 1AS3A 1NXVA 3LT4A 3MELA 3TDKA 3ZK8A 2EQ5A 4M36A 5E1MA 4E31A 2XCRB 4X84A 3TMYA 3KOOA 2YNMD 4R8KA 5FA6A 3EDRA 4G8BA 3I2JA 1ZJWA 1XUOA 1GPYA 3MS2A 1V9SA 4Q82A 5AJWA 4CLOB 1Z18A 2EFYA 1EDDA 5C0OE 2R97A 2QN6A 5DHAA 4UD6A 3SX0A 3IE1A 4IGEA 4QYSA 3PS9A 3C3XA 3CM0A 1KQNA 1A9XA 1LDMA 1DIGA 1RACA 1N5DA 2CLDX 2BKLA 3NTUA 1SQ6A 4F5DA 3A3KA 1VB3A 5L7WA 1Y4UA 3UAZA 3UK1A 1U02A 3ADDA 3PHBE 2F1HA 1DJLA 2OR3A 1IQUA 2V6MA 4ZVUA 4ARCA 5EMJA 2IWRA 4R1LA 2IUYA 3GP3A 1ZI6A 4EB6B 1P4HA 4X5OA 2YOFA 5G1OA 3NH6A 2FG6C 1MC8A 3EUEA 4R05A 4ZT5A 5BO5A 5EE5B 1H3NA 1VPTA 5CVUA 2V7QA 4RQAA 1F38A 4OQZA 5G0TA 3RAJA 3VZSA 5A4FS 5BMVF 3GP8A 1CR4A 3OSUA 5ALJA 3ZVRA 1XD2B 5BMVB 2OZLA 4X1IA 3N0RA 2A2ZA 5FTWA 5K0LA 1O94A 1J2UA 1LVGA 1XDZA 4EHAA 2SCUA 4EPRA 4ER3A 1SUBA 3G5UA 1F60A 3RBVA 3RVKA 2R6HA 2DP4E 4H7DA 4L78A 3W5JA 1MLDA 2ODQA 4OYLA 4TYYA 2G67A 2OMKA 2WSBA 4YALA 5AMXA 4QKQA 5KVVA 1JDJA 1C3OA 2PBRA 3FSJX 4ZIRA 4UJ3A 1K9SA 4ZPXA 3CX8A 5D5PA 1WDTA 5EP2A 5E6UA 1E60A 1QGAA 1T9HA 3CVJA 3TEJA 4IUYA 3AVPA 2AZMA 3ROZA 2GF0A 2WHYA 4BMSA 5HF6A 2FFQA 4DKXA 2O5CA 2FQYA 2VF4X 4F3TA 4M8NE 3EOBI 3IUEA 1VE7A 3HO8A 3M4XA 1NMEA 1QBGA 4DA7A 1RE1A 3E53A 4RPHA 3CEHA 5AW4A 1EDZA 3GRZA 4OU4A 1ZIDA 2A5DA 2OV3A 3LX4A 5JS6A 2H16A 4Q3EA 3ZE6A 1GPUA 4Q3AA 2ZKIA 4G0XA 5JROA 4HAUA 4KOAA 1X1DA 4MTLA 4Z4GA 2HOQA 2LKCA 3U4QB 2PUHA 3PF9A 1OB5A 2F1OA 2HK8A 2NQ8A 3QE4A 4NJEA 3I5YA 5BQFA 3C14C 1P8JA 1O9BA 2EARA 1UDBA 1C1XA 2I4MA 3K0CC 4JOBA 4V0NA 4CEIA 2AUTA 2V7BA 3F6CA 3W8DA 3QHQA 1BHSA 3CO5A 1NN0A 4QL3A 4A0FA 3ZHSA 2CEAA 1DTSA 4G8CA 3ZHRA 4EVQA 2J0SA 1E62A 4F91B 1QB7A 2XT6A 3C8HA 3SLKA 1Q22A 1WUJS 2ZIEA 1MX9A 2R6ZA 3VTZA 2FFBA 2NUAA 3Q6IA 4YXWD 1CX9B 2RIPA 5TXGA 5ALNA 3H2GA 3HEAA 1N3LA 4F8EA 2IHYA 2Z9BA 1NF2A 3I9LA 1ZJ5A 2O2CA 3W1EA 3PCXA 4OOFA 3AZPA 5H5JA 4FCTA 1RHRA 3EVNA 3QF4B 3EEFA 1YVUA 3NP9A 4H31A 4WJKB 4C3ZA 6PFKA 4S04A 4K2AA 4Q7MB 4YAIA 2R7AA 1G6OA 1DKLA 5L45A 2BMVA 4L9RA 1ZCZA 2OM2A 4IL5A 4XCQA 4KSCA 2CWWA 2O4UX 5JAZA 3ISJA 3DM9B 4OAQA 4QLAA 1IEVA 5A02A 1A9OA 3Q6NA 5JCPA 1BDIA 2QTGA 5CDSA 4ND5A 1BE6A 2MSWA 4DMMA 2C20A 1HWYA 2PUWA 2PO5A 3FUUA 4O2AA 4RJTA 4YT5A 5A5GA 1TE2A 1GQYA 4L75A 5CR9A 2MSKA 4HAVA 4MWEA 4C3UA 1XL1A 1F5NA 1QWOA 2W4QA 4JSYA 3HVIA 1KRHA 3QPCA 1I10A 2OGTA 1B3BA 2WJ6A 2IHUA 4EA9A 3FYHA 4RUKA 4G4IA 4EG3A 2HCFA 2RK3A 5A7GA 4A27A 3MLAA 3P9NA 3CBQA 4S2UA 3JQ6A 1TL7C 5F35A 5IBPA 1WNTA 1OV4A 2JGNA 2X9NA 3HCDA 3OQPA 4S1OA 1W2HA 3B1XA 3FZYA 4N9WA 3SJUA 4FMDF 4LOAA 1SHJA 2WT9A 3GY0A 5KC8A 3WGGA 1VLMA 2H31A 2ZZKA 1I9GA 3F2IA 4YJ2F 2ZSKA 2WF8A 1CJBA 1RLJA 4J4TA 4MDEA 3A1FA 3R3ZA 3GN1A 4IX1A 4MJ7A 1ABFA 3OKAA 1TU3A 2AV6A 3DDSA 5DKFA 4LSZA 5IJ0A 1MJHA 3C4VA 1XE3A 2QN9A 1YOVA 4JP2A 1XMIA 1KVUA 