1ZVPA

Crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
128
Chain Sequence
SGIKSLELLLQSMSPELMAGDYVFCTVNGALSDYLSLEPIATFREPEGLTLVLEAEKAQQAGLESSALFSLITLTVHSEAVGLTAAFATKLAEHGISANVIAGYYHDHIFVQKEKAQQALQALGEFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a hypothetical protein VC0802 from Vibrio cholerae
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein VC0802
total genus 29
structure length 128
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10000 ACT_3 ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 1zvpA00
3AB4A 1ZVPA 2HMFA 3TVIA 3AAWA 3C20A 3C1MA 2F06A 3C1NA 3AB2A 1ZHVA
chains in the Genus database with same CATH superfamily
3C20A 1ZVPA 2HMFA 3TM5A 4KR7A 4KR9A 3C1NA 3LDUA 2C5SA 3K0BA 3AB4A 3AAWA 3V97A 3LDGA 2F06A 3TMAA 3AB2A 4KR6A 3TLJA 3TM4A 3V8VA 3TVIA 3C1MA 1ZHVA
chains in the Genus database with same CATH topology
3C20A 1ZVPA 2HMFA 3TM5A 4KR7A 4KR9A 3C1NA 3LDUA 2C5SA 3K0BA 3AB4A 3AAWA 3V97A 3LDGA 2F06A 3TMAA 3AB2A 4KR6A 3TLJA 3TM4A 3V8VA 3TVIA 3C1MA 1ZHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB4 A;  1ZVP A;  2HMF A;  3TVI A;  3AAW A;  3C20 A;  3C1M A;  2F06 A;  3C1N A;  3AB2 A;  1ZHV A; 
#chains in the Genus database with same CATH topology
 3C20 A;  1ZVP A;  2HMF A;  3TM5 A;  4KR7 A;  4KR9 A;  3C1N A;  3LDU A;  2C5S A;  3K0B A;  3AB4 A;  3AAW A;  3V97 A;  3LDG A;  2F06 A;  3TMA A;  3AB2 A;  4KR6 A;  3TLJ A;  3TM4 A;  3V8V A;  3TVI A;  3C1M A;  1ZHV A; 
#chains in the Genus database with same CATH homology
 3C20 A;  1ZVP A;  2HMF A;  3TM5 A;  4KR7 A;  4KR9 A;  3C1N A;  3LDU A;  2C5S A;  3K0B A;  3AB4 A;  3AAW A;  3V97 A;  3LDG A;  2F06 A;  3TMA A;  3AB2 A;  4KR6 A;  3TLJ A;  3TM4 A;  3V8V A;  3TVI A;  3C1M A;  1ZHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...