1D1QA 4JIMA 4RD2A 1E1YA 4ZN6A 3ZGOA 3KCNA 4NFYA 5BNIA 4OSPA 4PGGA 4DM7A 1JL3A 1E0DA 3C3BA 1W87A 3L6DA 1JAXA 3KJXA 5G4KA 3D1LA 3NEPX 4F84A 3H5AA 2ZTLA 4KVAA 2ZT5A 4RBNA 1U8UA 3IB6A 3UJBA 4AY2A 2CY0A 3FPKA 1IL0A 1NG1A 4EYQA 2O3UA 3WAGA 5L4LA 2W9XA 4W7SA 3TOSA 2PZAA 3G6WA 5A9RA 1XEXB 4V0QA 4ZOBA 3TZ6A 1JR2A 2P6MA 1SXJE 4G63A 4XCXA 1ATZA 4KH1A 1NONA 5HZMA 4YYZA 4RIHA 4WLFA 4M0PA 4P7JA 1GDTA 1DV2A 3V3TA 4TWRA 3RC8A 4DR4B 3TR0A 4H6VA 1EVYA 1HT1E 4PO8A 3T9DA 1QQBA 3NCTA 4H2DA 3PX7A 2WI8A 2O3JA 3GUVA 2RGRA 1JJIA 3ABRB 5KWEA 1U7UA 1BWSA 1TAQA 1EFUA 3KZNA 3HA2A 1MCZA 2QP9X 1Z6AA 2CL7X 2V7WA 2HJWA 2FSVA 2ZXFA 5JSFA 1X2EA 2WIAA 2EBFX 1W88A 3DOCA 3W5SA 2GAFA 1UBCA 3ICOA 1NI5A 2EZ4A 3EE6A 4LF7B 1PJAA 3PXXA 5LQRA 3AB3A 4DLTA 1F8XA 4NYJQ 2ZTSA 4IHJB 4YMIA 3VRHA 1K3UB 4D9HA 4CTNA 2HF2A 1YDHA 2FJPA 4FE4A 1LW7A 4RF4A 4KI7A 4B4KA 2X5NA 4NAUA 4W5WA 4Y9RA 3INGA 5B7NA 3HB5X 3FPLA 3NFRA 2Q3DA 2G5PA 4DV3B 1ZD8A 4G26A 1NVUQ 4EUFA 3GJ5A 5AO9A 4PS0A 3PD1A 1GPKA 3DE5X 2J07A 4HAWA 2JRCA 1Y3AA 2QRVB 3BE8A 4BAGA 2CXQA 4LA4A 5EJ9A 4BNZA 4PSVA 3CEMA 3MHPA 4JCCA 5B1IA 3CPSA 4HLNA 1PNTA 1SKBA 3IP9A 3WMGA 2ZI3A 3KIPA 5TR9A 4UOEA 5K6AC 2OV2A 3AM3A 3HB0A 3QEJA 1M0EA 2ZB4A 2W71A 2VATA 4Q1VA 2XYHA 4D7AA 2ZDGA 3F3YA 3HR7A 1H4SA 1JKMA 2N3ZA 4MRSA 2X7JA 3KPVA 3TSYA 1ZMBA 3QJYA 5DN6D 3JQFA 1U5CA 1RWPA 3DUWA 3E9EA 1VHDA 2E4XA 4L51A 5JZ9A 5CGZA 2QG9A 3E6AA 1SCBA 5CB8A 1YKFA 3T1QA 4BFXA 1OTXA 2AH5A 1W581 3HADA 3MGKA 1L4NA 4FR2A 1IOVA 4NK4A 4OMDA 4LVUA 1AKYA 1PSWA 1U11A 2BFEA 4R71A 5CYFA 1NBMD 4YHHB 5KPJA 3RADC 2P9FA 2H4ZA 2ZUWA 1UT6A 3IESA 3IQGX 1YDFA 3K5HA 5D8DA 3THOA 4ZGBA 2BGWA 4RH3A 3QJ5A 4S1WA 1DG1G 2NIPA 2QZZA 3HJBA 2XTAA 3I4CA 4WZAA 3STVA 3W2FA 4EEXA 2IOYA 2IYSA 1GUFA 3RBXA 5E6SA 4G1MB 2IIBA 1NT4A 2VHJA 3EHEA 3LQQA 4WLEA 3HBLA 1QHSA 2JJQA 2NO7A 2OKCA 1XRJA 5AVTA 1E59A 2H5LA 1FEZA 4O0MA 5I9BA 2AN5A 4DADA 5GINE 1AB5A 5FHRA 3GF4A 3HRIA 4Q19A 1U28C 4AQ7A 4QOFA 2QB5A 3LHSA 1UPUA 3ELUA 5TS2A 4D4HA 1PS8A 1M2FA 3L6CA 3H05A 1VPEA 1CE8B 2Y1LA 4NESA 1T5TA 1DP4A 3NFYA 4IKPA 1YB7A 1YGPA 5DSZA 5JECA 5KTSA 3KZCA 1CERA 3PRJA 1XHFA 1BSVA 1NTRA 1ZLYA 4W1RA 2WWVD 2PVCA 4KGDA 3HWRA 3C3PA 1BMQA 4MKFA 1T8TA 1LV8A 3ER8A 1VJCA 4TVOA 3Q4GA 3ZX5A 4IOMA 1L5LA 1O95D 1J9ZA 4G0NA 1AKNA 1YR7A 3SR0A 3ZIAD 3K73O 2BGGA 6AT1A 4KQHA 4BLTA 1JSRA 3R9XB 1QHYA 2QRPA 3AF1A 4I5DA 4GDMA 1TO1E 3K5PA 2P9ZA 3JQEA 1EUCA 4MQLA 1DE0A 3HMKA 2ECKA 4CCAA 3OQHA 5CBKA 4HCJA 5CX4A 1XVVA 3H0EA 4LNAA 1AUVA 1XZIA 4WWHA 2W70A 3CV3A 1ZA2A 3G6KA 1P29A 3CRW1 2PYIA 3EEYA 3F0TA 4L2IB 2YWHA 1OAOA 4OA8A 3TIFA 4ARAA 5EJGA 1E4VA 4GPTA 2PCJA 2CLKB 4MWDA 2P1DA 4KR7A 2ZKLA 5AESA 3Q15C 2PE5A 2MSNA 3G89A 5J2TF 1S8OA 2PIDA 3L0BA 3SVLA 3PA8A 2H8GA 4D44A 4BQQA 3L7MA 1G60A 3RVNA 5DNEA 4UOQA 4QPNA 4EHFA 3RIXA 4QWWA 1XZGA 2FSPA 4GLBA 3DDZX 3OY2A 2QTVB 4DTCA 1VG8A 1ZD9A 1VE9A 1PEAA 5ED0A 3VA7A 1XNJA 3EQ7A 4LDAA 1PWHA 2WU0A 3ONFA 3PSHA 1NNUA 1C30A 4ABYA 1R4MA 4YH1A 1YB6A 3Q3CA 4DSAA 5I9NA 4GP6A 1X7YB 1GGMA 1NRJB 1ZRMA 4WBSA 2HSEA 4UM9D 4C5BA 3GG2A 3P0RA 4EFNA 3TTUA 5ALIA 1GCOA 2P1RA 5BRAA 1Y82A 2JA2A 3QBTA 1EPUA 1M75A 2EAUA 2ATXA 4JEUA 1ZW6A 2VDNB 4W9NC 3MVEA 3ZEAA 4HB0A 3SS9X 3F3KA 3OE7D 5L3VA 4A2QA 5BNWA 1IBSA 1E3TA 2BKXA 5AKIA 3FYUA 3ZYCA 3L77A 5IAKA 1XRRA 3O8RA 4EHHA 4L5YA 2WSYB 2GARA 3OX1A 4QEZA 1JAZA 1XDDA 2J32A 5JYCA 1USGA 3JQ8A 2Q28A 2Y71A 2XKAA 3CJRA 5DM60 1GNRA 4BNDB 3OT4A 1Y4AE 3HCFA 1JVBA 5AM2A 4REMA 2NP7A 4RVGA 4LZJA 2QTBA 1J42A 5DBIA 5DU2A 5EIBD 1OH7A 5HM6A 2RONA 4DDWA 1OVMA 3F1LA 4MVJD 1NAHA 3BWYA 3HA3A 4ND6A 4DILA 5C1BA 4Z4QA 2G80A 1A9ZA 1MEEA 4KR9A 1AB6A 4P2BA 1TDJA 2JKZA 4YRRA 1JQAA 2D0OB 3USCS 4V1CA 5KPDA 2V0GA 4X65B 1F2TB 1H2WA 2WU8A 1PGPA 3BGWA 1CP2A 3QBEA 1W1UA 2WYHA 1TQHA 1XP8A 3AX6A 4MV4A 4RFLA 3D6AA 2IXGA 4LGCA 4YRIA 4V39A 1T5OA 2YV2A 3N0WA 2CMGA 3JASA 4OAPA 5D5HA 1GTRA 4R31A 1U4OA 3W8EA 1QYCA 1AC5A 4FGSA 3QENA 2OXTA 2SKDA 1SUAA 3UMSA 4E70A 1Q11A 2GZAA 5C9ZA 2PH1A 2WB2A 1JR3E 1QG4A 2PCLA 2VCYA 721PA 4RS4A 4IG4A 1NJ2A 1K2VN 3UQZA 3QNUA 4RV9A 3W6OA 1GZDA 2QL7A 4RCYA 4FLFA 1EE2A 2W22A 2XOKD 3GFQA 1KJJA 1XWIA 4E15A 4X6LA 5HJ7A 4OXQA 2PM8A 1MXHA 4W9MC 4X1YB 7REQB 1DO2A 1NR7A 5LFAA 3R5HA 5IWCA 1ZJJA 1OXMA 1NF8A 3ANSA 4LRXA 5P21A 3F73A 3OIUA 3B78A 3DFZA 4NE2A 2FSUA 4O29A 1QZUA 2H1IA 2OM6A 3K9WA 1CUJA 1T26A 3TZKA 2JH9A 5FYQA 3OBBA 3QFFA 3KQKA 2VCHA 2Y0DA 1JFFB 1YQTA 3O4IA 3EXG2 3PFWO 4TXJA 2VEOA 3ZBQA 4E4RA 1PD1A 5FOUA 1IXYA 4JYPA 1U04A 4KL8S 5EINA 4YMSA 3ZY6A 1Y1RA 3EFHA 4Y2UA 1QS0B 4MZXA 3JYOA 4HAXA 4ZAVA 1U5BB 4F1JA 5BV2P 1L7MA 2IDMA 3KKKA 4REOA 3GFOA 4EDHA 2ZM5A 4D3FA 3RJTA 3OFSA 1RE0A 4DG5A 3L8ZA 1NP3A 2OP0A 2Q3JA 3ESQA 5IYZB 2D0DA 3KDAA 4QXMA 2ZUBA 5TB5A 4CN8A 3AB7A 3M81A 3P96A 5ICGA 1L4BA 1S6YA 3W1WA 1O9GA 4CFZA 2X3FA 3NWEA 2X0JA 4XJVA 2A0KA 4RV4A 2XZDA 4G0WA 1Q19A 1MTZA 4MIKA 1MO3A 3L06A 4MQFA 4ND1A 1KARA 5K1ZA 3W5CA 1Z0JA 4FYMA 2YMQA 4R2JA 2C2KA 3A11A 3L4BC 3P0JA 4IF6A 4TRRA 2ZBFA 3SHWA 3UCFA 3VAAA 5ES4B 2YS7A 4M98A 1SN7A 1KU6A 1UOEA 1EFVA 1GTZA 1Y1SA 4FX2A 4IJWA 2X58A 1NYRA 3DD5A 2GYUA 3H2JA 3D8NA 4BVKA 5SZJA 1P7YA 2D2EA 4J2TA 1GNTA 5JXGA 3PK0A 4ZDIA 2IP4A 1EE9A 1MHPA 3O4JA 4FOOA 4MB2A 3IPXA 3AJ9A 1UBLS 4IDGA 4Q4JB 5AJZA 3QY0A 1MOPA 2GZDA 3EGDB 4BAZA 3OJFA 3CEAA 2C95A 1SD5A 1SCJA 3WGMA 2WIJA 3HDTA 2PD4A 4WDRA 3KHTA 4KUHA 3WGVA 2IITA 3LLSA 3S99A 1JJVA 1WCIA 4IH1A 3TGLA 1FFHA 1G2PA 2NYUA 2CZGA 3T54A 2MR5A 3L7NA 1RKVA 4JB3A 3I8SA 3I1YA 5H68A 4QTYA 4L07A 2RGWA 5KNCD 2GB4A 3P2JA 1LCIA 2JFOA 4RGYA 4P31A 1ZIYA 2FP3A 3DT6A 2YWFA 3I9KA 1WKCA 2FWJA 1WDWB 3IC5A 4GR4A 4NYMR 5H7XA 4AKEA 5AH0A 2CUNA 3ZWBA 4XVHA 2QAGA 3IAM6 2FEOA 2RCNA 4G1UC 3EXAA 3LBNA 3CKLA 2CLSA 4JVOA 4BQSA 4EW2A 3REFA 3PC6A 5BR4A 3VGPA 4DB4A 5C35A 1NASA 1RBYA 3MRTA 4F46A 1T2UA 2XB9A 1KDYA 3U7RA 1XQYA 1G1AA 4TXHA 1C9NA 4UHHA 1N4DA 3TOVA 4J76A 3EDMA 1K08A 1Z82A 3T06B 3LQ1A 3WKEA 1HYBA 2C00A 3WLFA 1Q7BA 2BMWA 2G4LA 3ETDA 3W3AA 4DL9A 5A03A 1TO6A 1KXZA 3UV6A 1MGPA 4CIVA 3U7JA 5JOQA 5BW6B 1RYEA 1WTCA 1F4VA 1U0FA 1S89A 3G8AA 1K3FA 4PZAA 3VYRB 1MGOA 3DHWC 2Y76A 1NR1A 4AL4A 2QRGA 2Y9MB 1X0XA 1Z6GA 3CT4A 3SZGA 1E0AA 4R2MA 3GLHB 4HYTA 3BVPA 5CFRA 1Z08A 1SVOA 4UD2A 4FDAA 2P6NA 3KT3A 4TL6A 1ORDA 4DLYA 5EE9A 3AHIA 4W8GA 4C7JA 4GLJA 3S81A 1XTZA 1YVDA 2PH7A 1G9TA 4L27A 2IYTA 1S3IA 2VHUA 3BMQB 4AJ4A 2GZ2A 1G64A 4OB8A 4R1NA 4Y9DA 2QX4A 2WDPA 4S2EA 5T3YA 5ITZA 5FRDA 2YFKA 4TLCA 4YDSA 1E1RA 3EIXA 1SVKA 4U3JB 1E79D 2G4CA 3I6QA 3WNZA 4DWVA 2R11A 5BWBA 2WA1A 4N0QA 1DT5A 1BX1A 1TJ4A 2IXTA 3JYHA 1E2PA 4LOKA 4V38A 2WFZA 2O8CA 4W7HA 4C4YA 1VKZA 3GLSA 4ZEWA 4WOCA 1YH3A 3U9SA 4BU1A 2ZTHA 1WB5A 3JAWA 3STHA 5B58T 3DVSX 2YIDA 4FK8A 1C1DA 4F4DA 2AF4C 2ES4A 2J9FB 3ETJA 4WCFB 3TSWA 4C01A 1CTQA 3SQMA 3UWPA 4CKWA 3CXRA 1V5IA 3JR3A 2YHSA 3UXMA 1L7NA 3AEUA 1P3Y1 3KOXA 2H1HA 4E46A 3MNFA 4FINA 4AMZA 1YZLA 3JQ7A 3PGA1 1J8DA 3JD2A 1KC1A 5CIWA 2RHGB 2EFCB 2QGFA 4PBSA 5BQPA 4OFZA 4YXFA 1P2GA 1U2GA 4QUAA 4ZYUA 3IHTA 2R6CA 4G0OA 1JKJB 3GPLA 1WXIA 5LBTA 1V39A 5KREA 2Z1NA 2GM4A 3U81A 3CZMA 5KQGA 1QMPA 2QM7A 3EZ7A 3E3LA 4D9NA 2PT9A 5HE9A 3MG9A 1REQB 1LXCA 4US0R 2O5RA 2XNKA 4YLGA 1Z0IA 1KHHA 4DN6A 4J0GA 2DPMA 4ABTA 1KBZA 2IVZA 3CUYA 3MOSA 4DIDA 3THWA 2AOVA 4IDDA 3VHLB 1NVVQ 4P58A 4RM3A 4B75A 2Y4OA 1JPVA 2Q6LA 3H0KA 3QBVA 4A91A 1VYVA 1IATA 5A3VA 2ZJ8A 3JAKB 4ZKEA 1N33B 3AHEA 3HC7A 4BZZA 1TEHA 2BFWA 3EARA 4RF2A 3TE6A 2WP0A 2C54A 2C42A 1KZGB 1EAYA 2NQ2C 4JVMA 1PVDA 1L8OA 3BD6A 1EWVA 1TF2A 2DQSA 2A1TR 2YZ7A 3AR3A 3BTUA 3PU6A 2GM9A 1YRQA 3Q7EA 4L3WA 1F2UB 1HFJA 1KYYA 1ONSA 1XTVA 1DEXA 3DCNA 4TOIA 2CYBA 4NABA 3VSBA 4E14A 4C4SA 1KO8A 1KTVA 1Z26A 2F4NA 1U9JA 4FHGA 3V2GA 2H7VA 4RGQA 4FDVA 3M6UA 4X93A 1ZQ9A 1MRZA 1DBRA 1NSTA 2D06A 2Y1OA 4PXSA 4AS3A 4CLXA 3QIVA 4UBJA 2QUJA 4JB8A 5AD1A 5K0GA 1XTQA 4PVDA 4D4LA 1JEAA 4PG5A 2ZWAA 2J6BA 1OYYA 5IC4A 2JH8A 2ZRDA 1IPHA 2C0CA 3OQIB 5HHTA 2D1YA 1EFPA 2C5EA 1T5SA 2C77A 1XCMA 4BUJA 1BHJA 1FMLA 5A9SB 4ALIA 2C0PA 3O2SB 4GXNA 4U00A 4BNNA 2GILA 3DZHA 3BSWA 4PW0A 4RESA 1OKKA 2VUUA 4B35A 1W8IA 2HW8A 4HEJA 3SDBA 3R44A 3KKMA 3LPMA 3C39A 1BG6A 1PL7A 3PHJA 1M9NA 2C82A 4OCZA 3ONVA 1HYHA 3AI3A 3OP4A 3OZCA 4QDUA 4JC0A 4QYIA 4G07A 3VDMA 2E3JA 1RW4A 2AYZA 1XZQA 3LRPA 3JQAD 1M6HA 1AV6A 4QEKA 4FFLA 4Q9HA 4PLPA 3SY8A 1BE1A 3I2FA 2FVXA 1NJ8A 1QPBA 3HGTA 3L7BA 3AFHA 1GSOA 1UOQA 3OETA 4PSAA 4C6SA 3V8NA 4EHJA 1UK6A 2QX9A 1M1UA 4UUNA 1XOIA 4M9RA 4J7UA 1BYIA 3SYNA 4ZYLA 1CF4A 2HGZA 1UKZA 3DDWA 3N1UA 3N7AA 2Y67A 4GMGA 5K8VA 4DV0B 1OX5A 3AVQA 3ZZMA 1C7ZA 3I64A 1LBTA 1OIXA 1YMQA 1WMFA 3RS9A 1RAHA 3D9QX 1R0RE 2IXEA 4HLUC 2HK7A 1KAMA 2QYOA 1IE3A 2ZI5A 5JR3A 2ZXEA 2FOIA 2VXYA 3S2EA 1UBGA 4WKGA 5TSDA 3B53X 2G06A 3AGQA 4TS3A 2IU3A 2PUFA 2DBQA 1HYEA 2GRJA 2YWCA 1QRSA 2BT4A 3MS4A 1ZLXA 3WZ2A 2HADA 4EX7A 5EZSA 5SV2A 5EESA 1D3AA 1U9IA 1EWTA 3N86A 5B3JA 5C4IA 5CU7A 2IU4A 2F48A 2I66A 4KWIA 1DAHA 2VH1A 2V0CA 4DWWA 3LP5A 1M67A 1ORRA 3C6QA 1SCKA 3JVDA 4G5QA 4C4OA 3K70B 4Y2YA 1H23A 3L7YA 4RAQA 3FJ1A 2E1PA 2PD6A 3VAYA 3PUHA 1E9VA 1RLIA 4OK6A 2NZXA 4JI3B 5H59A 1HYQA 2QD4A 3LMKA 2NUBA 2O14A 2QNBA 3MJRA 3IT2A 3SC2B 3L3BA 3U62A 1I6LA 3LUPA 4AF6A 1CKEA 2J3EA 2GWRA 1L2TA 1RXWA 3L7DA 4B46A 3R5KA 1N92A 3S55A 3D4PA 3O94A 2XQIA 3QUAA 1ECJA 1PF7E 4RDCA 3NBYC 4XWGA 1KY5A 1WJGA 3M6XA 2BM1A 2I87A 4JEHA 1FZQA 3B9RA 1FDUA 4N65A 3RRYA 5ICMA 3C74A 5CW2A 2V3CC 2LPMA 3GT4A 4KIGA 4XKJA 3UJ6A 3UXEA 3WL4A 1D9XA 4BEWA 4NC9A 1WX1A 3UNXA 2AGVA 5DM0A 3QGMA 2IIQA 1I32A 1QK4A 1Z4PX 2YJ3A 3G9QA 1O94C 3N8HA 2RJ3A 4GBJA 4KZPA 4RACA 4ZEOA 1KJQA 1TCAA 5C1IA 3T3GA 5I9IA 1HLDA 1PEDA 3PC8A 4OGWA 3UOWA 5A6SA 3TL2A 1FDOA 2FDXA 4V3CA 3GLFA 4KC0A 4RXUA 4YI5A 4LPSA 1E1CA 2PAAA 2Q0XA 1M3SA 4FGKA 1AN0A 2BGIA 3KXPA 2W2LD 4UQOA 2ZUDA 4P2GA 1PFGA 3HVUA 2O7QA 2ZI4A 3R5FA 1NQXA 4IOJA 4A03A 2YQ4A 3OTQA 3G2QA 3JVEA 2ZZNA 3EIUA 3R1IA 1QH8B 4JGBA 4LZPA 3T7AA 2YZKA 4UXHA 3DMNA 1TU4A 1OXSC 1PUIA 4OFXA 4RO0A 3IUJA 1T4BA 4RPLA 1JLLA 1OB2A 3PWTA 4H7KA 3I9NA 4B6QA 4IZOA 4RPIA 4BV9A 2R6DA 5LP1A 5EIFA 3CZPA 3QEOA 2ZM6B 3BIJA 2XE8A 4KQCA 3ACCA 2YHUA 4M8IA 3AI7A 4Z9YA 3SQOA 4BNKA 2EFEB 3I9MA 5EPUA 3F78A 3UY4A 4DR6B 4LYGA 5JFOA 3ZWMA 3IPYA 1ZOOA 1EM8B 1PTKA 1SZJG 1VMIA 2Q29A 2WAYA 3IALA 3PB3A 4HGZA 3ZBPA 4FGZA 4D79A 2PEZA 3JRWA 2B4TO 4M60A 1CETA 3U40A 1A2KC 1CV2A 1SUIA 1CZNA 2HMYB 1RTTA 3I01M 3KVOA 1ZRSA 2QRHA 1UWVA 2PGNA 1XAJA 4AJIA 4KOEC 5KX5B 3Q11A 4NICA 5ALFA 4GZMA 5HXAA 4US2R 1QF7A 1KETA 4PZPA 2NM0A 1P31A 2B9VA 3B5IA 4P53A 4WGFA 3E35A 2GEKA 1BVYF 2X4GA 1NIPA 4L1KA 1P2DA 4LS3A 2W8BB 1J23A 4JJ6A 4U6NA 4RVUA 4R4JA 3QMPA 2QLNA 5E7IA 2NVUB 3BB3A 1E4YA 1EESA 3QWBA 4Q02A 1P4JA 2VK1A 2GX6A 4RVOA 4YJ3B 4JASB 2VP0A 5EIEA 2P1ZA 3BZUA 2WD9A 4PRKA 2JI4A 1IM5A 4HQRA 5SZHB 4TKVB 5F4ZA 1E3MA 1VMAA 4G0MA 2V6IA 3HBFA 3TGPA 3O4HA 4KQEA 4MKXA 1WVMA 3MAGA 4DARA 3BMOB 4I6EA 3U4GA 1TJNA 5JH7F 3MJTA 2XZTA 3AR2A 4KWEA 1OYVA 3V4OA 2B4QA 3AJAA 3PC4A 3WXBA 2FN3A 2FSGA 3D8HA 3A3NA 4RDXA 3MTDA 4K9MA 3O9VA 3U4AA 3BBLA 4IZIA 3RKSA 4WLVA 2X8LA 3WB0A 4V0RA 1XTKA 4GSKA 2DWUA 4R2IA 3N8DA 3WDSA 3LS2A 1R5NA 3LKDA 4EUKA 4TS9A 3FAZA 1Y98A 4PZLA 3RFFA 1JYSA 1RCFA 3FGPA 3MFQA 4UNNA 3W9BA 2D2VA 3IRUA 1JG3A 4RCVA 4C05A 1VHTA 4WVLA 3LFHA 3OZDA 4PNPA 4Q6BA 4W9RA 4OGLA 2OL4A 4HPXB 4ERXA 4BOYA 2XLBA 2Z43A 4E09A 4I1SA 5BP7A 4YP9A 1WSBA 3KKLA 4GPIB 2G7MC 1ID1A 3E0QA 4H1WA 1JE0A 1SZPA 3PNYA 2OXRA 4I5FA 1QANA 3VOAA 4X62B 3LSTA 4Y6GB 5EXTA 2QUBA 1RABA 4GX0A 2TYSB 3LDHA 4LBVA 3N0TA 1IZYA 3K0BA 4PC2A 4X7PA 1J5PA 5KTRA 4TL8A 4UDXX 2A5GA 3CYFA 1WSDA 1YC5A 2DFKB 2Y27A 3G3EA 2A0FA 4ZAZA 2JGIA 4UPEA 5EKSA 4KHZA 1ODFA 3BK2A 1V48A 3JYLA 3C24A 4MQMA 4RVHA 5MN4A 3IPAA 2OSBA 5FWNA 3LQRA 1B6TA 5JQWA 1L3IA 3I8OA 1EI9A 1KZ9A 4WXEA 2LCFA 5F78A 5AXBA 3GLGE 2B8JA 3WB2A 1XD2A 4B85A 1UK9A 2BVNA 5THKA 1II9A 4O4JF 3ZV4A 3LY5A 4FQ7A 3G2MA 4Z0PA 4U5XA 1GPNA 4NBTA 4A1OA 1YR6A 4OD0A 5COAA 2EZTA 4PR3A 3T5PA 4A15A 4XM2A 1HT3A 1Q3KA 3L1KA 1OZAA 4E2ZA 3D6VA 5BSGA 1CUEA 4KQ6A 2W90A 2H1VA 5LQAA 4YMTA 1IJEA 3R4CA 3WYFA 4FWIB 1GL3A 3L05A 2FSVC 4FFVA 3UAWA 2QVBA 4RV5A 3N9IA 2NAFA 1RYBA 4H3VA 4MVJH 4ZTZB 1OPRA 2AW3A 3AOEA 3KSMA 3SIRA 3SOPA 1DAOA 3MTEA 4BZPA 2QT0A 3TSOA 1A8UA 1AK2A 1C8VB 1ZH2A 3HGQA 4I9FA 1ZEMA 6YASA 2GESA 1U6IA 3H2KA 1KRWA 4WE3A 2PMFA 2JI6A 1JBKA 2O7NA 4DLXA 4EUSA 2EHDA 2PWAA 4PHTA 1DTEA 1C3EA 5E0OA 3TNJA 2VBCA 4LWQA 3TOZA 2A8YA 3SEZA 4DLRA 2CYCA 3KPWA 5CT6A 1UP7A 1EGMB 3C8ZA 2ZANA 4RH0A 3PQCA 4OQYA 3UJCA 2WAOA 1RMQA 1SVIA 3H13A 4Q12A 4OF4A 3SKYA 5I4KA 3U4QA 4IIXA 2EV9A 3WGTA 3FKSD 3UXHA 4D9EA 4YLEA 4U0KA 1EWRA 2OFOA 4B82A 3L4JA 1X7HA 2Y0PA 2QW8A 5T8KC 4LRQA 4U2GA 4DIUA 5A3JA 5JY6A 2LIPA 2V3VA 1NR5A 4DWOA 1T6YA 3RROA 3CQ9A 3NHAA 2IYVA 3PXUA 1LQTA 2ODNA 1I7PA 1ECFA 2YBEA 4BUZA 5BQ5A 2Q5OA 4HXGA 1DELA 2RK6A 3JQFC 2VJMA 2L69A 3RTEA 3T5DA 3U09A 1YFZA 5JAHA 1GZSA 1XJWA 2NU6B 4FUTA 4NOLA 1OPXA 3D2AA 5AOVA 4GZ3A 2QS9A 5FTNA 1A8SA 3E03A 4B33A 1J2JA 3B38A 3GCXA 2J4FA 1LF5A 1L4LA 2G71A 2PQ0A 4FI3C 3I12A 5AM5A 4ME6A 2HRRA 1MVNA 5LIRA 4C2TA 4GWLA 4KR2A 1YE5A 1P2BA 4RTPA 4HEA6 4BIMA 4V0ME 4Y6PA 4YP7A 3RSGA 1P81A 5L95A 2NO6A 3IHKA 3WA6A 1VIYA 4CT4B 5B58C 1NY5A 2NPOA 1ZK2A 3GNSA 1ZHHA 4JP8A 1VJ0A 5BQ3A 2PS1A 2PV0A 4BO2A 4EPXA 3KB1A 2ZJFA 5FYDA 1N5JA 2W7TA 1UAAA 4OPMA 1W36C 4UPDA 3EASA 2Y2VA 4XYBA 2Z58A 3WFJA 5FBLB 4YR7A 5HQJA 1Y6RA 3ZDRA 5GOTA 2H4JA 1R88A 5D3ZA 3WGJA 1J0DA 1KSJA 3K16A 4O1IA 3M6LA 5DWVA 5EKXA 1BEUB 1FFXA 1F4LA 4QRDA 4ENVA 2CWDA 4IHKA 1G7TA 3GJQA 1B6RA 2FQWA 1Z7BA 3TINA 5BV1A 3PUXA 4DJ5X 2Y9PB 3CLKA 4HWPA 1HTTA 3OU6A 1R2QA 3DAYA 4YAEA 1WMDA 4AKTA 1UODA 4YAFA 2VC2B 3VYUB 2JLQA 1A7UA 1XSEA 2BCJQ 4Z7NB 1GTVA 2J67A 4NOJA 3B1YA 1JQEA 4JBNA 4MA4A 5ARDA 3BORA 4PIPA 3UIEA 5LMCA 4H18A 2GCGA 3MZ0A 2ZUTA 4KR3A 2ZRGA 3KR1A 5M3BA 4B6PA 2ID8A 1P9OA 2WWTA 4MRAA 1DIAA 1IN8A 1UXIA 2RGYA 4YWHA 1RJGA 2R5WA 5F77A 5KNCH 2R2GA 5T5QA 2B4RO 2HA3A 2V7UA 1VL1A 4P7GA 4TMZA 3VXKA 3B60A 3CF6R 3FNBA 4NCIA 2J5RA 4F3RA 2QDXA 1Y6ZA 4YHBA 4U2EA 2UUAB 2J48A 5ALLA 1IEXA 1XEXA 4WJLA 1CS0B 1OAOC 3U3RA 1ZIPA 3KKQA 3G0HA 4MDYA 1GG8A 5BSFA 3R4VA 1WTAA 2VH5R 4HAZA 3ICQB 4LF5B 3OLQA 5KVCA 1ZD4A 2FW6A 2WR8A 4L5CA 2R7MA 5FH9A 2BI4A 2GJ9A 4PZEA 3R5JA 3LPDA 1OC4A 3PUIA 4JLJA 5H81A 2NG1A 2WWWA 1X9GA 1A98A 1U9ZA 2J5KA 5L9AA 1LSJA 1TEXA 1Y7HA 2LR0A 4OQPA 1KP3A 1TZMA 2D74A 4UFOA 2OVBA 1KOLA 4CTOA 2KWIA 4JJ7A 5F21A 5JWRA 4CLEA 2AEMA 4HKTA 4GPZA 1C0LA 1CQPA 4PAWA 3BT7A 3U4MA 1X94A 1QGOA 1Y1QA 2C2HA 3C7DB 4IY1A 1DEKA 4BX0A 5L6LB 4R7ZA 1EG7A 3ZIUA 5DT9A 4N6OA 1EHYA 1S2DA 4NDNE 3NORA 4IHJA 2ZJ0A 4AICA 4B6EA 4W5JA 5FWXB 2QTLA 3C6BA 1LTQA 1HYGA 1OLXB 1KI7A 1Q5PA 2ASVA 2P3LA 1NDHA 3LV8A 3WZMA 3MLBA 3WZLA 4RENA 4D1YA 3HO1A 4NOKA 2H7XA 2KB0A 5HVNA 3H7IA 4ZAXA 3KWFA 1OFIA 1CB7A 5YASA 3EUFA 4PV7A 3WL3A 1XEWY 4PWYA 1A4IA 2HAEA 1E8DA 3FNEA 3ZDAA 4DC9A 4JXZA 1R0WA 2FUG1 5ECWA 1F8YA 3OH8A 5IUKC 4RULA 1LRLA 4FSXA 4E2XA 2OE2A 3AY0A 2ZBVA 4QDKA 5ENZA 2QYSA 2DHCA 3N70A 2W2KB 4MO9A 1Z3IX 1TA0A 2CD7A 2GT1A 3BCUA 2BYTA 2R4TA 3TIIA 2Q62A 4B71A 4AXXA 5FAXA 3LYAA 1ZXLA 1JI0A 3K1YA 3LA8A 3LU1A 1U81A 1PU2A 2YJTD 1DJMA 1FW8A 1QMGA 4UCFA 4P5PA 3BRQA 3HB7A 4UZEA 1TPYA 2E7ZA 1E3DA 1FRFS 1FQWA 1P1KA 4OJNA 2IYYA 3IDSA 4DY6A 2CB9A 1PV4A 4DEYA 4MPJA 4ZT2A 1N2HA 3RS3A 3L9WA 4D3ZA 3UH1A 4EAQA 2WSLA 4LC0A 5ADHA 4KJZA 1WW3A 2VAMA 1Q1NA 2I1VB 2CHGA 2IYQA 4R0NA 1E4OA 1H0KA 1NJFA 1UJBA 2BM9A 3GZJA 4KO4S 5AYVA 2NVWA 4Z5XA 1S0UA 1DRKA 2CDBA 1ZH0A 1Y33E 2WE8A 5BV7A 1F48A 2Z6AA 4LQLA 1KDPA 2QV0A 1VIVA 5JCOC 1TADA 1SC1A 1M2OB 1U3GA 3OQVA 4NZ9A 3BSFA 4LZLA 3KSBC 1RXYA 4G8DA 4XR9A 1M6YA 3PR3A 4J8PA 3DF7A 1VA4A 2FRDA 4JA2A 1YJ8A 5AVUA 1CE8A 1SCDA 3WL5A 3BIXA 1YB4A 1SC9A 2WUEA 2AJ8A 3MTAA 2B1IA 4YB8A 2FYTA 4JLNA 2E4YA 1R1DA 3OFND 4TQ9A 4ZOEA 1W59A 1X80B 5EMKA 1LEHA 1Y5RA 2MSCB 1O9HA 2R4QA 3RIMA 2O0LA 3ADPA 3DEAA 3M1YA 1VOTA 3ASYA 3HXPA 2FQXA 3OIGA 1GPH1 4MIYA 1JPJA 3T4PA 1O6ZA 2GBLC 2V6BA 1Z2PX 3BK7A 5IKOA 3AVUA 1JVSA 2IHTA 3GJ0A 3NBUA 3PIRA 3O3OB 3RUPA 3SCZA 2PG3A 3T3MB 4CF5A 1XPUA 4Z0HO 3B36A 2ZJ1A 4HADA 4OHRA 2HLDD 3EIHA 5EE1A 1T3LA 3UUFA 3R9XA 3PQ8A 4ZHQF 1WUHS 1NL3A 3ICCA 4R0MA 3H5VA 2RB4A 1D0SA 2J41A 3FTPA 2XXAB 3K94A 1LF0A 5SZIA 3NBKA 4R8SA 2VWGA 3U1TA 4OK3A 3ZBTA 2WAXA 2DT5A 3D5TA 1MAHA 4OG2A 4UEJA 4WMLA 2FEAA 2VSNA 2ZRQA 3JY6A 4L2IA 5F4BA 4HTAA 5F7JA 9ABPA 2HSGA 1MH1A 2F1KA 1A7JA 4JQCA 5HM8A 4OIFA 4KFSA 4CM3A 2KI5A 2NXEA 2ZT8A 4U2KA 4B80A 5KHOC 2J0EA 2HB6A 4MQUA 1RHMA 5DXAA 5DTRA 5GZ6A 1Z7YA 3ZXYA 1RIFA 2AJTA 5G1PA 3IUMA 1DIBA 4KUGA 4QDJA 3RREA 2B98A 3K20A 3IQFA 1KSGA 3RH0A 2QTVA 3TQOA 3ELWA 2C9OA 1D0VA 1QH1B 2CW5A 3GB9A 1Y89A 4FD3A 3F7MA 2NO4A 4JLUA 1LLCA 4MLDA 5E4YA 5JTTA 2NMVA 2IPMA 3M5DA 3WK4A 5IMSA 3MM4A 3K35A 2WTAA 4C0WA 2OD2A 4YCLA 2NADA 3D7NA 5KYVA 4B2LA 3UJDA 2QAGC 4M1ZA 5D7BA 1B2LA 5AIAA 5IAOA 2B8TA 3HP1A 2OLKA 3I28A 3ZTYA 2HWYA 5EKUA 5DGHA 2WWHA 1URPA 1GRVA 1XZEA 2C1EA 3BB1A 3C3EA 1R0ZA 3C3WA 5EVCA 4JLMA 4E88A 1EQUA 1KBOA 1RHUA 2EYQA 1CUAA 4BKUA 2B0CA 2F3SA 4DIMA 4M53A 4Y3UA 4DIKA 1I7NA 2QW1A 1JHRA 2L82A 4HHEA 3EZ9A 6LDHA 1ENPA 1K2WA 4UVDA 1HTBA 1Z0UA 1Y8CA 1BRMA 1UIRA 5J5AA 4BNDA 4CQJA 4J16A 2ID9A 2WWIA 5JNUA 1YB2A 3MWFA 3TEMA 2H2HA 2ZBUA 4PQRA 5HKKA 5CAEA 2CEKA 5ALEA 1T9ZA 2Q9UA 3TPCA 5GIPE 1YSCA 1AF4A 1EQ2A 1UC4B 4BDTA 3RQIA 1F2TA 3AIKA 3H1EA 1U65A 4PO3X 2QD3A 3CY6A 4FFSA 3DB1A 5DCWA 2JHPA 4BFUA 2BZSA 4IRUB 5DM2A 4RZHA 4Z1MD 4RSHA 3G7SA 4MW5A 3RK0A 4AO7A 4MUGA 5DTQA 2BLLA 1KOFA 4BZXA 1PS9A 3VR4D 4LE1A 2O07A 4JJAA 2DBZA 1PX0A 2NZ2A 2WJJA 4UHFA 3UMVA 2DQKA 4R9RA 2B94A 1E2UA 5JRZA 4ZQGA 1T5DX 3BL6A 3V9PA 1FYXA 3EVBA 4JI6B 2ZYDA 2VP6A 2YWEA 1XPOA 2H59A 2O1EA 2Q6VA 1W4ZA 1WPQA 1EK1A 1WQ3A 3QW2A 2UZ1B 3PHIA 4EKNB 3R7AA 5BYJA 4X1YA 2XUGA 7REQA 5HUHA 2D5CA 3DWGA 2XAUA 3GAZA 4OYYA 1RR6A 4AZWA 5ILGA 1NVFA 4ZK6A 2V96A 4FTWA 1ZK3A 2J4DA 3MCUA 1S8AA 3OCZA 3GAFA 5EHGA 3TNYA 1C4XA 3TVYA 3WSWA 4YMUA 4JIGA 2PX6A 4HXFB 4KPEC 1G2QA 2ABWA 5EWMB 1Z0ZA 4IR7A 1V4NA 4PF1A 3E3MA 3EWIA 3TUJC 3GUUA 4DMRA 3GJ8A 3VPCA 4E1VA 8ABPA 1OCEA 3MCAA 2CMDA 5H02A 4AAYA 1WE2A 4N47A 1JWLA 1QS0A 1KQFA 1E2EA 3FNIA 3H5NA 1U5BA 5CEFA 2QY9A 5JJKA 4C0LA 3Q40A 1KFEB 3A9VA 1C0IA 1U2GC 4E32A 1M2VA 3LL7A 3VU8A 4HFMA 1Y6QA 1KK1A 2DUNA 3P1JA 4F3KA 1KGDA 3DVQX 3TH5A 3TR6A 2W42A 3KHUA 2OC9A 2KJQA 1CG6A 3QPUA 2O2IA 3DWIA 3RS0A 1LLDA 4B3FX 5FV4A 3TZCA 5KBYA 1QHEA 2J4CA 4D3XA 2VDUE 3ESYA 4UM9B 2E89A 1LTHR 2OG2A 1PBTA 4C0AC 2IHJA 5IVKA 3CE6A 4RXTA 3K2BA 5LLTA 1U3UA 3CWQA 3RC7A 3GEPA 1XMVA 1QAQA 1BJRE 2Q1SA 4URUR 5JZOA 2L19A 5FTLA 5K6TA 4BLOA 1TEVA 2IZ6A 3DNFA 4NJOA 2MTBA 1VB5A 5EUCA 4ZAWA 1RYYA 1CUXA 4WLUA 4WQMA 1QYIA 3NI2A 3IBTA 4C0SA 1XTSA 4RIIA 4RY9A 1W7AA 1LBHA 2GXUA 4WXRA 3KQVA 2DR3A 4NYJR 5BVGB 2V7GA 4R9VA 1D4AA 4OUDA 3K92A 3SGLA 1I0LA 4DGQA 2MINB 2P5TB 4K9RA 2UUOA 3ILVA 2M6KA 3TQQA 5IBQA 5EXEA 3UV3A 4RHYA 5CTAA 3LUHA 3ZXIA 3BKXA 1Z6QA 1MAAA 4NV3A 3Q3IA 1ZM4A 4UNIA 2GNOA 5GJVC 3RANA 2I4OA 2X6TA 4XWOA 5LOVB 1A69A 2L2QA 2P4EA 2Y0CA 2ZYAA 3E5MA 1QG6A 2P6UA 3KQYA 3LP6A 3IMGA 4R1SA 4YA6A 2G28A 2QHXA 3NXSA 4JGIA 4I5IA 4BC0A 2CNNA 2CUKA 5DHUA 5JVDB 3ZJ4A 4CF7A 3RSLA 4UTVA 1L7BA 1E63A 2VN8A 4BPBA 3VR5A 2G9VA 2NXWA 3NWOA 1XMPA 4U6QA 1JH8A 1HOTA 1VSQA 1DLIA 1XXHE 2DWQA 2XCTB 1EZ4A 3OFVA 4D3DA 1NC3A